1AIZA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport(cadmium binding)
molecule keywords AZURIN
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter denitrificans
total genus 31
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aizA00
2XXFA 1E67A 3EH4B 3D12B 7PCYA 4G7QB 2HXAA 1FWXA 1NZRA 3L45A 2VW6A 4E9QA 2BP8A 1L9RA 4Q89A 3S3BB 5A7EA 4GY4A 5D4JA 2WSDA 3C75A 4KOCA 2A3TA 3S3DB 2UXVA 3X1BA 1HAWA 3PAVA 1GY2A 3TASA 4DP1X 4QKTA 3NT0A 1R1CA 1T5KA 1W8EA 1IKOP 3NP3A 3WKPA 3EF4A 4G7SB 2DV6A 1GS6X 2J55A 2WO2B 2PCFA 3CZUB 3AY2A 1BYOA 1ZV2A 2FJSA 1PLAA 2HRHA 2HX9A 3MBWB 3QQXA 1MG2C 3OMAB 1GW0A 4DP2X 1J9SA 2BW5A 4NERA 4HHGA 1OF0A 1BAWA 1WA0X 1ZDSA 1TEGA 3PXLA 5TK2A 3RYMA 3NYKA 3ZDWA 1ET5A 4DP4X 3PPSA 1UATA 1SF3A 5I5IA 1A4BA 1AOZA 1VLXA 2IAAC 4A2DA 1ET7A 3SBQA 1L9PA 1PZBA 2BHFA 1PLCA 3QJVB 2LLNA 1OE1A 2EINB 3AZUA 3FQ1A 5B7MA 1SHWA 1CYXA 5I28A 3IBOA 2DWTA 3X1GA 2TSAA 4JHUA 4KO6A 3SBRA 2IDUA 4FA7B 2XX0A 7PAZA 2GI0A 2N0MA 2X87A 2BW4A 5I26A 3KW8A 4E9TA 1SDDB 2FTAA 4JKNA 3ZX1A 2JXMA 3DIVA 8PAZA 5PAZA 1OCCB 1J9TA 1SF5A 2VN3A 3NJMA 2UXTA 3H56A 1MZZA 4KNUA 3NJJA 2PPAA 2YAOA 3IN2A 2HX8A 2FQEA 2HX7A 1WS8A 4AI7A 4BWUA 2UXGA 2Y69B 4E9VA 4K9JA 2QDVA 2WO3B 5I5JA 1CYWA 4GYBA 5I6OA 4HIPA 3NP4A 3AG2B 3QJSB 4YSTA 1E5ZA 4E9RA 1OOWA 2AZAA 2FNWA 1AG6A 2JKWA 1JOIA 2MRYA 2YAPA 2P80A 4AKOA 5D4HA 3BVDB 3N55A 5I6LA 5FC9A 4BK5C 2W8CA 3FS9A 1FFTB 3FT0A 3EH5B 1PF3A 2PPDA 4A2HA 2BWIA 1PMYA 4W1TA 4MFHA 3PLYA 2YAMA 4HALA 3T6VA 3IEAA 1A3ZA 2FT8A 3NSCA 2H5UA 1KGYE 1N68A 2PPCA 4UAHA 3HEIB 2BP8B 3OMIB 4E9SA 4HHWA 4CSZA 3MX0B 2DWSA 2ZOOA 4YSSA 1N70A 1ADWA 4EF3A 1AAJA 3ZBMA 1RZQA 3U25A 2OJ1A 3CVDA 2BZCA 2XV2A 1WA1X 2XWZA 1JZFA 1GYCA 1GY1A 4A2GA 2TSBA 1AZUA 3G5WA 2X88A 1A65A 4M3HA 1V55B 5B1JC 2IWFA 3KW7A 1KBVA 1TKWA 2EIKB 2QPEB 1AZCA 1AS7A 2EILB 3NJGA 3BQVA 1M56B 1KDJA 2YAFA 1IUZA 1ET8A 2QPDB 2P80D 3AG1B 4PAZA 1NIFA 2YAQA 3HB3B 1EHKB 1E30A 1NIBA 4QLWA 1ZDQA 2VMJA 1PZAA 6PAZA 2JFCA 3ZIYA 5EHFA 2IDFA 2XV3A 3ASOB 1J5DA 3AW5A 4N4YB 3SBPA 3IN0A 2BO0A 2E86A 3TU6A 4YSPA 4DPCX 2J5WA 3JTBA 4GXFA 2XU9A 5F7AA 1ASQA 5ANHA 2FQDA 2CAKA 4DP8X 4WKXA 4RH4A 2YAEA 2YAHA 2EIJB 1AZNA 1RZPA 3NSFA 2ZONA 1NPNA 3NSYA 1MDAA 3EHBB 1W6WA 3WIAA 4ENZA 4DP9X 3CDZB 2FWLB 3OMNB 1OCZB 2QT6A 4BWTA 4DP6X 2IWKA 1PZCA 2PPFA 1JZHA 1PNCA 5D4IA 4P5SA 4W9ZA 1OE3A 2IDTA 1EZLA 4FAAB 4BXSV 1BXUA 2I7OA 2FQGA 4YSRA 2IH8A 2DY2A 2H3XC 4NB7A 3UAAA 1TU2A 5PCYA 4NAJA 2H47C 2J57A 2OCCB 4GP5B 3CDZA 4HZ1A 2XXGA 3H4FA 3QJTB 2I7SA 4X4KA 1YLBB 3UABA 4DP7X 1M9WA 3CVBA 3OD3A 4WTQA 1L9SA 2GC7C 3T71A 3FQYA 2UX6A 3FSZA 2NRDA 5AZUA 1MG3C 1AIZA 5B1KA 1SJMA 3WNJA 1NIEA 3EH3B 3OM3B 2IWEA 2IH9A 5B3SB 1ID2A 2PLTA 1ZIAA 2BWDA 3PAZA 2Q5BA 2Y1AA 3UACA 1HAUA 4GP8B 2CJ3A 1L9TA 1QHQA 1AG0A 4P5RA 3UGEA 4A2FA 1NIAA 1OE2A 4DP5X 2AFNA 4CSPA 1MZYA 2VSMB 4YVNA 2BP0B 2DYRB 1OV8A 1BEXA 4KO7A 4YSDA 2GC4C 3FSWA 4YSOA 4YSAA 1NICA 4A2EA 1ASPA 1V54B 1QNIA 2B08A 3V9EA 3ABLB 1KYAA 3ABKB 1NPJA 4E9YA 1BQRA 1PCSA 3T6ZA 5B7FA 2PP9A 1A8ZA 1DYZA 3NJLA 3NJIA 1JZEA 2YQBA 2PPEA 4G72B 3WG7B 3FU9A 2J56A 4Q8BA 1KV7A 1GS8A 4KNSA 1OCOB 2UX7A 3ERXA 2GHZA 5AKRA 1NIDA 3ASNB 1IC0A 1A4AA 2BP0A 1L9QA 1AS8A 4JHVA 1AANA 4G70B 2CALA 1NTDA 1J9QA 1IBYA 1NDTA 3NJNA 5F7BA 2VW4A 2XLLA 3CVCA 4G7RB 4KO9A 3WI9A 1A4CA 2VSKB 4HCIA 3GYRA 1CC3A 1QLEB 1SHXA 1JXDA 3TBBA 2AANA 5I6PA 1RCYA 2BZ7A 3PCYA 2PCYA 3OQRA 4G71B 1L9OA 4UANA 2UXFA 2YXVA 1KCBA 3UAEA 4AKQA 4YSUA 2RACA 1WAEA 3WKQA 2XYBA 4BDVA 1AR1B 3V9CA 1ASOA 2GIMA 1BXVA 1PLBA 1JZIA 3FPYA 5E9NA 4HCGA 1F56A 1NWPA 2VW7A 3IE9A 4KNTA 2CBPA 4YL4A 3CG8A 1JXFA 5B1JA 5I6KA 2FT6A 2IDQA 1J9RA 1PNDA 4HCFA 4YSCA 3T9WA 2YARA 4HAKA 9PCYA 3X1FA 2CCWA 4KO5A 4AKPA 3QPKA 1JXGA 1CUOA 1XMEB 2XUWA 4TXVB 4A67A 1IBZA 3QJRB 1FA4A 1NINA 3FSAA 3TBCA 2AZUA 1AQ8A 3DKHA 1PY0A 4UF7C 3NJHA 2I85A 1ILSA 2CUAA 3FPXA 5B7EA 4F7KA 1KBWA 3WNIA 3FSVA 1ZPUA 2HRGA 1GR7A 3GXUB 1SFDA 2HZHA 3AG3B 2Q9OA 1SNRA 3FU7B 1GS7A 5LDUA 3FYEB 3X1NA 1W6LA 1RKRA 5B1BB 3SQRA 2QDWA 2YXWA 1JVLA 1AACA 3AG4B 4DP0X 1DZ0A 1ILUA 1V10A 2ZXWB 4BXVA 6PCYA 1BXAA 1BQ5A 1URIA 2XX1A 3QJUB 4AX3A 1KCWA 1AZBA 2XV0A 4DPBX 3X2QB 1ZIBA 2PP8A 1JERA 5TK4A 3ABMB 4GP4B 3X1EA 1XB8A 1PAZA 3NJKA 3FU7A 5I6NA 4AZUA 1OCRB 4PCYA 1SFHA 1KDIA 5I6MA 4BWWA 2GBAA 2GB2A 2R7EB 1BYPA 3N2JA 3PAUA 1NWOA 1BQKA 4YVUA 5IY5B 3UADA 2XVBA 5I5MA 1CURA 3DTUB 1JZGA 1GSKA 2W88A 1SDDA 3FU8A 1M57B 4A68A 1B3IA 3NJFA 1X9UA 2B3IA 3QJQB 1JVOA 1JZJA 4KOBA 1AS6A 2DYSB 2FT7A 4YSQA 3S8FB 5B1AB 2GSMB 3GDCA 2VM4A 3FYIB 5AFAA 3T6XA 1J5CA 3NSDA 1E5YA 1WS7A 2AVFA 2ZWNA 2HLEB 3H4HA 1E65A 2EIMB 1I53A 2FQFA 2MTAA 1WA2X 1AZRA 3TA4D 4M4RB 1HFUA 2R7EA 4BDVB 4YSEA 4E9WA 4DPAX 1XB6A 2IDSA 4ZK8A 1XB3A 3FQ2A 4A66A 4N8UA 4F2FA 3S3CB 3S8GB 2VM3A 4E9XA 3JT2A 2OV0A 3ABGA 2PP7A 4L0PB 3T6WA 1X9RA 1ETJA 4F2EA 1TEFA
chains in the Genus database with same CATH superfamily
4PGCB 3NEOA 5ANMB 3HG1E 4F1SA 1ZKAA 2Z7UA 3T2QA 1XF2A 1NZRA 4XBMA 4LQFL 4S1SL 2VW6A 1T5WB 3BPOB 5IMKB 3VI4B 4GG6A 1JGEB 4LEOA 1G7PA 1KXQE 2XT1B 4S10A 3ULAB 1DVSA 1CFVH 1IAIL 1IBBA 1QMUA 1GSMA 4GKZA 1BQHA 2WXNA 4LL9A 1FI8C 1BZEA 5B22A 2F08A 2AMUA 2FECI 1TEYA 3OHXA 1W8EA 2AEOA 3N1PC 4MHHI 3DJRA 3GJFB 4PB9H 3AU0A 3CZKA 4FTVD 5CP7A 2ZKWA 3SHSA 2C4XA 2QSTA 3VFOB 5I6XB 2V4LA 3C09B 5EO1A 3RWDB 3M8OH 3AY2A 1DJIA 1KEMH 4TNFA 5I73C 4W81A 1ZHNB 2AJZA 4QRSB 5SWQA 5DEZA 3RX7A 4ZMZA 5A6IA 1AMYA 1MLCA 3IDNB 4LU5H 1HYSD 4L3CB 1K5NB 1M05A 5D7KE 5AAWC 5KBPA 4U1IA 4ZFOL 2V37A 5LO7A 5H8DA 3LKRA 1F11B 1AOZA 2IAAC 4JQIA 5GSVB 2OJZH 3MUZ1 3ARDB 4PG2A 1W72H 3WEOA 2ZZUT 1NPUA 1TZOA 1N9PA 3SGEI 2EEFA 3MFGB 1QI5A 4DO4A 2VXUH 5M95B 2F54D 4L5FL 1BPVA 4UV4H 5C08A 5GZOD 3T8XB 3WIFA 3U4EA 4P49A 3ZW3A 4D9LH 3X3GL 4NQVB 1H15A 4LSQL 3RWGB 3TT1L 4JKKA 5I71B 4XP4H 1S7XA 3B9EA 3PS6A 2BVTA 4NKDB 2R69A 4QIRA 3T5WA 2E7MA 3BOVA 1XV8A 3S5LA 1CT8B 4AQAA 3HCVB 3VD2A 1W80A 3QJFB 5FUCE 1ZLUH 5IB5A 5HGDB 1YEIL 4KNUA 4BCXA 2PXYC 4P2RE 4TNVK 5DJCA 5SWZD 1SEQL 2C9SA 1NGWB 2P44B 3DNKA 2D3LA 2CD0A 4OFYA 4S2SB 3QQ9D 1KTLB 1YEKL 5TFSH 4GYBA 4HIPA 3L5HA 1FZMB 1I7RA 2HB0A 2X70A 3QUML 3QJSB 1RK0B 1E5ZA 2WM0A 3LY6A 4P2OB 2VXSL 7TAAA 1R33A 1MWOA 1RHHB 4EBQL 5FYLL 1FFTB 1F41A 1FJ1A 1T89A 3L08A 4B97A 5GGVH 2LQRA 1PMYA 1E7UA 4LLAA 3G5VA 2F8VA 3VQLA 3RIFK 5J4MA 1SJXA 1PZ5B 3H7LA 4G8GB 1KBPA 2PWHA 3BQUD 1MFBH 4IYKA 2AK4A 3OMIB 1IC7L 1FO0L 4EO5A 3ZDYB 5MP6L 1E9OB 1MCPL 3MV8B 3ZE2B 4EF3A 2AQSA 3BN3B 1T0MA 1O9WA 5CR1A 3LDBC 1R17A 5C6TH 1I8KA 4DNLA 2WLIB 3SPGA 4JN1L 2DQGH 2FATH 4YHZH 4N2NA 2AQRA 3CLWA 1I7TA 3DLQR 2BNRB 3NZSA 1HI6A 2K7QA 2X88A 4JEGB 5ACZA 2IPKA 3BP6B 3KLAA 3VE0A 3SDDD 2V3EA 5C0AB 3WEBA 2ZUQC 5HI4C 1INDH 4PU2A 3ULVE 1T7VA 4UT7H 2F5BL 4RZKA 3HHSB 4F7MB 5CUSL 1OW0C 4LCWD 2ZUSA 3U7AA 1Z9SA 4PAZA 1NUNB 3H9SB 4GMTL 4QF1A 5FECA 4DVRL 3MJ6A 1FRGH 3MV01 5HGAA 3VWJC 4KJYA 1S9KC 5EU7E 3MRHB 4LPXA 3QUZA 1JZ4A 4IHBA 1UXWA 4N6RA 4FQQA 1EEQA 1QFOA 3MRPA 1FVCA 3VRJB 1TZAA 2QHRL 2G75B 5DZ9A 4WWOA 3U0PA 2X4UB 3UYRH 4GXFA 5DHMC 1P4BH 5TDNA 1Z9LA 4OFQA 2X4QB 3EBHA 2DQCH 4Z18A 1MCSA 3IETA 4MJIB 2J8HA 4PJXF 5DJ2A 1IQDB 4HJEA 3IMBA 2AEIT 2YAEA 2YAHA 1LWRA 3JWNG 2KZ1B 1BMGA 1ERNA 1BX2B 1DLFH 1NCBL 1EO8H 4Q4IA 4IOFC 3QQ3A 3VDAA 4I2XE 1Q1PA 2JKLA 4LSTL 1SYSA 4DP9X 3LQAH 3IS0X 1LO3L 2IPTL 3OMNB 2C7FA 2FHFA 4LCYB 3E2HB 2ZJSL 2EO1A 2H1LM 1JGLH 1MNNA 4PJBF 1CL7L 5KVFE 4CAGA 4L0YA 3WLWD 1FF5A 4MYWB 4OTXH 2DJSA 1OT1A 1PNCA 1UA3A 2PMZA 3V8CA 3HC4H 3ES6A 1LXMA 1KJ2H 1FO0B 4CMMB 1DBKH 2KPWA 4IJTA 4WNJA 5DHEA 1BXUA 4WFHD 1RUML 2CK0H 1QFPA 3ZRSA 1JN6A 4PHZA 2G60L 4ANKA 2J57A 4ODVH 2OCCB 4QRFA 2QBWA 3BKJL 4PRPE 1G9NH 2X1WL 5FIEA 4R4ND 5AW3B 3WO4B 4PJAF 4KQ0A 4PJIA 1RMFH 2YD7A 4OI8A 3ZQXA 3LQAC 3ZE0F 1U8LB 1WIPA 5K9KB 2NY6D 1A25A 1S9YA 3ILPB 2AEQH 4MXWH 2HG5A 5F7HA 5FKPB 1U8CB 1A5FH 3NQKA 4PRIA 4AIZA 2O5YL 1SJMA 1K8DB 3WNJA 4U6VH 3U7WL 5EPMB 4GQPH 4MWFB 4W9KC 4UM9B 4BFRA 3IGAB 4NZTL 1VACB 5T3ZH 3FTWA 2V7NA 3TA3A 5B3JE 2CKBB 2WLJA 4J3VA 3S37H 1J0JA 1FAIH 4HIHA 5F6IC 5AL8A 5JW3H 4KQ4L 1KFAH 4AM0B 3TJHC 2EYTB 1IIIA 2I32A 3QULA 1UA6H 4P5KB 3J7HA 3SJVB 5E08H 1MZYA 3QZBA 3I85A 3NJVA 5E4IA 2QVKA 2R0LH 5AOJA 5I1JL 5TE4L 3HC0A 4HX1A 3O4LE 2GC4C 1NICA 4XNMB 4LDEB 4N0UA 2V2XA 4G3YL 1U8IB 3V9EA 3C5ZA 1W0WB 4W9DC 5GGUA 5BO0D 5CEZD 3X13B 5IB3B 5DVOA 2HFEA 3HOGA 3IWUA 3LH2L 4TQEH 4I3GA 1CZ8H 1PU0A 4KROD 1ZT4A 5J1TC 1YEEH 3IM1A 1NMCB 4MB5A 2DB8A 1JWUB 4C55A 3OGCB 4QHNA 1P0SE 1UB5B 2YD1A 4UT6A 5D1XC 5D96B 5SWSD 3TVMC 4OIBA 1L9QA 3W2DH 2EIDA 3T09A 4XO5A 3UO1H 1BVNP 1S9VB 3QUYC 3HS9A 4G59C 3SDCC 1WAAE 1KLGA 4WEBH 3SSGA 1A4JB 1LL1A 2CJUL 5C8JB 1XH0A 2GFBB 2Y4SA 4BSJA 4ZD3H 3A67L 1E27B 2JV6A 2XZQL 2F9BT 3VXMA 1MCJA 4PJXB 2JCCF 2XG5A 5I9QB 5CP3H 3MXWH 3OQRA 3CFQA 3VFGL 5DD6A 5IVOA 2DLIA 1YZZA 5KSAB 4ETQA 2IFFL 5JYLA 3C8KA 4XAKE 4JRWA 4NENB 4KRMB 2BIPA 3MRMB 5IQ9A 1JP5A 2R9HD 4QRQA 2MNJB 2WJ5A 1PLBA 1HILA 5I1LB 2BJMH 1AGDA 4AG4H 3QW9A 4NUQA 1A22B 2OMBA 4IRSC 5INDA 1MI5B 5SV4A 5BS0D 9PCYA 2W9DH 1HDMA 3QPKA 1MRDH 1WAPA 3L5IA 2YPLA 3BCDA 1NINA 1E9PB 4KJQD 1HHJA 3WXVL 3F3HA 1R24A 4NQCE 4OLEA 3OX8B 4F8LA 2XACC 4O58L 4N28A 1EUUA 4DGYH 2WN3A 1T2JA 2PNDA 5A3ID 1KBWA 3F00A 3RP1A 1IILE 2KC0A 3O2WH 1ZPUA 5HVHB 3GXUB 4Y1AD 3ECWA 4KJWD 4MA3A 5BZZA 2Z31B 1DJZA 5I15L 2J21A 3QUKA 4Z0BL 5IQNA 2AJVL 1JRHL 3JT0A 3M7OA 4N86A 3KM2A 4XODA 5MENE 4JK0D 2OMUB 1KGIA 3SCMC 3K5RA 2JELL 4FQLH 5ID0A 4J4PD 3RVTD 2FNBA 4LHUD 2YJQA 4AIOA 2OYMA 2EICA 4YO0A 5FUOL 1HC1A 3F12B 1WZ1L 5C9JA 4BFKA 2VB5A 4F5CA 4FXTA 2DQFA 5GQBA 5HDBB 5FR3A 4FEIA 3JV6B 5T1LA 3WS3A 2IH1A 2JKJA 3B5GA 2V3FA 2CMRH 4TLTA 4KRNA 4LOUD 1GAFL 5IF0A 5KW9L 3CUPB 4YDLC 1BV8A 1T04A 1TENA 4M4PA 4AJVA 3NJKA 4MVBD 1P7BA 3CFCL 1CD9B 1G5GA 1OSZA 4AMXA 1JZDC 1SXAA 1N0LB 4MAZA 4N68A 4EN3B 4A63A 1NC2D 2NT1A 2XVLA 5E00A 3WTSA 1E28A 3U0TB 5F1IB 4L8BB 1NM4A 3POCA 5C0RH 1J5IA 4XMWA 3G6DL 4C54A 4HBCL 5K9OB 2WVSA 4A68A 5AYUL 3FL7A 1H3VA 1GZPB 1QQDB 4JFHE 5GJTL 1RK7A 4L4VE 4MZ3A 1GL4B 4JY4A 3S8FB 3IFOA 1FFPA 4PRHB 2Z35A 2FJHB 1L6XA 5KYUA 1PVHA 4ZFGL 2W9EH 1VENA 3EJYD 3WTWA 3HZVA 5AKSA 4BUHA 4BELD 1TJIL 4EXPX 1QBBA 1QSEE 3P9LA 2X4NA 1AGCA 2C9PA 5CF3A 2OW7A 4GBXC 3MJ8A 2AJ3A 3DUSA 4J6RL 5CD3B 3FUNA 1YRKA 3ZKXB 4FYTA 3OPZH 4XMUA 1OGTB 4X99B 2R2HA 3MUGA 4Y4KD 4WWNA 3ZT7A 4Z7WF 4Y8AA 4ZUVB 1E42A 2PP7A 3L9YA 3PQYD 4ZPTB 3T6WA 3BPNB 2JCCB 2K3TA 3E6HB 1QNZH 1EDQA 1VFMA 4PB9L 2XKNA 1ZGLA 3T0EC 1PSKH 4G7QB 4KI5D 3M8OL 1KEML 1ID5I 4IDJL 2BIMA 3E3QC 4W9FC 1FNGA 4LU5L 5IMOB 4F8OA 3O9WB 3BGMA 4KOCA 2JB6A 5EBWA 1HAWA 1A6AB 5IEKA 5KSVA 2IDCA 5AAMA 3E38A 2YR3A 3G6JE 2OJZL 5DJ6B 4N0CD 2ICEB 3VFUB 3WKPA 1ZK9A 3L54A 4KGLA 1HQ4B 4I3SL 2J8UF 3PYCA 2VXUL 4YBHA 3ZHNA 5A2KH 5DSCB 1PJWA 3N04A 3ZRFC 2A83A 2ADIB 1AKJD 2WYIA 4UV4L 4D3CH 2FUTA 1PG7W 1EGJL 2XY2A 3CK0H 4D9LL 5BJTA 2JXMB 3PWNB 4HHGA 2EXWD 3RURA 4I1NB 2C5DC 1RL1A 2J1WA 2NR6A 4IU3B 4NZFA 2RH0A 4P5TD 2MMXA 3BUYB 2OXHB 2EVIA 2QFRA 4P46D 1DJYA 4HOZA 4MNQE 4URTB 1QW9A 3IJYB 4LSUH 4EMZA 5IOPB 2WMPB 5BW7A 2H6PA 4ICWA 4KXCA 1MXDA 4QRPE 3ATDA 3FC8A 2CDEA 5CO1A 1C08A 3FU6A 3ARBC 4PRNB 1WWCA 1F58H 3LPOA 3MR9A 2G5BA 4G42A 2O6EA 4L3ED 4PJEA 3KW8A 3FFCD 4UQEA 1SDDB 1FNSH 1N5AA 1YSOA 2NNFA 3NIDF 3JTSB 1UURA 3CN2A 2C9VA 2YUVA 3GSWB 1ZRUA 2OMTB 4NWUL 2UXTA 3TEXA 2WNGA 5J6GA 2PO6D 3O2DH 1CQKA 2F5AH 4WWPA 5GGVL 5HPOA 2FYVA 3QDJA 3NIFE 4F3FB 3WN5B 4HKXB 3P3RA 2AXGB 2VDMB 1OGAB 2EIZA 2WO3B 3HZKB 1MFBL 3ROOA 4ZS6D 2XPGB 3EJSA 4EVNB 1A47A 3JVFC 4ISVA 3EOAB 2VL5B 1BD2D 4E9RA 1NCTA 2D03L 4JQIH 1T4WA 1J05B 1OAUH 1YNTF 4XWOD 3MYZA 4I5BB 4BSVB 1RAMA 4H2AA 3BZFB 3ZDZE 3UTTA 4Z7UB 5CEXB 4E5XB 1H8LA 1CXHA 3BHBB 3QZOA 4JPVH 4ZFFA 3FU0A 4FYQA 4PJ7A 4X7DC 2FATL 3GS0A 3ILQC 2MCAA 4YHZL 5DJYA 3DPBA 4CADB 1QLRB 4JQVA 2HCZX 3T6VA 4AC4A 3EYOA 1W72B 5J6SA 5DVPA 1CFTA 1J8SA 2NXZD 2PKDA 3FK3A 1I31A 3N1FC 4B7LA 2XJLA 4GUCA 5LGKA 5CGYD 1IKNC 4POZC 2V6HA 3ZO9A 2KLRA 2B3RA 4TUKH 3UYOD 3PHOA 2F53E 3UPAA 1K4CA 3ALPA 3TO2B 3T2PA 4D0CA 3VXPB 4NOFA 1UASA 1RZQA 2W60A 3ATAA 3GM0A 4Z7WB 5JUEH 3F6JA 1TPXB 4EKJA 4GRWH 4I4WA 4X4ME 1UVQA 3F58H 5CXPA 3ETBF 2COQA 2AAAA 4HUUB 1N4XH 4G8FA 4PTUA 1AD0A 2N1KA 2OJEB 3GEFA 4XNQB 1IBHA 2X2UA 1CB4A 4YHLH 4Q0XH 1F3DH 1S7QB 2JMRA 3B2MA 4P9HC 5DZOA 3GLEA 4A7GA 1A6VH 1P4BL 3NJGA 4GS7C 1A7OH 2NCMA 4GW5A 4PJ5D 5I2IA 5D1QE 3PRZA 4JRXB 2CBTA 2DBJA 4N2AA 4UAOB 1DLFL 1U3HB 1ZDQA 1EO8L 2NXYC 4NKMA 2DMBA 2K7PA 2QGCA 1T5XA 2JFCA 2QTVA 4DZ8B 2XN2A 1CLVA 4I87A 3LQAL 2J8UB 3S96B 4YC2B 1QRNB 2ZP8A 3RWCA 3H55A 3QJOA 1ZY9A 5DJ0B 4AH2A 3REWA 3BRFA 4ZMLA 4UZUA 1JGLL 3S2AA 1Y6KR 3NEEA 2YSTA 3JTBA 5K39B 3WU1A 3ARGC 1TQTA 3EYFA 5F7AA 3FZUC 1XGRB 4OTXL 3QFDA 5BV7H 3HC4L 3BT2H 4I18B 4OF6A 4RFOH 4RH4A 3DXAD 3R19A 3OAZK 3WE6B 4O51A 1DBKL 4AT6A 1FHGA 3BVNA 2CO7A 1NPNA 3GMQB 4XPHL 3NSYA 1DZBA 1YPZA 4MA1C 3VUAA 1IVLA 1S7SA 4OZFB 2P5EB 4IJ3C 4M6AA 4ODVL 2L7QA 4UYPA 3QZWA 3TNNB 2A73B 3CSYB 1JFQH 1AO7D 4U1NB 1EAOA 4RQQA 1H0DA 3TPUB 4P5SA 2ESVB 4JMXA 1IBDA 3OJDB 4C56B 5KSUB 3RL2A 2CO4A 3NIDB 4ZNCD 2I9TA 1T03L 5HHNA 2BIIA 2AEQL 3MCKA 3V4UH 1VKXB 4YSRA 1GH7A 1Z5LB 4M7LH 4Q4EA 2IH8A 1A5FL 1OD9A 4ZXBB 5K9JL 2HKFL 4MNGB 3MGTB 3TYFA 4A7QA 3GMRB 1FLTX 4BHUA 5F7NC 4ACPA 1NANH 2V7HA 2Z93A 2OQJA 5T3ZL 1R3IH 1TTAA 2WWNA 3AB0C 4PR5B 5DZJA 5L8KB 2RD0A 3GSRA 1DQIA 3DRQB 4ZS7H 5EO9A 5E8OB 1RZGA 5JW3L 4UUJB 4L8SC 4LLVB 5FDWA 3GJEA 3QA3B 1RZJH 5AAWA 3OJ2C 2JB5H 5E08L 2R0LL 3JWDC 4QOKB 1P7QA 2OSWA 2B5IB 2FSDA 2EDKA 3MNWB 2E56A 3QARA 7FABH 1R3HA 3OM3B 2XIIA 5B3SB 2NNRA 2W0FB 4D94A 3W0WB 3MBXL 3ATBA 3PREA 2KERA 2VLKD 1F6AA 2AEPH 1ZE3C 4RMQA 2IC2A 3K4DA 2VR5A 4PGJA 1FE8L 3LS4L 1WC7A 2ORBH 2HT4C 2GJ6D 4JFED 4ZMNA 1L9TA 1X5HA 2YA0A 1H5BB 2BY3A 3MBED 4YHMH 3UGEA 3TJEL 5DEFA 4R83A 5J8OA 3HE7D 3WTVA 3Q5YA 3S4SA 2N7AA 5DVMA 1BEXA 3MNVB 3QWQB 5FF6B 4R0LB 5GRJH 2ARJB 2YBRA 1KJ2B 2EO9A 1CFNB 4JVPA 5F89B 4POUB 2MIZA 2XXCB 4IGBC 3TBYA 1EJ6A 4PJHB 4PV9B 1F1GA 2PXYA 3UO1L 4R96B 2VDLB 3TEZA 4WEBL 1HOCB 2Z7YA 1UH3A 3DX9B 4IIZA 4L8DB 2ZCKL 4HIXH 1IRAY 1EFXA 4PJ8B 1KWGA 4KMQA 1XF1A 3KPMA 5JOFA 1J5OH 4ZD3L 1HNGA 4MYPA 1RD6A 3FHEA 2JJTC 1DQTA 3LSOB 4WK0B 3PUUA 1YY8A 3ZYOA 2UVEA 4PSPA 5BZDB 3KAAA 4ELMF 1IAMA 1FNAA 2APBA 4FXKB 3QZPA 5E7BA 1B4JL 1A4AA 1ZJBA 1R3LA 3ZPDA 4L1DA 4IOSD 5MEOB 2HH0L 1MCCA 3ETBJ 3CVCA 3MUHL 1NFDA 1D5XA 4YBLC 3MV11 4XXCC 1TQUA 3W11D 5D1XB 2OI9B 4AQEA 2BJML 4X7EC 4Z7OB 4DHLA 5AZ2H 1RCYA 1OTUD 4O2FB 2P1YA 3H6AA 3IDIB 4U6YA 1QRKA 4G71B 1YY9D 3O0RH 4OVVA 2YD6A 3VXSE 2W9DL 3BEVA 3RX8A 5IM7B 1MRDL 4J12A 1I9EA 3G5YA 3FTSA 5DUPH 4BKTC 1XBRA 4Q9BA 1P6WA 2P5WB 4OI7A 1CICD 1VPOL 3MTXA 3I50H 1RUPH 5D9SB 5DK3A 4KTDL 5IT2H 3SODB 1P53A 4LSPH 3O2WL 3LVEA 4U05A 1SOQA 4JRYE 3VFPA 3ZKQD 1HHKB 3VO0A 1TMCB 2W80C 5ESAA 1LO5B 1ZXQA 2WVUA 2D0GA 3CJJA 3QP3A 2CBOA 3T9WA 1MWAB 2R0WH 1X5MA 4DK3A 4AJ0A 5F7UA 4UNUA 4ZAKD 2DWDA 3VFNA 1NCIA 5HP5A 4WEEA 1OW0A 4X8JB 2OCJA 4L1SA 3QJRB 2QL1A 2XI9A 2CRMA 2WHVA 3IDYB 3C2AH 3HUJF 3NQIA 4HK3N 4JL1A 4MCYB 4UF7C 2BNQE 3VWJA 3NJHA 2MFNA 4PP1C 3HFFA 3CTTA 4Q6IB 3H54A 3GIVA 4P06A 5IV2A 3BSZA 4XPBL 5C0BD 5CZVL 3NFNB 4I85A 5CSZB 2CMRL 5AW8B 2MOGA 3IXTA 4L8CA 4HJ0C 3QDAA 5AVUB 4B9IA 2A4EA 4ODBD 2JIXA 5D2LF 4UWQB 5KBLA 1B2WL 3PWVB 4FNLL 1PEWA 3QNZA 3BAYA 3AG4B 5JXAL 1DFXA 4TULL 2W07B 1GJUA 5LNGA 1DVFB 1KGUA 2D73A 5IVXF 3MCG1 2XPZA 1ACYH 3JWNE 2C1OA 5F3BA 3STZB 4R5XA 3EH1A 3P9WB 4XMPH 1LQSR 1CK0L 1ZVYA 2FL5A 2VXVH 3GTVA 5D6DA 1BZ7A 5DK2B 2ZOWA 1PDKA 5ILTL 2CIKA 1H3PH 3MV7D 4WU7B 4FCHA 3F7VB 1N64H 2FK9A 2W9EL 3BGFB 3C60C 3FT2B 4PD4J 4MXQC 5D7SH 2R7EB 3JSSA 1AMXA 2MCMA 4BFNA 1JV2A 2WKOF 3QIWC 3R7QA 4RRPA 1QI4A 3OPZL 3ME0B 1EV2E 1FNEA 3GS4A 4DUWA 4UOQA 3KJ4B 3RDTB 4QXGH 4ALAC 3IDGA 2VE6B 1T6WA 3IMTA 3ZSTA 1QNZL 3FTYA 5CNHA 5DURD 1NBQA 4FA6A 2GY5A 5CIPB 5DJZB 4Y1TA 4ELMB 4JN2A 1QSFA 1PSKL 4FN0A 4U1KA 4WDIB 4I0PA 4NX0A 1IE4A 1ZT1A 2G9HA 1WA2X 5DEJA 1J12A 3AXLB 3DETD 4LARH 4LF3A 5KS9F 4NKOB 2Y7NA 5CBEA 3VXUA 2ZNXA 4HUXB 1XB3A 5EO0B 2DIEA 3S3CB 2VXQA 4DESA 4JO1L 3FCSA 2OV0A 4FQXC 3MAWA 3V5KB 3A3YB 2XTJD 2OKMA 3A4EA 2DBLH 1TEFA 2HYMA 1I1RA 5F0JB 5CEYA 1G6VK 4FL4C 3GJFK 1HNYA 2DOCA 4BRVA 2BOBA 1UM6H 2A74A 5HHOE 2IXQB 1YMMD 2Q10A 4D3CL 3U9PH 3CK0L 5AZEL 4A6YH 2NX5D 1I8MA 3IDUA 1JWSA 3B9KB 3LB6C 4IU2A 5HDWA 2D0HA 5FWQA 1WZLA 3U1PA 3T4AB 5CLYA 2ZQKA 3ARFD 2SEBB 1OD7A 2X4OB 4KV5E 2BFGA 3CMOH 4G43A 4LSUL 3EHBC 4P0DA 3TO4A 3ZKMC 1J5HA 2XNAB 3G3LA 3W9DB 5KUMA 3U4AA 5DRXB 1QWNA 3NA9H 1ZV2A 1GMEA 4HHAA 4F2MB 3K6FA 2WINB 1F3RB 3HUJB 2FLBT 2YBGA 2YIHA 4DP2X 2Y7QA 1SDAB 2KI6A 1IQWH 4PWJA 1V3MA 1K2DB 3NABH 2NUPB 3PDDA 3SDCA 2RFXA 3NYKA 3QWOA 4OZGF 3AMLA 1UZGA 2VDPH 1FNSL 4FNUA 2NT0A 1VGEH 5CKAA 2FYYA 2YLKA 2O5NA 3TIEB 4NM4H 3VFMB 4HS3B 4JCWA 4XOEA 1NMBH 5EZJB 2RCSH 4IRJB 3DROA 3O2DL 3RG1C 2I60L 2F5AL 3KXFA 4XNYH 3BUBA 5B7MA 2ADJA 3V0WH 4GRWF 3W37A 1XIWC 4CW1A 3MUJA 12E8H 3CHRA 3K80A 3UG5A 3FJTA 4KO6A 2IDUA 3I02A 4NO5B 5IVXB 3SKNA 4WUUD 5E9DD 4WW1A 2OK0L 1UT2A 1OSYA 4X4YB 3SE8L 4NNYA 4L23A 1VEMA 2V5RA 1FYTB 4MAYD 1UM4H 3C5SA 1E4XI 1L7TH 1MVUB 1XF4B 5FYKE 2NLJA 4A2LA 2OMYB 1OAUL 4LLWB 3M6DA 5D6CA 1XCXA 4P9HL 4U6HA 1BVKA 5I75C 3L3KA 1XH2A 2YAOA 2X9WA 1MCIA 4JANA 4WJKB 4IRSA 2ZP9A 4Y2NA 3EUDA 3VSUA 4X8CA 1RP9A 1UXSB 2CRIA 1PY4A 5GRYA 4M02A 4R5VA 3X3FH 4LDLB 4QEGA 4WU5A 5BVPH 4IMKA 5FGCB 4JREB 4XO4A 4CVXB 2HJKA 2EAEA 3SYQA 4TUKL 4HUKB 3NP4A 5IMMA 2HT3C 5L2KD 1T1XB 3PP3H 5TD4A 4D9QE 5FYJH 1QABA 3HBZA 1JOIA 3IJSA 1CIUA 2XN0A 5I1AA 3FO1B 1OM9A 1PX3A 3IFPB 3B7RL 4ONGH 3VACA 43C9A 5FC9A 1QBLH 2MPAH 2DQEH 4KDTA 3TBSB 3W38A 3V4VA 1ODUA 3F58L 4M5YH 1I1AC 4AV4A 3SCMA 2FT8A 2X1XR 4JPSA 4B9JA 1XF2B 1N4XL 2EVHA 1HXKA 2PPCA 4F7CA 1J86A 2AXJA 2CLRB 4IBYA 3KPSA 4MMXC 4ONHB 4YHLL 5KS9B 1JPEA 3M88A 4Q0XL 1GIGH 1G7PB 2AK1L 5IJVA 1E6JH 4HPOH 1AGBB 4JDTH 1RVFL 1A7OL 3V9FA 2GIYA 2E4FA 4GSDH 1JZ3A 4GKZB 3RPBA 1BQHB 3QDGA 3MLUH 1ETZA 3MLYL 3TFBA 15C8L 1OKEA 2BP3A 2HJFA 4K3HA 1UGKA 3LQZA 4NJ9H 2AXWA 2TSBA 3FQUA 3VVVA 2W0PA 5CP7B 4RMVA 4JM2A 1IJ9A 1IZJA 1AHKA 5EO1B 5MEPB 4M3HA 5AUMA 1PZ3A 1A1NA 1IEBA 2AJZB 3WGVB 1UG9A 3KLSA 4UU9A 1XCTB 1IT9L 1YECL 2YZ8A 4GQQA 1KC5L 5BV7L 3IWVA 3SYAA 1M05B 4YNYA 2OTUA 3BT2L 1IUZA 5JQIB 2AQ1A 4JFFA 1ETA1 3ABZA 3HB3B 3LAFA 2QPFA 4HD9A 4QLWA 1VFUA 3OKDA 4ZO7A 2I9LA 5GHWL 3ARUA 3SYCA 3GUTA 5E7FA 3AW5A 4LBAA 2WNXA 3HNVH 4MA8H 4PJFF 4X9HA 3JWDL 3S5LG 2H32A 1W2KT 2AMGA 3BMWA 4HFWB 5EOCH 4U33A 4DEUA 4OZIF 1MCWM 3U4EB 4N0FB 2H0EA 5T33H 1BZ9A 1W0YT 1H15B 3KYOB 4N0YH 1TZHB 1CDYA 1JPGA 3OKNA 4DP8X 3KBEA 4C8XA 1F4YL 5K69A 3IJEB 1FYHB 4AQAB 2NY1B 4F93B 1NEZA 3MNMA 3NSFA 3RGBA 2VZOA 3ZL1A 4M7LL 1A6TA 2YRBA 3ZHFA 3L5XL 4ENZA 3MPCA 5DWUH 1EBPA 1JNLH 1I75A 1TFHA 3T0AA 4NN6C 5DJCB 1S7WA 5IW3A 4ZMVA 5FLUA 4GRWB 3V0FA 2XWTA 1WISA 3CVHL 4KUCF 2WXHA 4KK9D 2MNWA 4GKSA 2R27A 4ZS7L 3SD5A 3ULUH 5D4IA 2KH2B 4D8OA 3O6KL 2X70B 3PL6C 1OE3A 1LHZA 1SVZA 1EZLA 1RZJL 2V17H 1GYWA 3BH4A 3W5MA 2Y7LA 2UZXA 5B3NA 1G6RH 1IFHL 4QRUA 5DF0A 3AVEA 2RJMA 1LE5B 1I1YA 2Q86A 7FABL 3QIUA 3V0VA 1FJ1B 5HJGA 5D93C 5L7XL 1WF5A 3G5VB 5I1KL 3HHRB 4X4KA 1MNUH 2JSFA 1UYWH 5HYQA 2AEPL 3O6FD 4N2GA 3DX0A 2LFEA 1MPAH 3CCHA 4KUZH 3SBWC 1SRDA 4YHML 3Q5TA 2DQ6A 4IBSA 4KRPC 1VSCA 2YEQA 1F3DJ 1T0MB 1NCJA 5BV7B 2APSA 3U9WA 3RY6C 4WKZA 1D5ZB 5GRJL 1GGCH 2OR8A 2APTA 1NIEA 2NPLX 4WI9A 3P77A 2DMKA 1OTTC 3QUXA 4OF7A 3N50A 1HI6B 3RKDC 3G9AB 3IBEA 3RUGF 4X98A 5ACZB 4P4KA 3KLAB 3VE0B 4HIXL 1DUYA 1HAUA 5BOPA 3A4AA 1KWKA 1J5OL 4TTGA 1WO2A 3UEQA 4DH2A 1JHTB 3HW7A 5IWLA 3MOBH 3NFSH 2QZQA 1Z9SB 1RJCA 3UBGA 4LVHC 4YSDA 5FECB 3FSWA 4QF1B 3FBKA 2EH8L 3OG4B 1A1MA 3B7SA 3EO0B 3MKKA 3GEWB 4RZCA 1NCGA 1NCWH 3QUZB 4N6RB 1T66C 4FQQB 4DKFH 2AKRA 4NQSA 3MRPB 1FVCB 1KGJA 5ISZA 3UDWA 1KULA 1ZLEA 3U0PB 3NJIA 3NACH 5TDNB 2Y23A 5D7IF 5H37H 4G6AD 1FH2A 3QEUA 2UX7A 2ZSVA 3O0RL 1KJ3H 4HLEA 4IBTA 4H0HB 4PY7B 1F4XH 4LXFA 3BAJA 3QQ3B 5DUPL 5CCJA 3LRGA 5DI8A 2V9QA 3FTZA 4R8WL 4G9DA 5EIQA 3L5JA 4PJFB 4OKDA 5HHPA 2YKKA 1WZAA 2VSKB 5IT2L 4FJZA 2IVFC 4HIQA 2B39A 2KBGA 4LSPL 4C4UA 5IEHA 3SOBL 1YEJL 1W8OA 3ZDXF 1IKNA 4LLYA 1PD0A 2AANA 2BS8A 2R0WL 3HRZA 2JKSA 3APCA 4L9LC 1X4YA 2AJUH 4D9RD 1F4AA 1F5WA 2YXVA 3V95A 3MRLA 2BRQA 2CHDA 2WP3T 5DFVC 3SEPA 1JN6B 5GGTH 2X28A 4HH9B 4Y2DB 5ESQA 5J1SC 3MNZA 1DN2A 1ZT7A 2EJ1A 3ALWA 3CPUA 3RVVD 3KGTA 5TF0A 2HMIC 1YDPA 2N01B 2AP2A 4PS4H 3UC2A 4R84A 2CHXA 5FHAH 1AQMA 5KN5A 4J3OC 3SDAD 4ZG1A 4RGNC 4HCFA 2G9KA 2ZAGA 4PJIB 5JZ7C 3QUHA 3LZFL 4NDMA 5C09D 2OYKA 1JF1B 3UAJD 2LLLA 3G08A 5CZXC 1S9YB 5EU6E 2XUWA 2ZUYA 2HG5B 5FUZH 2Z7ZA 3JBG7 1D3CA 1FL3A 4MB3A 3MJ9A 5AVWB 4PRIB 3K0YA 2X4SA 4NN5C 4ALAL 2FX9L 2DKMA 5H2BA 1MRFL 5EZLA 5FOBB 3I3DA 1ACYL 3K2IA 2X10A 3LRHA 3HS0C 5EC2A 4MZRA 2V7NB 4PJ6A 4EIGB 5IMLB 2YQ3A 4XMPL 1WIUA 2VXVL 2WNWA 3ARYA 5FCUH 4HIHB 4LIQH 3S6CA 4Z3TA 3SGJC 2BVPB 1H3PL 3X1NA 2HLAA 2PTTB 1SM3H 4O00A 2BSTA 1W6LA 3CD4A 3QULB 4G8EA 3TBWB 4AYEC 2PR4H 1N64L 3PWPE 1AACA 1DVYA 1KPVA 1DZ0A 4EJ1C 5D7SL 2ZXWB 3DX1A 3P0VH 2OTWA 1BQ5A 3ORJA 2V2XB 4YHNA 4I88A 4KAQH 3N85H 4JUTA 1PKQE 4DERA 5DMYA 3L2NA 3C5ZB 3RUGB 5JLZB 2DYPB 5D5ME 5GGUB 2CM6A 1I4FB 1JV5B 1HYSC 1S5IH 2HFEB 3TOPA 3MRCA 5C0EA 5BOZG 3WKML 3L7EA 4N5UA 4QXGL 2EXYC 1P2CA 2M83A 2R4RL 1SFHA 4Z76A 1J7VR 3VGBA 1KJMA 1MSPA 4X6BA 3IJHA 4QHNB 2CIIB 1A7RH 3BJ91 2N3JA 3UADA 4HQQH 3CMGA 1TCRA 3U30B 1RIUL 5GZOC 2PTUA 1M57B 4KY1H 1OEZW 3BT0A 4KOBA 1AS6A 3LPWA 3OMZA 3VD0A 1NCDL 4L8SA 5D7IB 4WWID 5FA4B 1E2WA 1KB9J 25C8H 2XG5B 5C0CA 2DBLL 2HLEB 3DK2A 5KZCB 1A02N 1ZS8B 2EIMB 5DD6B 3KWXA 1UM6L 4G1MA 3C8KB 2JI1A 2ZAIA 3FU5A 4YSEA 3J07A 2WXOA 3JVGC 2X4RA 3PHSA 3NGBC 3HI5H 3QQ9C 1X6LA 4FFYH 3CN3A 4QRQB 4ZK8A 4A6YL 3TEUA 1ZV5A 4F2FA 4S0HA 2NDGA 3ARDD 3ZDXB 4QJ5B 1AGDB 2DWEA 2NYYD 2KZWA 2WSKA 3NVQA 2UUDK 4JJHA 3VB9A 3FUEA 1MFUA 3CMOL 3FHQA 2ITDA 3VAEA 7PCYA 3T1WA 3PWJA 4X2UA 4AYID 4LPUA 4Z0XB 3NA9L 2GTWA 1YEFH 3CVHA 1HHJB 2BSDA 1AXSA 1R24B 2GCYB 3QRBA 4P04A 1X5IA 5DHDA 3DBXA 5T3XE 1IQWL 3FB5A 3HG1A 3BQUC 3WIHL 2HAZA 2W81C 3AWGA 5CLTA 1RZ8A 2VDPL 5F3FA 4MA3B 4MJ6B 3TASA 3LIZH 4DP1X 3EOBB 3QUKB 4Y19B 1KXQA 2EDDA 4K3DH 4QHUA 4W93A 2O93L 4UDUA 1ZD6A 1NMBL 2RCSL 5CJXC 2D3JA 5HJ3A 1G1YA 5ID0B 4HWUA 2HPOA 2P48B 2YD8A 1BYOA 1HK6A 4I13B 2A6IA 4F8NA 12E8L 5C9JB 1HU8A 1TR7A 4BK8A 3RPKA 1SLXA 3SDDC 3BP7A 2DQFB 2MKLC 3ZIMA 1N59A 4P2OD 1G0XA 3PABB 4AEEA 4PJEF 1WCBA 4W9GC 1UM4L 1L7TL 1YEGH 2LFGA 1T04B 3PV6B 3KCPA 3S88H 3O3EA 4FKEA 2XZCL 1J8KA 2EINB 1EAPA 3AZUA 3PGFH 3VQ2C 2VN5A 1SZNA 2Y25A 4G8GD 4NO0A 4KPHH 5I28A 4XHQA 1TXKA 3V4PH 2BHYA 3X3FL 5BVPL 3MV8D 1YMHB 2WXGA 2Z8SA 4XTRD 4PSRA 3ZX1A 2CDFA 5I30L 3S2CA 3CWGA 2AQ2A 2FHBA 3B9DA 4NI3A 5CCGE 3QXDA 4GG8B 4ONGL 1MCKA 3IFOB 1FFPB 3K1KC 3NG5A 1QBLL 2MPAL 2DQEL 2BNRD 2LTQB 2Z35B 4PJ7F 2L8AA 2FD6L 2Y06H 4KDWA 3QPXH 5KYUB 4XMZA 3HZVB 4M5YL 1KXHA 4GI9A 5C0AD 4QXTB 4E9VA 3EFOA 1CE1H 4OD1H 4ZTEA 1AGCB 2NY7L 1WEJH 5JPMB 1EJ8A 2NY0B 4P2RA 4DN3H 4F7EA 3MJ8B 2AJ3B 3DUSB 3KPNB 1PG7X 2LE9A 3WLWC 3IJ9A 1I82A 1I9IH 1E6JL 4HPOL 4MD5A 4JDTL 3H9SD 2EDTA 5F9WC 1B9KA 4GSDL 1RERA 2XN9E 4TUOA 3MUGB 3WYRA 2AEWA 3GZQA 3MLUL 5F72S 2QFPA 3V6OC 4RGMB 3KEDA 2NNCA 4NC1C 3HZ3A 4G2AA 1LEIB 2XKNB 4N1HB 1F3JB 4QHLA 3EXLA 4ZMPA 4R7XA 4DPRA 1ZLUK 3FBQA 3B43A 2TAAA 3EF7A 3FQ4A 3L17A 4P23B 3DX2A 3HEIB 1M9SA 3FQXB 4CVWA 4MJID 2J88L 2CJTA 1N70A 1FNGB 3AY4C 3ZSSA 1AP2B 4R4NC 3HBPA 2CLZA 3MJGX 5KJ7E 3ULUF 4HJIA 5H4ZA 4UQ2A 1ICTA 43CAA 3F5WA 4JHZA 3U25A 4HIJA 2EVFA 2E59A 3D2UA 2DMHA 5IEKB 5KSVB 1NSNH 1HL5A 2RHEA 2NY6C 1M6OB 1EHLH 4UV7H 4KTEH 3SKMA 3D34A 1I3RA 2VRQA 3MRBA 1XAKA 1S78D 3H85A 2K8QA 3N5AA 2Y72A 3RNKA 4I9XA 3LHAA 1ITBB 2DL2A 1BVZA 2A83B 3AU1A 5EOCL 4JO3L 1TKWA 3QIWA 5T33L 3FO0H 3BQVA 4KZEH 4N0YL 4OFIA 4OIIH 5E5UB 1BF5A 1E4KA 2LW3A 4P99A 2G2PA 3Q1SH 1D7DA 2VMJA 5C07A 1AYOA 1YPZF 3AABA 3HG5A 3KPRA 4PJDE 2IDFA 1EHNA 5DWUL 4G5ZL 1JNLL 4X6CA 5IGXH 4NO3A 3HPJA 2VWEE 2ODIA 3L3DA 1C08B 1K9TA 1R5IA 1MLBB 3MR9B 3VG9B 2G5BB 1IBGH 3LKSA 4G42B 4PJEB 4TSCH 1N5AB 1OP4A 5IFJB 2V17L 3AT0A 2IANB 4KROC 3BH8A 3UPRA 1UFUA 1ZHBA 3JWOH 1CGWA 1G6RL 4UM9D 3WIAA 5C9KA 2P24A 3CDZB 4JFXA 2YLHA 2GBTA 4EUPH 3EJJX 3KGRA 2A9CA 2CO6A 1KBKA 1MNUL 2OSXA 1UYWL 3V5HB 3B2UD 3UEZA 2E0PA 4N90E 3VRIA 3ROOB 5D2NE 1MPAL 3GHBH 2AQPA 2J25A 4KUZL 5JHDE 3SJVD 1B4LA 1M7XA 3FB6A 1OZTG 4L4TA 5LAXA 4QCIB 5SX4I 3B83A 1UKSA 3VH8A 2I07A 1OK8A 1R3KB 1MVYA 4FQCH 1BA9A 3N43F 3UTTB 4J3TA 1FN4A 1MCBA 1HKFA 2W0KA 3PGCA 3UAAA 4HIIA 1MCWW 4PJ7B 3DMMA 5PCYA 3HRPA 3BDBA 3DPBB 3HVDA 1W0VA 2Q76A 2Z91A 3D0AA 3EYOB 2EZ0D 1G7QA 2VR4A 4OF3A 4F2ME 1YLBB 3O45A 1CFTB 1DJHA 3EDFA 2R9HC 4LMQI 5J7CC 1LE9B 3ZTDC 5C0FB 3BDXA 4YFDB 2MCPL 3KYNB 3FSZA 3R1GL 1K4CB 4LO9A 2E76C 2WQWA 4JO8A 3FCBA 3MOBL 1X44A 5C0GA 4HDIA 3WJLC 3NFSL 4ADIA 2W60B 3C6EA 2ZUUA 4PY8J 1AIZA 3QEHA 3V6FA 1A9VA 1O7DE 1I8LC 1T21A 1S9XB 4PLNC 4O2CA 1UVQB 4ZYKB 4KJQC 3OQ3B 4RAUA 1OALA 4R4FL 4V2BA 4G8FB 4DKFL 1XIWA 2VIRA 1AD0B 2WQAA 3REVA 5A3IC 2P8MA 4KKPA 2CJ3A 3T0DA 2EXTA 4NRZA 4A2FA 1U8MB 4KJWC 1VERA 4H20L 5GRVL 1CFSB 1B90A 2P8PA 4JDEA 4BUQA 1IGML 3VU1A 5C0JA 5KSAD 3KL5A 3L3HB 4HGWA 1KJ3L 3HZMA 4GMSL 1Z9MA 3SKJH 3FHAA 4J4PC 3RVTC 3KLHD 4JW3A 2N1TE 3UCRA 3B9VA 4JKWA 1CXFA 3BGAA 3F64A 3IRCA 3I9IA 5IVZA 2D7OA 2GK0B 4W6YB 3RWCB 3O4LA 3GTNA 5AL0A 4AGLA 3IDXH 5FGCE 4N2MA 1KXTB 3L4CA 3EYFB 3VFWA 4M8VA 4AJWA 4LOUC 1MI5D 3QHTC 2BCKB 1VFBA 3D09A 3QFDB 4FNSA 4N20A 4IBVA 3FCTA 4U2ZA 3SDXE 1GS8A 2D2OA 1G7IA 3D25A 2AJUL 4MVBC 5IHUH 2B59B 1OP9A 3KHQA 2FSEA 5AWNH 2CO7B 1TJMA 1YPZB 1YEHH 1AGFA 5GGTL 5F88A 3OF6D 2VW4A 3WI9A 3MOAH 4M1DH 1A4CA 1B0RB 1JGDA 1KFGA 2Z31D 3BVVA 3BVXA 4D9QD 4Z7QE 5ICZB 2DI8A 4PS4L 1N10A 3QZWB 4IM8A 4ZBJA 4GG6E 2HG0A 4LRNL 4RQQB 5E6ZA 3NN8B 2C3VA 5JW4Q 1Z9PA 3O3UN 3RI5K 3CXFA 5JNYB 2PCYA 3RL2B 4XHJD 2HN7A 2I9TB 3T8MA 1J48A 1RJLB 5HHNB 3MCKB 4Z3EA 4AKQA 1KIPB 2YMOA 1G9HA 3EJYC 5FUZL 5C2BH 3BFQG 1E8WA 4M4RA 4TVPE 5KVGH 4LHQB 2R1YA 1JZ8A 5GS0H 4IKJA 3TYFB 3BSHA 4HZLA 3LX9A 2V7HB 2YJLA 3HMWL 4HWZA 2OQJB 2PYEE 5L9DL 1A21A 5FCUL 3GSRB 3WHE1 4BH7A 5EO9B 4OV5A 4LIQL 1OHZA 2DEYX 4U1LB 3MRDA 3NA4A 1L9NA 4EN3D 4Y4KC 1BWWA 1FORH 2M2DA 5I0VA 1V3KA 4UT9H 2PR4L 3WDHA 3W3BA 3EDKA 3JUZA 4P3WA 4PJ9A 2JJSC 1P7QB 3N43B 3P40A 3B34A 2IF7A 1WWBX 4PD4K 5TE6H 3IRZA 2Y36H 1R3HB 3P0VL 4DEPB 4PREA 1X9QA 4KI5C 3LKOA 1GJIA 3RTQA 5FYKU 5BVJA 1TZGH 1YN7A 3S4SG 2HTLD 5C08E 3TONA 3L3GA 4FQ1L 4PRHD 2WOBA 3DSFH 1K8IA 1S5IL 1WC7B 3AREB 1BVNT 4PIBA 3D06A 2XQ0A 4OB5H 2ZKMX 3BUDA 3BD4A 2G2NA 5DEFB 3PE9A 1ZV9A 4KMLB 1YNLL 4N0CC 2H0FA 4YHKH 1DQLH 1ILUA 1LNUA 4QJ3B 2YBRB 4ZMXA 2QKSA 6PCYA 1BXAA 1A7RL 1KYDA 2XCMC 4BQCA 2OL3H 3UBXB 1E5BA 3T2LA 1I3VA 2NQCA 1OQXA 3X2QB 5A16A 4XXWA 1P1ZB 3T3PB 2VZTA 5T5NG 4UQ9A 4KY1L 4U0QB 2DQTH 2XKUA 1ODAA 1EFXB 2EXWC 3Q2LA 3ABMB 4NQDE 5TK4A 5JOFB 1M42A 4P5TC 1PAZA 3HVNA 5BZXA 2LLGA 1MH5A 1X5GA 5E2UH 3FMGH 4P46C 3DC0A 2D7TH 2WCPA 1YY8B 2VLLA 3H8NA 5IBLD 4MBRA 5K5YA 4RMBA 4F9LC 3MCYA 4LLQA 4YLQT 4P2QE 3APNA 3F7QA 1N6UA 3VGFA 3O9WD 4WJ5A 3DPDA 1PFOA 4FFYL 1WRFA 4CGTA 2WLLB 2H6UA 1DQJB 5E1QA 1EJOH 2FT7A 4QNPF 2AK4E 1JUFA 4FNTA 3GDCA 3BLKA 1NCOA 4YHIA 1A2YA 3T6XA 2I25N 5AVTB 1O9VA 3FF8A 1TYJA 5EIVA 2FUQA 3UXFA 4L4VA 3G5XA 3GSQA 5FK9B 2PO6C 4ZFQA 4HS6B 4OGYL 4N2LA 5LGHH 3I9PA 4GKLA 2K6YA 1THCA 5EBGA 3BO8B 2VQTA 4FD0A 1WH0A 3B2VH 3VXQA 1U41A 2CNYA 2DTMH 4ZS6C 4D7PA 2Y1ZA 2YGPA 3ARTA 4X5LA 3KPQB 1CBVL 2P42B 2K9UA 4QI3A 4G8IA 4K3DL 1JNNH 2Z8RA 1ZPLA 4L0PB 3TT3L 4XWOC 5E8EA 4Y5XA 2DWDB 3OKEA 3FRUA 4LP8A 4DZBA 1WQVT 2BP8A 4N9GA 3ZE1B 4IMLB 2NXZC 4KKBC 4NEHB 2FECL 4GY4A 3VQ1C 5IV2B 5CGYC 4FS0A 5HYIA 5AD0A 5IHZA 1ZAGA 3LRSA 32C2A 2BSRA 2EYSB 2E74C 1O6SB 4E36A 3IXTB 2FO1A 4L8CB 1LK2A 2J72A 4ZX5A 1D9KB 1R1CA 1TZIB 2JIXB 2Y3NA 1SLUA 2ISDA 1NOFA 3APDA 4GAFB 1IO4C 4JHBA 3QNZB 1OGAD 1MN4A 4KPHL 5LBVA 4BKLB 1BFOA 2KT6A 4LOFA 2HX9A 3S36L 1RZKC 1HH9A 3V4PL 1ROCA 2H3NB 3AUVA 2YZ1A 2QPSA 5BCAA 1ZDSA 3WMQA 4HVBA 2E7LC 1X5FA 1NL0H 2C1OB 4RIRA 4JZOB 2FL5B 2Q8BL 2ZX5A 1DANT 1BZ7B 4BV1A 1PDKB 4WTXA 4AEHH 3LS5H 3NK3A 2H1XA 1PZBA 4S1DD 4ES9A 5I1CH 3ARRA 4RRPG 3IB4A 3QPXL 4EIZC 3RFZA 4HH8A 3WY3A 1CYXA 5HPMA 3KDMA 2YOAA 2DWTA 2JQZA 4CN6A 1UD5A 3EJTA 1CE1L 2A4ZA 2DLFH 2EEBA 4OD1L 3T3ME 4KXDA 3QNYA 4QDGA 4Y4FA 4CKQA 5J5EA 5CGMA 2EH7H 3CZSA 3SPVB 5F1NA 1I9IL 2F58H 8PAZA 5PAZA 1FNEB 4W9CC 1C5BH 3LD8C 3NJMA 3E7JA 2HKAA 3D07A 1YAZA 2FBOJ 4QY8B 3IDGB 4U3HA 3CLEH 3LTVA 4YHYC 4U3XA 4AENA 1MFMA 2E75C 4JN2B 1QSFB 1Y0LA 4XP9H 3MCLH 5L0QB 4I0PB 3L4VA 1ZT1B 3C6LB 5SX5H 4F58H 5CBEB 1AHWC 1E90A 4GAAA 3KPOA 4I3RH 4JRXD 3HS0A 2YKLL 3RJDA 2WXPA 1U3HD 2P80A 2WVTA 2F7PA 4W6XB 3LXCA 4JS7A 5DJ8B 2IH3B 3FCSB 3KWWA 5CEZL 1NSNL 4AUJA 2UY7A 4N6QA 5ICYA 1EHLL 1QRND 5LCVA 4XZ4A 3GZKA 1VHPA 1J8RA 5CEYB 4R7DA 4AEFA 1A1OA 4HF5H 4OCLC 3U2SA 3BAKA 2MSPA 4OF8A 2OYPA 3WSQL 4Q9RH 3AT8A 1KTCA 2A74B 4N0UE 4OGAD 4UAHA 4NT6A 4WIQA 1UM5H 3WENA 4CU8A 2EADA 2ZOOA 1UWEH 2JI2A 4Y7MA 4KZEL 1AAJA 1QUPA 1JWSB 4MJ5A 1I8MB 3BXNA 4HA1A 2UWEF 1CTMA 1Z32X 2OJ1A 5IP4A 4OJEH 2F53A 2P5ED 2CG9X 3Q1SL 2J4WH 4JJOA 4Z7VA 1FNLA 4G43B 3PDGA 3ZU8A 4AJYV 2VMDA 4J28A 4JKPH 3TO4B 2P45B 5IGXL 3INUH 1D7FA 1JIBA 3LZNA 4OJCA 4HHAB 4Z7NF 3I6GA 3T8VA 2ESVD 2IWFA 3K6NA 4W9EC 2F54A 4OKVA 2WYHA 4C56D 3D3VE 3L7FA 1IBGL 5GZOA 4OUOA 4KI1A 2RFXB 2JWYA 3QWOB 1K6QH 4TSCL 3AG1B 1D6EB 5CHNB 3SGKC 3MBEC 1M2OA 4ZXBD 3N42B 1E30A 3X12B 3HE7C 5BNXD 3LQMA 1KCKA 3JWOL 2EE9A 3VXME 1GZHA 5AVZB 2KDYA 5D1QA 1BDYA 1P6AB 3AXIA 5HGHA 3IN0A 1HINH 1AR1C 4L5FE 3AS3A 2BO0A 3VFVA 3MFFA 4PS8A 4CW1B 3RWFA 3NAAL 5T5FA 4M62L 5SWZA 2EC8A 3L5WA 3I02B 1D5MA 2FBJH 3SKNB 4J27A 1DSFL 3GHBL 3JVGA 4NNYB 1BIIA 3O3DB 4HC1H 3H7BA 4PB0H 5EA0H 4QOKD 1UD6A 4WW2A 3PWLA 4LDOB 2NLJB 2EDOA 2GSGB 1BQSA 5D6CB 4FQCL 5HYJE 3CSBA 1BVKB 1KB5A 3W0WD 2APWA 4PI0A 4YR6B 3CH1A 5HHMB 5DC0A 4M61A 3WLBA 5LG6A 1DJGA 1Z66A 3LMJL 2YPLE 4E41B 4ZQTA 5F2FA 1A6PA 2ZOLB 4PRAB 4W9IC 4ZZFA 1MCNA 4WU5B 1TYEB 1CLOH 1IGTA 2GPZA 1DJWA 4W9ZA 1FL5A 4ZQKA 1MHHA 5EBLA 4S1RH 3ULVH 2LAGB 4MS8C 5IMMB 3AXHA 1O0VA 4XPGH 3W11C 4HOXA 1NCUA 3OB0H 2VTFA 1DQDH 3IJSB 1EEYB 1OTUC 5ITBH 5FYLE 5DT1H 4EZKA 4WFGE 1YY9C 4NQEB 4K3JH 5AVSB 2ZPKH 4X5PA 4BFBD 5CJXA 4GB9A 3F6LA 4PJ8D 3IAGC 3JUYA 4JLRA 1PTZA 4KVCH 4XR8C 8CGTA 1CICC 4QO1A 5F1OB 4F7CB 4F5CE 2CDGB 3D52A 3OD3A 1E40A 3EJUA 5DUBA 5DGRA 2YHGA 3DTDA 5BXFA 4QRRB 5IJVB 3RQ3A 2Q2EB 3WNOA 2HJLB 4KI5F 3DRTA 1MHCA 4E68A 5E6RB 1ZLWH 3RRQA 4ZAKC 1ETZB 4A38A 3RJQB 5E0QA 1KELH 2C4FU 2HJFB 4LCWA 5LNEA 3DTXA 2ATPB 3LQZB 3R0NA 3FQUB 1QLFA 1XR8A 2XQYK 3UZEC 4H8UA 4AK2A 5T3ZD 4JM2B 5BZWA 4UBDD 3E1ZA 3IDXL 5D1XD 4EUPB 1CF8H 3CZNA 1A1NB 4GW4B 2BSSA 4OCYH 4UU9B 1JTTA 5E2TH 3UMNA 1NOLA 5CILH 4DP5X 1WHOA 1QTSA 1FAKT 2H4EA 1J9CT 2OTUB 4LPCA 3OLGA 1S6NA 3FT3A 4FJYA 5IHUL 5BOJA 5TE7H 4FKHA 4NLHA 4LT7A 2P5WD 5C6PB 3INOA 1HE7A 4YK4C 4PMFA 2WKLA 1YEHL 3ZMRA 1HS6A 1M71A 2FCBA 5T8IA 2IV9A 3F05A 1KYAA 3EO1A 3MOAL 4WSKA 1M1XA 5KBMA 1BQRA 1RZFH 5FX3A 1BLNB 3VG0H 4Z7NB 3TPKA 5DQJA 2PP9A 1A8ZA 2RMNA 5L88L 3GI9H 4IOIB 3KLLA 1BZ9B 3II1A 4ZPVA 3O41A 2CUHA 2F74A 3KLQA 3FQTA 4K07A 3GMMA 1JPGB 1N6VA 1OSPH 1OCOB 1AR2A 5CFAA 4MMZA 1NEZB 2FX8L 1GPOH 2BP0A 3UAFA 3LN4A 4P9MH 5C2BL 5KYYB 4K9EH 5EUOF 4ODWA 1A6TB 2W1NA 5KVGL 2A6DA 4XVTH 4XN4A 1DVUA 3V6OA 3TEYA 5CINH 5GS0L 2GG1A 4MCZA 4PBDA 2VJ8A 4X42A 4JY6A 1R5VA 2OLDA 2Q7YA 3K8KA 3CFIC 3ML9A 1JYWA 1NGZA 3OAUH 4P4RA 1KUMA 4M8QA 4U0RB 3SY6A 2B4CC 3UERA 4BFJA 4X5XB 5HHVH 5J11B 4RMRA 5GRUL 3PJSA 1FORL 4M1CD 4HFUL 3OC8A 1PW3A 1B6UA 1DVFD 4QRUB 2WK2A 2RACA 2GABA 2A6JA 3FUJA 3QIUB 5IESL 5TE6L 1F8TH 2Y36L 4XMKH 4RMTA 5DMKA 1PG7L 3ECBA 5JHBA 5E9NA 1JZIA 3DETC 1TZGL 2J71A 3QAQA 4XCCH 2ZXBA 1RULH 5AOZA 5HYQB 5J1AA 3DSFL 3L3OA 2YRLA 4NKIL 1PNDA 1M2VB 1G7JA 1ZOXA 5HGGS 1MF2H 3JTTA 5JPNA 2AS5M 4K9EC 3MREB 4OZ4B 4K5NA 2BMKA 2XSKA 1CMOA 4XT1C 3NFPA 5IQOA 4OM1H 2O5ZH 1DQLL 4WKZB 3UO8B 3QDME 2YA2A 5JW5A 3P77B 2I85A 4PJBE 2CLVA 4GQ9L 1ML0A 4LPYA 2OL3L 5DD5H 1J1XH 5DS8A 3QUXB 3O8XA 5G2NA 2HZHA 3EO9H 2Q9OA 4X98B 5FGBC 4P4KB 4O9HH 3RDTD 4MQSB 5B8CC 1F42A 4NN7B 1JPST 1S3KH 2HVBA 3BEWA 1QZ1A 5JHLL 1O7VA 1JL8A 3ARFC 1AJ7L 1FQ9C 4N3UA 5E2UL 5HYSB 3SOTA 2D7TL 3EH2A 2YWZA 3NPSC 1N67A 1MAMH 1OLZA 1KACB 3CIAA 2VZUA 3QJUB 3QDJE 5SWSA 4F9PC 4RZCB 4PJAE 1AC6A 2R2EB 3ISWA 3P54A 2ARJQ 1XTLA 2AKRB 2O5XH 4NQSB 1E2VA 3V4LA 3W82A 5ISZB 3VXRA 3EYVA 1AY1H 5EBMA 3OSVA 1SGKA 1LLAA 3ZUCA 3GKWH 3NIGF 5AVQB 4Y9GA 4LVEA 4DTGH 2CGRL 2ZSVB 3UTTE 2Y6TE 5AW1B 3BPLB 5D4QA 5KVEH 3Q2WA 3Q3GA 1QD0A 5IW1B 2B9BA 3PAUA 2VLRE 3KG5A 1PQZB 1RPQA 5JHDD 3B9KD 1DFBH 3DTUB 1UJTA 4G9DB 3B2VL 5AVXB 5HHPB 5J06A 1JVOA 3V0GA 2GUOA 4N2FA 1MEXH 5IEHB 3A6CH 1JPTH 5B39A 4X6DE 2FGZA 4MAYC 2E7BA 4P57A 5AFAA 4R7NA 2P8LA 3IU4H 4LLYB 3HRZB 3N1QC 5DJAA 4PVBA 4XB8A 3UTSB 3OR7A 3UIZA 1Z6JT 3WJLA 4TLKA 1EXUB 5DO8A 4X5QA 5ALBL 4ELKB 1A6UL 3CFMA 2VRAA 1HZKA 5ESQB 2H26A 1GGUA 1I9JH 3MNZB 4OCSH 2CM5A 4LCIL 2DQDL 3H3PH 4XNZC 2VM3A 2EEDA 5KN5B 3B3IA 4IRJD 1TQWA 2RB8A 2B15A 1SYVA 4O02A 1TYRA 3D0VB 3NSJA 3UIYA 1ETJA 3G08B 3AM8C 4KK6D 4CSTA 1T20A 1FL3B 2PW1A 4PCSA 2X4SB 4J4PA 3IKCB 5TDPA 1FYTD 4LHUA 3ECVA 5H2BB 5EZLB 1OTSD 2HFFA 5H4YA 4Z77A 2K78A 1NL0L 1YN6A 4G6KH 2CRYA 2UXVA 5E6IB 3OZ9H 2EACA 1U58A 3C12A 4GRLA 2QVMA 2X6MA 1LEGA 1CGYA 4NQTA 1AIFA 2X0VA 4RMWA 3TN0B 1JCKA 2HLAB 4QYOA 2WZAA 3LS5L 1WFMA 4L29A 3S34H 3CZUB 1XL4A 4YPGB 1PLAA 2YPVA 2LHAA 3DX6A 2F8XC 2DLFL 1UQSB 2OTWB 4G9FB 4JFYA 1OF0A 4YHNB 1NC2A 3FB8B 4Z23A 3CXHJ 4OW6A 1IM9B 1ET5A 2EH7L 2FZ3A 3T04D 1I1CA 3QJXA 5I5IA 5IHWA 3FH8A 1UKQA 3FUMA 4X0KA 5FO7A 5C0EB 3MRCB 5BQDA 2XFXB 1H8SA 3P73A 3L7EB 2YPKA 2XA3A 1PLCA 1P2CB 3CLEL 3GSNA 4Q6KA 2VDOH 1DDHB 2XV6B 2YRZA 1BFSA 3NTCH 4PJGF 4UB0H 4JBSA 4B6ZA 2YGNA 3IJHB 3IBOA 4EXKA 2ICCA 5D71H 3WGUB 3P4NB 5FV2A 5I8KL 2F6AA 4NGHH 5I26A 4F58L 1AQDA 1KYUA 4TTDD 4OLUH 4I3RL 1AH1A 2CHNA 1V7NH 3QEQB 4YE4H 5FO2A 1CGSH 2EE6A 2C8NA 4TL4A 3P69A 4YEFA 3BLPX 3NIGB 3SE3A 1NGYB 4Q52A 3TZVB 3WTXA 4Y5VC 2V2TA 4Y4KA 5C0CB 2HX7A 5FM8A 2G0KA 3PQYA 4HF5L 1UZ6E 1JYXA 4G1MB 3HPLA 5T1MB 1F02I 1HXYA 3RL1A 4A39A 3QCVH 2Z6FA 1UM5L 5HHXH 3DGCR 1UWEL 4OM0L 4KK9C 2O6FA 1BF2A 5CJBA 3HB3D 4AMKH 3N44F 5LXVA 4GAJH 1QSZA 1VJSA 3BVDB 3FS9A 3O4OB 1HVXA 4XP6H 1ZVNA 2BWIA 4CMHB 2J4WL 4P07A 4R4BA 5IBTH 3PLYA 4WHCA 4JKPL 2G3XA 4RISL 1C5CL 3INUL 3ET9F 3PWJB 2Y5QA 2GTWB 2VC2L 3FQRA 4E9SA 1AXSB 4HHWA 2NY5H 1OM3H 5LHDA 3DBXB 3O6FC 3GWJA 1W8NA 3HG1B 3GSVA 2NY1D 3T1FB 1EH9A 2VDQH 3TBVB 1K6QL 1IC1A 1CGXA 4ODXA 1RZ8B 4PVLA 4U1MA 5KAQF 2Y24A 3APMA 3W5NA 3ULVF 3BAXA 4P5TA 2LABA 4QHUB 2DF3A 1H3TA 3C8DA 3PP3K 3AADB 3CVIH 5G4NA 4P46A 2IV8A 3CXDH 5A40E 1ZA3A 4MX7B 1HINL 4LCCA 2FB4L 3CX2A 4OFYD 2EDYA 2VUYA 4JG1H 4ENED 4X7CC 5B1JC 5I18H 2A6IB 4ADGA 4RNRA 3POHA 1AGEB 4EOWH 4LOVA 1CFBA 3BP7B 3HE6A 1NFDE 2VDNB 2WXLA 1N59B 4MSWB 3MACH 4G80B 4HC1L 4YHOL 3CFDB 4PWIA 4WV1C 4DF9A 1NIFA 4CNIA 3M17A 3F7KA 4J8RA 2OZ4H 2BHUA 4L3EA 5LCVH 3FFCA 5E1AB 5LQBH 3KCPB 2KQMA 4OSUH 3MA7A 3LRLA 3GSOB 3DOHA 3ZKND 1A3LH 2B7DT 2WBKA 1EAPB 3LPPA 3PWUA 1U8HA 4GXVL 4NO0B 5KBKA 4Z9KB 2PO6A 4NIKB 5IUCA 1LMIA 3MLSL 4ELDA 3U6XA 4JPWH 1G84A 3T65A 1CLOL 4OLWH 1NGXB 3AC0A 3Q6GH 1OZUA 1MQKH 4XPGL 2B2XL 2CDFB 1MHPL 3FT4A 3TS8A 5HDQL 1DQDL 1UZ8A 3B37A 3ZHLA 5ITBL 3TWCL 3QXDB 1BD2A 2JCWA 1I1FA 4K7FB 1SY6A 4K3JL 3SE4C 1UOLA 1T7ZA 4AEIH 2FO4A 3C9NA 1SMAA 4G6MH 4KVCL 3EFOB 3OC5A 2J3SA 3GMLA 3NUKA 1WFUA 3QH3A 5CLZA 3ZE1E 1C5DA 1RIHL 4P2RB 5DXWA 3L6FA 3SE9H 1L0YA 1UJ3C 4GO8A 5KJ4A 3GRGA 3EG9A 2Y7MA 4JVWA 3HAEG 4ZUSA 1PKOA 4TUOB 5J3HD 1UOWA 1GOFA 1P9MA 5BO1H 2A38A 3QUZD 4AL8H 4Z5RA 1CO1A 5F0LB 1DBBH 3FN9A 3NK4A 4QHLB 1Z5YD 4XRCA 4M6MH 3UABA 5F71A 4TL5A 4XP1L 1ONQA 3RVVC 4N2KA 1CF8L 3OKYA 5A2CA 4NHCL 3FN0H 4JFZH 2NDFA 4WQOA 3CNKA 4OCYL 4HUNB 2Z4QB 1OO2A 3SDAC 2CLZB 1YC7A 1CTNA 4LVOC 3AGVA 4PRDA 3N44B 1T3FA 43CAB 3VGAB 1TVHA 3NZ8A 1UACL 3D2UB 4HIJB 3UAJC 5TE7L 2YOCA 3BI9X 5FW6A 4QRTA 5HBBA 3BWAA 1YEDB 3MRBB 1U6AH 5LDSA 1FH5L 5GJSH 5I24A 5KSBE 3RNKB 1RZFL 3MRQB 1RLBA 2IBZX 3VG0L 3G6AB 5IKCA 3AU1B 4YIQA 4QHPA 2W5PA 1QHQA 4N2DA 4KK8D 3BKYH 4OF0A 3EGSA 1NIAA 1OE2A 1PZDA 3SPJA 4A04A 1Q0XL 2L4OA 2EUXA 2X2HA 1ED3B 1AD9B 1KIQA 4H8PA 4GEJA 4Y2DD 4H8VA 4HT1H 1GPOL 3FUFA 4P9ML 3DXAA 4K9EL 1SJHA 3KPRB 4MBOA 1QNIA 2B08A 5ALCH 1NBZB 4LLDB 4X6CB 4KUCD 4NO3B 4LSVH 3RA7H 3BP4A 1BP3B 5ADPL 1P7KA 3L3DB 2E9BA 3VXUE 4B41A 3OAUL 1WAAF 1XD0A 3LKSB 3D85B 1AHWA 5HHVL 3QZLA 1MREL 1UEYA 2G5RA 4I48A 4K3EH 4NAQA 4ZDHA 4APQA 2GHZA 4DGVH 4PRID 5FOJA 2F8IA 3WEAA 3BH8B 4BIKA 2NW3B 4WO4A 3BPOC 2P24B 3GT6A 4WY7H 2EE0A 1F8TL 1J9QA 4XMKL 1NDTA 1BVLA 4HUVA 2QTEA 4B9GA 1MFVA 1ADQH 2GAZA 3GXFA 2C9RA 1HXMB 3VSVA 1C16A 1CC3A 1QBMH 3EBGA 2AJXH 4I2XB 1CI5A 3EBIA 1FSKB 5INCA 2GT9B 2MTPA 1MF2L 5I6PA 4B3VA 2AV7B 1WBYB 3NCWA 3VJ6A 2R1WB 1NDGA 1W15A 3VH8B 2I07B 4K73A 3K1DA 3NSXA 4FFZH 5I6XC 3OLEA 5GRVK 3C09C 1G0YR 1MRCH 2Q20A 2ICWA 2O5ZL 4JAMB 3WKQA 4YEEA 5BMFH 3PGCB 4HIIB 3C5ZD 3NCMA 2DYPD 3DMMB 3OV6A 1RUQL 5DD5L 1QHPA 1W0VB 4J6IA 4Q2ZA 4CC0A 2Q76B 4HCGA 3C6SA 3O45B 3EO9L 1EO5A 2XQBL 4NJAH 3TTYA 3L95A 2PW2A 1R3JA 3ZRCC 3CZGA 2VQ1A 3GB7A 4YDJB 1J18A 4WI4A 2ZWZA 2VL4A 4OZHA 3ARDC 2VRKA 2CCWA 4HKJA 2NYYC 4PRPB 1CUOA 1TFPA 3Q8CA 1A66A 3MBEA 1O5PA 2X6VA 3P9MA 4JZJA 2GSIA 3HE7A 1WFTA 4FLQA 3NCEB 2ADFL 3V6FB 2FRGP 1CGTA 3KXFE 3ZO0A 1WUZA 5T1KA 3KBHE 4TLUA 5I71C 3B8YA 5CN1A 5GZNA 4K5LA 3UZVA 4Y9CA 1SFDA 2R1XA 3AG3B 1SNRA 4M7ZB 2O5XL 4UQ3A 2FX7L 3K72B 5EZOH 4B9KC 3U7YH 1OLLA 1AY1L 1ZWIA 4JFOA 5C3IA 3F8UB 4MQ7A 5FDYA 5KZCD 1WFIA 3BAEH 5C0JB 4DTGL 5EB9A 2ZNWA 4F24A 5KVEL 5GS1A 1XX9C 3PWPA 2OMVA 3ARWA 2E7CA 3MI6A 1CG9B 1KJVA 5D7LE 3MJ7B 3HJEA 5IVZB 2EVGA 3GNML 3S35H 1JERA 3O4LB 3OKKB 2JJVA 4IOSA 3X1EA 3EFFA 3W9EA 1B0IA 5KANG 3P30H 2W0LA 3A6CL 3FONB 4H26A 4P2OC 4L18A 1PKQA 3VFWB 4XCYA 2AJSH 3IU4L 3S3PA 1U93B 4LLUA 1EHAA 5LBSA 5I1GL 1SBSH 3FCTB 1LP9F 2BK8A 4I7ZC 3D25B 3WXWL 1F97A 2FSEB 4RRPM 1FVEA 2XWRA 2GHWB 4ZO8A 4MLIA 2FWUA 1D5IH 3M1BA 4UOW0 1JFHA 1I9JL 4OCSL 5GGRB 3EGDA 3NJFA 5JA8B 2E7HA 1JGDB 1S9WA 5FS5A 1U8PA 2V9RA 1FBIH 1Y7VA 4XTRC 2XYCA 2K9FB 4Y19D 1CICA 3KPSE 3DIDA 1OP3H 5K9QG 5LN8A 3S97C 5IBUB 2DMCA 3D48R 2Q3XA 3PHQA 2C3VB 4U3SA 1OQOA 3UFIA 3LJ3A 3NMEA 1XSOA 2HN7B 1UD3A 1E6OH 3QDGE 1WFJA 1EXHA 4ZAKA 4MDIB 4M4RB 1WE5A 3WFHA 2D4FA 4B27A 2I27N 2R1YB 2O61A 2EKJA 4OCRH 1XB6A 3QIBA 4HZLB 4HWZB 4G6KL 3JWNH 5ICUA 4PY8I 3LZRA 4AVHA 3P4OA 4BH7B 1JD9A 4Y16A 1B2YA 4APXA 1KXVC 3MRDB 4ANUA 4PGZA 1ECZA 4EDWH 3VYNA 4LQ1A 2XXFA 4JFFE 5ECJE 1KGCD 2XWBA 2HXAA 3S34L 3RGVA 1KGWA 1CLYL 5AVYB 4PJ9B 3G6JF 4BZ1H 1XGQA 2X4TA 2ILLA 3T0BA 1U91B 3MX0A 2EDEA 1MELA 4JG9A 4PREB 1DL7H 3QRLA 3LKOB 2QLVB 3RTQB 1BWMA 5BVJB 3V8OA 1YVLA 3NH7H 4NQCB 3L3GB 4NKQB 3ZYZA 4H1LG 1WJ3A 4GAYA 5ITFB 5EU3A 4L0ZA 3C5JB 3KWUA 2VDOL 2D3VA 3E80A 5F7EH 3TCTA 3X17A 3NTCL 2PCFA 3E2HC 4LB8A 2NY0D 3JWNC 2WTPA 4MQXD 1OAQL 2KMWA 1S78C 4XOAA 5MENB 5DD3H 1GW0A 2YFOA 3ZKSD 5D71L 3QFJA 1FZOA 3ZOAA 5TK2A 4NGHL 3T0EE 4BQBA 3DGGA 2CKBH 3F6IA 3E3QE 4F33B 1V7NL 5C0ND 3VXOA 1SQ2N 4YE4L 2X2IA 3NDYE 2YGQA 1BSIA 2QSVA 4LAJH 5IOKA 4MDRA 4FFVD 2XWEA 1GYUA 3CHOA 4P23D 1HNFA 1J8HE 1HL4A 2JK5B 4JHUA 4LLQB 2DKUA 2G0LA 3WO4C 1J0HA 5HHXL 3NIFF 4WJ5B 2FTAA 5FKAA 3MRRA 4ESKA 1CIDA 5D2LE 4BZ2A 1L3NA 3RZCA 2H9GA 4AMKL 1JUFB 1T7XA 3Q1EA 4GAJL 2PWFA 4LP4A 1KPRA 4YHIB 4K23H 3VD4A 3DO7A 1A2YB 3P0YH 3IYLW 1WYJA 4XMXA 5IBTL 1KEGH 4L4VB 1I8IA 2ERJB 3G5XB 3GSQB 4BWUA 3QORA 2XXMB 3D51A 3Q01A 4M29A 4OLXH 4GAGL 3WNNA 1MJ8L 3B2UC 1KTDB 3F04A 2Q8AL 1QSEB 5IROA 1YMMA 1DLHA 5ABDE 3V52H 4B96A 4M00A 5FGBA 5FYJD 5B8CA 3ROLB 1KTBA 1HCFX 1ZLDA 2IJ0C 5I66A 5IUSA 4FX5A 5DS1A 1F2XK 4P59H 4BHUI 2C3HA 1G7MA 3ARFA 3CVIL 4Y5XB 5JOPE 2WWOA 3OKEB 3V6ZA 2XN9A 3NSCA 2O6CA 2H5UA 3FRUB 1AXTH 1U30A 4EIBA 2VDOB 3LOWA 3MUY1 2NYZA 1SVCP 2BP8B 5I18L 4U31A 4N9GB 1EEZA 2EZ0C 2VSCA 4FOMA 4EOWL 2DWSA 1SJEA 4F9PA 4I1PA 1QO3B 2IAND 3OR6B 3HMXH 5ISZE 3LRSB 4K7PY 32C2B 4PS3A 1NMCC 2BSRB 4MKMA 3DVGA 2OZ4L 2KL6A 5FYKH 2WQSA 5D96C 5LQBL 1MIEH 2BDNH 2WP3O 3ESVF 4OSUL 3SO3B 4J5VA 5AW2B 1AZUA 1JDCA 5FW7A 1A3LL 1MCQA 3CPLA 4HMEA 4YUEH 3G6JB 5TGBA 5E1HB 1HH9B 2EIKB 2D4DA 4ZRGA 5EFIA 4JPWL 1AZCA 3N3EA 4FULA 4K71B 1A14L 4OLWL 1D6VL 1KDJA 4RIRB 4N8CH 3Q6GL 4WUUA 4BCYA 1QAWA 4PRBA 5I9QC 1T6BX 3UTTD 1XVSA 2P7TB 3VWKA 1BZDA 1ES0B 1USQA 1XCQA 2YEVB 5KSAC 4M03A 5ABAA 2WBJB 2F1BA 4FDWA 5F93C 2PCXA 2XV3A 3TH4T 2BNUB 4Y2OA 1OARH 3RFZB 1NAML 4AEIL 6CGTA 3KLHC 3FFDA 4DPCX 3KDMB 4G6ML 4MNQB 2Z92A 1CD1B 4PJDA 5L4JA 3QNYB 3GBMH 4J3OG 4Y4FB 5J12B 4V1DE 5H94A 5HGBA 5I74B 4QRPB 5EN2A 2EDJA 5F1NB 2W9LA 5F9DC 3SQBA 1ORSB 3SKUD 3QFGA 2VDQB 1KBGH 4IKIA 1N2RA 2IMNA 5BO1L 1XGYH 1EUTA 4AL8L 4U1JB 3W1ZA 1U8JA 1DBBL 1HQRA 4AENB 1JGUH 5CSGA 3AM8A 5F96H