1AIZA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport(cadmium binding)
molecule keywords AZURIN
total genus 31
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aizA00
3DIVA 3S8GB 3AG1B 2CAKA 4A67A 3QJTB 2JXMA 1E5ZA 4A2DA 2GHZA 1AAJA 4DPAX 2UX6A 4PCYA 4A2GA 4A68A 4RH4A 4G71B 2R7EB 1NWOA 4WKXA 1JZJA 1MG2C 1OE1A 4KOBA 3PAVA 5D4IA 2WO3B 3FQYA 3OD3A 1M9WA 1EZLA 3T6VA 1ASPA 1MDAA 2VMJA 5FC9A 3NSCA 1A4CA 1BXUA 1IBYA 5EHFA 2VM4A 1YLBB 2WSDA 1WS8A 1IBZA 1AS7A 5I6MA 2YARA 2TSBA 2PPDA 2BP8A 3NJMA 4A2FA 2I7SA 4A2HA 2B08A 2AZUA 2IAAC 1CC3A 2TSAA 3CDZB 3FSAA 2HXAA 3OMIB 4HALA 1FWXA 1PMYA 2HX9A 3SBQA 5B1JA 4Q89A 1SFDA 1AS6A 1XMEB 2VSMB 3ZDWA 1QHQA 4HAKA 2JFCA 1E30A 3HEIB 4E9XA 4L0PB 4YVUA 4DPBX 1AZNA 2DYRB 2H5UA 2FQGA 2XXGA 5B7MA 3ASNB 5F7BA 4DPCX 4YSCA 3IBOA 1GS6X 4HZ1A 6PAZA 3KW7A 1EHKB 1NPNA 2PP8A 2W88A 1NTDA 5LDUA 4YSPA 1T5KA 2AFNA 3D12B 4YSRA 1W8EA 3GYRA 4YSEA 1AG0A 2JKWA 1MZZA 1AG6A 3QJRB 1V55B 1J5CA 2XU9A 2J56A 3KW8A 3NJGA 2ZONA 3FU8A 3AZUA 4P5RA 2IH8A 3BQVA 3EH3B 1RCYA 5I5JA 1ZPUA 3TBBA 5A7EA 1WA2X 1N68A 1NINA 2PP7A 1E67A 4PAZA 1A3ZA 2DWTA 3PCYA 1L9SA 1IKOP 3S8FB 1CURA 5I6PA 1ET5A 1KGYE 1R1CA 3L45A 3QJQB 3QJSB 1CYWA 5D4HA 5B1KA 4BDVA 3UAAA 3RYMA 3CZUB 4W9ZA 4HCIA 4JHVA 1KDIA 2IH9A 5I6LA 1DZ0A 1L9TA 1GR7A 1AACA 1JZHA 1BEXA 1OE2A 2FJSA 3X1NA 4NERA 3FYIB 3S3DB 5B7EA 3FS9A 3OMNB 1CUOA 2IDFA 1NIDA 2CBPA 1J9QA 5IY5B 2RACA 2N0MA 3NP3A 3OQRA 4EF3A 4DP1X 4GXFA 5I26A 3WI9A 2FTAA 3ZBMA 3WNJA 4BWTA 5AKRA 4GY4A 3FSWA 2GC4C 2YXWA 4YSAA 1B3IA 8PAZA 3SBRA 1HFUA 1HAUA 4JKNA 5TK2A 4HHGA 1E5YA 1SF3A 6PCYA 1NZRA 3FU7B 3TBCA 5E9NA 4KNTA 3SBPA 1JZIA 1MZYA 4UF7C 1PAZA 4DP5X 3QQXA 4HHWA 2BP0B 2IDUA 2B3IA 5F7AA 4F2EA 2XUWA 3IN0A 3NJNA 1KBWA 1GY1A 3S3BB 5TK4A 1JVOA 2UXGA 1L9QA 2QDWA 5I28A 2PCYA 2ZXWB 2PPAA 5B7FA 1PNDA 2Y1AA 4A2EA 4FA7B 1ZIBA 3X1FA 1URIA 2GI0A 2XV2A 4GP5B 5PCYA 4FAAB 4ENZA 2IDTA 9PCYA 1NIAA 1PZCA 2BWDA 2HLEB 2HX7A 1JXFA 5B1JC 3CG8A 2W8CA 1QNIA 4BXSV 1BQKA 3AY2A 4YSQA 3NJJA 2A3TA 3N55A 4N4YB 5AZUA 1SHXA 3T71A 2DYSB 2CJ3A 4DP9X 3T6WA 1WS7A 3EHBB 2DV6A 1PZAA 4DP0X 3H56A 2OV0A 3FPXA 4ZK8A 4HCGA 1A4AA 1ET7A 1L9RA 2YAFA 3T6XA 2XLLA 1A8ZA 1GS7A 4GP4B 4P5SA 3FYEB 1GS8A 2VW6A 4G7RB 2DY2A 2YAPA 1ID2A 4DP2X 3WG7B 1ADWA 1ETJA 3X1GA 3H4FA 4NB7A 3X2QB 4KO7A 4AZUA 5I6KA 3WNIA 1BYOA 2J57A 1SDDA 4N8UA 7PAZA 2GC7C 2MRYA 1TEGA 2VSKB 1N70A 2I7OA 4KOCA 3FPYA 3PXLA 3ABGA 3NJFA 4YVNA 4X4KA 4E9VA 1QLEB 2YAEA 4YSSA 2FNWA 3PPSA 4G70B 3FSVA 3TASA 2X87A 1JOIA 1NWPA 2QT6A 2QPEB 3V9CA 2GSMB 2PPFA 1ILUA 3AG4B 4Q8BA 1JZGA 1PZBA 3T6ZA 4G72B 1OCZB 3NJHA 5I6NA 1JZEA 1SHWA 3U25A 1AZUA 3NJIA 2IWKA 2DWSA 2XXFA 1OCRB 1RZQA 1NPJA 3IE9A 1W6WA 4YSUA 1BQ5A 3PLYA 1ZV2A 3HB3B 1PNCA 1PF3A 3ZX1A 4BWUA 1GYCA 3OM3B 1OCCB 1CYXA 3OMAB 2PPCA 2XX1A 3NSFA 4AKOA 4E9YA 4AI7A 2OJ1A 4KNUA 2OCCB 5B3SB 1GY2A 5B1AB 1TKWA 2EINB 4E9SA 4F2FA 3H4HA 2BW4A 2PP9A 3NSDA 3G5WA 1I53A 3N2JA 1IUZA 2YAOA 2ZOOA 3FQ1A 4UANA 2VW4A 4TXVB 2BW5A 3EF4A 4NAJA 3SQRA 1UATA 1BAWA 1SDDB 3AW5A 4AX3A 3TU6A 3AG2B 2PLTA 3NSYA 4CSPA 1X9UA 4DP4X 1JZFA 2I85A 1SFHA 2BZ7A 2VN3A 4G7SB 3UABA 5I5MA 3NP4A 1J9TA 1AS8A 3T9WA 4KO5A 5B1BB 1NICA 1J5DA 1WA1X 2BO0A 1AQ8A 4YSTA 2GBAA 2HX8A 2XWZA 4E9WA 2FT6A 1PLCA 2H47C 2IWEA 2EIJB 3X1EA 3CDZA 4A66A 4CSZA 4M3HA 1GW0A 3PAZA 1NDTA 1RZPA 1L9PA 2HZHA 1KCWA 4QLWA 1M56B 3NT0A 2J5WA 1A4BA 2YAMA 1FA4A 5PAZA 2EIMB 2HRGA 4G7QB 2IDSA 1NIBA 1X9RA 4YSDA 2BP0A 2NRDA 3V9EA 4KO9A 1JVLA 2FT8A 1J9SA 2CCWA 2H3XC 1BXAA 2R7EA 1A65A 1W6LA 3UADA 2XV3A 2Q9OA 3X1BA 3DTUB 2X88A 4MFHA 3FU9A 1F56A 1ZDQA 3WIAA 1AZCA 4AKQA 1ZDSA 3GDCA 4K9JA 3MX0B 3ERXA 1KDJA 1ZIAA 1DYZA 3EH4B 2VM3A 4YSOA 1E65A 1ASQA 3ABKB 1KYAA 4E9QA 4DP8X 1ET8A 4BWWA 5I5IA 3BVDB 3C75A 3NJKA 2FWLB 1OCOB 1XB6A 3NJLA 3ABLB 4GP8B 3FSZA 4HIPA 3FQ2A 4F7KA 2XYBA 3AG3B 1PY0A 2AZAA 2CUAA 1XB3A 3NYKA 4W1TA 1OV8A 2GIMA 2YAHA 3FT0A 3MBWB 3WKQA 1OE3A 3QPKA 1BQRA 1BXVA 3DKHA 2YXVA 3IEAA 1GSKA 1NIEA 2BZCA 2PPEA 1AZRA 1AIZA 4WTQA 3UAEA 2Q5BA 2Y69B 2UXTA 2IDQA 1RKRA 1SJMA 1WA0X 2EILB 2EIKB 3CVBA 1JXDA 2LLNA 1JERA 1VLXA 2XX0A 3CVCA 2CALA 2QDVA 4UAHA 2MTAA 1ILSA 2UXFA 4GYBA 1ASOA 3PAUA 1FFTB 4YL4A 4BK5C 3IN2A 1PCSA 2E86A 2GB2A 1OOWA 1WAEA 2XVBA 3UGEA 1AANA 3JTBA 1XB8A 2FT7A 4DP6X 4E9TA 5I6OA 2J55A 1PLBA 1TEFA 2ZWNA 4BDVB 2FQDA 3QJVB 3JT2A 3EH5B 1IC0A 3ABMB 5ANHA 1NIFA 7PCYA 1V10A 3TA4D 2YAQA 3GXUB 2FQFA 2IWFA 3FU7A 3S3CB 1AOZA 1BYPA 5D4JA 1JXGA 1KV7A 4JHUA 2PCFA 4BXVA 4HCFA 1M57B 1KCBA 1TU2A 2FQEA 1MG3C 3QJUB 3CVDA 2AANA 2YQBA 1PLAA 2BWIA 4M4RB 4DP7X 1OF0A 2QPDB 1AR1B 3ZIYA 2UX7A 4KO6A 3WKPA 3UACA 1V54B 1HAWA 1KBVA 2VW7A 2BP8B 3ASOB 4KNSA 4AKPA 2HRHA 1J9RA 2WO2B 2AVFA 4E9RA 1SNRA 4QKTA 1AZBA 2P80A 1L9OA 2XV0A 2BHFA 5AFAA 2P80D 1SF5A 2UXVA
chains in the Genus database with same CATH superfamily
4M7ZC 2AEPL 1BAFH 3DIVA 4MS8C 3W0WA 2JCCB 1HI6A 2NXZB 1N7MH 4GFTB 3P77B 1HHJB 3NPZB 1A6VH 4QHLA 1QSZA 4OLYL 5ID0B 4Q9QL 5T33L 1DBAH 4X2UA 3PUUA 1JGDA 5HGAB 4S1DD 4MA3B 1T7ZA 1JF1A 1MG2C 2MKWA 5IHUL 5GS1C 1ZLUK 3HBQA 2NYKA 1N8ZA 1J9CT 2BPBA 3A24A 2K9UA 3ILPB 4OVVA 1U33A 2NY5L 4Z7OF 3L16A 4K94H 5C0AE 5JXAH 3DHUA 1EK3A 1BFTA 2YARA 4D0BA 2W65B 2VUKA 2QHRL 4PJCB 4UT6L 1KTDA 2YMOA 4DKDC 2H45A 2CD0A 1FC1A 1XWVA 3OMIB 4JRXB 1PMYA 4BKLA 5B1JA 1LNUA 1ZS8A 3BIBX 4QXUL 4U3SB 5CGMA 1HSAA 3KH3A 2FIKB 5HHMD 3MUGB 2IEPA 1ADQH 4XPHH 3VFOA 4WNSA 1SY6H 2ITDB 2X41A 5EU5B 1CFVL 2V2XA 3ASNB 2Z1KA 1OTTC 1R3LA 4G6KL 3TV3L 3DO7A 2EXYC 4GRWH 3L5HA 1TJMA 2A74A 3FUEA 5KOVC 1NPNA 3K91A 3QDGD 5FYKH 1SN0A 1JZ7A 1NTDA 4IHOB 1QACA 4Y2OA 3EGSA 1LWHA 2P28B 4NQED 4YSRA 2GK0B 4BCXA 4EN2A 5HP5A 1BIIB 5C9KA 4AEFA 1VRSA 3UJJH 3BUPA 3LKSA 1J5CA 2DQTL 2FJHB 5CWSA 3SCMC 4UNUA 4EIGB 5T8IA 3KDPB 3M1OA 5FYKL 4J2QA 1KB5L 3TZVB 2WXNA 2OTPA 2GABA 3FQUB 5ADOL 4HDIB 4PGCA 3TO2B 3MREA 1NINA 3J7HA 3V6OA 1WC7B 4OD1H 1KJ2B 1WBZB 3QFJE 3QSKB 4LL1A 4POZC 4Q4IA 5TE7H 1I7ZB 4BRJA 4OZIA 5GISH 2OMXA 4DFHA 2WVVA 1JPGB 2C1PB 3SZ6A 3BSZA 3I74A 4CJ0A 1MFVA 3VD4A 3HRPA 4S2SA 1KB9J 3SE8L 2EYSA 1OTSD 3HHSB 4HFUL 3V0EA 1AQHA 2C3WA 1HU8A 2O5YH 3EJZD 1HHHA 1MHPH 4PHXA 4U7MA 5CEXB 4WI9A 5A2AA 1BZEA 2VN7A 1FH5L 4HLEA 4QTIL 2DD8H 2F5BL 2XIBA 4KX8A 4G1EB 1KIQA 1QLRA 5I74B 1Y07A 4WO4C 3NH7L 3GIZL 2V0AA 3L3GB 4BSVA 5HYJD 3L95A 4L3EB 3MJ7B 3WI9A 5DK2B 1XD1A 3QRGL 1XGRA 1ORSB 2ZF9A 4PJ7F 4XMWA 1MNNA 2AJVH 1R17A 1IE5A 2AXGA 5IVXA 1X6NA 1KB3A 5HYJE 2Z1PA 3K8MA 1KV3A 1DSFL 1TZGL 2X1PA 3KLSA 3GBLA 1SF3A 1KNOB 3UXFA 5JDSA 3R7RA 3P77A 1D3CA 4JFHD 4TUOA 2X4OB 4FI6A 3FQRB 1B4TA 4OFQA 5GRJH 3APMA 4KK6D 3SD2A 3BVWA 3O9WB 4LEOB 4AYFA 5BW7A 3MRBB 3RB7A 5CP3H 1JF1B 3F64A 3NFPB 3L3OB 5TF0A 1FLTX 3O9WC 4XVTL 4D9RE 1KIPB 3S3BB 4UT9L 4Q56A 5H35A 1UWEH 2UXGA 4LLVB 3H54A 1YEFL 1KGCD 3MACH 3PWPE 1VFMA 1QVOA 5GZND 3U9PL 1ACZA 2XZAH 5DMGD 1ZA3B 5LN8A 3B5TA 4OM0H 3MLTB 1PG7H 3DGGA 1YN7B 2W95A 1URIA 4FFVC 3EDFA 3D18A 3IFOB 3SKMA 1L7IH 1ZGLA 4K7FA 1P69B 4AC4A 3OHXC 1RXLA 1LE5B 4LCWE 5E8PB 3O0LA 5EORL 4BM7A 3I9GL 1JYWA 4HXAH 1OTTD 3P9MA 3PWLA 5HHXH 3T71A 1BWWA 1SHXA 4JFFE 5F93C 4QXTB 5FUZL 1J5OL 4ELMF 1RVFL 3CHRA 3DXAD 3GHEL 4Z7WA 1CFNA 3HAEB 3RFZC 3DX0A 3ZN6A 2GSGA 4PREB 5KANI 3H0TA 1Q9KA 2EDOA 4KKAC 3OR6A 2MOQA 1ID2A 3JV4B 3MNDA 3IRZA 3PFQA 5A40E 4ESKA 1OCWL 4XAWL 5CZXC 5FA3A 1MW2A 3GLZA 4WU5A 2F7RA 2FJGA 5C6PB 4KK8C 1TJXA 2NMSA 4Q6YA 2WBJA 3E8UH 1F3DH 3EO9H 3LMJL 4GIAA 4XMLL 3ZE0B 1M42A 1BYOA 1UGNA 1AGEA 3PG2A 4S1DC 4XPAL 2DQUL 4NCC1 1KSRA 3WFDL 3PDOA 1RHHA 2NZ1A 1ZVSB 3IU4L 2P8PA 1DLFH 1UWYA 3I3EA 5CSGA 2B9BA 3RUGB 1YCSA 3M7FB 2X7LB 3FPYA 4TNEA 4E9VA 1B4RA 5EUKA 1E4KC 2GTWA 3CMGA 2VE6B 1O6SA 4Y9CA 4LB8A 4N8PA 3UBXB 4GQQA 2QPEB 4OJDH 5ESVB 2C3XA 4YE4H 3AG4B 3P4MA 4PV8B 4WUUE 3HOGA 4X9HA 2HTLC 1KTLA 3GHBL 4LEBA 5T1LD 1OCZB 2HA1A 3UBFA 4L1TA 4JJHA 2RCSH 1LK3H 4FQ2L 4Y4KC 2VXQL 4JRYB 2X9XA 3U25A 1BVNT 1XTMA 1U8QB 4IBQA 2QSVA 5HVHB 3EYSH 3EBIA 3IE9A 4FL4C 5KOMC 5IMKB 2WLMA 1T1ZA 2FWOA 1PNCA 4ICXA 4FRWA 3B5GA 2R2HB 2G75B 5DUJA 3SJVA 1P4LB 4KRPC 2BRRL 1MVUA 4GSQA 3PWUB 1COBA 4NZUH 4YDKH 1EUTA 4Y5VB 1EFXB 2YKLH 4ODXA 1U91B 1DN0A 4RMRA 1GY2A 2D3VA 2R4SL 3KNBA 5C0FA 2Z8VC 4P2QE 3HZKA 1HWHB 2BSED 1G5GA 5I2IB 2P5EE 2B1OA 2N3JA 2Y22A 3D08A 1ITBB 3L4YA 1QA9B 4NQVA 1SZNA 2Z6FA 3L9BA 2OMYA 4N9GA 2V3FA 2YGNA 1MXGA 1QBMH 5D7JD 1Q94A 1TFPA 2VW4A 1MFBL 3SQRA 2X4SB 2R69A 4IQHA 3MBED 4M1GL 1GCYA 3ULVD 3HI6H 2J25A 4EI0A 5L8JB 5D7HA 4BKSC 2H1PL 3S8WA 1WBXB 5C0FB 2PLTA 4OKDA 1EMTH 2AEQH 4U4IA 4N2LA 1MRFL 3RZWA 3FOMB 2ZCLL 4LARH 4N3UA 3BVXA 3MCG1 3ZTEA 1P53A 2P3YA 5JPMC 3DV4A 5D2NB 2AXFA 4FFZL 2ZT9C 3SKJH 4CKVX 2J5LC 5MENA 2Q6WB 4BKTC 2GBAA 2ZX9A 4A2LA 3ME0A 3P1VA 1H3PL 1O7VA 4H7VA 2L7UA 2JQZA 4P46C 3ZUCA 5FWRA 5CUSH 1C5DB 5HVWA 1JSYA 2XFXB 4AQ8A 4JQIH 1IM3B 1QLEL 1UOWA 2GEEA 4AL8L 2MHAA 5F97E 1UD8A 1YJDC 3N44B 4RFEA 4TUOB 2HN7A 2F8OA 4LOFA 4JFPA 4OY9A 1V3KA 4BH7A 3ZYOA 1KEMH 4MZ3A 3VXPA 2AQPA 3D0LA 1DANT 5FO9B 5DGRA 3P4LA 3QDAA 3RL1A 1BXAA 5DJ2A 4U49A 4XCCL 3QIWC 2GJ6B 4V1DA 3II2A 2BM3A 2ZG2A 4UZUA 1BZQK 2EXTA 2A7BA 2PO6D 3DTUB 1CU4H 4MFHA 4WWKA 4LGPB 2EKJA 1FVEB 4QXGH 5BJTB 2ZOWA 3EG9B 1LO4H 3BGFC 4OCRH 3OKLA 1UCTA 2WZPA 1Z3GL 5IOPA 3CSGA 3NK3A 1EDHA 5D1XB 5DJZA 5I75C 4UDTB 5DQJB 4KDWA 5L4FA 3FQXB 3SOBH 3H7BB 1CL7I 4BK8A 1RZIB 3QS3A 2OR9H 3RTQC 4XVSH 3H1ZA 5EBMA 3ECBB 3T4AC 1F4AA 2E7LA 3QEQE 2IC2A 5C0CA 3K1DA 2G5UA 3FB5A 1KENH 4XNZB 3G5YB 4LLMB 4UZGA 2LTQC 2HJKB 3U46A 3MLYH 3EOYG 4JG1H 3QUKB 4NHCH 4AYBA 3GXDA 4MA7L 1M1SA 1S7VA 3ZLQC 4NKMA 3VRLE 1ES0A 1SJMA 4PG9B 2QPUA 1ND0A 2CJUL 1SN2A 1HOCB 2D3NA 4MD0A 3FN9A 4OIIH 4LPVA 2DIBA 2ZD0A 1DQQB 3KWTA 1G9MH 1GC1L 3DTDA 3HS8A 3MCKA 4O4YH 3Q43A 4JGJA 5T3XH 2OULB 5FX3A 4TSCL 1AD0A 1L6PA 2WLIA 3BQUD 3P3SA 1HXYB 4RA0C 1I9EA 2JNZA 2R4RH 1E4JA 3UTTD 4F27A 2GB2A 2VISB 3RY4A 1P4IL 2CIKA 1WAEA 2X6CA 1E4HA 4MD4A 3I3BA 4ODVL 3UGEA 2VDLB 2C9XA 3D0VB 1KYOJ 3O3AB 4EI5B 4ZFOL 1UWXH 4JO3L 4HK3N 1A1MB 2CGZA 4FQQB 3QE5A 3ZZLA 3DX8A 2PCXA 3JWOH 4LPXA 3LS5H 4FHJA 12E8L 3QG7L 2IWFA 3FH5A 5IJKA 2VUOA 1K9TA 1IC4L 5CO1A 1T6VN 5E2JA 2R1YA 4KKCD 4RDBA 2PCFA 5E6IB 3B9KA 2XNAA 2OXHA 5FFGA 1HN1A 1HHIB 2HFEA 3TVMB 1LO2H 1KCBA 1S7SB 4QAWA 4YDLC 1XGTB 1JMZA 4FTVD 1PU0A 1XSJA 2OXGB 1Z66A 2DB8A 1E4KA 3TH3T 4GUQA 5D72H 3KBEA 1JCKA 5FYLL 4DP7X 3DOSA 4FNQA 5AW1B 5I8KH 1T0NB 4N26A 1Z0NA 4G6MH 4XPFL 1PDKA 2D03H 3UACA 3ARGD 1FL5B 1XHHA 2ADGA 2ZP8A 4B0MM 5KW9L 1H0DA 3D33A 3IS1X 4HW6A 1WZKA 1TVHA 4L8BB 3E6FA 5D93C 1AKJA 1E9PA 5FPIA 3BZFB 2VDMB 5IHHA 1OP3K 1NPUA 3L9YA 3BSGA 3DSNA 1V3MA 3U6RA 1CG9B 1QO3B 4M1CD 1E5ZA 4P4RA 2WZAA 1JPTH 4KDTA 1QPPA 2ZYRA 2AK4A 3WTTA 2W81C 2D31B 4HJGB 2BSSA 2WQAA 1OAXL 4XOBA 4G71B 2JMRA 4WKXA 3ALPA 4GKNB 4TMPA 1RI8A 1M9WA 4M48L 3DIFB 1FZOB 4JRWA 5EEVA 4K07A 3VXSD 1NC4B 3QWQB 1I75A 1AR1D 3E0GA 2NZIA 2VM4A 5DD3L 1TTBA 2VUYA 3P0VH 3KLHD 3DX6B 2D9CA 1YVLA 4TSCH 4LZKA 4PJBE 2XN2A 4JKPL 3CDZB 4X7TB 3NPSC 3IDMB 2YQGA 4G1MA 1E30A 1GL4B 1XSIA 2CR6A 4GG6A 5EPMB 2HWZH 1P2CA 3SPHA 43CAB 3K2UL 1TR7A 1YYCA 2FH6A 1TMCB 4OF0A 2J2ZB 4RVBA 4ZTOL 3GSUA 5GGUB 4A6YH 4H20H 3PIQB 4W81A 3RIFK 3RVWC 3GIVA 3WS6A 5AVUB 4H8PA 4LGRB 1NFIA 5LDUA 2NY4D 3IXTA 4Z7VA 4M5ZL 1TQWA 1F4HA 1OARL 1OTUC 2D7TH 2XDHA 1WAAA 3L4ZA 5FECA 1SUHA 3BVTA 3GC3A 5F6IC 5KAQF 5FGBA 4TLUA 2WLYA 2ZSVB 3E3QC 3JXAA 3WIIH 1YPZF 4KY1H 2ZSWA 4HKXA 4WUUD 3STLA 1AP2B 1Q9KB 3FN3A 2P5EB 4X80H 3H42H 1UM4L 1ZPUA 4LCYB 3MYJB 4A2MA 1NH6A 2HVJB 2AXJA 4LSQH 4PJ5D 2E9IA 3QNFA 5AAMC 3PHSA 4PJ5A 1UKTA 1GZQB 2DBJA 1RJZA 4M6NH 3M7OA 3QUYC 1W0WA 2FJGB 3Q01A 4F7TA 2ZKYA 4JHVA 4MRCA 1IQWL 1N18A 3EOAA 1DZ0A 5CGYC 1HHJA 4YR6A 3GXMA 2ZTBA 3LN4B 3BHBB 3UTPE 5K9QG 4GOSA 3MRFA 3FS9A 4DO6A 3AY4A 1LEKA 1GGIH 1NCAL 1KPRB 2H26B 4F1SA 3MU3A 3GUTA 3MV01 3QZWA 2ENJA 4R2GB 2P7TB 2RACA 3O3EB 1HWGB 1P1ZA 3OPUA 5E51A 2ESVB 5E9DA 5FOJA 2NX5D 4PLJC 3PWLB 5IQ9B 1HE7A 5HHOE 1G6RB 1Z9OA 3QQ4B 1MFAH 2GT9B 4PB0H 2ATKB 3OKOA 3FKUS 2XVKA 4YXLL 3TV8A 3B3IA 1MCFA 4OKVB 1S78C 4URKA 3RLSA 3GBMH 1JS4A 4YFDB 5TPWL 1A9VA 1GA2A 1T22B 5D1ZC 4JK0D 5KYUA 4X50A 2LHAA 2E74C 3O3AA 5CLTA 5DRWA 4WW2C 1PD1A 5L2KB 1WV7T 5E0QA 1DLFL 2E46A 2HUEA 4XMPH 2QPFA 4W9HC 4KNTA 4ZYKB 4LCWB 3RAJL 2NTFA 1FUNA 1VCBC 2DJ4A 3F6LA 3GS4A 4WI0B 4EN3C 5B8CB 5EEYA 4ELKB 1QEWA 4GB9A 3VXNA 5HD8D 3IN0A 1U91A 5HVFB 5IESH 5IIEA 4I0KA 3RFZB 4OZGF 4CNIA 3BISA 4NUJB 4N3TA 1TLKA 3ZJAA 4XI5D 1FV1B 4HKBB 3BZEB 1OT1A 5D70L 1XSKA 4OW6A 2DWDB 2NX5B 3T0EC 4LPCA 2DMBA 5DFVC 4U7KA 3U7WH 1T83C 2ALAA 2BRRH 5D9SB 2HFGL 4BV1A 5GS1A 5I8CA 3JUZA 2ZX7A 2EE0A 4IGBA 1CS6A 1EUUA 2YRZA 3REWA 3WIHH 3GHPA 2EDFA 2EACA 2OJZH 4WCYL 1RJYB 2DLIA 4TQIA 4K4KA 4Z78A 2A3TA 2ETWA 1T2JA 4NM8L 3U7AA 2B15A 2C1PA 4UTBH 4JKWA 5GSRB 3BGMA 2DYSB 3C5ZD 5ILTL 1YUHA 3UC0H 1OKEA 2DV6A 4B9IA 1R5VA 2IPUK 2YD6A 1JP5A 1F3JA 3H56A 3SCMB 3BRFA 3VXRB 3VFRA 3VSVA 3WJMA 2D31A 1JGLH 1KYFA 1B90A 2CUIA 2KQNA 4H1LA 3V8CA 2JKRM 2X3AA 3WUZA 4IBUA 3KVQA 3RJQB 5DUML 4D7BA 3UCRA 2YAPA 5TDPB 3OHMB 3L4WA 3VVVA 4Z7QF 5C0CD 1CTNA 4KKNA 4ONFH 2D9QB 1G6RL 5FWQA 5C71A 3WDIA 3NCJH 5C0IA 1WAAF 4X42A 1KJMB 3ECWA 1O7SA 4YLQT 1EZUA 1R33A 3SPVB 5M7QA 4NEHB 1IAKA 2FO4B 3CFBB 5LWYH 3A47A 4PJBF 1F4WH 2J57A 5MEQB 4JHAL 5FUOL 1D6VL 2OMWB 1PQZB 3LH2L 2XWTA 4MQXC 1UH2A 3B7UX 5KVFE 1HEJC 1HSBB 1OQXA 2XA3A 1LE9B 4HWBH 1LQSR 5D1QA 3PXLA 2GJ6A 4R4ND 4V1DB 4G6JL 4X4KA 1TZGH 4Y88A 4HH9B 2EDRA 4KC3B 1XT5A 4F1ZA 1MEXH 3ZZSA 1X5ZA 3QIBC 2P48B 4QRTA 4YHYB 4OAWA 1U8PA 4MX7A 2CR0A 4M8QB 3O6ML 1PZBA 1WIOA 2BOBB 3GSOA 3QDME 3MRLA 4LSVL 2LW3A 4YHYC 1RH8A 3PP3H 3NH7H 3NJIA 1N2RA 4K71B 4Q9CA 4QRRA 3Q05A 4Z9KB 2IWKA 2XFXA 3O2WH 4H25A 1NPJA 1W6WA 1ZV2A 2ODIA 3MX0A 4YEEA 3RA7H 3F8UB 3OM3B 2D7PA 4ZX4A 4FG0A 2VDNH 1SXBA 1MHPL 3MUY1 3MV7E 3QORD 1A64A 1FCGA 1PG7L 5F0PB 3GMPA 1T6BX 3LTVA 4UOW1 3HMWL 1VFBA 4F7EA 1UZ6E 5DC0A 5I19H 1JNLH 2R0WH 3PY9A 4QOKD 2VNCA 3Q9PA 4XWGL 1HOCA 2YAOA 5L9DH 3K6IA 2J1XA 3NRQA 3WEXB 5TFSH 3TYGL 2BW5A 1KZYA 2GK2A 4KX7A 1Z5YD 1Z9PA 3IRPX 1CR9H 4Z7NE 4XMTA 4QOKE 4PM1A 4B9PA 3W81A 5E08L 4P06A 5KBPA 3WNKA 1U3YA 1GGCH 2HLFD 1SOSA 1NEZG 3GUTB 1HILB 3SYQA 2XICA 1X9UA 4AGMA 5GS0C 3I50H 2K45A 2ZX6A 4N20A 3UABA 1PKOA 2G5RA 5KN5B 3A3YB 3JVGA 3I6SA 1SYSA 4BFNA 1X5AA 4LXFA 4J6RL 1HHGA 2E7CA 4F57H 5EIIA 4F8LA 1J05B 2EAEA 2X70B 3LNGA 3KE0A 2ENQA 4NM4H 1KF9B 4L8CA 1E2WA 2H47C 2C3VB 3CCHB 4OI9A 2VXTL 3EJPA 1SHMA 3T65A 1FZMB 3FFCB 3MJ6A 4OGAC 2Y1ZA 1M56B 2FJHA 5CWSB 1AJ7L 3HKZA 5I17A 2J5WA 4C83B 2DRUA 3PGCB 5DR5H 3U9WA 4QHUB 5D1ZD 2IDSA 3GJFB 3LZFH 3RGVA 4H1LB 3B9EA 4OD3L 4XAKE 3K3QA 2H3XC 3CPLA 1IVLA 3V95A 5KBNC 2IG2L 3N1GC 2WBJC 3Q0HA 4YHZL 2HLAB 1AZCA 3J27A 5HYSG 2Z35B 1UA6H 2ICEA 3UZEC 4NT6A 5J1SC 4PJFE 3X14B 5DLLA 4NUMA 3VXUD 4F37K 3KYAA 3QAZB 1QUNB 1ZVNA 3LEYL 2EEAA 4B9JA 3QDJA 4PB9H 3U6XS 1KYAA 5AOLA 4D0DB 4MMZA 3NFSH 7TAAA 1I8UA 1IQDB 2VR4A 2HCZX 3WD5L 1E5BA 2OSXA 4U3HA 2XYBA 5CGYD 3AT8A 1ZK5A 2P5WE 4QO1A 3OLIA 3DMMD 3VGAB 4RETB 3UTOA 3QPKA 2KL6A 5FHAH 4DGYL 2Y3AA 2ERJC 1MIML 2CBQA 3T8XB 1GSKA 15C8H 3FTWA 4OTXH 2VMDA 2RALA 4X5XA 2B59A 3HN5A 3UJTL 3B2XA 3FFDB 1MCHA 5I0ZA 2KT6A 3DI3B 1JK8B 3LVTA 1FSKB 5D1XD 1JHTB 4QYOA 4NP9A 3W9EB 3WL9B 4Y19B 4J3UA 3D39B 3FQWB 3TNNA 5J6GB 1EEZB 2OMNA 2J1WA 4WTZA 1XZ0B 2AV1A 2BNQD 5BCAA 4HA1A 1C1EH 2A9MH 3LRSA 4YL4A 3M8OL 1IEBB 2NY4C 2VMFA 3HE7D 1UASA 4Y2DB 2BDNH 2K9FB 2YOCA 2Z31A 4FLRA 5EZLB 4J39A 1OB0A 1QX1A 2XG5A 1G1KA 1HCYA 4K8RD 4L4VD 4Y9GA 4MJ2A 2DW5A 2N1KA 4BYHA 1A7PL 3QJVB 2OZNA 1HYSC 2MNJB 3EH5B 4OCWH 4UTBA 1LO0H 2VDOL 2XJKA 3TWCH 4KU1A 1L0QA 1V10A 1CFBA 1A25A 2EEXA 4JFEA 2PW2B 2VITB 1ML0A 3P2BA 4PWEA 3UAJA 2MEJB 3U82B 2J8UE 4ABWA 4F24A 4HBQA 2ARJQ 5B3JF 1JXGA 3RIAK 1XF2B 5CBAA 4NQUA 3IWVA 1U93A 5IB4A 3CNKA 2Q7AA 2K3HA 1U95B 4GKSB 4JN1L 4ORGB 5IBLC 3LPOA 4GBXC 1OT2A 3N04A 5SX5K 1FNAA 3G9AB 3QUZB 5CZRA 1H3XA 3PGFH 5HYJA 4TTDC 3LPWA 2UX7A 3HKFA 4Z3TA 5AW8B 4JE0A 2DM2A 1DDHB 3TIEA 3MOBL 1I9IL 3FCUB 1A6TB 1M6OB 4Z6AT 3L9EA 4C58B 4IJ3B 2E8YA 5DJZB 3IDIB 3OZ9H 4X98B 4J27A 5ITFA 1FQ9C 4QRAA 2FLBT 5A7BA 2CRMA 4HS3A 2WWNA 3FSOA 1IAIH 1FZJB 4QHKJ 1XAUA 2QVFB 1INQB 3SEPA 1N6UA 3D0AA 1E3XA 1Q9LB 3PHOB 2UZIL 5ISZE 1CVSC 5C0CB 1BM3H 2WC7A 1YQ2A 3EFOB 4HMEA 1TUPA 2I9TB 1BZDA 4PCYA 2BVOA 4NBYB 3LIZA 3FU5A 4G8FA 2QZQA 3SPJA 3WS6C 2VM9A 3D69B 5HVGB 4HJ0D 4N0YH 1ES0B 1S8DA 1LQBC 4PG9A 1AO7B 3ETSA 1LO3H 4L4VB 4YIQB 1IAIM 3HB3C 5HPMB 1SGKA 1INQA 3VA6A 2IFGA 5HVHC 4LHQB 3RY6C 2DM7A 4MBRA 4Z5RB 3GJFK 1U8IA 2F7QA 4M5TA 4GEIA 1SYSB 1AZVA 1TIUA 2QTVA 5I1LB 2IAAC 1OLLA 1CGSL 2FEDD 3HZYB 3P02A 3KDMA 1E9OB 4JRYD 1FGNL 3TH2T 3FTXA 4XVSL 1DJXA 4Q89A 3FFCA 1Q0YL 3FTVA 2NSQA 3S3SA 5LGJB 2EP6A 4LLUA 1BJMA 4PJEE 2Y72A 4A39A 5AOJA 2FAUA 3C9NA 2QQNH 4JY6B 3ZRCC 1UXWA 1NEZB 2H1XA 2MH4A 1FO0B 5F7FA 5EOCH 2NXZC 3SDDC 2Q8AH 3M17B 3ZSTA 1GS6X 1LTXA 1T21A 1YMMB 5D1QE 3BWAB 4NN6B 4FYSA 4DUVA 2PP8A 1FLRH 3MO1A 3BH9B 1TZHB 2AGJH 3S35X 5I8EA 1UOVA 3PJSA 1BVLA 5HYQB 1A14H 4G9DB 1QRNB 1GYWA 4NDMA 4R3SB 2V5SA 3MV9B 3QWRA 6TAAA 1PX3A 2P4AB 4X9GA 2OMZA 1GHFL 1BW8A 3D2UB 3P40A 5CZVL 1FL5A 1WA2X 5DC9B 3AT0A 5G55A 2FHBA 1XCQB 5DO2D 5DFAA 3MA7B 3FO0L 1IKOP 7FABH 1TPXB 1J8RA 4PRHE 1R1CA 3QJQB 3OPZL 4G8IB 5KVGE 3P3UA 1MCKA 3GKWL 5AW4B 3DXAB 1A3QA 1C12A 1DVFD 1JZHA 3KLAB 2RTTA 1GGTA 3OMNB 5SV3A 3T8XA 2H6UA 4X8GA 4U3XA 1NCIA 4GXUM 5LAXA 4FJYA 3WN5B 2O93L 2YWYA 1GMEA 1J9QA 3FFCD 1FE8H 2W1NA 3TJPA 5I9QC 4L18A 5DFTA 4ODWB 2C4FU 4PJ9D 5BRPA 3MSPA 4DP1X 1BX2A 1D5MB 4CC4C 4QXVA 3W9EA 3WL9A 4JPIA 5SWZA 3QQ3A 3GRBA 3N3EA 4YGVA 2DLEA 3IFLL 4GAYA 4LLMA 4TL5A 3VG0L 1CQYA 2GC4C 1UZGA 4PJ5B 2E9BA 3MR9B 4G8GD 1ZEAL 1Y6NR 3NA9L 4PJHE 1KIRB 3HC0B 5DJCA 3C6EA 3RPKA 1J11A 4MD0B 5HGHB 1B0WA 1GVIA 2ATPB 5BUPA 3FW6A 1Q9LA 3FU7B 2E5EA 1TYRA 3SBPA 1BMWA 4D8OA 2EDHA 3PHQA 4Q6KA 2BVYA 1GC1C 1XCTB 3CH1B 3M1BB 4B9YA 2X2UA 4P46D 5CJQL 4AGOA 1IGFL 4NXSA 4P5TC 4BJLA 2HH0L 2HRLA 3IF1B 4PJFF 1E4WL 4IBWA 5F7NC 1GY1A 4P23B 2VDOH 2VLRB 3G6JA 3O0RL 3FTGB 3EYSL 4R5XA 2OP4L 1ZJAA 3BFQG 5HYJB 4UDUA 4MJIB 3UJIL 3EHBD 4GLRI 3AS2A 4FA7B 4OGZA 4ZXBA 1J86A 2G9HA 2Z91B 3C09B 1A6PA 1MI5D 3CG8A 3HCVA 4FMVA 2DIEA 4JL2A 4X4MA 2W8CA 3KPLB 4BFIB 2PTTB 2ERJB 2N0KA 1A6TA 2J71A 2PNDA 2WP3O 3GSNB 3NJJA 3QH3B 1YPZE 5ETUA 4MNQB 4N4YB 5JW5B 1NC2A 5AZUA 4A7TA 5L4MA 1WS7A 1K5NA 1G7HB 2XWJA 2BSDA 4M5YL 2QBWA 2OA9A 4WEUD 5EWIH 2OL3B 1F58H 3OZKA 2EUVA 1ID5I 3B56A 3ILQD 2XZQL 2KLSA 3M45A 1BMGA 1RULL 4M3JA 5KYYB 1NJ9B 3CIQA 2FEDC 4M29A 4MAYB 1KLGB 4K73A 4NKIH 4P5SA 5DVKA 4U1LB 5KZCB 5JQ6H 2ADFH 2PYEB 1MY5A 4XPGL 5HHNA 1KPRA 2TRYA 4R7LA 1JI2A 3CU1A 3QHZH 1NGXA 2ITDA 5EU5A 2P43B 3BD3A 1MRCH 2LTQB 5FS5A 4UNIA 1N6VA 4S10A 3TFKD 3TWYA 4PJAA 1U8MB 5J4MA 3D2UA 3VB9A 1U3HB 4Y4KD 4FFYL 5C0RL 3QRGH 5HJ3A 3ZGIA 4FG2A 2OXHB 4XRCB 2A6IA 5H94A 1XR8B 3IK2A 1FVCA 2QV2A 3L5XL 4PS3A 3V4PB 2BNQE 2JH2A 3SKNA 2EADA 2N7SA 3LV3B 3FCTB 2Y36H 2B0SL 4N90D 4OSUH 2QKIA 4F20A 5GGRA 2HAZA 2Z92A 3EFDH 2VL5B 4OZHE 4KDVA 1LXMA 1UD4A 3M8OH 3QRBA 4N2CA 3S7GA 2YUXA 2K8MA 3T6ZA 1QG3A 5E6ID 5I6NA 5DR5L 3US1A 2R51A 1G7LA 4ZS7H 3CXHJ 3U9PH 2QR0B 1YEFH 5E00B 1QI5A 2DWSA 5DVMA 1UKQA 4YSUA 2ZUVA 4XNZC 1CE1L 3QJFB 5I8EB 4PJDB 5DHYA 1D5BB 1AY1H 4Q6IA 5C9JB 2J2ZA 3OMAB 2YN5A 2PPCA 3UG3A 2V33A 1X5GA 4N22A 5E03A 5DHVB 4MB5A 3BUTA 5MEQA 2AV7A 4UINH 1N19A 2HTKC 5E1AA 4RA3A 1TCRB 2JI1A 3NZSA 2Q86A 5F9WB 1OB1A 2CDFB 3FUKA 3QDGA 2DQTH 3QUXD 4LEXH 5E5LA 3INUH 1KGUA 2E7HA 5D5MF 3NABH 1UXLA 3T1FA 2CGRL 3G5WA 4R7NB 5IF0B 3SE3C 4O2FB 1HYSD 3K2MC 1W0VA 4OZGB 1JWMB 4BSVB 4YZFF 5IB2A 4UINL 4MDIB 1SDDB 3FH7A 3UTQB 2VWEC 4Y8DC 1UZ8B 3BESR 1BQLL 1T7XA 4MJ6B 3K6DA 2BOCA 2P8MB 3ALXA 3NG5A 4ELMA 4NJ9L 4LPWA 4NNYA 4M7LH 5DMGC 1UWXK 2FE0A 3ZE1F 1FYTA 4K5LA 1Z1WA 4JFYB 4X5WB 1EO7A 1JWMA 3POCA 4JFSA 4QRBA 1E9QB 1DLHB 4UT6H 3MGTB 3CXDH 1I7RB 2FDBP 1I1RA 4CU7A 2ESVD 4QY8A 4W9JC 3UTSB 5C2UB 3S35H 4BCZA 3VD0A 1JK9A 2TRHA 2Y36L 1RZPA 3UROR 4PS4L 2V5MA 1FIGH 3MNWB 4WY7L 1V27A 2TAAA 2Q0ZX 3RVUC 4LSVH 3VUAA 2X12A 4NQXA 5I1DA 3O6MH 1YN7A 3CDGA 1WZMA 1MFUA 4KI5F 4OQTL 1Z2KA 5DD0L 2W9DH 3D3VE 4ANVA 3MFGB 3TX4A 4K2UL 3V5KB 3EDJA 5ANMA 2R15A 4DT2A 1RUKH 4TL4A 2JJTC 4DF9A 3IXAB 4DEPB 2HJFA 2X88A 2H2PD 3HG1E 3QYNA 3E8VA 5GGTA 1ZDSA 3IDJB 1KT2A 3MX0B 2HFFB 1PD6A 4K9JA 4RWYL 4MJ4A 4EDXB 3KGTA 5DEJA 4E5XB 1NGPH 3ABKB 1H5BC 4G6KH 4F7CB 2Y7QA 1XTLA 1YNKL 2IANA 3ELQA 1WPCA 1L7TL 4UV4L 5L9DL 2VLJA 4LK4A 1LNUB 1OCOB 1ZS8B 5CS7A 2IQAA 3WIHL 2VDKB 4JG5A 2HJFB 1IC1A 4ONFL 2BS71 2FX8H 1I1FB 2H2SC 2ESVA 5E9DB 5E4EB 4U1GC 3IMVA 3AREC 4TNFA 1UKSA 4FYTA 5F1SA 4FNRA 4E5XG 4HCRH 4OGAD 2YPLE 2NNFA 4IK7A 4XC3H 4POZD 1UJ3A 3F7PC 4AV5A 4PRHA 3B3IB 3F7YA 5A3IC 1CGWA 3Q6GL 1JGVL 4ODTL 1EZSA 1H5BA 3IS0X 4YFLI 4DNLA 2GJZB 3RU8H 3TVMA 3V4PL 3JUYA 4Q6IC 5LQBH 3T0DA 2CRZA 1KXQE 1B6DA 4N0UB 3WMQA 5J6HB 2O1AA 1P9MC 4LVNC 5H37H 4WFFD 1BZ7B 2JJTA 3SYPA 3D2TA 4H8WH 5BS0A 1OY3B 1QUNA 1KMGA 1TZHA 5GQBA 1X7QB 3D06A 4FJZA 3PFUA 3S9DB 3JTBA 1HNFA 4WI6A 3OKDB 3FRPA 3APNA 4HFWB 2J55A 3VGBA 1R3HB 4FG4A 3PNWA 1MRCL 4UUJA 4XP9H 2D7NA 5T3ZD 4KJYA 3UDWC 3M88A 3N42F 1JCVA 2L0DA 3WEBA 1WDAA 1RUPH 5J56B 5FUOH 3GJFA 3RWJA 3WFHA 2DMHA 1X44A 2UY6B 1FG9C 4I3GA 1F13A 2P52A 4HCFA 3IMWA 3ZL4H 2PWHA 3L3IA 4N6RB 4GUCA 4PJ7B 4K3DL 4ZDHB 4PBWD 1OSPL 4A37A 4MZIA 1ONQA 3DJZA 3U30B 3GK8L 5CF3A 2ENPA 2G2RB 2MPVA 3QZLA 2J73A 4P04A 4FFTA 1YEDB 2FEEI 4WSKA 2HKAA 3MROB 3ARTA 4NO2A 1KBGL 1G0XA 2DKUA 3L08A 1I7RA 3H2WA 4TF4A 5H4YA 2OI9B 3OJVC 4OFDA 1IT9L 3WY4A 3VXMD 3QEUA 2EC9T 4UTBL 2A4CA 5DJ2B 3QIUA 3QIBD 3GKWH 3CVHH 3T08A 3BT2H 3QIBA 2CDGB 4WFHE 1DO5A 3QP3A 4QXTA 1ZRUA 3WMPA 1ZHNA 4X6CB 4Z8FL 4UYQA 5JZ7C 3ARFB 4JPIB 5SWZB 3ZTCC 2EDTA 2KMWA 3U7WL 2YO3A 4QRPB 5C0AA 3G5VA 2JB5L 2F19H 3LAFA 5CBAB 1QASA 3PAVA 3TC9A 3V4VA 1G7IA 1EZLA 4JO1H 4R97C 1LDSA 1OWRM 3IMTA 3O8XB 1AGFB 1B4JL 5FC9A 5AUMB 2VCOA 1NA8A 3BP7B 4NQDE 2W0KA 5L0QC 3D0LB 1YMHA 1JDCA 4Y7OC 1XD0A 2R59A 5IROC 4C8XA 1A9BA 2YD4A 4UQ2B 3IFLH 3RHWK 3X17A 2TSAA 3CHXA 2X4RB 2R23B 4JFDE 1CIDA 1Z3RA 3PQYA 4XCYA 4NQEA 3TBYB 4HIEA 2VSMB 3MV7B 4H8WC 5DZJA 5C3LD 3Q48A 5BRZB 5LHDA 4XBGB 3LY6A 4UIMB 1X6LA 4JFDD 1R9FA 3GBML 2RFXA 1BVNP 3PJLA 4AYID 1T03H 1FGNH 1AY1L 4TVUA 2ZCZA 3NCYS 1CE1H 1W91A 5IB1B 4GI6A 1EHKB 3D51A 3NSXA 4NQSA 4JFHE 5CJXC 3DVFA 1HCZA 1P6FA 4XB8A 3U1QA 4JRYA 3S4SB 1M3JA 3CHOA 3MLWH 1OM3L 4KH9A 3L8QA 4GMTH 5HYEA 2O4EA 5LGHH 2LU7A 4CC4A 4D3CL 4DGVL 3FUJA 5JIIA 4FC3E 4IM8A 3DETD 3KW8A 3W5MA 3PHAA 3UGUA 4TUJA 2K1MA 2G75A 1U58A 4P5RA 4MAYA 1PKQA 1RCYA 1WCQA 1I8LA 3B2UC 4MD5A 2HJKA 3RPBA 5BUGA 3KL3A 1B2WH 1TNNA 3EJYD 2SEBA 1X9QA 1N9PA 4PAZA 3ZKMD 4PP2A 4EN3D 2WXRA 4OZHA 1O75A 1T4WA 3QXUA 2ZNWA 3HZKB 4FQXB 3RG1C 3TURA 2JSFA 3ESPA 4PRAB 4JX0A 1ADQA 4TNVF 4W9ZA 4I9XA 3QO1B 5K1NA 1XGUB 5GJSH 1F6AB 1G9NH 3M17A 1KLFB 3O41A 3PHOA 2OMVB 4WW2A 1QZ1A 4QRPD 1ZXKA 1OAXH 4M56A 1FO0A 1BLIA 1BEXA 3QPQC 5C8JA 2G0KA 2W80C 3O2DH 2X4PB 1S78D 3S3DB 1JPTL 5IMOB 3OGCA 2FHCA 3IU3A 4HZLA 4PRBA 5JQ6L 1IM3D 1AVAA 4NKIL 4PGDB 1S7QB 3KWVA 3NP3A 3PPEA 3QO0A 3SQOL 2C9QA 5DMKB 5LXGH 1TXKA 1E50A 4W6YB 1S7TB 3QJXA 4WLCA 5KYXB 2VSDA 1UD3A 4P5MB 4Z5RA 2VDRB 3E2HB 3KVPA 1PYWB 4O02L 5I0DA 3DJRA 4RIRA 2YD5A 3L9RA 3ES6B 1BG9A 3ARBB 3WUWB 3WSQL 1MFCH 2A74B 3K2UH 5GGRY 4AZ8B 4ZI8A 3FBQA 5I8KL 1IM9B 3LZPA 2GAZB 2XWXA 5EU7C 1D5XA 1HAUA 1Q9OB 1UA7A 3OKDA 5I1CL 2R4RL 1A7PH 3N42B 4JCWA 5AL8A 1X5YA 3AJ7A 4MXQD 4JDTH 3QJFA 1JZIA 3QUYD 2O30A 1G4MA 4R4FL 4TOYH 1O5PA 2GUOB 2ESVE 4LCWA 5I73B 3WFEH 1UHVA 1ZT7A 2CDFA 2PYED 3QDGB 3VXQA 4NOFA 4GMTL 5DRZA 1OM3H 4FTDA 3ZYZA 3O4LB 2OTUA 3RVVC 2K6YA 4M6MH 4QRFA 5GGQH 3EJTA 5CN3A 3FOMA 5HBBA 5IIEB 3FO2B 3RFZA 8FABB 4NGHH 1PZ2A 4ZPTA 4KV5E 4I87A 1CG9A 4ZFGH 2WJ5A 4NX0A 5C0ND 2ZUYA 4CADA 3FUMA 4PLKD 2OR9L 1H6EA 9PCYA 1KCVL 1NIAA 1INDL 2NUPA 2ZKHL 5SX4H 3NUKA 3WNPA 2C9UA 1JHLH 2YPLB 3NRPA 4U1HA 3IWUA 5FHAL 1QNIA 3KWUA 1I9JL 4DGYH 1BQKA 4LLDB 3N55A 1NDGB 2CXKA 3PP4H 4HIXL 1D5IH 1RIUH 5C70A 3O2DL 2EZ0D 3EHBB 3Q5OA 1AI1H 3BDBA 4LLYB 4MA1C 1PZAA 2NYYC 2AXHA 4KK9D 3BRDA 3CZFA 1G9NL 3FPXA 4M9OA 4ZK8A 5IMLB 4Y5YA 4JZNA 4BE5A 2ADYA 1BQUA 5LCVH 4NUPA 2BP5M 4U6XA 1U8PB 4MX7B 4UQEA 4NPKA 1P5VB 4L9LA 4WSGA 4P46B 1WUZA 1SQ2N 5F71A 5CZKA 3PP4L 1ADWA 4EIBA 1U9KA 2F15A 3VNZA 3GRWA 4KROD 5LUMA 5E2TH 3SHSA 4JFED 2WIIB 1QR1A 5HHVL 3B83A 4GAJH 5EEWA 2R23A 3BT0A 3C6LC 2OSLB 5EUOE 4OCRL 1T66D 5T3ZH 2CRYA 5TE4L 2VSKB 5AW3B 4UM9D 4QRSA 3HMXA 3ZZQA 2Q3AA 3CLFH 2Q1EA 2WGNB 4XN4A 4KJPD 1VF5C 3SJVD 5C0EA 3F58H 4FXKB 1GHFH 4HH9A 1K5NB 4JMNA 1QSEA 4JFZH 1KC5H 4UIKH 4HHAA 3KD4A 4Q8BA 1B2WL 3ULVF 1OAQL 3GK8H 4TOYL 1IEAA 4LOVA 3RWGA 4A63A 3ULAB 1A7QH 4KKRA 3EUUA 3MA9H 3ARGC 4OLVH 1AZUA 4JHWH 3WFCL 1ZE3C 1Q72H 3CZEA 5J89A 1OCRB 4AEIL 5BO0D 1YEKH 3VXUE 5FFLA 1YNTB 4W9FC 4NO5A 4J2XA 4RQQA 2XPYA 4HWZA 2J6WA 3R1GL 2IBZY 2BXYA 1F3DJ 4E41D 4NJAL 2QLVB 2XX1A 4F33A 5KN5A 4M7JH 1BYNA 4V1DE 1PLGH 4HGWA 3NIGF 4APQA 2O61B 5D5ME 2YZ1A 4TSAL 5HGDB 3TA3C 4KKCC 1QBBA 2CJSA 4X6CE 3KM1A 1IM9A 3TPUB 3AM8A 2Y6SD 2C3VA 5LXGL 3NSDA 2F19L 3BZEA 4PRID 3ARRA 3MRGA 4XO5A 1P5UA 1OSZB 3HTLX 5EZPA 2Q76A 2ROYA 4CU6A 4NUJA 1CTMA 4H26B 4DOHE 4IJ3C 1UG9A 1H15B 4P4RB 2ADJA 1IKNC 1MAMH 1QFWM 1XH3B 2HSIA 3L7EB 4GKLA 1AGBB 4JGUA 4V11A 5FGCB 4Y5VC 2PF6A 2VLMD 4XCFH 3ARDC 2ZG3A 4OLWL 5EF2A 2QR0A 2ZP0T 2NY1B 3JV6B 3QCVL 2HT2C 4F7PB 4NHUB 4XMZA 4ODUA 5T1DL 5F7EH 4P4KC 1JN6B 3BUYA 1NAKL 1UM5L 5DURB 4LT7A 3CFJB 5FW6A 3T9WA 3RWCB 1MJ8L 4L3ED 1QI4A 4Q4EA 4E9WA 3KGRA 2DM4A 3HG1B 4N90E 4A66A 1TT6A 3T0EB 4CSZA 3IU4H 1SLUA 4HZAA 1MWAA 1J1XH 3LDBC 3CGTA 3I50L 4ILDA 4NKQB 5GGTL 5KYWA 4XB3A 1TTRA 4JDVA 5D2NA 1LL1A 5H4ZA 1KGJA 1LK3L 4FQ2H 4UOJA 4Q58C 5EDXA 2YK1H 5AD0A 4F8QA 3FHEA 3DOHA 4YE4L 2DAVA 3GGWA 4XNUL 1HSBA 4FQLH 4JHBA 4ONGL 3LXBA 5DJDB 3UP1A 1LE9A 1K8DA 3C60D 2Z0BA 2XV3A 4L8DA 4LGSB 4HUWA 4ZW8A 3O4LD 2Y2TA 3A4DA 4MLIA 4ZMOA 3O4LA 4GPVA 3GXTA 2OMTB 5I0YA 3OLGA 3IFPA 5H35B 1DN2A 4AW4A 3RZCD 1DQJA 2R2BB 2WYZA 2EC8A 4AVKA 4NQVB 5GRWA 3LS4L 1U6AH 4PI0A 5I76A 1QFPA 4FYRA 3UZQA 5A2LH 2B1HH 3VFMB 4N0UE 1KJVA 4TRPH 3ZKQD 1G5AA 1L7IL 5ISZA 1PY0A 2CUAA 2J12B 3Q6GH 4K9EC 1U4EA 4GS7B 2OJEB 4W1TA 2VXUH 3OXRB 4F7TB 3MBWB 4LSUL 1OE3A 4KZDL 1C5CH 4MAYD 4EZJA 2HKHL 1AIZA 3HFML 2AK1L 4G9FA 4P2RA 1EEYA 3SDCD 4Y16C 5KVEE 3MRJB 4QTFA 4FFYA 4HC1A 4YX2H 1YZZA 1RKRA 3GHEH 2YMXH 2EILB 5EUOF 5E5MB 1L7TH 3T04D 4YLBA 3F62A 2XX0A 3RDTB 4P48A 3WLWD 2VZOA 4UQ3A 2WBJB 3IMSA 5IFHH 2HT4C 2CBTA 2GSIA 3BN9D 4ODTH 1ZHNB 2VMCA 4XNQB 1RUMH 3ZDXF 2BH0A 4P57A 3DO7B 2WN2A 3BCDA 5CU5A 2DLGA 4BSWB 3ULVC 4Q0XL 1CXFA 2EIEA 4QKXB 2CHNA 4F7MB 1S9KC 3OKNA 2WXQA 4HIIA 3H9SD 3KMDA 1QABA 3DYOA 1G4RA 4XVTH 3RQ3A 2JB6A 1IAOB 2NY1D 1Y18B 3VW3H 2JJSC 4MD5B 9CGTA 1KTDB 2DQUH 4PJIB 3L3KB 4PPTA 4PJEA 3D39E 4XNUH 1S5IH 2ZIDA 4HEME 3CBRA 2EABA 2ZXDA 1NDMB 5E2VL 1EWHA 3O6FC 2F68X 2GYSA 3N6YA 2FB4H 1LHZA 4XXCC 1SXCA 3ZT5A 5JHDA 2EXWD 1BJ1H 5A2JH 1BZ7A 4E2OA 1Z9MA 3AS3A 3FTSA 1RUQH 4NN5B 4P8QA 5EOQL 1VJSA 1NMAL 4K15A 1V54B 1J5HA 4I2XB 4GW4B 4KTYA 4HWEL 1D5RA 3SO3B 1L9OA 1UM5H 3VI3E 4HOWA 4H0HB 2DYPA 3I02B 4NO3A 4O00A 3L1OH 4UT7H 1PJWA 5IHZA 4RLDA 4AUYA 1C16A 3QJTB 4X6BA 3TO4B 5IQOA 4LLWA 4GW4A 1Q94B 3BDYL 1YAZA 5HJ3B 4XC3L 4HFUH 3X3GL 4LCCC 5KEZA 3ZHLA 2MPAL 2PABA 2Q2LA 4KOBA 1MDTA 2OX5B 3BYYA 4L8DB 5EG6C 5IGXL 2ZXAA 4F58L 3NSCA 3D4CA 3H9SA 4JDEA 4X4ME 3WJLA 1AQKL 3FQRA 4G2AA 4C56B 1AGDA 4ZS6C 5BNXD 3DX8B 4QO1B 1M71A 1WS8A 2XN9E 5I6MA 1AOHA 1M9SA 2F6AA 3G9VA 5IW1B 5A6LA 5JA8B 3HE7A 3QUYA 4YFLF 1UURA 3BUYB 4NS0A 3K72B 3LQMA 4I3RL 1XH0A 4Z0BL 1AQDB 1Q38A 5B38A 1C08B 3QZOA 5HGBB 3GLAA 3W3BA 5J9PA 1ZTXE 4ZTOH 3VE0A 1E5UI 2B59B 3QIBB 3ZQWA 1PTZA 2NZ9C 4Q0XH 2E4FA 4KMTL 1YRKA 3Q13A 4BFRA 3SGJA 5GRVL 3C5SA 2A2QT 2F08A 1MAJA 2WJ7A 3EIFA 4PJHA 3STZB 3WFCH 4IIQB 3EFDL 8FABA 1KG0A 2QL1A 3A4AA 3QULA 4QRPA 3RA7L 4K71C 3MRLB 4JKPH 3BMVA 3VFRB 3WJMB 1JPSL 4IMLA 5BV7C 3TN0B 5KBLA 3O2WL 2IBZX 1IJNA 3SY0B 4CSTA 2OK0L 1L3NA 1VERA 1AC0A 3MCLH 3SYCA 2AQSA 5MEOB 3HS0B 1EJOH 2VLLA 2XTJC 1AHWA 2CKBL 4YHPB 4PGEA 4XVUC 3F7RA 2R0LL 4JY5H 5HYFA 3QR0A 3QQ9C 3ZY7A 1OPGL 1RIHL 3T3ME 3EO0A 4IKLA 3HZVA 3EH3B 3RGBA 4LP8A 3AQYA 3QEQD 3SGEH 1U8OA 2FZ3B 3TBBA 4EMZA 1E67A 1XR9B 5GHWL 3S8FB 2YLHA 5JHLL 3O81A 4AJWA 4OJYA 4AGLA 2AABH 5CIPA 2IJ0C 2QQKH 4XN7A 5E0FA 4L2YA 5AW5B 4UQBA 3GSNL 3JV4A 4KGLA 4AM0Q 4FEIA 4KKZA 2IMMA 4P2CG 5I6LA 2P1YA 3DBXB 1U6AL 4PJXF 2LGNA 3SO5A 3WEOA 1A02N 2B8OT 2DQIL 5F89A 3K6NA 1T1WA 4Q9QH 3QNYB 3W11D 3X1NA 3CFCL 3V52H 3VFGL 3QR1A 1VADA 3KGUA 2BFVH 1UB6B 2D7QA 2MNWA 4NN6C 5DUMH 4XNDA 1KZQA 3FO9B 3H6AA 4XHJD 5J6SA 1U3JA 5ITFB 3FB8B 4UQ3B 3TEXA 1IIKA 4GS7C 2R69H 3RDTA 1FVEA 4WI4A 2O5ZH 3JT0A 3I9IA 2AJYH 1KELH 3B7YA 5IFHL 3HVNA 5AKRA 1QFHA 3FSWA 3DWTA 2V5TA 4L9DA 5HHOB 4JO2L 1J1XL 2CBMA 3L3JB 4MHHI 4Y16B 3HG4A 2ZUTA 8PAZA 2W0FA 3WXWH 4WFGD 1TQBB 2EIZA 1R19A 2V3EA 1B0GA 1P5VA 3HNVL 4L9LB 1ADQL 4Y5YC 5J0BA 5H8DA 1OF2B 4NGHL 1MCLA 1E5YA 1P7KB 1IFGA 1D9KA 1XF1A 3CVHA 3MRMA 4JPKL 4P2OA 4RGMC 4UIMA 5KJ7E 3EOTL 3R0NA 5D70H 1P5UC 4LPYA 4HJTA 4U1GB 3GZOA 4U6HB 1MCPH 3QUHA 2E4TA 4P9HC 5DVPA 5F7EL 2IMNA 5GIRB 5BUAA 3L6FA 1FJ1B 2Q7NA 2YD8A 1X5KA 3PWPD 5F7AA 4LDCA 4Y4HD 3TBTA 1QLFA 4BUGA 1BD2B 1T5XA 2B1HL 5ESAB 2AGJL 1L9MA 3C9NB 1N5YL 1DVUA 1SY6A 3HBGA 2OR7A 2CH8A 3CZJA 3SCMD 1NL0H 1RJZB 3KCPA 1LLAA 3M07A 3MRKA 4YXHH 1WBYB 3GB7A 2X4TA 1CXEA 4TUKH 5DQ9A 1A7NL 4GRMA 3EF7A 1QAWA 1H15A 1VFAA 4UYPA 3M1CA 1T21B 2VZ3A 5GS2H 1A1MA 4FQQA 2NW2A 2EXYD 4BXSV 3V0HA 3D0VA 2CIIB 1QKZL 4WHTA 1YC8A 3IGLA 1GAFH 3O3EA 2ZKMX 3ESMA 3ENEA 3PV7A 5IBTL 2EYSB 3JZYA 2R1WA 1E9OA 2NW3B 2YJQA 1MPAH 5A6MA 1SJXA 3CSYA 2EYTA 1EFXA 1OAKH 4HC1L 4PWJA 1FYHB 5H37A 4JANB 3LKOB 4M5YH 4YO0B 2V7NA 4ZJ9A 4PJ8D 3PABA 3WO4C 3NFNB 4JM2F 4QT5A 4JMXA 3B9VA 5DJ8B 3T09A 5K9OA 1UB5A 3TBSA 2QTEA 8CGTA 2DJSA 2E47A 5T5FA 1K72A 3LEXA 3LXCA 3WHXA 1ZVYA 4OR1A 5CXPA 5C6TL 4OQTA 3V6BR 3A21A 3UP6A 3MMEB 3TA3A 3ZKXC 5MHSE 2ED8A 1WWWX 2MRYA 4LU5L 1WQVT 4QCIB 3RX5A 3V4LA 1SOQA 1HXKA 4PTUA 4Y5XB 1S9WA 4TKWA 2Z65C 4MS8D 4GUPA 5D5MB 3U0TA 2PYEE 4PG2C 5F1IA 1I4FB 1FF5A 4BA8A 3CTTA 1NAMB 4BFEA 3WJJA 3KAAA 4KPHL 3I6GB 2GBTA 4HWUA 1WTGT 4G72B 2ENSA 4AIZA 3GSUB 1OXYA 5F21B 3Q8FA 2QELA 4JM2C 3HI1B 2F0CA 1BQ5A 3PLYA 3HVDA 1A14L 3DIFA 4A6YL 1XF3B 4XBPA 1AXSA 25C8H 5T5NF 4KPHH 1X4XA 4GEJA 4L1DA 4L23A 3OXRA 3NSFA 2BJML 1FLRL 4RSYA 3OG6B 4XXDB 3MV8A 4YXKH 5ID1B 3IDXL 3BWUC 4XHJC 4AG4L 4KNUA 3FDWA 1F97A 3R4RA 1A3RH 4R0LC 5ADPL 5DEGA 3RUGF 2CLRB 2APFA 1TKWA 4JHWL 1S9YB 4W9EC 3I84A 4LLAA 4OLVL 4X99B 1N8ZB 1I9JH 2BIHA 3FQTB 3WE1A 4KNQA 1I53A 1XF4A 2BDNL 3V4VL 4MAZA 4JRXE 4NQQA 4DO5A 3LZOA 2R4SH 4NAJA 1BHGA 5DD3H 4IKJA 4ZO7A 2YKLL 3HAEH 1N0LB 4NZUL 1FJ1A 1WP6A 2P5WA 3AG2B 1GH7A 4HUXA 1JPEA 1UUSA 5JHLA 3AACA 3HNTH 4QOKB 3SQBB 3KPQA 1NKGA 3UJTH 5GPRA 1SM3H 1Q1JL 1JUFB 1E2ZA 1SQMA 2JKLA 3MRKB 4HKZB 2B2XH 1TZIA 3T6QC 2D7MA 1NICA 5E2TL 1N4XH 2AJSH 3B9KB 4HJSA 5FKAA 4DGIH 3RVTD 3GI9H 4ZBJA 4Z3IA 4ZSOE 5DMIH 2FT6A 3BZ5A 2PW1B 4L8SC 2EIJB 4FG6C 1SLWA 4KWUA 2OYMA 2RD0A 3UC2A 1Q1PA 1PAMA 4RGNB 2V4LA 2IGFL 5JYLA 3HC2A 5KVEL 5ES4B 2IAMA 3CWGA 2IF7A 5TE6L 2COQA 1BAGA 2Q76B 1T7YA 3LEYH 2VDRL 4X5QA 1YDPB 1B2YA 1BQSA 1NCNA 4IK6A 3IDNA 3POHA 4LP4A 1NEUA 3QA3A 5AVQB 3P9LB 1HXYA 2AJXH 2K6ZA 1HNGA 3V0IA 4HIXH 4FXLA 5D6DA 5JXED 1RUPL 1KJ2L 4PD4K 5TGBB 2AJZB 4V1DD 4F7MA 5GHWH 3B8SA 3WUWG 3BPLC 1NGWA 4NQCA 1Q0XL 1YSOA 2C8NA 4HIHB 5D7JA 5MENE 2H3KA 2C4FT 3EYUL 1TPXC 2WBWB 4WGKA 2OLDA 3MRDB 3L3DB 3MUZ1 4YDKL 4GW5A 4PJIA 4YSOA 3T3MF 2BVUA 2R9HD 4N2EA 2HPTA 3S37X 1I8IB 5AVTB 1CCZA 3C75A 5GGQL 3WMSA 1DANU 2VC2B 4HFWA 1RK0A 2JJSA 4F7KA 1BECA 5CCHE 4KHTH 3D50A 3UO8B 1GKOA 1R3KA 5DMKA 4CBZA 4PU2A 2ICEB 5I74C 3RU8L 4G5ZH 4HT1H 4ADIA 1YHPA 3UMTA 1K6QL 2EDLA 1PL3A 5AYUL 4O4YL 3GPEA 4WI7A 3IJ8A 3LKNA 2O5ZL 4X83A 4D3CH 4DGVH 4L4JA 4RIRB 4ADGA 2VLKB 1BM3L 1J05A 2QVTA 1KBKA 4XC1L 2C9SA 1QW8A 3KPSB 2EYTB 1VLXA 1PKQE 1JG9A 4EEEA 2MTAA 3MLYL 4GO8A 3GQFA 2WW8A 4JG1L 1MLBA 2VDMH 1XFPA 4O02H 4TLSA 5F8RC 5HJGA 3DSNB 2PYFA 3CX5J 3HNVH 3QQDA 5I76B 5IB3A 5IF0A 4I9WE 4X5LA 5C09B 4NFDA 5E99H 2EICA 2DWDA 2E86A 1G7LB 4GAYB 4L1SA 4M3KB 4LCVA 4XMLH 5KSAD 3FO1A 4GKNA 3ZMRA 5DJYA 4WEBL 4EI6A 2A38A 3K4AA 1FVDA 1OL0A 1A0QL 3S5LB 3WHE1 2FSEB 3LKQA 5F1OB 3BFWA 2FQDA 4Q9RL 2VZ1A 4R7VA 5HI4D 3C87A 4KX9A 5C9JA 1NIFA 1QFUL 5CCGE 2ODHA 2VL4A 5IQNA 2VN6A 2B4CL 3D2UD 4K2UH 2KC0A 4ZD3H 1TZAA 1GIGL 2CJTA 1AOZA 1UJTA 1JGDB 1JJUA 5F70A 3DURB 4Z7UF 2IALA 4WENB 5B38B 3EKCA 4BHUI 1EJOL 3RNKB 3HR6A 4ZFFB 5J11C 4FQCH 5CNHA 1JWUA 1AGFA 2OK0H 2AI0L 5I16B 4X6EB 3V4VB 4HXAL 4H25B 4ODBD 4F9LA 3HA0A 2QPDB 3LNIA 3ZIYA 1VAHA 4B60A 2H0EA 2FYVA 2IWGA 1LJMA 4YR6B 3FU6A 3WLWC 5LGHL 2V9RA 3QQNA 1MW0A 3S2CA 1G0DA 1KCUH 4C56E 1JIBA 3CN0A 1EGJL 2P80A 4OI8A 2P80D 5INCB 3GBNL 4RCAA 5AG9A 5D71H 4GSRA 1EXHA 3GSWA 3LNFA 4MHHG 4Y2LA 5BMFH 1CDIA 5B38G 3SKJL 1KFAL 4HLJA 4OZIF 4FFZH 1RQ5A 2A6JA 3KPRD 4E5XA 4GSDL 3KWWB 4PRHD 4FFZA 2XBTA 2N4IA 3V0AC 5JTWA 5A2CA 4I7ZC 1AQKH 2N01B 4DVRL 5HHNB 4XWGH 1NGYA 2JKJA 3WENA 1MCWW 2GI7A 4M8QA 1KLGA 1UC6A 4PMFA 1J48A 2VLKD 1JZJA 3L1GA 2XWDA 5TDNB 3QEHA 2ZOLA 5JORA 1AO7D 4QY8B 5GGSB 3UTSA 1NCWH 2X7LA 1JPST 5C2BL 3ML9A 5KS9A 5DMYA 2E0PA 4BD4A 4JFTA 3CDGB 3V0JA 1RUML 3KWXA 3WD5H 1H9DA 4Z23A 1AO7E 3LKSB 3DO4A 2O5NA 1CTOA 4M6OL 4Y5XC 2B08A 3IKKA 4NYLA 1I8MA 4PIBA 1CC3A 4Y4FA 5F88A 5HI3C 2XKNA 4ZUVA 4XP9L 2WHVA 3H3KA 3QEQA 3MXWH 3H85A 4R6UA 2ISDA 4L8CB 4KZEH 3B7TA 4WU5B 3A4FA 5DGQA 5IVXF 1UFUA 1CI5A 1U8LB 1QHOA 1W72B 2EO7A 3O41B 3SDAB 4DIXA 3HHSA 4XXWC 4FP8H 4YSCA 2BIOA 4JM4H 5I17B 3MN8A 4OT1L 4OCSH 2XKUA 1ITCA 1G9HA 1F41A 2Z4QB 5I0WA 2QQQA 3ULUF 3QXDA 5LQBL 3IU3B 4HZLB 3FUHA 2X2YA 2FB4L 4U31A 4GMSH 4YSPA 3OXSA 5IG7B 1MCNA 2NR6A 3E3QE 1OWWA 4DOHB 4ATTA 4IRSC 2CXGA 1WFUA 1J0IA 4MMXB 4OB5L 4HIHA 5D7JB 1YNTF 5TE7L 4MMYB 3VSQA 4NAQA 5L2JB 2XY2A 4Z7NF 2HUHA 3CVIL 3AZUA 2XQBH 3SGEI 3VX1A 4DCQB 5CCKH 1ZMYA 3T2LA 4E9LA 5EFIB 5I0XA 3PWNB 4JE4B 1CK0L 2AEWA 3LSOA 4F2ME 3PL6C 4EOWL 3MLVH 1L9SA 3CFEB 3EADA 2YRBA 4UV4H 5CJ5A 4AIXA 4UTAL 4L3CA 4QT5B 2BX5A 5I0VA 1YNKH 3MRCA 5FYJU 4H0LC 3IYLW 1T89C 1KDIA 1OALA 4BZ2A 1L9TA 1SRDA 4OLXL 2YQ2A 3KJ4C 5E2VH 3VMPA 4EZLA 1MFAL 1DTUA 2XBZA 4HV8A 3FYIB 4PJCF 3IGAB 4F5CA 3X11A 2CDEA 1NIDA 2WB1A 3VI4A 1OPOA 2XZQH 3T4YB 1A4JB 3EYOA 5ELIA 5CINH 3IJEA 3AMKA 3FL7A 4HBCH 4ZMQA 1UT9A 4GXFA 1B0RA 4WHTB 2VDOB 1REIA 3HFMH 3QFJB 4DEWA 1YJDH 1MCRA 4EIZC 3L3OC 1CDGA 5AZEL 5IW1A 2HVJA 1KB5B 4PS7A 2Z34A 1HQRA 4H1LG 3LRSB 4LCIL 3A0OA 3OKMA 3QS2A 5CLXA 4Y1TA 3G5VB 4JDZB 3S35L 1JV5B 1TG8A 4U6VL 1KNOA 4OLWH 5E6RB 1QTPA 3VFNB 1JK9B 3OR7B 3FF7A 3K2IA 4L48A 4OCSL 5AAPA 4PJ9B 2OZ4L 4FLOA 1YJDL 4P5KA 4HSCX 1JNNH 3MRBA 2HFGH 2V3DA 1L6XA 3C6SB 1S9YA 1W80A 3EBGA 2WVUA 4IKNA 1OARH 4NRYA 1N7ML 2DWEA 1ZV5A 2MJWA 2Y1YA 5ABZA 1BAFL 1ZT4A 5GZOA 1KT2B 3JSSA 2OTUB 4NENA 4F93B 3ARPA 1S7UA 2KERA 1GJIA 1NGPL 2X89A 3Q5YA 4OAWB 5D5MA 2PETA 4A2EA 2EQDA 2JB6B 2KPWA 1FBIL 1FNHA 3QWOB 5D1ZB 2BK8A 3L3JA 5GRXG 5L8KB 3LB6C 3MGTA 3CN4A 4U1NB 4L1HA 3ATFA 3PWJA 5C2BH 4AIZB 3NABL 4L4TB 3N9GH 4ZG1A 4JY4B 1CWVA 5CR8A 4MKMA 4PJDF 4WEEA 1UD2A 3QG6B 1O6SB 4XX1E 3MV9D 3N5AA 4UQIM 1NANI 2VDNB 1QYGL 3NDYE 4WWID 5EUKB 1W0YT 1NOFA 1HKLH 5TDOA 4JZJB 4H2CA 4OGXH 4XVJL 1MNUH 2XLLA 3RWGB 4AUUA 3QXDB 3GKZA 2F5BH 2VW6A 1LK2B 2CLZA 2X09A 3GTTA 4NUQA 3VFOB 3FQXA 4G3YH 4NRXA 4X4XB 1O6VA 3KVDD 4XCFL 5FM5M 2ZKWA 4HWZB 1UM4H 4IOSD 2NCMA 4N0UA 2EDMA 2XPZA 3MKKA 1FO0L 1A6UH 1QSFE 2O5XH 1TCMA 2H7WA 4V2CB 1XGZA 4P9MH 2DQMA 2XKNB 4ZUVB 4N0CC 4XP1H 1IGTA 2EKSB 4N1EA 1OZTG 7PAZA 4NYLB 3HE6A 1TEGA 2ED6A 5D1QD 2OW6A 5FA4B 4G8EA 4EUPB 4FKKA 3VFVA 4LSTL 2YRLA 2AJUL 3S5ZA 5C0RH 4G70B 1ZPLA 2VIRB 4MJJA 1QZNA 4RAVB 3TASA 4M7JL 2KI6A 4HPHA 1TF4A 4B5ZA 1U8CA 4GW1A 1ZXQA 5JUEL 1I31A 5GS0L 4TTGA 3ZE2F 1TQUA 4Y1AE 4I3SH 4LEXL 2GJJA 3BRGC 4N9OB 3WIFA 4NO3B 3VU2A 2QQNL 1WFNA 5E24E 1OGTA 2H1LM 4LAQH 3HN3A 2X4OA 3TLRA 2WXFA 3U2JA 2MTPA 3P73B 4M5ZH 4JPWH 4ZTPL 1OCCB 1P7QD 3GLDA 3LKPA 4ODUB 4N2IA 4ZMLA 1PZDA 2C7UA 2OJ1A 4ZFGL 1CO1A 2XNAB 3B6SB 1KFAH 4NXKA 1GTNA 2OCCB 5C0BD 4IU3B 1N26A 5HGGS 4JJOA 5B1AB 2A1WH 3SIKA 1A7BA 4EVNA 4OFVA 3FHAA 2JCCA 4E9SA 3IAGC 2G60H 3ZYIA 2ZCKH 3MA7A 3N2JA 1WWAX 3L3GA 1DVSA 1YYLL 1JF6A 5F6IB 1MIEL 5CLYA 1RUAH 3FQWA 5L4IA 2VZSA 5F44A 1CFTA 2J8OA 5JXAL 3KGSA 5ICXA 4YAQB 5IHUH 5IVXB 3OKEA 4EN3A 1G7IB 3U30C 1V8HA 2BZ7A 2VN3A 4DSYA 4FFYH 4G7SB 3K8KA 2OMBA 2VDLH 3U7YH 1HJCA 2WQRA 4AE0A 3ATBA 1BREA 2E27H 4KO5A 1YNLH 5D1ZI 5AZ2H 5TE4H 3DGCR 3GS7A 4IDJL 1XVSA 4LQFL 1CDJA 5D2LF 1D5IL 4LOEA 3C5ZB 2BP3A 3VWKC 3IXTB 3AXLB 3VQMA 3MNZB 5ESQB 5DI8B 1K2DB 1NBYA 3DX4A 3H9SE 4JO4L 4JY4A 3SKOA 2JIXB 3CXHK 4RMUA 3MKGA 4FMFA 4P49A 2DL9A 5F1NB 2H9GB 2D7TL 2FWSA 3D3VA 3HJEA 5IBUG 5SWQA 3MVSA 2NXYB 1Z9SA 3D39D 4ZMXA 4CN1A 1RSFA 3VD9A 1EV2E 3BVNB 5AZ2L 3F85A 3EO1B 2XWBB 4J8RB 3I9AA 1ECZA 4XNXH 3ZKND 3QUKA 1TU2B 2FLMA 2OSLA 3TN0D 2P9RA 3IDIA 4HJUA 5FYLH 5IROD 1AC6A 1F56A 4NRYB 1KY7A 1LWRA 3G6JB 43C9B 1KEML 3B9AA 2RAMA 1K6QH 2CPCA 1ASQA 3QUZC 2MMXA 2ZCHL 3MNMA 4FS0A 1INDH 1JFQH 2NY6B 2QZ5A 5IOKA 3CQFA 3QEHB 5IOPB 1B9ZA 1ZK9A 2C26A 4U6XB 2ZCKL 5B4MD 5CEZH 3NJLA 4HMCA 2XIIA 4S1QH 5KG9A 2ZPKL 1MWAL 1FORL 3NYKA 2ENYA 4JQXA 3FOLA 3PDGA 3DMMA 1R3JA 5C07B 3BIKB 3FRPG 5HGHA 2GIMA 4KXZI 2KZKA 4Z95L 1DDHA 3OAWA 3TIEB 4A7GF 3VFPB 3VI3A 3EYUH 4RFOH 1P4IH 2ZUSA 2Z93A 4ODVH 2WAQA 4Y19E 5I23A 4JM2A 4E41B 3SOBL 4H40A 5DHXB 1MRFH 1IGYA 1YEJH 4Z7WE 1ZEAH 2FLRT 3VU1A 1TJHH 2CUMA 3ECUA 1NM4A 2K4WA 3K8LA 3VG0H 5F8QC 5JUEH 3GSVA 4OM1H 1DJYA 4IDJH 3VFPA 4DK6A 2N59A 2A6JB 3FK3A 1MFCL 3DOSB 3BWAA 4R4BA 4NQTA 1SJEA 1A47A 5L6YL 1OOWA 2NYZA 3PV6B 4H1LH 4WJ5A 5K69A 3VD3A 4OVUA 2NX5E 5AB1A 2FWOB 2ZWNA 5D72L 1S9XB 3IRCA 2GITB 3V5KA 1SVBA 3CSPA 4G11A 5ANHA 1BVLB 3WCYA 5HYQA 4NC1C 4PTTB 2YAQA 1KYOK 1MF2H 5T3XE 1JZ5A 1YAIA 1FYTE 4JHUA 4YJZL 3DA0A 2YA2A 3QJHA 1TETL 1M2VA 3SDDB 3CPLB 1MG3C 2C9AA 5DO8A 1RAMA 1HHIA 2HFEB 3JWOL 4JY6A 4ZNCD 5E8DL 1IT9H 2BWIA 3Q6FB 4M4RB 1ICTA 5C09A 5LNEA 1NAML 2BNRA 3GBEA 4Z7IA 4G6AD 1UQSA 3P3RA 2X0VA 1VZHA 1XGQA 4LDEB 4QGYA 2UZIH 2QPSA 3MO1B 2BY1A 3D5OF 1JV2B 1KBVA 1WFJA 3L81A 4ZUUA 3GINA 5IHBA 3BX7C 2WD0A 1YMMA 3BVUA 3N41B 3MODL 4XO9A 2HRHA 3LKQB 4Y4HC 2B14A 1W2KT 2VGLM 2IH8A 4MQ7B 2WLLA 4PWHA 4L5FH 3RGVC 1TSRA 5FYJE 2YRPA 1KJMA 2Y4SA 4Y0GA 1XBRA 1FGVL 1LDPL 1E7VA 5IB2B 1VGKB 1QBML 4IHBA 4NHCL 4QHNA 2BY3A 3U9UB 1W0VB 3N85H 2YBGA 4XP5L 3PQYD 3REWB 5F9OH 3WFZA 2BLFA 1OD7A 4CGUB 1T3FB 3MPCA 1OCWH 3MR9A 4WI5A 4XAWH 3ZDYB 3WNOA 4CL7A 4PP1D 3JTTB 1CGSH 6CGTA 3UTTE 4H8QA 4U1JA 4ELMB 2FUQA 4GUPB 1BXUA 3U0TB 4YNYB 4X7DC 2OJEA 1QPKA 5J12B 3W5NA 2YPVA 3HZVB 2H1PH 2PPDA 3QWNA 1LP9A 3NJMA 3N06B 1HVXA 4FKHA 4XNBA 1RVFH 3TZVD 2GKIA 4WFGE 2LU5A 3MAWA 4B9GA 3KPNB 3V4UH 1FWXA 1EEYB 1SFDA 2JIXA 1AS6A 3LIZL 4QI3A 4QRQA 5SV4A 3ZPDA 1SMOA 4QXGL 3DYPA 2AEIT 2VXSH 2R2BA 2WWMC 3U2IA 4R96B 2GY7B 4YPGA 2X4NB 3CSTA 1NM9A 1H8SA 2XXGA 4P07A 4EO5A 3V6FA 5B7MA 2JJVA 2OZ4A 3ZKXB 5BO1L 3BP6A 3GXPA 2C34A 2XPGA 3PXHA 4JZNB 4HZ1A 4ICWA 3GBDA 3MTXA 5FAAA 5EZJA 1JWSB 3OJ2C 4FF9A 4IEFA 4XWOC 4WI2A 5A16B 4WVRA 3TBYA 4X7EC 5JMOC 4PHZA 3FQNA 3FXIC 3I75A 2IH1B 3D12B 4GI8A 1W8EA 3NEOA 2BIQA 4BA0A 1MOEA 2ROXA 3CUPA 3OR7A 4HWBL 4AYMC 2CO6B 4PR5A 3QDMD 3X12B 3K71A 1RP8A 1SBSH 3KYNA 4L0ZA 3GEWB 2FR4B 2EDJA 4LCCA 4NRZB 5JQHC 1G87A 4AE1A 5T5FL 4Y2DC 1TITA 1ZGLB 1O7DC 1KBGH 1VKXB 5ALCL 4BZ1L 3N1PC 5E4IA 2X2IA 4OZHF 5D7SH 1NGXB 3HUJB 3S4SA 3ILPA 3CFKB 3QJSB 1OGAB 4FQXD 3P2DA 1MFDH 4IRZH 3B7RL 5FXCH 4CMMA 5F0LB 3RYMA 4Z3GA 4PRNA 2AEQL 4GRWF 4F9PA 5DURD 2CO6A 3X12A 1AACA 4NNXA 4LL9A 4K3DH 1E28B 3FFCE 3BP7A 2XQBL 4XP6H 5BQ7A 5D6DC 4TLKA 5CCKL 5FUZH 3HR5B 3QIWA 4OZFG 3IAPA 3QUXC 4PCKA 3Q8BA 2V2WB 4L3AA 4LHJB 3WEMA 4UCFA 5E5RB 2UZYB 5IW6A 3HE6B 2E9WA 4PW3A 3FT2B 4JKKA 4U2ZA 5L2KD 2NY0B 3CXDL 4K5NA 4GKZA 1C8PA 2R2HA 3DX9A 1NJ9A 1IGML 1Y18A 2FBOJ 2X9WA 2KDYA 3ZBMA 4TVPL 5IFJA 2LFGA 5CEXA 3RWEB 2EH8L 1QSFA 2VOTA 2NDGA 4AV4A 4P2YA 5E6IC 2J5LB 4MDRA 5JHDB 3HLKA 4JUSA 1R0AH 1B0IA 4YN3A 4P59L 4PRPE 3US0A 5GSVB 1BQLH 1F6LL 35C8L 3UG5A 3CFTA 2AJYL 4M9PA 1PS3A 4ZX5A 2WINB 2HFTA 2YEVB 4RWYH 1EXUA 1X5XA 4YZFE 4ZOAA 4NFBA 1QQDB 1HHGB 4OZ4B 5IBUB 4WV1C 4ZPVA 4JANA 3FQUA 2ZYIA 4MJIE 1T3FA 1DSFH 1JD9A 4GI9A 3P30L 3C8KB 2Z0UA 3OX8B 4TLTA 5DLMH 5ABAA 3TNMA 1CGVA 3O8XD 3L3IB 5TK4A 1L5GA 3ETBJ 4M8UA 4YHMH 1RK1A 2QEJA 4JFDA 3BUIA 1YQVL 3KPPB 1A66A 1FZMA 1CK0H 4KK5D 1SYVB 3SBWC 3AMLA 2DDQL 3Q6FA 2VR8A 4J3OH 5FOBA 1EXUB 2EXWC 1JXFA 3SY0A 1HCFX 4KGJA 2HX7A 3AGWA 5E4OA 4PY7A 3PWPB 3L3HB 3L5JA 2YKKA 3QB7C 1OT4A 4PEEA 2P5ED 3NCBB 5C0GA 3WKML 3GSQA 4Y89A 1GOFA 3MMEA 3UTPD 3B8YA 5GRYA 4RAUB 4KRN