1AIZA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport(cadmium binding)
total genus 31
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aizA00
3TASA 4AZUA 2FT8A 1TEGA 1SDDA 3EH5B 3T6VA 2PPFA 1JVLA 3OMAB 4JHUA 1E5ZA 2Y1AA 4HAKA 3MX0B 3FPXA 3UAEA 1FFTB 2J56A 3ZDWA 4FA7B 3NSCA 1ASQA 1W8EA 4G72B 3S3CB 2PP7A 1PNDA 1V10A 4AKOA 4N4YB 2PP8A 1A8ZA 4DP9X 1X9UA 3EHBB 4GYBA 3L45A 3S8FB 4YVNA 4GP4B 1QHQA 1RKRA 3T9WA 1PZBA 1A3ZA 4DP8X 3DTUB 2YAEA 1KBVA 2FJSA 1HAWA 1OOWA 2I7SA 1CURA 1PZAA 1W6LA 3X1FA 1NPJA 4BXSV 1VLXA 1A4CA 1AZUA 3H4HA 1L9SA 3AG1B 2XXGA 2UXGA 1AAJA 2JFCA 1V54B 2GB2A 1J9RA 1ET8A 1NWPA 1PLBA 2CBPA 4DP4X 1E65A 1PLAA 2EINB 3ASOB 3FU7B 3FYEB 1OCZB 1CC3A 2H47C 5B7FA 1OV8A 4HCGA 5B1JA 1ZIBA 3OQRA 4KO6A 3HB3B 1FWXA 1WA0X 2XWZA 3IN0A 1NDTA 4E9VA 1TEFA 2PPAA 3AG4B 3BQVA 1SFDA 2ZOOA 5B7MA 4GP5B 1GS8A 2ZXWB 5I5MA 3FU9A 1BQ5A 1NTDA 2BP8A 2IWKA 2DV6A 2EILB 1NIFA 2OV0A 2P80D 3WG7B 1OCOB 3EH4B 1PZCA 4A66A 5AZUA 4KOCA 1WAEA 1EZLA 1NIBA 3S3DB 3CZUB 2IAAC 2N0MA 1M57B 3CG8A 1MZZA 3ZBMA 4YSUA 1NIEA 2X88A 3FQ2A 4YSEA 4ENZA 1KBWA 4YSCA 4PAZA 1PNCA 2FTAA 2XUWA 4DPBX 2XVBA 1SF3A 3QJUB 1J5CA 2VW7A 4KNUA 3CVDA 4F2FA 4G70B 2QDVA 1GY1A 2FT6A 3T6WA 2A3TA 4E9RA 3QJSB 2XX0A 5AFAA 3FU8A 1GYCA 3FSWA 2IDUA 3IEAA 3QJTB 3EF4A 1A4BA 1J9TA 2BHFA 1W6WA 3FPYA 2JXMA 8PAZA 1L9TA 2HX9A 1GY2A 4A2HA 4F7KA 2VW6A 4AX3A 3FYIB 4UANA 1RCYA 3NT0A 1EHKB 1R1CA 3WNIA 5FC9A 3X1EA 1N68A 1ADWA 1NZRA 4EF3A 1PY0A 2XV2A 1AS8A 4YSPA 4G7SB 4DPCX 4A2FA 1MG3C 2IDTA 3NP3A 1X9RA 4DP2X 2CCWA 3PAZA 2XU9A 2HRGA 2FQDA 3ABKB 5A7EA 1SHXA 1J9QA 2YAHA 4BWUA 1MZYA 4YSRA 2VSMB 3PPSA 4YSQA 5IY5B 1SDDB 3KW8A 3AG3B 3DKHA 3ABGA 1M56B 1KCWA 2IH8A 2VN3A 4KOBA 1A65A 2YAMA 3NYKA 5LDUA 1JZFA 2HZHA 1PLCA 3H56A 1PCSA 3QJVB 3QPKA 4HALA 3X2QB 3S8GB 1AS6A 1AS7A 2TSBA 1IC0A 2LLNA 2BWDA 4GXFA 1ASOA 3PAVA 1JZIA 7PCYA 5B1BB 3V9EA 4QLWA 3CDZA 2DWSA 4DPAX 1NIAA 2Q9OA 3WKQA 4BDVA 2XLLA 2EIJB 1OE2A 2YARA 4PCYA 2BZCA 1HFUA 3PLYA 4CSZA 6PCYA 1BEXA 1L9OA 1XMEB 2VM4A 4HHWA 4NERA 1AZCA 1OCCB 1N70A 2HX8A 3NJGA 4E9YA 2FQEA 1AQ8A 4WKXA 1IBYA 2DYRB 4HHGA 1JXFA 1T5KA 5AKRA 2AZAA 1L9RA 1L9QA 2JKWA 1ILUA 3KW7A 3N55A 3TBCA 2UXTA 2QPEB 1B3IA 4JHVA 4W1TA 4BXVA 3T6ZA 4A68A 2XV3A 4AI7A 2AFNA 4KO9A 4A67A 1KDIA 1BYOA 1SF5A 1GSKA 3IBOA 1V55B 2PCFA 3QQXA 2BWIA 5TK2A 3G5WA 1JXDA 5B1JC 1ZDSA 1AR1B 3MBWB 1DZ0A 3FSVA 3PCYA 5I6MA 4P5SA 4YL4A 3UADA 2BP8B 9PCYA 4KNSA 1SHWA 2YAPA 1AG0A 2BW4A 5B1AB 2Y69B 1WA1X 3WNJA 4G7QB 3PAUA 3NP4A 5I28A 3BVDB 1NINA 4TXVB 3FSZA 2ZONA 3AZUA 1J9SA 3FQYA 2HX7A 1ILSA 2W88A 2EIMB 1AACA 3NJNA 4YSDA 2HLEB 1AG6A 2E86A 3SBRA 3ERXA 2Q5BA 1XB8A 2AANA 2VSKB 3NJHA 2IDSA 4YSTA 4DP6X 2GI0A 5PAZA 2GC4C 1XB3A 2H3XC 3UABA 1JZEA 1JZHA 3NJIA 4CSPA 3TA4D 3ZX1A 4MFHA 2OCCB 4HCIA 1E5YA 2IDFA 2W8CA 3FQ1A 1WS7A 4NAJA 2CAKA 3X1NA 1JZJA 4AKQA 3FS9A 4M3HA 1AOZA 4W9ZA 3TU6A 4G7RB 5F7BA 1BXAA 1NIDA 5D4JA 1M9WA 3NSFA 3AW5A 1OCRB 2X87A 5ANHA 1QNIA 3HEIB 3CVBA 1QLEB 3ABLB 3X1GA 4A2GA 2MTAA 1UATA 3NJMA 4NB7A 4UF7C 2J55A 1KDJA 4YVUA 3S3BB 2YAFA 1F56A 1WS8A 2GSMB 1BXVA 3T71A 1L9PA 5I5IA 3EH3B 2VMJA 2YXVA 2EIKB 2GIMA 4Q8BA 1PF3A 1JXGA 2QPDB 4N8UA 4DP5X 4DP7X 1JERA 4E9SA 2PPCA 5I6OA 2FQFA 1KV7A 3CDZB 1KYAA 3OMNB 4HIPA 3GYRA 1AANA 2CALA 2PLTA 2WO3B 1PAZA 5I6PA 3UACA 4BDVB 4Q89A 3H4FA 3IE9A 3U25A 2FNWA 4BK5C 1ZPUA 2AZUA 1GS7A 1CYXA 3SBQA 2TSAA 3WKPA 4YSSA 2IWFA 2DYSB 1ZIAA 5F7AA 5E9NA 4ZK8A 2PPEA 3CVCA 3AG2B 3DIVA 1J5DA 5TK4A 1AZRA 4A2DA 2HXAA 1ASPA 2MRYA 4E9XA 1IBZA 2BO0A 2CJ3A 2WSDA 4JKNA 2PPDA 2I7OA 6PAZA 1BQKA 2UX6A 2HRHA 4AKPA 5D4IA 2NRDA 5B7EA 2CUAA 3FT0A 4WTQA 1ET7A 2YXWA 7PAZA 1URIA 2I85A 3NJJA 4HZ1A 3T6XA 1NPNA 3NJFA 2YAQA 4KNTA 4YSOA 2VM3A 3FSAA 4G71B 2H5UA 3NJKA 4P5RA 3ZIYA 4A2EA 3D12B 1OF0A 3OMIB 1ZV2A 3WIAA 2WO2B 3GXUB 3NJLA 5I6LA 1GS6X 2RACA 1OE1A 3C75A 3V9CA 2J5WA 1ID2A 4FAAB 4E9WA 2ZWNA 3NSYA 3FU7A 1KGYE 1WA2X 1AZNA 2BW5A 3ASNB 3QJRB 4YSAA 3OD3A 1AIZA 5EHFA 1IKOP 1GR7A 2UX7A 3N2JA 2UXFA 1BXUA 3JTBA 1JOIA 1SFHA 2B08A 2IH9A 3GDCA 5I6NA 2YAOA 2UXVA 4KO5A 1MDAA 5B1KA 5B3SB 2IDQA 4K9JA 5I26A 3PXLA 3SBPA 1SJMA 1TU2A 2R7EB 2XV0A 2AVFA 3QJQB 1GW0A 1I53A 2R7EA 2IWEA 3SQRA 3NSDA 1ET5A 2DWTA 1KCBA 4RH4A 1E30A 1PMYA 3RYMA 1BAWA 2FWLB 1A4AA 1YLBB 3X1BA 4BWWA 1NWOA 4DP1X 4GP8B 1ZDQA 4X4KA 2QDWA 2DY2A 2BZ7A 2FT7A 2PP9A 4E9TA 4HCFA 1RZPA 1AZBA 1OE3A 1MG2C 2P80A 2VW4A 1BYPA 2BP0B 3UGEA 3WI9A 2FQGA 1DYZA 1ETJA 4GY4A 1E67A 3OM3B 2BP0A 1XB6A 2GBAA 4M4RB 2XX1A 5I6KA 2J57A 5I5JA 4DP0X 3UAAA 2QT6A 2XYBA 5D4HA 2B3IA 4E9QA 3JT2A 1JZGA 2PCYA 1TKWA 5PCYA 1NICA 4F2EA 3AY2A 4UAHA 3TBBA 2GHZA 1RZQA 2GC7C 3IN2A 1CUOA 4L0PB 1IUZA 1BQRA 4QKTA 2YQBA 2XXFA 1CYWA 4BWTA 1FA4A 3ABMB 4KO7A 2OJ1A 1HAUA 1JVOA 1SNRA
chains in the Genus database with same CATH superfamily
1QLRA 1DP0A 1JXKA 2FWUA 4NHCL 4JFYB 2G2NA 4EN3C 1KLGA 3BC9A 3HC4H 4FYRA 1EO5A 2MOQA 5ESVB 2D7TH 1UWGL 4HWZB 4P5KA 4PJEE 4OZGF 3CZJA 4XMKL 2VN6A 3G6JB 1NGXB 1R3LB 2JKIS 1M71A 3Q6GH 3S3CB 4Z7OB 3IB4A 1P5UA 2EXTA 2NNXA 5HHOE 4TQPA 3TO2B 1L6ZA 1P5UC 4QO1B 2AXGA 5E5MA 2NTFB 2ZWLT 2HB0A 4ZW6A 5CEXB 3NIDE 1BOGB 1P84J 1Y0LB 1DR9A 5TPWH 4F7MB 1BZ7B 4L4TE 1FJ1A 4BXSV 5BJTB 3C8KA 3FRUA 4Z5RA 5SX4I 1RQ5A 2FDBP 4FXKA 2MNJB 5D7EA 5AVVB 4Z7VE 4F3FB 2P8MB 1D6VH 3RFRA 3DIFA 1V54B 3DSNA 4G9DB 1KV3A 4FQ1L 1WFOA 3UAJC 1ET8A 3ZMNA 1MCEA 3P9LA 4WKZA 3GS0A 3LS5H 3T3PE 1DLHB 1ED3B 2VXTL 5FKPB 1OSPL 5HHMD 3U48A 5ILTH 4W9LC 1X9QA 4IMLB 3TM6A 1T1ZA 3B9EA 1G7PB 3O0LA 5FEBA 4AQ1B 5E24E 3U1PA 1HH9B 1U6AH 3HE7D 3PWNA 4AM0A 5T3XD 3MBWA 3PWLB 1TU2B 2R4SH 4M4PA 4M8VA 4R2GB 2V5RA 2IG2L 3SCMD 5LQBH 1IQWL 3WG7B 1NIFA 5JYMA 4I77H 5BQ7A 5HDLA 4ZMLA 1DUYB 4NC1E 4UM8A 1EFXB 2CR6A 3BZ4B 1I8IB 4OCSL 2ZX8A 3JWNC 4Y1AE 2VC2B 4X98B 4F7CB 3HR5B 1TQBB 2F08A 3IU3A 4HPHA 5GIRB 3QQ4A 4YJZL 4AEIL 1WWCA 5DD0H 2XHNA 2FNBA 3UERA 1JI1A 1GY1A 1TO5A 3HMXL 4Y4KC 4MLSA 4KXAA 5JPMB 2GW5A 2GABA 5I16A 3N6YA 1BV8A 4HUVB 2Z7YA 4BH7A 3NA4A 4X6FB 1VGKA 1KNOA 5JLZA 2Q7AA 1HH6B 1YY9D 5KW9L 4L4JA 5DO2C 1Q72L 3GSRA 1SZNA 1VGEH 1JTPA 3R1GH 1T0OA 3ARDC 5JHDA 1ADWA 2HCZX 3QDHA 1FC1A 3H3BC 4G1EA 3MJ8A 4ODSL 3BZDA 3T2OA 5LUMA 2LV4A 4N8VA 4NQVA 4QTIL 2FGZA 4OCRL 4LLUB 2V9UA 1F6AB 2ZP9A 1RZ7L 1RU9L 3ZE1B 4AG4L 5AB9A 2WBJC 3K4AA 3QQ9C 2YAHA 1BPVA 2DYPB 1FFQA 4HEPA 2OP4L 2BXZA 1R3IL 3LZOA 3PPSA 2EXWC 4HUWB 3AM8C 4GMSL 1LO0H 2K45A 2RCSL 2CD0A 3RP1A 1FE8L 2OMXB 2QGDA 5DC2A 2NY3B 2X70B 3BP4B 3S2CA 2ZG3A 4OKVB 2XPGA 1ZGLM 3ABZA 5EIQA 5D1XA 3EYUH 3FHAA 4L3CA 2Z65C 2XPZA 5F71A 5GGUB 2C3VA 2NXZD 4DW2H 5IIEA 4WFHE 2TSBA 4LEEA 4ACPA 3HZKB 2CDFA 1CGSH 1D5MA 2FCBA 1HZHL 1R5IA 4L29A 2IALB 4QHUB 4Q0XH 2F5AL 1PS3A 2EIZA 1HHHB 4HFWB 1WUNT 1E9QA 5DJ0B 5H8DA 2FX9L 2YD1A 5C71A 3PF2A 3BP5B 4HX1B 1DDHB 5F9JB 5ANMB 4AJ0A 5HGBA 1KPUA 3WEXA 4ODUB 4NENA 3UGUA 3HZVB 1UKSA 2J6EL 3BCFA 1N5YL 4PTUA 2OSWA 1BEXA 4ZFOB 5E95B 2EE2A 3TN0B 1S7UA 2I60L 4ZAKA 1DO5A 4OLXL 4XP1L 4PD4K 2G60L 4NERA 5E8DL 2J2ZA 5KSBB 1JWSB 4R3SA 4ZAKC 4QAWA 3IDGB 4HUXA 4OD1H 4QGTA 5EZLB 3VFNA 3W9DA 2M1KA 4AT6A 4X7DC 3BPLC 4DFHA 3NFSL 5E2TL 1HIML 4XNXH 2XQBH 3PHQB 2WB1A 2CO7A 4MD5B 1T21B 1TF4A 5FOBA 3MRKB 3VDCA 1VA9A 2VERN 2XWEA 5EUOE 4N0YL 1X9LA 1UENA 1U8OB 2IVFC 4GW1A 1T80A 3II3A 2BWIA 1N5AB 5C0EA 1RSYA 5EEWA 5E5LA 2QR0B 1N64L 4NEHB 35C8L 4RFEA 4W9EC 3RX5A 3UADA 1WV7T 9PCYA 5AAPA 5F9OH 4B5EA 2P46B 2DMCA 2YD6A 3L5XH 3K8LA 4GQ9L 3IMRA 1FPTL 3FQTB 5AAMC 4A39A 1X5GA 3Q5YA 1ORQB 3K8KA 4LCWE 4DKDC 5GGQH 5C0JA 1A6TA 5I71C 4H8WC 5JDSB 2DQGL 3OPZL 3FRPG 4GMTH 3WBDA 3ZE0B 3L95A 3HUJE 2EQDA 3WLBA 3BWUF 3FQYA 3UBXI 2EDKA 4XZ4A 2BNQB 1BJ8A 1AACA 2H26B 4K0OA 4A37A 5JHDD 2JKSA 3D85B 2CDGB 1PZ3A 3W56A 4L4VB 3ULUC 1KJMA 1G6RB 3UYRH 1OAZL 2LABA 4R90H 3VMPA 2ATPB 3SPGA 1M7DB 2OMVB 2XA3A 5FYKU 2V3FA 3B9KB 1OT1A 4PJGB 4Z7UF 2VSDA 4H20L 3F7VA 1QNZH 3OGOE 1YEHL 5DZ9A 4ZS7H 2H3XC 2EXWD 1HWWA 4Z0XA 1HEZB 5JIDA 2F19L 4YQXH 1E5YA 4M8QB 1WS7A 1Z9SB 3GO1H 4JCMA 1NJ9A 1QFPA 3CUPA 5GQBA 1DLFL 3IE4A 2V8LA 4ELMF 1T7XA 3B56A 5D4JA 3Q2LA 1RIHL 4U1MB 3T2NH 2FH6A 4I9WE 3IGUA 2ADFL 1QX1A 5D1XD 3SE9L 1DEEB 2QVMA 2NZ1A 3Q7JA 1MIEL 4RCAA 4GLRI 4BZ1L 5K9KA 4OU3A 2CM5A 3W39A 3KYNA 2B8OT 3IF1A 5HGDB 1MJUH 3L8QA 4W4NA 2IV8A 4JO8A 3QIBC 5IEHA 2BIQA 4LRNL 2YXVA 5E51A 2RQEA 2TRYA 2VLJE 2AC0A 5ERWA 2XZCH 3OLIA 5F8QC 1KIUA 5J06A 4RWYH 3HAEH 4EDWH 4ZAKD 3MLUH 2UY7A 5IVXF 5CEZH 1FV1A 3L1OL 3P3RA 4DUWA 4JFFB 3QDAA 4NQUA 1V3KA 4PCKA 1KYAA 43CAB 4X99A 3DX6B 3SO5A 5SWZE 3SOTA 3ZKQD 2EUXA 3FONB 4NQSA 1TTCA 5CLTA 3DX2A 3QEQA 1KCUL 5LBSL 1NMCC 4TSCL 2DL9A 3OHXB 3N43B 2AXHA 5B3NA 1T7VA 5DUPL 4UNIA 5IOPA 4QXTA 4WU7A 3HHRB 1JD9A 2D7TL 3CLWA 1S7QB 3STZB 2HKAA 1F11B 1XGPA 4L8DB 2AK4E 3KHOA 4Y7MA 2FWOA 1INQA 1URLA 2HT3C 3NZ8B 4P57B 5FUCC 1SM3H 2HRHA 4M93B 5HI5C 4U2YA 3VCLA 2HPOA 1F8TH 3ZVVA 2BHUA 2H6OA 4KWUA 3VXTB 3G6JF 1DJXA 2D31A 4Q6IA 4Y9CA 4NKOB 3V7AG 3ULUD 5TPWL 4JHBA 1PZ5A 3BJ91 1RJLB 4F7TA 4WUUB 4LSRH 3ZKXB 1NCNA 2IOMA 4GT7A 3RURA 4QRSB 3CZFA 4Q6IC 3ZIYA 4A2EA 2LT9A 1D6VL 1NCJA 3ZLQC 4GRWE 4J8RB 4HG4K 3CFEA 2WBXA 1BIIA 3DOSA 3GXUB 1D6EB 1X5XA 3C75A 2EICA 4UILH 3QCTH 3WTUA 4X6CF 3QIUA 1F86A 2L0DA 4ICWA 3B3IA 4KKBD 4XO3A 4RGND 2F7OA 5SV3A 5DSCB 5ILTL 4JJHA 3SGEH 4WY7H 5BRZB 1NCBL 3TEYA 4H13C 3T0EE 3RDJA 2BFVH 4LNRB 1VFAA 2GHWB 5AVSB 3PWPB 5EUOF 2A9NL 3ZSSA 1UG9A 1U6AL 4G6KH 5B1KA 5CN3A 2C4XA 3N5AA 2R4SL 3PWUB 3Q1SH 5LQBL 3QNXB 2OR7A 4PIRF 2WP3O 4NHUB 1PQZA 4I77L 4Z3EA 1WC7A 4AQAA 3MLZH 5FYKL 2Z31A 3NBNA 3O2DH 2Y6SC 3VQLA 5I17B 1WAAE 2QVFB 4UTAH 2XRAH 1XT5A 4OVUA 5HDWA 1TQUA 1CGWA 4OLWH 1N9PA 3QQDA 4W9HC 3K6SA 5CD3B 1BZDA 4IOFC 2WAQA 3CHRA 1PW3A 1ID5I 2V37A 4OLZH 3FN3A 4KKLD 3SDAA 2BSEA 2V5YA 4QXWA 1MH5A 3QG7H 3HKZA 3NPZB 3SDAC 1CD1A 5K69A 1E67A 1XF4B 5I24A 5F0JB 1R5VB 1S7RA 5DVLA 1Q9LA 3QEQD 1ZTMA 3NCJH 3QDGE 3R19A 1EZUA 1TTFA 1VGEL 3HFFA 4CBPA 1H6TA 4LQFL 5E1QA 1GTNA 4NCDA 2Y7MA 3SQOH 1NKRA 4ODWB 5MENA 1BQLH 4ZTEA 2PCYA 4JO4H 4MBOA 5PCYA 3ZOAA 5IQ9A 3SPJA 2HT3D 3DO4A 25C8H 4UYPA 3UC0H 2GC7C 1I7RB 2G30A 1KIQA 2E7DA 3VXUA 2ZCZA 5IJKA 1Z9PA 1J8HB 3MJ7A 4OF5A 5C6TH 3P4OA 2N1KA 2BVTA 3BUDA 2ZG2A 3GSUA 4KNQA 3MUGA 3O6KH 3BIBX 1FZKA 1IAII 4HC1A 1LO0L 3FT2A 4JFEA 1JPGA 1W8NA 3MYJA 4N9GB 4AZUA 1U91A 1G9EA 3MLWL 3DBXA 3UEZA 1KSRA 1SYSB 2O72A 2EDWA 2PPFA 2H0JA 3MR9A 4UNVA 1FDLH 2CXKA 2VR8A 4HD9A 1U41A 4P2OA 2E6JA 4U6TA 4XWGH 4DW2L 5FM8A 4HZAA 2Y36H 4V1DA 1IJ9A 1CGSL 1UD5A 4P2OC 2JKNA 1WITA 2WIMA 4PGJA 3QIUD 1GKEA 1QAWA 2VXVH 4Q0XL 4ETQA 3UP6A 4OZIE 3IJHA 3RGVC 4JPSA 4PRIE 3QZWB 5ADPH 3C6SA 4DP8X 5ALCL 3RY5A 4WI2A 4AVKA 1R9FA 3FAWA 1RZGA 4FG6D 2F8XC 1TQTA 2X1WL 4OI9A 4N6QA 3K81A 1EWHA 3I2CH 3STLB 2XXGA 4DKEH 4JFWA 1M7IB 5DU7A 5JIPA 1N12A 2SEBB 4JLRB 1A7NH 1UD4A 2Y6SD 4P2QE 4ZJ9A 4OD1L 5EO0A 3ZE2B 2Z3FA 4PS8A 2Z31D 1SQ2N 4Q14A 3KM2A 1U36A 4OIAA 2VABA 2EUZA 2XQBL 2VLMD 3O0RH 4LPXA 3EFOA 3RAJH 1OTUD 3V0VA 5IVNA 4LCIL 5KSBF 4LCUA 3KYAA 3MNWB 1H6EA 4FQCH 4KKNA 3BRGC 1CTNA 5KOMC 1NDTA 3RPIB 3UZEA 3VGEA 5MI0C 3ZQXA 2OTUA 2ZWKA 3BFWA 4XNQA 1S7VB 4FQQA 4Z95L 2H45A 5BZDB 3SDAD 2BSED 1H5BA 5C0AB 2Z1PA 1EJOL 1WH0A 2P8PB 3SE4A 5IT2H 1R24A 4HIXH 2ZXEB 2ENQA 2LU4A 3L5XL 3O4OC 5FYKE 3I6GB 3IGFA 4Q4EA 4ODVH 4LB8A 4ZFGL 2R8SL 3AXHA 2EYTB 3QUYC 4N28A 1EZLA 4UTBL 4J3OD 2R2CA 3RDTB 2AABH 2WZ0A 2ZWZA 4MQSB 1K8IA 3D39B 4KH9A 4CN6A 2EVFA 2R0ZH 5KZCB 2R1WB 1OM3H 3L4XA 5MEND 4MCMA 1T1YA 3IKCB 4ZX3A 2MPAL 4G70B 4KMQA 4R90L 5CEYB 5JNYA 1RP9A 2A3TA 5DT1H 1XR8B 2VLRB 3MCLH 5HVGB 2LFEA 1UKQA 3NIGE 3GSNL 4X8XA 3OC5A 1V5JA 3VXUD 1X5AA 2LTQC 3EF4A 4FG2A 4MJ5A 5JW5A 3MREA 1KWKA 4QRQA 2JXMA 5FYLL 4YQXL 5LBGA 5DDHB 4N2LA 3GO1L 2F54E 3S35L 4MA1C 1WAAF 1FI8C 1QR4A 1YEIH 2K8MA 4JFED 5CSGA 4UANA 4WTZA 1D5ZA 1H8SA 4EIGB 1E5UI 1EFQA 1JPTH 4IHOB 1NC4A 3QAZB 4LPUA 2BRRH 3T2NL 5JXAL 4PJXE 2P5EE 3OPUA 4RSVA 1A4KA 2DQTL 4P2OD 1F02I 5CJBA 5DURB 4TKWA 4V1DD 3QFJE 3DVIA 2VZUA 2QADC 1S7WA 5DS8B 4Z18A 2VN7A 4W6YB 1SHXA 3B5HA 3AREA 1MQ8A 1ZXQA 4G8EB 3FH7A 4YSRA 1CG9A 1CFTB 4YOKA 4D8OA 1KPVA 3U9UB 1CIUA 3AREC 3HAEB 1A7QL 1RZIB 4P3DA 1GRWA 3OJ2C 1NFAA 2X1QA 4JHAH 5IMOB 3SY0B 1XIWC 2PUQT 3FL7A 3PP4L 3FQ4A 3QCVH 2LHAA 4ALAC 4RWYL 1HQRA 4EDWL 1OOAA 1A65A 1FYHB 3MLUL 4NO0A 3P4MB 1HVXA 1QPXA 3C5SB 1FFNA 3SOBH 3X2QB 3GLAA 1BBDH 4FE9A 2CMRL 3RIAF 1K4CB 3BSZL 4XMTA 4EQ2A 3U2SB 1NQBA 2ZYIA 5C0BA 3SPHA 1T3FA 3TOPA 1DQIA 2AS5M 1U8NA 5B1BB 4PRAB 2DQDH 4LLWB 1JWMB 3WKQA 5DQ9B 5CO1A 3VWKB 3B2PA 4WK2B 3AQDA 2C34A 3MV8E 3C60C 4Y4FA 2BP3A 1DANU 1KBPA 4ANKA 1WCQA 2A2QT 1IVTA 5J6HA 4GRLA 1OSEA 4Y4FC 1QWNA 1QG3A 1LP9A 5F8RC 1AOHA 1I85C 4EOWL 2CBMA 2HX8A 4HDIB 4XWOC 4XZUB 5C0ND 1E5CA 1MCWW 1ZAGA 3KS0H 4MMXB 1P4UA 4YBLC 3BUQA 2TRHA 3CN2A 1OPOA 1DJIA 2HVJA 5CSZB 1IILE 3FOMA 3ZDXB 1IQDB 1F8TL 1W0VB 4KZDH 3BGMB 4HLZH 3FT4A 1CTMA 1C5BH 4K8RL 3EXJA 2XQYA 3NACL 1BVKB 1BYOA 5JHLA 4M3KB 2EDOA 4LPTA 4LSRL 3BHBB 4NN6B 3VD3A 5J12B 4X6EB 3V6OA 1ZDSA 3P77B 1MCBA 3NIFE 3P30L 3L9RB 1U8IB 3NCCB 3BLPX 4KNSA 5G4NA 3DX9B 1CLOH 4WW1A 3V6OC 1WVZA 3G6DH 4X4ME 1T20A 5I0DA 3QCTL 3GF8A 2EDRA 3TIEA 2OMWA 3EXLA 5EC2B 4JVWA 2BVYA 3NP4A 4XPFH 1GIGL 1JZ3A 2CDEA 4LEBA 3MZTA 3QEUB 4QCIA 5GS3A 4O2FB 4HH8A 4FCAA 1B0RA 3QFDB 2BFVL 3N40P 3GS4A 5D5ME 3V0HA 3PXHA 2B16A 1NC4D 1CT8B 2EZ0C 5DWPA 2AHIA 2VSKB 5K93A 1AI1L 2QADD 2WWMC 3Q1SL 2ESVA 4BJLA 1Y18A 2E6QA 4JM2F 4KU1A 1WFTA 3MLZL 1XB3A 3NOIA 3QUXD 1RZKC 4XN2A 4GKLA 4YDMA 3RVVC 5I75C 5L9DH 3D48R 4FG4A 3ARED 4UTAL 4YGVA 5FYLE 3SDDC 1DCEA 2IDFA 2ZOWA 1SEQH 3LRSA 3GUFA 4YO0B 1F6FB 5AVQB 1JZJA 4OLWL 4M3HA 2AAAA 4JFOB 4X9YA 5DK2B 1G6VK 5I1KH 5F7BA 3GHEH 3A67L 2EH7L 3U2IA 4NSKB 4AYGA 1YEJH 2XWXA 2D3NA 4LLYB 1M9WA 3FCSA 1BVNP 4F2MA 4NO0D 4J3SA 2RA1A 2ZAHA 4I13B 1UJ3A 2IIJA 1KGWA 2LLGA 4G42B 2ZYRA 1S7SA 1W0WA 2P26A 2MTAA 3H42H 1VZHA 5C0BD 1AGCB 3BSHA 3IDYC 4JM4H 1KDJA 1F5WA 2LAAA 5DJ2B 1MHCB 1A1OA 3GFUA 2P9RA 4HS3A 5E8NA 1USQA 4IW4C 5BS0E 3NCJL 2M2DA 1PSKL 5D2NC 3HJ0A 1IT9H 2NY0B 3LEXB 4Y4FD 4K3EH 3PQYA 5E00A 3FCTB 1T66D 1ZY9A 3FH8A 1HI6A 3ISYA 1BQLL 1RJZB 5CWSB 3SQOL 2PTTA 1FAIL 4GRLD 1WBZA 4JO4L 2XG5A 1YN7B 2XTJC 4XNYH 4XX1E 4A2LA 4F15C 3UC0L 4L5FH 2K7QA 1U2CA 3K2MC 4XMVA 4Q56A 1AGFB 4HUNB 1W0YT 1U58B 1L0YA 3L3KB 3AGVA 1QWHA 1PZSA 4JPQA 4NAMA 4NFCA 3N1GC 1MFDL 5C07E 3SGKC 5C6TL 2JTDA 5K9OA 2EIDA 1YG9A 1EQWA 1GZHA 3O6KL 3IDJB 4U6VL 3RX7A 1AD0B 2DI8A 3MRCA 3WEMA 4UDUB 4ZX6A 3C8DA 3MNZB 1GZHC 1TJMA 4IGBD 1SYVB 1GGCL 3JVGA 3KPMA 3MRNA 3L4YA 1FDLL 4O51A 5BOZG 4LP5A 2C1PA 1IJNA 1WGVA 3QC6X 2CXGA 4XWGL 3D4YA 4Q4IA 3CC1A 2V3DA 3JVGC 3MX0A 4OGXL 1DQLH 1GCFA 3DTXA 5D7LA 3TYFA 2FE0A 3OR6A 4AIXA 5DJAB 2VXVL 5HJ3A 4BFFA 3KVPA 2YEZA 4I4WA 1Z66A 1RUPH 1X6LA 1I9JH 1LO5A 3T6XA 3LHPH 2Y25A 3KPRB 4NP9A 2CJUH 3GRGA 1CI3M 3T0VA 4GO6B 1PZ2A 2Q76A 1OARH 3I2CL 1MCHA 3BIAX 3EGSA 4DKEL 4DKFH 5HYSB 4YBQC 2Q3AA 1FO0H 2DJUA 4GW4B 4NXSA 1KJVA 2YD0A 3APNA 1A7NL 1I7UA 3K3QA 3NJLA 5HHOA 5I6LA 2ESVD 4AQZA 4PG9B 1NFDB 1R0AH 3RX9A 1KC5L 1PCXA 1XZWA 2P7TB 2YLKA 3Q2NA 4QWWD 4LSUH 3O0RL 3OZKA 2KDGA 5HHPA 5IESH 2IGTA 4L4TA 1RHHA 4FTVA 4MNQE 1VFBB 4KKRA 1OM9A 1WCBB 3M1OA 2ADJB 2UX7A 2F7RA 3ZE2F 1MFAL 1ZLDA 3F83A 4FFVC 5HYJA 4GQRA 2BDNH 2AI0L 1JOIA 1P5VB 2VDLL 1IM3B 3OXRA 3HI5H 4BFNA 2OXHB 3IJSA 1MCFA 2Q7NA 3UYPA 4OT1H 5JQIB 3JBG7 4TF4A 2WKOA 4JPKH 2IAMA 4FJYA 4KX7A 4NFDA 1TO4A 2IAMC 4ODVL 2EDJA 4JRWA 4P5TA 4G6AC 3RUGA 4M7LT 3CFJB 2E6PA 1LMIA 3CHQA 3VXNA 4KXCA 5SWSB 2AABL 2BOBA 2AK1H 5IQ7L 1UH2A 1TYJA 2R0ZL 3X1BA 3B7SA 3PQYD 2VR6A 3SCMB 1WISA 1FVEB 2C4FT 2VNCA 4W81A 2B20A 4JDEA 4PRPA 2HTKC 4Y19B 5T1MA 4Q9QL 5J0BA 1NCCH 2VUKA 1S9XB 1HZLA 2X1PA 5DK3A 1BYPA 3LNDA 4PRBB 2JQZA 1K4DA 2HTLD 2BP5M 1KCKA 2YRBA 4JY4A 1QD0A 4X6DE 1ZJBA 1HINH 43C9B 2C9XA 4E5XA 5I5JA 2Z7ZA 3BAJA 1IBBA 3UAAA 1LWJA 1YEIL 1ZHKB 1NAKL 1PZUB 5IMLA 5LGKA 3G08B 8FABA 1E28B 4XBGA 5JIHA 3GSXA 4ONHA 1JPTL 2X4RB 3OLGA 1IGIH 2BJML 3RU8H 3SJVD 2GTWA 4NI3A 4AGLA 1UOKA 1ZV5A 3O4LE 4R7DA 2WQ8A 4NBZB 1BLNA 4QY8A 2EEBA 5GPRA 4QKTA 5D7LD 3MCG1 3DO3A 4UQEA 1Y1DA 4RZCB 4ZX5A 3DV6A 4EN3B 2FJHB 3K6OA 3U7WL 5J1AA 3PHOA 4CUCA 1QLRB 2A74B 1Z3GH 1KTLB 4AY0A 2VDOH 1UXMA 3W81A 5FGCE 1NEZA 2J6WA 4ZUUB 1KLGB 1ECYA 5IB5A 1QOKA 3B43A 4JRLA 4P5KB 4YBQD 3ZTNH 1AC6A 1WFMA 4JHAL 4OJCA 3AACA 1SHMA 5BCAA 4WFGE 4BKLB 3QCVL 1JVLA 4OVVA 3WMPA 3L17A 4APXA 3MRGA 2Z93B 2FHBA 3LPWA 4MNGA 3AY4A 1P5UB 2X6UA 5HHOD 1BBDL 1ASQA 4FHJA 5F1IB 1MWAH 2PP7A 1V10A 3AY4C 1T22A 3JQOB 1AKPA 2WLMA 2AXGB 2G5UA 2ZE0A 2XY1A 3F12B 3LB6C 3U0TB 2NR6A 2OZ4H 2DQDL 1M1XB 3VE0A 4ZFZB 4L4TD 1FJ1B 4FTVD 5AOIA 2ZXCA 1WZKA 3C8KB 3FRUB 3EDDA 1M1SA 2G0LA 2VXQA 4OD2B 3WNMA 3CN4A 1CURA 1D5BB 1JK8A 4PJCA 5HYJD 1RK1B 4NIYE 3VI4E 1WBXB 2JE8A 3DIFB 1H3WM 1KB5H 2NY5C 2EDDA 5D1ZI 4LLDA 3M1BA 3HZYB 1UM5L 1OTTC 2IAMD 2CCLA 4U0QB 2FVNA 4G6AD 3TFBA 3FU7B 2OR8A 1JGVH 4GIOA 3D6GA 4JO5A 3E9TA 4KZDL 4P5TD 5CCJA 1ZIBA 3QO0B 1C5BL 4NQCE 1EXUA 3HAEG 3P4NB 2Q3XA 5IHHA 2P44B 1BW8A 4HBCH 2HTKD 4AM0B 4FFTA 1FFOB 2PPAA 4U1SB 4H8VA 4A7VA 2WQAA 3Q2WA 1EXGA 3LS4H 4PRPD 4BUGA 5FO9A 1X5JA 4WEEA 5BQ7B 1PKQB 3EGDA 3G3LA 4NP4H 1CGXA 5EULV 3WNOA 1OCOB 3TYGH 3EH4B 1IAKB 1E4HA 1BJ1H 4WI0B 1SOQA 4A66A 3H7BA 1XF3A 5D2LE 1NIBA 4HIIA 2WUBH 3K0WA 3ZY7A 2A4CA 2IAAC 2P45B 4Y4KB 4KY2A 4AH2A 1ODAA 2TAAA 3PV6B 4FQHA 4KDTA 3BO8A 3FQ2A 5E08L 1XV8A 1KBWA 2A73A 3R4RA 3ZKSD 1JZ7A 2V2WA 4GKSB 3S5ZA 3T1WA 4PN6A 5ID1A 5DR5L 5EBLA 1KGJA 3CFKB 3PJLA 4LT7A 4BH7B 4LCWA 4UT6H 3V10A 5L9DL 3ULSB 1DE4B 1VGKB 4I3GA 3IAPA 4TPRH 1CDJA 4WI6A 4EI5A 2F1BA 3ARDB 4HK3N 3N06B 5ICYB 3HUJA 2ZCKL 5C0GB 2K0RA 1WEJH 3EBAA 4TS6A 3ZT5A 4GAGH 1GY2A 1SEQL 4EI5C 5CLWA 2WLLA 3IXTB 2WWNA 3C12A 1R1CA 4G1EB 1I7ZA 3MJ8B 1PY0A 1WFUA 2WBJB 1I3UA 1IARB 1MPAH 1UA7A 3NCMA 4X5RA 5E2WL 3JV4A 4WHTA 5B38A 3US0A 1O75A 3DGGB 4PGBB 1NDGB 2YWYA 4P49A 3T77A 3IT8D 5CZRA 3SGJA 1WD8A 5AB2A 5I1DA 2CCWA 3LB6D 5HGAB 3ATEA 3H42L 2ZXAA 3ZHLA 1R4XA 3MV9A 4LLVB 3SGJC 3U0PB 2NR6D 4BCXA 1EGJA 2HLAA 3HG1B 1PPIA 2VDPB 1VFOA 4P2RB 4X4YA 1ZVYA 2HFFA 3ASWA 2H6PB 4M6MH 5EU3A 5INCB 4FHBD 1DJHA 3GZQA 4WFFE 4L3CB 3R8BB 2F61A 3HE6A 12E8L 2AQQA 3FFCE 3OZ9L 3EO1B 4JB9H 3LSOA 4JRFA 5DMJB 1JZFA 1D5MB 3F6LA 5F72S 5K39A 2IO5A 4XNYL 1XO8A 4L29B 1MSPA 1AS7A 2XWBB 2LLNA 1UUSA 5GISH 5D96C 2ZPKH 1KLFA 1ASOA 3T08A 5JPNA 4DGVH 4P3CL 2FX7L 3MCKB 4HIJB 5HGBB 2DWSA 1KPUB 4WJKB 5T3ZD 2QQKH 4NENB 3ZDZF 4KX8A 5D6CB 3QXDB 3DYPA 2Y72A 1Z5HA 4AEHH 3QJOA 4N1EA 4TUKH 3WE1A 5LGYA 3V79C 4ZAKB 4PCYA 5D70H 4AITA 4G6FB 5LNGA 4CSZA 4QHLA 2J2ZB 1YPZB 2WTRB 3QYCA 3BPLB 4FTDA 2UUDK 2QLYA 3V4PL 1AZCA 3AABA 1N70A 5KYUA 4W6XB 3ET9F 4AT6B 5EEXA 4PW3A 1DQMH 3WEAA 1DQLL 5IM7A 3VQMA 4GAYA 1H3PH 2BK8A 2CO7B 4QHMA 2OYLA 3SIKA 4AGOA 5FOBB 2GBVA 3HLAA 4HWEH 1JNHB 2F8IA 2Z64C 1CGUA 2X4OA 2B59A 1RUPL 2HWZL 3GMNB 2XVKA 4KAQH 5TGBB 1JI2A 5H4YA 3V4VH 3AU1B 3S97C 1C16A 2ZUSA 5LDSA 4WWKC 2CJUL 1WHPA 2HRPH 4JDZB 1OARL 5H2BA 3G5WA 4HCRL 4PU2A 1YNTA 1I9IL 1JYNA 4KMLB 1FNGB 1FO0L 3MFFA 4HETA 1NLDH 5LBVA 1Z3RA 2HMIC 3MJWA 3FO1A 4UBDC 2QELA 2YEQA 3VAEA 5I71B 5CP3H 3L2NA 2YAPA 4X7CC 5ACZA 3VD1A 1ZK9A 4LCWD 2R9HD 1EHAA 3PAUA 4Z7QB 3CN0A 4NNXB 2W5PA 4LSUL 3VGAC 4EI5D 4UMSA 3B7RL 3L95B 3WLBB 3GXPA 4ODTH 5KSVB 4G8FB 3VFTA 1A7RH 3DXAB 1ZHBA 1NFDF 1NUNB 1J9SA 1E2VA 2WKLA 2XWDA 5DA4A 5A2CA 2BDNL 5KJRL 3HI5L 2MOVA 2DQCH 2E86A 1H15A 1G7JA 1W80A 1XB8A 4HK0B 1UEMA 4F58H 1FG2A 3WTXA 1UTDA 5DVOA 4OD3H 2GUOB 4GW5A 3MTRA 2NY2C 2YSSB 4QRTA 3JXAA 1A2YA 3BDBA 4S1QH 3SDCB 2E9BA 1RY7B 3SKOA 4PJ5A 3MV9D 2EDFA 4EBQH 1UOWA 3MRIB 1OSZB 3IJ9A 4CSPA 1A3QA 1QVOB 2QHRH 2AK1L 4L8SA 4EDXB 4JGJA 1KXQE 3HBQA 2FHCA 2MH4A 5ESQA 3W5NA 4RLDA 2O6CA 3KGRA 3HE6D 2WXNA 3AUWB 3G7TA 3KEDA 4R97B 5HYSG 2ID5A 1CLZL 2WLKA 1T2JA 3PP3H 1NCCL 4KK8D 4OLEA 3FF7A 1IGML 3BVNB 3QIBB 4KI5D 3RY4A 2XWCA 3W2DH 3W39B 1CL7H 4WI9A 2EDQA 5L2KE 2QEJA 4HGKC 2BNUA 2UY6A 4FEIA 4JN1H 5EF2A 1HINL 3V5KA 3BWZA 2NZ9C 3QXUA 3OKDA 4N2EA 1RUKH 4PBDA 3FCGA 4ALAH 3SQBA 1IBHA 3EW3B 3CHPA 4LHJB 3BAEH 4NJ9H 4V2CB 3VXRA 1FV1B 4NZJA 2YMXH 4Y5XA 1I3GH 3H9HB 4ZSOE 5E8EB 1UH4A 3RU8L 4JFHE 4ZODA 4K23L 3ZTJH 4FQLH 1RMFH 1JXGA 4Y2DA 3SZKC 2QPDB 1NMCB 4HJIA 4NQSB 2ZP0T 1KV7A 4I2XB 1Q1PA 5TDPA 4OGZA 3CX2A 5DHXB 4FNRA 3LKRB 4P46C 4DGWC 4QTHA 1NUDA 4M43H 1MJ7L 4DCQA 3GD1C 2J1ZA 3IKKA 3WFCH 4JPIA 4TNFA 3RI5K 3E2HC 4H88L 1CD9B 2BVUA 1YECH 2J1WA 2EE3A 1FNFA 2AJXH 2VQTA 1M9SA 1INQB 3DIVA 2HSIA 4H1LB 4XB3A 4XN8A 5EZJA 1OIOA 3ZDYE 3DBSA 3LKSB 1L6XA 2BO0A 5KOVC 2F7IA 1MWAL 1SMDA 2Z35A 2CKBH 4LHQB 1DFBH 3SYQA 1G5GA 2OZ4L 4Q6IB 1AGDB 4DGIL 1ND0B 1M2VA 1F6LL 3BW9B 2G9HB 3MRBA 1PZDA 5DEZA 1MAML 1I1FA 3OL2A 3A4AA 5J9PA 2FH8A 4R0LC 4WI8A 5GZOA 1KB5L 5J5EA 2MQ0A 3DOSB 2EO1A 1OPGH 1B4TA 1OXYA 1RZJC 3W3BA 3FQRA 3BXNA 1ZWIA 4PLJD 2W60B 1ZVHA 3B3IB 3L08A 4JO1H 1OE1A 5IF0A 4P23D 4OZIA 4KRNA 5A16A 3OKEA 5IHBA 4P59H 1INEH 4U1GC 1U8JB 3MRDB 4PJ5D 4WJ5B 4GXUN 4KKZA 1UWXK 2X3BA 3PGCA 4N0UE 4FKKA 4YSAA 1KJ3L 4L1HA 3WLWC 1OW0A 3WTYA 1S7TA 3VFUB 3SZ6A 1JK9A 1UWXH 3RWGB 3LS4L 3VNYA 1DZBA 2VC2L 3CIAA 4MQXC 3WXWH 1OZTG 3F6IA 5D1QA 5IKCA 2WCPA 5K5YA 4KTDL 3TFKC 3TYGL 1KIPB 4KTYA 4DEPC 2VWEE 1NMBL 2WUBL 4NOBA 2OBGA 3K6SB 4OF3A 2MNWA 3MUZ1 4EI0A 3VUAA 4M7KH 1ZHNA 5GS2H 2A83B 3SDAB 2VDQB 2EXYD 4IRJA 4PJ6A 4E41E 3VXRD 4G43A 3M1CA 5DRNA 3QNYB 1BFTA 4M8RA 4MMZC 4Y2DD 4U2ZA 4YPGA 5AVTB 4NZUL 1SEBA 1AO7A 4HLZG 4D9RD 4R5TA 4TPRL 5GGRB 3S4SB 3VWJD 3UTTE 1X5MA 4L3EE 4BM7A 2YD2A 1J12A 5MENB 4UUJA 2ITCA 3AS2A 5BZXA 5AAWC 1JF6A 3TBWA 3ZZQA 4P2YA 3IMWA 4ZTOH 3IU4H 4YXLH 4M29A 3JT2A 3VI3E 2Y6TE 4KTEH 4FP8H 1AGEB 3US1A 1ORSA 3TBBA 2GHZA 3IN2A 4F9LA 1BLIA 1CUOA 2N01B 1ETZA 1A64A 2XXFA 1D2OA 1XF2A 4Z8FH 1JP5A 1NBVL 3O11A 4MJ4A 4O9HL 3KVQA 1FZKB 2GVYA 1MHHB 4F9LC 5BXFA 3TONA 1BFVH 3MYJB 1U91B 1UURA 3GJFK 2C1OB 4Z7OE 3DBXB 1HHGA 3CX5J 1VEPA 2J3SA 2DJ4A 4M6ML 2NSMA 1SDDA 3N85H 4P2OB 1P1ZA 2MHAA 1XCXA 2PW2A 3LQMA 5GZOD 4JB9L 1T03H 4R96A 1JV5A 3GJFH 3FPXA 2BS8A 2GIXA 4RZKA 3RGVB 4FA7B 4PS7A 3K91A 2NDFA 4M7LL 3KCPB 4HEMA 2DDQH 5JIMA 3ARWA 2ZPKL 3VU2A 4UAOC 5JZ7C 1M3JA 1RK7A 4XB7A 1SVBA 3WLWD 1DBBH 3NFNB 3QZLA 1N26A 2QQKL 1MXGA 2JB6A 4LKCB 4FYSA 4CKQA 4I8DA 3S35X 5LVEA 3O6LH 4QRUA 4R7NA 1F4YH 1NPJA 3EUUA 3INUL 5KVEH 1MVYA 3SN6N 1AAJA 3CGTA 4PBXA 3WL9A 1QW8A 1J1PH 2YKLL 1YEGH 3QDMB 4O2EB 2YUWA 1WZLA 2K8QA 2X89A 1DQML 5D1QD 4DFIA 4NBXB 1H3PL 2R0LH 1CDYA 3EFOB 4FYTA 4XGZB 5JIQA 3WUZA 4HWEL 3V0VB 1X7TA 2HUHA 5MI0B 3CFDA 3P2DA 2WV3A 3MV8A 3V4VL 5MEPB 4ZUSB 3D3VB 1MFNA 1P4IL 2HRPL 2OTUB 4LSTH 3O3AA 2EDLA 4KQ3H 2XWZA 4N90D 3TVMC 3DURB 4E9VA 2C9RA 4IRJD 5E94B 3O4OB 4GP5B 1KTJA 2C7UA 2PWHA 3BP6A 4NM4H 3BVXA 4J6RH 3QUYB 3EJPA 1R24B 5I0XA 1JE6A 1NLDL 3H6AA 4X5PA 5C3LD 2F53B 3HS8A 1AO7D 3UJJL 4P3WA 3VFSA 5KANG 1WPCA 2BVQA 4XPBL 4IQHA 4ZUTA 5J6GB 2CSPA 4ODTL 1R3KA 4IBYA 3MNDA 4HOZA 1A7RL 2N0MA 2I07A 3HHMA 4PJ9A 4BHUI 4YSEA 2BIOA 3B2VL 1CN4A 3UJTH 5JNYB 2A0LD 5EO9A 2LTQB 3NCBB 4X4MA 1E4KA 4GNKB 4F58L 1LMKA 1IC5H 4OZHE 3UC2A 4OD3L 3G6AB 3KPQB 5EIIG 4ANVA 4MD4A 1E4KC 4MJ5B 4MA1B 4PGEB 3UBFA 2CLRA 1LHZA 5I73C 3N41B 4GEJA 5FWQA 2JXMB 2K9FB 1QLEH 5LO7A 4EBQL 4FADA 3U7YH 5HDBE 1L9TA 2R0WH 3BH9A 4J27A 4QOKE 5IHZB 1QBAA 4PJHE 4TVPH 3ZE1E 2FYYB 3LZRA 3DVFA 2VW6A 3HC3H 4XCEB 4ZMZA 3WN6A 4ZQTA 1EVUA 4MZIA 4CILA 1EAPA 2QADB 3QC5X 4PV9A 3P2BA 5ICZB 5E4EC 4YSPA 3DNKA 4EEEA 2NQ3A 2P5WA 1GGUA 3V52H 5JHAA 3FT1A 3W2DL 3LNFA 1CL7L 3AREB 4WSKA 2H0FA 5L4IA 1BYNA 4FCHA 1CG9B 2NT1A 4Y2LA 1MW0A 3OJMB 1CLYH 2FHFA 1XIWB 2ADGA 1ZGLA 4PM1A 3LIZA 3K74B 2GJ6B 4HW6A 4JFXA 3WNPA 2W59A 5L6YH 3TCLB 3FT3B 1BQUA 3DKHA 3ABGA 4Q9BA 4AUJA 1DO6A 3CLFL 1Q38A 4NZDA 1I3GL 2BHZA 4OGYL 1FFNB 5ANME 1E8YA 2CO6B 5DYOB 3LN5B 1HE7A 1RMFL 5HHQA 3H54A 3JWDH 4DGYL 4LEXL 2X89D 4O5LH 5F93C 5D7KD 3C60B 5FECB 5F0PB 2XZZA 1YQVH 2GKIA 3BD5A 2C5DC 4JGNA 4Y2OA 3MV8D 4PJ7F 4R4FL 4L18A 4Y4FB 2VRQA 3IXAA 4KXZI 2YARA 4G83A 3WFCL 5J6HB 2J8UA 2D3VA 4AVHA 3VYNA 4YBLB 3RL2A 2E56A 5EOTA 3L4WA 2FBOJ 1XGQA 4MXQD 1YECL 1XMEB 1QWUA 1EMTH 3DMMC 4PJBB 2AJXL 4OI8A 2NY1C 4ZDHB 2FLRT 3ARGC 4E9LA 3FO0H 1RJYA 3GINA 3KPTA 2CKBL 3KW7A 3LKPA 4ZMPA 3ZQWA 4CADB 4APQA 4PJ8C 2WCSA 2WQXA 2Q86B 4LBEA 1FRGH 1ZA6B 1H6FA 3TA3A 1JPST 4MJJA 5FS5A 4PJ9D 1V27A 2NW2A 1SJHA 3V4UH 3NUKA 4MAYC 2R23A 3MYZA 4JFPA 4NRYA 3QW9A 3U6RA 4JCLA 2JJWA 1RK0A 3WEXB 1OPGL 4YL4A 3ZE0E 5SV4A 4YAQA 2X09A 3TIEB 1I3RA 2BNQE 2OMWB 3ETBJ 5AQ0A 3U4BL 3GIZH 4W93A 2CDEB 2ENYA 4P59L 3WNJA 4ONFH 3UMTA 1BGXH 5I28A 4AIOA 1T2QH 3UL4A 2DOCA 1B0RB 1SUJA 2Z4QB 3MRLB 2W0KA 2WWOA 3AZUA 3TJEL 2H2PC 4DVBB 5CF3A 3IDXH 4MCZB 5I75B 5E03A 3TBTA 1WT5A 2ESVB 1ZS8B 2JJSC 2EO7A 2YZ8A 3A3YB 4LL9A 1XR9A 5EN2A 3K5SA 3SDDB 3TEUA 4FC3E 2P5WD 2J1KA 1WT5C 3BVVA 5C7ZA 5ACMA 3KWTA 4ZD3H 1NBYA 4OFPA 3IFOB 1CFNA 1E9OA 5HI3D 3QI9A 4HIEB 4IU2B 1F18A 3DVNA 3CIQA 3TXAA 1LQSR 3A4FA 3FQ1A 1CQYA 1DVSA 3QUZC 4M6OL 4KC3B 1AZVA 2WOYA 1IU1A 3UZVB 3BPOC 4OSUH 1W72L 2A9AA 5F1NB 2KYIA 3TBYB 5A1AA 3IDYB 1ONQA 2G75A 4PMEA 4RMVA 3TT1H 5I1LB 1OCRB 3VB9A 4KZEH 4I18C 2ZCHH 4FI7A 3RFZA 3MJ9L 2HJKA 1HQ4A 5D2NB 4AOFA 1A1OB 4OZHF 4G80B 4Y16B 1GA2A 4CN1A 2AJ3A 4PH8A 4BFKA 4GRMB 3T4YB 4NO2A 3LZQA 4MB4A 3QUMH 1EH9A 1HI6B 2XTJB 4F15B 5E9DE 2D7MA 2PTTB 4MMYA 3ESMA 4UYQA 5F0LB 5HDBF 3LPFA 3IU4L 4PJHF 4YXLL 2XG5B 4HSAC 3I6LE 4KTEL 4FP8L 1PF3A 5CJOL 4DP5X 1FSKC 4QXGH 1D2PA 3REVA 1EDQA 4I88A 4LHUB 5E4OA 2PYEA 2O5YL 4RFNC 2AV1B 2IH1A 4ERSH 2GEEA 1G9HA 5IVZA 5K9OB 5C2UB 4Z8FL 1PAZA 2X2IA 4NFBA 3W37A 4APQD 1MUJA 2ZOTA 3QCUH 3TA3D 4FZEL 5A6MA 2JCCA 2R0KH 3WKPA 4YSSA 1A3LH 1T03L 2DTML 2AQNA 5D7LB 4DTGL 2XWTA 4Y8AA 2WLHA 5KANI 1KCRH 2FATH 5G55A 4JJOA 1QI4A 4N0RA 2KI6A 5FKAB 4YNYB 3CFQA 1OTSC 5TQ2H 3QARA 3QPXH 4KKCD 3CK0H 1N59B 1X5ZA 2H2PD 3O6LL 2JIXB 4Y4HC 4J6IA 5DRXB 4WI4A 1F4YL 4IIQC 4RIRA 5F2FA 5J6SA 3KEHA 2C9QA 3T3MB 5B8CC 4M5TA 1E27B 4ISVA 2AV7B 2DQFB 2WQWA 3GC3A 3D0AA 3TEZA 1KFAH 4C56B 3PWPE 3AAZA 5LJYH 3NK3A 3FAXA 3IDIB 3O3DA 2R0LL 4GG8B 4LEOA 3IGAB 1EV2E 3RWDA 3QI9D 4RNRA 4F9PC 5KBLA 1LNUB 1T83A 1ZT1B 3DX4A 5HYJB 1ZJAA 3Q6FA 4LOEA 3DPDA 3OXRB 3FN0H 4LSTL 1LO2L 4ZI8A 1YMME 3UYPB 3VXOB 4Z7IA 1XF5A 2XVGA 4HZLB 2IAMB 4J6RL 2QSCH 2KPNA 5KS9F 4PGCA 5AVWB 3PAYA 4A6YH 4PJAB 2IGFH 3GMPA 2FUTA 2WXFA 3L9YA 1I1CA 2FJGB 5C7XL 1EEYA 3KPSB 4HH9B 3OGCB 1I4FA 2COQA 5GS1C 4ODHH 2FR4A 3V6BR 5FM5M 1JGEB 1KUMA 2BZDA 1F2XK 4IBUA 1ZSHA 4KHTH 1DQDL 1OHQA 3OKMB 1EAQA 3CSPA 2W65A 3WUWG 3CVHA 4YZWA 4FLHA 2PR4H 3BRFA 4PRPB 4A7GF 4HT1H 3UJTL 4XODA 4OM1L 2OM5A 4GAFB 5BZZA 3U1SL 1UASA 2AJYH 5F3BA 1QLFB 3MPCA 4JNXA 3EO9H 1HKFA 3BP7A 3GZKA 1KGIA 1UADC 3HHSB 2PYED 2ZSWA 1N6VA 4E5XB 5DMYA 2QZ5A 1QLEL 5DHVH 3UIYA 3S7GA 3U7YL 3FNKA 4MJIB 4TVPL 2H41A 1K72A 2OK0L 3BUYA 3GZOA 3PGFH 2OMYA 1J8HE 3O4LD 3OAYK 4ZOAA 1AIFA 2QGBA 3ZXAC 2LE9A 3LRGA 3GMLB 1IIKA 2J21A 1UQSA 2VDMH 5IEKA 5AOZA 2Q2LA 3V52L 1AHWA 1OTSD 3DV6B 1UM6H 4MGXA 3GPEA 3QPQC 5DFWH 1KIRB 1A1NA 2FGWH 2G3NA 1CLYL 3VVWA 4F1SA 1NEZB 2OMNA 3W0WA 4BWTA 1FA4A 2R29A 3EUDA 4LVOB 1OB0A 4AJVA 1UUNA 5I8CB 4OZGA 4MTMA 5L6YL 3PL6C 4GAJH 4APXB 1RUQH 3P3SA 5FCUL 1KZQA 1MEXL 1KJ2A 2ROXA 3AXLA 1ZPLA 4PVMA 4JO3L 3UAEA 5CINH 1QUPA 2CBOA 3JWDL 1J0ZA 1DN2A 2BMKB 3V0GA 3PY9A 2DTSA 4PIBA 4BRVA 3BAYA 1UA3A 2XN9E 1AZZC 3ALWA 3X3FH 5C08A 4OKDA 3G5VB 1KBKA 5DHYB 3VE0B 1CU4H 1YQVL 3L45A 2YS4A 3NPSC 1DHKA 1X5IA 2G3MA 4U1KA 1EPFA 4GFXA 2OL3A 3FQXB 3OX8A 3U4EB 5LNDA 4PHXA 4PS4H 1E3ZA 1OOWA 4LLDB 3M1BB 1X4ZA 2OULB 4XVTH 3AG1B 3MGAA 3CLEH 3DJZA 4LESA 3SPVA 1KOAA 1EMTL 4LIQH 3BAIA 2YBRB 4B0MM 3QB7C 2GB2A 3Q8AA 3F7KA 4OTXH 1PLBA 1IEAB 3FO0L 1CD8A 4WDIA 5I8KH 3D1MC 1CC3A 3CZSA 1R3JA 4FQXA 1MIMH 3P4LA 4FD0A 2DLHA 1Y1UA 5C0AE 5L88H 3C2AL 4F91B 1YNKH 2B4CH 3CWGA 1DQKA 3OQRA 1YJDC 5CHNB 2CR3A 3Q3GB 3RWIB 2EYRB 1U4FA 5C6PB 5H94B 1HC1A 4XHJC 3ZTJG 2UZYA 2ENSA 3V4UL 5FO9B 4Z7WE 3HBPA 3EGDB 2E9JA 5I82A 3F7QA 5C09A 3SEPA 1JSYA 1VB9A 5TDOA 1NTDA 1R5WA 2BP8A 1A8JH 4W9GC 2F1AA 4AXWA 4ONFL 2NY6C 1PZCA 4DIXA 5JW3H 2C3GA 2OJEB 1BGXL 1XAKA 3UTZA 3ULVL 2ATKA 1PBYA 4FQHB 4YXHH 2GAZA 3UTSE 4N2HA 1SVZA 4LZKA 4DERA 4UZGA 2PYFB 1HT6A 1XBRA 5BMFH 5AWNL 5EZIH 1YEFH 2V2WB 1CFVH 2FLBT 2O5ZH 3IDXL 4LSPH 2IDCA 1N2RA 2XVBA 4LPWA 4BKSC 2DZEA 4PYGA 5EBLB 3CFNA 2XPYA 3EGXB 3QPQD 1BJMA 1KELH 3LNHA 1GYCA 5F6HJ 3MRPA 4ZD3L 3UTQA 2NX5B 1J9CT 1Q9WB 4XHQA 1TZHB 4J3BA 3HZMB 3MKKA 4J3XA 4BE5A 4POYA 3W0WD 4TULL 4HISA 2OR9L 3QRBA 4KV5E 4BFGA 4BSVB 1KGUA 1FNLA 2V17L 4HWBH 4AX3A 4X80H 5DA0B 5HPMB 2CNZA 3VJ6B 4XMUA 2C9VA 5ELIA 5HTSA 3T77B 4DUXA 3TT1L 4KK6C 1PKOA 3TEWA 4KZEL 2G4EA 2Y2TA 5D7IB 3MV9B 3PUUA 4IS6A 1SBBA 5C08D 5AALA 2EE9A 4NC0B 3IJ8A 4PJIB 4UV4L 4IBSA 4PV1C 3O41A 4MA7H 4TSBL 4YLBA 5FDWB 4HWUA 4DETA 2CLZA 4WFFD 2GQHA 3DX3A 4XXWA 3KR3H 3MOAH 5D96B 1HCZA 1ZHLB 1G9NH 3MBXL 2WGXA 1NFIA 4W68A 5GZNA 3PE9A 3RWEA 5L2JA 1ACZA 3QR2A 4AIZB 4Z76A 4M8UA 1IC0A 2APTA 4ERSL 3ROLB 4G9FB 1UD6A 2P24A 2ZSVA 4FQXD 4QLWA 1BAFH 2OS7A 4YDZA 1NIAA 1MCJA 4WNQB 1EEQA 4H2CA 1RUAH 2PWFA 4QHLB 3QCUL 1U8LB 5ID0A 4OW6A 5CLXA 1XEDA 1OF2A 3QDJB 4FQPA 3K8MA 4JDTL 4AYFB 3NABH 2EE0A 4ZFFA 3MKGA 1UT1A 2XKSA 3T8XA 5IM7B 5C09D 3TP4A 2BSSA 1JXFA 4L8CB 3QNZB 2FATL 1GPOH 4WWKB 2B59B 2Q1EA 1L9QA 5IBUB 3L4UA 1TVHA 5TQ2L 1ILUA 1CFSA 2EKSB 3H9SA 2OXGB 4NAQA 3A4DA 3QPXL 4W1TA 3AMKA 3SKUD 1GGIL 2A6KB 5IBTH 1ZA3B 3CH1B 3ZHNA 1YNTB 1HWHB 3RWJB 1L3WA 4Y89A 3BQUC 3MFFB 5CMAB 3GUTB 2XETA 3PCYA 4P5SA 3VGAB 3WNKA 3D4ZA 1JGUH 3P0VH 1HK6A 1RAMA 5GRYA 1KFAL 4LHUG 2IPTH 2C3HA 2H0EA 3E80A 5GRJH 1FCCA 1A9BB 5B1AB 3KPPA 5JOEA 1AR1C 4G7QB 3OV6A 4OAWB 2B9BA 4ATTA 3VFTB 3FUFA 3WFBH 3PNWB 2CUMA 4UT9A 3WFHA 3ULVE 4OF0A 4YXKH 2P8LB 3BWUC 2ADIA 4YHOH 3EOTH 4ZO9A 4P2CG 4PWIA 2NY2B 5CJXC 2HX7A 1ILSA 2EH8H 5E5UB 4AV5A 3TBVB 2WWKT 5INDB 3NJNA 4Z7UA 4A6YB 4GW5B 5EU7E 2YUVA 2QSCL 5T3XL 1F3DJ 2QMKA 4HQQH 4JFQA 1SHSA 5FUOH 1EJ8A 4BK4A 1E4XH 5KN5A 2YA1A 3G9AB 2X1OA 4JL2A 4NC1C 4ELMA 4L1DA 1SY6L 4NQXB 4PW4A 1NAMB 4Y5YA 4HCIA 4KHTL 2W8CA 3IETA 1CXIA 4M6NL 1GZQA 3MJ6A 4IBWA 5LCVA 1XCQB 1THAA 1J05A 4K7PL 4ZFQA 32C2B 4Y5YC 2OTWB 4G7RB 3O8XA 1S3KH 2PR4L 2WXKA 2NY4C 4PSRA 3FHQA 1JHTB 4HT1L 3FO9B 5C6WH 1KLUB 1MW1A 2GBTA 5GZND 3AW5A 3O8XC 2H1PH 2AJYL 2W0PA 4CJ1A 5EEVA 3UPRA 5AW0B 3ZL1A 5DEFA 2ZQKA 3V5KB 2J55A 5DLLA 3S3BB 3OKDB 4WGVB 4YVUA 1C12B 4AL8H 3WS3A 1M6UA 2E46A 2DLEA 3KBPA 3MRFA 1JNLH 3V0DA 2KUTA 3SDYL 2ILLA 3EH3B 5EMYA 1MJ8L 4G8GE 2NLJB 2CPCA 4WNJA 5FGSA 5TDNB 4JFHD 5AW1B 1CL7I 4KV5F 2EABA 1KBGL 1BD2A 4F8OA 1B90A 2G5BA 2VDML 2Z6FA 1CLVA 3MMEA 3QULA 3DX1A 3WSQH 3HS9A 4N8UA 3SHSA 1HHJB 1PDKB 3CPUA 3Q43A 3G5YB 4P46B 1UM6L 5BW7A 3KBEA 3W11D 4NCC2 2FGWL 4HIPA 3GYRA 5E6YA 3H9SD 4U3XA 3E2HB 5CGYD 2D8KA 4QTHB 1CXLA 5IFAL 1WQVT 1PIFA 3BEVA 3U25A 1IGJA 3X14B 5KYYB 5FO7A 5ALBH 4HA1A 3PDOB 3MXWL 1S9YA 4GAJL 4HFUH 1RUQL 1UXWB 1VPOH 2VGLM 1NBQA 4OUUA 5CGBA 1QACA 4UIKL 4ZW5A 5ISZB 2WD0A 3EDKA 3KPRE 3IMBA 4M61B 5ESVA 5TK4A 4HWZA 3FFDA 5SX4H 5GJTL 4Z7NE 3X3FL 1SLWA 3G6JA 1NGXA 3TJPA 1R3LA 1M2VB 5B7EA 1CU4L 1JTOA 4JL1A 4PLKD 4R0LB 2Y9RT 1URIA 2I85A 5JA8B 4JKKA 3TO2A 5JQHC 3BAXA 3LNIA 3P0YL 4QO1A 4XVUC 4PS4L 4YSOA 4NKIH 2NTFA 4K71C 5K1VA 4YDNA 1CTOA 5CEXA 1QPPA 2WVVB 1BOGA 1Y0LA 2RB8A 4XVTL 3FQRB 1BZ7A 2CUIA 4U1GB 4F7MA 5BJTA 2V2TB 1MFVA 4PBWD 2JTYA 2P43B 2DD8L 5KYWB 3BT2H 2P8MA 2XG4B 1F00I 3CAFA 3OMZA 3TJHC 3VRLF 3RX8A 4OFKA 4OTXL 5FYJE 4K5LA 5B1CA 1XCTB 4IDJL 2MNUA 5I8KL 3NSYA 1MIML 1BVLB 5L88L 5C0CB 3SODB 1B6DA 1ED3A 2LOEA 1YNKL 2B4CL 5FKPA 3CZGA 5IREA 1JK9B 2WXQA 5KEZA 5HHME 2WAHA 4JG0H 3DWTA 2NSXA 4IMLA 4ZO8A 4W9KC 3L3HA 3O8XD 1CDHA 2X1XR 3JYCA 5E6SB 1MJJB 5I6NA 5EEUA 3QS3A 4FFYH 4AQ1A 5HD8C 2YGQA 2ITDB 1HH9A 4I0PC 4DEPB 5DGRA 4D0CB 5T3XE 2WZPA 5KUKA 1NCTA 1KWGA 1SLVA 2K3HA 1TU2A 3PWLA 1XX9C 1FFRA 1N0XL 3KGUA 4Y19E 3VM7A 1X5LA 4LNVA 3WE6B 1N7ML 2VZSA 2ZOLA 4KRPC 5LGJA 4YDKH 3QJXA 4ANXA 1TLMA 1ZHNB 4YXHL 1E30A 1EFXA 1XSIA 4MMZB 5F9WC 1I8IA 1O6SB 3EFDL 3MLYL 5F21B 5BMFL 1A4AA 3QORC 4BWWA 1LD9B 4IOSA 1A66A 2ERJC 1YEFL 3GWJA 3FZUC 1CFVL 4F7CA 1QBML 3HR5A 4AVIA 4YPGB 4A7SA 1BD2D 2AQSA 2WM0A 2ICWI 1SEBB 3A6OA 2D3JA 1BXXA 1MHPL 3N44B 1B3JA 2P80A 4PTTB 4WTWA 5JPMA 3IS1X 4HF5L 1Z9LA 3DOIA 2DM2A 4HUKB 5DGQA 5CU5A 1V3LA 2GBAA 3K5RA 2ITCB 4AJYV 4HUVA 1DVQA 5DUMH 4GG6B 2PO6C 4X6FA 3VU1A 2OCFD 3VACA 5T5FA 1HH6A 4HC1H 1R47A 4WCYH 5J1SC 4NN7C 1QRKA 4TLKA 1VKXB 2ZWYA 2A6JB 1WFNA 1USZA 1DVUA 1ZTXH 2X6MA 1FYTB 3ZYZA 3WTWA 3U82B 1EERB 2FJFB 4XP9H 5CR8A 2NY7L 3O11B 1IGFL 3RHWK 4RMUA 1E8WA 4LLUA 4PP2A 1F4WH 2P48B 3DARA 5J7CC 2VITB 2ICEC 3FB7B 3HG4A 4UB0H 2EVIA 3WHXA 4K5MA 4QXVA 2DYPA 3GBNH 3ZL4H 5JW4R 5D7IF 1P1ZB 1OKEA 3GI8H 3QJFB 4K94L 4HUWA 5IB1B 3KR3L 1OP3K 1JV5B 5DVNA 1NOLA 2FD6L 4MJHA 4PJIF 4LPYA 4UAOB 1G9NL 4JHUA 1LO3H 4WGWB 3JZ7A 3BP4A 1CO1A 3HG0A 2IGLA 4OKVA 4AUUA 3L1FA 1Y6MR 2H32H 3SE8H 5FF6B 3WIHH 4L05A 3P1VA 1HNFA 1OP3H 4AKOA 1BX2B 4BH8B 2PP8A 4RAVB 5IUSA 1JXJA 3HZKA 4FZ8H 4H26B 5IW6A 4WU5B 1SOXA 1DN0A 2IALA 5CZKA 4QHUA 3VSVA 1QHQA 4HFWA 1HHHA 4QRUB 4R7NB 1SJVA 5DJ0A 5E6UB 4HOMA 1A3ZA 1SLXA 3CZKA 5HJBA 1GXEA 4HX1A 4IKKA 1DDHA 5F9JA 1RIVH 5HD8D 3S6CA 5CZXC 1VLXA 4JREC 5DZNA 3I9GH 1I7TB 1CE6A 4CKVX 3NRFA 4ZFOA 3OTTA 1NCOA 5L0QC 3DYMA 2AEQH 5LXGH 4I3SH 1VSCA 4IRSC 4JX0A 4K2UH 2WZPD 4H40A 4GINA 3ZN6A 1XL6A 1GPOL 2BY2A 2F9BT 1E65A 3BVUA 4KRPD 4R2GD 4XMWA 1JWSA 3CFDB 2EADA 5KSBA 3A24A 3IDGA 3TVMB 4X5XB 4X0KB 4HXAH 2Z8SA 3U6XA 4HCGA 2FBRA 3ZTDC 1BHGA 4LAJH 3JWNE 2YGPA 1P4LB 3PHQA 3V6ZB 4MD5A 1T21A 2O6PA 1EFXD 3MRKA 6CGTA 1WA0X 3EH2A 3MAWA 4IOSD 3CX5K 1U8OA 3ULUL 5ICXB 3QO1B 1CVSC 4U4BA 4ICXA 4MRCA 2CGZA 3NEOA 3TCXA 2Y5TB 3D2UA 3P0VL 4ZX4A 9CGTA 2X6CA 3INOA 4L0YA 1HX0A 1NLBH 3A23A 4UM9B 5J4MA 2IWKA 3U79A 2DMBA 2Z0BA 2P80D 5GRJL 2X05A 4BKTC 4ZUTB 1VJSA 1TIUA 3W1ZA 1TR7A 5C0FB 1QI3A 3WFBL 4YZFF 3FQTA 3CZUB 3CZLA 3SD5A 4YXKL 3F7LA 1QFOA 1FUNA 5I0VA 4W6WB 4WEBL 4F8TA 4YHOL 4TQEH 5JDSA 2EDBA 4BZYA 5I73B 3T0EC 5DHEA 4L8BB 4KUCD 2KZ1B 4YDIH 2YD7A 2H26A 5JHDE 4X7TA 3D85A 2CDGA 2QDVA 4E9RA 4QJ5B 4JHWH 4L4VA 3TNMB 1J8SA 2XX0A 1G6RA 3N9GL 3P0GB 4O2CB 5FUOL 2ATPA 3FBQA 2OMVA 1A7OH 1E4XL 2NW3B 5IBUG 4PJGA 1ZE3C 4UQAA 4HJ0C 1TJHL 1U8KB 1V05A 3WTVA 3H3KA 1JZ8A 2H9GB 3VXPA 1MFUA 5E4EB 4GLRH 2ZUTA 2DYPD 1HEZA 3LH8A 4M8QA 1Z9SA 3DHMA 3TNNB 5AW5B 3EYVB 3RA7H 3CU1A 5FC9A 3DRTB 4XOEA 4LFHG 2V6HA 3MLPA 2HP4A 1FGNH 2P5WB 5A6IA 3I02B 3DC0A 3IWVA 4P2RE 2H1PL 4FULA 4S1DC 4M5YL 4U1MA 1AYRA 1MG3C 3GMQB 2GCYA 2GTQA 2JI3A 3PAZA 4K9EH 4YWGH 2M8XA 4D0DB 1ZGLB 2FQDA 4IBLT 1AE6H 4M03A 4O02H 4NQQA 4AL8L 3KDMB 4IHBA 3RKPA 2CIKB 1ERNA 1JNLL 3E6FB 5HGDA 4GUPB 5A6LA 2H1XA 5JHBA 5C2BL 4G6ML 1QRNB 3FO2A 2IH8A 5HHQB 1AQDB 3D9AH 3HA0A 5DZAA 1KTKE 1MWOA 2N0KA 3WSQL 5I1CL 4TL4A 3RY6C 1YYLH 3KZ8A 4BSWB 4HGWB 4JFFA 1YPZE 4EJ1C 2XQYK 4Y2OB 4XTRC 2FX8L 3VGFA 5KAQF 43CAA 3MLXH 3DMMB 3FONA 3IMSA 1NDMB 1CR9L 2NY1B 2WWKO 3BMWA 2D7PA 2MJWA 4KJWC 3WJMB 3ARGB 5L8LB 2X28A 3OHXA 4HFUL 4WAFA 3VH8G 5JHLH 4U1IB 2WOBA 5FV2A 1MY5A 5DK0B 3MRJB 3TCTA 1SXAA 1HL8A 4FN0A 3D2UD 4EIUA 1A7PH 1S7QA 3STZA 1BZQK 1AGBB 3DV4B 4PJ8B 1F11A 4Z6AT 4XXCA 1ZLUK 4I85A 1ZXKA 4BCYA 1IBFA 5ABDE 5JMOC 3N55A 2D3LA 4P57A 4LBEB 2J20A 2QPEB 4XXCC 4MAYB 5D1ZC 1TZGL 3APFA 3PWVB 1J87A 2BINA 2W07B 1ROCA 2V0AA 2NW2B 4PB0H 1DJWA 1SF5A 2R23B 4NKIL 1ZLUH 3VXTA 1TJIL 1GJWA 4NKOA 4YAQB 1MRDH 5LGHH 3ULUE 5E56A 4NZTL 1E3XA 1RJLA 2NZIA 4WUUA 2O6DA 2BNQD 4XC3H 5KAQG 3L3JB 4QRSA 4KZ0A 3D85D 2J44A 2EO9A 3W9EB 4L4VD 1LWRA 1ZLEA 3FC8A 3HZ3A 4J8RA 1OO2A 4U6YA 2FB4H 1D6EA 2IPKB 3B7UX 3UCQA 2DQHL 4LSQH 1YY8B 2UYLB 4RGNE 5DSCA 4JQIH 1HSBB 1KG0B 4JG0L 2BSCA 3TBTB 1TZ8A 5BRZA 2W88A 1QTPA 5J57B 4JM2A 4LNRA 5EN2B 4PG2C 4N2OA 3HLKA 1MRFH 4NNYA 2IDSA 1NBYB 5IMMB 2JLPA 3LZPA 4JM2C 5DMIH 1INDH 3QUZB 3PWUA 3AT0A 3ARYA 5CP7B 2X4UB 1TENA 2ZUVA 3N3EA 4QRRB 1GAFL 4NHUA 3BPOB 2C7FA 2P4AB 4YDKL 1NCDH 3DETD 5I17A 2D03H 4JUSA 4P5MB 2CO1A 4L0ZA 4JFVA 4EKXA 1SBSL 4I18B 4ZNEA 1TCRB 2IMNA 2DQJL 2ZKXA 4RGOH 4W9ZA 4PYHA 3F85A 2LQRA 3EJYC 1UCBH 4WVRA 1OD9A 5GS0H 15C8H 3KGSA 4DGUA 3V0WH 3EOYG 1PD0A 3MROA 1QNIA 1HQ4B 2DLGA 2D0HA 4HJJH 4JFDB 4FJZA 4JFFD 2AJ3B 4K7FB 1TVDA 2YK1L 4KJWD 1QSFB 1IFRA 4NO2B 1UGKA 5A40E 5I66A 1WF5A 2FIKB 5C3IA 1XF4A 5DI8B 1E4WH 4MMYB 1R5VA 3EBIA 4EPSA 5DUML 1BZ9B 3QEQE 5DFAA 4AV4A 2IV9A 1DJYA 1FSKB 2P1YA 3O45B 5AG8A 3ORJA 5EOCH 4RFNB 4HC1L 4U1JB 3GLDA 4HS8H 4HYTB 5I19H 2BM3A 5CD5C 3REVB 3QHZH 4YHLH 4L37B 1IAIH 4ODWA 1ZTXL 5I15H 5GGVL 3KM1A 3QGVA 2Z0UA 1BDYA 4XP9L 5FUCE 5F6IC 5LHDA 2E8ZA 4KFMA 1I7RA 1L7TH 2WO3B 4EIZC 3RIFF 3MGTB 2R83A 3ZIMA 4FXLA 4GSXA 2VMCA 2X4NB 4MD0B 1P2CA 5I1JH 4DN3L 1SN5A 2WLYA 4N9GA 4AGPA 4MXWH 2E8YA 2GITB 2DYSB 1SYSA 2XWTB 4WUUD 3EDFA 5F7LB 1MFEH 1J5DA 4NDMB 2M26A 2OZNA 2W81C 5T33H 2X3CA 3SE8L 4U1HB 3FTXA 2V8MA 1JYXA 4CGTA 2X2JA 1RFDH 4OCXL 1FH5H 4Y4HB 3UZQB 4AQ8A 4IIQB 5BO1H 3CFUA 2DMKA 3F58H 5AZ2H 1WFIA 2Q0ZX 4F8PA 5B8CB 3RVUD 2DM3A 1JTTA 4IBZA 3LQAH 2VUOA 3K7UA 2DLTA 3RZCC 2QJDA 2QVKA 2UWEF 2YAQA 3I9AA 1PYWB 3ESUF 2K1MA 1BIHA 1RIVL 5HI4D 5BRZD 5CJ5A 5BUPA 2H5UA 3I9GL 3VFOA 3B2UC 4JM2D 3W57A 3STLA 3PYCA 3OMIB 4IMKA 2AEQL 3MA9H 5LXGL 4B9JA 1M7IA 3D51A 1KXTB 1OAUL 4NN5C 4E36A 2SEBA 4FKEA 2ORBH 4JLRA 4RNRB 5ABZA 1S5HB 2J7LA 1DBJH 4FAAB 1QHOA 1R75A 1E7UA 3BYTA 4WO4C 3OKLB 4HXAL 4YHMH 3BLKA 1WA2X 1S2EA 4G59C 3L7EB 4XAWH 5AW9B 1FL6B 2VLME 2V7HB 3EJYD 5EHFA 4N2AA 4M7JH 1LDPH 4OFQA 5GGSY 1GVIA 3DOHA 3MNWA 1QBBA 1AHKA 1QSEA 5BZWA 3LDBC 4TOYH 4KXBA 3UBXB 3RGBA 1UZGA 3RPIA 1Y07A 5GS1B 5B3SB 3DI2B 3L3DA 2VIRB 4NM8H 1K3IA 5K9QG 3DDFA 4DKAA 1S7VA 1MNNA 4MVBC 3RQ3A 5BZDA 3APDA 1D7FA 1OSYA 4ONGH 1IAMA 5TF0A 1AVAA 5F7FA 2P8PA 4H0LC 3BAWA 4KK5C 3NSDA 2AEPL 3I6GA 3EJRA 2EYTA 4YGAB 4RH4A 1HDMB 4DQOH 5A7BA 4TQEL 3ILQC 4NPKA 1YLBB 3RDTA 4DO6A 1RZFH 3LYRA 3D39A 4IKJA 5F3BB 3R0NA 4YN3A 4YDIL 2R1WA 2GJPA 4BCZA 5MENE 3IKCA 2ZSWB 5ETUB 2DWDB 1YCSA 4WGKA 1YEDB 5CEYA 2X41A 2XIBA 4CNIB 2VLRA 5KSUB 1A7OL 1ETJA 1AY1H 3LX9A 2JELH 1GJIA 2A6DB 1UD8A 3AQYA 5DDHA 2QT6A 4MBRA 4YMPA 3D69B 4WEMB 4JFEE 4TNVK 3ZZSA 1CLCA 2KT6A 1FGNL 5EZOL 4IHOA 5J11C 1N8ZB 3AY2A 3MA7B 1JZ4A 1QQDB 1IZKA 3OB0H 3SPCA 2WK2A 3GMRB 4K9EL 5CZVH 3PL6B 3W0WB 5CCGE 4V1DE 3D8MA 1B4RA 1AE6L 2XKUA 5DS8A 4OZGB 4QRPA 2X0UA 2PCXA 4UOQA 4KJPC 3LNGA 1OGPA 1T4WA 4G8EA 4NHCH 1CFTA 3MO1A 3U9UA 1S78C 1QR1B 3HAEA 2VXQH 1MKFA 1RZIA 3UBHA 1KULA 3CTTA 3D9AL 1OAYH 3SY0A 4RRPA 1E2WA 3WKMH 3ECQA 4GEIA 4XMKH 1UWFA 5C08B 1UWYA 1GZPB 1YYLL 3P4MA 1MCCA 1H6UA 4UZSA 3C5SA 1OVZA 3U2SA 2FRGP 1U0QA 1K4CA 4U1KB 3QDME 3M88A 1LL1A 4PRAA 3H53A 1GSMA 1I1RA 4LLWA 2X7LB 3VWKA 1H19A 7CGTA 2E9GA 3SPVB 2SODB 1DQQB 1K5NB 3EHBC 1A4CA 4XPHL 3NTCL 1QSED 4AV0A 4K3JH 5ADOL 5JHLL 4MVBD 2BVOB 2UXGA 1XMWA 3Q01A 4HMDA 1G43A 1YUHB 2OI9B 2YXFA 2B77A 4HDIA 1J1XL 5C0AD 4MMXA 3MRHB 2LVEA 3QZMA 2ZD0A 1T0NB 4PJFB 1YDPB 4Y9EA 5CSZA 3ILQD 3D33A 1IQDA 1W0VA 3LN4B 4K73A 3BGMA 4CL7A 2WPGA 4PB0L 5I2IB 1ULVA 4K8RC 4D8PB 3RDTD 2RHEA 3D39D 1MRDL 3I85A 5B7MA 4FMKA 3BHBA 4UU9B 2NY6B 1R5WB 2JJTC 4XC3L 5KZCD 3FU9A 4X6EA 1A9VA 1YRKA 3P77A 1I8LA 5JQ6H 3HB3C 5FCSH 5K1JA 1IQWH 5J12C 5LG6A 3L9RA 1U8IA 2DV6A 1Q8MA 2EILB 2LAGB 3FFOA 2VLRD 2FB4L 1I8LC 3ZZ1A 4R26H 2VR5A 5FDYA 4KOCA 1FZMB 4LSQL 2GFBB 5EC2A 3GKWH 3FCUB 4HPOH 5KUMA 3S36H 4RAHA 3I75B 1ZKAA 4ATWA 2QV2A 3ZBMA 3EADA 3LXCA 4JPVL 4O2FA 3FB8A 1DUZA 3QVAA 1Z0NA 4ENZA 4YSCA 2Y22A 4HHAB 2XICA 4YDLC 1T0PB 3QJUB 1J5CA 3WS6C 3MRPB 5D9SA 3IFNL 2X4SB 4JDVB 4DZ8A 5DMIL 1INDL 5JW4M 1P7QB 1DCLA 5IB3A 1RI8A 3O2DA 4JGMA 5DURD 4BBWA 4B95C 4Q74A 2Q8AH 4NZ8A 4JJ5A 4PJDF 4QRPD 1T04A 3ZL2A 3VG9C 1S78D 2YD8A 4NX0A 1EGJH 5I30L 3VGGA 3CSGA 4RGOL 2YD5A 4YO0A 1UXSB 1RPUA 1N68A 1NFKA 3NGBC 1UCBL 5IUCA 2AEWA 4IIZA 4E42A 4J3WA 2GJ6E 4NSKA 4RGMC 5CEZD 1UB6A 4LLYA 4QTIH 3PFQA 3WGVB 1QABA 5D71H 4HJJL 1RZ7H 2XZAL 5A3ID 5I1GL 3Q5TA 4AG4H 4G42A 2HUEA 3O41B 2V2XB 3M17B 3RJOA 2APXA 3CXDL 3GK8L 2V5TA 5C0BE 3C5ZC 1R3IH 1E4WL 1HHKA 2VSMB 2D9QB 3F04A 4HKZB 5DJ2A 3UTPE 4BZ2A 1EDYA 4GSDH 4IEFA 3DI3B 1SXZA 1FE8H 2N7BA 4IYKA 3UGXA 5EOCL 3L9BA 3VWKD 3REWB 1FBIH 1Z9MA 4UQ3B 3L7FA 3ZGHA 3LEXA 4OB5L 5TQ0L 3ZUNC 3QHZL 2YAMA 3FCTA 4YHLL 3CVIL 1FFPB 5CWSA 2HZHA 1RJZA 5I15L 1OT2A 3TO4C 2YFOA 4R4ND 1YN7A 2P24B 5ABAA 1R33A 2WJ5A 2F5AH 3MQIA 1L7TL 1AGFA 4J3TA 1U58A 3L3KA 5ID0B 2Q9OA 1J5HA 3FRPB 3CSTA 5F96L 4JQVC 4FMFA 2MTPA 3JWOH 3IDJA 3T8XB 5F7EH 4MXWL 2BVEA 2I60H 5IFHL 2BVPB 3HB3D 3MNZA 4OLXH 3EDEA 1BWMA 2DKUA 1MFEL 1SYVA 3V6OE 1OCCB 4E9YA 5T33L 2FECL 1KEMH 4DO4A 4CGUB 1CFSB 3MRMB 5KVGH 1FH5L 5E2JA 5E2TH 5AG9A 1HIMH 3BCDA 3F58L 5AZ2L 3BQUB 4N0CC 1EBAA 2QSQA 4BFIB 4JHVA 5DJAA 1SVCP 5C97A 2E3VA 2OSXA 3OB8A 1A6PA 4N0YH 4XP5L 2ZAIA 4M5ZH 3KPRA 2BOCB 1MCPL 4U6XA 1N64H 1AR1B 1MRCL 4GRWH 3KLKA 1IM9B 4QPEA 4GH7B 3MA9L