3IJSB

Structure of s67-27 in complex with tsbp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
221
Chain Sequence
EVMLVESGGGLVQPGNSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDISPSYGVYYEGFAYWGQGTLVTVSAATTTAPSVYPLVPGGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
total genus 42
structure length 221
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijsB01
4JZOA 1U91B 3P30L 4XZUB 4PRHA 3T0AA 4KMTL 1T1XB 3D39A 5EO9B 4F57H 3GSWA 2NZIA 1ZV5A 4ZNEA 4JG0L 3C5ZD 1FVDB 4P2RD 4Q7DA 3JWDL 3NTCH 1T2XA 4L4TB 1P84K 1I9RH 4HUXA 4J4PD 2ZOKB 5FUZH 4QY8A 2WUCH 5KVFH 1I9JL 2FHFA 1A02N 1FDLL 4XP5L 1J05B 5T1KD 2WWMD 5L9DL 1P4BL 3S3PA 4WW2B 4EI5B 5J6GB 3EDFA 4JFQA 3VDCA 1K5NB 4DKEL 3O9WC 1P2CA 1ADQH 3VFOA 4ONGL 2XN9A 1H15A 4JGJA 4JRWA 1Q94B 5EO1B 4WJ5A 5SWZB 4X98A 4ACPA 2HVKB 3OKDB 4NC1E 1UZ8A 3QHFH 1XGUB 5M7QA 4S1QL 4P2CG 3FN0H 3B9KA 1QZ1A 4DZ8B 3QZWA 4NQSB 12E8H 3SO5A 2ZUSA 4PJEF 3UTQA 3ORJA 2KZ1B 1G7JA 1WC7A 1TTFA 4ODSL 1D9KA 1WZ1L 5BMFL 1PQZA 1CLOL 4HLJA 5E94B 1LO3L 1I1FB 3L3GB 2UWEF 5MP6L 3RUGA 1H3UA 5EU6D 1HHKB 1NSNL 3C8KA 4PJFB 9CGTA 4ORZC 1LK3L 3NCMA 1BWWA 4XAKE 1N5AA 1YJDL 5EBGA 1QFHA 4JQVC 1JPGB 3JTTA 3LV3B 1F6LL 3ARZA 2J88L 5D7JD 4Y1AA 3Q0HA 4GRWF 2YPLA 2V9TA 1I7ZA 3BE1H 3RBGA 1MCJA 1KN2L 4FA8A 3ALPA 2CLVA 1JGUH 4MYWB 2GUOB 4UTAL 5KVGH 5K9OA 1MIML 3C9NB 4X5WB 4H20H 2I27N 1CDYA 3W9EA 2DOCA 3SQBA 3RWCA 3RWHA 3EDJA 3PGCA 3X3FL 3HCVB 4FHBD 4LMQI 3MR9A 4QHMB 1NCBL 1KIUA 3KHQA 4OCNC 3MV8E 3OHXA 1GGIH 4CVZA 4NQXA 1DR9A 2P47B 4WY7H 5FCUL 4ZAKD 4LP5A 1INQB 5HYJB 1C7TA 3KPTA 1UADC 1UWGH 5I15H 4CN6A 1NBYB 5DRXA 2Z91B 2BNUB 3HE7B 1IGJA 5JO5B 1FNAA 2ZG2A 3GI8L 4HUMB 5JQ6H 4PGEA 5CUSH 2GITB 4N5UA 3GIZL 1BOGB 3J7HA 4OLWH 1A3QA 1BHGA 3BMWA 2DB8A 2EDWA 4JHWL 3L3HA 2DM7A 5IBLC 3DI2B 1B0GB 2D7TL 3HUJF 5FHBH 3SDDD 1XFPA 4OZIF 4ZSOA 4MJIA 1NMAH 1CE1H 5IHZB 3ZT6A 4LRNL 3L5XH 1Z9MA 5E2UH 1D6EB 5TE7H 2P5WD 4BK4A 3CUPB 4OUOA 1RIHH 4AMKH 3GMOA 4HIIA 5GIRA 1NLBH 1NLDH 4MJ5A 5I73C 5KVDL 1ETZB 2XXMB 4MWFA 4P5TD 3V6ZB 4PJCF 4U0QB 3O4LA 4YGVB 4UIMA 5C70A 4TUJA 1B0RA 4OZHA 4B7LA 4H5SB 2DI7A 4KV5F 3PWUA 5EG6C 3HI5L 3TZVC 1N6QL 5C08A 4XWOD 4UILH 5IGXL 4DCQB 2JB5L 3OR6A 1LHZA 3S4SB 3OKKB 3QG7H 4Z7UF 1BBDL 1AY1L 3GSUA 4GRMA 1IEBB 4XPGH 1VB9A 3BIKB 3H9SD 2HLFD 4K9EL 5IV2B 2D0GA 1ZHNB 5KVEH 2MWCA 1SYVB 3SDAB 2NMSA 5ALBL 4OF5A 2DDQL 1L6ZA 3WFBL 4P4KC 4YBQC 2APFA 5ID0B 1FO0L 1UJ3B 3CVHL 3RTQB 5D6CA 1LDPH 2Z8RA 3O6FD 1T83C 1JZ8A 2APTA 1G7LA 4D8PA 4YFLF 2FYYA 3DVFA 4YDLB 4RQQB 4C56D 3WEXB 2R0LH 2ADJB 5F7WC 1BZ7B 2IBZY 1WAAF 3G04A 5DMYA 1VKXA 4YHZH 4ZD3L 1BLNB 2QHRH 4KJQC 3VA2C 4P2QE 1LO4H 5IFHH 3MJGX 1JF1A 3LQZB 4KHTL 1RUPL 5IW1B 2YN3A 5F7UA 1YEEL 3REVB 5GRYA 4TSCH 1JPFA 4G6JL 5IHUL 1YEKL 2XKNB 2BY2A 1QLEH 5D5MB 1HIML 3TA3C 3QUXA 1WK0A 4X6CA 3N06B 1RZJC 1T4KB 4TUKH 1EEUA 5J1AB 5DD6B 4AIZB 5T5NF 1NFDA 5KSBB 3UROR 2DJUA 4TPRH 1FL6B 3LQAH 1NDGB 1RZKC 4IMLB 3UMTA 5L8KB 3GMRA 3DX7A 1QSFD 1MCQA 2FL5B 1M7DB 3QIUC 3DX9B 1WISA 4JRYD 15C8H 4OF6A 5GZOC 1LEKB 4EVNB 3OGOE 2OTWA 1XIWA 5CEZD 4HT1L 4JRXB 1HE7A 5D72L 1G9ML 1BVZA 2FX8H 3MJ6A 1PG7X 2E27H 2BOBA 3GKWH 1GZQA 3O6LH 5C07B 4R96B 1QRKA 1I7RB 4PRIE 4KVCL 4WHYH 4IRSA 1J1PL 3B9KC 4YDVA 4X4YB 3OGCB 5D1QD 3LHPH 3I3BA 4HK3N 5I8OL 3VW3L 4PTUB 4C83A 2F53E 1D9KC 2WBJC 5HGAA 4S1SL 3N1MC 2IPUG 2GYSA 1YY8A 3VWJA 3NIGF 4XVUC 3I6KB 3RBSA 5TDOB 3C6LD 3HZMA 3N1FC 4OFYD 2PTUA 1RY7B 4LPCA 3J8F7 1F45A 1FFOA 1Q9WA 4TNWK 3TJEH 3B8SA 2JELL 4HMDA 3W5NA 3KYKL 1NCCH 2E8ZA 3PP3K 5ICXA 3DV4A 5D8JL 1LK2A 3MLUH 1QR1B 1RZ8B 1CFNB 3L7FB 4ERSH 5HXMA 3CFBA 4HF5H 1KJMA 4S1DD 2IBGA 1U8OB 3TH4T 4DGYH 4L4TE 5DUMH 4OKDA 3WIFB 1UWXH 3OKMA 4Z7VF 1KYOJ 1ZGLP 4TQEL 4IM8A 1BD2D 1YNTA 1DDHA 1IKNA 4UB0H 3KPQA 1YJDC 4UDUB 1U2CA 1QLFA 4AM0B 1P7QD 1DQDH 4ELMB 2HJLA 2AV7B 4NCC2 3Q2CA 4ZFOB 4XP6H 2Z93A 5T3XE 3DNKA 4PJEB 3R1GL 4RISH 1U42A 3TO4C 4U1JA 3BP5B 3VH8G 1XGRA 2GT9B 3RI5K 1CI5A 5E8PA 4JCLA 2YA2A 3G6DH 5SWZE 3BH8A 3DWTA 1MNUH 5A16A 2Z8VC 3H3KA 1KCRH 4FQCL 2BFVH 3BUYB 2AEWA 5ERWB 1MRFL 1WICA 1G6RH 5I1LB 4YO0A 3QFJB 4AG4L 5J12C 1T1ZB 5EC2B 4GRWB 4M6OL 2XACC 2A77H 2CO6B 5F6IC 3SKMA 1YMMA 2H8PB 2VQ1B 5E8NA 3AUVA 1NCAL 1T1YB 3HAEA 4NBYB 3ZDXE 1YDPA 4WIQA 3ELAT 5GGVH 5CP3H 5I1KH 4JY5L 1KPVB 3MOBL 3O11A 5SX5H 3UPRB 3B2UD 1DN0B 5CJBA 3P11L 2FEDD 2MCG1 5E2TL 1V7NL 5C09B 5ACZA 5FDWA 4M00A 3LCYA 2ADIA 3FT4B 2PKDA 1KJVA 4ZTOH 3DX8A 4LQFL 4JM2A 4HBCH 4ZFFB 5C0NC 5F7KC 5SX4I 2ZCKH 1F13A 4D3CH 3MACL 1A7OL 2EH7H 2VLRA 3ULVL 1OAKH 5EIIA 1VFMA 1G9NL 4U4BA 4QHUA 2XXCB 1N0XH 3S36L 4OZIB 3T4YB 5ADOL 2CSPA 3DXAA 3UTPE 4P4KB 3HG1B 3SKJL 3FQTB 4YHPA 5CCKH 3O45B 7FABL 4G6KL 5KG9A 4HKJA 3HNSL 1MFBH 1BIHA 1NC2D 4NKDB 1MLCB 1LILA 3PXJA 4G3YL 1T6VN 4M6NH 4N8VB 1FP5A 4G6AC 2Z35B 4PJCB 2LVCA 4HKXB 1QO3B 5CBEB 3MGOA 3ARFA 1CBVH 2YPKB 3EYOA 3U0TA 2ICWA 3SDCD 1INEL 4UT9H 2G2RB 3O2VH 1KFAH 4W6XB 4YEEA 3STLB 4ONHB 2HG5B 1C8PA 5HYSG 5F1OB 4Z7UB 4WI7A 4PRHB 3RVVD 3D39B 4PJHF 4Q0XL 4KK6D 4S10A 2AEQL 4NC0B 1ZE3C 1UXSB 2DYPB 3TA3B 43C9A 4PRPD 4TOYH 3ZYZA 2CJUL 2VXSH 3BPOC 4AK1A 3KR3L 5BW7A 3NFPB 4JAMA 1CFSA 1CICA 4CJ0A 3LKOB 4YNYA 3QJFB 4UT7H 1FNFA 1D5ZA 4NQDB 5DHVA 1D6VH 3KPRD 1VEPA 1QRND 3QIUB 1TNMA 4P9ML 1L0XA 4Z0BH 3VGHA 2BY3A 5FGCB 4O02H 4GRLA 2GJ6E 1F90L 1VPOL 4JFQB 1XIWC 1OGAD 3IDIA 3L7EB 3SGKC 1F3JA 3N1PC 4N1HB 2VIRB 3ZSTA 3QR2A 3PGDA 2W38A 5I8EA 1EV2E 1FORL 5FFLA 2OSLA 1EA9C 5FO7B 4BUHA 3EFDL 2C3GA 1EFXB 3GM8A 4Q9CA 5JW5B 4H26B 4IRSC 1W8OA 3B9KB 2DBJA 2E7CA 5BXFB 4R0LA 2ZG3A 3IAPA 3ABZA 1OTUD 3TN0D 5INDB 2DQEH 3UTQB 5HGHB 1LGVA 1EAPB 1JF5A 1K8IA 1PKQA 2WBJB 2QTEA 4E42A 3IB4A 1PQZB 3VWJC 1KB9J 5GS1B 4MNQD 3Q5TA 3W0WD 3T0EA 4BUGA 4PRNA 3F12B 3KVQA 3GMLA 5ESQA 3VD4A 3OXRA 3OKEA 4JO2H 4BFEA 1N5AB 4AEHL 4XNUH 1CD9B 2ZUQB 4G8FA 4GAGH 3RVXD 4DGIL 5DLML 2H2PC 1MAKA 4ZQKB 4BH8A 4TTGA 5D5ME 4NO5A 5J9PB 5T5FH 4JQIH 4LSSL 2XPGA 1Z6JT 4C59B 3H42L 4NOBA 1W72B 1TCRA 5SV3A 1TETH 3JV4B 3RWIA 5KSBE 2DJ4A 4XP4L 4J4PA 3RWHB 2C7UB 2IH1B 3C8DA 4HPYH 5DJDA 4F7TA 3FRPG 1OAZH 2ICES 4GG6F 4IEFB 5B3JE 5FA4B 4H1LB 5IQ9B 2XZQH 2AERT 3CFCL 1A64A 4JN1L 3I6LE 4FMKA 3SDXA 5FECA 5CD3A 2MTPA 4JJ5B 4RSVA 3TO4B 1CCZA 4JRXE 1IM9A 3HI6L 2K7PA 1RK0A 1TZIA 1ZT1B 3ARTA 5DFTA 4Z9KB 2RB8A 5GS0L 3G5VB 4LCWD 5EN2A 5C07E 5C7XL 5E2VL 5LVEA 3EO1A 4PGEB 2VH5L 5GGQL 4RBPK 4MGXA 4Y4HD 4PY8I 3IRPX 4MJ6B 3ZYOA 3LKNB 1DUZA 2GSGA 5EORH 3MLVL 4YBLC 1H3PH 5F6IB 3D1MC 4QNPF 4ZSOB 4MJIB 4FXGA 1GOGA 3I2CL 3OV6A 4G7VH 3EOTH 4HFWA 3CFKA 1A3LH 1UZ6F 2XFXA 3AS2A 5J7CC 1VGKA 4X80H 4ZTPH 1N8ZB 1QBML 2HKFL 5EU6A 2O5XH 5FYKU 4OSUL 3BIBX 4C4KT 4PGCA 3FQNA 4HIIB 3KYNB 4NPYB 4Z7VB 5GIRB 4LDLB 5EFIA 2PYFA 2I60H 4BH7A 5D7JA 4P46A 4X6BB 4M61B 1JWMB 3O4LB 4NJAL 4NSKA 4TUJB 4OZHB 3N85H 2VXQL 4FQXB 3RWFB 4JM2C 3MUY1 3TT3L 3GSNL 1N2RB 2Y23A 1FAIH 5F9WC 4XTRC 3D6GA 1FZMB 3OR6B 3IDNA 3KPLA 4NRZA 4K3HA 3KLAA 4WNQA 4BKLB 1J11A 4F8TA 2P4AB 3BZ4A 4FP8H 5ITBH 1QFOA 4ELME 2J6EH 3JVGA 1A6WL 1KPUA 3UO1H 3KXFB 4PJEE 2VXTL 3ZDZF 5J06A 4OBRA 4IOIB 4G7YH 1LEGA 3S36X 2OTUA 1UM4H 4OD1H 1S5IL 4EI6A 3GSNA 3GNML 2H32B 2WWKO 3FKUS 5EC1A 3SJVD 2A73A 1G7IB 3DGCR 3VU2A 3QG6A 2NNAA 4P59H 2DMCA 3C60D 3S35L 4LPWA 2VMFA 5JIPA 4D8PB 4L9LB 3QFJE 2XTJD 2Y4SA 5F7YC 4K3JH 1M4KA 2ARJQ 4GRWE 4J3VA 5IK3B 1NUDA 1JNHA 5IMLA 2Y72A 4JZNB 1KXVC 3LSOB 1RK1A 1FE8L 4ZUSA 3ARFC 3ZYIA 3G5XB 4YC2B 1RUQL 4M4PA 4PUBH 1JF1B 4YHOH 4OFVA 3QDHA 4WDIA 2ATPB 5I18H 4FRWA 2NZ9C 2P5WA 1AD9B 1TJHH 2VLMD 1UJTA 3E8UH 1RURH 1F5WA 5AWNL 3MXVL 1V3MA 2OJZL 3VXRE 1S7WA 4FQLH 4QXGL 4EN3C 5C09E 1C5CL 1MWAL 1BJ1H 1KELH 4QRPB 4LVNC 3MRMA 5DS8B 4CVXB 3P9LB 3MFFA 5FOBA 2CXGA 3G08B 1YECH 4ODWA 2V17L 4H0IA 5LCVH 1DBML 3QQ4A 3DX7B 3DYOA 4HIJA 1QG3A 4ETQB 4NN6B 1KGCE 3TEUA 2OTWB 2VQTA 1XIWB 1MWAA 2A83B 3MA9H 1F4WL 4AYFA 4HK0A 2FHBA 2MQ0A 5DEGB 4OZIE 1H3WM 3P4NB 2OLDA 3HG1E 4MD4A 1G7MA 4UOJA 3WXWL 5B21A 4MQXC 2J7LA 3QIBD 3DRQB 2HFTA 2EDFA 2HT3C 4R0LC 5HHPB 2VSDA 3D69B 1E4WH 2Y6SD 3KHOA 4TNVF 1RVFH 1BQUA 4PJHB 5TDNB 5EB9A 3MBXL 2GY7B 4QRTB 4C56A 4NQCB 3S3JA 3QWQB 4AQOA 5I6XB 5FA3A 2VNCA 1K2DA 4JY4B 1Q1JH 2QADC 1R5WB 2FLRT 3REWA 1TVBA 3T0EC 4KV5E 5C0CA 5LXGL 1X4XA 3L3DA 1DSFH 4N0UA 1KLGA 3A6CL 3BDYL 1DQLL 2EE6A 1FFOB 2ZCHH 2AW2A 1SVCP 2G60H 2BVUA 3NA9L 4Z7UE 4PRHE 1E27B 3D39E 2FO4A 2XKSA 1AJ7H 5KBNC 1EX0A 2EH8H 3FB6B 4RFEB 5CEZL 3C5ZC 2YEZA 2FJGA 4QRSA 4F7CB 4HGMA 4XNQA 3TM6A 2YSSA 5F7DB 4XVSH 1AH1A 1DE4B 4J4PC 3OKMB 4XGZB 1U8KA 1XF3A 3GSQA 4Z8FL 2EYRA 2EDLA 4P3DA 3D3VB 3KPQB 1HOCA 5DWUL 4NNXB 1QSFA 5GGSB 5FGCE 3S3SA 2WWMC 5KJRH 2AKRA 4X6EB 1ZLSH 5FDYA 2EDJA 3DUHA 4G8EA 1WAAE 4YE4L 1JGVH 4MA1B 4NZUH 4Z95H 3CX5K 4HEME 3OZ9L 4JE4B 2UZYB 5C0BB 4LP4A 5JPMB 2V2TA 5FUCC 3T65B 1U36A 1OSPH 1VERA 4YO0B 1WJ3A 2UUDH 4FG6D 1CGSH 5D1QA 4AH2B 1HILA 2D03L 3Q3GA 3RL2A 5E8NB 3MLSH 5T1LB 3C08L 5DYOB 4HH9A 2H41A 4UT6L 5IMOA 1WWCA 2GJJA 3RUGE 1YDPB 1EERB 3IU3B 2QL1A 5GS0C 3RWDB 3BWAA 4U6VL 1HYSC 4QYOB 4J8RA 1JWUB 3MRPB 5JXAH 5CINL 4GG6B 4PJXA 4XB7A 3DGGB 2PW1A 3TH2T 3VCLB 1SMAA 2YPLE 5D7JC 4F9LA 4CU6A 4UINH 1SYSA 5J3HD 1HINH 5CILH 4LASL 3DX8B 4JM2B 5CP7A 1GGUA 3GJFK 5EBMB 1RZIA 2GJZA 4NM4L 1S3KH 5BVPL 1NC4A 2Z31D 5DQ9B 5IB1A 1BD2A 4KVNH 2FB4L 3VD5A 1YEGH 2JK5A 3JVGC 1N64H 5EUOA 4Q9RL 1P7QA 4OCXH 5EIIB 4ZAKC 3KG5A 3ALXA 2B1HL 4QHUB 4KJWD 4PB9H 3T0DA 4JB9H 3P77B 4YDKH 2I9LB 2DQDL 4HLZH 5EWIL 5TQ0L 3NIGE 4YHPB 4OLYL 4OFDA 2Q8BL 2X4RA 5ISZA 5BS0D 3ULUL 5E00B 5HDOA 2ZJSL 3IKCB 3MX0A 1NBVL 1IC7H 2P5ED 3S35X 5GSVB 4WU7A 1H9VA 5D2NC 2A0LD 3EW3B 2W65B 1QACA 2F5AL 5IJKA 4HC1H 5AG9A 4BQ9A 3U7WH 5FYKD 4ZSOE 3L1OH 4QXUL 4MJIE 3SDDC 3MGOB 3ARFB 3PL6A 2VITA 1YZZA 4APQD 3IFPA 1CLYH 3JWOH 2ICWB 4ESKA 4G43A 4OIIH 5D7LD 4M8VA 1SJHB 4U1MA 5I74C 4PGZA 1KXQE 1AXSA 2IBZX 1J5OL 4RMSA 3OAUL 1GYAA 3NCFB 3TCXA 2NX5B 4Z7VE 5B8CC 2F5BH 3MRJB 3WHE0 1GSMA 3FO1B 4M5ZH 4EN3B 5HPOA 2XZAH 4M7ZB 4MLIA 4YXHL 1B2WL 1OB1B 3O4LE 4CADA 3AAZA 4OGAD 4OGZA 4OZHE 1L7IL 1XEDA 1FNLA 2CGRH 3ES6B 1MQKH 5C08E 1FFQA 4GG8B 4QHLA 3BGFC 4HFUL 4XWOC 3HNTH 3MJ7A 1DQJB 4Y88A 3KLHD 4WWID 1KIRB 2V2XB 2X4UB 1IGIH 1XGQA 3S5LA 2H26A 5HPMA 1OAYH 4FFZL 4MD5B 1MJ7H 4QF1A 3UTTB 3KXFE 1F3JB 4HG4K 1KUMA 3IDGB 3VMPA 2IBBA 4F7EA 2HLFC 2R8SH 4LEOB 4PJ9B 2XY1A 5KOVC 5BCAA 2AS5M 4OLVL 4PB0H 2DQHH 3VXNA 4F37F 3GDBA 4P3CL 1YEDA 4CMMB 4OT1H 1TZGH 3KWWA 3IFLH 5E95B 3G5YA 1U8HA 1LO2H 5E5RB 4DKFH 8FABA 1T22A 1PZ5B 4E42B 5ILTH 4OM0L 1U8NA 4HDIA 3UDWA 2QADB 5J11C 1AHWA 3FMGL 5FOJA 3L95A 4B50A 2AXGB 4P57A 1RUKL 3E6FA 2F8XC 5IKCA 1EEZB 1OSZB 2DICA 3N9GL 5IEKA 3OXRB 3OKEB 1LNUA 4U1HB 5F1NB 4FQJL 4I2XA 3THMH 5DD0L 1J86A 2L4OA 3MLRL 4G8FB 2R15A 2YZ8A 1A8JH 1WBYA 5EIVA 4J2XA 4P4RA 5FYJH 4NO3A 4BH8B 4Z7OE 5EU3B 3L9RB 2VL4A 3C5ZB 3ETBF 4QRPE 3UC0L 1QLRB 1RZ7L 3LQMA 4PLOB 3X13A 3B9EA 4P2RB 4PRPA 2W9DH 1NKRA 3L5WA 1YEHH 5EA0L 5HYIA 2GKIA 1GRWA 2VLLA 5JNYA 5DJDB 1UM5H 2ZSVA 3P0YL 3AXLA 3WUWA 3VXPB 2IJ0C 5JXEA 3KPRA 1QRNA 3QULA 5T1KB 3V5DA 3MLPA 2MHAA 3V4VL 3QXAA 4FZ8H 1Q0XH 4JFFD 5FO9A 1WWWX 3BP7B 3K8KA 3VGGA 1IE5A 1TZIB 1K4DA 2ZKHL 5DJAA 1B6UA 1T2QL 2A6KA 5MI0B 2KZWA 1CE6A 1XCQA 1CT8B 5FYLL 1ZGLB 5IWLA 2WLZA 2VC2H 4G9FB 2XA3A 4TVPH 2FX9H 4UQ3A 3CSPA 5I0ZA 5D1QC 3I02A 2A9NL 3NGBC 4PJHE 4QO1A 4NQCE 1UB6B 4FXGB 1LEIA 1YEJL 2BNRD 2FBOJ 4KKAD 4MNQA 1VGKB 2DQIL 2RFXB 1CR9L 1NDMB 1QSZA 2VDQL 3C6LC 3RGVA 1BBJA 1OAXL 2X4PA 1BQHA 2A9MH 1YNKH 1KV3A 5D1ZD 5IB2B 1R5VA 2HTKD 4JFZL 5DMIH 4OI7A 2XWJB 4GKNA 1B4JH 4NHUA 2FATH 4EIZC 4NSKB 3EO9L 3WE6A 1KENH 4OV6F 1GC1L 4PREA 5E5MB 3UTZA 1VADA 1UXWA 4I8DA 1JF6A 4S1DC 1I1AD 3WFCH 3P9MA 3V0WH 2AJYL 4NRZB 4M62L 4XI5D 3KLAB 4RMQA 1MHPL 3D3VE 1IC1A 3EOYG 3NVQA 3P0VH 2YKLH 3ECBA 1ZGLM 1UCBL 3HZYB 3JTSB 4LLYA 3PHSA 3T0XA 4F9PA 4ZAKB 1IL1B 4Y19A 5JOPE 1AFVH 3S4SG 4K7PL 5I17A 4FQ2H 4R26L 4TUOB 2OXHA 1LEGB 2Y36L 5IQ7H 1RU9L 4EI6B 2E7BA 2V7HB 5EC1B 1X5FA 2VZVA 3QG6B 3AMKA 3O3EA 4O2FB 1JV5A 4KI5D 4U6HA 2GAZB 3OSKA 5KANG 4Y4HA 5D2NB 2NY7H 1J1OH 4PJIF 4HKBB 3WHXB 4XPAH 3TBWA 5IJKC 1UT9A 5IMLB 1ZT7B 1NGPL 3WFDL 1RUML 3SDDB 1RK1B 3MRQB 5AZ2L 5A1AA 3CLFL 4NWUL 2XZCH 4ORGA 5I74B 1IGYA 4U1NA 1CXKA 4OIBA 4I5BA 5HHOD 4JPVH 5C0RL 2P5WB 1CTNA 1IAKB 4E41D 4P5KA 4G6FD 2IAMB 4EBQL 2FJHA 3MGTA 3U2SA 5B8CB 1NUGA 1CVRA 4GG6E 5FKAA 3ZTJG 2HWZL 3BEWA 1V7MH 4Z18A 1HEZB 3B2UC 2FEDC 1X7QB 2XT1B 5E99H 2CLZA 3SE8L 2X4OB 4P5TB 3DPBA 3MRMB 4JFXB 2J5LC 2AXHA 3PQYA 5BJTB 5FOBB 1TMCB 5IM7A 4JANB 5SWSD 3B4NA 2BVQA 3MODL 4LLUB 1EHLH 3BGFB 3QEGL 4YXLH 4NNYA 5DQDL 2NPLX 1UC6A 2FH8A 1RZJH 4O5LL 3GRWH 4DFIA 3U46A 4YHYC 4NQUA 3WS6A 5DTFA 4AEIL 1U3YA 1HWGB 3U6RA 5L6YH 5DRWA 2IPKB 1RZKH 4CU8A 5T33L 3H9SB 3MOAL 4YWGH 4L3ED 1RSFA 3P30H 4PP2A 2QJDA 4KMTH 1FVCA 3RIAK 2VZ1A 3BGAA 1P7KA 4KKCD 3UX9B 1S7UB 1LDSA 3D25A 4JG0H 3HC3L 1N3NB 1FPTL 1AI1L 1K3IA 1I1CA 3BP6A 1DEDA 4F7PB 3JWDH 4L1HA 3O6FB 3PDGA 5LGJA 4ZUUA 2P8PB 5DXWA 3DURB 4RNRA 5GGVY 5HI5D 2AEPL 4OLEA 3WKNA 5E6ZA 5T3ZD 1I9JH 1S7XA 4NFCA 5BZDA 1FDLH 4XP5H 1K2DB 3MSPA 1MPAL 3UDWC 1TVBB 3C5JB 5L9DH 1P4BH 3NACL 3M17B 4ZUVA 4IIQA 2K7QA 3HI1B 4F58L 2NR6D 4ZPTB 4DKEH 3P73A 2Y1VA 3G6AB 3KYOA 3O4OC 2BSTA 2X41A 4ONGH 4Y16A 4U05A 2Y7QB 3RVVC 3S7GA 4KK6C 4FOMA 4JFHE 4JFOB 1S9YB 4S1QH 5L7XL 3CFDB 3V7MA 4QRSB 1IGTB 5C8JA 3ET9F 3DUUB 1U93A 5L2KD 4XNQB 1ITBB 4PRBA 2DM3A 3BOVA 3EJYD 4ZXBD 1CK0L 4K07A 1UWEL 4EIGB 4ODSH 32C2A 1WZ1H 5BMFH 1GHFL 1YQVL 5DC4B 1CLOH 1HOCB 1AR1D 1W0VA 4LKXA 1LO3H 2NXYC 5DA4A 1NGXB 4Z78A 1JHKL 5DJ2A 1UH4A 3QRFM 5MP6H 4JRYB 3AROA 1NSNH 4NWTL 1F58L 1LK3H 1NGYA 4XXDA 3UTTE 1YJDH 4GLRH 2QV2A 1HKFA 4OZGA 4UV4L 2J88H 2O5YL 1A4JA 1SBSL 3HE6A 4LIQE 4OQ1A 5CGTA 4OB5L 1KN2H 4JGMA 5GRVL 4KJPC 3IJHB 4PJAF 5INCB 1J12A 5AAMA 4JG1L 3KLSA 4UTAH 2V2TB 1MIMH 2H3NA 1ZLWK 3QIBA 1WCBA 2IANA 1X5XA 5D1QB 2XNAA 3NGBB 1OTUC 4DW2L 1HILB 1A7BA 1MCBA 3WNNA 3X3FH 4AENB 3WSQL 1PY4A 1NCBH 1QTYT 1NANI 3X14B 4HH9B 4KUCF 5FCUH 3LB6D 5AD0A 1J87A 2IG2L 3IJSB 3C6LB 2XKUA 4A6YB 3RGVC 1F4HA 4WGWB 3BWAB 4KROD 2XA8L 4R90L 4B7IA 4LCYA 1ACYL 4N8PA 3GI8H 5E6IA 3GIZH 1OPGL 3BWUC 1UFUA 4P2RE 3D85D 4JHWH 1AQDA 1OF2A 1RZIB 1LE5A 2D7TH 4UNVA 1BGXL 3FO9A 4BZ2L 4HUUA 2X4SA 5HHQA 2MMXA 1IM3A 4LRNH 1VFBB 2OK0L 3WFHB 1U41A 1MCPL 2MPAL 5EUOB 1P7QB 1ROWA 4F9PC 1I7UA 5FM4A 4XBGA 3RDTD 1AGEA 3H9HB 4XCNA 1PEZA 3IDJB 2VDML 4KC3B 3VXMD 1TLKA 4CRPA 4Z6AT 5KVDH 3CXHK 1CQYA 1KTLB 4OD3L 3MYJA 2RCSL 4KXZH 3N0PB 3ME0A 2AXFA 5FUCE 4G9FE 3HI5H 1N6QH 4WU7B 5BZWA 4Y4HC 5IGXH 1BF8A 2JB5H 2HFGL 1AD0A 1WZLA 3QDMD 2BY1A 5JIIA 1MRDL 1BBDH 3NOIA 1Y0LB 1FLRL 4X9FA 1T5WA 1AY1H 5C2UB 4G43B 5DK0A 2J1KA 3UTSA 4N8VG 4NFBA 1OAQL 1SJEB 4R2GD 3V0VB 1MAML 4K9EH 2ADFL 1CFTA 2XV6B 1KB5B 4UBDD 1JMXA 5ALBH 1R3KA 2DDQH 1OHQA 3TYFB 3WFBH 3DUSA 5I1EL 3QQ9C 1EXUB 3SE3A 5CHNA 1FO0H 2F74B 3CVHH 3B6SA 1CDUA 2J5LB 2EO9A 3MV7A 2YD1A 2NYYC 4V2CB 1I7TB 3GGWB 4H88L 1RJLA 4PJBF 5BRZA 4YHYB 3C2SA 1XZ0A 4BYHA 4RFNB 1FH5L 2CMRL 3EFFB 3GI9L 3LEXB 5DC0A 3MRKB 3WS6C 5F9JB 4X9HA 4ZD3H 1S9WA 2R1WB 3S5LB 4CDHA 5HPMB 4KHTH 5IFAL 4PJIB 5JORA 1RUPH 1YEEH 3KPPA 4F80A 3JV6A 1RI8A 1OP3K 3UP1A 4G6JH 5IHUH 4P48A 1YEKH 1ZOXA 1HIMH 3VI3F 3CK0L 3VXNB 4BM7A 4CNIB 1YEDB 4KRPD 2DQCL 4R3SA 5KSAD 3RAJL 3VH8A 1VFUA 5GGRB 1NC2B 4E5XA 5IF0A 5D2NE 4F2MA 2P5EA 1S7QA 1EPFA 1XF5A 3T8XB 3IGAB 1ZHKB 2VAJA 2XTJC 2ED7A 8FABB 1IQDB 1I8KB 3PWJA 5F8QC 1SVZA 1T5XB 1U8NB 4HDIB 4PJDF 4M1DL 4OKVA 5DUPL 2CKBB 1G1YA 1FBIL 4APQA 4IIQC 3FB8A 3T4AB 5D7LA 3SDCB 4RAVB 5IKCB 3O3BB 4KTEL 4HT1H 4IHOB 5D72H 2P5WE 1G9MH 3O4OB 3V4PL 3O0RL 4Y16C 1KEML 1I8IA 1XCTA 4QHKI 4PJ7F 4N5ED 4P4RB 1X3DA 1ORQB 5T5NG 4ODHL 3MNWA 1A7RL 4KVCH 3GJFA 1X5YA 3VRIA 5C0EA 1J1PH 1NAKL 4ZYKA 1JYNA 3ARYA 5I8OH 3VW3H 3D18B 2DM2A 2I26N 2VLLB 4PRDB 5TE6L 4H8WL 4S1SH 1JGEB 3MRCA 4MX7A 3OMZA 1BAFL 4G9DA 1QRNB 3QULB 2JCCB 4O51B 1ES0B 1EVUA 2CRMA 1DEEA 5F7HA 3MRGA 4JHAL 1E4KA 1Q9LB 1HQ4A 4JFEB 5EOTA 1OGAB 3H9SE 4LGPB 2JELH 1K4DB 2FGZA 5CD5D 3PWNB 3KYKH 3DO7B 3LZFL 4WW1A 2A6KB 5D8JH 2VN4A 2ZUUA 3NZ8B 1ZT4A 4LMQE 4YDIL 1JPSL 1QEWA 2M2DA 3QHTC 3QIBC 2FZ3A 3GMNA 4X8JA 5CJ5A 3NCJL 4GXUM 3TN0B 3T2NL 2Y6SC 2UV3A 4C56E 1CDHA 1ZXQA 1WVZA 4HS6A 4TQEH 1OD9A 1KF9B 1LEIB 4LCUB 2BCKA 3GSVA 4GFTB 4MNQB 3QDGD 1SQ2N 2I07A 3W0WB 4HWZB 1ZHBA 3Q1SL 5HD8C 2X05A 4LPYA 4XXCA 1A22B 3R1GH 3LEVL 1DUYA 4GKSB 3QFDA 2CRZA 2YRLA 3HAEH 35C8L 1ZAGA 3EJJX 2EXYD 2BVPB 4LBEA 1CDIA 3KYAA 1XF2A 1IBGL 1PLGL 3ZSSA 4FQCH 4M3KB 5E6IC 3WE6B 2PTTB 1R3LA 5AUMB 4PREB 2OL3L 4ZS6D 2NY0D 3UTZB 1IGML 1XGTA 5HYSA 1VADB 1MRFH 4MMZC 4AG4H 3TBYA 3GBNL 3RX5A 2YXFA 4M6OH 2JJSA 1IGFL 2Q76B 5LGKA 1BJ8A 4PJAB 2VRAA 4Z7WA 2AJ3A 1NCAH 2YA1A 4BZ1L 3RVWD 4LF3A 2FJFA 2OQJB 4POZD 2AJZA 3DVGB 4RIRB 4JRYE 3MA7A 4MNHB 3TJHD 4WV1A 4JY5H 4WI3A 3MOBH 5CEZE 4JFFA 2EYTA 5MEOB 2VDPL 2OL3A 4CU7A 5E8DL 4ETYA 5E2TH 3MUJA 1V7NH 2IALA 5KANI 3KDMA 3MZGB 5EO0A 1BOYA 1AQKL 2B5IC 4LCWB 1FC2D 3O3EB 5GRJL 2X4NA 4LQFH 4WTXA 3SGDH 5F89A 4OCSL 5DZOA 4Y4HB 1JN6A 4HMEA 1KT2B 2C3VB 5HYJD 3ULVF 7CGTA 4GMSL 2NTSP 4HIXL 4MCYA 1N59A 2FEEI 3MACH 1A7OH 5MERA 3MUGA 3VFRA 4RCAA 2VLJD 1BF2A 3ULVH 2XWBB 3HE7D 1IGYB 3ZKND 1S9VB 5I2IA 5JHDD 1XGPA 1FIEA 3OB0H 4MD0A 1G9NH 2FDBP 3NN8B 4JR9L 2FJHB 3MBED 3S36H 3U2SB 5ADOH 4GKZB 1OVZA 1S9KC 5EZOL 4JREC 4K8RD 3SKJH 4M5YL 3BDXA 3SE3C 1XMWA 2WSKA 2YWZA 7FABH 4G6KH 4ZO9A 3HNSH 4LPUA 4RAHA 4DAGL 3I75A 5IM7B 3CAFA 3GEWB 5J3HC 3V6FB 2V9RA 2BVQB 3VXTA 5LAXA 4HUWA 3VJ6A 4GAYA 4I0PD 5CIPB 4JKWA 4G3YH 3E2HC 3LS5L 2HN7B 4AL8L 1TTUA 3QI9D 3U46B 4J1UA 5I1HL 1T1WA 5DTFB 5HDLA 5SV4A 2VLKD 4LAJH 5ID1B 4IJ3B 2N56A 3CFEA 1INEH 4YPJA 4PLKC 2W91A 5EUOE 2R9HD 5DHVH 3GMMB 1CD8A 3LAFA 3S9DB 3FRPA 5EDXA 5CMAB 4BELD 5I1AB 4KJWC 3AM8A 4Q0XH 2CDFB 2Q7YA 1J1XL 4R7DA 3FQRA 3JUZA 2AEQH 1AP2A 1AO7D 1VACB 3SJVB 5DJCA 3U4EA 4JQXC 2CJUH 3ZYJA 4OAWB 4LHUG 5DUBB 1ED3B 3ZHLA 3C60B 3KR3H 3EYVA 3MNVA 3T0WA 5D7IF 1OTSD 4HMCA 2XTJB 2A0LC 2R2BB 4TVSa 4KDVA 1GH7A 3GUTA 2X42A 4P9MH 1II4E 1F6AA 3RNQA 4ZUVB 1F90H 4AT6A 5DVNA 4KK5C 4APQC 1VPOH 1VFAA 1FYHB 2GFBA 3P73B 3KYOB 3RTQD 4NJ9L 4OGXL 4E41A 1SY6A 4PV9B 3HC0B 1DBJL 1FORH 4J12A 1MHHA 1MCLA 2VTFA 4BSVB 1FYTD 3EFDH 1MHEB 4D9RD 3TO2A 5JW4Q 1CL7I 1CN4A 4OGAC 5FHAL 1VEMA 1U93B 5SWSA 2BX5A 1MI5B 1EO7A 2X1OA 1Z0MA 3PF2A 5IB5B 5D2LF 3UYRL 3EO0A 1T66C 2EC9T 5DHYA 1K6QL 5DK3A 3KLHC 3EOBB 4K2UL 2ICCA 4Z78B 3HS0A 2I25N 1PX3A 2HJKA 4ZOEA 3SDXF 4PJIE 1E4KC 4AEHH 2OJEB 4DGIH 1KNOA 5DLMH 1IAOA 4P5MA 5I19L 1UA6L 4ODBD 5IW3A 4W68A 3DMMA 4XCCL 1JWSB 4LSSH 3H42H 3QIBB 2PTVA 3UJJL 4PJ7B 4XP4H 5H35A 5BV7B 1MCWM 4JRXD 3H7BA 3DI3B 3OJ2C 2EYSA 4F15B 1RZGA 3CFCH 5HY9A 1UH3A 4KK8D 5KN5A 2AQ1A 4JN1H 4UDTA 2VABB 4XXCC 3MRIA 4M93C 1QSED 1S7RA 4JKLA 4KQ4L 3U0PA 3HI6H 2E7HA 2B1AL 2BRQA 3ROOA 4LCYB 4AZ8A 4TRPL 5GS0H 1F00I 3L5JA 4YAQA 1XF4A 5E2VH 3RWEB 5C7XH 4Q6IB 1R3IL 2VH5H 3IETA 5GGQH 4YQXL 3FONA 3ARDB 1Y18A 3KNBB 2R2HB 3MLVH 4ODVL 3ZHKA 4I48A 3DBXA 2JJSC 4LL9A 4Q6YA 3CDYA 5HHQB 4TN9A 3I2CH 1A1OB 1QRNE 5J8OA 4BA8A 1QBMH 2JCCE 2HH0H 5EBLB 2HKFH 3U7YL 1I7UB 1YN7A 4XBGB 4OSUH 4WV1C 2VISA 4WUUB 2VDLL 4Z77B 1OGAE 4KZDL 1H8NA 3TIEB 1ZS8A 1RZFL 3QUKB 2D7MA 2PR4L 2W0KA 2C26A 4NJAH 5CSZB 3CD4A 1S78D 2AXFB 2VXQH 4ZS7L 2W0FB 3MRHB 3HRZB 1NCDL 2BC4A 4M9PA 4Y2OA 3DX6A 3TT3H 3GSNH 3MV8A 1KPRA 4JFYB 3H8NA 1S5HA 5DA0B 3I9GL 1XR8B 4ELKA 2VN7A 5ESAA 2BSSA 3NCEB 5BO1L 1ZK9A 3OB8A 4MNQE 2IGFL 1F42A 3W0WE 1A6WH 4KKAC 5D9SA 2VXTH 3W9DA 4OZFB 1FJ1A 3FOMA 4LLDB 4PFEA 5LKNA 1R3KB 5I8KL 4QGYA 3M45A 4HGWB 1K85A 1S5IH 3GNMH 3LPGA 1FG2A 2HTKC 4DKDC 3D2UD 1FGNL 1A4KB 3S35H 3ARVA 3LRSA 4LLAA 3D85A 4EOWL 5EUKB 1I1AC 1RJLB 1KIQB 1P4LB 1XZ0B 2N7AA 3B9DA 1FE8H 4XI5C 1FN4A 4LNVA 1S9WB 4U31A 2Z4QB 2Z31B 2G75B 1RUQH 5I75B 1ORSA 2CK0L 4YDJA 3D0VA 5JPNA 5KZCD 2R1XA 5LBSL 4G80B 5AWNH 3MXVH 2OJZH 3T3PF 3AM8C 1FV1A 3VXMA 4QXGH 3HTLX 1C5CH 1MWAH 2PF6A 3IAQA 4NOFA 4YHNA 3K7UA 4LCWE 1T0MA 4XPFL 5BS0B 5EH1A 2CH8A 1X9QA 3HZKB 5IBUB 3VH8B 4KI5C 3FT3A 2P5EB 2X70A 3KPNA 2V17H 4UTBL 1Q9KB 2XOTA 4ZPVB 4N0CC 1M71B 1DBMH 2BVEA 3MV9D 3ZMRA 4CMHC 1HDMA 3QDMA 2FH6A 2R0KL 3CCHA 1FZKA 3PIQA 4APQB 1I3VA 2ZZUT 5IESL 1F4WH 2A6IA 2F15A 5AG8A 1RPQA 4UNUA 1JZ5A 1H5BC 2V7NA 1XCTB 3G9VA 4I18A 2QKIA 2FSEB 2E9BA 3WXWH 1NGQL 4XCFL 3IFOA 5DMJB 2DWDA 3GJFB 4Q97A 3PV6B 4JY6B 2P8MB 3MRNB 4MQ7A 3AC0A 3NIDE 1CDGA 1HN1A 2P49B 1N26A 2VWEE 4UNTA 3MO1A 4P2QA 3MBXH 5HBBA 2YBRB 3EIFA 1U95A 3ZT7A 1KIPB 1T04A 4OUUA 1HKLL 4HX1B 5JDSA 2X7LA 1J10A 4CL7A 5LXGH 1U8JB 2HKHL 4RZCA 5D7IB 3A6CH 3BDYH 4XRCB 1DQLH 4YR6B 5HGDB 5I9QC 2LQRA 5EOTB 3ESUF 3OXSA 1NUNB 3U4BL 3BISA 1EGJL 3VFUA 3NA9H 4I0KA 4KKCC 4L29B 2QQLL 4NQDD 3SJVE 5CEZH 1IFHL 4GT7A 3DMMC 3QEUA 3D0LA 5F7NC 1VEOA 2XY2A 4X8JB 4PJ5D 3QBTB 2XTJE 3S37L 5HI5C 4Z8FH 3DSFL 4RGNB 2DTML 3WDJA 2BCKB 3WJLA 5DWUH 4I3GA 1EGJA 3NPSC 2I07B 2I24N 1A14L 2QEJA 4PR5B 5F7EL 5H94A 1WEJL 5CZKA 2ADGB 4NHCL 3QNZA 1DUYB 4MDJA 3OJDA 3MRBB 2NR6C 4NKOB 4MJ2A 4ODXA 4NC1C 1JTOA 5D2LB 3TNMB 1WIUA 4ZO8A 4YE4H 2VLME 1A7PL 4KRLB 4PJXF 2EKSA 3OZ9H 4DVBB 3C09C 2GTWA 2F53A 1OWRM 3ISWA 1KLUA 3BPLC 5HHNA 3V5KA 5IB4A 1N7ML 4I1NB 4JDVA 4XNMA 2D03H 3EJYC 4ZXBC 3LIZL 3IVKA 3C08H 1DL7L 4Z7WB 4UT6H 1D5XB 4LF3B 1AR1C 4XZUA 3MA7B 4RX4D 1SEQL 1T1XA 1I85A 2K1MA 4RRPG 5EO9A 5C0FB 2NTFB 5T3XL 1T6WA 2ED8A 3O6ML 4AEFA 3V0AC 1FVDA 4JFFB 4U6VH 3O6KL 5CINH 3QUZD 3ARGD 4L4TA 4QOKD 3K3QA 1RULL 4POYA 4XCEA 1JJUA 2ZOKA 4S1RL 1P1ZB 4Y4KD 1IAIM 4JVPA 4LASH 6CGTA 1ZTXL 1J05A 2MKWA 3AB0C 3BUTA 4NM4H 4PJ7E 4WW2A 4EI5A 5BVPH 2DN7A 2R0ZL 2VDKL 3HPJB 4A2MA 4EKXA 4MCYB 1J0KA 3CFJB 4U1GC 1K5NA 3OBAA 5D96B 2FB4H 1Y6NR 3KPSD 1CXIA 2BNRB 2A38A 1Q94A 4Q9RH 5EO1A 5I2IB 5SWZA 1XH3B 5CWSB 4LRIC 1CGXA 2B1HH 4OCYL 4DK3A 1OQOA 1BWMA 2IMNA 1DCLA 1UEYA 3OKDA 2YA0A 3ULUF 1V05A 1A6AA 2DQDH 4KROC 5E8OB 5SX5K 2HT4D 5EWIH 4DZ8A 5D1ZB 4HJGB 5TQ0H 3TCLB 4NQSA 4OLYH 3OJMB 5E8EB 2Q8BH 3ULUH 3PP3H 2VUOA 2ZJSH 5EZLB 1NBVH 3I75B 2Q87A 1NAMA 2PYED 1BREA 4DK6A 2F5AH 1I1AB 4HKZB 2FBJL 1HHKA 4PJFA 3ZE0F 4HLZG 3NZHL 4J1UB 4QXUH 4LK4A 3S98A 5JW4N 1JPGA 4QKXB 3MRLB 1QA9A 1FL5B 3DIFB 4EXKA 4XHJD 3LRHA 4JHZA 4I77L 1J5OH 2J3SA 4WUUE 3OAUH 2GUOA 2APXA 5C9JA 2CR6A 5E7FA 4R7DB 4Y7MA 4YXHH 1JPTL 1B2WH 4P2OD 5T1MB 5DJCB 1L7IH 5JA8B 2CDGB 3HCVA 2WQ8A 1KJ3L 2JJTC 4QHMA 5IW6B 5IUSA 5FKPA 1FFNB 4K8RL 4HFUH 4DQOL 1YEFL 1KJ2A 4OLZL 4YEFA 1INQA 4V2BA 5HYJA 4CMHB 1OCWL 3FOLB 3O3AB 1C16A 1F6AB 3RNQB 4FFZH 2Z91A 2EDBA 3HE7A 1VFAB 2XWTA 1EDQA 1U9KA 5JHDA 1RV6X 5HHOB 4R2GC 4X4ME 2XICA 4G6FB 1H5BB 2GITA 4HXBL 1QR4A 5C0AB 4UBDC 1BQLL 4P23D 3QAZC 1MHHB 4I18C 2A6JB 2DQUL 4OLVH 4RWYL 3Q5YA 5DMKB 4BQCA 1B0GA 4P3CH 4NC2B 1FHGA 2VL5A 1TQBB 5IHZA 3HZVA 4RAUB 4YXKL 5GHWL 2LABA 4I0PA 5IOPB 5JIHA 1D6EA 5DZNA 5CGYD 4BSJA 5EZJB 1Q9OB 1JCKA 3CUPA 5IT2L 3LDBC 4OM0H 1LO5B 3FMGH 3RJDA 3L3OB 1RUKH 4N90E 3N9GH 4IS6B 1F97A 4YGVA 4MNGB 3P3YA 4FQJH 4RWHA 5DD0H 2Y25A 4L3EB 3MLRH 4H5SA 2D0FA 5IVZA 1HQRB 1R0AL 1WLHA 5L0QC 2B4CL 3KJ4C 2ITCB 4HIEB 4DCQA 3UC0H 5BS0E 1RZ7H 3S4SA 2UYLB 2AJXL 4KRPC 3GMQB 2J12B 2P5EE 1ZWIB 1NCWL 4JKKA 3GHBL 3QUYD 5EA0H 4WWKB 5H35B 3BD3A 3BIKA 3P0YH 4LHUD 1AKJD 4KHXL 5FYKE 1ZHNA 3NPSB 4NGHL 4PD4K 5KN5B 1SYVA 3IRZA 4UDTB 1NUFA 2BERA 3V4VH 3VGAC 4ZG1A 5HVHC 5HI3D 3FQUB 1UJ3A 1BM3L 2J8UF 4FABL 3RTQA 1K3ZA 2ZKHH 5A3ID 1T2QH 3G9AB 3VFSB 4RQQA 4N5EC 1A6ZB 1UH2A 3WEXA 5FYLH 2QQNL 3A6BL 5D6DA 1BZ7A 3PWPD 5I71C 1QOKA 4HUKB 2A9NH 5L2KB 4ZXBB 3LQZA 4LLVB 5IW1A 1YEJH 5JZ7D 4GW1B 2DQIH 1I8LA 1CR9H 3ZL4L 1I85C 2VDQH 5D7IE 2XKNA 3BPCB 3BEVB 3MOQA 1OAXH 5D5MA 2Q8AL 5EBWA 3RNKB 4IBLT 1G7PB 3VWKB 5LWYL 5FGBC 4JFZH 4YHML 5J1AA 5CD5C 5DD6A 3GHEL 1L0YA 4JKPL 4LSPL 4AIZA 3CZFA 3LN4B 3EO9H 1OY3B 3GSRB 1GC1H 1FL6A 3DX6B 5GRUL 4NT6B 2FL5A 3LRGA 1M7DA 4I4WB 2EDQA 3DX9A 1S5HB 1LEKA 4GAJL 2W60B 3WXVL 1GGBL 3V5HB 2AJYH 4EVNA 5IVXB 4GW4A 1JBJA 2EZ0D 4M62H 4RA3A 2ICWJ 1MHPH 1MRCL 4JRXA 1Z9LA 5K59F 1QKZL 5DR5L 1UCBH 3UPCA 5H8DA 5D7KE 3QSKB 3VD7A 1FQ9C 3GBLA 2YD6A 3TBVA 4K7PH 5C0BD 1PW3A 4R26H 1I7RA 5D2LE 4U1SB 1OOAA 2Y36H 1RU9H 4X4YA 1FG2B 2IADB 4PTUA 1CD1A 2BNQD 1P6FA 1CL7L 3P4LA 4DGVL 3LRSB 5IB3B 4ZS6C 2NY0C 4XH2A 3I6KA 3SY0B 5TDOA 4EEEA 5GGSY 1NGPH 3HMXL 3WFDH 1RUMH 1FN4B 4Z7WE 5AZ2H 4LKCB 3CLFH 5DJYB 1M7XA 4NWUH 3RVWC 1HWHB 5IP4A 4YDJB 4L4VD 1EEYA 4POZC 4ZFOL 2O93L 3SGJA 5C0RH 1I3RB 1QR1A 3QO1A 3EYQD 3TJHC 4YIQB 1LP9F 3UJIL 4JFFE 3RDTB 3X11B 4EBQH 1CFNA 3RWGB 5ICYB 3MCLL 4Q2ZB 1SHMA 4G42B 2HWZH 1NEUA 5JR1L 3VXMB 5C6TL 4Z0XB 1U8OA 3BN9C 2OXGA 1U8QA 3SE8H 3V7AG 1C1EL 2XG4A 4YHNB 2UVFA 3WIFA 2XIDA 3HMXA 1FCCA 4AIXA 3MODH 3T0VA 5HYQB 3FT3B 4RBPH 5DJXB 4P9HC 4AM0A 2C9AA 3QEGH 3WNLA 1E6JL 1MCOL 3CSYB 4D9LL 5DQDH 2AV7A 4ZFOA 4HAFA 3SGEI 4O5LH 4PJEA 3EDDA 3QDMB 4LCIL 4AEIH 3NABL 4ZO7A 3CCHB 1FZKB 2GT9A 3PIQB 2BNRE 2DQGL 2E6QA 4FFVD 4DN3L 5DMGD 3VD9A 3HE7C 4L8CB 1G7HA 3ZKNC 5T33H 3MOAH 2A6IB 4H25A 4BSWB 5JW3L 3WJJC 3ZHDA 3MBEC 3BUYA 3QAZB 3WO3B 5I1LA 3OKLB 4RDQF 3HC3H 4K8RC 4PV8B 1FPTH 1AI1H 1T1ZA 5EC2A 1U8PA 1C08B 4NKMA 2H8PA 4PBVC 1S9XB 2P24B 3DETC 4PGDB 3H7LA 1EIBA 1T1YA 2NY5C 2F54D 1KOAA 1WFUA 2AEPH 4I0PC 4PG2C 5EU4A 2Z9TA 5GQBA 4YFDB 3CFIC 4EUPB 2NX5D 1MPAH 1B90A 4U7KA 4MAYD 2X7LB 3UPRA 3NACH 1Z2KA 1KN4L 4NM8L 4F58H 1G9EA 3ARBD 1CZ8L 3HHRB 3OXSB 1J0JA 2R9HC 4G8GB 1IC5L 1I8MB 4HUVB 2AEIT 3WNPA 1JYVA 3ZO0A 4NUGL 3T3MF 5L0QB 4ZFFA 3KJ4B 5DRZB 1NLBL 1GVIA 5L7XH 3QEUB 5DC9B 2VKXA 1BVLB 1X5HA 4KI5E 5KSAB 3PUCA 1QFWL 1CK0H 5DSCB 1UWEH 5DQJB 1SJXA 3D9AL 3QUMB 3UTTD 1GHFH 1BVKB 1YQVH 3MV9A 3UZVB 3H9ZA 4KPHL 4NZDA 4OZIA 4J23A 4TNVK 1JHKH 3MXWL 1DQML 1QNZL 4PJ9D 4NWTH 3HG1A 3LH2L 4OCWL 1F58H 2B4CC 3FQTA 3QNZB 5HVHB 4FNLL 4NFDA 5HHOE 2BOCB 3WN5C 5FK9B 2W9EL 4PIRF 3RPIB 4UV4H 2WAHA 4F33B 2O5YH 3RTQC 3P4MB 4S0TD 1SBSH 5C0AE 4NKDA 1P84J 4IDLA 4OB5H 2ICEB 2AQ2A 4Z7QF 3V6OA 2GTWB 4N8VA 3VGEA 5FYJU 2VZTA 2Z35A 4JG1H 4PJCA 5D6DC 4OLUL 2EDXA 1KLUB 3FZUD 5GGTL 4HKXA 1QO3A 5CBEA 2HTLD 1GIGL 5I71B 1A9EB 1QFUL 2IH3A 2NW3B 4QTHB 3W11D 4DW2H 3WSQH 1UCTA 1XAUA 3IF1B 4ONHA 2HG5A 5F71A 3I3DA 2YD5A 2WBWB 4PS4L 4Z7UA 1I8LC 1TQCB 2IG2H 4RGOL 3CU1A 5F72S 4D0BB 1UXSA 2DYPA 4MNGE 1Z9SA 1MUJB 2HFEA 2XA8H 4Y5YA 3TA3A 3QXDB 1D5BA 2Z92A 4R90H 4L3EE 5GGTA 2X2YA 4XCEB 1ACYH 3NFPA 5KW9L 3HB3D 4XBPB 5ANMB 5E1AB 3LKOA 3QJFA 1JNNL 3QQNA 1OPGH 4NQDA 5ACMA 2X89D 2KBGA 2X4TB 2J8UB 3QIUA 1LO0L 2AGJL 3BYYA 5CJQL 1BGXH 4PJ5A 1NFKA 4BZ2H 2FR4B 4LQ1A 3FQWA 3L7EA 5T3ZE 3I50L 2VIRA 2OK0H 1EJ6A 1MCPH 1WAAA 2MPAH 3QDGB 5FEBA 4KK8C 4LHJB 4B0MM 5FO7A 1EMTL 1BZQK 2CUHA 2AK1L 2VDMH 1EFXA 4G9FD 1A6AB 4HGKC 5JW5A 4H26A 3QXVA 4KKLD 5BXFA 4U6YB 3S6CA 4OD3H 5INDA 1EK3A 2RCSH 4JPWL 4JN2B 5HGHA 3SKNA 1EAPA 2WBJA 3WFEL 3K2UL 5KSUB 3MC0A 2NY0B 5GS1A 1W72L 5JOEA 1NAMB 3NAAL 2FWOB 2HFGH 3F12A 4R4BA 3HC4L 1TTGA 5L2KE 3UTOA 4D0DB 4M3JA 1MRDH 3D48R 3CPLA 3QPQD 1FLRH 5CJXA 1HSBA 1QA9B 3UAJD 1OAQH 4RX4A 3SGJC 5E4EC 1MAMH 2QBWA 4XP9L 2ADFH 1I9IL 4ZQKA 3NBNA 5J9PA 4X9GA 4GSDL 4W70A 4J3UA 5C9JB 5I1EH 3LOWA 3QUZA 1W72A 2NY1D 3RWJB 3JV4A 1MF2L 3FT2B 1JYWA 5GZNC 2Y07L 2C7UA 2IH1A 5B39B 4Y4KA 1FNHA 2N4IA 1S78C 5FA4A 5FKPB 4H1LA 5IQ9A 2BK8A 2DQTL 4H88H 2VKWA 1I4FB 1KJ2B 5IVXE 4JJ5A 3TO4A 4P2YA 1FH5H 3BT2L 2CMRH 3GI9H 1TPXC 1C16B 1HH6B 3ZKMD 3VFWB 1R3JB 1ZT1A 2VLJB 4KKBD 3UPAA 4X7FC 5IFAH 2XWTB 1JGDA 3G5VA 3V9FA 5JHDB 3PP4L 1AE6L 2AK4D 1O5DT 5ETUA 2P42B 4M03A 3MBEB 4JO1L 4MJ6A 5CZVL 3LKNA 4JFPA 3CK0H 2PO6D 2VL5B 1LP9B 1YPZF 2DQCH 3RAJH 3RP1A 4MA3B 3HZVB 4N0YL 4I0PB 4XNXL 1N8ZA 2PYEA 3FN9A 3W2DL 2IAMD 1MCEA 3QI9B 2R29L 4M1DH 4YK4C 3KYNA 5DUPH 4NPYA 2E8YA 4Z7VA 3TBSA 1FBIH 2VLKB 5EOCL 1U8MB 3HNVL 4KTEH 4M61A 4X6BA 5DD1L 2AJUL 1JWMA 5TF1L 4MDIB 4QWWD 5HDBF 3V4PH 3O0RH 4N0FA 1KEMH 4FQXA 5IVZB 3RWFA 3VXME 1CGYA 1W2KT 3NCCB 4J3OC 1N2RA 1XGYL 4ODHH 1FZMA 4NNPL 1A7RH 2LU7A 1AO7B 3H2WA 4P2OA 1G6RA 3U9PL 1NAKH 5DDHA 3Q6GL 5HI4C 5CFHA 4BKLA 3VGDA 4K71B 4KAQL 5J56B 5I1DB 3E6HB 3IYLW 4F37K 5TE6H 4H8WH 4HWEL 3KXFA 3QDME 1BAFH 1G7QB 3PHQB 4IOIA 3MUHL 3M8OL 1DZBA 1A1MA 4HWBL 2H32A 3OAZH 4JHAH 2WIIB 5ICZB 1G7IA 1M7IB 3WN5B 2QSTA 3ZE0E 3LZFH 2BVOB 1NCNA 2R69L 4L9LA 4P23A 3UJTL 2AP2A 3V6OC 5IROA 4YDIH 5IK3A 1FYTB 1JPSH 3WNKA 4JZNA 3LSOA 1EBPA 3G5XA 1TDQA 3NCJH 1IQWL 2VR9A 3T2NH 3SO3B 1EH9A 4HWBA 4C57C 3WLWD 4PRAB 2VJXA 4M43L 2AJVL 2ATPA 1AD9A 1Q8MA 4OCLC 2J8HA 4ALAL 3CVIL 3Q1SH 4XP1L 4QTIL 4WHDA 5FB8B 4UQ2B 3LEVH 2O5ZL 5EBWB 4QRPA 3INUL 5DS8A 4L5FL 4G8GE 4Y5YC 4CVXA 3P9LA 35C8H 3O9WD 1OT2A 1IBGH 1PLGH 3G08A 3CZFB 5TE4L 3OF6A 3MGAA 5C3LD 2C1OB 2OL3H 4X9IA 1IGMH 1VESA 3A6OA 5GRZA 1MCKA 3GBNH 4ETQA 1T0PB 4GW4B 3HAEG 3R06A 1IGFH 2WM0A 2A83A 3SGKA 4OTXL 1WBZB 4BZ1H 4LHUA 5DEGA 2JLLA 2SEBB 1HH9B 1DP0A 3P4NA 4X7SL 3B83A 2AABL 5C92A 4KTDL 3TBVB 1QSEB 4LOUD 1AGBB 5FYJD 2WINA 4LLMB 2VDPH 4PLNC 3RIFF 3G6JF 5E8DH 3DRQA 1SMOA 5HHPA 3D69A 4HHAA 1AQKH 1CD1B 3F6IA 4PJHA 2OP4L 5TDNA 4OZFG 1IT9L 5GRJH 4QRTA 3CGTA 4NQCA 2D31B 3B3IA 1BX2A 1F6FB 1KCVL 1PY9A 2K3TA 4OCSH 4JY4A 4WI4A 1S7TA 3KYMA 5GS1C 5C71A 1NCTA 1A6TA 1R5WA 4XH2B 2X1PA 2VAAB 3NCBB 2JB6B 5A2JH 4GMSH 4HIXH 4XMLL 3HN3A 5CJXC 1RIUL 1E27A 2ZUQC 1EEYB 2L7JA 5E4EB 1KTDB 4OF0A 3QO1B 4LAQL 4JR9H 4WTZG 3FB6A 4GUPB 4KFZC 4RFEA 5EOQL 3UZQA 1T03L 5EZOH 1IEAB 3QUZC 3ARGC 3V2AR 4M5YH 3QJHA 1U8QB 4F7CA 2WWKT 4CUCA 5L88L 5ANME 5F21B 2YR3A 4NCC1 5F7DA 4K7FB 1DE4A 4XGZA 4OZ4B 4DAGH 4X4XB 1HZHL 4Y4KC 3GBML 1HNFA 2YC1B 3D3VA 2J8UE 5I1JL 4NNXA 5GGSA 2UZXB 3LS5H 4AL8H 2I9TB 5I8CB 1BIIB 4NQED 4X6EA 5I1HH 4OCMC 5IBLD 4WO4B 1TPXB 4YHLL 2ESVD 4UUJB 3RKDD 5IBUG 4EDXB 3WIIL 4DOHB 2PW2B 3QDGE 5KS9F 5EPMA 2UWEB 1G7HB 3SCMD 4M1CC 2IF7A 2VQUA 5C0BA 4H25B 5JPMA 4F7MA 3NA4A 5GJSL 3T65A 5CEYB 2BVYA 1J1XH 2HT4C 4HPOL 4WENB 4FFWD 3ZE2E 3VE0B 4AH2A 1U8PB 5KAQF 4NKMB 2BNQA 3D2UB 5CSBA 3O8XB 1GPOL 5T1LA 1GOFA 1TZHB 5DYOA 3RU8L 2DS4A 4X6FB 1R5IB 5EU4B 3TZVD 3WMSA 5JMRA 3IU3A 4PJFE 3RWDA 2A6DB 2ERJB 4X6DF 4YK4B 1MHCB 4QYOA 1JWUA 3MRPA 4GG6A 2UVEA 3DGGA 3VCLA 2XQYG 4H0HB 3VFNA 5FO8B 5HYEA 4XHJC 3X17A 3K1KC 4NJ9H 5KZCB 4OGXH 3EJZD 5F88B 3JUYA 3D5OF 2LTQB 4FQXC 5K59E 2EEBA 1TXKA 1DBJH 2BY0A 3U30B 2Q6WB 4F3FB 5EBMA 4P2OC 4U2YA 4LLQA 5FHAH 3QNXB 4BK5A 4O58L 2FIKB 3VXSD 5DQ9A 2WBKA 3QXTA 1F2XK 5FIEA 4FMFA 4LPXA 3FO0L 5FF6B 1U3HB 3UYRH 1MCCA 2EDNA 5HYJE 3HUJB 3MV9B 1JZ2A 1K6QH 4K2UH 1CD0A 3P77A 1YPZB 2I9LA 2YRZA 4HJ0D 2VLJE 4MB4A 4A2LA 2AV1B 2X44D 2DLFL 5GRWA 2LU4A 5JHDE 4KTYA 5E00A 1G0XA 2G5BB 3IKCA 1OGTB 1L7TL 4URTB 5B4MD 1K4CB 5GSVA 1CU4L 4L9LC 4P23C 5I19H 1WV7T 2W65A 1UA6H 5IROC 4O2EB 4UI2A 1CGUA 4XCCH 2EEAA 4XVTL 3TWCL 4LSUL 1LP9E 1N6VA 2YXMA 4PYHA 2IH3B 3UJJH 4YC2C 1JPST 4XPHL 4YUEL 4M7KL 2BDNL 1SJHA 5F44A 2EC9U 2F54A 1VGEL 4MS8D 5CGYC 4XNZB 4DTGL 4OBSA 5C1MB 2BMKA 1YMHA 2NX5A 3OAYK 1HHHB 3MRJA 4X7CC 3TFKC 1R3HB 2VLKE 3FO1A 3VD3A 4EN3A 2ARWA 3WUZA 5GZOD 4KQ4H 2ZUXA 1OB1A 1AXTL 3ARBA 3NH7L 2HFEB 4Y5YB 2B1AH 2B7DT 2C5DC 1D5BB 2Z92B 4O4YL 3OPZL 4N9GA 4TRPH 4LIQL 3ES6A 4KJYA 1ZLVK 2XN9D 4GG8A 4UV7L 1R3IH 4YQXH 5GGRY 1CFVL 1DQJA 1AO7E 5E9DB 4KGLA 1KIRA 2V2XA 2X4UA 4UIKL 4PTTA 2YPVL 5DT1L 5E08L 4ODVH 1SM3L 4NN6C 4PJ5B 3UBXB 3K4DA 3EGSA 4JFED 4MD5A 4HV8A 2X9WA 3FQWB 3UTTA 4XB8A 1CF8L 3K1DA 3IDGA 2VXUL 3T77B 4WI5A 2YUVA 5ADPL 4LEOA 4L8BB 3U7YH 4PJ9A 2VDLH 4KZDH 4OFIA 1HCVA 1JI1A 4Y4FB 5HI3C 3BP4B 4CMMA 1E6OL 1RZFH 3DVNB 4KUZL 3RA7L 3HA0A 2Z8WC 2PR4H 2WLYA 4PJGF 5A3IC 4FN0A 4LSRL 4Y1AD 4GW5B 3SKNB 2MFNA 1BFSA 2HT2C 3EYUL 2X4QA 4ZS7H 3WL9A 1FYTE 1NCDH 1PZ5A 2DI8A 2P8LA 4NRYB 5DURD 4D9RE 5I6XC 2B39A 3QH3A 1KBGL 2MCPL 1HSAB 2VSCA 4KXZI 4R4BB 3I9GH 1MCRA 4TULL 2AXGA 3T3ME 3TBTB 1T7XA 1EEZA 1OSZA 3CPLB 5AZEL 3U0WL 3E3QE 1ZVYA 4U1HA 5BO1H 5F1NA 1HSBB 3PABB 4AQ1B 2Y5EA 2IGFH 5JZ7C 3QDJD 3LKSB 2ZUVA 3QA3B 2E3VA 1UACL 3MV11 5EU3A 3L9RA 3C5ZA 3U1SL 2OR9L 1QLRA 1PFCA 5LJYH 5I8KH 3QUZB 2ITDB 3ARGB 4P2RA 3IS1X 1ZANL 4QOKB 5D93B 3VFTA 1KACB 1FGNH 1MREL 1A0QL 4FXKA 1A6UL 4Y4KB 4LVHB 3VXPA 4ZDHB 3QRGL 2X89A 4EOWH 5T1KA 3G6JB 1ZLWH 4L8DA 1NGWB 3CLEL 3FFDB 2EZ0C 2ENYA 3BP7A 5D1XB 4JZJB 5K33A 1MLBB 4KUCD 3KPSB 2CK0H 2FD6L 4MA1C 4PY8J 1JGDB 1UGNA 2ATKB 5TFSL 3V79C 1QSEE 1GGTA 1CT8A 4WUKL 1KG0B 5LBSH 5ETUB 2DIBA 2V5SA 1ZGLA 4G9FA 1WWBX 2GTZA 2YD8A 5D7SL 4JFPB 2GSIA 4PJ8D 4XPFH 1EO8L 2X1WL 3LN9A 4XCYA 1UB6A 3Q5OA 3LMJL 3BKCL 5HJ3B 1J18A 1X4YA 4UTBH 2D7QA 3GO1L 2PYEB 2IQAB 2RFXA 4WCYL 2YD7A 4HZLB 2OS7A 1NDMA 1NANH 4LSQL 1N0LA 2R0KH 1DLHB 4QRRD 3TBSB 1UB5A 5IB2A 1F4AA 5IESH 3QPXL 5DJ8B 2XWJA 5B22A 2DWEB 5DVOA 4WEMB 1JGLL 4N0FB 3EYQC 4LEXL 5E5MA 2MNUA 5HDQL 3L6FB 1NGQH 4XCFH 3WDHA 5KS9B 4P2OB 1G6RB 5DDHB 3RKPA 3HZYA 3JTSA 4IOFC 4K7PY 4X7EC 3CDCA 4I3RL 4ZAKA 1NL0L 1IL1A 4RA0C 1PYWB 3KS0J 5A40E 1HKLH 4JO3L 2F58L 3KJ6L 5F6HI 4TUOA 6FABL 2P1YA 4OI8A 4M9OA 3WNMA 1A1MB 4LGSB 3CMOL 2HKHH 3BMVA 1Z5LA 2V7HA 2UWEE 3BKYL 5DMGC 3VXOA 3U4BH 2YUXA 1EGJH 3MNZB 5F7MC 4O2FA 4X6DB 4ZODA 5GS2H 2GAZA 3TP4A 1MCHA 5TDPB 5IBTL 4FQQA 4P23B 5D2NA 1GOHA 4QCIA 2QQLH 4MXVF 1X5AA 4HKBA 4LGRB 1IFHH 4XNYL 3WHXA 3VXQA 1BJMA 3M07A 1ZT7A 3QNYB 3EOAB 3QUXD 3SDDA 3MRQA 5ENWB 1H3XA 4FQHA 2W0PA 4XHQA 5K9QG 5CGMA 2D9CA 3MREA 1L4IA 4M1GL 3S37H 4R4FL 3F7RA 3MTRA 3DSFH 5B3NA 2DTMH 1IAKA 1QUNA 4BFIB 2IAMA 4GQ9L 5B8CA 3RY4A 2P44B 1A14H 2NY3D 4MAYC 5F7EH 1WEJH 5MHSD 1HEZA 4HW6A 4NHCH 1X7QA 4J3WA 1NFIB 4M7ZC 2X4OA 4P5TA 3ARBC 4OM1L 3S96B 4JFXA 2XTLA 5BJTA 4JANA 1A7PH 3EUUA 4LLUA 1MI5D 3QDAA 1OP3H 4CGTA 1IGCL 3ZE1F 3FHQA 2HVJB 1P9MA 2CO7B 4KY1L 3TESA 5C0GB 3LD8C 3F5WB 4OJFL 1N7MH 2RGSA 5CS7A 2R2CA 3R06B 3QUYB 3G5ZB 3LIZH 4WW2F 2IPKA 1DL7H 3HUJE 3MV9E 3H9SA 5F9OL 2VZOA 4LHUB 1AKJB 3BX7C 1BEYL 4WHTA 1YPZE 1URLA 3VWJD 1MFAL 1SEQH 4X83A 4KZEL 2PETA 4PJ9C 5T3XH 1S7UA 3O6MH 1CS6A 1N3NA 4NKQB 1H8OA 3O6KH 2WINB 5J13C 4F7PA 4GAFB 4HQQL 4HS3B 4NQVB 4GBXB 3HMWL 4GKOA 3O6FA 1RULH 3ILQD 4HHAB 3UZEA 2P8PA 3V6OE 3DURA 1ZHLB 1FFPB 2HFFA 4JDZB 4S1RH 4IMKA 4JDTL 4PJCE 3B3IB 4MSWA 3SBWA 3T2PA 1BX2B 1F11B 1ZTXH 3QB7C 4RMTA 5DJ6B 1S7TB 3KYMB 4WEUD 2RAMA 1A6TB 1PG7W 3BPNC 3FZUC 1J0HA 2HTLC 1MY5A 3C5JA 3M17A 3PWPB 2R0ZH 3HI1A 2VDKH 2DF3A 3W11C 2BP3A 4ZPTA 3SGDI 4PBWD 3G6AA 1I1RA 5JLZB 1EHXA 3D87B 2Y7QA 3CX5J 5GISL 2IPUK 1U8IB 1U8LB 4OCYH 1BZ9B 5HHMD 2WZPD 1JHLL 5ESVB 3ARDD 1S9YA 1Z3GL 4JFOA 3CFDA 4XPTL 3VFGL 3B2VL 5K93A 3LKRB 1IGTA 1D5IL 1TIUA 3QJHB 3DUUA 4WU5B 1X5KA 2F8OA 2EE2A 5ALCL 3HB3C 1ZA6A 3IJYB 3L3IB 4MZ3A 4NQDE 5E9DE 5TH2B 1NGXA 1EVTC 4JRYA 2FBJH 4PJ5E 4WUUD 4PJGB 2V5TA 1FRGL 3NZHH 1HHJB 3P4OB 4XPBL 4JEGB 1YMMD 1KEGL 2XRAL 5EPMB 2HA1A 4I77H 3GSOB 4A6YL 5MI0C 1MAJA 4IRJD 3IJHA 3SE4A 1CLZL 5INCA 2PXYB 3MLZL 4F7MB 1G1CA 1WIOA 1FLTX 1JP5A 1JPTH 4KKLC 5B38B 3F6LA 2BNQB 4AENA 4HIHA 1MCIA 1KJ3H 1VHPA 4JO4L 3X14A 2D7OA 3PJSB 4K8RH 4DQOH 1YEFH 4OLZH 3IJSA 1MCFA 3C6LA 4P3WA 4A6YA 2APVA 4OFYA 1OCWH 5E6YA 3WD5L 5IR1B 1FNSL 3OKNA 1EJOL 4NO0B 5IJVB 1WTLA 2BSRA 3LKQB 3VFNB 2VLRD 3BIAX 4FFYL 4L4VB 3UAJC 4HEPG 4B53A 4EUPG 1AGDB 4LSVL 4HXBH 1DBAL 1BQLH 4LHQB 3F7YB 2BVTA 4LFHG 2NY1C 4RWYH 1O7SA 1YNKL 4QOKE 2IPTL 4LLQB 3IXAB 1UKTA 1G0DA 1P69B 4YXKH 4PGBA 1VFBA 5GHWH 3WFHA 3P0GB 3G6JE 1HNGA 4N90D 4ZOBA 2J8OA 1P6AB 3HPLB 3ULVD 5IT2H 1CG9A 3H9HA 3OKOB 2ZPKL 2I5YL 3SEPA 5IEHB 3IDJA 4HUNB 5DEZA 3KPSE 2GW5A 1HI6A 3BH9A 1KTLA 2NQCA 2APWA 1IAII 5GGUB 4FZEL 1KB5L 4D0CB 1I1YA 2NZ9D 4Y5XB 1X5IA 2E7MA 1J9CT 4NP4L 1R0AH 3ESVF 4K23L 2B4CH 3EYSL 4MXQD 4WFGD 3OX8B 3O2WL 4PP1D 3AS0A 1CIUA 3KAAA 5CKGA 1SEBB 2PO6C 2AJXH 5F3BB 3R8QA 4Y89A 1Y0LA 1NCWH 4RGMB 3GHBH 4W6YB 2PYEE 2F54B 3H3PL 3HR5A 3V0VA 1SJEA 1CICD 1CTOA 3GMPB 3H6JA 4HG4J 2B20A 4KHXH 2BMKB 2D4DA 2IAMC 1YMHB 1KB5A 2MJWA 3TH3T 3QQ3A 4NGHH 4MAYB 1RD6A 1J8KA 3TYFA 2QHLA 4PGJA 2MQCA 5DJ0A 1EXUA 4GRLD 4E0RB 2IFFL 3ARBB 4P5TC 2F74A 1MH5A 3ARQA 4O2CB 1BM3H 3UCRA 1X6LA 4FABH 1GAFL 5D5MF 3AU1B 5I16A 2V2WB 4QWWC 4FQIL 1PSKL 1LD9A 4N9GB 4KJYB 4GOSA 3MLWL 2WQRA 1I7TA 3GGWA 3BGMB 3VRJA 1FG9C 5HVWA 5KS9E 2QQNH 5KSBF 1P9MC 3A6BH 2PCPB 3FAWA 5HTSA 3WS3B 3EFFA 3LEXA 5F9JA 3MRKA 1MCWW 3LD8B 4PTTB 2R1WA 4QT5B 2HT3D 1L6XA 4NBZB 2IMMA 3WLBA 3EGSB 4HV8B 2G9HB 4PJIA 1CXFA 3JWOC 1HXMB 1KULA 2CKBL 4K3EL 3ZL4H 2FO1A 1RHFA 1U92B 3QWOB 4FXLA 5GSRB 1FVEB 2Q8AH 3K74B 5J13B 3C6SB 4CNIA 4XX1G 1K9TA 2ZOLB 5LWYH 4X6DE 4U1KA 4YHMH 3PV7A 1I3GL 4UMGA 3GHEH 3O6FC 4JKPH 1NC2A 4LSPH 5GGRA 3RL1A 4J6RL 5CEXB 2DM4A 2LV4A 3T8XA 3IGAA 4HJJL 1ZHKA 2X4QB 1IQDA 1I8KA 4IMKC 4RGND 3WL9B 5I1GL 1DBKL 2P8LB 3SBWC 4BQ6A 4EXPX 1NJ9A 1T5XA 5GRUH 3MJ8A 4YHIB 1S7SB 1MEXL 3QH3B 5D7KD 3BPNB 1JTTA 2A74A 2CKBA 4U7MA 3T2OA 4GAJH 3WXVH 5IMMA 1GGBH 3GRWA 1IILE 3BZFB 3T4AA 1BFVL 3SDCA 4RAVA 3O3BA 1AC0A 4IHOA 1MRCH 3WLWC 5DK2B 1QKZH 4QRQB 3V8CA 5DR5H 3VDBA 4HCRL 3GIVB 1T21B 5SWQA 1ORQA 5C3TA 4DN4L 1U58B 3BO8B 5J4MA 2GK0B 1IM9D 4PPTA 1DVFB 3Q48A 1PG7L 3D18A 3RZCD 1UYWL 3VFTB 2CPCA 1CL7H 4FXKB 4PRDA 4DGVH 2JJWA 1JGEA 1JUFB 2R4RL 3MRRB 4PG9B 1D5MB 4NRXA 4HCRA 4MB3A 2JCCA 4O51A 1ES0A 3STBA 2NY4D 4L8DB 1QVOA 1E28A 4ELMF 3DV6B 3HMXH 1Q9LA 5B39G 4JFEA 3WO4B 1OGAA 5I66B 1NGZB 4GQPH 1XT5A 3VFPB 3PWNA 4GO6B 3DO7A 5C0JB 1TFHA 5C0IB 3TNNB 4G5ZL 4K3DL 4DWHA 4I3SL 3NZ8A 3UJIH 3SE4C 1PKOA 3MCLH 5GS0D 4LOUC 5JR1H 2H9GA 1M05B 5C6TH 2FX7L 1HYSD 2CIIB 1GXEA 2GTZB 1C1EH 3SDYL 2GSIB 3TN0A 4P46D 1RMFL 2B0SL 5BQ7A 2VDOL 4XCYB 5F7FA 1BECA 2WP3T 4LCUA 3W0WA 4HWZA 1E6JH 1MCOH 3I3EA 3PWPE 5CJOL 4GRWH 4D9LH 3LN5B 2VXVL 4GKSA 4X8XA 4LCIH 4NO2B 3NABH 2MKLC 1UENA 1UB5B 4JPKL 4FQ1L 2DQGH 1QD0A 2BVPA 4DN3H 3K0WA 3QDJA 2PTTA 5AUMA 1RQ5A 5JW3H 1H3TA 3QCUL 4EQ2A 1FNEB 2NY1B 3O3DB 5AAWA 2Q76A 3RX7A 4PJAA 5HVGB 4YX2L 2OQJA 1R24A 5DVKA 3DVGA 4LARL 4RIRA 4V1DD 3MJ9L 3V95A 4MNHA 4O9HL 4PJGE 5JMOC 4QHNB 1T0NA 5MEOA 4WFHD 3RKDC 1KN4H 4NM8H 4Q9QL 2Y06L 2YD9A 1Z5LB 1CZ8H 3VXOB 4RDQG 4YFEA 1IC5H 4LCWA 3SQOL 3DTXB 1QQDB 5C0BE 3ZT5A 3SCMC 2AK4B 3OTTA 1J7VR 4ZOAA 2DTSA 4NUGH 4NZTL 4FQQB 2R2EB 3JV0A 1A21A 4QCIB 5K9QI 1KT2A 2C3VA 5ITFA 4FFWC 3MJ9A 3VXQB 2BNQE 4NYLA 4W4OA 4PJ8A 2PO6B 2Q20A 3MFGB 2NY6D 2LE9A 2EC8A 4FQHB 1MFNA 1QFWH 2IC2A 1JNLL 3MREB 2XWBA 4NKIL 2GEEA 2RBLA 3D9AH 4LLWA 5H37H 1S9VA 3DSNA 1FZJB 4MA8L 3NN8A 4KPHH 1JNJA 2XG5A 2EDRA 3PWLB 5C0AD 3MXWH 1DQMH 4GKZA 1MVUB 1QNZH 4OQTL 4QRRA 4KRNA 4OCWH 3LH2H 4ZNCD 4FNLH 3BSZL 4L4VE 2GJ6B 2W9EH 2HLAB 1BMGA 4PBXA 4ZUTB 3EJZC 3MRDB 3V6FA 1NBZB 1ONQB 3OR7B 1PGRB 5CIPA 2QSCL 4HSQA 4MQTB 2HN7A 5F3HA 4OLUH 4ISVB 5GGTH 4RFNC 3MRFB 1GIGH 1WT5A 4KDWA 5ID1A 1QFUH 4XT1C 4OQTA 3RHWF 1NBQA 3WCYA 1T2JA 3GMMA 5E56A 2DRUA 3QCTL 4QNPE 5CMAA 2CDEB 5I1AA 4UU9A 4PS4H 4WHTB 4CAGA 4HS8L 4RGOH 2CDFA 4HJ0C 3PDOA 1UZ6E 4D94A 5GJTL 3VG0L 5C0CD 1VACA 3SJVA 2ZNWA 4K94L 4NCDA 3I6GB 4OAWA 1S7VB 5DUBA 1ED3A 1FO0A 2DMKA 3N50A 3C60A 5B4MC 3CVHA 3FO2B 5KW9H 2EIZB 1WZKA 2JTDA 4WWKD 2HFFB 4MA7L 4XBEL 3MCKB 1RHHB 1JNNH 2R2BA 2JJUA 4XC3L 3DHMA 4MSWB 5CLTA 1HHGA 4RFOL 2Q86B 2P7TB 3OWEA 1LO0H 2AGJH 4XAWL 5FV2A 1OL0A 2IQ9L 3QO0A 1DANT 5CJQH 2F54E 3HKFA 1A3RL 5AYUL 3RUGF 3SDCC 5EU7C 5TGBA 4Z76B 1U3JA 4LNRB 4LSTL 4CN4A 1DBBL 3I50H 4PJBA 4MS8C 2NX5E 1INDL 4PV9A 3HC0A 3WIHL 1EMTH 5FM5M 4BSVA 2R23B 1MHEA 2AK1H 5K9JL 1ZSDB 3ZDZE 1IJ9A 5JQHC 1JVKA 1F3DJ 1A47A 1OAUL 3JWNC 3O9WB 4JPWH 1MJJB 4CVWA 1MI5A 3JWDC 1ZA6B 3BAEL 2VE6A 3WFEH 5IB5A 5CLWA 1IAMA 1NEZB 1FGVL 3K2UH 2HJFB 1W72H 3NAAH 3EOBA 3HC4H 4S2SB 3FN3A 3WIHA 5BV7L 5MEND 4MXVE 4U6XB 5I30L 4XWGL 3VWKD 4FTVD 4H1LH 5DZLA 3FCTA 3SPVB 4PJDA 2OJEA 3GSXB 3A0OA 3EAKA 4XP9H 1HXYB 2IFGA 1I9IH 1A9BB 2ORBL 2EEDA 4GSDH 3SE9L 5J1SC 1JWSA 4RMRA 1B4RA 4X5LA 2ARJA 1MF2H 2NW2B 5DD3L 2DL2A 3BYTA 3TN0C 4PJ7A 1M6OB 2Y07H 2DD8L 4JGUA 4EZMA 4HIHB 2C4FT 1AGCB 5EU5B 4JLRB 4G8IB 2DQTH 2VABA 2QR0A 3BT2H 5I0DA 1MELA 3ZE1E 4E9LA 1B6DA 3CXDL 4PLJD 5DEFB 1MIEL 2O61B 1RJZB 1NC4D 3OKNB 3CXHJ 2BSRB 3EYFB 2BHUA 3MLTB 3O2DL 3RVXC 3RWEA 3PP4H 4QRUB 1AE6H 4Q6IA 4X99A 2R0WL 1C5DA 4OZHF 1MSPA 2EIEA 4JO1H 3ARDA 5CZVH 2C1PB 5E2WL 3KNBA 2R2HA 1JYXA 1T20B 3VFVB 2E9IA 3MLYL 4WFED 5ISZD 1KCSL 2VUYA 4PGBB 1A1OA 1FZOB 1J0IA 1JRHI 4N0YH 1ND0A 2JJVA 4KH2A 4XNXH 2X09A 5EBLA 3W2DH 4L3CA 3O2DA 3S97C 1CG9B 3F8UB 2CXKA 2R29H 4WUUA 1TJGL 4Z77A 4NQEB 4K7PX 5IMKB 2ESVB 2FCBA 3TIEA 4ODUB 3BKML 5EOCH 1KYOK 3PL6D 1HI6B 3BH9B 3HNVH 5DD1H 3QUKA 2AJUH 5TF1H 4CN1A 5CSZA 4DKAA 1ZLUK 3IDMA 3N1QC 2QQQA 3P9WB 1I1YB 2NXZD 3SCMB 4IRJA 3U4AA 2W0FA 3MRHA 3HRZA 3DROB 3ULUD 3LEYL 2H32H 4JFYA 1XGYH 3VXUD 4NNPH 3VXRB 1XR8A 4W4OC 3U9PH 5I73B 1EUTA 4PJ8C 3Q6GH 3QEHA 4WEBL 4CW1B 4KAQH 4WHCA 1T7YA 1DFBL 3CH1B 3HR5B 3AVEA 2NY2D 4HWEH 3TZVB 2X9XA 4OZFA 1YUHB 4X4MA 4LLDA 3M8OH 4YLQT 2AI0L 1HYRC 3NFNB 3QQ3B 2V6HA 4WI2A 4HGWA 1U2HA 4HWBH 4Z5RB 5DJ0B 1KC5L 2DLTA 1MH5B 1G0YR 4Z7OF 1NMBL 2HP4A 1A4KA 5I16B 4XVJL 1LD9B 4X6CF 5D4QA 4U1LB 3BXNB 2R69H 1JZ7A 3UJTH 1QYGL 2EE9A 3VRJB 1JHTA 2VWEC 5EUKA 4OGYL 1NFDF 1CFQB 1KIQA 1P4LA 3PWVB 1FCGA 5M95B 1BFOB 4WTZA 5E7BA 1WT5C 1E4JA 4IJ3C 2Z4QA 1IQWH 2Z31A 2G75A 4LFHD 3VXSB 2PUQT 3WLBB 5IFJB 3TPUA 4M43H 2AJVH 4G8GD 1IVLA 3RY6A 3WKML