3IJSB

Structure of s67-27 in complex with tsbp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
221
Chain Sequence
EVMLVESGGGLVQPGNSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDISPSYGVYYEGFAYWGQGTLVTVSAATTTAPSVYPLVPGGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 221
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsB01
4ALAL 4HWBH 5DZOA 1IZKA 2QQLH 4R0LC 3GHEH 4PJEF 3VFGH 4WEMB 2OTPA 3JWOC 5KVDL 3FO2A 3G08A 3VGEA 1A9BB 5J6HA 3QUKB 2NLJA 3IAQA 5IW3A 3WBDA 3ZDXE 2VNCA 1NMBH 2C5DC 2R0LL 1WBZA 4WCYH 3QULB 2E9IA 3KYOA 4XPTH 1FVDB 1T21B 3UJIL 3QH3A 2QHRH 1QSEE 3EDEA 4OLVH 2DQJL 3RL1A 2XT1B 1ED3B 2DOCA 2AK4B 1C5CL 1I8LA 1ODAA 4JFFB 5BVPH 3I75A 3OR6A 2V2WB 1CLYL 2H9GB 3D3VE 4L4VE 3ULVF 4OSUH 1ZHKA 4L9LC 3V79C 5A16A 2A6DB 4WV1A 1NFDE 1GXEA 4N8CL 4Q2ZB 4HFUH 5GZNC 5CJQL 2FO4A 1JPSH 5FCUH 4HWEH 3T77B 3PUCA 3KYKH 4RIRA 1U95A 4P4KA 5JTWA 3LQAC 3IAPA 1IAII 3WKML 2D7MA 1H8SA 3HFMH 2PXYC 3O9WD 1U3JA 4N68A 4YUEL 1CT8A 5CJXA 3HMXL 4DQOL 1ZT4B 2Y36L 3SGKA 3V8CA 5KBNC 5B3JE 4N0RA 2MJWA 4TUJA 1DJSA 3BGMA 4NFDA 4WI4A 1NGZA 3AFLA 4OF8A 3GSUA 4JE4B 4I3RL 3SKOA 4DUWA 1N5AA 3RHWK 1KTRL 3UBXA 4WWKC 1GGCL 4ZAKA 1XGUB 4KKLC 1FORL 1U93B 1EUTA 4JRYB 1GZPA 4P57B 2HWZL 5J1AA 1MIEL 2AK4D 3HZYB 3RX7A 2X4RB 1QFUL 4JFFD 3UBXI 3BWAB 2DM2A 5I1IH 2G5BA 1UJ3C 3BP5B 5EC2A 4O58L 3WUWB 2P8LA 4DKDC 2APVA 4D9LL 5EB9A 1G6RB 3EDKA 1A4JA 5D2LF 4FQLL 1WFTA 5B3NA 5IMKA 2IPUG 2BFVH 2DLTA 1R3JB 1MQKL 4CJ1A 1QACA 5AG9A 3NN8B 3OKOB 3CZJA 5D1QB 5MI0B 4A6YL 2VWEC 3L3KA 1FYTA 2FSEA 5E4EB 3CXHJ 1ZLSH 3C5JA 3TJHC 3VXOA 4P2OC 1S7VA 5C0CB 3ALXA 4QHKI 3IDMA 3IU3A 3GB7A 1RZJH 2N7BA 4QRPD 2NMSA 4PBXA 3BJ91 4QHUB 3KPLB 1FZKA 1N3NB 3D6GA 3PWLA 5C0JB 4XRCB 3GBML 2ORBH 1YYML 1O5DT 3P11L 5EULV 4OKVB 3S4SA 1I9EA 3EZ8A 5H35B 2Q8AH 5J9PB 4TNWF 3B9KC 4J3UA 3H0TB 2ZG2A 1VFOA 1ZLWK 4LQFL 1PLGL 1VGKA 4MNGB 2R4SH 1S7WA 4L4TA 1IM3A 2K7PA 2I07A 5KSBB 3MODL 1S7UB 2VDOL 1XAUA 4Y2DD 3IXAA 2IH1A 2Z4QB 4CU8A 2F53A 5KTEH 1KCVH 1GHFL 5BS0D 2FDBP 5ANME 4PY7B 4U1LB 5T1KB 4HIHA 3T0BA 4JB9H 3B2UC 4ZPVB 4LVNC 3MMEA 1DE4A 3DRQB 3RWHA 2EDEA 4G43A 3LQAL 1LEKA 1T0NB 3BUYA 1IZJA 1W0VA 4JR9H 2ZOKA 3RVVC 2IAMA 4P2QB 1AIFA 5CBAA 3CAFA 2ILLA 1LDPL 3IDXL 5I15L 5D1QD 2MWCA 5IFAH 5FUCE 2OJZH 5IF0B 4PJFE 2VAJA 1XEDA 2I5YL 4JZJB 1V7NH 3C8DA 1CE6B 1RIVL 3WUWG 4NQEB 3ELAT 5IEKA 5F7HA 5HI4D 1H15A 4MNQD 1GGYA 3ZSSA 1OOAA 4NSKB 5CSZB 2MSPA 4LLMA 2ITCB 1WISA 4GMSL 4B50A 3FOMA 4L5FL 3DV4B 3PGFL 4D0DA 4WW1A 1SM3H 3O45A 3VD9A 5F1OB 5HHOA 4I2XE 5CEZH 1OAQL 2NY3B 5L9DH 1X5JA 1NAKL 4MA7H 1CF8L 3MLWH 3QDGD 4XI5D 1IE5A 2R0WH 5I8CA 3BISA 2H1PH 3LN9A 1Q1JL 3RBGA 2NY4B 4R8WH 1LEIB 3BEVA 2PO6A 1D9KB 4OIAA 2LTQC 1IAKB 5T1KD 5DD0L 3C08H 3LIZL 4XCFH 3QPQC 2YZ1A 5J89A 4QRQB 3OG4B 1AI1H 1MY7A 5L2KD 4P3DB 2Z31D 5AYQA 5C0DA 2EKSB 5HDOA 2FD6H 4OCWL 3P4LA 4JVWA 5DK3A 1CXFA 2DQDH 1ZOXA 5I0ZA 3F5WA 4ZTPH 4O02L 2C3XA 5I2IA 3BZFB 1JYXA 5TFSH 1OB1A 1OARL 2OL3H 2X4TB 1ZANH 3GSWA 4U1JA 4I13B 1CFTA 5FEBA 2VERN 4N9GA 1E27A 3BO8A 5DJDB 4HS6A 4JZOA 1HEZB 3M1BB 5KJRH 1P84K 4NNXB 5DJ6B 2RAMA 1XIWC 3H9ZA 5I1CH 5JW4M 1NGWB 2ZZUT 5ALCH 1A7BA 2D7QA 3CX2A 3WS3B 3MRQB 1MI5A 4NP4L 5HGAA 3WS6C 1CFQA 5D7IF 4FABL 2XWJA 5A2KH 3IXTA 1RUML 4YK4C 4WUKH 3MJ9H 2PN5A 1PAMA 2HT4C 4MHHG 4P59L 3IETB 5LWYH 5CEYA 12E8H 3MRGA 2AI0L 1DBMH 4LVOB 2NY4D 3GRWA 1H3GA 2G5RA 2YPKB 3WIIL 3RAJL 1D9KD 5T1LA 3GM0A 2EDQA 3GJFH 1DLHA 4G9DB 1HCVA 4NZJA 5D2NB 4WJ5B 1TQCB 1V5JA 3NAAH 4KRPB 2Y7QB 3MLTB 3MV9E 2XACC 1UWEH 2XWTA 1U3HB 5J11B 4K55A 4PREA 1DBBL 1NFKA 2VLKB 1HHJA 4PJ5A 1RU9H 1FFRA 2L7UA 3MRFB 4FNLL 3PL6C 4K07A 1HHHB 4LRIA 4BM7A 1KN4H 1CGUA 3LN4B 3L3JA 3FTGB 3DX6A 3JVGA 1INQA 4TSAL 4Z5RB 4I0PB 3ZKNC 2BVPA 1KIQA 3BMVA 1BQHB 3MA7A 3U46A 3EO1B 3BRGC 1T1XB 1KNOB 1A7RH 4KK5C 2DYPA 3C5ZC 4FQHA 2JE8A 3FT2B 4YDJB 2O61A 1T1WB 2VXSH 3G5YB 3Q5YA 4P2RB 3CK0H 4EI5A 5HYSG 5HTSA 5IWLA 1U8NB 5DEFA 4APQC 1QHOA 2IF7A 3ARPA 3G6JF 4UB0L 2CIIA 5DR5H 5E6IC 1GYAA 3M17B 1EO8H 2EEBA 1PSKH 4PJAB 4GRLC 2P24B 3S98A 2PTTA 1LK3H 4MQTB 1NC4A 2VDLH 4ONOA 4JFPB 2ZCHH 4KRPD 3U6RB 3EW3B 3HB3C 1U3HD 4S1DD 4QHLB 4JGUA 2HLFD 2VLKD 4IRZH 2OS7A 4JO1H 4HIXL 3NABH 2RJMA 1QSFB 2A6JA 3HAEA 1T2QH 1FH5L 4OF5A 5CWSB 4JPVH 3F8UB 3ARDA 2EO9A 5JOFA 4AY0A 4I0PD 3Q5OA 4LDOB 4R90L 4GW4B 3U7YL 4OIIL 2ESVE 4TYUA 2JTDA 1MCBA 4XBPB 3OAYH 3HA0A 2O5ZH 1A7OH 2A2QT 2HTKC 4EEEA 4NM4L 5IJKC 2EDDA 2D7TL 2CO7B 4P2RD 4JDZB 3FQNA 5CZXC 5DUMH 4PRBA 5C0IA 2I9TA 4LF3B 3HE7B 5DD6A 4HZLB 1PJ9A 4OQTL 4GAJL 3QFJE 4X80H 1DUYA 1EFXA 4Y8DC 1UH2A 5K9JL 5DJAA 1BQHG 1YNKH 3IS1X 15C8L 3V4VL 3H7BB 3OAZK 5LQBL 1F02I 1S7XA 3BGAA 1FFNB 5MENE 3BPLB 2FJFA 1AE6H 5DO2C 3T0EE 1AJ7H 2EH7H 4HJ0C 3GBLA 1XGQB 5I1AB 4PG2A 5FGCE 5LAXB 3I9GL 2PW1A 3I6GA 2DI8A 1MCNA 4PJIB 1PG7H 1MUJB 5DI8B 1QBLL 4UQ2B 4X9FA 5ITFA 1F58L 1QSFD 3H3KA 2IPUK 2NPLX 5EOCL 4OCNC 4X8JB 4I48A 4OFVA 3LCYA 3ETBF 3ILPA 4M9PA 1EZVX 4Q6IC 4YXKH 1QFWI 3NMEA 2GY5A 1R24A 5C0GB 1JZ5A 3MFFA 3DLQR 2JJVA 1GZQA 2LVCA 1OP3K 1N4XL 4XP6L 3HG1E 3CFJB 2AXGB 3LQZA 2CKBH 3VMNA 1MCLA 4JRXE 4PY8J 4OTXL 4NCC1 4BSJA 1MCJA 2FX9H 3MXWL 2VXVH 2NY1C 1TZGL 3OKLA 3O4LE 4UINH 3D3VB 4RISL 4UV4H 1X3DA 3MRLA 1NFDB 4N5UA 3WN5C 3ZDZF 3A6CL 1OQOA 4BSWB 5T3ZH 4HJJL 1AQDA 1JWMA 2Y6SD 4DUVA 5EO0B 4DEPB 4NRZB 4BKLB 2F53E 1YUHB 3AAZB 2C1PA 3NPZB 1BVKA 4OB5L 3O8XC 2H41A 1IFHL 1I1YA 4KJQC 4U1HA 1FBIH 5KAQG 1HINL 2EYRB 3KYKL 3QI9C 4ZPTB 1UACH 2AJYH 1I1FA 3T3ME 1FN4B 2VDKH 5A2LH 3DUSB 2ED9A 3G5XA 3IRZA 5IVXE 1AXTL 1U8IB 1A7NH 4Y89A 2OR8A 1LP9A 2XV6B 3CCHA 1MNUL 3RWEB 4MX7B 5I16B 1QSED 3BPCA 3NGBC 4GQPH 2Z8VC 4M7ZB 1HOCA 1BF8A 2CO6B 2VYRE 5ELIA 1EEZA 3FB5B 2HKHH 1Z5LA 3D3VD 4L4VD 4BQ6A 1MHHB 4YIQA 1ZS8A 1MRFH 3ET9F 1RI8A 3NIFE 3O3DB 2WM0A 3S36L 2GSIB 2BNUA 2FX7H 3DO7A 4KDVA 1J7VR 3O2DA 5GRZA 4DGYL 1CWVA 4X6DF 3S37X 3VXNB 43CAA 5I1EH 4XCCH 1G7JB 2JJSA 4RMUA 1FNLA 3SE8L 2BXYA 1EEQA 2BFVL 1TZHB 1XF5A 3MJ8B 5JQ6L 1TZIA 5ITBL 5D5MF 5BVJB 3BX7C 2EDKA 4R3SA 1IM9D 4YBQD 2Q7YB 2ZUTA 1MF2H 3MZGB 2YSSB 4FQ2L 2Y06H 5DT1L 5E00A 2HKFH 1HWHB 4JFXA 1YY9D 4KZEH 1A6AB 5DZNA 5JR1H 3O3EA 2CKNA 2GJJA 4O9HL 3BP4A 1P9MA 1UQSA 4PB0L 4M7KH 4PB9L 4JRWA 1QLFA 4YGVB 2FCBA 4P48A 3T2OA 4DVRH 3BFOA 3RVWC 3B5HA 4HSQA 1KLUA 1ZHLB 2K7QA 5ANMB 2D03H 3NACH 3RJQB 5HXMA 4QY8A 1OP5K 5DJ0A 5D7JC 4JKPL 5KG9B 2G60H 3PNWA 3MNVB 1WZ1H 3JTTB 3U4BH 4Z7OF 5ACZA 1KPRA 2FIRT 4HH9B 3RZCD 1X5AA 2XKNA 1MFDL 3CFDB 3VFNB 5MP6L 1S9YB 1Q9LA 1F3DH 4P5TC 1EFQA 3NZ8A 3IVKB 3F58L 3QHFH 2BHYA 4GKSA 4PJFB 1ZTXL 1OM3L 1UB6B 3RY6A 4S1QL 1I8IA 3ARGB 2XPGB 4ESKA 5HHQB 4U1MB 2L4OA 4TSCH 3D69B 4Y5XB 5GQBA 4OIBA 5D93B 4F57L 5DJYB 1XGRB 4KKAD 4AYFA 2R2BA 3VFVB 3PP3H 2RIKA 3CDGA 3GI9H 3BDYH 2AXFA 4GSDH 3UTSE 3VXTB 4I2XB 1KJ2A 4JM2A 3RZWA 3N1QC 1CDIA 1VGEH 3MSPA 3NZHL 2CDGA 1MIMH 4PJ5E 1YEHL 3SE9H 1LILA 4MDIB 4NO3B 4ONHB 3SDCA 3UTQB 2AJZB 4OCXL 3LRSB 7FABL 2BMKA 1H0DA 1OSZA 4X7DC 2HLAA 4MAYC 2QTEA 4M43L 3DURB 4TN9A 2J8UF 5ID0A 2BERA 3LY6A 4DZ8B 3MUHL 2ICEA 4I8DA 5E2VH 1BZ7B 1I9IH 3E1F1 3AB0B 3LKNA 3TVMB 1QR1B 4OT1L 1FFQA 4OD1L 2DKMA 2DLGA 1MWAL 4CKVX 1K4CB 3V7AE 5GRJL 1Q9WA 5IMOB 3GUTA 5A2JH 4KKBD 1TQBB 4I3SL 5CUSL 4C58B 2N56A 3O2VL 1SY6L 4XC1L 4CGTA 1CFNB 2DQTH 4E41B 4KTDL 5C07E 4MWFB 4N0YL 1AO7A 5HPOA 2F8XC 5ESVA 4OLUL 1VHPA 5TQ0H 5BQ7B 1LK2A 1T2JA 2OXHA 4RX4A 4J7RA 1G7PA 4GG8A 3RTQA 4LFHD 3UO1H 4OAWA 4MSWA 3HHRB 5L7XH 3WHE1 1U8KA 4LCYB 4QRUB 4UILL 2VXTH 3JWOH 2A6KA 3O2WL 3OKKB 3NVQA 4QT5B 4N0UA 2X6MA 1T04A 4JPIB 2F5BL 4I0CC 5IOPB 1R0AL 4YDVA 4WY7L 3VG9B 4JPWL 4V2BA 1I9JH 1R5VA 1FCGA 1UZ6F 3CU1A 1P6AB 4MXVE 4HUMB 4PJXF 3REVA 3TBYA 4LFHG 5IVZA 3UZEA 4KK6D 3CZFB 3UDWA 4HKXA 3MV9B 1DQDL 1T22A 1FDLL 1Z0NA 1BJ1J 4NCC2 1KUMA 3I3EA 4ISVA 2EC9U 3CFCH 1J8KA 4H20H 2QSTA 2GKIA 3P40A 2RCSH 4EUPA 4JHZA 3OB0K 5IK3A 3RDTB 3SKMA 5E2UL 1QA9A 4FFWC 3RVXD 1RIUH 4M6NL 4H8WC 4OGXH 2HJLA 2OR9H 4YLQT 5GRXG 4LAQL 4PRIB 4W81A 3GMNA 1ZT7A 4PJGB 5FK9A 3F65A 2AEIT 1NGYA 4FQCH 4PPTA 3T65A 1L9MA 5D7SH 2Y5EA 3TBVB 1OTTD 3E3QC 4LSPH 5DQDL 4PJ8A 5D9SA 3TH4T 2R8SH 3O4OB 1MJ8H 3EDJA 5FM5O 1CU4L 1FGNL 2X42A 2ERJB 2FH8A 2BNRA 1S5HA 4OFPA 3G08B 5J6HB 2NLJB 2IPTH 1R5IA 1WBZB 1AC6A 2GITA 1KFAH 1KJ3L 3KYOB 3MBED 4QKXB 4IIQA 3MV9D 2HFGL 4Z7VF 3QH3B 4YC2B 3RL1B 4M6OH 4FXLA 5EZOL 4OZIA 1H3PL 2CQVA 3SGDH 3I75B 4NNPL 3IJHA 4OF3A 4KUZL 2BCKA 4KGJA 3DX9A 5D96C 1ZHKB 3ARYA 5A16B 2ZCHL 4WV1B 5IHZA 1YEIL 3QCTH 1D5MA 1W0YT 3KPSA 1QRNA 4JM4H 1N6QL 1G1CA 2FO4B 1QSVA 5JMRA 3L3IA 3TO4C 3L7FA 2EDBA 4RIRB 1U95B 2FX8H 4P4KB 1MFCH 1YNLH 4OCRL 2DD8L 3K3QA 4EDWL 4KMTH 2C4XA 1ETZA 1NDGA 1PY9A 4L3EA 4OZHA 1JWSA 1CT8B 2EIDA 4W4OA 3UYPA 5IR1A 4HWNA 1CICA 3ULSA 2N1KA 5C8JA 1BHGA 4TUJB 4MA1C 1JRHI 1NGZB 2QLVB 2R1YA 5EOQL 3QISA 4YZFF 5AUMA 3GSUB 4JO2H 3PE9A 3SKOB 3UBXB 1ORSA 4U4BA 1LP9E 4Y5YC 1FV1A 4HW6A 2R29H 4LLDA 4ZAKB 1MCSA 5TPWH 3BKJH 2NW3A 3UYRL 5J1AB 1WIOA 4H8WL 5I30L 4XNQA 1FNGA 1JBJA 2G5BB 3DYPA 3GBNL 4ODWA 5EC2B 3ZE0F 2P8LB 3QCVH 1UVQA 1TJHL 1HKLL 3RX8A 1NCWL 1A4JB 2LU3A 4NZRH 3TBSA 4Y4KD 1RJZA 4XVTH 5EU6A 4MB3A 5IFHH 2YBRA 3TYGL 4R4NC 4P4KD 3C09B 3V4UH 5I1DA 3E2HB 3S35L 3L3KB 1FYTB 2FSEB 3C5JB 3BUTA 1GIGH 2ZWLT 4P5KB 2D4DA 1YECH 3VXOB 5GGSY 1R3IL 4XMKL 5DQJA 1S7VB 1JMZA 2IANE 3FQRA 3IDMB 4J1UA 2MQ3A 3NFPA 4RWYH 1A22B 1BX2A 1FZKB 3PWLB 5I1JL 4TUKH 2NY0B 1YMME 3S4SB 5MEND 2QQNH 1VCAA 4ZAKD 3C8HA 3GFUA 1VGKB 3CFBA 1S7WB 3MLRH 1BZQK 4JLRA 1IM3B 4L4TB 2I07B 4G7YL 5F9OL 2EXYC 3IXAB 3I3DA 4PTUA 4DOHE 2F53B 3T1FA 5IESH 4I0KA 1KELH 2PR4L 2YUXA 4HIHB 1GGTA 2Y07H 5EA0H 2YA2A 2CUMA 2AK1L 3MMEB 1A3RL 1DE4B 3UBXG 3RWHB 2JJTA 1J18A 1IKFL 4GRMA 3HC4H 4G43B 1LEKB 3BUYB 2DF3A 4YPJA 1W0VB 2XTLA 2R56H 4MAUH 1KBGH 2IAMB 1AIFB 5CBAB 2FEEL 2I60L 3OG6B 3HG1D 4HCRH 3CLEH 1Y18A 5F71A 3O6LL 4JRXD 3NTCL 3TA3D 2V2XA 5IEKB 1H15B 4GG6F 1CGSL 3ZTJG 4LLMB 4EVNA 2QJDA 3O4LD 3UMTA 3FOMB 1A7NL 5JORA 1QLEL 3PV6A 4D0DB 3FO0H 4M1GL 4WW1B 3U7WL 3O45B 3HLAA 5HHOB 3WXWH 3VI4E 1K8IA 1T2XA 4FP8L 3DHMA 3VA6A 1NANH 5DD1L 3BKYL 2ZCLL 4QXUL 1FFOA 5C0ND 5I8CB 4L4TD 4BQ9A 4DCQA 2LQRA 2F53D 3BEVB 2PO6B 4HF5H 2DQGH 2UWEA 3A67H 1BMGA 1T83C 1F2XK 1RUKH 4NZDA 3HNVH 3S4SG 4N0CD 1T03H 4S2SA 2IEPA 2VZVA 4KI1A 5C0DB 1J11A 2VZSA 5I75B 4RFNC 3LZFL 4U33A 5GRWA 1AHWA 4NUGL 3ZT7A 3FB6A 3F5WB 4Y4FA 2KZ1B 1L7IH 2Z91A 4ZFFA 4AQOA 3TLRA 5I2IB 4WTZG 3ZE1E 1OB1B 3GSWB 3QZWA 4U1JB 5I8KH 1VACA 1CFTB 5BV7B 4NO5B 3ARFA 2GI7A 3EJYD 1E27B 3BO8B 4KXZH 4N9GB 4OCYH 4OZ4A 3WHXA 4HS6B 2QEJA 4YHLL 4JZOB 1AO7E 3W2DH 1NAMA 5FM5M 2W9LA 1F4WH 2QADB 3L5JA 4IDLA 1QZ1A 5HHOD 3KLDA 2K3TA 1UWGL 1MI5B 1FVEA 3BKMH 5HGAB 3TZVC 4XP5L 1I85A 5GJSH 2XWJB 3GSNA 2BY1A 3IXTB 3X14A 5IQ9A 4N0UE 5C6TL 3BAEL 5CEYB 3MRGB 3HUJE 3IFOA 5T1LB 3BD4A 3U4BL 1DLHB 4DN3H 2HH0L 4IRJA 3OSKA 3O6FA 2XWTB 2BDNH 4LASL 1TJGL 1TNNA 4JGJA 3FRPA 5JIHA 3U1SH 4PREB 2DQCL 1HHJB 4PJ5B 1G9NC 1CIUA 2NZIA 2EDRA 2Z0BA 1VENA 2VRAA 1QRKA 3SDXF 3WJJA 3EIFA 1IC4H 4GRWF 3L3JB 3S37H 5HPMA 3DX6B 1INQB 5BMFH 2V5RA 3GI9L 2J2ZA 3D85A 4LVHC 2BVPB 1F6LL 2VUOA 1KIQB 5E4EC 3MA7B 1N0XH 4LDLB 3U46B 4X9BA 3HPJA 3U30C 2FO1A 2H45A 3QCUL 2DYPB 4FQHB 2Y25A 2O61B 4IRSA 4EI5B 2GTWA 5DEFB 2IQAA 2CIIB 1F8TH 4J2XA 1FFPA 3T0XA 3BT2L 4JG0H 2XZAL 3KPNA 4ZNEE 5T1LD 4HWZB 2PTTB 4RCAA 2LE9A 4KZDH 2FB4L 2YRPA 1Q0XL 1CXEA 4S0TD 4MMXC 1A47A 2AEQL 5TH2A 4XMPH 3MRCA 1M71A 1W72A 2DQFA 2WLZA 4PJ5D 3RU8H 4BELD 1TMCB 3HAEB 2A6JB 4MB5A 1LVEA 4WW2B 1I8KA 1YDPA 1E4WL 4C55A 4PJDA 4EBQH 3ARDB 3MV7E 5JOFB 4M3KB 3VXMA 2E27L 5DMIH 3KPSE 1QRNE 1EJ6A 1JGLL 1RURH 1XGYH 4M48H 3SQOL 1T20A 3L3DA 4DGVL 3MREB 1FSKB 4U7KA 4NM8H 5AAWA 1OD9A 1PDKA 3IFLH 2P43B 1BM3H 3KLAA 1AR1D 4FQQB 1MSPA 2IFGA 2MKWA 3FQNB 1A7PH 4PRBB 5C0IB 3VD7A 3TJEL 5DFTA 4FTVA 2I9TB 4D9QE 5DD6B 3OBAA 3SOBH 1RZ7L 3HCVA 4YHMH 2AV1A 2NY3C 1DUYB 5HY9A 1EFXB 2Y23A 5DJAB 1NC4D 3T8XA 5FHAH 1S7XB 5I74B 2FJFB 3MJ6A 4YHOL 5KS9E 1CYGA 2YN3A 3MO1A 2OZ4H 4JFDA 4LHJB 4P46D 3QUYA 5BO1L 5CS7A 2KKQA 2X4OA 1G6RL 5KSAA 1Y6MR 2PW1B 3I6GB 1G9NL 1XF1A 4F15B 1MJJA 4RAHA 4WO4C 1OPGH 5KVGL 5ITFB 3NFSL 5FECA 1E6OL 3Q3GA 3VFWB 1XGPA 3C2AL 2FJHA 3ARDD 4XBGA 4I48B 1LO2L 1R5WA 3ILPB 5J3HD 4OQ1A 2OI9B 4HWBA 3ARQA 1A9EA 2XNAA 1J0HA 3VXUE 4M5ZH 5EU6E 1R24B 5T5NG 4UBDD 1FRGL 2VXQH 3CSBA 2DDQH 1GZQB 2P1YA 5FV1L 3HAEG 2E6QA 2E8YA 5GSVA 3L7EA 3LQZB 1MLCA 3EZJB 1N5YH 1I7TA 4YHKH 4PG9A 6FABH 3B2VL 4M1CC 3OKLB 1Q0YH 3VFTA 1EFXD 1TVDA 4YHIA 4M7LT 4ZMAT 3MRLB 4LARL 5I73B 4TPRL 3L5XH 1RULH 3D25A 5EIQA 5D6DC 1BBJA 2VXUH 3VD3A 4LVOC 2CJUH 1JIBA 4Z7NE 5I18H 4TVPE 1P1ZA 1CL7H 1AQDB 1JWMB 2J5LB 5B38A 4UDUA 4ZOCA 1J5OH 5D2NC 1TIUA 1JZ7A 4OCSL 2C1PB 1BVKB 2ZSWA 4XPBH 5FO9A 1I1YB 1U3HC 4U1HB 5J11C 3N85H 1FL6A 2HLFC 4U1IA 2DQEH 4JHWL 2CMRH 4P4RB 1I1FB 3P77A 1KULA 4FQIH 1QFPA 1EH9A 4E42A 5HHXL 2VABA 3G5XB 3EHBD 4DN4H 1IAOA 3CCHB 4L1DA 5IT2L 4UZGA 3BPCB 2A9MH 2VMFA 1HOCB 1BIIA 1T89C 1EVTC 3W9EA 1FAKT 1U8HA 1EEZB 3PDOA 3QUZA 2C4FT 5DJCA 1NLDL 4ELME 2P5WA 5B4MC 1Z5LB 1VEMA 5AG8A 4LCWE 3FMGH 1IEHA 4YIQB 3WO3B 1ZS8B 4K3DL 3BQUC 4M00A 1SEQL 2BNUB 4HX1A 3JZ7A 5DVKA 3DO7B 5AZ2H 1JZ2A 4FFYH 3QG7L 4I18A 2Q87A 5ISZE 2VQTA 1DQLH 4XVSL 5HYFA 1UCBL 1T7VA 2BRRL 1KCSL 3MGAA 43CAB 1OAKH 3K1DA 2J6EH 4P2CG 4ENED 4B7IA 5K9OA 3TNNA 3CX5J 2P8MA 4LGPB 4WU5A 3BJLA 1XF5B 35C8L 3I6KA 1TZIB 3OX8A 2OMNA 4Y5VC 3IKCA 4R3SB 2JJUA 3QDME 3O6ML 5E00B 2EDHA 3GMMA 1T1ZA 3FCTA 1KJVA 2YR3A 4E0RA 3O3EB 1V7ML 3BP4B 1WAAF 1UQSB 3MGTA 5JHDA 2Q1EA 5F7UA 3EOTH 1GPOL 3Q1SL 3IDIA 1QLFB 1FG2A 1NGPL 1NGQH 4EQ2A 3MNZA 4I77L 4UT6H 5J0BA 1KLUB 2QQNL 2NXYB 4QY8B 3HE7C 5DJ0B 5FYJD 5C09A 2Q86B 5MEOA 1LO0H 3PNWB 5KVFL 4H88L 1ZVYA 1KPRB 2XG5A 5ACZB 2MQCA 5E24E 2XKNB 5FDYA 4JQVA 4Z8FL 2EDLA 1NC2A 1CCZA 4Z76A 4RGOH 5DEZA 3NZ8B 2YPVH 5EA0L 3BPLC 2PETA 4GKSB 1I8IB 3IKKA 2PCPA 1A6VL 4FFVD 4PJBA 3AREC 2ARJQ 3TBTA 1I1AD 4DKEH 2IAND 1EGJH 3HC4L 5I76A 1MFNA 2DWDA 4Y16C 3A0OA 5DMKA 2HMID 2UV3A 4KGLA 1P4IL 5IHUH 2R2BB 1IGTA 3CDGB 2AXFB 3IU4H 1KJ2B 3CLEL 2GT9A 4JM2B 3D0LA 4LQ1A 2CDGB 4ERSH 2EKJA 1N6VA 1K6QH 3STZA 4PRPB 2CR3A 3RPIA 1K5NA 1DN0A 2XZQH 3SDCB 2X40A 2ZPKL 1OSPL 4DW2H 3NOIA 4JANA 2BMKB 4JVUA 5JIPA 1INEL 1OSZB 5E2WH 2HLAB 1GC1C 3MRMA 1ND0A 2Q8BH 3HMWH 2DTMH 2O5XL 4U05A 4Z7WE 1C7TA 1A6WH 5ID0B 2Z35A 4J3SA 2NXYD 3VXPA 5GJTH 4KI5E 5ICXA 2ICEB 4G42A 4G7VH 2VZUA 3MA9H 5FYLD 3LKNB 2ATPA 4GLRH 4L9DA 5H94A 2CK0H 2YMXH 2AAVA 1WIPA 5JA9A 1Q9WB 4MA8H 1N8ZA 3GUTB 5DC9B 3Q6GL 1LO3H 1X6LA 3PG2A 1EHAA 1OF2A 1CTOA 3DGCR 3PWVA 1Q72L 5D71H 1AO7B 3HI6L 2HG5A 1QQDA 5ESVB 3QJHA 5B21A 5FUOH 1LK2B 1YQVL 2HVJA 1G7PB 4GG8B 3RTQB 4DEPC 5CP7A 3R06A 1EO5A 2OL3A 1B90A 4OAWB 5HDLA 5DVOA 1MCPH 4MSWB 2CRYA 4X8XA 1U8KB 3SDDD 2EXWC 4ONGH 1WWWX 3GK8L 2A6KB 3DMMD 4WEBH 4PJDE 1BFOB 4W6YB 4N0UB 4R2GD 4XHJD 1UWXH 3ES6A 1T04B 3VA2C 4Y4HD 5FGSA 4YDVB 3GGWA 5I1HL 5JIIA 1DVFA 3PGCA 3S34L 1DLFH 1R5VB 5B8CA 1YYLL 3DBXA 3REVB 3TBYB 4S1SL 3KPQA 3MJ9A 5IVZB 1JHKH 1C16A 2EIZA 4FG6D 4HKXB 3LS5L 3MV8A 4ISVB 3CVIH 2DLFH 2M1KA 2E9BA 3GJFA 4PJ9B 4EUPB 1HH6B 5GRUL 5D1XA 4KV5E 5IK3B 3SKMB 5F7DA 1QA9B 2FHCA 1RMFH 1S3KL 3RIFK 4UTBH 4D3CH 2HJLB 4PJHA 4Q9RH 3V6OC 5J13B 2D2OA 3VGFA 4LCIL 2F58L 3GMNB 1AO7D 1ZT7B 5FK9B 1NGYB 1DUZA 4TQEL 4Y8AA 3T65B 3P4OA 4ZO8A 3WLWD 2JELH 5E7FA 3QO0A 5EWIH 3W0WA 4YXHH 4D0BA 2FATL 5DRWA 1IC4L 1J0YA 1MAJA 4PJ8B 1SJXA 5D9SB 5F21B 2E7BA 5A43C 2YOCA 1CXKA 1ZGLM 2VAAA 1KGCE 4RGMB 1SQ2N 4HPOL 4WFHE 1JPGA 4M6ML 4HWUA 2BNRB 4HD9A 3VGGA 1S5HB 4MS8C 1DFBH 2BNQA 4M61A 1AP2A 1R5IB 2NX5A 3BZ4A 5D2LB 1NCAH 2GITB 3IJSA 1S9WA 1J1PH 1U9KA 2UVEA 5DEGA 5FCSH 1JFQH 4XPFH 1S7RA 5FOBA 2CLVA 2XKUA 4JHBA 3H6JA 3D39A 1Y6KR 3LS4H 4OZIB 4K71B 4G6JL 4RMTA 3K74B 2AEPL 4FQPA 3IJHB 4LPXA 4DGIH 2BCKB 4GS7B 3DX9B 1LEGA 4ZDHA 4FQXC 3TO2A 5IHZB 1WUNT 1D5MB 3KPSB 1QRNB 4P9HL 1B4JL 3CU7A 1K9TA 3RKDD 1MFBL 4KKBC 3L3IB 5TE7L 1FZOA 3FHAA 3UJJL 1ZEAH 5JHLH 1FHGA 1I3RB 3L7FB 5KAQF 2GTZA 3C2SA 3ARGC 3TT1H 4EUPG 4GAGH 5H37G 4NRYA 2OK0L 1IGCH 1IMHC 1ETZB 1NDGB 4KHXL 4OZHB 4L3EB 1NMAL 1JWSB 4PJIF 5IR1B 3PXJA 1CICB 3ULSB 3QA3A 3WD5L 2XZCL 5C8JB 1JHLH 2BNRD 4HJGB 4AENA 3FONA 3RFZC 5D8JH 3RL2A 1CLZH 3ILQC 5IQ7L 3LVEA 1BD2A 5KSUA 4OZGA 1X5LA 1ORSB 1U8JA 3W5NA 2WQ8A 1FV1B 3ZDXF 4JKMA 4LLDB 2A6IA 4UT9H 1X9QA 2NW3B 4XXCA 1KLGA 2AP2A 3CXDL 1ES0A 2Q3AA 1WZMA 3ZL4L 4LNRA 3I85A 1EAPA 4XNQB 4NJAH 1FNGB 4WUUA 4EN3A 3LKOA 4ODWB 1JNHA 3S88L 2RB8A 3TVMC 2WIIA 5ESQA 1JYWA 3CVHH 2BJMH 1UVQB 4YX2L 4P5MB 1J8HA 1MCWW 1QRND 3ARBA 3KPSD 4BQ8A 2V5TA 4NQUA 3TBSB 1RJZB 1RZFL 5EU6B 1NFDF 1MRDH 4PGJA 2YBRB 2ARJA 4YHPA 4AEHH 3RA7H 1S9KC 1JF5A 4JHAL 2JCCE 1A3LL 3QHZL 2VKXA 5BV7H 5I1DB 5MEPA 1JZ8A 4TULH 1BBDL 3NH7H 2ICCA 2ZSVA 5E8PA 3UC0L 1ADQA 4D9QD 5GGTL 1CICD 5DQJB 4YAQA 1VERA 3QQ9D 4XBEH 3X11A 1CG9A 1UM6H 1RZKC 3FQRB 5FUZH 2W9DH 2BVTA 4J1UB 2R1WA 4F9PA 2VXQL 3NFPB 5JXAH 4J8RB 2ADFL 1BX2B 1CI5A 5FDWA 2UY7A 2CKBA 5DFVC 1I3VA 1AD9A 1RHHA 2MCPL 3BE1L 1F5WA 1N5YL 4JO4L 3RVTD 4J6RL 3GKZA 4BUHA 3HNSH 2GSGA 1UXWA 3VG9C 1II4E 1OAYH 1OHQA 1TVBA 3T4YA 4FXGA 2WV3A 3CFBB 1A3QA 1RVFH 4WI8A 4JLRB 4LRNL 2D3VA 4NZUL 4PTUB 2A77H 3T1FB 5HI5D 3FFCA 3V7MA 4M8QA 2VDPH 1DBKH 5F72S 4YEFA 2B2XH 1C08A 3RDTC 1CGWA 3KYAA 1YEGH 5ALBH 1BWMA 2IG2H 5EU6D 4GRMB 5L0QB 5EU4A 4NHUA 3FZUD 2ZCKL 4CVUA 1FYHB 4JQXC 3ZLQC 3L1OH 4M62L 4KJYA 1N64L 4YE4H 3KJ6H 5EBWA 3RRQA 3U2SA 3K8LA 3UTTA 5J57B 1Y18B 1B6DA 1PEWA 4ZFOA 1HSBA 5LG1A 2V2XB 3LV3A 3SJVA 4DZBB 4EVNB 1KEGH 1Z6JT 5EIVA 5JORB 1QYGL 3QIUB 2VDQL 1C1EH 4L8BA 5A2IH 1RHFA 3PV6B 3RPKA 1J05A 1CLOL 1DANT 1Z9SA 3OKEA 4HLZH 1KCLA 1OGAE 5DD3H 2DM7A 4M93B 1UADC 1CDYA 5B22A 1K8IB 2HRLA 3UJTH 4TVPD 25C8L 1FFOB 5JOPD 2DLIA 2J88H 3V6FA 3AY4A 3FMGL 4DCQB 1YPZA 1E4XH 5JW5A 2IC2A 4A2MA 1HZHH 1K8DA 2C26A 2UWEB 4POZC 2JIXA 5C2BH 5ACMA 3OAUL 3QRGL 4S2SB 1XF2A 3BMWA 2NTFA 3UPRA 4DWHA 5EZJA 4LSQH 1XCTA 2YUVA 1QBBA 3DTXA 4Y4FB 1UM5L 5CAYB 4WV1C 2Z91B 4YJZL 4ZFFB 2EC8A 5F7YC 4JFHE 1RZKL 3QZWB 5GZOD 3ARFB 3JWDH 4GW5A 4KK9D 4OF7A 4OZ4B 3WHXB 5BRZE 2G75A 4BZ2L 4PJFF 2AJ3A 3G6DH 5CCKH 3P0YH 1NAMB 5F93C 5TE6H 4PS4L 5F7MC 4CADA 5GHWH 1RZIA 1FO0L 4K7PX 1W0WB 1FVEB 4QTIH 5DGRA 2ZUXA 3VCLA 3SGKC 4ODSH 1UA6L 4WI6A 5E5UB 2X44D 3QDJA 4H5SA 3DO3A 3GSNB 1KT2A 2AV7A 1WSST 5DUPL 3X14B 5ISZD 1YY8B 4Z7QE 3VMOA 4D94A 5AZEL 5CGTA 3HC3H 2AGJH 3IFOB 3U9PL 2ENSA 3S3JA 3T09A 1BQLH 4ZAKC 4ETYA 1B0GA 4G6FD 4IRJB 4LPCA 4OGZA 4HC1L 2EE6A 3T0DA 3Q6FA 3O6FB 3O3UN 1F4HA 5DJ2A 1BFTA 3QDMD 2XQBL 4KQ3H 4IOFC 2JF1A 4HFWA 4Y4FD 2W0FA 3BD5A 4JG1L 4D9RD 1T0PB 2D7OA 4PJHE 3ARFD 1ZLUK 2BRQA 3DSFL 3AVEA 3V0VA 4NC1C 3VRLE 1X5YA 3D85B 3DX7A 3ISWA 4KUCD 3MACL 3U36B 3P9MA 4ERSL 4A2LA 4GAYA 3HPJB 1BJ1H 3EFDH 4JN1H 4TNVF 3T2NL 1J9CT 3VWKC 1S5IH 4UU9A 4S10A 4IRSB 3UAJC 2YK1H 2GTWB 2I9LA 2X7LA 2YPLA 3QZWG 5JUEL 3L5IA 2P45B 1FJ1A 3V0WH 2NY0C 5JW4N 1FFPB 3EYSL 1JGVH 3KPNB 3ULUE 5DWUL 4YH6A 2BNQE 1HYSC 5HVHC 4Z7UE 4GO6B 1JGDA 4LDEB 1NCBH 4M5YH 2EH8H 1NGXA 3QEHA 4MA8L 1HHKA 5TH2B 3MRCB 1M71B 4KQ4H 5EN2A 1SJVA 1W72B 1IAIL 2DQFB 3WFEH 3IDYB 3D39E 3Q5TA 3ZMRA 3CDCA 2LU7A 4QLRA 1IAMA 3FOLA 3VDCA 2PYFA 2EDFA 3SPVA 1I8KB 1G9ML 5BOZG 1PYWA 1YDPB 2HTLC 2DQIL 4PJDB 1PVHA 4XNUH 5D7LA 4R0LA 1WCBA 2J4WH 2IAMC 5JPMA 3VXMB 3D85D 3ZE2E 3U82B 4QRPA 2W07A 1T20B 1VFUA 3L3DB 4KI5D 3FRPG 5HDQL 1LO4L 2NYYD 3KLAB 5GGQL 2AJXL 3GHBH 4HUVB 4AEIL 4M7LH 3X12A 3BH9A 1DL7H 4FTVB 2FNBA 5CP3A 4XVJH 1I4FA 3CFIC 1OGTA 2WP3O 1GAFL 4RGNE 3HCVB 4JO3H 2AV1B 5CHNA 5GGUA 4JVPA 3P3YA 2D4FA 5HY9B 3F7YA 4FHBD 1F3JA 4RFOH 3T8XB 4ZUWA 4X6CA 5BS0A 3GI8H 3MJ7A 5T1DH 4MVBC 1AXIB 1I3GH 3MO1B 3QPXL 3THML 1ZLVK 3E8UH 4JFDB 3QUYB 2X4OB 5KSAB 1Y6NR 2PO6C 2DQUL 2VZ1A 1N7MH 3WNKA 1MJJB 4PLJD 4R4FH 5DRXA 1FGVH 4OGYH 5FECB 4LSDA 3Q3GB 4MCZA 4LVEA 3OR7A 1Z3GH 1A6PA 4FQ1L 1MRCH 4PJCA 2ICWA 4G5ZH 1EVUA 2PXYA 1H5BC 2FJHB 4XBGB 5IW6A 1K3ZA 4I5BA 2VDNL 1JPST 4MXWH 3VWJC 1R5WB 1JPTL 3VXMD 4Z95L 1J8HE 2FLRT 4AL8L 2NQCA 4MNQA 1JGEA 1A9EB 2A9NL 2XNAB 3LPWA 4NWUH 4W6XB 2B0SL 2ZUQB 2OSLA 4WI7A 1TCMA 4QXTA 1NCUA 3LKQA 5GGRY 3MRPA 3LMJH 5F6HJ 3B5GA 5F6IB 5EUOE 3L7EB 1TCRA 5ICZA 1MLCB 5CSGA 2QADC 2JK5A 2ATKA 1I7TB 4GXUM 4OLZL 4TNWK 4PG9B 1DQMH 5F3HA 2NXZD 3VFTB 1T66D 4YHIB 4PUBL 3UYOD 4RMRA 1UJ3A 2BXZA 3PF2A 1CQKA 1JFQL 2EE3A 1BF2A 1E6JL 1NKRA 1L7TH 1BBJB 5L2KA 5KSAD 2Z31A 1P1ZB 2C3GA 4N0FA 1OAXL 3TBWA 3VGDA 4TRPL 2DKSA 5B38B 4UDUB 2IGFL 2Z8WC 1WAAA 5IBLD 1H9VA 1JUFA 2WANA 4X98B 3SGDI 3K2MC 3FFCE 4N9OB 1EV2E 1FPTL 1WF5A 2ZSWB 1EHXA 5FO9B 5D6CA 3EYVA 3QUMH 1AFVH 4WFHD 4HBQA 1FL6B 3H42L 4U1IB 5HVWA 4YXLH 2Y5TA 3HZVA 5I19H 2R39A 1IGML 3KLSA 3P77B 5AYUH 4E42B 3RUGE 2VABB 1KENL 4NKOA 4PJEE 3EUUA 4GBXD 1V3KA 1CZ8H 5BJTA 3HC0A 5FAAA 3JVGC 5F97E 1IAOB 1TJIL 5D70L 5HHMB 3WDJA 3HE6D 2YWZA 4MHHI 5IW1A 3UTTE 1JJUA 3H3BC 4GQ9L 1BIIB 3WEXA 5DHYA 3B9KA 3W11C 2IBZX 3W9EB 1CLZL 1U8HB 3EYOA 3PDOB 3QUZB 5DJCB 2P5WB 3N0PB 5GIRA 4LIQE 1AR1C 3WJLA 3SE3C 4EI5C 2WBKA 5BZDA 3KPRA 2R1XA 1VB9A 2ZKHH 5CJOL 4YO0A 5E99L 4L3AA 4KRMB 3MOBH 5F1KC 4HX1B 3MRKA 4KKCC 3BSZH 4K94C 4Z18A 1R3KA 2J8HA 4I18B 1BREA 3QYCA 1IBGH 1VFMA 1BLNA 1YPZE 3BH8A 3IFNH 4XPHH 3B43A 2VO5A 5E08H 3TNNB 2P8MB 1B2WH 4WU5B 5HDBF 4F8QA 3I6KB 3OX8B 4WW2C 3IKCB 4XAWL 4ODXB 1ZK9A 3DI2B 3U4AA 3WFBH 1HK6A 4PLKD 3QEGL 1MCKA 1MFAL 1PGRB 3GMMB 1T1ZB 1KJVB 3FCTB 4P9ML 3T3MF 3MLZL 3HN3A 5B38G 4E0RB 1EHLH 5HHMD 2V9QA 1CS6A 1GC1H 5JHDB 3MGTB 4G80A 2XN9E 2XTJE 2CUIA 1P7QA 3BGFB 1FG2B 1FSKC 3TPKA 3MNZB 3L3OA 4UTAH 1MJUH 3P9LA 4OCLC 4NHCH 5F9WB 4NRXA 3D1MC 3QJFA 4LSVL 1KB9K 1CFBA 4LSTH 4CMMA 2IMNA 5SWQA 5C09B 5MEOB 3GRWL 3JTSA 1DBJL 4XTRD 4FZEL 5IBTH 5C7XL 5H8DA 2PTUA 1YJDH 4LLVA 2OYPA 5AAMA 5GS1A 4G6MH 1DEEA 3WXVH 1JL8A 2DI9A 1T7WA 1NC2B 4Z76B 5EU5A 3NA4A 5IIEA 1XZ0A 5I74C 1DBKL 5GSRB 3HI5H 5TJWK 5F8QC 1VKXA 4PG2C 2PCPB 4N90E 4PJBB 2VZTA 1TLKA 5I76B 2DWDB 4K9EH 1A02N 4HT1H 4MQXD 5TQ2L 1J10A 4F15C 1X5GA 4M4RA 4JAMA 5LGHH 5KVMC 1CD0A 5DMGC 4U1SA 1IGTB 1T5WA 5AD0A 3R4DA 2A0LC 3ME0A 5LJYH 2IQ9L 2GT9B 1FNHA 3D0LB 4NIKB 1NMCB 4NJ9H 3EYQD 3EO9H 1RJLA 4C4KT 1DQQA 3STZB 3RPIB 3IF1A 1K5NB 1IC7L 2NR6C 4O2CA 4OD3L 4XNZB 4NO0B 1FAIH 1XMWA 3E6FA 5C0RH 4JANB 4GKNA 4HS8H 2B39A 1M6OA 3MRMB 1A2YA 4CN6A 4ZS7H 5ADOH 4YQXL 2Z35B 1J1OH 4X6FA 1UYWL 3PABA 3VXPB 1GGUA 1M7XA 4OQTA 4G42B 5ICXB 2C7UA 1JGUH 1YEFH 4TSBL 3CLFL 3RWFA 5DD5L 2ATPB 1F6FB 2CK2A 1NANI 3GSXA 5H94B 2APXA 2HJFA 4FFZL 1KIRA 2YPLE 1J1XH 3JUZA 1NC2D 2J8OA 2R0ZH 1HZHL 5I73C 4EOWL 3INUH 4QXGL 3MBXL 3ZKSD 1OF2B 5JLZA 3SDYH 3O6KH 2DBLL 2YD1A 4Y1AE 2FGWL 3PWVB 4NKMA 5I6XB 5EH1A 2HG5B 1QQDB 3QJHB 1UKQA 2J5LC 4GOSA 1CK0L 5CP7B 3R06B 32C2A 3X13A 1U8QA 2OL3B 5L2JB 2W9EL 1OGAD 2RFXA 4M3JA 3MV11 2HT3C 4Z7VB 3WKNA 3S96A 1O7VA 5FKPA 1JMXA 5CCKL 5TE6L 2ICWJ 5CEZD 2FZ3A 1S7QB 4HQQH 4KXZI 4MZ2A 5D7LE 3ES6B 4J3OC 4NUJA 2NZ9D 4L8SA 3GGWB 3ECBA 1JI1A 4JY6A 3AXLA 4M9OA 1DVFB 3PGCB 2F54E 5E9DE 1HDMA 5CGYC 5B8CB 1AQKL 3DBXB 4IBLT 4WENB 5ECJE 1YQ2A 3KPQB 3LEVH 4XWOD 3L9RA 2CLRB 4K8RD 1C16B 2EIZB 2PKDA 4OLXL 2FYYA 3MROA 4LMQE 1JNLH 1X5ZA 1F90L 2EZ0D 3MV8B 3WO4B 2ZUYA 1UEMA 2AJSH 3GJFB 1JE6A 3WNNA 5D1XB 4PRHA 1BQLL 2XQYG 5F7DB 3JV6A 3O3AA 3L95A 4NQCA 4XCNA 3RBSA 1URLA 4J3XA 2LAAA 2P44B 4JFEA 4YHZL 5C2UB 4G6AC 4PJHB 1K3IA 4HUNB 3BI9X 4X6CE 5BRZD 1QFWL 1M05B 4JPKH 1DUZB 3ZSTA 3AS1A 5GISH 5F1SA 3QEQE 5MEQA 3PDDA 5C0BE 3LHPL 3QO0B 4ZO7A 3W0WB 3U7AA 1S7SA 4JY5L 2VLME 4HUUA 4D0BB 4FFVC 2JJSC 4CMHC 5T5NF 5IJKA 4S1RH 2R9HC 5L6YL 3E6HA 4PJCE 5TF0A 3QNXA 4X0KA 2VAAB 1QSEA 2W59A 1JPGB 3K4ZA 3KXFA 2FEDC 3N1GC 2BNQB 1P9MC 1AP2B 4M61B 1DTUA 3LKPA 4K3EH 4L4VA 5BZWA 2OTUA 2NX5B 1OAZL 1QPXA 3BZ4B 4TVPH 5K9QI 3IJSB 1S9WB 5FV2A 4KKNA 1QUNA 5DEGB 1RUPH 4PP1C 5CLTA 3V0WL 1S7RB 3B9VA 2CLVB 1U58A 4WHYH 4XZUA 5FOBB 3RWJB 3D39B 5GS0D 5D1XD 1HE7A 4PGEA 1XGTA 4XCEA 5F7LB 5DGQA 3T4AA 3FN0H 5JXED 4BK4A 1LEGB 1K4DA 4KY1L 4ZDHB 3TO2B 2Q6WA 4M7JH 1IEBA 1BPVA 4Y19A 3AS2A 1SJHA 1U6AH 5CGMA 1BEYL 3SCMD 1FZOB 3CDYA 3U0TA 4RBPK 1BJ8A 4EIGB 3D0VA 4CRPA 2GTZB 2X4PA 1KPUA 3PWJA 1IM9A 4NRYB 4XP1H 5CKAA 3M8OH 3NCFB 2BVOA 1CGYA 4KROB 3F7RA 4NN7B 3U48A 1EJOL 2VWEE 3Q0HA 3QA3B 2UZIL 3PP4L 4JM2C 1OTUD 3A6BH 5JW3L 1D5ZA 2ZNWA 4AENB 3FONB 2BNQD 2MMXA 4HS3A 3BZDA 1BD2B 3P30H 3SDCC 5KSUB 4OZGB 1U8JB 4MA3A 4IJ3B 3LQMA 2A6IB 1J86A 1B6UA 1KLGB 3OKMA 2EDOA 5FYJL 3D39D 3RZCA 1ES0B 1X4XA 2AJUH 4LNRB 1EAPB 4MCYA 2R2HA 2R4RL 4WUUB 3I6LE 2OZ4A 1QNZL 4EN3B 3TIEA 3LKOB 1JNHB 3AUVA 1I3GL 3O2DL 2X1OA 4KU1A 5ESQB 4HUWA 3O8XA 4Q9BA 1J8HB 2V17L 3ARBB 4Q9CA 3PQYA 1IGIH 4M8VA 3QI9A 4U1NA 1JZ3A 3QT2A 4K7FA 4X7TA 4YHPB 2ARJB 4JGMA 4U6VL 4KJWC 1PZ5A 1J0ZA 2QKIA 2H2PD 5MEPB 3FAXA 1NCDL 2NY6C 4KROD 5E8PB 2DL9A 4G8GE 1CXIA 3RTQC 3NCJH 1WWAX 2R0KL 4YAQB 3X11B 5CD3A 1CG9B 4RGND 3U0PA 2R1WB 4LSSH 1EEUA 5FDWB 2H6PA 2CKBB 3ZKMC 3BDBA 2AQ3A 1AD9B 1RHHB 5FHBH 2HRPH 3SKNA 1HILA 1AGDA 1OLLA 1TPXB 5GRYA 4ZS6D 5T33H 1VFAA 3ULVC 3VDBA 1L0YA 1UXWB 1DQML 4OM1H 1TVBB 1LP9F 4FXGB 3T4YB 1BQSA 3MRIA 4WI2A 3NBNA 5FYLL 1U42A 4NKIL 1N59B 1KCUH 3GNMH 4AG4L 3FFCB 1X4YA 1H3VA 2CXGA 3UDWC 4M8QB 3BPNB 4NZTL 2YD7A 4MDJA 4F58L 1J8HD 4PJ9C 5ID1A 1C08B 2Z9TA 4FQJH 4NYLA 1CXLA 4CN1A 1JHTA 5EU4B 5L88H 4NHUB 4KMQA 3L6FA 1WEJH 2F5AH 5J13C 1CL7I 3RVUC 3MNWA 3N50A 4KJYB 3DXAE 5EBWB 3V6BR 3U2SB 1PZUB 4IHOA 2UUDK 1REIA 1KJ2L 1O7SA 1J88A 4ZFOB 5I19L 2V5YA 1HSBB 3V4PL 2X1WL 3LV3B 3SJVB 4G8FA 1BOGA 5AYUL 2SEBA 4UV7L 5L8JB 2AS5M 4QWWD 2OR7A 3STLA 2DLHA 5EOCJ 1X5IA 4HMDA 4L8BB 1A1OA 4PJ8C 5JW4Q 4MJIA 3OPZL 3QXUA 1V3MA 4WHTA 1AGBA 1J05B 3OKEB 5E8OA 1A5FL 1ACYH 3BZEA 4RGMC 3OJDA 1BAFL 1P6FA 5D7JA 3T3PE 3WLBA 2VITA 1PG7X 5C08E 1INDL 3V6FB 1I7ZA 5D1ZD 1YPZB 4PGDA 2QV2A 3FFCD 4HXAH 2AJVH 4XNYH 5T3ZD 5JW5B 1HIMH 1K8DB 1P5UA 2JIXB 1OY3B 2CUHA 3WV0A 2P5EE 5FYJU 1XF2B 4K23H 2NTFB 4K71C 4O5LH 3UPRB 4AMKL 3LEYL 5T1MA 5F70A 4FZ8H 2ADJA 2A83A 5EZJB 2ITDA 4HDIA 2J6EA 1XCTB 5DXWA 1KEML 3CD4A 1KC5H 2DQHL 4ODHH 2VIRA 3DTXB 3EO0A 5C70A 5DUBA 4TUOA 3BDXA 3UTTD 2XTJB 4OI9A 4GW5B 4ZTOH 5I71C 1FIGL 2G75B 2AJ3B 5DTFA 4OLWL 3D9AH 4MAYA 3CGTA 4CADB 3H3PL 4U0QB 4MJ6A 4W4OC 1RZIB 1BWWA 5EC1B 3VCLB 1WWCA 1BZ9A 4UIKL 1QSZA 4X4ZA 4AJ0A 5GPRA 1NL0H 3CFKA 3EYFA 3QDJB 4JM2F 1HNFA 4H5SB 3MBEA 3VI4F 2C4FU 1KT2B 4UTAL 5JA8B 2AV7B 3K0WA 4P2YA 3MXVH 4L4JA 1MCOL 2VH5L 1PBYA 3WE6A 3EFFA 1VPOL 1ONQA 2OX5A 4YDIL 5BCAA 1HXMA 4DAGL 2XQYK 3DV6A 1B0GB 5DJXA 5HHVL 4HG4K 1WGOA 5GGRB 4EXPX 3WXVL 4XH2A 3Q6FB 5DJ2B 1M1SA 3QIWC 3QIBC 4GW1A 5DC4B 2W0PA 4DK6A 2NY2B 4HFWB 1I1CA 2W0FB 4NQCE 1CBVL 1MJ7H 4JFEE 1SMOA 4NQDA 5CINH 4JDTL 2XTJD 4PD4K 1D6VH 3SDAC 4XP9H 4WVRA 3O9WB 3V0VB 3I2CL 4X5WA 3ZE1F 1QLRA 3DX7B 1I3UA 1B9ZA 4YDKL 4Q9QL 4U2ZA 4YWGL 4RA3A 2J3SA 4C56A 4GAYB 4JFZL 1U8OA 4UDTA 1MFEL 1JTOA 4O2EA 3VFOA 4E9LA 1Y0LA 2LVEA 4UU9B 2IFFL 5TDOA 1G84A 4XPAH 4RMVA 3QDJD 2FBOJ 2I9LB 2X7LB 4GXVH 4PBVC 1XH3B 2YPLB 1MAMH 2ED7A 4R7DB 2E7HA 1FJ1B 5E2TL 4QXWA 5TF1L 4X7SH 1ZT1A 4PV8A 4OD2A 3KXFE 5FIEA 4N90D 1IQWH 5ILTH 1QBMH 3QSKB 3HUJF 3UXFA 4XAKE 1JGDB 4JN2A 1NGXB 3QEHB 3KJ4B 2VDRL 4GLRI 5EN2B 4NGHH 3TESA 2ESVA 1UZ8A 4Y4KA 1LD9A 2W1NA 2NY2D 5SWSE 2QSCL 3L3HA 3VI3E 3FOLB 4PRNA 2PYFB 3SPVB 4U6XA 4OI7A 1PYWB 3BD3A 4LK4A 5GGVL 3GJFK 4POUB 4KAQL 2GK2A 4XX1E 5D7LB 4LU5H 1JRHL 1WCBB 5JPMB 4Y19E 1OTSC 4XP4H 5SV4A 4PGZA 4QRPB 3QFJA 3KPMA 4F8TA 5K93A 2XRAH 4LPVA 1J0IA 2R15A 5C9KA 2XKSA 5MENA 3X12B 3BH9B 3TC9A 2J8UE 3T0EA 4ORGB 2YPLD 3QIUC 4X83A 3C60D 4GH7B 3GO1H 2CGRL 2WK2A 4JJ5A 1I4FB 1OGTB 3R0NA 5CHNB 2WZPD 5GGUB 4M93C 1EK3A 3F7YB 4Y2DB 4Y1AD 1F3JB 1OAUH 3ABZA 4ZUWB 3MCLH 5BS0B 2XZZA 3MJ7B 3TYFA 4MJ5A 4XXDA 4X99A 4IMLA 1UENA 3F6IA 5ADPH 2WUBL 1JV5A 1PX3A 3MLSL 2X2YA 5HHPB 3TO4A 3BEWA 2VSDA 5DRXB 1RFDH 1ZGLP 5CILH 3BW9A 4F33A 4MCZB 3OR7B 1DBAL 4OZIF 4PJCB 2ICWB 4PJ7A 3HG1A 2PXYB 1N26A 2WWKT 5IW6B 4I5BB 5D7LD 2MKLC 4QHNB 4JRXA 3H9HA 3TA3A 2UZXB 3TV3L 3PQYE 4CVZA 4MNQB 2F54D 1FNEA 1RIHH 4ZSOE 1GH7A 3O4LA 2P4AB 4AH2A 4ZNCD 2ZNXA 2OTWB 3ARVA 4RFEA 2YXMA 3ARFC 2OSLB 4QXTB 3LKQB 3MRPB 4WGWB 1AKJA 4ZUTA 4NWTH 1TCRB 5ICZB 3MTRA 1UZ6E 2JK5B 2ATKB 1S78C 4PJXE 3SBWC 2UYLA 3QDGB 1ZVSA 1G7LA 4OZHF 5T5FH 4PRDA 3VMPA 2VOTA 4QTHA 4X7CC 5F3HB 4F9LA 2VSCA 2ZJSH 1YEJL 3OAYK 4ETQB 3V52H 5SX5H 4K94H 3DUUA 1EMTL 4JKWA 4K7PL 3N9GL 1F4XL 5C0BD 4KWUA 4O4YL 3FRUA 1MPAH 3O0RH 4PTTA 5GZND 5L2KB 4KHTL 3FB7A 2Z31B 4N0FB 5KS9F 3TBWB 4LCCC 3ZYOA 2GHWB 5IVXA 4IRJC 1JUFB 3MRNA 1Q38A 3O6FC 4EZMA 3JV4A 2PXYD 5D6CB 3EYVB 4DVBA 2W92A 2Y5TB 3HZVB 4BFGA 4HPYH 1FG9C 3LH2H 3MLUL 5IGXH 2DJSA 3B9AA 4QCIA 4NKOB 1FZMA 1HXYA 1U91A 4TTGA 3HC0B 4PY8I 2Q76A 1KTKE 4WWKD 3QDHA 3U0WH 4JEGB 4KPHH 3P0VH 5IW1B 1CTNA 4CUCA 4LGRB 3U4EA 3WUZA 3WEXB 3B9KB 5ETUA 2AABH 5CIPH 1IC5H 1NUNB 4AIOA 3SQBA 3EYOB 4NO2A 5C0AA 3UROR 4U6HA 5GIRB 4K8RH 5ABDE 3MLVL 4GMTH 4IRSC 1YZZA 4OGAC 4MJIE 5T3XL 1QOKA 1CR9L 2MPAL 2KUTA 3KPRB 2R1XB 4HXBH 5BZDB 3RWIA 5F7FA 4YO0B 3QRFM 5E8DL 4XWGH 4LVNB 3WSQH 5HYQA 4QGYA 1R3KB 3TPUA 3CVHA 2CSPA 1BLNB 2IPKA 4XC3L 4WFED 2YKLH 5IB1A 5LXGH 1MH5A 1EHNA 4Z7NF 2IWGA 3BH8B 5HYSB 3TJHD 2BVYA 4M1DH 4XGZA 3IDYC 4P2OD 5LCVH 5E8EA 3NCYS 4NT6A 4OM0L 4ODUA 3MOAH 3DECA 3SKJL 4HIEA 5J7CC 1GGBL 4DFIA 3IDGB 3EYUL 1NAML 1BFVL 1SYSA 4RA0C 3WFZA 4G80B 1A14L 4YZFE 1JF1A 3B9KD 1CFVL 1DSFH 1P7QB 5KZCD 3BKCL 1HI6B 2VQUA 3L3OB 3LD8B 3P9LB 3GSNL 3ZTNH 2O5YL 3QJFB 1AC0A 1FVDA 3QWOA 3KPRD 4HIIB 1CE1L 4CMMB 5SWQB 1T83A 3GSVA 3JTSB 4BH8A 4Q97A 3B2UD 5GS0H 4LLVB 1MREH 3QHTC 4FS0A 1BFSA 3WFCL 5GS1B 2KH2B 1T66C 4IDJL 1DEEB 2B1AH 3QEUB 5EU5B 3UTSA 3RVVD 5IIEB 2XA8H 1XZ0B 4XHQA 5E70A 4K2UL 4NCDA 4XPGL 1VKXB 3QUYC 4KTEH 2FGZA 2GJ6A 1I9RH 1T5XA 1NDMA 2NY5H 4JAMB 1OCWH 1UM4L 3KR3L 1BJMA 1MHPL 2UWEF 2F5AL 4YPGA 4U1SB 4KVNH 1T5WB 5AD0B 5D72H 3WFDL 5EZIL 5CZKA 3UTOA 5E56A 1A0QH 5EORH 4G3YH 1RJLB 3TZVA 5JZ7D 5JNYA 2FBJH 1D5IL 1DQQB 2NY7H 4NQDE 3GMLA 3IF1B 3MLXH 4Z0BH 3UP1A 2Y1VA 2B4CH 4O2CB 1P7QD 3ULUH 5IFJA 3E6FB 4Q74A 1K85A 3LB6C 3FQXA 1X6NA 4GKNB 2ZUWA 1M6OB 1U8LA 4U7SA 5LBSL 4HEPG 2ZUQC 1A2YB 5F7NC 3GIVA 1C5BH 1GOFA 5F44A 5IMLA 1F4YL 5SWZE 1ORQA 3T0AA 5F6IC 4X6FB 3PABB 4C56E 2C7UB 3DRTA 4KUCF 3QPQD 3GDBA 5C07A 5ENWA 3RWFB 2EDYA 4LEXH 1MVFA 5TE4L 2ZP0T 3GSXB 2HJFB 2M8XA 1KIRB 2JB5H 4P46A 2VLRE 3CMOH 4ZUSA 4M4PA 5FFLA 3WUWA 4DTGH 3K46A 1LE5A 1W72L 3GIZH 1E4XI 5JLZB 4HK0A 3TT3L 4O5LL 1KN2H 4NKMB 1TETH 3K2UL 5F7EL 4Q0XL 1QKZH 3ARRA 5I1GH 2YN5A 5CZVH 3MOQA 3X13B 32C2B 1U8QB 3P4MA 2X41A 1BP3B 2RFXB 1P84J 3ARUA 1NCTA 1NCCH 3S96B 3E3QE 5FKPB 5C0CA 5C08D 3MUY1 3MUGA 3H9SE 4K3JL 1GSMA 2FZ3B 4GT7A 3GJEA 4NUJB 5EU7C 2VLJE 4L8SB 4OJFL 3CC5A 4RNRA 4XRCA 3ECBB 2HT4D 4JY6B 1KCRH 1DANU 3AXLB 3PP3K 4OLYL 4J3WA 1KIPA 1HDMB 3H2WA 5DLML 1JNNL 1MEXH 1F4AA 1AY1H 4NN6C 2P5ED 1P4LA 3FO1A 4Z7WF 3L9RB 2ZUSA 4F7PA 2VC2L 3X3GL 3ESUF 2FYYB 3MROB 3QUZC 4RAUA 4G8IA 4DJMA 5KSBA 2ZUUA 1FLRH 5CD5C 1JI2A 4PRHB 3JV6B 3O3AB 3L95B 4KVCL 4JQIH 4XCNB 3IT8D 3TWCH 4JFEB 3W81A 4LSRL 4PIRF 3PL6D 1HNGA 4I18C 4ZFGL 1HHGA 4KTYA 5KW9L 3KWWA 2XIDA 4G6KH 4XMLH 5MEQB 1AGFA 3ZKND 1PKQA 4XB7A 1JP5A 3AU1A 1ADQH 1S7SB 4HUUB 4ODVL 5IF0A 1AGEA 4HWBL 4KK5D 3C5ZD 2QQLL 3E6HB 3GHEL 3QNXB 4PJ7E 3VFGL 4X0KB 3TIDA 3C6SA 1QSEB 4APQD 3G04A 3VJ6A 2WWMC 2WUCH 3GKWH 1LE9B 3OZ9H 5E6ID 1RZJC 3AROA 4PJDF 5IB2A 3KXFB 1NMBL 4GRLD 4AEEA 4WCYL 3LKPB 3VG0H 4L4VB 5BZWB 2OTUB 4XPTL 5F1IA 4ZD3H 3WIHH 1FNAA 2QHRL 4OCMC 4DKFH 4OLVL 5D4QA 4Y2OA 5F9WC 1U58B 4XZUB 3R1GH 3HB3D 1NBVH 3QO1A 4PRHD 5BVPL 4PGEB 4NQCD 1XGTB 4XCEB 1IQWL 2IADA 1ZHNA 4JFED 4NQVA 1CDUA 4WO4A 4OSUL 3T4AB 1IARB 3ZT5A 5HGBA 1GCFA 4KV5F 4MNHA 1K4DB 1IGFH 1FL3A 2Q6WB 1IEBB 4HFUL 4Y19B 5JOEA 4ONFH 2QQKH 1JPSL 1SJHB 3CSYA 5I1KH 3FFDA 4HWEL 5FCUL 3VW3H 3DUHA 3U0TB 3D0VB 1FNSH 4QOKE 3X3FH 2X4PB 3PWJB 1IM9B 5F9DC 3HFML 4BJLA 1CGTA 4MD0A 2BVOB 2VJXA 4JZNA 2V9TA 4X5XA 4HGWA 1E0OB 4LIQH 4LSUH 4ZXBC 4WRLA 2CDFA 1D5ZB 1NMCC 3KXFD 4ODTH 2NY1B 3PGDA 4HS3B 4NFCA 3ULVH 1QEWB 5F3BA 4XNZC 4XAKD 3ZKXB 1A7QH 3S5LA 3LPGA 5DJZA 1NLBH 2CRZA 4MA3B 3RP1A 1TITA 4OBSA 2D9CA 3OKMB 1G6VK 1MELA 3RZCB 5K9QG 2JLLA 1GGIH 5I1IL 4MCYB 5C0AE 2R2HB 3CFEA 1WLHA 1KYOK 5JMOC 1UCTA 3TIEB 3EGSA 1M7DA 1UH3A 5A2FA 4NFBA 4LPYA 2VL4A 2Y7QA 4HUWB 1A1NA 1JPFA 3O8XB 4Y19D 3BESR 4TOYH 1IT9H 1I1AA 4PFEA 2IANA 5DSCA 4JCMA 4U1NB 4K7FB 4X7TB 1UB5A 2R69H 3ZZ1A 5AWNH 4V1DA 5A3IC 5L8KB 2QKIB 2WSKA 3NCYP 5I6XC 1ZLSL 2B1HH 4OLEA 1YMMA 3P73B 1MHCA 4ALAH 1XFPA 5HYIA 4MJ2A 1RZJL 3NGBB 4XX1G 2C1OA 3ZT6A 5CD3B 2EIEA 3B9EA 3U0PB 5HI3C 2CRIA 5KVDH 1KNOA 2NY1D 4PYGA 2ORBL 2H6PB 3S36X 1A1MA 1DQTA 2VR9A 3VGBA 5JIKA 2R0LH 2Q8AL 1HILB 3HZKA 1ZLVH 1AGDB 4JDVA 3BQUA 1VFAB 1G0YR 3UJIH 5C1MB 1DVFC 2R4SL 2DQJH 4PJAA 2HT2C 3MRIB 2BY0A 4U2YA 3FQWA 5KTEL 1KCVL 2GY7B 4ORZC 4UAOC 1CLYH 4JFPA 1L4IA 4JB9L 3WO4C 3OB8A 3O8XD 1NBZA 4MDJB 5ERWA 2Z93A 5ID1B 4N8CH 3OGCA 3PQYD 1E28B 4NDMA 4NYLB 4WHCA 2BSSA 5CJQH 1JHTB 3QI9D 2YA1A 4JR9L 3KNBA 4OV5A 3EDDA 3L6FB 1T0MA 4Y5VA 1TXKA 2YUZA 1RV6X 2GCYA 3QUMA 3MNWB 2HN7A 5IFAL 5EFIA 2JB6A 2OJZL 3WKMH 2I25N 1C12A 4MD5A 2X05A 1V7NL 4IHOB 5K33A 2JCCF 3FO9A 3GM8A 4YUEH 3EAKA 3SDDA 3HMXH 2VZ3A 4DQOH 2X4SA 4G8FB 4HMEA 1BOGB 1NBYA 2SEBB 2GJ6E 2Y36H 3DMMA 2EDJA 3MUJA 5HSFA 5K59E 3STLB 1SM3L 1A1OB 3DWTA 4Y4HA 3DROB 5CEZL 4WHTB 1AGBB 4I3RH 5L9DL 3V6ZA 3P0VL 3BIAX 5E8OB 3BZEB 4MA7L 4XVUC 1VEOA 1JTTA 3MLWL 4ZODA 3OJDB 5D7JB 4RRPA 3WLBB 2VITB 1GGCH 2R0WL 1FORH 2H1PL 2HWZH 1MIEH 2H8PA 1I7ZB 4R8WL 3CIQA 3AGVA 1QFUH 3PHSA 4HLJA 2W65B 3C08L 3NIGF 4XCFL 1JNJA 4O58H 1AI1L 4XWGL 4D9LH 2FJGA 1A6ZA 5INDA 1RK1A 3AREA 4WGVB 4JRYE 2FD6L 1V05A 2WBJC 4Y16A 5T1MB 3V2AR 2ADJB 2A83B 4FQLH 4R7NA 2ITDB 2DQDL 4HDIB 2DI7A 1PKOA 1MQKH 2VISA 4ZTPL 3D2UA 2XG4A 2VIRB 3LN5A 3EO0B 3VRIA 4CVXA 5TFSL 4PP2A 5DUBB 1SBSH 4A6YH 4TUOB 2OL3L 3HZMA 1ZANL 2OQJA 1FVCA 5GS2H 5KJRL 3JSSA 3L5WA 2HP4A 3BN9C 4ZFZB 5DTFB 5I1CL 4MAYB 4N5EC 4PJBF 3QXVA 3ARWA 1K2DA 5ALCL 3HUJA 4MJID 5DVNA 5FA3A 3RVWD 4MJ6B 3GBMH 4NN7C 2FHFA 1YYMH 3P11H 5CP3H 1BZ9B 1ITCA 5D7JD 4DFHA 5HGDA 3CFKB 4AK1A 5C0CE 1FL5A 3MBEB 3TN0C 4WUKL 3MJ9L 5LWYL 4LQFH 1PLGH 12E8L 3ZTNL 1DBML 5FO7A 3WE6B 3EFFB 3MODH 2VDOH 4P5TD 1ONQB 1GHFH 5GS0L 1HXMB 3DV6B 3DSNA 5DJXB 3B8SA 3NAAL 4XH2B 1IKNC 1KACB 1UWEL 1CXHA 2MFNA 4MNGE 3PXHA 3LQAH 4GW1B 5KSBE 4EN3C 1RU9L 4L29A 5I15H 1LDPH 3IDXH 4R96A 3MRHA 3VU2A 2D9QB 1WC7A 3ARBC 3OL2A 4NQDB 1EIBA 1KN4L 2D7NA 2I5YH 1KF9B 2EYRA 1RIVH 4KVNL 4X5WB 3EJZC 1QLRB 1FN4A 2WW8A 5CMAA 3TEUA 5TDPA 4MAYD 4GMSH 4P2QE 1U8IA 4L5FH 1PKQE 3FO2B 3PGFH 1ZSDA 4ZNEA 1A7RL 4EI6A 4Z78A 3I02A 4C56B 2EE2A 4MX7A 1U8OB 4UDTB 4O2EB 4YBHA 3VFOB 1OAQH 2VXSL 2XA3A 4Z0BL 3CK0L 1Y0LB 3VFRA 5TDOB 1NAKH 4NQEE 1CF8H 1C7SA 5DR5L 5DJ8A 5C92A 2GAZA 1EO8L 1OWWA 1PSKL 2H2SC 1MHHA 1ZT1B 1LK3L 1Q1JH 4OD2B 4PV8B 2B20A 1TPXC 5LVEA 2CH8A 4Z7QF 2VDLL 5E95B 3OR6B 1RD6A 2JKXA 5DD0H 1YN7A 3LIZH 4P0DA 3V6OA 3MV7A 4JN2B 3BRFA 3ESVF 3DPBA 4OCWH 2ESVB 1UZ8B 3JBG7 3MZTA 4IRZL 4Y4KB 4JO1L 1LD9B 3NABL 1T2QL 5FYKE 3L3HB 4PRNB 3DYOA 1DZBA 1TETL 4O02H 3C6LC 4U6XB 4NQDD 2OXGA 2DJ4A 4JPVL 1LO5A 4CDGC 1OARH 2ARWA 2D0GA 4OFKA 5HD8C 1ZA3A 1UKTA 4KJPD 4PJHF 2Q7YA 2AXJA 3NA9H 1WK0A 2O5ZL 1A7OL 3BGMB 3QFJB 4C56D 3KPMB 3VRLF 2D0FA 1G0DA 3VH8A 4NP4H 5DUML 2K9UA 1N5AB 3QBTB 5MENB 4FABH 3C5SA 3T0EB 5KS9A 4LCUA 1KCRL 5FGCB 4JJ5B 1RUMH 2AW2A 1GZPB 4X80L 4P59H 1MQ8A 2AI0H 5I8EA 4KRLB 3SE4C 1YNKL 3WIIH 4FFWD 3RAJH 5ACLA 5F9AC 8FABA 4MXQC 4FRWA 3MRJA 1AE6L 5D96B 3KLHC 2UY6A 1AJ7L 2EH7L 3TYFB 3AY4C 4FQXA 4MJ5B 4XXDB 4X99B 4IMLB 4BH7A 4Z7UF 1AH1A 3O11A 1JV5B 2AEWA 4JQIL 2ESVD 1PG7L 3VXUA 3TO4B 5IMKB 3BEWB 3SGEH 1DBBH 3ARGA 3BW9B 4F33B 4YFDB 5D2NE 4PJ7B 1PQZA 4FNLH 3HG1B 3KPOA 4B7LA 1NUFA 4JRXB 3H9HB 4TSAH 4YXKL 3TA3B 4QRRA 4CVZB 1ADQL 1Q8MA 1FNEB 3GB7B 1WCQA 3IU3B 4ZUUA 2VLKE 3QFJD 3O4LB 4MA1B 1EPFA 2J7LA 2NW2A 4AH2B 2DAVA 2H32H 3ZDYF 4RFEB 4V1DE 4MB4A 4NO3A 1VEPA 1AKJB 3VGHA 2CKBL 4ZUTB 3T0ED 4D8PA 1GOHA 2FX9L 2VXVL 2UYLB 3BXNA 1ZVSB 1G7LB 4UB0H 4PRDB 5J1TC 3TP4A 1G0XA 4QTHB 4UINL 2JJWA 4UV4L 2IH1B 1BZ7A 1I8MA 4LLUA 3DUUB 1T6VN 4P2RE 4YR6A 1O0VA 2EDWA 1K4CA 5T3ZL 3FRUB 4PTTB 4OZGF 3FB7B 3S35X 3TO4D 4OUUA 2XOTA 4PJAE 5IVXB 2FIKA 3MGOA 2ZOKB 4HIXH 3MRNB 4QNPF 1FH5H 1HQ4A 4HHAA 3JV4B 1FBIL 4UQ3A 4XCYA 1G7HA 1WTGT 1UACL 4LBEA 2AJYL 4DVBB 3P4NA 1KG0A 3ARXA 4R90H 1R6VA 1V3LA 1QTYT 4OIIH 3U7YH 2BK8A 2VDKL 4ELMA 1CIDA 4ZFOL 4QCIB 5FOJA 4LCWA 4EJ1C 1FZMB 1U91B 3O9WC 4NM4H 1ZE3C 2Q76B 1AKJD 2D7TH 4CDHA 3PHQA 1BECA 1KXVC 3QP3A 1FO0A 3U4EB 5ETUB 5FGBA 5CJ8A 5EUOF 2HKHL 4NO2B 5GGVY 5C0AB 2O26U 5A40E 4OQTH 3K4AA 5ISZA 4U6HB 4GAJH 4OZFA 4WNQA 1A7QL 1MRFL 5K9JH 15C8H 3V4VH 5LQBH 1HQRA 4UMGA 3RWIB 4IEFB 2X9XA 4GXUN 4PLNC 2FX7L 5IMMA 3HI1A 5HYQB 4QOKD 5E4IA 2WBWB 3I9GH 4MQSB 3TPUB 4CN4A 5C3TA 3CVHB 2E7LC 4RSVA 3QDMA 4R4ND 2IPKB 5IB1B 1QBLH 1MH5B 4JQXA 1S7TA 1F58H 3BP7A 5I1EL 1YN6A 3GEWB 4XCCL 5EOCH 5JPNA 3KJ4C 3BWUC 4XGZB 4BQCA 1P5VA 5E8EB 2ED8A 1VDGA 4NT6B 3O81A 3CXHK 4ODUB 4PJIE 4HIEB 1MF2L 2MHAA 1SJEA 2IH3A 3M07A 2Y06L 2V2TA 2HKFL 5IUSA 4KZEL 1W8NA 1SYSB 5JR1L 4Z77A 3RUGF 1N4XH 1CFQB 4M7KL 4XP6H 1JF1B 4DVRL 5DMJB 4OTXH 3ARTA 1MHEA 3MXWH 5C0AD 3SHSA 1TZGH 2D03L 3NACL 2EXYD 3BHBA 4RISH 3TM6A 1HYRC 3QWOB 2A1WH 5F8RC 2G60L 5EBMA 1WZ1L 3GSVB 2Z92A 4BH8B 2HJKA 3RJDA 3A6CH 1W2KT 5MERA 4RFNB 4Y2DC 4HJJH 1T7ZA 3QHFL 3UTSB 4AIXA 4AT6A 4UNUA 4NBZB 2A74A 4CNIA 2BY2A 3G5VA 2RGSA 3KVQA 2B7DT 4UT7H 1H8NA 4OB5H 2D0HA 1IFHH 1YPZF 4TSCL 4WTXA 3W5MA 2GJ6B 3P2TA 1T5XB 1NDMB 3QB7C 1HINH 4YPGB 4Q7DA 1PW3A 2VQ1A 3BDYL 4L3CA 4GSDL 4K7PY 4U31A 1SVZA 4Z7WA 1VGEL 5D1QC 5MI0C 5EBLA 1MIML 3RQ3A 3SE9L 1AXTH 3BOVA 4OFDA 4OUOA 4X4XA 3TZVB 2BVQA 1A6UH 1MNUH 5JNYB 5HI4C 3GMLB 3A6OA 4TNVK 5IFJB 1XR8A 3FQXB 1U8LB 3BIKA 3G9AB 3GIVB 3GMPA 4U6YA 5IMLB 1ORQB 1QO3A 4FN0A 5E2VL 5KN5A 2YRLA 1I9IL 3DRTB 1NC4B 4XI5C 5C07B 4U6TA 5ENWB 3S36H 2DN7A 4ZUVA 1ERNA 3S9DB 3CH8A 5DMYA 1BVLA 4P46B 1ZHBA 4ZUSB 3UTSD 5C86A 4DGYH 2UUDH 2DQTL 1LE5B 4HK0B 1LHZA 2Z31C 2GJ6D 3SE8H 5TQ0L 1U8PA 3V6OE 2BC4A 1FP5A 5JQ6H 4YNYA 3UO1L 5ITBH 3P4MB 4LVHB 5KOMC 1SBSL 5L7XL 4FQ2H 2HAZA 4P5KA 3K1KC 5DT1H 5E94A 3RGVA 3U30B 4JZJC 4QRSA 3TZVD 2VXTL 3JWOL 4O9HH 3TFKD 5E03A 3VWKA 2EO1A 3MUGB 4PB0H 5DQ9A 4PB9H 2FH6A 3GJEB 2MQ0A 4O2FA 4MD4A 3CC5B 4RNRB 5FF6A 5J8OA 1I9JL 1P69B 5IV2A 1KIPB 1TTFA 1P4LB 2X1QA 3FO1B 3LKRA 2AXHA 2DM4A 4F7PB 4JKPH 5C07D 4JRYD 1B0WA 1VSCA 4RAUB 4G8IB 3CFCL 5IHBA 2CXKA 4H20L 2RCSL 3RKPA 1OLZA 3WJLC 1MFDH 5MP6H 3MX0A 2NY4C 4HLZG 4WTZA 1IAIM 2P48B 1D9KC 1RIUL 3OJ2C 3V7AG 3F58H 2OR9L 4OGXL 3DVNA 1ZTXH 1OM3H 4S1QH 4YFLI 3WNMA 1EBPA 1DR9A 4UNTA 4FQCL 5HVFB 1JCKA 1ZWIA 5D7SL 1HHGB 3T0WA 1Z9OA 3KHOA 3KWWB 4F57H 2GEEA 1AGFB 1PKQB 1P4BH 1CD1A 1RK0A 1HHIA 3AU1B 2N7AA 4LSPL 1AGEB 3NZHH 4WIQA 2AKRA 3MFFB 1ZKAA 3OTTA 2R8SL 1YEHH 1MJ8L 4GBXA 5C0CD 4NNYA 4GJTB 4X9GA 3QUXA 5HJ3A 2DIAA 1DQJA 3TIDB 3HE6A 3C6SB 4OCXH 3G04B 3VJ6B 7FABH 1I7RA 1S8DA 3IDUA 4HBCH 1NFIA 4QRRE 4M43H 5IB2B 2IPTL 5JZ7C 4UUJA 1T6WA 4ZOEA 4CU7A 3CSGA 1KFAL 1TFHA 5F1IB 2YD8A 3LD8C 1JK8A 4M6OL 4OT1H 4OD1H 2OM5A 1UWXK 1MWAH 3QO1B 2YD2A 5GRJH 3D18A 5E5RB 2IADB 1ZHNB 4NQVB 4I3SH 5CUSH 4WO4B 3O2VH 1SY6H 5HGBB 2C3WA 1KV3A 3QXTA 4MNHB 4XC1H 2WLYA 1TQCC 1EX0A 5GS1C 4BA8A 3QCTL 1FL3B 4JFYA 4KRPC 4KTDH 1VFBA 3U83A 4JM4L 4N0YH 1H5BA 2WIMA 2WINA 4S1DC 3CSYB 4OLUH 3FFDB 3VWJA 4P2QD 2VLLA 1ZAGA 5DHVH 4X6CF 2FX8L 2P49B 1MFCL 1YNLL 3L5HA 3B6SA 4KMTL 5EOTA 2X4QA 4NO5A 4MD0B 4NQED 4E41E 4P3CH 1LP9B 4JZNB 3SGJC 5IB3A 4UILH 4I0PC 4X5XB 4HGWB 3O2WH 3NA9L 2I27N 2CDFB 2F5BH 2APBA 1TVHA 4PJCF 1R0AH 3CMGA 4WY7H 4JPWH 3C9NA 4JO2L 2NY3D 3PGDB 4M6AA 3FN9A 2X70A 5F3BB 2QR0A 1EDQA 1WT5C 1F3RB 2R29L 3S5LB 5DJZB 5TPWL 3BKJL 3RY4A 1DQDH 1FDLH 2EICA 5FYKD 5C0EA 5E2UH 2JCCA 2L0DA 4JY4A 4WO4D 3BP6A 3CFEB 2VUYA 3QCVL 4M6NH 3EGSB 2QSQA 2P8PA 1M7DB 1P7KA 4LAQH 1A1NB 1JPFB 3C8KA 4NZRL 5I8OH 4XVTL 2X9YA 1I1AB 2IANB 4NBYB 5DSCB 5IFHL 3J7HA 1DP0A 3KS0J 4BK5A 1UB5B 4BZYA 3PWUA 3V4UL 4HKJA 4HAFA 2W60A 4V1DB 4B53A 5TGBA 2OJEA 1GIGL 1YMMB 5DQDH 4PRIE 4JFXB 1MHCB 1YECL 1KPVA 2DTSA 2IBZY 5DHXB 3H9YA 4PJGE 1RQ5A 1CU4H 1FGNH 2C1OB 5C0FA 4RWYL 2XI9A 4RWHA 4M1CD 4ZO9A 4TUKL 4DOHB 5IBUB 4Y0GA 3FQUA 1A1MB 3MR9A 3SE3A 2EE9A 5E1HB 5INCA 1T3FA 3HZKB 1RAMA 4JDVB 3BQUB 1KJ3H 2XWBA 4L8SC 2HFGH 3V9FA 1MCIA 1U36A 1E4KC 2QBWA 3MLRL 4JFOA 5EZOH 3UTZA 5FA4A 3HR5A 4HWZA 2GJZA 2XYCA 5IESL 1H3PH 2P7TA 1Q9LB 1FIEA 3FQWB 2BHUA 3RI5K 3O41A 1KELL 4NNPH 4ZOBA 4KUZH 2Y07L 2HFEA 4J4PA 1OWRM 1NBZB 5ERWB 2Z93B 1YEIH 4LHQB 3OKYA 3OGCB 3MRDA 3FL7A 3FB8A 4NDMB 3S5LG 1N6QH 2BSSB 1S9VA 3KNBB 4OV5B 2R56L 3EKCA 4MAUL 1KBGL 2Y6SC 1T0MB 4Y5VB 4WW2A 1S9XA 4V1DD 2GCYB 4LEOA 3QUMB 5ICYA 2HN7B 4OCRH 5EFIB 4HCRL 2DD8H 2JB6B 1YMMD 4EDWH 1C12B 1OGAA 4MD5B 3MYZA 3FO9B 2LABA 3N1PC 1ZLWH 3SDDB 1MCCA 1MVUA 2X4SB 3ZYJA 1NBYB 5F96H 3DMMB 4V2CB 3D48R 4R2GB 3MREA 1H0DB 2VL5A 4QHKJ 3FO0L 2BSTA 4Y4HB 5EOQH 5B4MD 1ZGLA 3WXWL 4H1LA