1AIZA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport(cadmium binding)
molecule keywords AZURIN
total genus 31
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aizA00
4JHVA 5TK4A 2PPEA 4DP6X 1NICA 1GS7A 4MFHA 3H4HA 2YAFA 3AG3B 1WAEA 3IEAA 3S3BB 3NJNA 1FA4A 2BHFA 2VW4A 3GYRA 5I6MA 1IC0A 2YAOA 1ZIBA 2EINB 1ASQA 2ZONA 4BDVA 3S8GB 1OCOB 4YL4A 2AVFA 4KNTA 5I6OA 3WKQA 1SHWA 1PLCA 1OV8A 2GB2A 3PLYA 4YSSA 3MX0B 1AG6A 2QPDB 2BZCA 1ET7A 1AAJA 3NP3A 2QDVA 3S8FB 1OE3A 3DKHA 1JXFA 4P5SA 1E5YA 4BXSV 2P80D 4KOCA 4GYBA 4E9XA 2AZAA 3ABKB 4E9SA 5D4JA 1ZV2A 3PXLA 3QJTB 2PP7A 2XXFA 1BXUA 2VN3A 2CCWA 2J5WA 2R7EA 1BQKA 1ZDQA 2CUAA 1AZBA 1PAZA 3T6VA 1PCSA 2CAKA 1SF5A 3EH5B 3G5WA 2ZOOA 2EILB 1ZDSA 4G72B 1MZZA 3FYEB 2YAQA 3FYIB 4N4YB 4A2FA 1MG3C 1ZIAA 2AFNA 4DP8X 1OCZB 1WA2X 2GI0A 1IKOP 1J5CA 3N55A 4BDVB 1NINA 3OQRA 1AS6A 3AG1B 2JXMA 2VW7A 3X1NA 1CUOA 2IWFA 1OCRB 5AKRA 4PCYA 2XUWA 1BQ5A 6PAZA 1GY1A 2QT6A 3HB3B 2TSAA 3FU7A 5I26A 3WNJA 3X1EA 2I85A 2FJSA 5A7EA 1L9OA 4YSAA 2YAMA 3TA4D 3TASA 3NJMA 3V9CA 2PCFA 4A2DA 2FWLB 2XV3A 2CBPA 4CSPA 3NJIA 1CC3A 2BO0A 3FQ1A 2VM3A 2QPEB 1PLBA 3NJKA 4DP0X 3QQXA 1A4CA 1EZLA 5B3SB 4A2HA 2HRHA 4P5RA 3QJVB 4AKQA 2DYRB 2GBAA 2R7EB 1PF3A 2DWTA 2NRDA 2HZHA 2GC4C 2HX8A 4YSEA 4G7QB 4GY4A 2UXFA 5B1KA 2FT7A 2EIMB 1UATA 3NSYA 3CVBA 4KNSA 2XX1A 1WA0X 3RYMA 2UXTA 3KW8A 4Q8BA 4RH4A 2QDWA 3D12B 1NPJA 1BXAA 1KBVA 3T6WA 1AG0A 2LLNA 2W8CA 4F2EA 2UXGA 2FQFA 4YSTA 4DPBX 5I6KA 3OM3B 3AY2A 3NJFA 5F7AA 1M57B 1OE2A 1NIBA 1WS7A 1JVLA 1PNCA 3PAUA 2RACA 4W9ZA 1WS8A 1E30A 1JZEA 3SBRA 3BQVA 3FSAA 5I5JA 3SBQA 2H5UA 1KV7A 2YARA 3OMIB 1KYAA 4AX3A 1IUZA 1NPNA 3TU6A 4YVNA 3DIVA 4QLWA 1RZPA 4NAJA 3UGEA 3WIAA 7PAZA 2FT6A 4KO6A 3S3CB 1E65A 1ILUA 1A4AA 3QJRB 3QJQB 3ZX1A 2FQEA 3JTBA 4E9YA 1JXGA 1SHXA 4HIPA 2AZUA 5D4HA 1E5ZA 5PAZA 1ASOA 1L9QA 1XMEB 3TBBA 1GW0A 2IDQA 1DZ0A 2X87A 1BQRA 2XVBA 2J55A 5AFAA 3X2QB 2HX7A 2DV6A 1L9SA 5AZUA 1TKWA 2OCCB 2VMJA 1JZFA 2E86A 4G71B 1L9PA 1OF0A 1X9UA 4HAKA 1DYZA 1SDDB 3T6ZA 4FA7B 1V55B 1E67A 2EIJB 1XB6A 1NZRA 3WNIA 2VSMB 3FU7B 4QKTA 1A65A 4X4KA 3ASOB 3HEIB 2IH8A 4PAZA 3ZBMA 4AKOA 3X1FA 1MG2C 5IY5B 1BXVA 4HCFA 1ASPA 1PLAA 4HHWA 5B7FA 4KNUA 3FU8A 4YSQA 6PCYA 2CALA 2Y69B 1QNIA 1AACA 1XB3A 2I7SA 4F2FA 5I28A 3IE9A 3T71A 4BWTA 4GXFA 2N0MA 2XV0A 3MBWB 2YAPA 4UANA 3FQ2A 3FSZA 1KBWA 4G7SB 1QHQA 2HX9A 4HCGA 4YSDA 3C75A 1T5KA 2XWZA 1OCCB 3GDCA 3WI9A 3X1GA 4JHUA 1ET8A 1W6WA 2XX0A 4AI7A 5F7BA 3DTUB 3H4FA 2EIKB 1V54B 3PAVA 3UACA 1GY2A 1AZRA 3PAZA 2B3IA 5TK2A 1FWXA 1ID2A 3ASNB 1IBZA 3NSFA 3AW5A 1JVOA 5B7EA 1NWPA 1NDTA 3UAEA 2BWDA 5I6LA 1JZJA 2TSBA 1HFUA 2BP0A 2IH9A 4WKXA 3ZIYA 1ZPUA 1FFTB 4DPAX 2FQDA 2IDUA 2VW6A 4DP2X 5D4IA 1NIEA 1AZCA 1GSKA 1W8EA 4NB7A 2PPFA 4ENZA 3EH4B 1IBYA 4E9QA 2XV2A 1PY0A 5B1JC 3SBPA 1BEXA 1MDAA 3ERXA 4GP8B 3U25A 2UX6A 4HZ1A 5PCYA 7PCYA 4DP5X 5LDUA 5B1AB 2Q5BA 3AZUA 3L45A 4K9JA 1SF3A 2Y1AA 2HLEB 3N2JA 4DP9X 2BWIA 2XU9A 3OMAB 1SFDA 2BP8A 1JOIA 4A67A 3UAAA 1NIDA 3IBOA 5FC9A 4YSCA 3WG7B 8PAZA 1SDDA 1GR7A 1PNDA 3TBCA 3JT2A 1R1CA 1AR1B 1JZIA 4UAHA 4HHGA 1PMYA 2FT8A 4A68A 1AIZA 1HAWA 3SQRA 4W1TA 4F7KA 3FS9A 2BP0B 3T6XA 1AS8A 2A3TA 1KGYE 2P80A 2VM4A 3AG4B 1PZAA 1W6LA 3H56A 2GSMB 5E9NA 4BWWA 1PZBA 1JXDA 3EHBB 3ABMB 3FQYA 1J9SA 1JZGA 1NTDA 1AQ8A 4DP1X 2PPCA 3PPSA 3QJUB 2J56A 3EH3B 5I5IA 3ABLB 2JFCA 2Q9OA 3EF4A 2J57A 4AZUA 3NP4A 1QLEB 3FSVA 1X9RA 2WO3B 3FU9A 2PP9A 1EHKB 3CDZB 3CZUB 3FSWA 1GS6X 1J9RA 4KO9A 1VLXA 3WKPA 1CYWA 1URIA 4YSOA 2ZWNA 5EHFA 2ZXWB 5B1BB 4DP7X 2YQBA 1XB8A 2IWKA 4Q89A 1F56A 2FQGA 4M3HA 1RCYA 2IAAC 2DY2A 4N8UA 2IDTA 2H47C 2YAEA 1L9RA 2OJ1A 1GS8A 1JERA 3T9WA 2PPDA 2FNWA 4FAAB 2YXWA 4TXVB 1GYCA 4E9WA 2BW4A 3FT0A 2PPAA 4M4RB 4A66A 4GP5B 1AZUA 4CSZA 3KW7A 1N70A 4GP4B 1L9TA 1KCBA 1ILSA 5I5MA 1ETJA 1I53A 3NJLA 4G7RB 1RZQA 1ADWA 2B08A 1SFHA 1SNRA 2PCYA 4DPCX 2PLTA 4AKPA 2XYBA 2HXAA 1A8ZA 1V10A 2FTAA 2UX7A 1CURA 4E9TA 1AANA 1KDIA 4E9RA 5I6NA 1KDJA 3NJGA 1J5DA 4KO5A 4BXVA 3BVDB 3CDZA 4KOBA 2XLLA 2WO2B 2GHZA 1OOWA 2WSDA 1NIAA 1CYXA 3FPYA 4DP4X 4YSUA 3QPKA 2GIMA 1MZYA 2VSKB 4YVUA 2H3XC 2AANA 5ANHA 1TEFA 3NYKA 1BAWA 2XXGA 1A3ZA 3CVDA 4WTQA 2BP8B 3NSDA 3V9EA 3IN2A 3CVCA 2I7OA 5B1JA 1TEGA 2IDFA 1HAUA 2CJ3A 3NT0A 2W88A 1KCWA 3NJHA 4L0PB 2IDSA 4G70B 2OV0A 3IN0A 1M56B 4BK5C 9PCYA 4A2EA 3FPXA 4JKNA 3OMNB 3UABA 3GXUB 4HALA 1J9TA 4EF3A 3PCYA 4YSPA 1ET5A 1JZHA 1NWOA 5B7MA 1PZCA 4E9VA 3ZDWA 3CG8A 3OD3A 1AOZA 2YXVA 2MRYA 4HCIA 1A4BA 3NJJA 1N68A 1YLBB 3NSCA 1B3IA 2HRGA 2DWSA 1SJMA 2GC7C 2YAHA 1WA1X 2PP8A 1NIFA 1OE1A 2UXVA 2MTAA 3X1BA 1BYOA 1BYPA 2IWEA 4UF7C 1M9WA 4KO7A 1AZNA 4A2GA 4BWUA 4ZK8A 3UADA 3QJSB 1J9QA 2BW5A 2DYSB 1TU2A 4NERA 2JKWA 2X88A 3S3DB 3ABGA 1RKRA 4YSRA 5I6PA 1AS7A 3AG2B 2BZ7A
chains in the Genus database with same CATH superfamily
4P99A 1BEYL 2YC1A 4ABUA 2Q86A 4PWJA 2CRMA 1IEAA 3BESR 1D5ZA 2PYFB 3UJTL 4AEHL 5DJZA 1VFBA 2LHAA 5BOPA 1ZVSB 3HI1B 1GGCL 4BFFA 2CE6A 1I85A 3VRIB 4PJCE 3WAJA 2HKFL 4PV8A 4ICWA 4BFRA 5FHBH 4Y4HA 2YMXL 1U95B 4P5TA 2YGNA 3WSQL 1FHGA 3K2UH 4E2OA 1A6TB 3LS5L 4RETB 1HJBC 2AJYH 4F9LC 4NSKA 4DN3H 5C71A 3MRNB 4HQQL 4LXFA 1MCPH 1JFQH 1IC4L 1ICTA 4FQCH 2H2SC 1GH7A 1WCQA 2JI1A 1ZLVH 5H35A 4MAUL 1LP9B 2Q6WB 2VZSA 5C86A 1EO8H 2OR8A 3D25A 2WXIA 3EAKA 1P84J 3LQAH 4GRWE 4ZX4A 2NYYD 2XPYA 2C9XA 3FOMA 3MLXH 5I15L 4YLBA 4FKHA 2C3XA 3FUMA 4EIGB 5AG9A 3UPRA 3TIEA 4AGNA 1HZKA 2Z93A 1VERA 2PP7A 1KIUB 3NH7H 2VN3A 5IZ7A 4CA4A 1BQKA 4EUPG 3G5YB 2UZYA 2YUVA 3JBG7 4MNQD 4RA3A 4LCCC 2J4WH 5B1CA 3OKYA 1PQZB 5AQ0A 3O2DH 4EBQL 1NGZA 2TRYA 4XX1G 1N0LB 5EPMA 2OYPA 3KYOB 4AEEA 5I23A 2DYPD 3BW9A 3MLRL 4XGZB 4WFHE 1VZIA 1JNHB 3W11D 2NYYC 4KY1L 4QWWC 1WQVT 2W65A 3QE5A 3OR6B 4X7SL 2P9RA 3IF1A 2EDMA 4GAJH 3GSOB 1IKOP 4I8DA 1M3IA 4OIFA 1NUNB 3HNTH 5F88B 3X1NA 3L3DA 5DUPH 3PHQB 3OPZH 1MOEA 3TT1H 1NLBL 5JR1L 4FF9A 3BLKA 1ONQA 5I18H 3UTTB 2TSAA 2X70A 4WO0A 3HE7B 3FRUA 3NCJL 3F12B 3QRLA 3VA6A 4TKWA 3X1EA 4F8QA 5LQBH 2X2JA 4JE0A 2QELA 4XPFH 4XP6L 3TA4D 1GIGH 5IBUB 4A2DA 2YKKA 2EKJA 1FDLL 3HG3A 3K6SB 4NDMB 4PRBA 3ARPA 5DEZA 3CH1A 3QJVB 3QPXH 2E47A 4WV1B 3LSOB 1BWWA 1C12A 3IJYB 3Q5OA 3CZGA 4S0SD 2LVCA 4JPIA 4FG2A 2NQCA 3E80A 4PWKA 4R0LB 4U3CA 5AVRB 3PDOB 4P5MB 4BK4A 5D7KE 4NX0A 4RRPA 1WZMA 4G8EB 3TWYA 3R0NA 5EWIL 5EU4A 1M7UA 4H8QA 1KGUA 3UFIA 1YUHA 4NUJB 4LSRL 1F58L 4TQIA 4MXVE 1AQMA 2V2WA 5F7AA 1F4WL 4C57C 1ZA3B 1BFVL 4EI5B 5F3HB 5BQ7B 4AQ1C 2Z8RA 3T4AA 1DLFH 2CJSA 2CRIA 1XGRA 5DTFB 3UYRH 5HHXL 5JZ7C 4P4RB 5ESAB 2CMRH 1NKGA 4J2QA 4RGOH 3HIZA 3H42L 1KB5L 43CAA 4AMWA 4NZJA 1I8LC 1JDCA 3KPSD 2CNZA 3MRGA 4WWKA 3GLAA 1PAMA 1IAKA 3EDKA 3K6NA 4AEIL 1FIGL 1VDGA 5CIPB 4B5ZA 2AABL 5E4IA 2VDKH 4ZQKA 1EAJA 2QSCH 5HHMD 4HIXH 3GF8A 3ZZ1A 1JNLL 2HRPH 5L9DH 3JTBA 3GI9H 1PX4A 1SHXA 2OYLA 4FQIL 3BE1L 1XMEB 3CZEA 4KK6D 1HDMA 2IDCA 1OF2A 4F8LA 3BGMA 1SQMA 5L88H 1W15A 4MCZA 4OGXL 2XZAH 4HPYL 1CPUA 3BZEA 3P0GB 4N0UB 4U1SA 3HG1B 4UV4H 3EH1A 3MYJB 1BWMA 2A6DB 4KTEL 4LMQE 1L9SA 2ZJSH 4MMZC 3AREA 2ZKYA 2X3AA 3TYFA 4NQDB 3H6AA 3MCG1 2WLKA 4HFWB 5D70L 4OF5A 1DE4B 3RDTA 4M61B 3T6ZA 2RH0A 3F85A 5T1KD 3TVMB 2VDLH 4JPWH 2VSMB 5G2NA 4DO5A 5EIIG 4TQ8A 1HEJC 3PJSA 4FI8A 2XIIA 3QIWC 2EDWA 3GMPB 2DTSA 4HJ0D 4Q4EA 4X4KA 3O4LA 3ZBMA 5I75C 4DERA 1YEGH 1BQHB 3MKGA 1JV5B 1QP1A 4OD2A 1UWFA 2OJZH 4J27A 3STLA 5E2JA 3NQKA 3F6JA 3EO9L 3V0JA 3FMGH 4UT7H 3H2WA 3CK0L 2EIZA 3MJ8B 1I7TB 1F3DH 2Z7YA 3BKCL 3DMMD 1OW0C 4ZNEE 1KBWA 2FUTA 3FZUC 2WCPA 4XMTA 1S6NA 3VQ1C 4ZTPL 3T8VA 5MERA 2AXGB 1U93A 4MD5B 1OGTA 5JNYB 2BMKA 3VDAA 3IGFA 3GGWB 1DUZB 2JTYA 3FU6A 4NN6B 3VUAA 5LN8A 4HH8A 1JYNA 5IMOA 3V7MA 3SQOH 2ADGB 3T2OA 4GLRI 3FTWA 3QB7C 3F62A 4NUGL 2EEDA 2HMIC 3V0GA 3L5JA 5CEZL 1KCVH 2TRHA 1T1ZB 3MTRA 1MCHA 2VLMD 3H54A 3NCMA 3SGKA 3MV8B 5J06A 2FWSA 2C34A 2C5DC 2VCOA 4IM8A 2G4GA 3RVVD 1F2QA 1JPFB 1Y6MR 3BI9X 1CLZH 1U36A 4ZMYA 1X6LA 2HN7A 3DPBB 5DRZA 4EQ2A 2XYCA 4XNQB 1VFOA 1X5ZA 2MFNA 4MVBD 4Y1TA 5DZNA 4ZW5A 5IMLB 5LGKA 2OLDA 2W91A 3QQDA 4I89A 4K4KA 1QR4A 1I8UA 4HQQH 4P05A 1A22B 3EYFB 3L4TA 4PS7A 4U31A 2J25A 2W07B 1BFOA 3QDMD 3FRPB 5B1JC 1BEXA 1KPUB 4XMZA 4F5CE 4GP8B 1NGYA 4M8VA 4PV9B 3QQ4B 4GKOA 3ARBA 5EU6E 3QDHA 5CJOL 2ENYA 4GKNB 1TVHA 5FYJL 3QIBA 4FFYH 4YS4A 2WSPA 4BRJA 1MNUH 3LZOA 5HDBE 3A6OA 4WW2A 4JL1A 3HZ3A 1UD8A 1XF4B 4WRLA 3WO4B 3LZNA 3BZFA 4A67A 4P23B 2X4UB 3G5ZA 1MAML 4ATTA 4IRJD 1P7QA 3V6BR 2BSTB 1YPZE 4XH2B 3ZT6A 1N0XL 2Y5EA 1ADQH 4DKEL 4KDTA 2ADJB 2NT0A 2KQNA 4ZTOH 2GTQA 5DJ6B 1NAMA 1QLRA 3AVEA 1AIZA 1PKQB 4TVPL 4XP4L 4LLQA 2IGFH 5CU5A 4IRJB 4G6KH 5K9JL 4OCWH 3A4EA 1IB5A 5JHLL 1AXSA 3UO8B 3ULVC 1D5MA 4QRUA 1AHWA 1ETA1 4WI6A 1G9EA 1S8DA 1CU4L 4WFGD 2KERA 1URLA 5HXMA 1KGCE 4U3SB 3ABMB 4GRMB 4PJGB 4XO4A 5HHPA 3B9KC 1ZHNB 3L7FA 2AC0A 4ELMF 1CF8L 1J0JA 4FNLH 3EH3B 4KZDH 2X5PA 2Q8AL 1UFUA 1Y07A 2DTML 3QNZA 4JJ5B 5F0PB 2AEOA 5FGCE 3T3MF 2CM6A 3WFDH 5ABZA 3CFTA 3V4UH 2OP4L 4TVPD 5IHUH 2WO3B 3HPJB 4Z7VB 3VRLF 1WCBB 1FNLA 2HMID 3FSWA 4JG0L 1VHPA 5EBLB 3W1ZA 3F2LA 4EZKA 5IVNA 3RP1A 3ELQA 3QNXA 1J11A 3WKPA 5ADPL 2BSDA 4F7CA 4DEWA 5FB8A 3WN5A 1IQWL 3C09C 1SJHB 1U3HB 3VSUA 4LLVB 1E6JH 1JGUL 1NCAH 3MOBL 2F8VA 3DHMA 4HS3A 3B1TA 1N7ML 2APTA 2MCAA 1CGVA 5B38A 4MRCA 1OPGL 3L7EA 5K9QI 1CYGA 4JFFD 4M00A 1DQLH 1TZ8A 2VE6A 1FVCB 3GBMH 2MMXA 5CCHE 3WEBA 3BQUC 4ANXA 3KLHC 3IDIB 5T1KA 4LNRA 3TO2A 4E41B 4GG8B 4HETA 2DEXX 3VWJD 3QNYB 4CKQA 2A74C 3FFCA 5HYQA 1ACZA 3MLSH 1GTFA 2EYTA 4XCFH 1E4KC 1A14H 1FCCA 3BKML 3C9NB 4G7RB 2B08A 1Y0LB 1GKEA 3EJYD 1ZANH 1KYDA 2ENJA 4U1KA 5GGRB 3O2VL 3TBYB 2OMTB 5JW4M 3VD0A 1X7TA 3QG6A 2ZAIA 4IKNA 5C0AD 1AGDB 1C5BL 4X5QA 4JS7A 3UMNA 2NSMA 3VM5A 2WP3O 3H9SA 3ARBD 1FORL 3ZDYF 3O3BA 4FQPA 1BVNT 3HKZA 1JPSL 2JKJA 5HHOB 2ENSA 5G5DA 4MHHI 3RPIA 1KEML 4HKXA 3GBML 4YFEA 3G6JB 4OV5B 2O93L 2G5BB 2CHWA 4IOIA 4R90H 2YR3A 2BERA 2QVKA 4X0NA 1CI3M 2F8OA 5F0LB 3HZVB 1BMZA 4PCKA 4ELMB 4EEEA 4ZXBB 1M05B 3B2PA 2IOOA 3BPLC 2ORBH 2VDNL 4PJEA 4Z3FA 3QI9D 4JY6B 5JA9A 3O41A 2KLSA 3LEYH 4ALAH 4JFHE 1SZNA 1J9TA 1QBBA 4NNYA 2R0KH 5DRXA 1ET5A 3SDXF 2VH5L 5B7MA 3OPUA 3ZGIA 2HAZA 5IB5B 2NLJA 3QAZC 4P2QB 3CG8A 3S7GA 2UZPA 4DT2A 1BJ8A 2IXQA 4XAKD 5DLLA 3II3A 3CBRA 4GOSA 1NPUA 2WKOF 4XWOC 5AW8B 3WJMA 1OAUH 3V6FA 1JIBA 5INCB 2DTMH 5TD4A 1BSIA 2OSWA 1IM3A 2GC7C 2VR7A 2YAHA 4MJ5B 2VLJA 1UADC 5H2BB 3FHEA 3X1BA 4BWUA 4Z8FH 4YK4C 1AZNA 4HJJH 5SWZD 1J1XL 3EFOB 1QAWA 2V8MA 3MV8E 4TLKA 4OZHA 3WTXA 1XZ0B 4Z76B 2XXMB 4JFQB 3RBSA 2X88A 3B8SA 3MJWA 5DGQA 3MBXH 3COOA 4ZMLA 1OVZA 2DH3A 5SV4A 2V37A 4X9IA 3GUTA 5EBWA 3VMPA 4ANWA 5TDPA 1SYVB 1SUHA 1DQML 2R1YB 3BZ4A 5HGHA 5GS2H 1XCTB 1MFBL 3MRCB 1CFVL 3HKFA 4LP4A 2YBRA 1E2VA 4NN7C 4WI3A 3ZT7A 1X5KA 1E43A 1CD8A 2Q87A 1K8IA 3RNKB 1U6AH 3PU7A 5C6PB 5I1HL 2IH3A 3K3QA 3L9RB 2JIXD 3CN2A 4ZDHB 5E9DA 2DYPA 1I8MA 1NAMH 2CHZA 1WFMA 3IPBA 5IEHB 3KWTA 3IU3A 1AOHA 1QYGL 2VISA 1FP5A 3IMSA 5LAXB 1G9NH 1YEJL 3QGVA 4LDEB 4XOBA 2W38A 3P4OB 2R2BA 4MNHB 1N8OE 4I0PC 3PHAA 3W37A 3A4FA 4N25A 3P73A 1DBAH 5SWQA 4FCAA 1IC1A 4G80B 1I31A 5D5MF 3SKMA 3PWPB 3U9PL 4X6FB 5HGBA 3MLWL 3GXIA 3JTSA 5CEZD 4PG2C 4IBVA 4OLYL 3S5LB 5D4JA 1LNUA 2VIRA 2B4CH 5EF0A 5KW9H 4PJAA 4JB9L 5B3NA 2J8UF 3KLQA 4E5XB 1U41A 2HKAA 4QHKJ 3OJDB 3W2DL 4M62L 5DZ9A 3NK4A 2GI7A 4NI6A 4PV1C 5LXVA 4B9CA 4AEFA 4I48B 2ZOOA 2FX9L 3SYPA 2L8AA 2WYIA 2FEDC 4N22A 2VUYA 1IKNC 3B3BA 4PGCB 1PZSA 1UH4A 2G2RB 2QPSA 2KYIA 1UD6A 5AB0A 4H26B 1KFGA 2JELL 3DX9A 3DVGA 3DUSA 1FNEB 2A9CA 1Q90A 2OKMA 2B9AA 2V3EA 1IX2A 3FSOA 4ONGH 3EJCA 5AB1A 2WBJB 4LHQB 4N2NA 4Y1AA 3HC0A 4K5OA 4P2AA 3MCLH 1LO5B 2E74C 2QLYA 3CMGA 1NGPL 1TTBA 3FNKA 2CO4A 4JO3L 4NLHA 4DAGH 3MBXL 3M46A 1QKZH 5KSAA 1FZKA 5C0GA 5EORL 3O2WH 1FE8H 5JHMA 4JO1H 4JHAL 1O6TA 1BFTA 4OZ4B 4B0MB 3PP3K 2PNDA 4LVOB 4LBEA 3V9CA 2XZQH 2ZXDA 2H9GA 3GT6A 5E08L 3HR5B 1NKRA 5BVJA 5I71B 5J11B 1YY8B 1XSKA 1T22A 2A7BA 4K7PX 3T5WA 2Y1ZA 3QQXA 4DQAA 2GFBA 2HRHA 5D1XD 4EI5D 5IBLD 4PIRF 1VAHA 1UD2A 1M7DB 3QDJA 4UDTA 3MBWA 3R06B 4GW1A 4JDVB 4Y9EA 5AVXB 2VQ1B 1RUQH 2OZ4H 1TZIB 3M17A 1MWOA 1TO5A 4JM0A 1NCIA 4GAGL 3G08B 4GBXD 4XMPL 4OD3H 3QWNA 1S7QA 4HMCA 4K5MA 1U9KA 2ZAGA 3NTCH 4YR6B 3TX4A 3WCYA 1CT8B 2BIQA 5DHVH 2C9PA 3VG0H 3EJJX 5ESVA 4NC1C 3BWSA 3T6WA 1AG0A 3SGDH 3P3SA 2VN4A 2WLJA 3U7YL 5I6KA 1NC4B 2JKIS 3SDAB 1C8PA 2CDGA 2KH2B 3QCVL 3SPIA 2X4RB 3W9DA 1ID5I 3VGFA 2K0RA 5FO9A 1ZY9A 2FX8H 1E30A 1SXSA 1A7QL 2XA3A 1RULH 2YRBA 3MC0A 3PABA 4MKMA 5AYUH 5BZWB 1RY7B 5L4IA 4A7GF 4L29A 3LKPB 2NUTB 3PWVA 4L23A 3WENA 1MLBB 4PRID 2BIIA 2AJZA 2H6PB 1H5BC 5JPNB 4YDIL 1WF5A 4WCYL 2I07B 3SDYL 3OX8B 3A3YB 5D7JC 1WIUA 4PJ9A 5F0MB 3MR9B 3EBIA 2GKIA 5IJDC 3LIZA 4U33A 4ZYKA 1QSZA 2AJ3A 4M43L 4XCCH 5EOQL 5IMMB 3RGHA 4FGMA 2BOCA 4PH8A 4XB8A 5DHMC 2X12A 4MD4A 4Y7MA 3ZUCA 5IQOA 4O2CA 3B83A 5TF1L 4AGPA 3DMMA 4WEUD 5AZUA 1S4IA 5JQ6H 5GISH 3NFSL 1PZ5A 5GZNC 1SEQH 2FB4H 1L9PA 5DYFA 1S78C 2VDLB 3K81A 2WKOA 3AABA 1MFNA 1KTJA 3FQTB 4LKCA 3RKDC 3SDCC 2JQAA 4AQ1B 1NZRA 2QQLL 2PWHA 4X8XA 3D87B 2BY2A 4ZSOE 3QO0A 3LHAA 1DSFH 4GAYB 3QORA 1AY1H 5KZCD 1P7KB 2E3VA 1XSIA 2ARJA 1IKFL 3MLZH 1ZGLP 1UYWL 4M1CD 1HZLA 3HG5A 2I7SA 1E4JA 1LO2L 1WFNA 3VXTA 4NAQA 5GRJH 5JTWA 3E7JA 2ZUWA 3RWGB 3VXSE 5C0CE 3P69A 3C60C 3F3HA 1PDKB 1G5AA 1TTGA 3QZLA 4L4VB 3C75A 2X4PB 4ZX3A 1E6OH 3KJ4B 4JKWA 1EEZB 1XGPA 4Q52A 3ZE0F 3NCWA 3NEXA 4WIQA 5MENE 1F45A 1AZZC 4NHCL 1QWNA 3M1OA 3VFUA 4RGNE 1IGTA 2DLEA 3BPCB 3PQYB 5F1NA 1OAYH 4HJ1A 1W8OA 4HK3N 4J8QA 1OGAE 5D7HA 4OQTH 1AZRA 2KDYA 4HJEA 1A9EA 2WIMA 4YDVB 3RL1A 4IIQB 2NY1D 2X0UA 2W92A 1S9VB 4WKXA 4M5YL 4UB0H 3MUY1 3HAEG 1RK0B 4CBZA 1TTAA 4OF3A 1F6LL 4Z7VE 5EV7A 2IDUA 3RWCB 5HYSB 4CN4A 3IMVA 4EO5A 1MHPL 2ZUQB 1MHHB 1G7MA 1PY0A 2AK1L 1CTNA 2DD8L 3HVDA 3C8DA 3EHBC 4H2CA 3U25A 2VLKE 3SD5A 1I9EA 3KVPA 5B1AB 2A6IA 5KBDA 1CDCA 2PR4L 3QIWA 2WCSA 3KDMB 4HIHB 4ORGB 3O6ML 4JDEA 2R69A 3WNMA 4MA1B 5EZLB 3UC0H 4TNWK 1WYJA 3A23A 2X2HA 4NBXB 1YDPA 5FC9A 1BQLH 2X4TA 4LLYB 4EI6B 4M6NL 3STBA 4JFPB 4YHML 4M6ML 3RIAK 3RTLA 3LQAC 4MBRA 1RZ8B 4LZKA 4MGXA 4JFXB 2IGTA 1HAWA 2ERJC 2OMZA 3OKMA 4W1TA 1DVQA 1N67A 4IOFD 4ODVH 3GXTA 4NKDB 2A3TA 2O1AA 2P80A 3WXWL 5A16A 2EP6A 1PFCA 2QQLH 4RLDA 3GRGA 3H56A 1NMCB 3DXAB 3BE1H 3RB5A 3A0OA 4O2FB 2OK0L 2W95A 5CKAA 3BZDA 5DD0H 4Z5RA 3FQYA 3ARUA 3PWLA 1IC7L 5ID1A 3WJJA 5T1DL 2EO7A 5EIIA 4X4ME 1BIHA 4OF0A 4MAYB 5BXFB 2L7QA 3ZY7A 2JFCA 4JRYB 1OM3H 1AFVH 3ARVA 3CDGA 3DI2B 5DFWH 2YQ2A 2XHNA 3LRSA 2A9NH 2QSTA 4DVBB 2E6QA 4LLMA 2VKXA 2PN5A 1JNJA 5MP6L 1XF2B 2HT3D 4AE1A 3BUIA 2NY4B 4LDLB 3OJVC 2AJYL 3KCPB 1CFQB 4U7MA 4XBMA 1ZLVK 3O6LL 2D9CA 2CK2A 4OM0L 2Z7UA 3DSFL 3DRTB 4N2CA 4LESA 1JTTA 4AVKA 5E8PA 5FYJU 2V33A 3RAJL 1F8TH 1MCNA 3VYOA 3LB6D 2ZCZA 2CCVA 2OJEB 4IRJC 2D2CC 3V55A 1YEKL 3DVNB 3RVUD 5BRPA 3RURA 5E2VH 1PZ2A 1SMDA 3NAAL 2FJHB 2WXNA 4NN5B 4LCUB 4YXHL 3MRRB 3QCVH 1F6AA 2BW4A 3WE1A 3C2AH 4HUWA 1ZSDA 1HH9B 3IJ9A 5AZEL 4A66A 3KPQA 4M1GL 1WC7A 4WTZG 2XZAL 4KKCD 2B16A 1S2EA 2XPGB 2ZOKA 1HYSC 3L3JA 4PREA 3K2MC 1AO7A 3CN0A 4NXKA 1XH2A 4GSQA 3AAZA 4R9HA 3H55A 4FQHB 2ITCA 3GINA 3SPGA 3C8KA 1TMCB 5T5FL 4XO9A 4BA8A 4NQEE 3GZQA 4WK0B 4ZAKB 1YECL 4QPEA 5HBBA 3L08A 4JW3A 1P5VA 4K3EL 1XCXA 3RUGB 5F1SA 3UGUA 3NJGA 5JW5B 4NQXA 1A3RH 4CN6A 2ATKA 3RVVC 3WIIL 4XPGH 3NACH 1YEIH 3ZOAA 2YWYA 3D3VB 5DRWA 2V3FA 1V3MA 3LQZA 5FYKU 1SRDA 2FNBA 4UDUB 3EFFB 4AYDC 1CLYL 1V7ML 3F7YA 3VXNB 3CPLB 5ANHA 5FYJE 3FQNB 3GBNH 1JD9A 5AW5B 2G75B 5IB2A 4U1JA 2IAMB 3BWUC 3UO1L 2P52A 2GUYA 3VD1A 4N26A 3ZSTA 4A7VA 3NJHA 1V5JA 1EAPB 1MRDH 1UZ8A 2HKHL 2Y5QA 1C5DB 1DVFC 2YIHA 3D9AH 4MJ6A 4P59L 4YDLC 1TQSA 4BSVB 2IOMA 1T3FA 4J1UB 1WWAX 5ICZB 3R18A 3PCYA 2F54D 1T4KA 5ALCH 4NWTL 3HJ0A 1ED3A 4WUKH 1KTLB 4B53A 3ZYJA 2ZYSA 5CCKH 1GA2A 3V79C 1E8YA 4XCEB 1PG7H 2NNXA 4CU7A 1XXDC 1UWGH 1X5LA 3MV7A 3VGAC 5D2LB 2JE8A 4J3OG 3RQ3A 1TYEB 1U8LB 2QVTA 3KM1A 1T5WB 1I9IH 2NX5B 1CL7I 2WANA 3MLUL 4OV6F 2XJLA 4NYLB 5GSVA 3SE9H 1BYPA 4KJWD 1T21A 1UJ3C 2JIXA 5AALA 4TV3A 2VITA 2Y1VA 2F7IA 3AY4A 1L6PA 2Q7YB 1TU2A 2P5ED 1COBA 4F1ZA 1U8OA 3PF2A 5CR1A 5HP5A 3TEWA 3PIQA 1PL3A 2Z34A 5I6PA 1AS7A 3AG2B 3MJ9H 4L37B 4TNVF 3HUJA 1B6DA 4UZSA 5EO9B 1GJIA 3U0PB 3QEQA 4I2XA 1I3RA 1ESOA 3UAJD 3IEAA 3S3BB 3S35H 4YDLB 5I6MA 4MMZB 2EUXA 1FFNA 3HCVB 3SD2A 2WLZA 1A1OB 3KH4A 1SGKA 4FABL 2ZIDA 4P0DA 2C4XA 3WKQA 4ERSH 2GB2A 3DX0A 4PJGE 5E8NA 4DH2A 1SXAA 5KS9B 3H6JA 1V8HA 1ET7A 2WV3A 2Z1PA 1K4CA 2H8PA 3I3BA 4JQIH 3H7BB 5KANG 1JWUB 4JHBA 4N1HB 1HNYA 3TWCL 2XT1B 2YO3A 3ABZA 4I88A 1QLFB 1JXFA 4P2RD 2CBTA 2HFTA 4WUUA 2HJFA 3MGTA 4UT9A 5E8EA 4AQ8C 1NMAL 4B9FA 2IMNA 1QZNA 3OAWA 3ULUL 4ZPTB 2GT9B 4K5PA 5I66B 3WBDA 3D85D 1AKJB 3QA3A 3HE6D 1YEIL 3E1ZA 1CGSH 1TFPA 2N3JA 2XTJE 4FFYA 1ZDQA 2BNUA 2EZ0D 2Z92B 4WJG3 3WFCH 2CKBA 3IE4A 1IZJA 1EHXA 2NW2B 1IKNA 4QGTA 4F2ME 4Q14A 4N6QA 2DL2A 4KV5E 4POZC 1EBAA 2YN3A 1QWHA 1U91B 2GEEA 3FTUA 4HWZA 2WNKA 2ZYRA 2NY2D 1BFSA 2L4OA 2ARJQ 2Q76A 2UWEF 4NCC2 2Y23A 4QYAA 2ZX6A 4NFBA 1OK0A 1MUJB 3ZUNC 2KL6A 3D2UA 2JXMA 2VLLA 5SV3A 4ZOCA 3BHBB 4Y2DB 1E6JL 4PCYA 3G9VA 1S3KH 2BIOA 3LRHA 4A2MA 1F90L 3ARDD 3Q8CA 1HXYB 1RI8A 4UT6L 3WNJA 3WE6A 2I85A 2J71A 3OKKA 3PL6B 4R90L 1YUKB 3AQDA 5A7EA 1RUML 3ETBJ 4OZHF 3BEWB 3T6QC 1WBZB 3V0EA 1RLWA 2Y5TA 5EU6B 5E1IA 3SQBB 2PCFA 1R5IA 1LEGA 4WVRA 1U8PB 3FUKA 5HDQH 5L0QC 4P2OC 2XBDA 3FQUA 3H9SE 2ICEC 2AJUL 1B9ZA 3GSNL 1AGCB 1RD6A 4TUOB 1WZ1H 3CLWA 4QJ3B 4PMFA 2YK1L 3SY0A 1PF3A 2Y7MA 2OMXA 1E7VA 3Q1EA 4UINL 5CKGA 2PWFA 1W8NA 1PX8A 2HWZL 4GW5B 2ADIA 2OQJB 5CBAB 1F3JA 3F83A 3FZUD 3INUH 3OG6B 4Y5VB 3AQZA 1QQDB 1VPOL 2APBA 4PJXB 3CX5J 3RPKA 4EKJA 2DWDA 1NGXA 1IGYB 3KW8A 1A7PL 4Y4FD 5SX4H 4X5RA 2AF2A 4X6DA 4OJDH 5LGYA 1V05A 2BVQA 1F4XL 2R8SH 2EAEA 4JAMB 5J1SC 3BSHA 4PUBH 5IK3A 2EYRB 3IKCB 3MRLB 3IXTB 4AIZA 5H35B 3U2SB 1B88A 4RFNC 1I1CA 4HEPA 5CINL 3T08A 1UM4H 5FO7B 4QXUH 3IJHA 5T3XD 5EO0A 1RHFA 3FSAA 4HEME 3EGSA 4E41E 5H8DA 2ZT9C 1AIFA 4D9QD 5E0FA 4ZJ9A 1HCZA 3MV7E 1UM5L 1GW6A 3OWEA 2QQKL 5CWSA 5G55A 3WIAA 4HSCX 4XHJD 1FLRH 3EDFA 2WCGA 1LE5A 1G1YA 2EXYD 4NQSB 1Y7VA 2OXGA 1PQZA 3UPAA 2GJ6E 4ZUWB 4P46A 4WK4B 3APNA 1I4FA 4FKKA 3JVGA 3CCHA 5EOCL 5DS8A 3OGCB 5FWRA 4EDXB 4OAWB 1SJVA 3OAYK 1EBPA 4OD1H 4ZMXA 4KKBD 1ZE3C 1XCQB 1X7SA 3VH8A 4HWBL 5HHOD 3DTDA 3HC3H 5GGVL 2VDQB 4EKXA 4MJIE 3HE7D 4BGLA 1EVTC 2P28B 3ISRA 3O8XC 2PXYD 4WHYG 1EHNA 3BAYA 5F7FA 3KLSA 3D0LB 1FNAA 4CNIA 4QRTA 2B1HL 1H8NA 3HZMA 4M1DH 1NCBL 4QHNB 5TDNA 3DSNA 3WIHL 4P9MH 2IGFL 4ZS6D 5EFIB 4U6XA 5KYYA 4A04A 3GBLA 3UROR 3JV5A 2F9BT 3QFJD 1BVLA 3A21A 1AACA 2IF7A 1D5XA 3T2NL 2RQEA 5FFOA 4MQTB 1J8HB 3K1DA 2EE0A 4BWTA 5ICYB 5E6ID 1MWAA 1S7TA 2X4QB 3CFKB 2GIYA 4H4NA 4HCGA 4IBYA 1R34A 2G60L 2CR0A 3A6CL 4J3VA 5DJDB 1T6VN 3MRMA 4EZMA 1XTMA 4HKBA 2VDRB 4MJIA 4Y5XC 3WTSA 1CE6B 4Z7UB 3L5WA 1MHCB 2PXYB 1E5BA 3CC5A 4PS8A 3F04A 3ARFA 2GG1A 4NZUL 1XL4A 5DVMA 1YHPA 5E1AA 3ZQWA 2NY5C 4AW7A 4YHOH 5TK2A 4FHKA 3EYOA 3QJFA 1CDIA 1SN2A 4G1EB 4FS0A 1FFOA 3ZTNH 4KK6C 3PXJA 1HZHL 1AD9A 4X7TB 2WUBL 5A2KH 3H9HB 5CGYC 4M5ZL 1ZHLA 4ISVB 1M6OA 5D8JL 3TIDA 2ZCKL 2N7BA 4NHUB 1T7XA 1A5FH 4LSTH 2XTJB 3ERXA 3SDXE 4YHKL 2YPLA 5I1CL 2QVIA 2WWNA 3OVUB 4YHLH 1X9LA 1RZ7H 5CSBA 2Q5BA 5E8OB 2GPZA 4YQXL 2F5BL 4OW6A 1MJ7H 4OIIH 1BW8A 2QSCL 4NM4H 1S7WA 1HQ4B 3Q8AA 4IDJH 3OMAB 4ZO6A 3W9EB 4D8OA 5DK2A 3SKJH 4BKLB 4UTBA 3TYFB 3LKQA 1OAJA 3LN9A 5LB1A 1P5UC 4KKAC 5DYOB 3E9TA 3JWDH 1G7HA 3BKCH 2EE2A 4NO5A 1OM9A 3VAEA 2JCCF 4OGYL 3RWIB 4QF1B 1BQLL 3EO9H 3VXRA 1JZIA 5ECJE 5BS0D 2F61A 1FN4B 1U0QA 4AZ8A 3MLRH 5D55A 1CMOA 1E9OB 1BZOA 1EEYB 4I4WA 5DD0L 1PYWB 2P24B 3Q01A 1BZ7B 1UZGA 2R39A 1A0QH 2XNAB 2MWCA 2XKNB 4KI5F 4NQEB 1RZFH 1KGYE 2BY0A 2R4RL 2VM4A 3G5VA 4GG6B 1I85C 2XQBH 1LYQA 3MV9A 4YO0A 3VRJA 4J5VA 3HHRB 1EV2E 2B1HH 5E4AA 1PZBA 1KB9K 1JXDA 2C9SA 4JANB 4KHTH 4KROB 4TVSa 4OZFG 5C3IA 2AQ1A 3EFDH 1IGMH 5C07E 3CZNA 3C6LA 4NQQA 2QR0B 2R23A 4WNJA 3EF4A 4AZUA 2AW2A 3HI6L 3V0DA 4ZTOL 3BP6B 4OGXH 4GFXA 4H20H 3WUZA 2P3YA 2XQYK 4FNUA 2V17H 4DN3L 3QWQB 2GJ6A 4ZMVA 3INOA 4RRPG 5AOIA 3C5JA 3TYGH 1Q0YH 3HC4L 3L3IB 4PGDB 3QNFA 3S5YA 2J1ZA 3KPSA 4GMSH 4FHJA 2O26U 3D4ZA 4G6FD 4PJDA 3ZVVA 4BZ1H 1XB8A 5EEWA 2VRKA 3B3IB 5AAWC 4HXAH 4PLJC 4ZW6A 1P4LB 4Y19D 3CTTA 2YWZA 5DRZB 4DWHA 3L9EA 4N9OB 3OKNA 1ACYH 4FXKA 1GS8A 4QRRD 5HJ3B 4RFEB 2AQ2A 3IGAA 3MX0A 1JI1A 4LKXB 5MENA 3QIBD 4L4VE 2WZ0A 5BJTA 5K5YA 1CFTA 2EXTA 4PGEB 4YE0A 1KLGB 3GD1C 2RFXA 5IQ9A 1RQ5A 4LLWB 4Q97A 5CD3B 3D34A 5CP7A 2WQWA 2YHGA 1UUSA 1L9TA 5HYEA 3NPZB 1AGFA 5KVGE 3GKWL 4PUBL 5F89B 2NTFA 1FO0A 4QAMB 3HAEA 3WY2A 4GINA 1YEHH 4XOCA 1P5UB 4PJ5D 1ZTXL 4LRNH 4GKZA 4D0BA 3RKDD 4J12A 1DSFL 2F54B 2W0FA 1RL1A 4PJBA 4PJIE 1DVYA 2GBTA 2XSKA 4XCYB 4PTTB 2F8XC 3AWGA 3O3AB 4M62H 2YD4A 3LYRA 3TN0B 4KOBA 4P9HC 2N59A 4OD3L 5IW1A 3B4NA 2DWEB 3G3LA 4TULH 4D7BA 4FFZA 3RDTC 5C09A 1NFDA 1QLRB 1M1XA 1C1EL 3HFFA 4HUUB 3VSQA 5KBLA 4FTVE 3QS3A 3GHBH 4Y4FB 3F00A 3BD5A 4L1SA 2I32A 4U1NB 1BAWA 1WD9A 3FCSA 4NGHL 3IDXH 2YMXH 2R2EA 4ONHA 1FO0H 3NSDA 2R0WL 2WBKA 3GO1L 4XE5B 5L7XL 2X7LA 4NO2A 3LNIA 5HHPB 4PJFF 1BD2A 4Z7NB 4FLHA 3PWUA 3PXHA 3NQIA 3ULSB 1KPRA 3GXUB 1Q0YL 1IZKA 1RZGB 1S7VA 5AYQA 1PZCA 3ZKMC 5K9KA 3BUPA 1XIWD 3ILQD 3MV9D 3IDGA 3HPJA 2A9DA 2DLTA 5T1DH 4GUPA 5DMGD 4F7PA 1MLCA 2LU5A 4UB0L 1EDQA 4JJHA 1T6WA 1XGQA 3M6DA 3QO1B 2V9UA 1WBXB 5TDOA 2MKLC 4PMEA 2HPTA 2QLVB 4F7CB 1UQSA 2ZX5A 3RPBA 1HL4A 3V7AE 1WWWX 4P3DA 3U7WL 5EU5A 5IOPB 3N6YA 3MV11 1NCHA 2HJKA 3HRZA 4GIOA 4R4NC 4RWHA 5F9WB 1TQVA 3CDFA 4XWGL 4MD0A 1YYCA 3CU7A 3QEUA 3AM8C 3MLXL 3G6AB 5CBEB 5IVXB 3FFCD 3K71B 3O0RH 4KK8C 1JNLH 1A6WH 2HRPL 4Q9QL 2D03L 2PPEA 1T80A 3VXMB 2FJFB 4KITB 3S37X 3ZMEA 1F41A 4GUQA 1E9QB 3WY4A 3E38A 3RFZA 4LO9A 3VJ6B 3OLDA 1MCOL 4MNQE 3MRPA 2NY6D 4HXAL 2IANA 3VDCA 1MF2H 1X7QA 1ETZB 3D3VD 4OKVB 3CU1A 3TPUA 1EGJA 5F7EL 3QUYA 1BPLB 1SHWA 3QG6B 4CMHC 3BDXA 2WC7A 3WFEL 2YUXA 1AGDA 4F58H 3V7AG 2G4EA 3WHE0 3PWJA 1KTRL 3ZDZF 4G9FE 3QRFM 3L3GA 1NFIA 5C0JB 3HUJE 3LS4L 4UBDD 4AV5A 2Z35A 3GS7A 1ZEAL 4IKLA 1DL7H 1YEDA 1ZGLM 1ORQA 1U8NA 2AXFB 1DQVA 1KJMA 4U49A 1MFBH 1YQVL 2A0LC 3IU4L 3VXSB 5I1JH 3RWJB 1YMMD 4FEMA 2H6UA 1L0PA 5A6IA 3LKRA 5DK0A 2HT2D 1U8QA 4L3EE 3NCEB 5EZIH 3TZVD 2ENPA 2Z65C 4KKAD 4KQ4L 4HULB 3NSJA 4XP5L 2XZCH 4JN2A 2NY7H 4YIQA 3O4OC 3GI8H 5IKCB 1OTUD 1P1ZA 4GS7B 4ZNCD 3FYIB 4XP6H 3ZIMA 1DQDH 4A2FA 3MLPA 5DRXB 3MJ7B 4HC1H 1NL0H 2LGNA 2XQYA 3V0HA 3KEHA 2VMEA 3DUHA 4FN0A 1KNOA 4HJSA 1BREA 3EGXB 2I24N 3TGXA 2I60H 2OSXA 5DDHB 1A1MA 1WEJH 4ZUVA 2C1PB 5LXGH 2QADD 1E5CA 5GGTL 1JF6A 4NWTH 3HN5A 3L3KB 4X8JB 5FXCH 5LCVL 4UV7H 4PGBA 2BDNL 5I1DB 5FUZH 3GSVB 5E1HB 4Y4KD 4PP1D 3CFDB 4KTDL 3S36X 5EOCJ 5I26A 1VESA 4JFFA 2KUTA 2P5WA 1DUYA 3AMKA 4PIBA 2WYTA 5CLTA 4ZOEA 3VFWA 1AY1L 2Q1EA 4UQEA 2EVIA 3OZ9H 5BS0A 2XV3A 4EBQH 3MRJB 3EO1A 2RR3A 1U3ZA 2CGRH 1EFQA 4KVCH 1UXWA 4ZFOB 3VD9A 2XN0A 4Y2OA 4J4PA 4AQEA 2O30A 1JPST 3MRCA 4N28A 4WW2C 1REIA 3N40F 4NWUL 3T1WA 3U0WH 2BSCA 1FG2A 2AEWA 5F7WC 1UXMA 4C4KO 1F4YH 1WA0X 5TFSL 4WI4A 2WMPA 5IHWA 2QKIA 5DA0B 4RH4A 5IM7A 1PU0A 2IH3B 4YXKL 3TEXA 4C55A 5E6IC 1AH1A 1YEFL 3ZL4L 4C56B 4MZRA 3OM3B 4C83A 5DVPA 2CO3A 3N9GL 2M26A 2A9BA 3V5DB 3K2UL 1CXFA 4P3CH 3FUJA 2Q10A 3DOSA 4OCRL 1L7IH 1N4XH 4OF7A 3LNEA 1L3WA 4CVZA 2FLBT 4BZ2A 1KTDB 1D7CA 3KPMA 2EKSB 4GBXB 3OMIB 5D2NE 1NDMB 1YPZB 1KGIA 3B9EA 4YVNA 4PJAB 4NAJA 1F3RB 2GITB 5D7EA 3VWKD 3P4LA 3UBXI 3PFUA 1AR1D 1Z5HA 4ODWB 4YHYC 4K71B 2W5PA 3P4MA 1KJ2B 3PE9A 4E9YA 3VA2C 3S2AA 1EVUA 1MJUH 1DLHB 2N0KA 4M7KL 1AVAA 5D4HA 4LLDA 4Z3HA 3U30B 4WDIB 4HWNA 3FU0A 3NFPB 5I1KL 1LK2A 2J5LB 5EA0L 5FA4B 4PJ5E 2OBGA 2K6ZA 4QOKD 1OTTD 1FNEA 2B77A 2VXSH 1K4DA 1J8HE 2J6EA 3VFTB 3BISA 5IVZB 5JLZA 1U92B 3BAKA 3KXFB 1DP0A 2F1EA 3S36L 1M42A 3WEMA 4HLJA 5DUBB 4LNVA 1XB6A 1QYGH 1S7XA 4TNGA 1OD7A 3TA3D 4R83A 2CDEB 3TO4C 3U1SH 4FA6A 4Y4HB 1FYHB 1DQDL 3FHAA 3DO4A 3ARGC 2WTPA 3R4DA 5KYUB 4N0FA 3VFMA 3JWOC 3HOGA 4ELDA 3HR6A 4NSKB 1HHHB 4TVPE 4PJEF 4TNWF 4DHLA 3KLHD 3QZPA 1DCEA 3TVMC 2HH0H 4WO4A 4OB5L 3ETSA 4UANA 5I8CA 3QIWD 5CILH 3MNZA 1NC4D 3SDAD 1CGYA 4UOW1 1RIUH 5EC1A 3O6FB 4JFZH 5L4JA 4ZO8A 1F8TL 4IKJA 4Y5YB 3HNSH 1INQA 2L0DA 2WD0A 1QABA 3Q6GL 4NENB 4Z7UE 5F7BA 2VLKA 4ELKB 4BQCA 3OZKA 1MELA 3PAVA 1CLOH 2X4OA 2ZNXA 3ARED 3S6CA 3UACA 1U30A 3BP4B 2P8MB 5FO9B 2VQUA 4XXDA 4UQ9A 4DEPC 4AMKH 3IGKA 1WFUA 1IV8A 1JZJA 2LLLA 2X2YA 4APQA 2ZNWA 4BQBA 1TJGL 2DQIL 3Q2LA 4HD5A 4OTXL 3TJEL 3ZKNC 1NFDF 1NIEA 4N1EA 5JPNA 2EXWC 2MCPL 2ZOWA 3CVHA 4Q9BA 5JIIA 1B0RB 1A6UL 1XD1A 3UTTA 5F70A 3RNQB 2FSDA 4AIXA 2ZJSL 1KXTB 3F12A 5FCUL 2WO4A 4ZX6A 2JB5H 7PCYA 2DRUA 3R7QA 1TLMA 3L13A 2XXCB 1T0PB 4K9JA 4WW1B 1KEGH 3OC8A 1OAKH 1NBCA 5DMJB 4LHUA 2XQBL 1E50A 5J5EA 3MZTA 2H26A 3GMLA 4GRLD 4OUOA 3CXHJ 2BNRD 5D7LE 3NJVA 3EADA 3DECA 2CLRB 1C5CH 2DPKA 4XPTH 3FC8A 4EAEA 3QFDB 3H2PA 4DUWA 8PAZA 4AQ1A 3MRDB 4GFTB 2IPKA 1KENH 3R8BB 1S7SA 2VWEC 3QO0B 1A7OH 3JWNE 1PMYA 2DBLL 5ISZD 1MCKA 4GMTH 4RX4D 2HG0A 1TJHL 1PPIA 4ZODA 4XCNB 5H94A 4KZ0A 4F7MB 4F7KA 4PJIB 3QDJD 4MQ7A 5DHXB 4QTIL 1R3KA 1MIEH 2H1XA 3S5ZA 4PJDF 3DROB 4PTUA 2F8IA 4MLIA 3L6FA 3TOPA 2R27A 3ZMNA 5L8LB 2YBGA 1WITA 5F1IA 4GIAA 2GCYB 5DHYA 1OLLA 1AO7D 4RFOH 5FO2A 5FEBA 1JK9B 4MQSB 3MROB 2VLJD 2X4PA 2XVKA 5MI0B 2VH5H 1XHHA 2WJ5A 2WZ5A 5JOFA 5JHDD 2GSIB 1BAGA 1HCYA 2IFFH 4Y88A 3UTOA 5KYWB 1MCLA 1QASA 4MDJA 2AKRA 1JL8A 3QR2A 3UZQA 3I75A 4MCYB 3RZCD 4E0RB 3ZDZE 4DEPB 2Q86B 1SOSA 3D48R 4MHHG 3W38A 2IAMD 2PYFA 2NX5E 3I6GA 5CEZH 3K0YA 4F92B 1WFJA 4UQCA 4Y9GA 4CADA 5F9OH 1FDLH 3GJFA 4JFED 4L8CB 1K72A 1WISA 2PYED 3STZB 1F56A 3VTTA 1RCYA 2BWQA 3AREB 3CNKA 5FYJD 1DJGA 3MRBA 4WJ5B 4O02B 1FPTH 1LILA 1MI5D 2J6WA 3DBXB 4MQXC 2NXYB 3TT1L 5CCGE 3X12B 5JPMB 2FNWA 2B9BA 4PB9L 3TVMA 3PNWA 1K3ZA 1EUTA 4TULL 2F18A 1UVQA 4HKZA 4OBRA 3WTUA 1LO3L 1NMBL 3GSXB 3ML9A 1UGNA 3RGVB 1W72L 5DHEA 1XEUA 5ITBH 1BA9A 5ALBL 3EDEA 4PJ9C 4GXUM 3KGSA 1FZOA 4I87A 5D2LE 5ICXB 3I9IA 3FULA 4LVEA 3M88A 3NZHH 5HHOE 2PO6A 3NJLA 3DARA 4XXCC 4FG4A 1RZQA 3TIEB 2PCYA 2AK1H 3MREA 1C08A 3MV01 5KUKA 1RZ7L 4X5WB 5IJCC 3EYUH 1EA9C 1P6AB 4H88H 3JV4A 2X0VA 1F2XK 5EUOA 3WDHA 2X3BA 4DEUA 8FABA 1NGZB 4WENB 1DQJA 1N0XH 1UD4A 2GHZA 1EANA 2NY6C 4G3YL 4DP4X 1MVUB 1T83A 3DJ9A 4AJVA 2ICEB 1PIFA 2C1OA 1LP9F 1MZYA 3MUGA 5LG6A 5EOQH 4UV4L 1TVBA 2M8XA 1BLNB 1KBPA 4HZLB 4WJKB 4J3XA 3QCUL 2XXGA 1A3ZA 3QAZB 3HZKA 4KK8D 4TOYL 5BRQA 4DK5A 2BP8B 4IHOB 4ZOAA 2NY4D 2CUMA 5ALBH 2ZUQC 4FXTA 5KVDH 1FO0L 2GW5A 5DR5H 2XQ0A 1JF5A 1XF3B 4LSSH 3GQFA 5B1JA 4DSYA 3MV8A 3N3EA 1HT6A 3NIGF 4UIKL 2H41A 3IN0A 1JPFA 3AC0A 1TETH 1Z7JA 3VI3F 5DCCA 4N2DA 1NGPH 4RRPM 2KQMA 1DQQB 5EO1B 1FIGH 1SUJA 2AXWA 3BLBA 2V5RA 1RU9L 2EDQA 4E9VA 4EIUA 3MAWA 4ZFOL 4OUUB 3AUVA 2A4ZA 3K6SA 3OHXC 2MRYA 1A4BA 3IM1A 4L1DA 5C3TA 3SZKC 4Y16B 4RAHA 3LH9A 1AHKA 3C60A 4WV1A 4LIQL 3QSKB 2NCMA 5JIHA 2H0JA 1ZK9A 2R2HA 4HPYH 3ZKMD 1ORSA 4JPIB 4POUB 1S3RA 4RCAA 5I73C 2UXVA 1QPXA 4HPHA 5KVGL 2IWEA 3JYBA 2C3VB 3VMOA 1DJWA 2WLLB 3QT2A 5JQIB 4RDBA 5I1CH 1XF4A 3IFOB 4NERA 5ADOH 1TJIL 2DS4A 3AS0A 3DUUA 3S3DB 3DIFA 4YSRA 1MJJB 3SKOA 4FQXB 4HUCA 4X6EA 3MLWH 3HMXL 3OMZA 4PRNB 1E4HA 3OB0K 5CJXA 2YAFA 3SE4A 5ENWA 1I82A 4QO1A 1FG9C 4J8RA 5I15H 2K3TA 3RWFA 1T66C 3KPQB 4FNTA 2VW4A 5IIEB 1UD3A 4G9DB 4ZMPA 1LLAA 3RX8A 4P4RA 5ESAA 3ZKQD 1KELL 4HP5A 1M7IB 2OX5A 4I77H 3FCTA 4JO1L 2L7UA 1NDGB 5D7JD 3S0PA 4PS3A 1F4WH 3OTTA 3UDWA 4L4TD 3LS5H 4K8RH 1J1PL 3L2LA 4ZQKB 5BQDA 1IGFH 2VN5A 4QHMB 2O6DA 2YPKA 4NQCD 2VZTA 3RWHA 2VDLL 3DJRA 3NP3A 2ZUUA 4QTHB 4UOQA 3V0AC 5HJBA 4H25A 3OXSA 1WPCA 2JH2A 4FL4B 4G8FB 3DKHA 4CVXA 4WKZA 3RTQB 1WBYB 2VKWA 2E0PA 1OF2B 2QQKH 3BGMB 3VCLA 5D7LD 4RVBA 2P80D 5EU7C 2ILLA 4JFTA 4KJPC 5TE4H 1RIVL 1VCBC 3B7UX 4E9LA 3BZEB 1R0AH 1ODAA 3EFDL 3GRWA 1VZHA 3CPLA 3A6BL 3N42F 1UT1A 4KRLB 4RZCA 4S1RL 4O2EA 3TN0C 2FVNA 2VLRB 4LPTA 2IAMA 1U8MA 1YJDC 2R7EA 5GJTL 2CUAA 3PDDA 2VRQA 5MEPB 5DEGB 3I9GH 4GKSB 1I7ZA 3IVKA 4A7SA 4PG9B 4UWQB 5DJ0B 4JG5A 3D4GA 3ZE1B 3VFPA 4N0YL 5JW3L 3I6SA 3WEXA 5L2JB 5ICZA 2F53E 3NIFB 1CLCA 4U0QB 2AFNA 3O11B 1BQHA 3FQXB 1ZD6A 4KAQH 5CN2A 2V5SA 4BA0A 4PJ9D 2GI0A 1UB6B 1E8WA 4RQQB 3GIVA 3OQRA 3ME0B 2ICWI 5AW9B 5I8EA 1ERNA 4MB4A 3HBQA 4ZFZA 2XWXA 2CO7A 3O3EA 4HWUA 1KN4L 1N3NA 2OXHA 3D85A 4X7SH 2CIKA 3MHZA 2DQCL 3B7RL 1GXEA 1DVXA 4X6DE 3HB3B 5KVEH 3L54A 3CUPB 1TETL 1KUMA 2MOVA 1MJUL 4G8IA 1LWHA 4M7JL 2L3BA 5AOLA 4RGMC 4YSAA 5AOMA 3Q3GA 5L2KD 3DETC 4YAQA 3H8NA 2Z1KA 1G94A 3B5GA 1HNFA 1OQOA 3VFSA 4ZFQA 4H20L 4L37A 4P9HL 3O3BB 4FABH 4N2MA 4PM1A 3ZSSA 3MGOB 2FHCA 4KKZA 1OEZW 1CDUA 2OMYB 1YJDL 1WE5A 4UOW0 1ZS8B 5CD5C 4OKDA 2Y07L 2KPNA 4RMVA 4PI0A 1T20A 1TFHA 2G5BA 3QDMA 4GPVA 4C54A 5SX4I 4UQBA 4KUCF 2XX1A 5IT2H 5J3HC 5E2TL 1B0IA 1MFDH 5C0NC 4XNQA 5A43C 2JCCE 3DRQA 3EYVB 3JWNH 1XL6A 5JXAL 4IBQA 3QQDB 1KBVA 1DR9A 3N41B 4YUEL 3KPRA 2W8CA 4JVUA 4R2GB 4JZNB 2VQ4A 5EN2A 1K4CB 2H8PB 1F4YL 1MHEA 2RGSA 4QXWA 4GI8A 1J0IA 1CL7H 2CO6B 3L4CA 1HTYA 4AEIH 4U6YB 1EZUA 4K3JH 1EJOL 3ARBB 3MGTB 2DKSA 3ISWA 1KB5H 1TVHB 2A6JA 2V3DA 3LZLA 3MKKA 4R2GD 3IMBA 4M9OA 1KV7A 4AK2A 4HUKB 4QEGA 1DLFL 5L6YL 2D7OA 2PWEA 3MOAH 4HJTA 4RMBA 3LNGA 1T1YA 1QFOA 4GMSL 1JXKA 3QJRB 1IGCH 4HA1A 1VJSA 1CXLA 4YQXH 4JFVA 4TUJB 4JREB 1M53A 5EU7E 1D6VH 4HIPA 2AZUA 1E3ZA 1UYWH 1JDDA 3I84A 3B34A 5DJ2B 5HVHB 1PFOA 5FO8A 2JB6A 1BZ9A 1FLRL 4BKTC 3KWWA 4R96A 1LMKA 1G7IB 2RIKA 5ABDE 3F6LA 5DO8A 2J55A 4Q6YA 2AK4E 5AFAA 5F9JB 3AS1A 2ZWKA 3WDJA 4AYID 4OSUH 2D3LA 3BO8A 3APDA 2DMHA 4ODHL 1K2DB 3WFDL 1AHWB 3K8MA 2FWOA 3QXAA 4O00A 2BFVH 2D7QA 4J3OC 3DYOA 5HDOA 4NT6B 1X9UA 3N43F 2LTQC 1V55B 3AT0A 1HHJA 2D0GA 2AJUH 3GZOA 4WFFE 4F37K 2QL1A 5AKTA 1A65A 1RZFL 3DOIA 2NXYD 4TRPL 3DO3A 3D05A 3PGFH 5CEYA 1XGTA 3FBQA 3VFVB 5J6GA 4UZUA 5E9DB 4OF6A 1H6EA 1U3NA 4QRSA 4JEGB 1GC1L 1HCVA 5DHVA 3SHSA 5B7FA 4YSQA 3SE9L 4FHBD 1VPOH 4EN3C 2AHIA 4XB7A 5ELIA 2R2BB 4I2XE 4MNHA 1DEEB 3FOLA 1W72H 3SY0B 3PWPA 4DCQB 4LLAA 4XNYH 5L2KA 1QFWH 4R7VA 1OTUC 2HFGH 3V4VB 4DJMA 3QJHB 1UM4L 1OCCB 4KJWC 1JWSA 2FD6L 1RULL 4JFUA 1MVYA 3FUDA 4EI5C 4GSXA 4B9JA 1U8IA 1H3GA 4Z7VF 5J6HA 1GY2A 1ZA6B 1TZGH 1K6QH 4MYWB 5HHNA 1ID2A 2Y2TA 4ZBJA 2WKLA 3C5ZB 3NSFA 3O6LH 1TO4A 1VIWA 1KJ2H 2BWDA 1B2YA 1LP9E 2BP0A 3N0PB 2YPVH 5BV7C 3ARGD 3IYLW 5KVMC 3DV4B 3TJHC 4M03A 4K3GA 3HC0B 1QRKA 1BOGB 5GRWA 1QW9A 3QZWB 1EO8L 5KYXB 5D4IA 3ZDXB 5F96H 1OAXH 2Z7WA 4DGVH 5EDXA 1AKPA 1LE5B 1EZVY 5EBMB 4RMQA 4V11A 4ZUUA 4X6CF 2GJZB 4BCYA 1KXQE 3KJ6L 2I26N 5FF6B 1SHSA 3BKMH 5T1MA 3TJHD 1YVLA 2MQ3A 3ZTEA 5CCJA 1L6XA 3K0WA 4DP5X 1AQKH 1CIDA 1YECH 2WVVB 5D1QD 3BH9A 4A2LA 3CCHB 3QUXC 5I19H 4BH7A 3VWJC 4G6KL 4EDXA 5K9JH 4KRPB 3WFCL 1SF3A 3RPIB 1HC1A 3CFCH 3V0VA 2CO2A 1RPQA 3NIFE 3V4VH 1XCQA 4KGLA 2QZQA 3U83A 4XNXL 4ZS7H 1DSWA 1FE8L 4Q6IA 3RWDA 4P06A 5I8KL 3ESNA 2BFVL 4ELMA 4XZUB 2W9EL 2HTLD 2C3HA 5GGUA 1ZVYA 5CMAA 3VXUD 1FFRA 2VDRL 5HI3C 4AH2B 2BPBA 1QBMH 3T2LA 2IO5A 4HUVA 1BZEA 2DMGA 3SQRA 2ZP9A 2NY0C 3AGVA 1HYSD 3FO1A 3TBVB 1AS8A 3VMNA 2HTKC 3FUIA 5D7LA 2CDGB 1JGDB 2O5YL 4MMYA 3G6JF 2B59A 4OLZH 2YA0A 1EEUA 1MI5B 1FL3B 5DD6B 1T7YA 2Y3NA 5J89A 3L1GA 5GGQH 1S7TB 4K3DH 4W9LC 3ILQC 4Z7NE 5MEOB 1KMGA 4Z23A 2ZUXA 3VB8A 1BP3B 3QXWA 3LKPA 4KZDL 3PPSA 4WEMB 1UWGL 4NC0B 4HS8L 1FGVL 2VDNB 3EFOA 3E6HB 3GTVA 4JRYD 3FN9A 4RBPH 2X1WL 1H0DB 3LTVA 4Z76A 1LE9B 1F5WA 4UTAL 1IEHA 3FTXA 2NCEA 5KS9F 3HUJF 1JHLH 1WH0A 3BAIA 2E7DA 2C9AA 1GAFL 3QUKA 1GS6X 1U3YA 4L18A 4KO9A 5EG6C 2OI9B 1RUMH 2ZX7A 4EJ1C 1BV8A 3O6KL 4LCCA 1XCTA 5L0QB 5B8CB 4JQXA 5JHDB 4L1BA 1I9IL 2EIEA 4O51A 1FFOB 1T1XA 2ORBL 3QQ3A 3PL6D 4ODVL 4X7TA 35C8L 1R9FA 1VADB 4NQDD 1XGZA 4Y5XB 1OGAA 5BRZE 3F7LA 1VCAA 2ZOLA 1M2OA 3HNSL 3ML8A 4CDGC 1GSMA 3C6LD 3TIDB 3UTQA 4GS7C 3WLBB 4ZMAT 5DJAB 3NAAH 1FCGA 5F6IC 4U6VH 3S4SG 1J48A 1H9VA 1NH6A 1OB1B 1XZWA 2H3NA 4ZO9A 1QR1A 5C6TH 4Q2ZA 2R56L 4JM4L 4Q0XH 2YD2A 4IOFC 5ISZB 2GJ6D 3MXVL 3I6LE 5CJBA 1SJEA 4QMEA 1RHHB 3SKMB 4P5TC 2G3NA 1FYTB 2UWEB 3SKNB 5J1TC 3QEQD 4WSGA 3V0FA 1SNRA 1HU8A 2XBZA 1Q9KB 1U8KA 2DOCA 5E9DD 3PWNA 3QIUB 2VT0A 4M6AA 1KN4H 1W0WB 3OJDA 3RWGA 2KDGA 5D1XB 3DX6A 4WAFA 5I6NA 5FLVA 4KO5A 2DD8H 5C0ND 3BVDB 1YNKL 1Q1JH 1CLVA 1TF4A 3APFA 1UACH 1IGML 2EYSB 2APXA 2HT2C 4PJCA 4EI0A 1BMWA 3SJVE 3MNVA 4MDIB 5JXED 1RSFA 5I1LA 3GPSA 4FZ8H 3TBWA 1BBJA 2VN6A 3GSNB 2A0LD 1EEYA 4I4WB 4JFYB 2JV6A 4LK4A 2CJUL 4DESA 2CHXA 4BCXA 2WN2A 4QYOA 5EUOF 2PTUA 1D7BA 3T1FB 2ZX9A 1O7VA 4QLRA 3LKOB 4WQOA 3WS3B 1YNLH 1IAOA 4G8GD 4GRWH 3AXLA 5DRNA 4DOHB 4TF4A 1KCWA 4TUKH 1MFVA 3KL5A 5JR1H 1JS4A 4XBPA 4KTDH 3QUXA 3ZXAC 5DUPL 2QR0A 3ULUF 3HS8A 3P11H 4OZ4A 2WJ7A 4FX5A 4OM1H 4LBEB 5HHVH 2E46A 5LCVH 5GJSL 3MUHL 4YWGL 2YXVA 5BVJB 1MHHA 1QFPA 4ANVA 3NJJA 2X09A 1B4JL 5LXGL 3TLRA 3NSCA 3BQUD 1TQBC 4IRSB 3D25B 4FDWA 3K74B 1E8XA 4PJ7B 3IFLH 4ABVA 4GW1B 4JDVA 3WD5H 1OKEA 4S1QH 4S0HA 1EJFA 5F6HI 1IE4A 1SXZA 3OAZH 4I77L 1RLBA 4UIMA 4ZK8A 3RGVD 1KT2A 4U4BA 3GNML 3VQ2C 1U58A 4G1MB 4NRXA 3OG4B 4PFEA 2PYEA 1U21A 1AGBB 5IVXE 2AJXL 1CXEA 2BZ7A 5CGMA 4GI9A 4R5XA 5EOTB 4JO8A 3W9DB 1LL1A 3N1MC 1FA4A 3U6RB 2P8PB 4BINA 1SY6H 1XIWC 1BMGA 1ZIBA 1CGXA 1IAII 1OARL 2XKSA 4LOFA 3TF4A 2BNRE 2ZYHA 4F27A 1OCOB 4KMQA 3L3DB 3OKEB 3A67H 5KVFL 1HILA 5E08H 2F53D 4G6AD 1EXUA 4Z3GA 3PG2A 1I3GL 2QBWA 1VA9A 5FYJH 4AE0A 5EIIB 4U1IB 1CQKA 5I17B 5EBGA 1EDYA 4G7YH 1OWWA 1Y18A 2XWJA 1MH5A 3H42H 2XETA 3SE3C 2P5WE 3FQWA 1E6OL 3CN3A 4JMXA 4JFOB 4JRYA 4X5PA 3RILA 1SYSA 3VGGA 3P9MA 2VDMH 3MOQA 2WAQA 4KOCA 1A6VH 4PY7A 1M1XB 3HNVL 3B2MA 3QDGA 4E9XA 1TT6A 3FO2A 4MCNA 2D03H 6CGTA 4NO0B 1ZV2A 3R7RA 4FNLL 4YHZH 1L9NA 4V2CB 4B7IA 5IJKA 2FBOJ 2CHNA 5A3IC 1YY9C 3O6FD 4L8SA 3FTGA 1I75A 3X11A 4G8EA 5J0BA 2YAQA 3BFWA 1Z2KA 2VLRD 1E7UA 3FRPG 3GZPA 2XRAL 4Y8DC 1OCZB 2HA1A 2NUPA 3PV6A 5C08A 1QRNE 5E03A 5KBNC 5DD5L 2VQTA 1XF5B 4IS6A 4OLEA 4XXWA 5T8IA 5BMFH 2DM7A 3D9AL 3TCLA 1FNFA 3HE6B 3T4YA 1DBKH 1WBXA 5TDOB 2MTPA 1IM9B 4MAYD 2ITDA 4MZ2A 5JORB 5SX5H 3FFOA 2CR3A 4CMMA 1ZMYA 4MJ2A 5DJCA 4M48L 2HRLA 1A66A 1Z0MA 1D9KA 1VKXB 2X6CA 4NZFA 2QEJA 2FJSA 1OGSA 3MLZL 5DA4A 4QRRA 3SBWA 1FL6A 3QWRD 4HU2A 4L4TB 5F7EH 4OY9A 3H85A 2O4EA 2FWLB 5MP6H 3HRZC 4MRBA 1CC3A 5GZOD 3FQ1A 2Q0ZX 2LQRA 2NY4C 1WIPA 1RXLA 1UM6H 5HDBB 1AXIB 1OM3L 3W0WD 2DICA 5I2IA 1TXKA 4TNVK 4J23A 4KY1H 3MCLL 4PGZA 3RWEB 5IOKA 5HYFA 3VJ6A 3ULVE 3RL2A 1S9XA 4NRYA 1CXIA 5J13C 3MYJA 4KRNA 3E8UH 3A47A 5HGDA 3MA9L 1LGVA 2GY7B 1J8HD 2GIXA 4P9ML 3Q2NA 2QSQA 2Y4SA 4WI7A 3L5XL 3AY4C 4MAYC 4ZX5A 3WFZA 3D39D 1EAPA 2ZICA 1UZ8B 2BNQA 2V5TA 3KS0H 4MJ6B 3EJSA 4CC4C 3S3JA 2QFPA 4XN7A 3NTCL 4YHPA 2EH8H 1HHKB 5FUCC 2P48B 1ZJBA 1ORQB 1NFAA 1CDHA 1U8NB 5C9JA 3BXNA 3TBTB 4YDIH 1BJ1J 5J12B 3QIWB 4YDJB 4BFEA 3BVWA 2OZ4L 5AAMA 4YHIB 3WMPA 5C07B 4EUPA 3H3BC 3SE8H 3BQUA 3G6JE 5C6WH 2DEYX 4ODTL 3UGEA 2P49B 4V33A 3Q0HA 2NX5A 3S37H 1BBDH 2QPFA 4Z77B 2L7JA 5BW7C 2H3KA 1O6VA 1Z6JT 2CG9X 2DQ6A 2F7QA 1JXGA 3TJPA 4P57A 2EEFA 5INDB 2B1OA 4DOHE 5I76A 3JT0A 1L9QA 4J28A 2NY1C 1BFVH 5C0AE 1IQDB 3TP4A 1ML0A 1Q9OB 5GPRA 4GMTL 3SDYH 3VXMD 1KNOB 5KVEE 1BQRA 4PJHB 2BVTA 1U8HA 5IMOB 2E56A 2AGJL 4U0RB 2WGNB 3P2TA 3U0PA 3PY9A 4HK3J 5CFHA 4NRZB 1TKWA 4XNUH 5C2BH 5CINH 3BT2L 4XPTL 5D70H 1TG8A 5ADOL 2DZEA 1K9TA 2E59A 3WIFB 3O45A 4Z5RB 1FFNB 2J1XA 1T5XA 1VFUA 2EDJA 1G7LB 2PW1B 1LVEA 2HT4C 3UBXG 2BJMH 4NQTA 1YNKH 4EE2A 3WXWH 2PMZA 5JZ7D 1DVFA 1UB5B 1WK0A 4G43B 5FM5M 2NR6A 2JI2A 4HCFA 1PLAA 4XBGB 3T0EB 2F6AA 1T66D 2W07A 3EJUA 1BFOB 5D72L 5GQBA 2Y3AA 2R4RH 2Y69B 2UY6A 2F53B 2VAJA 2X9YA 2YA2A 5IBUG 3F7RA 1OP5H 2J8UB 3BIAX 2XWCA 4XODA 2JJSA 3RVWD 2CLVB 3IGLA 1G5GA 3SDDC 3V4PB 4OCSH 3H9SD 4ZSOA 1B4JH 3Q06A 4P2QD 3RFZC 5J9PA 3BP7B 2XDHA 4JM2D 4LSSL 5HHXH 5A2BA 2JWYA 2VLJE 3L2NA 2W59A 1DDHB 1V54B 2VABB 3SB3A 4H2AA 3O2WL 3PAZA 5DJ6A 2R51A 3VG0L 3Q6GH 3SOBL 1IQWH 1WC7B 4AYEC 5DZAA 4XMKH 1J05B 1NSNH 3B6SA 5GRVL 6FABH 2A6KB 3I02B 3TZVA 1JXJA 4R3SA 2ITCB 4JG0H 4DPAX 4HIEB 4HMEA 3HI6H 3T0EC 1MPAL 1HE7A 2VZVA 3GLZA 1U42A 3J07A 5F7LB 1MY7A 4C8XA 3WYRA 2C7UB 3SBPA 1KJ2A 4FTVB 1I7UA 1NL0L 4JO4H 2WZPA 5CU9A 1G43A 3DJTA 3UG3A 3O2DA 4UT6A 2HFEB 2OTUB 3MCKB 3VQLA 4GSRA 1R5IB 1QNZL 3A4DA 2XWRA 1NCTA 3EJQA 2B2XL 2MPAH 2Y1AA 2WWKO 2XN2A 4PLOB 5EEXA 4IBUA 5IROD 5DJ8B 3SJVA 4P49A 2XACC 2VZUA 1Q9WA 4YEEA 4X6BA 4CC1A 1TNNA 2PO6C 4XN4A 1SFDA 1I7RA 2Z4TA 4DAGL 3LH2H 3GMQA 4G5ZL 4FG6D 3UAAA 5LAPA 1KG0B 1NANH 1RUAL 4FC3E 4KDWA 3BD4A 4LLVA 3CXDH 3LHPH 1PNDA 3TBCA 3QXVA 1AHMA 1T0OA 3IJSB 1R5WB 3D0AA 1KV3A 3CHOA 2IG2L 3F7KA 3MJ9A 3AFLA 4TNEA 1J5OH 1MEXH 4NLAA 5EEVA 3L3HA 4MA1C 1EDHA 3IDMA 1CD1B 3FFCE 2X6BA 5IVXF 3FF7A 3OXRA 3UEZA 1IGCL 4X98A 2WY3B 3QVAA 5T1KB 3TVMD 3ZHNA 4DGWC 4LAJH 4KRMB 3RX9A 4QJ5B 3OKOB 3IDJA 3HG1E 1KGJA 1MAKA 5FO7A 4FD0A 2LU4A 3EHBB 3WIHH 2MNWA 2NNRA 1JZGA 1DJSA 4U6HB 3BZ5A 3L95A 3WUWA 3W81A 2VR8A 1BXXA 3D30A 1T21B 3ZYZA 4UMGA 3FB7A 2C9VA 2CIIA 2F5AH 5ID0A 3V4UL 5J1AB 4G5ZH 2C3GA 3S48A 3WKMH 4YK4B 3PL6C 3U48A 1WGOA 4NQSA 1EHKB 2AEPH 4PQXA 1P4IH 1JK8B 4ES8A 1JHTB 1JFQL 2WLIB 2ATPB 3RVTD 1BHGA 2BVPB 3IMRA 4P8QA 1A6AB 1J0ZA 4XXDB 1FYTE 4F33A 5IJBC 1QI5A 5FK9A 1ZE3H 1JBJA 4AGMA 3LPOA 4FXLA 1JTPA 4IMKC 1ZHKB 3MN8A 2GSGB 2PW2B 1HSAB 1T0MA 2V9RA 4BJLA 3TEYA 3SQOL 12E8L 2CXGA 3LPWA 4P2CG 3AB0B 1JPGA 2YD5A 2IDTA 3ECBA 1MPAH 3CFNA 2BS8A 4WHTB 5GJSH 4QR7A 1RJLA 5E8NB 3UYPB 4X6CA 5JOEA 1I8IB 1IVTA 3O41B 1FVDB 5LKNA 4QRTB 1WD8A 1QFWL 2H1LM 3V4PL 1CDYA 4QXUL 2DH2A 3NCBB 1G6RL 3FH8A 2FIKB 1YO4A 2Y6SD 1KCBA 3V2AR 2ZXQA 1THAA 4H1LB 5FR3A 4DPCX 1CR9H 3FQRB 4RMUA 5F0JB 1TZAA 1Q9LA 2HXAA 4Y19B 5IQMA 4WNQB 1NCBH 1BBDL 2CLRA 2HUEA 3Q2CA 4FMFA 4UV7L 5EH1A 1TCRB 1GZQA 1KDIA 1NOAA 2Y06H 3S3PA 3WIIH 1J5DA 1YG9A 3X3GH 2APWA 3CDZA 3H2QA 2WO2B 3LB6C 3MA7A 2EC9T 2J2ZB 5DZJA 4I0CC 1IJNA 2IQAA 2X2IA 4MA7H 2EVHA 4PWIA 5A7BA 3KPLA 4L3CA 1U91A 5I1GH 2B8OT 4AMKL 3HLAB 2FO1A 2E9WA 4AM0A 4IU3B 4YNYA 5JHAA 3EBGA 3VE0A 2IADB 2H0FA 1GVIA 2R1YA 2R0ZL 2FL5B 2ZG3A 1I1RA 3RHWF 4JR9L 3LEVL 3CVCA 4KQ4H 3CQQA 1HIMH 5L88L 1MIML 1K5WA 3Q48A 5F1IB 3KZ8A 2OV0A 4LFHG 4HIIA 4R7DB 4KK9C 1HS6A 3GI9L 4P4KC 4JQVC 1W0VA 4YX2L 1DQMH 2FD6H 2EADA 1N8ZA 3NSXA 3P3TA 2MNJB 2RCSH 1JCVA 4OB5H 4MDJB 2DYPB 3BPNB 3SGEH 5FS5A 5JA8B 1FORH 4MZIA 1A25A 1YN6A 3P3UA 4QRPE 1HQRA 1YLBB 4XWOD 2DLGA 3N9GH 2C4FT 3ALPA 1GGIH 5IHLB 2NY3D 1A7NH 2FZ3A 1JGIA 5DS2A 4W6XB 2OMXB 5FV2A 1NIFA 5HI5D 4GW5A 3GDBA 1S7WB 4BFOA 2ZXAA 4ETQB 3BYTA 2I9TB 4D8PA 3IDXL 3UADA 2SEBB 4QI3A 5IWLA 3WTWA 1THCA 2JKWA 4MB1A 3B5TA 3U0WL 1VEOA 1T0NB 4JRYE 4UTBL 1TYRA 4FKEA 2HWZH 2NY3C 2PO6D 4N3UA 1IC7H 2YGVA 4YGVB 4DP6X 1KTCA 1KY7A 1HXMB 1QEWB 5G4NA 1UA6H 4MFHA 4LEOB 4FI7A 5A40E 4MA3A 2FHFA 1CICB 3HG1D 2C9RA 4NCDA 3GYRA 4YHNA 2EIDA 1M3JA 4YE4L 2DLFH 3IFNL 4K9EC 4JQIL 3ARBC 5C0AB 2ADFH 5K9OB 3T1FA 3PAYA 4WK2B 2EVGA 4GH7B 2JJVA 1OV8A 3U46B 4XC1H 3KPOA 1UZ6E 2D7NA 3JV4B 1TYJA 1R75A 3EJZD 2CRZA 5CGBA 4JY4B 4HU8A 4RAUB 4DUXA 4UM8B 4FP8L 4Z7WF 3CSPA 4XVTH 5DS8B 1E5YA 2JK5B 4PYHA 3QZWG 2A99A 1JDAA 3WOVA 5AVWB 3HR5A 4BRVA 5L6YH 2VDML 1VACA 2ZSVB 5DI8B 1A3QA 4QKXB 1ZGLA 2QJDA 5JXEC 1E4XI 4M8UA 2ZX8A 3REVB 5C0DB 3SSGA 5EZJB 2UVEA 2YPVA 2XXFA 3HZKB 5E0QA 5J11C 1MAJA 2FJGA 4M4PA 2MQGA 4PGDA 1WTGT 3IJ7A 3PGDA 1IGJB 4U4IA 4OQTA 3V6OA 4NNXA 4NGHH 4QNPF 3I6KB 5GXBB 4NKOB 3GHBL 5E94B 1D6EA 4FFWD 1CGSL 4WI9A 3OKNB 2JQZA 3VXPA 3I9GL 3QFJB 3CFJA 3ES6B 4OUUA 3D3VE 2VYRE 3FONB 4Z7WA 3RVWC 4BSWA 1QFHA 3N55A 1CFTB 1NINA 3FTSA 5AUMB 2Y7QA 2A74B 4H0IA 1OSYA 3MRIB 1OCRB 4KHTL 3PABB 5F8QC 1QVOA 2RD0A 2UZXA 3ARDB 2JCCA 1GY1A 1FO0B 2CGZA 3HAEB 5IB3A 3RVUC 4KZCA 4W4OC 2LV4A 2ZWSA 5TQ0L 4EVNA 4W70A 3K72B 4N8CL 2QKSA 1KLFB 3MUJA 1DZBA 1SQ2N 1UOVA 2OTWA 2WQUA 1MCOH 3UO1H 1J1PH 1JUFB 5DFAA 1CE6A 2EACA 2DQEH 1MHCA 3B7SA 2LFGA 1UXSB 4CJ0A 3S96A 2X44D 3NJKA 1X5JA 1EEQA 1PLGH 3GXPA 4ZW7A 5LJYH 4P5RA 1FAKT 1VFAB 3VX0A 2WINB 3P9LB 4HFUL 4KXDA 2LU7A 4BQ6A 5GRJL 2I5YH 3GXDA 3ARQA 2DWTA 1VFBB 1CBVL 3KMDA 2CQVA 4G1EA 1E27A 4G9DA 2ZZUT 1AI1H 4O2CB 3K5SA 2FT7A 3NSYA 4KXZI 1R46A 1UUNA 2QHRL 1KIPB 3IS0X 1PKOA 3FT3B 4MJID 5DC0A 3HMXH 1N12A 4IDJL 2R2EB 4ONHB 1QTPA 3KGRA 4G6ML 5D1ZD 4K3EH 1LEKA 3K6IA 5AVYB 1Q94B 4APQD 4OIIL 1IBGL 4P4KA 1O7DC 2LLNA 5D72H 3ET9F 4TTDC 5CEXA 4FQIH 3AY2A 4AV4A 2V17L 1M57B 3WJLC 3ARRA 4Y2DC 5E2TH 4ANKA 3CLFL 4WKZB 1HXKA 1U2CA 1DQLL 2ESVD 4W9ZA 3UP6A 2ZCKH 4LRIC 2HFFA 5I5JA 1IILE 4L5FE 5FW8A 3S4SB 3ZPDA 5IESL 3LV3A 3MOBH 3DVIA 3LQMA 3KHOA 4F2MA 4W9DC 2TAAA 2HPOA 4NUMA 4P59H 1EHLL 1B6UA 5DEFA 2AAVA 3ECWA 4YHOL 1AJ7H 2F58L 3WEXB 5PAZA 3TBBA 3D18A 5F8RC 3RVXC 1C1EH 2X9XA 3F7VB 5DR5L 2BLFA 4LCIH 2P42B 1CDBA 4KFZC 2J8UE 2VXUL 1FGNL 3CFQA 4ONGL 2BC4B 2LAGB 2E86A 1N59B 3GTTA 4BK5A 4IIQA 1OF0A 3BPOC 4WTXA 3REWB 3QDGD 1SDDB 1OAKL 1TQCC 3C5SA 1ZTXH 1TIUA 2OS7A 4FQXC 4HUXB 3T2N