1AIZA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
b'AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport(cadmium binding)
total genus 31
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aizA00
3NSDA 2PCFA 3EH5B 2VMJA 2MRYA 2NRDA 5I5IA 1CYXA 1PAZA 1X9UA 5B7FA 1JVOA 1OCCB 5B7EA 2LLNA 3FPXA 2X87A 2W88A 3CDZA 3FYEB 1OCOB 5PAZA 1KYAA 1PZBA 7PCYA 2YAHA 4HZ1A 1KGYE 1NIBA 2CAKA 2IWEA 2YAEA 1NIFA 3OMAB 1SJMA 3GDCA 3ASNB 4AKOA 3AG4B 5E9NA 5TK2A 2FT6A 4A68A 3GYRA 4FA7B 2HX8A 1JZFA 4YL4A 2VSMB 3N2JA 1SHXA 2IDFA 2PPEA 3SBPA 1JXGA 3S3CB 2GC4C 3OD3A 5D4JA 4M3HA 4BXVA 1SDDA 3NJFA 1XB6A 2BZ7A 1CURA 1AZUA 3CVCA 3QQXA 1PMYA 4YSTA 3X1EA 1J9TA 2J56A 1OE2A 3UAAA 4E9QA 2CUAA 1GSKA 3BVDB 2YAQA 2TSBA 3EH4B 4BDVB 1WA0X 2EINB 1JZIA 3DTUB 2IAAC 7PAZA 1X9RA 3UGEA 1GR7A 3FQYA 4G71B 1PF3A 3PAZA 5B1KA 4EF3A 2YAFA 8PAZA 4QKTA 1MZZA 2BP8B 1TU2A 2JXMA 1V10A 2PPFA 2XV2A 4KO7A 3QPKA 1NPNA 4L0PB 5A7EA 1AQ8A 4HCGA 1WA1X 3X2QB 3NJGA 1NINA 1PNDA 2CJ3A 1DYZA 4HALA 1FWXA 5I6PA 1ZIAA 3TBBA 2XVBA 2R7EB 4A67A 1JZJA 2UXFA 1AZCA 4NERA 1FFTB 4DP7X 1L9TA 1GS7A 1L9SA 1ASQA 4JKNA 5F7BA 3T6XA 1KDIA 1XMEB 4A2DA 1IBYA 1F56A 4PAZA 4KOCA 1PLBA 3FYIB 1PLCA 1CC3A 2AZUA 2FQFA 1AANA 1BXAA 1XB8A 5TK4A 3NT0A 5B3SB 2ZXWB 1IKOP 2DYSB 1KCWA 4DP1X 2VW4A 1SFDA 4HIPA 3QJQB 1W6LA 3MBWB 5ANHA 3KW8A 1ET7A 4KNUA 4A2HA 3X1NA 4YSPA 4W9ZA 5LDUA 2J55A 3SBQA 1KBVA 4BXSV 2JFCA 4AI7A 2BP0B 2XUWA 1JOIA 3NJJA 4A2EA 1YLBB 4GY4A 2J57A 1V54B 4DPCX 2PP8A 1TKWA 3FU7A 2IDQA 5AZUA 2QDWA 4PCYA 4F2EA 2B08A 3WI9A 5I6MA 4NAJA 1OCRB 3IN0A 5IY5B 2TSAA 2VSKB 4AZUA 3G5WA 1IC0A 1MG2C 4G7SB 2XV3A 4W1TA 1OV8A 3AG2B 3OMIB 3MX0B 1L9QA 4AKPA 4N8UA 3CVDA 3QJSB 1HFUA 1RZPA 4Q8BA 1IBZA 4A66A 1MZYA 3WIAA 2J5WA 1BQKA 4YSCA 2GIMA 2QPDB 1GY1A 2XWZA 4CSZA 3HEIB 3T71A 3N55A 1KBWA 4E9TA 5D4HA 1PY0A 3FT0A 4GXFA 2FT7A 2GB2A 4GP5B 1OOWA 1GS6X 2HX9A 3CVBA 2IH9A 5AKRA 1I53A 1WS8A 1W6WA 2PLTA 3U25A 4DPBX 4GP8B 4QLWA 1JXDA 2B3IA 1HAUA 2QDVA 3EH3B 3T9WA 1E30A 1RCYA 2VM3A 2W8CA 3TA4D 3ASOB 4N4YB 4NB7A 5I26A 3FSAA 3WNIA 3UADA 4P5RA 2FWLB 3S8FB 1URIA 2YARA 4ENZA 1JVLA 1NIAA 1A8ZA 2DYRB 3GXUB 1ASOA 2P80D 4UF7C 5B1JC 3FSZA 4HHGA 2YAOA 4M4RB 3IBOA 4YSQA 2VN3A 1A4BA 2BHFA 2DV6A 1XB3A 4UANA 4AKQA 1FA4A 2AFNA 3S3DB 1AG6A 2MTAA 4WTQA 2H3XC 5D4IA 1NTDA 3EF4A 1B3IA 4HAKA 3H56A 3JTBA 3AG1B 3FU7B 3NJHA 2UX7A 9PCYA 1WA2X 3H4HA 1KV7A 4K9JA 2XX1A 3PXLA 3V9CA 1SHWA 1GY2A 2ZOOA 3NSFA 4ZK8A 3TU6A 2QT6A 3NJLA 4E9YA 5I5MA 1JERA 3QJVB 4F2FA 2HLEB 3T6ZA 1L9PA 1RZQA 4DP6X 2WO3B 3PPSA 4DP9X 3NP4A 3X1BA 1AR1B 2PP9A 2XV0A 3ABLB 4A2FA 3ERXA 3TASA 1AZRA 2FQEA 3FU9A 2PCYA 3QJTB 1NIEA 1AS6A 1QHQA 3OMNB 4MFHA 3CDZB 4G7RB 3S3BB 2OJ1A 1ADWA 2VW7A 4DP2X 5B1JA 1BYPA 4BWUA 2P80A 1BQRA 4WKXA 3T6WA 3WKQA 3JT2A 1AOZA 1N68A 1TEGA 2FJSA 3ZBMA 4BDVA 1JZGA 2IDSA 2RACA 2PPAA 4F7KA 2XU9A 4KO5A 2YXWA 4KNTA 5I6KA 2JKWA 3ZX1A 4E9WA 3T6VA 1L9OA 1SDDB 4YSAA 1J9QA 2BP8A 3PLYA 6PAZA 1MDAA 1BQ5A 4DP5X 4YSRA 3KW7A 3WG7B 2YAPA 4YVUA 3AW5A 3EHBB 2AVFA 1PZCA 2HRGA 3AZUA 4YVNA 2R7EA 2GI0A 3IE9A 2EIJB 1OE1A 2IWFA 4DP8X 4UAHA 4G7QB 5F7AA 2I85A 1QNIA 1WS7A 3ABGA 4P5SA 3TBCA 2OV0A 2AANA 1AS7A 1BEXA 1NICA 4JHVA 1ASPA 4JHUA 3PCYA 4BK5C 2UX6A 2H47C 3FS9A 1NWOA 1OF0A 4YSUA 4BWWA 2E86A 4DP4X 4FAAB 2OCCB 2CBPA 4X4KA 1M9WA 2XXFA 1KDJA 5AFAA 2FNWA 3S8GB 1UATA 2CALA 5I6LA 3NYKA 3NSYA 2BW5A 4E9RA 2IWKA 2GSMB 1QLEB 3WNJA 3IEAA 3NJIA 2VW6A 1L9RA 2YQBA 1A65A 2DY2A 5B1BB 1PLAA 2FQGA 1DZ0A 2HXAA 1GYCA 3OQRA 2Q5BA 3AG3B 2BP0A 4KO9A 2XX0A 1AACA 2CCWA 3NSCA 3H4FA 1J5CA 1J5DA 3FPYA 5FC9A 3D12B 2FTAA 1JXFA 2GHZA 4HCFA 2EIKB 3PAVA 1ZDQA 4YSSA 1ZPUA 3AY2A 4E9VA 2AZAA 3ZDWA 2HZHA 1TEFA 3WKPA 3NJNA 2N0MA 1JZEA 1PNCA 1A4AA 2IDTA 1EZLA 2IH8A 4YSDA 3UABA 1ILSA 2I7OA 3UACA 4Q89A 3HB3B 4CSPA 2UXTA 1A4CA 2PPDA 2VM4A 2XLLA 2X88A 3DKHA 3CZUB 3FU8A 1IUZA 1NDTA 3PAUA 1JZHA 2I7SA 4GYBA 1CYWA 1SF5A 4KOBA 3IN2A 1T5KA 4HHWA 3V9EA 2Y69B 2GC7C 2PPCA 1MG3C 1AZNA 2HX7A 3FQ1A 2BZCA 1OE3A 1J9SA 4GP4B 4KNSA 5I6OA 2FT8A 1E5ZA 5I5JA 3BQVA 2BO0A 1E5YA 1PCSA 2FQDA 1M56B 2BWDA 1VLXA 2WO2B 3UAEA 2DWTA 5B1AB 4HCIA 2EILB 1E65A 1ETJA 1SNRA 1BXUA 3SQRA 1SF3A 3FSVA 3ZIYA 1W8EA 1NPJA 1CUOA 2WSDA 2XYBA 1GS8A 3ABMB 3X1FA 3FSWA 2HRHA 2IDUA 2Q9OA 4E9XA 3C75A 1OCZB 3RYMA 1M57B 2Y1AA 4KO6A 5B7MA 1ZV2A 2EIMB 3QJUB 1WAEA 2YAMA 3QJRB 3FQ2A 1AAJA 1A3ZA 1N70A 1SFHA 4DPAX 1BAWA 2XXGA 3DIVA 1NWPA 2ZONA 1HAWA 1V55B 1E67A 1ET8A 1BYOA 4YSEA 1ZDSA 2DWSA 3L45A 5EHFA 1AIZA 2YXVA 3SBRA 4E9SA 6PCYA 1EHKB 4RH4A 2QPEB 1AZBA 1NIDA 4YSOA 1PZAA 1ID2A 4AX3A 3NJMA 1KCBA 2ZWNA 3NJKA 2H5UA 2A3TA 1R1CA 2GBAA 1BXVA 1J9RA 1RKRA 3CG8A 3NP3A 1ILUA 1GW0A 2BWIA 2UXVA 2PP7A 1AS8A 1ZIBA 4DP0X 2UXGA 3ABKB 1NZRA 4A2GA 1AG0A 3X1GA 1ET5A 5PCYA 5I28A 4G70B 5I6NA 2BW4A 4TXVB 4BWTA 3OM3B 4G72B
chains in the Genus database with same CATH superfamily
3D4CA 3NSDA 4I85A 4PBXA 4EI5A 3WNPA 1NCWH 1P1VA 3MLUH 2Z7UA 4C8XA 4TQIA 1MF2H 5J06A 5ICXB 5FYJH 3OLEA 1M3IA 1UXWB 3VSTA 4Y16D 4L4TE 4IRZL 3MLPA 2G3ZA 3ZTEA 2KZ1B 3D07A 3DI2B 3GUFA 4RAVB 2YWYA 3JWOH 5F9AC 3MV7B 4DEUA 3U30C 1XIWA 3KLAB 5BZXA 3Q2NA 3AG4B 2E7MA 1MIMH 4PJEB 4NZFA 3TH4T 3RA7H 3RWJA 1LM8V 3HNVL 2FDBP 4GSDH 4HX1A 2X38A 1MFCL 3H85A 1RZFH 5IESH 2YZ1A 4M6NL 5BNXD 4AY0A 1INQB 3QRBA 4JLRB 4KI5F 3M1OA 4DTGH 2K4AA 2YJQA 1XH2A 3CFBB 3KAAA 2EKSA 1WH0A 5AW7B 5JHDE 1OAKL 1H8NA 3SDDD 3R1GH 3IF1B 4E9QA 5ILTH 2WQXA 3PREA 4R84A 5E95B 2LGNA 2QSVA 2PYEA 3VI3F 4ONHB 4RZCA 5EULV 5EU5A 1PD6A 3P4OA 5AW1B 4R9HA 5AAWA 4NX0A 4L8BB 1IGIL 5AG9A 2DM2A 3VO0A 1PF3A 2CBMA 4ICXA 2FJGB 2XWJA 4Y4HA 1CFVH 3FUKA 4TYUA 3E8VA 4NQQA 1FRGH 5C2BL 1BG1A 2WXOA 1J0JA 1FFNA 1T2XA 2LLLA 2QSTA 3BXNA 5TDNA 3QUML 4Y5XA 1NEZG 1NINA 2B0SH 1UB5B 1XVSA 2CO1A 3QFDA 1FWXA 4PJGB 1A7QH 1HH6B 5D2NB 3VM7A 1Q9WA 1QKZH 2WXNA 2XQYG 2OAAA 3BAYA 1QZ1A 3O9WD 3VG9B 4MMZA 2QKSA 2ZUUA 1N6VA 3MLWH 2ZYHA 2AQ1A 1MRCL 3NN8B 4NNYA 4OCXH 4WW1B 3P0GB 1GZQB 3KPOB 4PRIE 4WW2C 1IBYA 4DAGL 1ZVYA 2HVKA 1LEKA 1WITA 2CMRL 3FK3A 4RSYA 2VDMB 3ZE1F 3S36H 3AU1A 3CPLA 1CC3A 2ADJB 2F5AH 1N67A 1A6AB 4PBWD 3RZCD 1TITA 1R3HB 4S1SH 1BX2B 1IAIM 2N7AA 2WUCL 4PJ5B 3TIEB 2XIDA 3LNHA 1RZJH 3ARXA 4MDJA 3SYPA 1RURL 3I3EA 3OZ9H 3K71B 3EG9B 2O5YL 2Y22A 4D3CH 3GC3A 3KPMB 3DSNB 3ARRA 2UZYA 2Z31D 3R06A 1ZPLA 4M00A 5TTRA 4P2QB 1PKOA 2OMNA 2VC2B 3EJCA 4HEPG 2FO4B 1JFHA 4XMKL 1XCTB 3QFGA 3ROLB 4ZSOA 4Z7QE 5KN5A 2PP8A 4X7DC 3FU7A 3QUZB 4XVUD 1IVLA 3N1PC 2BDNH 1P5UA 5MEQB 2D7QA 2Z91A 1YEDA 1RPQA 3OGCB 3DTDA 5BOPA 2D2OA 5IBTL 4Y89A 5FXCH 3RVXD 2VSKB 4BH8A 2D9CA 4G7SB 5G2NA 5ESVB 2DL9A 3M1BA 1AFVH 4H8PA 1BGXH 1NBVL 1IJNA 3NA4A 1RJLA 4D8PA 5KZCD 5C0DA 3DX1A 4HJIA 3STLA 2A4CA 2ZNXA 2DQDL 3CVDA 3IAQA 4E0RB 4TQPA 3B8SA 4PRHE 2FLMA 3DO7A 4F8LA 4A66A 3WIAA 3KYKH 3OSVA 2C1PB 4HMCA 3K2UL 2HWZL 1HWHB 3UPAA 2NUPB 4AMKH 3WO4C 1OL0A 2I60L 2QFRA 2ZG3A 3UTQB 4FXGA 4AIEA 4W9LC 2IAMC 2FGWH 1GS6X 4MKTA 2V2XA 2VLMD 4JEGB 1JWUB 3OAWA 1J7VR 4PRDA 4PGCA 3G5XB 2XXCB 4I3RH 4K7FB 4UQ2B 4NHCL 2X6CA 4QXUL 1EJOH 1J1PH 2EYTA 1IM3A 5KVFE 1ETA1 1LO4L 2P48B 2LAGB 1C8PA 3WL9B 1RIUH 3VWKA 3HLAA 3TA4D 1OAXL 1W0YT 4EJ1C 2IEPA 3APMA 1CGYA 1MDTA 5AW4B 4F5CA 1YNLL 2QQLH 4DCQB 4ATWA 4BH7A 4EI0A 2WYTA 4ENZA 4AUYA 1JVLA 3MLSL 3KLSA 2X89A 2X2YA 3B5TA 2CQVA 2EDKA 1AXSB 4N90D 3T8VA 2E46A 3SCMB 1JPTH 5AVWB 4KZDL 2W5PA 2AV7A 5GS3A 4HHGA 4L3CA 3FH8A 1SXSA 2PN5A 4PB0L 1A4BA 1QRNE 2QKIB 1UZ6E 3DVNA 4YHNA 3FQWA 1N5AB 4E5XB 2BVOB 2Y36L 4PP2B 5IQLA 4JZOA 3MRGA 4W9HC 5IQMA 4YZFF 4FQCH 1CGXA 3HC0B 4WTZG 1KXVC 1A25A 3M07A 5E94A 1IM9D 3U9WA 1YEJH 3B56A 3NJXA 3IMBA 5FHBL 4KVCL 4Z3EA 1KV7A 4J3UA 4MCZA 2DJ4A 4J3BA 3TVMB 1FZMA 3T6ZA 5F88B 2BINA 1KYOJ 3C09B 4P59H 4YHOH 4PGEB 1QUPA 1ROCA 3BEWA 3GO1L 1TQWA 2ZXQA 2OPCA 4ILDA 1CE6B 5CJQH 5HHQB 3IU3B 3BH9A 4TLUA 3HI6H 3VGAC 5TGBA 3T2PA 1DSWA 1JD7A 2Z64C 4AYID 3EBIA 3D25B 3U6XA 2EACA 5IHUH 5KBLA 3FOLB 4XVJL 4NQXA 2I9LA 4LVNC 5ESQA 3KMDA 4OAWB 3K8LA 2FR4B 3HZKB 3U0TB 1S7VB 4HIHB 1FPTL 4HPHA 3NZ8B 4R2GC 3CSYB 1J0HA 4LSSL 4ZS7L 2HLFC 2V8MA 1I3GL 1HHIA 1RK0A 5F72S 3F83A 4BDVA 3K6SB 3EXJA 1D2OA 2CIKA 4HJGA 3C6LA 4OD1L 4ABWA 3G6DH 2IDSA 4FFYH 4P2OB 4WWKB 2EZ0C 1JP5A 4YE4L 5D5MA 2ATKB 5B3JE 4JO5A 4TOYL 4Y2LA 4HQQH 2X1QA 5J0BA 5JQ6L 5GRYA 2G0LA 4G6FD 1VHPA 4N26A 5ERWB 5K39A 4ANVA 4EIZC 1BMZA 3KPNA 3PDOA 1TJIL 4PMEA 4QHUB 4ESKA 1Y0LA 1QPKA 2QHRL 3EZJB 3EGDB 1BD2A 3KCPB 3T4YB 2R27A 2HPOA 3TA3D 2E6QA 1ACYL 3AXLA 4P2AA 4HIXH 3POHA 2F08A 3BP7B 4YIQB 3MLXH 1TU2B 1WS7A 1G7LB 1FZJA 2OV0A 2WBJA 3SE4C 1D6VH 4HUWB 1A6WH 1XQ4A 1ZANL 3DTXA 5HHXH 5J8OA 4JHUA 4ZX3A 4E9LA 3T0BA 4RMVA 3D33A 3QEQA 3CU1A 3S3PA 1GOHA 2FO8A 5JIMA 3X11A 2EYSA 3U0PA 4HUNB 2E86A 2R69A 4PMFA 1IKFL 4FYTA 4F33B 1YMMD 4XNYL 4I0PA 4ZMAT 2V5MA 5GGTL 3GPEA 3KWXA 4ALAH 1VFBB 3BI9X 1HEHC 3WTYA 3EBGA 1KELL 2F8VA 3PHQB 2XZCH 5JXAL 3NAAL 3NJIA 4HWNA 1WTLA 4G8GA 2Q8BL 1A65A 3CZNA 4AEFA 3BP6B 1DZ0A 2VXVH 4P5TC 3I6SA 3QZPA 1QSFE 2AAVA 1R3KA 4IRSA 1XV8A 3L3GA 4HIIB 4PJXB 2HT4D 4KHTL 4GO8A 1IGFH 3FUIA 1P7BA 2DQHL 2HG5B 1H3PH 3NDZE 5DRZB 1TQCB 1OTSD 3RNQB 3PHOA 4HCRL 4MD0B 4TSBH 3C12A 1JGEA 2KS0A 3ZK0A 4B53A 4TNEA 5E8PB 3PWLA 2EE0A 1A1OA 4NKDB 4O5LH 1IEBA 3GMOB 3V55A 2JI1A 3X14A 1U8PB 5DA4A 2IH8A 4YSDA 1BZDA 4OQTH 4EDXA 4Y1AD 1QQDA 1C5DA 8FABB 1MFBL 1WBXB 1S3KL 2K78A 4XVSL 2NSXA 4Y5VA 4ZZFA 3M8OL 3KXFB 1H5BA 2N7SA 1KJ2B 2QSCL 3OKYA 5AVRB 3ULVL 3OV6A 2NLJB 5JOPD 5DD1L 4PJCF 5DO2D 1M1SA 5J13B 3ZTCC 4CW1A 2XWXA 1E7VA 4MSWA 1LXMA 1RUML 2Z7YA 2ZQKA 1DCEA 2CRYA 1XF5B 4CMHC 5C97A 5I1LA 2D7PA 2IQAA 3AWEA 5C70A 5SX5H 1E5YA 1S7QA 2OMTA 3MO1A 4MXWL 4PYHA 4ZW5A 2FJFA 3QRGL 4LCIH 2DKUA 2K8QA 3BAIA 3EJZD 2D7NA 2YMOA 3VTMA 5HGDA 2PW2B 2ZUQC 1SNRA 2NX5D 3ECWA 4XBEH 4KRPC 3O3DA 5HJ3B 2XBTA 3BKCL 3VXUD 4DKEH 2YA1A 3L95A 1U8QA 3RDTD 3VFMA 4KKZA 3N5AA 2ZG2A 2J1ZA 3K91A 5D7EA 4NC1E 1FNGA 3J7HA 1FGNH 3E1ZA 5EN2B 2ZXDA 1DFBL 1URZA 4NRXB 2X1PA 5DQDH 3V5HB 3K6OA 3PWJB 4PS7A 1H6FA 2XBZA 2B59B 4GI6A 3B83A 4OZHA 4Z0BH 2CRIA 3IGLA 5BW7A 1E7UA 1NCHA 4DVRH 4NFCA 1IC7L 1BA9A 4P23A 2EE2A 3ME0A 3BWAA 3RI5F 4AV0A 2I5YL 3JYBA 4GW5A 1D9KA 1EAPA 4NDMB 3KD4A 1BBJA 1YN6A 4LLVB 1M6OA 4FJ6A 1L7TH 2KERA 4DKTA 1ONQB 3ZVVA 2CO6B 3NIFB 4FFZL 3DYOA 2ED9A 2DTMH 2R29H 4X80L 4F8OA 2X7LB 1CXIA 5L4MA 2Z7ZA 4XPHL 3K5SA 2VQUA 2XV6B 3I9GH 4FGMA 1WP6A 3ZTJH 4ELDA 1Q9OA 4WEBH 3MGOB 1WHOA 5ENWB 1XSJA 4X83A 3NP3A 5DURD 3NRPA 1AD9A 4H0HB 2J8UB 2BMKB 2HH0H 5JPMA 3U9PH 2H3KA 1CFVL 4DP0X 1KULA 2VZ1A 1WCQA 3QDGB 4UQ3A 4RISL 5KVMC 3EHBD 3QPXH 4P46D 4IU2A 1UOVA 1ZMYA 4PG9B 3FF7A 2OI9C 2WCSA 4GFTB 4UIKL 5ALCH 3C87A 4B0MB 4BFKA 4CMMB 4Z7WA 3DGCR 5I5IA 2FWSA 2X4PB 2UWEE 1IGCL 1BDYA 3L3DA 1WF5A 3TZVC 2IFGA 1ZSHA 5EU7C 5T1KB 3DRTA 3RWDB 5PAZA 4KZCA 5J56B 2SEBB 1TTUA 2Q7YA 1QSZA 2VXUL 1LO5B 2DMHA 3T0DA 3WIFB 4YDIH 3ZRFC 5LWYH 5I8EB 2PXYB 3ECVA 3CMGA 1SJMA 3NTCH 3VFPB 3E6HB 5KANI 3NDYE 4GAJL 2NNAB 3OJVC 4IBQA 5J1TC 3FSOA 1S9VB 4J2XA 3K80A 1ICTA 4EKJA 2IDFA 1HIMH 2YRPA 3GBML 4H8WH 1IB5A 4NPJA 2XIIA 4PI2A 2W9EH 4ODTH 4RGOH 2Y23A 4TKWA 4YLQT 5D4JA 3CK0H 4ZTPH 5IVOA 3CPUA 4WHCA 2BZ7A 1CI3M 1CURA 2ROXA 1JZ6A 1CJYA 3QH3A 1JGIA 2Y07H 1ZGLM 4MD5A 2GJ6A 3TESA 4XNXL 1ES0A 2XTJE 3JVGA 1DQDH 2J21A 4W9IC 4F58H 5E2UH 4XCYA 5FA4A 1KV3A 4PJ9D 1HOCA 2J4WL 5JDJA 1HSBB 2P44B 5JZ7D 1MWOA 4NT6B 1SEBA 4UM8B 3R19A 1MCHA 4R97C 4UINL 4HGKC 1IJ9A 1KNOB 1QPXA 2OTUA 4XPBL 2AKRA 4FHBD 2K45A 2LU3A 3U1PA 4DEPC 8PAZA 2G60H 1T83A 5FYLD 2AABH 5ACMA 5JMRA 2XV2A 3JYCA 4KO7A 5I18H 4YH6A 5HDLA 2WNKA 3AMLA 4LRIA 4FQIL 2JB5L 3FO0L 4Z7UB 1PNDA 1FFPA 4JFDD 2GEEA 4HLZG 3ATBA 3H2WA 4DEWA 3WTSA 3QA3A 4H20L 5DZPA 4M8VA 1ZLSL 4O58H 2XIBA 2WVUA 2DLFL 1A1NA 1SJHA 1XTMA 4Z5RB 1JF5A 3PGCA 5C8JA 5D1XB 3I6LE 3KYKL 4JY5L 1U93A 3BLPX 2DDQL 3IGFA 2VXSH 1BZ9A 4RX4D 4A39A 1G7QB 1TCMA 4UOW1 1AXTL 1J8HD 4JM2D 4QRPB 2EC9T 1FNLA 4OM0H 4OUUB 1XB8A 3AT9A 2HVJB 4Y19A 2MCAA 4ODWB 1FHGA 2YOCA 2IANE 1SFDA 3PY9A 4KKRA 2CLRA 4KTDL 1AO7D 1J1PL 1JRHH 1RSYA 2YPLA 2IPKB 4JO8A 4XCFL 5F0LB 3LKQA 3MJ7A 4XZUB 1VIWA 4KNUA 1IGTB 1DP0A 5HYEA 2D73A 1NLDL 3RL2B 3K4AA 3SDAC 4LDLB 5DZOA 3SKJH 5I8OL 3IMUA 4HJJL 4Z77A 3QG7H 3B6SB 2VISB 1JZ4A 1RUQL 4KKPA 1YYLL 1HJCA 3WNMA 2UWEB 1D5RA 3EFOA 2FBOJ 5B4MD 1MCSA 3FBQA 3Q8FA 2DQTH 1OAJA 1LO0L 5EZJB 3ESNA 3H6AA 4LBEA 4CVZB 4DFHA 3U1SL 1F1GA 4MYPA 1K4CA 1SDYA 2HAZA 3RVVD 4AXWA 4HWBH 1U36A 3H2QA 5B38G 1NCAL 1DVFD 3AG2B 3TO4A 2GTWA 2IG2H 4XNBA 4ZDHB 3RILA 4KROB 1SOSA 1ZE3C 1W0WA 3FO1B 2NNRA 4ODBD 3QG6B 1BVOA 3BH8A 5FA3A 3QEGL 4KJPC 2BHUA 4QT5A 2ADGA 1EJ6A 2AI0H 4HYTB 3SY6A 1MCCA 1RZ7H 3CC5B 3WE6A 5C6TL 1MRFH 3MV8D 1RMFL 2JCCE 2VXTH 1C5CH 5GGSB 4OCSH 4O2FA 4Z7NE 2ED6A 1F4YH 3FN9A 4CC1A 5D2LE 1NCDL 1QD0A 2HVBA 2BX5A 4UT9H 1ZKAA 3FCSA 2O5ZL 1KTBA 2CLVB 4WUUA 2YA2A 1ETZA 2WZPA 3TJEH 4RIRA 5EIQA 1YJDH 4OZGF 4N1EA 3DXAD 3BUIA 3H9HA 5J1AB 4NGHH 3LPGA 5FYKE 3QZLA 2X1WL 2DWEA 2R8SL 3RTQB 4JQIL 4XCCL 2GT9A 3IXTB 5GGRY 5DUPH 2BJML 3VFUB 3CSFA 2OTPA 3Q6FB 1R5WA 4HIJA 4F7MB 2CR3A 1I1YB 3N42F 4PJ7B 3CU7A 5JO5B 3WAJA 2G3MA 2X9XA 1SOXA 3SD5A 1P84J 5IJVA 3P0VH 4G6MH 4TVPH 3HRZB 4I88A 4WO4A 4N9GB 3OX8B 1R3JA 1UM5H 4U1LB 2P80D 2AJVL 3SQOH 1F00I 2D8KA 4HJSA 1UENA 1LD9A 2WCGA 5J3HC 2NTSP 3LNEA 2EVJA 4XE0A 4KZ0A 2PO6C 5LJYH 1UJ3C 1T0NB 1JF1A 3WTWA 3FRPG 1YQ2A 2VLKA 4YR6A 4F7CB 4OTXL 3PWVB 3RY6A 1ZK5A 1NDGB 4NN7C 2C9QA 5AAMA 3MBXL 1UOLA 2JVUA 3H9SB 2NW3B 3SQBB 3CLFL 4PWEA 2KDGA 3C2AL 4L4VA 5GGUB 2A0LC 4JFEE 4BEIA 4B97A 5EC1B 4RAVA 2IALB 4BZYA 4DP6X 5GGRB 5B39A 3W57A 3KLAA 3CTTA 1I1FB 3L5XL 3ARBD 3SDXB 4EXPX 3HHRB 2NYZA 3VFOA 4MXVF 1NIEA 5HHOB 1N7MH 4FQXA 1INQA 5LVEA 5T8IA 3WEBA 1NMBL 1CLZH 1U8JA 2ZKXA 2MIZA 3SJVE 4PYGA 1NFDA 4HULB 1KLGB 5HPOA 1OAQH 4K3DL 4GLRI 3ILPB 4ZT1A 4JKPL 1MJUL 3T6WA 3IF1A 3UOAB 3U82B 2Z35B 1MLCB 1DTUA 1CDIA 4KDTC 3WBDA 1PFOA 4LLDB 4X0NA 3UMNA 3BO8B 3IM1A 3NCJL 3S0PA 2VRKA 4L8BA 1TQUA 2X09A 5D96B 4KO5A 5C08E 3VSUA 3UBXB 5HD8D 4Q7DA 1E4WL 1R34A 2J2ZB 2ZXAA 2FJGA 2PWHA 4FL4C 3ILEA 4GRWB 1J9QA 3UYOD 3GDBA 1CZ8H 1CGUA 1QHOA 4HFUH 4PB9L 3SPVB 4TSBL 1YEGL 4LSQH 4Q0XL 5ESAB 2YAPA 3NIDB 3KYOB 4LOVA 4BCXA 3E7JA 4KUCF 1UB5A 1WIPA 4PJGA 4E42B 1FHNA 2HRGA 2ZCLH 4KHXL 3Q13A 5I19H 2IPTH 3RVTD 3IYLW 5A2JH 3HG1B 1MPAH 1BEYL 5KSUB 2C5DC 1CWVA 1IC5H 3L9BA 5DRXB 2IGLA 1O6SB 2V7HB 3A4DA 4KNQA 3FTYA 1QLEL 2AK4D 3CBJB 3ZL2A 1GZQA 1MJJB 5KYXB 3K4DA 2ODHA 1U6AH 4ZYKA 1UWGL 2V3FA 2PWFA 2XYCA 1C08A 4JO2H 2ADJA 5IBUB 4OLZL 1S8DA 2X4NB 3GSVA 4OZIB 4PCTA 5JW4Q 2NY5C 5F89A 1BX2A 3BUDA 5E9DD 5C07B 4TPRH 2VT0A 4FABH 3OKMB 4PJ5A 4PJDE 4CILA 1L6PA 4YQXH 2AQNA 5BRQA 1Y18B 2N0KA 3K71A 4H40A 3NACH 4UOZA 2YQBA 3G5ZA 4L5FH 5CLTA 4C59B 4ANUA 4DO4A 4F7EB 1CDBA 3KPMA 4Z3GA 1BIHA 1Q72L 5C0FB 2CO3A 2J6EL 2HXAA 2DIJA 2P5WD 3UAJD 2JJSA 2X4OB 2YEVB 2YOAA 3IDUA 1JS4A 4A7TA 2FO4A 2VDNB 3ROLA 1XCTA 5BS0B 1J5CA 1A4JA 3LTVA 1ZTMA 3QUZA 2X3AA 2EEBA 3DX6B 2XZQH 2FEJA 2COQA 3D30A 3PAVA 4L4TA 3P2BA 3T3PB 1R5IB 3V0EA 3OGCA 3JV6B 1A47A 4NHUB 3QQ9C 3JBG7 4XNMA 4Y2DC 1TTCA 3UTTD 3UBXI 4DVBA 2YKKA 1HCVA 1S9YB 1A4AA 2IXQB 3FQNB 5ESVA 1B88A 4WI4A 1DVSA 4URKA 1ZAGA 1T6WA 4PJBF 3WLWD 1BM3H 3WUZA 5L2KD 3RDJA 4FG0A 2PTVA 2ARJQ 5FYJE 3L9EA 4U3CA 3SE3C 2O61B 5GGVH 4HS6B 1CTNA 1CYWA 4UQ9A 3IN2A 1QTPA 3PNWA 4PG2A 1AZNA 3LRSB 4XC3H 2NY4C 3AC0A 1FLTX 4K7PX 4X8JB 1N18A 5JHDA 1F6LL 3UTQA 1R5VB 3CWGA 4V1DB 5I6OA 1SBSL 1C9SA 5IGXH 3C60C 2MH4A 1PD1A 3DUSA 5DQJB 4ZFOB 2CLZB 4Z3JA 4ZXBA 1HKFA 2C34A 3G5XA 4ZO7A 3SKNB 4UQ2A 3UAEA 3BSGA 4NBXB 1HT6A 4HCIA 4LXFA 2DIEA 2DQMA 4ZUUB 4FP8L 1AR1D 4NI6A 2Y2TA 3L1OH 2F54E 4Z3FA 4KQ0A 2ZKYA 4WU7B 1QATA 4FQJH 1JN6B 3DPBB 4I77L 5E8EB 1FIGL 2N7BA 5AZ2L 4DCQA 4K3JL 3QAQA 1MHEB 2H2SD 4KO6A 5GS0C 5K59F 3TWCL 1DBML 2R9HC 3QJUB 3FUNA 4YE0A 4KGJA 2WBWB 1AXSA 1USZA 3ZKSD 1N19A 4AM0B 1NWPA 2PCXA 3AY4A 4MRBA 3SCMA 4XHJC 4WO0A 3G6JF 3DSFL 1S9XB 4K5OA 5DS2A 1ZS8A 2DEWX 2O72A 3VD1A 4D0DB 1UGKA 2QKIA 1KXTB 1RZ8B 4UT7L 3BP4B 1I4FB 2ESVB 2BVOA 5I1HH 4PP2A 3W5NA 3G9AB 2HFTA 3UJIH 3HC0A 5EG6C 1DE4A 2G2NA 4RGNB 5IB4B 1OALA 1KCSL 5E2UL 2ORBL 3MBED 1HZLA 4MS6A 5FM5M 1BP3B 4LAQH 3APCA 1Z7JA 5F88A 5J6HA 4C56E 1ZHBA 2YRZA 5EEYA 3KR3L 3T1FA 4A2GA 1AG0A 4JRXD 1CE6A 1K5NB 5HHQA 4WSJA 3FJTA 5DC2A 2NRDA 1KCVH 1T2JA 2A9NL 3MRIB 3IDYB 3QZWA 3VB9A 4PD4J 2LLNA 1GMEA 4NUJA 2FIKB 3FOLA 4K3HA 2YFOA 2XWCA 4Y4KB 3U0WH 2AP2A 3L7FA 1BXXA 5HDQL 2H1XA 4JJHA 3U0TA 2FR4A 5C1MB 5J9PB 2EEAA 1YMHA 3NZ8A 4B9JA 3CSYA 3FT4A 4ENEC 3G5YB 4WFGD 2C1OA 5FPIA 1AY1L 1JPSL 2DWYA 1DZBA 3D09A 3VH8G 4AKOA 2IVFC 3QNXB 5E9NA 3IMVA 1UYWL 2VLLB 2W81C 2Z93B 3LQAH 4P99A 4FA7B 1BVKA 3K6SA 4EIBA 5HXMA 4P2OA 1J05B 3V4PL 2ATKA 2DI8A 3P4NB 2OR9H 3K2KA 1F5WA 3S3CB 1HYSC 1UQSB 1OK8A 4PRHA 3DK2A 4A1RA 4JFTA 1QFUH 4WFHE 5CP3A 4LIQE 3GBLA 5F96H 3QXUA 3TTYA 2MOVA 5ERWA 1E9OA 3TEXA 2ZE0A 4QAWA 5FHAH 4MA1C 3EBAA 3EH4B 5FWQA 3F64A 1HKLL 1A6ZB 1HU8A 1LVEA 1QW9A 1WFOA 2YGVA 2NY7H 3TYFB 5A6LA 2Y6SD 5F3BA 1FE8L 2XBDA 2AQTA 4Q6IB 4IKLA 3BP7A 3JZ7A 4YIQA 4GQ9L 4PRPB 2EVGA 1TU2A 3S37X 1G7LA 2JQMA 3OC5A 2NQ3A 4J3XA 5IFHH 3CXDL 4XP4H 4WTWA 3T1WA 4F57H 4RMSA 3V52H 5LDSA 5INCB 4JDZB 1XSKA 3GRWL 3PQYE 2E56A 2IQ9H 2EQDA 3ULUE 2BZDA 4L8SB 4EKXA 3LN5A 3QDJB 4JN2B 5FUOL 1VFBA 3P9MB 2DQUH 3G6AA 1CVRA 2NY6D 1ZTXL 3PHQA 2DLEA 3N43B 3ZE2E 3V6ZB 3O6FD 1THAA 2DIAA 4Y1TA 5IHLB 1QRNA 4M48H 4NM8H 5IR1B 1MCWM 3BP6A 4LKXB 4APQA 3EYVB 1AD0B 3MRNA 3ULVD 2O1AA 4AH2B 4N2IA 4HIIA 1O7DE 4PJXA 1HNGA 4HOMA 1GCYA 1XGYL 4F15B 3QZNA 4DP1X 2HG5A 3QQ3A 2ALWA 3DDFA 3M6DA 1W6LA 3AT8A 5DRZA 4YK4B 5F7HA 3RNQA 5E8PA 4AQ1C 1GW6A 1FVDB 3QPQC 1X7QB 3ZKXB 2Z0BA 1RP8A 2APSA 4X98A 1C1EH 3R4RA 4LVHC 5CU9A 4AI7A 1FFOA 4LCYB 3UO1H 8FABA 3LVTA 3PL6D 1WBXA 4F8QA 4LB8A 4Z7AA 1D5MB 1NC4D 2G5BB 3ZDXB 3T2LA 3FFOA 2DN7A 5SWSD 3W2DH 1DBAL 3N0PB 2YD7A 1AYOA 3SQOL 1BZ7B 3BWZA 1TG8A 3FB6A 3JV4B 4QD2E 3ZE0E 2B8OT 3UYPA 2NXZD 4R26L 4LARL 2AJZA 3IS1X 3VNYA 3EO9H 3HE6C 5AAWC 2MFNA 2EH8H 2VDLH 4JDTH 3CDGB 5L4IA 3NEOA 2VZVA 3MLTB 3RWEB 4I9WE 2LABA 4PJAE 2ZWSA 2PW2A 1BBDH 1T66C 3AXHA 4UQDA 3HMWL 3DBXB 2OS7A 4YSCA 3QORB 4PRAA 4ATTA 3JWNC 5GRJL 3S35X 5KJRL 1FLRL 3AQDA 1AC6A 5DR5H 1R17A 2B4CH 1GGBL 2ITDB 4QYOB 1IE5A 2H6PB 4NRXA 3LDBB 1RI8A 3PWJA 4NN6B 1WS8A 5D7KD 1Z9MA 4RGMC 3OJDB 4DKAA 3EH3B 3RX9A 3KGUA 3GNMH 1EDHA 2R2EA 5KSAB 1NAML 1U8OB 4J3WA 2CKBB 5EEXA 3TIDB 3GKZA 4NDMA 1QFWI 2CO6A 4K8RH 1SYSA 4GAFB 1AGDA 2X7LA 1G7MB 1NIAA 2J88H 4M8QB 3EGXB 3LXUX 4WI0B 5C09D 4PWJA 4BKLB 1E4XL 4UQAA 3MGOA 4M03A 2O5XL 5KVEL 4AT6A 4F3FB 2J8UA 4LCWB 3UG5A 4GQPH 2VN3A 3CUPB 3QDME 5E6IC 4PG9A 5EU4B 2F7OA 1L0YA 1AG6A 4O2EB 4XXWC 4QRAA 1CBVH 1NUNB 4N2LA 4HU2A 1J8RA 4JFHE 3QXDB 1WE5A 1MI5B 4HAKA 4HPYL 5K1JA 3EO1B 3AG1B 5JLZA 3A6CH 3GWJA 3RGVC 4LVEA 4ISVA 2ZSWA 3WY4A 2CDFB 1V3LA 2ZOOA 3TX4A 3UZEA 2SEBA 4IDLA 4PHZA 1BG9A 1IQWL 3AQYA 2WO3B 2OMVA 3C08H 2NY6B 1CF8L 3VFPA 2XV0A 3ABLB 2GVYA 3CQQA 1TXKA 3E6HA 3Q1SL 4OZFH 1PY9A 3L2LA 2MHAA 4JO1L 4NIKB 1S9VA 2R0WL 4PGJA 4D94A 2HG0A 2JJUA 1JXKA 3MRHB 1WCBB 1T89A 1YUHB 4K9EC 2D4DA 4Z7VF 3SY0B 5I1IL 1YNKL 4MLIA 1VCAA 4NFDA 1XXFC 1GOFA 3D3VE 4BWUA 3NPSC 1N5YL 3CBKB 1UWXH 3UERA 1W8NA 5D71H 3PWPB 4J3OH 4LLWA 2ZP8A 5LGHL 3F7VB 1KJVB 1KEMH 5JW5B 3BT2L 4LQFH 4NT6A 1UVQB 3LNFA 2YXWA 4B9FA 4BFFA 3BQUD 4UM8A 5HGBB 2JKWA 3S5LB 4F93B 2GQHA 3VTAA 3LZOA 3VWKC 3GSUA 5I76A 1JCKA 1GGIL 4LCUB 3WFBH 3TBTA 5DK2B 1QI4A 4Z95L 4XT1C 3KPQB 4ONOA 2N01B 1I7RA 2HT3D 4WF7A 2CJUH 4Z7UA 1A9BB 3QUYD 4LDOB 3KYNB 4KTYA 1DJHA 5H4ZA 1ZOXA 3PUUA 4BZ1A 1X7SA 2H3NA 3VYPA 4J3OG 1WSST 1YPZB 4LE8A 2WGXA 3HG5A 1QWUA 2F7PA 2GY5A 1NBQA 3EYSL 4Z5RA 3QIWB 4W9FC 4XWOD 1DUYB 1A3RH 4X5QA 2HJKB 2LLGA 5D1XA 1WRFA 3V6FB 1DJXA 4HISA 5BVPH 4MJHA 1KB9K 1WWAX 2DF3A 5FB8B 4QRPA 1S7SA 3ARFB 3KPSB 4OUUA 2HVJA 3QQDA 5I17B 2P28B 4ODWA 5H35A 4BKTC 3X12A 2G4EA 3KYMB 4GNKB 4JGNA 4FULA 1F4WH 2IWKA 2Y1ZA 2K7QA 3WNJA 1OSPL 4YX2L 3PU7A 4XZUA 4NQCD 5IMMA 1IGTA 3PV6B 3T3MF 2N1TE 4HJUA 4OI9A 1EVUA 3RL2A 1SXCA 1CICB 2F61A 3CZGA 4LLQB 1G7PB 1F4XH 1ROWA 2VISA 5EZLB 3WN5C 1D6EB 2G4GA 2UWEA 5KJ4A 3ZZQA 1HINL 3LPOA 2NXYB 2EIKB 1INDL 5K9QI 3B4NA 4LNRB 3OXRB 5EZJA 4QNPE 4N5EC 4CVZA 3ZDWA 4A7QA 3ARSA 1I9IL 3ZYZA 2IDTA 1BQUA 1XD1A 5FO2A 4ZDHA 3C6LC 3RVUC 1MFUA 2P49B 2PPDA 1E28A 4OF6A 3FO1A 4FNSA 2ZUVA 4MVBC 4H8VA 4GYBA 4HP5A 1L0PA 3S37L 3JWDC 4KOBA 3GLZA 2TRHA 4Z3TA 2DMKA 4I1PA 3R8QA 1CI5A 1ACCA 1MFEL 3DUUB 3DX7B 2O6CA 1YA5A 2Z8WC 4MGXA 3VDCA 4LP8A 1E5ZA 2BNQB 4KTEL 1BJ1J 1G7HB 1IEAA 1U3JA 1UHVA 1UD6A 5FW6A 2NDFA 1MCBA 4U1KA 4O51A 1S7UB 4EQ3A 5IVZB 5L8LB 2YLKA 3CLEL 4K2UH 5J1AA 1Q9LA 3HZYA 3SQRA 4NM4L 5E8DL 5AVSB 2XYBA 3RTQA 4P57B 2EE9A 5EN3A 1YO4A 4ZX5A 3MCLH 4MA7L 2WXRA 1FNHA 4ZMNA 1F3DJ 3QWRD 3VFUA 2GTZB 4JHWL 5LHDA 1ZV2A 2A6DB 1PAMA 5BPPA 1SJXA 4OLVL 4F7MA 2CSPA 3LEVL 1I1YA 5JO5A 4PJ7A 1JNJA 4UM9D 1I8LA 2A9ML 2D3JA 1CGTA 3HRZA 4Z7IA 3OX8A 1I9RH 4U1LA 1M05B 5IMOB 2XPGB 4X7TA 3BP5B 2YMXL 3BX7C 3WJMA 5DJYB 6FABH 5DS8A 4W4NA 3EOBB 4RH4A 4C4KO 1MOEA 3OXSA 1PZAA 3TEZA 3QRFM 2Q7AA 1KJ3H 4F7CA 1NAKL 1O6VA 2NY1C 2YEQA 5C0GB 5CBAB 2L7EA 5I1CL 4LSRL 4XWGL 3V7AG 5I15L 1NDGA 3ZDZE 3BZ5A 4QRQB 4ADIA 4P9MH 2NY5L 3NVQA 2EEDA 3SQBA 5AW6B 1MCOL 3TEWA 4WWNA 2IANA 1ERNA 3GLAA 4NPYB 5G4MA 3W9EB 3DIDA 1EO8L 5EC1A 4GMSH 4X7SL 4L1SA 5GGRA 3GHBH 5ISZB 4AL8C 3N41B 4KVNL 3P30L 1XAKA 3X1GA 3U6RB 4TXVB 1QO3B 1UTDA 2YN3A 3B43A 1KYUA 5DC0A 1OW0A 4XPTL 2O6PA 2WIIB 3A47A 4LSDA 5HHOA 1H5BC 5FV1L 5DDHA 1W2KT 3C5SB 3H42L 4QGYA 1CYGA 5FGBC 5LN8A 2V5RA 1KLGA 4DJMA 2X44D 4F8PA 2VH5H 3W1ZA 2WXFA 3ILPA 2E7LC 4XVTL 1TJHL 3SYAA 3ASNB 3T0XA 2L0DA 5TK2A 1WWCA 1RUAH 2IPUK 3V8CA 4ACTA 4XP5H 4LLDA 5IZ7A 5HYQB 3BO8A 1BF2A 1E2WA 4N2GA 2VLME 3MA9L 1YEHL 5LCVL 3NZHL 4ELME 3UBXA 1TO4A 2BH0A 5AUMB 5IJKC 2AQSA 1C5BL 3SPVA 3MREB 2BSSB 1T4KB 2AJYL 1CDUA 5D5MF 5ESAA 2CUAA 2JCCA 3KYOA 4JN1L 1U0QA 1N0XL 2X5PA 5F9DC 2Q76B 3GB7A 3HW7A 2XN9D 4NLHA 5D2LA 1X9RA 4FZEL 2V8LA 2JF1A 3L16A 4KRLB 3GMPB 4L1LA 1QVOB 1FP5A 4CVWA 3HG1A 1AE6H 4HBCH 2C3GA 2QEJA 3O4LB 5DRXA 4N90E 2V7HA 1O6SA 2VQ4A 1K3ZA 1MJ8L 1U2CA 1ZEAH 2IMNA 2Y4SA 2PPFA 3D7PA 1RIHH 3C5JB 3EDDA 4HKZB 4OI8A 1U8KB 1MJJA 5AW8B 3GI8H 4JKKA 5KYXA 3IMSA 3HJEA 4GPVA 2CJ3A 1P0SE 4LOFA 4RFEB 2X4NA 4OZIA 4TS6A 4UYPA 4LU5L 5GS0L 1MELA 2CD0A 5IW3A 2LVEA 4YUEL 4J8RA 3OKMA 5KBNC 3K6DA 1WAAF 4MRCA 4NERA 2D2CC 5IB1A 3EOTH 1Y18A 3L4VA 1BM7A 2E7HA 2H1PL 2ILLA 5FO8A 2BK8A 3VI4B 3D08A 3ARTA 4YFDB 4U7SA 4ONGL 4PVBA 3A0OA 3GK8L 2FQFA 2X4OA 3T2NL 1BZOA 2D4FA 4MB4A 3VCLA 1DLHB 1L3WA 1N64H 3KPPA 4DIXA 5BS0A 4MMXC 4NQED 3REWB 1SEQL 2I9TA 4R2GD 1MHPL 3ZMRA 3BKYH 1BLIA 1R5IA 4JFEA 2HLFD 1BJ1H 3GSNH 1LP9B 3D0VB 4A2HA 3AACA 3I9AA 4XMPL 4U49A 2ENYA 1S9YA 2IXQA 3FQNA 4CADA 2EZ0D 1Z3GL 4XH2B 3HA0A 4NQDD 1BQHA 3RNKB 1XBRA 4AJYV 4PVNA 5E2TL 2ROYA 5JR1L 4Y4FB 2O61A 2B9AA 4GG6E 3BVNA 4HS6A 4HUXB 2BVPA 1F3DH 1FC1A 2OQJA 3HG4A 2OZ4A 3SJVA 5CZXC 2CR0A 3GGWB 3OKNB 4FG4A 4AQAA 2W92A 3H9YA 4NZUH 5AVYB 1R5VA 4V1DA 2EUZA 3II2A 4R96B 3K8MA 1RVFL 1I7ZA 5D1QB 1NC2B 3TYGL 5CIPH 2ALAA 4XBPB 3E3QE 1KCUH 3SKNA 2NY3C 3EJYC 1Q0XL 2MQ0A 3NK3A 3O3BB 4QRBA 4XN4A 4BUQA 1G7JB 4G6KH 4ZUUA 2AEPL 3DRQA 3RJOA 4UOJA 3WEXB 3OBAA 1EGJH 2D3NA 2BSTB 4K94H 2F53D 4U1IB 3GIZH 1SLUA 2C3VA 5E8EA 3LRHA 1TNNA 2BSEA 2Y24A 3P9LB 2I69A 1MHEA 4P5KB 2L4OA 2FECI 3HTLX 5E2JA 5TF1L 3U25A 1KPUB 1SMDA 4AIOA 2RIKA 2CG9X 1YMME 1OAUL 4JR9L 1XCQA 1Y6NR 4AM0A 3GJEA 2JKTM 4GBXD 1KT2B 2QV2A 4J1UB 1S9XA 2E9GA 4JHBA 4OLUL 4GAGH 2V37A 4DFIA 2WP3T 4P5TD 5F7LB 4D0DA 5G4OA 2IFFH 5HVWA 3BP4A 1I4FA 1QOKA 4OZHF 3UADA 5I0ZA 2CO7B 2C9AA 3LMJH 4XXDA 5EUOE 1UWXK 4BFIB 3C5ZB 2ISDA 1A8ZA 4HKXB 5F3HB 1JZ7A 1IAKB 3GXUB 3D51A 1UC6A 2A6JB 4FG6D 4TM9A 1WT5A 1CVSC 4UF7C 4PJDA 4NOBA 5F1IB 4UCFA 5HHPA 1BVZA 1YEIL 4F92B 3QAZC 5LBSA 4JB9L 5D7IB 1CFTA 1T7YA 4N8CH 1CG9B 1JNNH 2R56H 4UQBA 1B4JH 2YD5A 1V7ML 2GSGB 1R3LA 1JWMB 2CPUA 4ACPA 3CZLA 1W91A 1B3IA 1GCFA 4OLWL 1LMIA 1E4KA 5HDBB 2ADFL 4Y1AE 4OLEA 9PCYA 2FIKA 3NSFA 4L9LC 4RQQB 3FTZA 1QBMH 2BPBA 4JFZH 5JOPE 4Z7WF 5EZOH 2GW5A 2DLIA 4RMQA 4DP9X 2EDOA 4AIZB 2EXSA 5H37H 2N56A 3T0EC 1MXGA 3TO4C 3QNXA 5DLMH 2VLLA 2Z93A 4JS7A 1GYAA 3O8XB 4EN3B 2VJXA 2DBLL 1J05A 1QMUA 2A4EA 3P4NA 4G9FB 4HEME 4FTDA 1NGPH 4KRPD 4UIMB 3VRIA 2YXFA 1F4AA 4C4UA 4HD5A 1UQSA 3VXTA 2JI3A 1FNFA 3KZ8A 4BE6A 3O11A 3KJ4C 4ADJA 4PJIE 5GS2D 4YDKH 2W07B 2E8ZA 2NX5E 1LO3L 3CDFA 4KMLB 3VXUE 4EVNB 3RB5A 4A6YA 2GUOB 1AOZA 2Y7LA 1E43A 1JFQL 2YXMA 3ZBMA 1EEZB 4WSKA 2WSKA 3MRLA 5EIIB 1CN4A 5CILH 3TYFA 5I6XC 1NM4A 1HZKA 4N2MA 4X8GA 3LD8B 2BIHA 3DIFA 1HN1A 4HLJA 2FBJL 4YLBA 4Q6IA 5EF0A 1DDHB 1L9NA 3MRBB 4PRPA 4OF3A 4POZC 2KLTA 2AS5M 2OK0L 4JAMB 2X41A 5FW8A 1OGSA 1PZDA 4YSRA 4D9LL 3MACH 3LPPA 1LL1A 2HMID 4JDZA 2J5LC 3BJLA 3QNZA 4IMKA 1HL8A 4JN2A 3GHEL 1XGTB 2EDMA 3WJLA 3P9MA 3CN3A 3IDIA 5F7AA 5C0AD 4FMFA 2EP6A 3SKOB 2COVD 2OJEA 4LPYA 1BEXA 3D85A 4FQ1H 4B3VA 3TCXA 5EMYA 5ID0B 3L4ZA 4JJ5A 4LKXA 2H47C 3EYVA 4JW3A 4XOBA 3FO9B 5GRZA 3RY6C 3VXMB 3GFUA 2HFFA 1XEDA 3TZVD 4DP4X 5ABAA 3QJFB 4AH2A 1RZGB 1INEH 4M6AA 5KSBF 5DJ6B 2FCBA 4S1DC 2OL3L 5AALA 1EVTC 2OR8A 5ADOL 4BV1A 3X13A 5EZPA 1ZLUH 3W9DA 1DSFH 3B9KB 5CZVL 3GJFB 2WKOA 1G6RH 3O6KH 4BZ2H 4C56A 1FVDA 1X7QA 3WELA 3V79C 5DFTA 3BHBB 3RIAF 1A66A 1MXDA 4D0BA 4N0UB 4LCYA 1MCEA 2WW8A 4NIYE 3IKCB 2HN7B 4X4ZA 1D5MA 3CZJA 1A7RL 2CGZA 2FNBA 4JJOA 2H2PC 1GHFL 3C2SA 4HCFA 4ZTEA 1J0ZA 5IROA 4YHYB 2E7BA 1DANU 3N3EA 4MZIA 3MRJA 1UXSB 3MNZA 1IGMH 3JV4A 3CCHB 3CD4A 3VRLE 4AMWA 2VDPL 3HB3B 5B22A 3WIHH 2EDHA 2E9WA 1QBAA 25C8L 4G2AA 3CDGA 3PUCA 4AK1A 2FX7H 4PLKD 3MRKA 5A16B 2GK2A 2VSDA 1Z6JT 4ZW3A 3RWEA 2V5YA 5C0NC 4K9EL 2GC7C 4JDVB 3DBXA 4FMKA 2NZIA 1EQWA 3QORA 1MQKH 1JHLH 4JGUA 2CK0L 1KN4L 4GMSL 4NZTL 3TCLB 5FYLE 3F85A 4NOFA 5CCGE 4I3SH 1T0OA 3C6EA 2P8MA 4QYOA 2HKFL 2H6PA 5D2NC 2DMBA 4ODHL 2FQDA 3MCKB 1NFKA 4QCIA 4JFDE 1E9QA 4UB0L 5KJ7E 3TURA 3HS0A 3VG9C 5C6PB 4Z8FH 1D7FA 3TO2B 5KYUA 3UFIA 1VGEH 3CV5A 1ZSDB 5J5EA 4ZUWB 1AKJD 1U8OA 3NBNA 3TIDA 5EO9B 3MI6A 1FNEA 1IX2A 4I1NB 5EOCH 4AGPA 2XKSA 5I1EH 5CO1A 1J8HE 1G7MA 4YHMH 4M8QA 3HE7A 4QOKB 4WI0A 2LQRA 3BZ4A 4NO0D 3KLQA 4BKLA 3WSQH 1E67A 4AGQA 3AUVA 1OARH 4U6VL 4KUZH 4LCWA 2HJFB 5MERB 2A9CA 4JM4H 1AO7E 3SDAD 5GGQL 3SOBL 4V2CB 2X3BA 3U36B 4KJYB 4H2AA 5EU4A 2NUTB 4WFFD 5ALBH 4HOZA 4O2EA 3QIUB 4O00A 4LVOB 5CCKH 1U42A 4WKZB 3RAJH 3QXDA 1MI5A 3FNKA 3GQFA 3EO1A 3KPRD 3NJKA 2H5UA 1H3GA 4I0CC 4QTIL 4GRLB 3L3IB 2BOCB 2XTSA 3CFTA 2P45B 3IDJB 1LO2H 4FN0A 5DZLA 3AT0A 4KKLC 2BHYA 1S5HB 4JG0L 4G5ZL 4M5YL 4XN9A 4LL4A 2IH1A 3LKSB 4HIEB 4XP9L 2FX9L 2DTSA 3COOA 1H6EA 1FVCB 2W9DH 1C8QA 4M62H 1JRHI 3QHZH 4ZFQA 1N4XH 4KJPD 4NAMA 1DQLH 2WTOA 2MRYA 4KUCD 5IVXB 4JRYD 1CYXA 5DD5H 3SDYL 1JGLL 1GTNA 4IGBC 3ECBA 4XX1G 3WIIH 2XKNB 3VXRD 3MRHA 1WCBA 1YUHA 3NCYP 3SY0A 3INUL 3GIVB 2JMRA 3MBWA 1AJ7L 5HI3C 2YAHA 2YLHA 4MWFA 4WI7A 4XOEA 4JPKH 4Y16C 1XZ0B 1IZKA 3MJ9A 1N0LB 4A68A 3MV8E 4PJFB 3CDYA 3DOHA 3MNMA 3PWPA 2QBWA 3L6FB 5KVGH 1SUJA 3FH5A 3RHWF 1NFDF 4QI3A 1QR1B 1MREL 5JW5A 2ZIDA 3FB5B 3QCTL 1UVQA 2QVKA 3RP1A 4KU1A 3S5LA 3AM8A 4WLCA 4LLUB 4X4ME 4AENB 12E8L 3DXAE 5KSVB 4YSTA 3PF2A 5DK2A 1NCJA 1O9VA 3LNIA 3V8OA 1HZHL 5FFGA 1RUPH 3KPQA 3DROB 1OE2A 1XSOA 3CFKB 3R7QA 1YDPA 5KYYB 4X6DE 2A1WL 1ND0B 4LCCB 4AYFA 4P3DB 2BVQB 2ZNWA 2C9PA 3CQFA 5TDOB 5IQ7L 3ARVA 2NYYD 5MEPB 3LKOB 3SCMC 3SO3B 5J3HD 4WK0B 5DD3L 3Q44A 2PO6D 2YAFA 5T3ZD 3QIWA 1MZZA 1DUYA 3O6LL 4H26B 3QCUL 4KK9C 1H6TA 4PJGF 1NPNA 2BSBA 4LMQE 3V0WL 1TVDA 4ZODA 3HUJB 1RPUA 1BFOB 2CK2A 2H4EA 3QR1A 4DGYH 1HI6B 3HJ0A 1T0MB 4X9GA 3BAEL 3CFCH 3H9ZA 2R69L 5GZNC 2D7TH 4X6BA 5I17A 4PQXA 2A0LD 3LKPB 5CN2A 2VMCA 3KYMA 3TVMC 2BOBB 4PTUB 3VSVA 2FD6H 5EDSA 3C09C 4JHZA 2VDKH 1QPPA 3EOYG 3ZPDA 2MSPA 5FO7A 5HYJD 1A2YB 1AZVA 1E9PA 4PAZA 4K94L 5EC2A 3RIFK 1NUGA 2VDOL 2IGFL 1PLCA 2HFGH 3MLZH 7CGTA 3OKKB 1G7PA 1AANA 1HILB 1DL7H 3HAEH 4ZW7A 1CF1A 1PJ9A 4FYRA 5EZLA 1PZ3A 1YEEH 1IKOP 1D6EA 2DYSB 5JW4N 2JTDA 2VW4A 1BOYA 3H6JA 3BSHA 4LNRA 2L04A 3RU8H 3OXRA 4G82A 4Y2OA 3EYQC 5DVMA 2AHIA 3SZKC 4OB5L 1V5JA 2EAEA 4MNQD 4AL8L 4OGYL 2UZIL 4MZRA 1XBDA 4NP4L 4WWKC 4DKFL 4P2OC 4NENB 4V2BA 2W1NA 3CVHH 5KS9B 4WI2A 2JELH 4UV7H 1FH2A 3K81A 5DD0L 2QSQA 5B8CB 2Z1PA 3ARGB 4M3KB 2QDWA 4K7PH 4HKJB 5EO0A 5BXFB 2B08A 5I6MA 4UDTA 4IHOB 4L3EB 4MCNA 2N4IA 3X3GH 2FE0A 4RMBA 2VKXA 4B6ZA 3C9NB 3G5WA 3DUUA 1MG2C 4UZSA 3L1GA 3QXWA 4IK7A 3RVXC 2BNQA 5FKAB 1GL4B 1G7HA 1UADC 1KFGA 1J1OH 2ZSVB 4P5MB 1OQXA 3BJ91 5BJTB 4IKIA 1S7UA 4JFFD 2O6FA 3UIZA 3UTSD 2VR6A 4HK3N 5I1JL 3WKMH 1HHHA 1I1AB 1VCBC 4I4WB 4OFYA 2EABA 3MFFB 3VXSD 3I6KB 2KL6A 5I30L 4G7VL 4P57A 2XWZA 1QNZH 1M7DB 1IFHL 3N55A 2AK4E 3OR6B 1A6VL 1MNNA 3QR0A 2WINB 4PRNB 2DJSA 3NABL 1JZDC 4G8FA 5I1AB 2A6DA 3CFJB 5GRUH 2ZPKL 3U9UB 2FUQA 4OGAC 3LN9A 1NBYB 2DQJH 4GP8B 4JREB 3H3KA 5F7NC 1DLFL 5E9DE 4Z3IA 2W8CA 4RCAA 5KTEL 1M05A 2DMCA 2WZ5A 3S96B 3ZLQC 4N8PA 1UM6L 1EHNA 1B6DA 2UVEA 4CDHA 4Y9FA 4JX0A 4JFOB 5AZEL 4NEHB 2YD6A 3EOBA 1T22B 4PVLA 5HGGS 2Z9TA 1E6OL 3WNIA 5ADPL 5IB5B 1NFIB 2ZUWA 5CBAA 2YARA 4J2QA 1T6VN 2ZICA 5C0GA 3O0RL 3TLRA 2DH3A 1CL7L 3TN0B 2FSEA 5IJDC 2P5WE 3APDA 5AYUH 2XACC 2P8LB 4QRQA 1BOGB 2Q2EB 4ZTOH 1KPRB 2CHNA 1ZHNB 3WGVB 1TQCC 4Y9BA 2EE6A 5T5FA 3NCXA 3QQ9D 4NPYA 4Y2DD 3W9EA 1JDAA 1ZLDA 5LQBL 1RK7A 4YSQA 4Y5YB 1U41A 2E4TA 1MCPH 4S10A 5FEBA 4X9BA 2WC7A 1UJTA 1F11B 1QO3A 4CGTA 2BFVL 4KJWC 1UWEH 3UTTE 1VB9A 3EF4A 1NGZA 4G8EB 5L2KE 2AGJH 1U3NA 3CSGA 2UX7A 5KW9L 4MNGE 5G55A 4FEMA 4F2ME 3QJVB 5FDYA 3OLDA 3U46A 5DHMC 3BVUA 1A5FH 5EBMA 4J6RL 4ZG1A 3C60D 5T3ZH 3QJHA 5L88H 3CHSA 1OM9A 4FQ1L 5JHLH 4J3VA 1B0GB 3VWJB 1U3HB 1I3UA 2G0KA 1CO1A 2FQEA 1T04B 3FU9A 4MCYB 3K0WA 4TNVF 5HYQA 3MKGA 3L13A 3P1VA 2ZJSL 1M7UA 4K71B 2ZTBA 5I82A 5EIVA 2FEEI 4FXLA 3RFZB 3L08A 1NBZB 5AUMA 3BAKA 1SY6A 5B1JA 4W6XB 1BYPA 3O2DL 1J1XH 2OX5B 4QRUB 1DSFL 3MREA 2BSSA 2G30A 1ZLUK 4X6CE 5GS0D 2R9HD 4JO3L 1Z1WA 3GMMA 2Q76A 1KTDA 4OCYH 3CH1B 4M7JL 1EFXB 3GMPA 4DZBA 5IB2A 1YECL 3A6BL 4GUCA 1QVOA 1EAQA 4XHJD 1J0KA 3QUXD 2XJKA 1JK9B 2X2JA 5ANME 3RX5A 3I6GB 3O4LA 1BAFL 1S5IH 4WRLA 3O9WA 4YSAA 4U2YA 2I32A 2QPUA 4HKZA 3V6OE 1MCKA 1U8KA 5FIEA 2MCG1 4LRNL 1QA9A 1TVBA 5JDSB 3OLGA 1ZS2A 1ZV5A 3MCYA 1BJMA 4RFEA 2VXQH 4M1DL 3GSXB 1O9WA 4HUKB 1XR9A 4WV1B 3BYYA 4FFYA 4N0YL 3MODL 4KRMB 3ABZA 4UU9B 4J12A 3VA6A 3MUUA 3L7EA 1JGUL 4I2XE 3TA3C 2IWFA 4LPTA 4G8AC 4RMTA 1CE1L 1R3IH 4HF5L 2RBLA 4PGDB 4XPGH 2B2XL 3VI4A 1A14H 2WLKA 4UV4L 2WXIA 5JHMA 3MV9B 1KG0B 5EZIH 3VGDA 3Q01A 4JRXE 2CBPA 2XHNA 2D03H 2Z31A 1DLHA 5SWQB 3PE9A 2FNWA 5CJOH 2CALA 1PW3A 2A6KA 3BWUC 3REWA 1SBBA 3JTSB 3HOGA 4ENED 5TE4H 4P2RB 4N25A 3F65A 1C12A 2VLRD 2VW6A 1ZLVH 2G2RA 1LP9A 3D0VA 2PXYC 3V4LA 1P4BL 4PJXF 1FNSH 3IJYB 3WAKA 1PLAA 4L8DB 4UT6H 4WFGE 4OT1L 1WBZB 3IGUA 4XH2A 1W16A 4TULH 2VITB 2ZYSA 1NOFA 1T89C 1VPOL 2LU5A 4Y4FA 3F7YA 4D7PA 3TV3H 4Z7OB 4LSPH 1GC1C 5KVFH 2Z4QB 4HUXA 4MTMA 5IWLA 2WO4A 4M1GH 3RWCA 1ZPUA 1PYWB 1HVXA 4KFMA 1ORSB 2XG5B 2JJTC 3GGWA 3OKNA 4O4YH 5IT2L 1EJFA 3HNTH 3MOAL 2VERN 4OGZA 4OCRL 2WLMA 4DN4H 1Z32X 3KS0J 2JNZA 5D1QA 5SV3A 2GSIB 1NC2A 3ETTA 4IRJB 4LDEB 3VW3H 2WVTA 4FXKA 4AZ8B 2X6UA 1S7WB 2XLLA 5EPMB 4U4BA 1OPGL 3ZU8A 2K4WA 3LH8A 1OGTA 1SF5A 5E7BA 3LV3A 4LZKA 5I1GL 4ELMA 4PRBB 3E2HB 3GMQB 1K2DB 4I87A 4MB3A 3U6XS 2C7FA 5AB2A 4U1IA 1I7TB 3NFSH 2Z3FA 4RRPA 1P7QB 5DMJB 4E2OA 4FERA 2BO0A 4HXBH 4BFNA 3DVIA 4OQTA 4M62L 4JG1L 3IFPA 3AREB 1AQKL 5FAAA 3D0AA 1KPUA 2W0PA 3O2WL 3BUBA 5B1AB 3ETBF 1FBIL 3WIIL 4BRVA 3Q9QA 5C0CD 5D1XC 1NL0H 2C9SA 1RH8A 3BPNB 1KT2A 4Z0XA 5MP6H 1J87A 1W8EA 4J1UA 3FU6A 4PW9A 1JGVH 2OYPA 1WWWX 4A38A 3B3BA 4K4KA 4LL1A 4ZOCA 3RDTC 3QQNA 1Q0YL 1FORH 4JNXA 4LOUC 5ETUA 2VDLB 2UY7B 3C5ZA 5G4NA 4HKXA 1KIQA 2P5EB 5F3HA 3LS4L 1GA2A 3ULVE 1L6ZA 4IU3B 5IREA 2OMBA 3DIVA 3EW3B 1V55B 1XGPA 3FTGB 3BRFA 3N40F 5K9OB 1IM9A 1VKXB 2BRRL 3NIFF 4NWUL 4RA3A 5JA9A 3GS4A 1B4RA 2JCWA 1CDJA 1E50A 5D7IA 1DQKA 1CG9A 2DMGA 1RUKH 1XGRB 2ENPA 4IHBA 2VUOA 2GSGA 5C0BD 3CVIH 1JPST 2GITA 2J8UF 3IFLH 3LOWA 1X6NA 2AQPA 4NSKB 3BAXA 1P1ZB 4RQQA 5DVLA 5MENB 1PIGA 3NJVA 3P11L 4N3UA 4NZRL 2CE6A 4LF3B 4QTHB 3D2UB 2PYED 2F19H 3D1MC 1F3RB 4TSAH 5SWSE 4WEMB 3THMH 4AIZA 4XCNB 2ZCZA 3V4UL 5I28A 1NGWB 3V4VH 3T8XB 1CR9L 4IS6B 1LGVA 2GJPA 2R29A 4JMXA 4KROC 4FZ8H 3O8XA 1JBJA 4KKBD 4JKMA 4JO4L 1IGJA 1T66D 1ZHKA 2ZYRA 2ZUSA 4G9FA 4UIMA 1P7HL 3MROB 3Q2CA 4GG6A 1FYHB 1OCOB 2ZG1A 3FAXA 5LG1A 5ITBH 4P4KB 3D48R 3H3PH 2RCSH 5A1AA 3NCWA 3NIGB 2R1WB 5KANG 4N8VB 1H0DB 2YAEA 1H8OA 4EVNA 1OAYH 2PTTB 5BRZB 2GUOA 3A67L 1ZT7B 4HV8B 4WTXA 5EIIA 7FABH 2D0FA 3BSZH 4IBLT 2FGZA 2GC4C 5D7KE 1PG7X 1YEEL 4HG4J 5BUAA 1OP9A 1U91B 3BCFA 2ICEB 3WD5L 1OOAA 4KK8C 1DDHA 4YHKH 3MRBA 4PWHA 1V3JA 4IQHA 1LTXA 2OXGB 3FXIC 2Y1VA 3FTVA 4B60A 3DECA 4JAMA 4PS4L 1AHMA 3QFJD 4NUGL 3Q7JA 3GUTA 4PWIA 2WLIB 3WMQA 1K6QH 1I85A 4EZMA 1WA0X 3DTUB 4JM0A 1UFUA 3DGGB 4ETQB 5F9WB 4S0TD 1YQVL 3N40P 1I8LC 1ZVSB 3HRZC 4TVSa 3L9RB 4PJ9C 1XGTA 1YMMA 1CT8B 2CWRA 1M7IB 2JELL 4X8CA 5C09E 2CRZA 4KX7A 1T2QH 4Z7UF 3MUJA 3SKOA 3RQ3A 1DJWA 1MRDL 1AHWB 1JPFB 5AAPA 1MIEL 3MLYL 1RK1B 4ODSL 4D7BA 5D7LB 5ID0A 3VG0H 5AW3B 4ERSH 4RA0C 3JSSA 2VDML 3FO9A 5CMAB 3T09A 3VB8A 3VXMA 4HALA 1LWHA 5CD5D 3RGVD 5I6PA 1RZGA 5SWZD 3O81A 3EJJX 4BGLA 4PPTA 2HTLC 3ARDB 3OHXB 3VI3E 4BRJA 5CLZA 1WUNT 1CCZA 4TSCH 2WNGA 1L9TA 3S88L 2E6PA 3KS0H 4KMTH 4OF5A 3US1A 4UAOB 2JI2A 4FYQA 1ADQH 3EH1A 3KEDA 3MRQB 2H6OA 3BHBA 5HVHB 2AJSH 3LXBA 3M7OA 5HYSB 3QGVA 2AZUA 2Q2LA 2H45A 4EI5B 1BXAA 1OSYA 5E4EC 4JM2C 5TK4A 3Q9PA 3S4SB 4CSTA 2X0WA 1PX3A 2VC2L 3IKCA 4QRRD 3S3SA 3ZRCC 4Y1AA 2APWA 3EDFA 1GGCH 1PTZA 3D2TA 1MW2A 1PKQB 4XN1A 4XBGB 1BV8A 1T1ZA 2W80C 3MXWH 4MASA 4M7LH 5FGRA 5DF0A 4DUXA 4JCWA 3WCYA 3LKRA 2VTFA 1UXSA 1XIWB 2MQ3A 3CCHA 3U7WL 5FS5A 4F91B 3A21A 1E8ZA 2UWEF 5DRNB 3RWJB 3GLEA 4FFWC 2BC4A 5DVPA 4ZAKB 4FQPA 5D6DA 1IM3D 4PJ6A 3KBPA 1EANA 5D96C 3ZE1E 3V9FA 3VWKD 5A16A 4Q9BA 3QUHA 4F8TA 5AZUA 1YCSA 2A74B 1DO5A 3ZL4H 4IBVA 5C0IA 3L4XA 4UMSA 5T1DL 5ELIA 5CJXA 4LBAA 4LSVH 3E8UH 4GAAA 4M43L 2H0PA 3RJQB 4W1TA 4MA8L 2YQ2A 5HTSA 2FBRA 3RVVC 1L9QA 3P4OB 3MCKA 5HI4C 1LJMA 5CFAA 1H19A 4YXHL 1BQLL 1BIIA 2A9BA 1UOWA 3F6JA 4Q8BA 5DK3A 5C0RL 2JKNA 1IBZA 3QNFA 4Y4HB 5CKGA 5D8JH 3BZEA 2J5WA 1KBGH 1ZSDA 2AJXH 1KFAH 2EIDA 3M1CA 4ZUWA 2EVHA 3PP4L 5CXPA 2IJ0C 4GW4B 1I9JH 1XF4B 3GSRB 5EO9A 1AR2A 1T1WA 3BXNB 3HEIB 4JPVH 1J88A 4AYEC 5BUPA 4HWBA 4Y5XB 5D4HA 5GQBA 3QFDB 2VR8A 3WXWL 3N85H 4KJQD 1RXLA 3S8WA 4QOKA 1F8TH 3TBVB 3B34A 5ACZA 3LEXA 2XXMB 3VFSB 1PIFA 5DWUH 4L37A 1QWNA 2X6MA 5MERA 2OJZH 2ZOKB 3ZN6A 3JWNH 1X3DA 1JYNA 4PJ7F 3EGSB 4N2CA 1LEKB 4HJTA 4HMEA 1E42A 3AU1B 4KJYA 4NQCE 2GAZB 3U36A 3CPLB 2NUTA 4OUOA 3RUGE 3VQLA 5L0QB 4P46A 1OGPA 4UT9A 1CFNB 3QIUA 1UA6H 2HRPH 4FXTA 4WKZA 3VD5A 1Q90A 2DQCH 2X4QA 3L3IA 4MDJB 1ED3B 4N5ED 3UXFA 4R4FH 1OCWL 4YHIA 1X5KA 3I85A 3HG3A 1XB3A 2LVCA 3C6LD 1XGQB 2UZYB 2A7BA 1A7PL 3R06B 1F2QA 4R8WL 4U7KA 4OI7A 2ZYIA 1FVCA 1Y7VA 3BYTA 5D55A 4B7IA 1P53A 2G5UA 4MVBD 1BAGA 2HKHL 2IBZX 3VXNB 3FU7B 3DA0A 1MFMA 1TZAA 4QF1A 4UI2A 1GY2A 1P5UB 5JIKA 4QYAA 3WHE0 4E9YA 1WEJL 2J8HA 1PZ5B 5CF3A 2NT0A 5F7EL 3SDXF 2NYKA 2X9WA 4BH8B 4UDUA 1SM3L 3HMXL 1BD2D 1L7IH 1XZ0A 1TQBB 4MBRA 4L2YA 4PJFA 3M1BB 1OT1A 3L6FA 5K9KB 1P5VB 1T5WB 2PCFB 3QVAA 3STLB 1B4LA 4A7GF 2QADB 2YBRB 3FB5A 4YZFE 2WBJD 2BY0A 5J1SC 2JQZA 4LLUA 2Y7SA 5L9DL 1DQML 4AENA 4W9GC 2V9TA 2UY6B 5CCHE 5KSVA 4GSXA 2PTUA 3WKQA 3R4DA 4RNRA 5I0WA 4FXGB 3DROA 2ZKHL 3CFKA 3HVNA 3T5WA 1G6VK 1CGWA 4I0PD 4YHLL 2OMWB 4LCCA 1ND0A 1Q1JH 1YG9A 3OKDB 4P3DA 2YUZA 4GRWF 5BZDB 3GI9L 5C92A 1IGYB 5MEPA 3LIZA 1UEYA 2EYTB 2ZXEB 1E6JH 4L48A 1RU9L 1G9MC 1SHMA 4R83A 2CNYA 1KXQE 3NIDF 1KENH 2B20A 1SDDB 5HD8C 2YQ3A 3MUHL 1OB0A 3EJUA 3K6FA 1MDAA 4MAZA 2E27L 2NY1D 3FUJA 4RZKA 5DMKA 4BH7B 5F7KC 2R4RL 1G1CA 1T0MA 2BVYA 2B16A 3TT1H 1ITBB 4KQ3H 4RGNC 4RX4A 4DSYA 1PZCA 2DD8L 4KV5F 4YVNA 3IE9A 1WIOA 4NNPH 1R47A 2KKQA 2EIJB 1IARB 1KN2H 1HE8A 5H4YA 4R7VA 4OCWL 4AEHL 2Y7NA 2B1AL 3IU4L 4G7QB 2J1KA 2BOBA 2AV7B 2DIBA 2VDRH 2R0KL 3I50L 4HH9B 4QHMA 3MGTB 1AS7A 1ASPA 1CLYL 4YHNB 3DVNB 4OZIF 3FQWB 1A2YA 4FYSA 3WO3B 2OA9A 5K9JL 3EUUA 3Q5TA 4YSUA 3OHMB 2CXKA 3OKKA 4NWTL 3LKNB 3NCFB 1HILA 4P48A 3ZR5A 2WLNA 3IDYC 3S98A 1TIUA 2XXFA 2XY1A 5IFAH 2AC0A 5I6LA 4Y4KC 1PLGL 3PFQA 4XO3A 5D7SH 3FT2A 1OF2A 4HAGA 3IAGC 3BEWB 2G3XA 2UYLB 3TT3H 1F02I 4FHKA 32C2B 3KJ6L 4L1BA 4TUOA 4DOHE 1G1YA 3AG3B 4AYGA 2AK1H 3NSCA 1D5IL 5I8CA 4S1QH 5KOMC 5AWNL 3AU0A 4NQXB 5FC9A 5B8CA 5M7QA 2VLJB 4HSAC 2GHZA 4HKJA 1KJ2L 1R6VA 1ZDQA 5FYKH 2F8IA 3UBXG 4IHOA 4XO8A 1F18A 2BNRD 3T4AA 3WKPA 2L7QA 3NJNA 3C9NA 1S9WB 2TAAA 5AYTA 3VFGH 4XXCA 5EF1A 4DGWC 2BERA 3F2LA 5CLXA 2Q8AH 3MV8A 5FKAA 4HGMA 2DQIL 2Z65C 4PLOB 5FO9A 2Y2WA 1XWVA 1A4CA 4P5MA 2AVGA 3BC9A 2X0VA 3L1FA 3LS5H 2QQQA 5BJTA 3TXAA 4P23D 5D7JB 2XN9E 2OMUB 5GSVA 4Q6IC 2FWUA 1A0QH 1T5KA 15C8L 1BFSA 1MG3C 3A22A 2EDNA 5FWRA 2D0HA 1W0VA 1NCBH 1NA8A 2VRQA 3DXAA 3GSNB 1BQSA 3I6KA 3FAWA 3MFFA 4OJFH 4WW2B 2AEQH 1M7DA 5GJSH 1UM4L 3GKWH 3NGBB 3THML 1Y1DA 2F15A 4PRNA 1JNLL 2YPVL 3CFJA 1M56B 4OD2A 4L8SC 2NR6C 5DVNA 5IBUG 3AXLB 3FN3A 5DHEA 2WXQA 1GPOH 4XNZC 1UD3A 3JQOB 3SSGA 5TFSH 3JWDH 3O41B 1G1KA 2H8PA 5IQNA 2PR4L 4ECNA 1QLFB 3DTXB 3IE4A 4ONFH 5FCUL 4OD3H 1XR8B 4JHAH 1KZQA 4BFJA 1B90A 4AEIH 3QEQB 2HRHA 2IDUA 3IGKA 4PJCE 4CDGC 4FI7A 4GIAA 5AENA 4H1LH 2L8AA 4TUKH 2JKLA 5IB5A 3BMVA 1NFIA 3BE1L 3JVFC 4CBZA 3MRCB 4XNUH 5F7MC 2EIMB 3B37A 1TEYA 5CIPB 4J6IA 4F15C 3K6NA 1CGSH 3B2MA 1LLAA 4Z76B 1BOGA 1ZHNA 4GT7A 3FFCB 4NQEE 5GS1B 4YWGH 5MEOB 4ZMXA 1GOGA 4G6JH 3SBWC 6CGTA 1AIZA 3ZKXC 3Q2WA 4G8GB 4Y5YA 3V6OC 3F05A 1NH6A 4R4NC 4RWYH 1WJ3A 3KDMB 2QQNL 1F11A 5ACLA 4OSUH 4RAHA 1R3KB 4IRSB 2YK1H 5LBGA 3T0WA 4KFZC 1J5OH 1BQHG 4NQDE 1TETH 2GBAA 3KHQA 3VDBA 5F8RC 1E5UI 5IROC 1VSCA 2R83A 2GJ6D 1JGEB 5EU6B 3D39B 5JQHC 1IEBB 3KLKA 5AB0A 3QUMA 4R5VA 2HPTA 1NDMA 3X3FL 2XNAB 1FAIL 4NO2B 1YEFL 3D69B 3WNNA 1B0GA 2WQWA 4EDXB 5TE7L 2NY3D 2IAMB 3EJYD 4Q9RH 1T04A 1OKEA 1PAZA 1YC8A 2JB6B 4KKNA 1OCCB 5GZOA 5DEJA 2FLBT 2FATL 5CAYB 3QYNA 1OGAD 3O0LA 3WFEL 5FW7A 5HYFA 1KIRA 3OL2A 1SDAB 3J2PA 5DVOA 5FUZH 1GC1L 3QORC 4DQOH 2X42A 2LOEA 4ODXA 4CW1B 2C4FT 4QRUA 2F18A 1G43A 4GXVL 3KCWA 4MSWB 1DN0B 4WK2B 5CWSA 5I1LB 1NEUA 3LDBC 2F53E 2AV1A 1S7QB 1UCBH 2OMTB 3MO1B 4GG8A 4O9HH 2P26A 3CH1A 2FIRT 1VRSA 1EFXA 1CIDA 2A5UA 1AP2A 2NY0B 4U1MB 2WXHA 5HGDB 4DW2H 3BVVA 1KGWA 4D9QD 3LCYA 3O3DB 3QO0B 3I6GA 5KSAC 3L95B 4WU5A 3CVCA 2JK5B 5D72H 5I74B 3VFMB 1T7XA 3K72A 4OVUA 3LRMA 4MAYB 1QSED 4Y19D 4H88L 2OSWA 4M56A 5JDSA 1H6UA 1KWGA 2AK4A 1MFAL 3BKJH 3REVA 4P9HC 2EINB 2XN0A 3EKCA 3UGEA 3GSXA 5C3TA 4WV1A 1TYRA 4UU9A 4BZ1L 1FGVL 3KGRA 4Z18A 4WWPA 2Y6SC 4M7KL 3T6QC 4EF3A 4HA1A 4E41B 1KF9B 3ME0B 1AKPA 1GGTA 2YPKA 5M95B 1HE7A 4MMYA 4PGDA 1V10A 5FGCE 5TPWH 1D9KB 1K8IA 1EAPB 5C7XH 4OLYH 1M6OB 3WDHA 3QDAA 4LSVL 3MV9A 1KG0A 5ICZB 3T65B 3B9DA 5BCAA 4DN3H 1VFAB 3BZFB 4J28A 1LK3L 3PJLA 3ALWA 4YXKL 3VGAB 2NW2B 2WANA 3KBFA 1VAHA 3N43F 2WUBH 2GHWB 3GSWB 3O2VL 2R7EB 2AJUH 2RQ8A 3ENEA 3O6ML 4K23L 1X44A 1JZJA 5T1LB 2P5WA 3AMKA 3JTSA 3H7LA 3R18A 4P2RA 4ZD3L 3T0ED 3T2QA 3TO4D 2NY6C 4A6YH 1F56A 4JFQB 4ODVL 4HXAL 3UC2A 2VB5A 4I18A 5AKVA 5DJXB 4L8DA 2CPCA 1RJYB 5I66B 1T20A 4KPHL 1LDPH 1WBZA 2F5BH 5I0XA 1XX9C 1M71B 3UTTA 2VITA 1KGCD 4FTVB 1R24B 5TE6H 5DHYB 3ULVC 2OBGA 3DGDA 3DRTB 4J4PC 4RETB 2QQKH 3LXAA 1G5AA 1PYWA 4DGIH 1ORSA 1CU4L 2XG5A 3CLWA 2ITFA 1HEJC 2K70A 4KXBA 4KXAA 3WTVA 4F80A 4WUUD 4BXSV 2WZPD 3ZDXF 1JMZA 4R90L 2GTQA 1HQ4B 1ESOA 4XAWH 5DT1L 2GSIA 3R8BB 4IRJA 1JOIA 5I0YA 4GUQA 1WVZA 4B0MM 3G5VB 1S7WA 1MEXL 3IPEA 3MOQA 4OY9A 5EPMA 1TUPA 2YKLH 1UA6L 1ZTXE 3PL6C 5T3XL 4POZD 4FCAA 3CE1A 4O2CB 5E99L 1TSRA 2ZAGA 3GMQA 1K2DA 3JWOC 3Q43A 4EOWL 4O02H 1G6RB 1WGOA 2TSAA 2P42B 3QH3B 1S2EA 4TRPH 1RFDL 3EO0B 2CXGA 3OPZH 1I7TA 1IC0A 4X6CA 5BQDA 1ES0B 4AE1A 4AG4H 3ATEA 4ZNEE 1A9EB 1H3TA 5GRXG 4XCYB 4LSTL 1G9NH 4IIQA 4U6TA 5EA0H 3ES6B 1SEBB 4HG4K 4NXSA 4NZDA 1RZPA 4TNWF 2OTUB 2AKRB 5A2KH 2QLVB 1PZUB 4BHUI 3S34H 2VLKD 5C0AE 2CA3A 4U1NA 1LILA 3W0WB 3QO1A 3ARFC 2RMNA 3L3HA 2HX9A 4KDWA 1ZD6A 4S1DD 5T1MB 1DBBL 1MW0A 5GJTH 2UY7A 4EZKA 1UUSA 1P6WA 2P5EA 4XGZA 4YJZL 4DPBX 3MNDA 4IU3A 5FF6B 3KPLA 3MV7D 2VM3A 3FHQA 3FTGA 5K9OA 3PGCB 3WUWA 4BA8A 1T21B 3B2UD 2A4ZA 3MBEA 3WKNA 3IFNH 4V33A 1GZHC 4YXLH 2VJ0A 2I27N 2WJ7A 4ABVA 2Q20A 3BDYL 4NZJA 1CICC 1XGRA 1BF8A 4MCMA 3QW9A 4TQ8A 1IC4H 2YGPA 3GBDA 2BWQA 3H8NA 4JRXA 3ZT5A 1NMAH 1X9LA 4QO1B 3WFDH 1TOXA 4N2OA 1CB4A 4NSKA 3AJ7A 3KVQA 1P1ZA 2NXYC 1P4IH 2K3TA 4MAUL 1ZRUA 4IDJH 5L2JB 1FDLL 2CLRB 5KBDA 2YPLB 5MENA 3LKQB 3ZDYB 3MJ7B 4LIQH 4LF3A 2C9RA 3D2UA 4HT1H 4KI5C 4OZGE 4QTHA 3UYRH 4QGTA 2GFBB 5CSGA 4CA4A 4CN6A 5DEZA 1NGWA 4EUPH 1FUNA