1CFBA

Crystal structure of tandem type iii fibronectin domains from drosophila neuroglian at 2.0 angstroms
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
205
structure length
205
Chain Sequence
IVQDVPNAPKLTGITCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGEDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Neural adhesion molecule
molecule keywords DROSOPHILA NEUROGLIAN
publication title Crystal structure of tandem type III fibronectin domains from Drosophila neuroglian at 2.0 A.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 39
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 1994-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfbA01
3VH8G 1CE1H 4H26B 2AI0H 4FRWA 1VFAB 3FFDB 3GSNL 3RA7H 4U1GB 3DRTB 4S2SA 5DJYA 4AL8L 3RGVC 4QRSA 4LMQI 4DKEH 5JXAH 4M1CC 1HXYB 2DQFA 4M4PA 4HEME 4K2UL 5C08D 2HFEB 4Z18A 5JZ7C 4LRIA 3D5OF 1T7VA 4HXBL 3T1WA 4GBXC 1P7KB 3QR2A 5EBWB 1MY7A 2BSTA 1AIFA 5KSAD 5C09A 2YOCA 4CW1A 1F3RB 2BNRD 3W9DB 1RJYB 3NCJL 5HVHB 4D0DB 4NJ9L 5AWNL 4CADB 4MJ6B 3DXAE 3RVWD 4JRXB 2XWBA 5CSZB 2I24N 2NY6C 4PV9A 1H3PL 1DBBH 4EN3A 1YYLH 1WBXA 1OT1A 5D1XC 1ULVA 2D03L 3NN8B 5DMIL 5LKNA 3OKMA 2BP3A 3JWDC 3UTTD 3ARVA 1Q9OB 2KH2B 1OAXH 3DROA 4DN3H 4RMWA 1OSPL 4XPHL 1FFNA 4F57L 4AIZA 3O8XB 1DLHA 3GJEA 4ZD3H 2V9TA 4N90D 4HWBH 3REWB 1SJEA 5I74C 4OV5A 4OLVL 2MKLC 3PWNA 3BQUA 2C3VA 3GM8A 4HMCA 1CD9B 3QO1B 3HS0A 3M45A 5BQ7A 4XMKH 4FQXD 3NIDE 4EXKA 2COQA 4YHYB 4PJ5E 5C0CD 2VZ1A 4U1IA 1SYSA 1R3IL 2ESVB 3C2AL 1UM4L 3JUZA 4U1LB 5LXGL 1S7WA 3DUSA 4XAKE 4UTBL 4WFHD 1H8OA 3I6LD 3TCXA 2W60A 3LSOB 3BISA 2VLLB 4P23D 1ZVHA 2J6EL 5JR1L 4PJGB 3IF1A 3BWUC 1BBJA 4RFEA 3MACL 5FO7A 4LSUL 4Q0XL 5IEHA 4QT5B 3VFPA 1FSKB 3WN5A 3GK8H 1WCBA 3L7EA 2AABH 2F54A 1X5HA 2VDRL 2YEZB 4FQPA 5F8RC 2GJ6A 5C6TH 1QKZL 3T4YB 4ODXB 4ODVH 1OP5H 4QRRD 3GSUB 4BFBD 2CLRA 4FZEH 3SJVA 3IS1X 3O6FA 4X8JB 2AJUL 3EYVB 4S1QH 3AREC 5B3JF 4X7SL 3RDTB 3IKCB 2BC4B 4HKZA 1HK6A 4H5SA 5HHME 2H9GA 4HWEH 4MDIB 4QRUB 4EUPB 2ZPKL 5D2LF 1CLZL 4RAUB 3MRNA 3SGDI 2AJXH 4BSWB 3KS0H 1YY8A 3WUWG 1U93B 5IVXE 3ULUD 1QSVA 2VZTA 3FO0H 5EUKA 5IBTL 2X4NB 5DD0L 5IUSA 2RCSL 2CIIB 1N64L 1EERB 3VD5A 1AQKH 3QIBD 4Z8FH 2GJJA 5H37G 1EJ6A 3AROA 3MCG1 4DCQB 2CRMA 3WBDA 4FFZH 2DTML 4WUUB 4QHMA 1EMTL 3P40A 3RVWC 1YNKH 1HWHB 1H5BB 5ADPL 2UWEE 4M5ZL 5FFLA 1BD2D 4WJ5A 4KI5F 4JFFD 5HYJE 5DT1L 3V6OE 1A3RL 4QXTB 2VAAA 2ZUVA 3PF2A 5E6IB 5IMLB 1YA5A 1DBJL 1IM9B 1KTLB 4YHZL 1D5IL 3DO7A 4KI1A 2GQHA 1S7SB 5GJSH 4AH2A 4X6EB 1X4YA 4YDKL 5BRZD 5IKCB 4TNWF 3WV0A 5J13B 5D7SH 1ADQA 3WDJA 2Q6WB 1XF5B 5DQJA 3MRLB 3KR3H 2DQEL 2R1XB 1WV7T 4JDVA 3WFCH 2EIDA 3MNVB 1JZ8A 2NY1B 2VABA 4JPVH 5DEFB 4APQA 2R0ZL 5BW7C 5C0BB 1CGSL 2BSRB 3KJ6L 3EO1A 1MCBA 3IFNH 3S6CA 3UEZA 4FQXC 2FRGP 5TFSL 4BZ1L 4NQCA 4D9QE 4DAGH 2UZYB 2AQ3A 1JTPA 1S7UB 2BVOB 4TOYL 2XQYK 4HLJA 4TSCH 1KB9K 3SGJC 1T2XA 1JMZA 3PWVA 1AQDA 5IB3A 3TF7C 2MOVA 4RZCB 4X6DA 4MNHA 3G5YB 1NGZA 4WV1A 1A1MA 4XNXH 4U1SB 4MB5A 4LAQH 3MYJB 5AEAA 4YDJB 3RVUD 3NTCH 2R1YA 3ARDA 4E42A 1I85C 5FHAH 5T3ZE 5KVDH 1A47A 2XWJB 4ZO7A 2MPAL 1OP3K 1EH9A 4J6RL 3SKNA 4LCCA 2Q7YA 2AJYH 2AKRB 2DQGH 4YQXH 4PGDB 3SE9H 2A9NL 4R7DB 3SE3C 3KPPB 4L3EA 4OD1L 1NEZB 2YD7A 1I7UA 5TE4L 1J5OL 3IDNA 2WBWB 4LCUB 1F6AA 5D8JL 4NQVB 3L3OB 1DVFB 2XTJB 5DRZA 5BS0B 3MODH 1PBYA 5DTFA 1ORQB 4FTVA 4JR9H 5CD5D 3MV8B 3FQUA 1L9MA 2FDBP 3K4AA 3CD4A 3EYUH 5EOTA 4ZYKA 3HR6A 5FO9A 3ULUC 1CIDA 4X6DE 1NBVH 1KUMA 3CFDB 3QDME 4NOFA 4Z7VB 2X10A 1KF9B 2EH8L 4ZUTA 1FNSL 2WLYA 4HEPG 4R9HA 1UB5A 3PL6B 5DJ8A 3RX5A 5F3BA 3CLFL 3QIBC 2DKMA 1PKQE 1LILA 3UTSE 5HGDA 2L7JA 1NLBL 4YHOH 3D9AH 3VI3E 4X7TB 5B8CC 2NX5A 5HYEA 3GBNH 1RZKL 2BVEA 4L3EE 2YPLB 2N1KA 5IQ7H 2BMKB 1WEJL 4PJIE 1PZ5A 2A83A 1I1YA 5AG9A 3AVEA 2BOBB 4P5MA 4K55A 4LFHD 2WWKT 1NDGA 1OAYH 3QPXL 5FYJL 3DX7B 4XZUA 5HHNB 4I77L 1P1ZA 4GAYA 3L3HB 3T0ED 1KYOK 2AGJL 1HQRB 4JRYD 4OZFA 4KKAD 3IETA 4ZQKA 5L88L 2JLLA 4I5BA 5C3TA 2VR9A 4F58H 5GRXG 3EOBB 4NQXA 4YK4B 3S35L 3RNKA 2XXCB 3DTXB 1OCWH 5IMKA 5I2IB 2ADFH 2X41A 2Q76A 2MCG1 1B6DA 3PJSB 1TQCB 1D5ZA 1TJIH 3MMEB 4PRPD 4URTB 1CICA 3MA7B 2W9DL 3WHE0 3RWCB 4ORGA 4OCYL 4POZC 1YEDB 3OXSA 4XRCB 1CZ8L 3KPRA 5I1LB 4GG6E 4PRID 3ZDXF 3B2VL 4FXLA 4WI6A 3RTQA 4AENA 4YBLB 2ZCKH 3HCVA 5DUPL 5EU6E 2DOCA 4JFDB 1UH2A 4R8WL 3BKYH 3O3EA 3RVUC 1ZTXL 4PJHF 2M2DA 5GQBA 4GQ9L 3MLZL 1FYTA 4U33A 1HYSD 2ZG1A 2HKFL 2XKNB 3KYKH 5JPNB 4Q2ZA 3EDJA 2B5IC 5E2TL 4WVRA 1JZ3A 2IH1A 4IRJD 4P46A 4X5WA 4V2BA 4XXCC 1QFUH 1TFHA 1EHNA 2HH0H 4BQCA 4Y4HA 1B0RB 2H2SD 8FABA 5FM4A 1YDPA 4PJCB 5D5MA 5SWZD 4K9EL 2F53E 4NIKB 4RISH 4X98A 5D7JC 1B90A 1OAZL 1J8HA 3ROLB 1JPTH 3M1BB 1MCCA 5TDPA 4TVPH 3M07A 1DCLA 1QLRB 5ANMB 2Q3ZA 2LQRA 1AD9B 4MQXD 4NWTL 3SDDD 1I3RA 4GKNA 2BNQE 2OJZH 3QZWG 1ND0A 4HIXL 5JLZB 1CF8L 2IADB 3MRCB 5JDSB 4JO4L 2HLFC 1NMBH 1V3KA 5DRXB 2W0LA 1HSBB 4GRWB 4GW1B 4OJFL 1BFVL 3BHBA 1MHCA 1B2WL 4G8GA 4XPBH 4NWUL 4XVJL 4IIQA 3T04D 5C07E 1TTFA 1S8DA 1N6QL 4W6YB 3MLYH 3S5LA 3B6SB 3HI1A 2FH6A 2J4WH 2QADB 4PJXF 1UKTA 1M4KA 5HHQA 1XZ0A 4NGHH 2Q86A 3D0LA 2IEPA 3EYSH 3QXDB 3RWGB 4F7MA 1V7ML 4LMQE 3MV11 4LBEB 4LLDA 3TBYA 4BUGA 1UWXH 4GKZB 1TJGL 2DQIH 5ICZA 1HH9A 2XWTA 4N9OB 5IEKA 2DWEA 1FIEA 1QSFD 1LO2L 3BVNB 3RVVD 5LGJA 5BVJB 4NQDB 5BXFA 2DMKA 1INDL 1PFCA 3QFJD 4D2NA 1CXKA 3QCTH 4YUEH 1A6TB 4O2EB 1JGLL 3F5WA 4KKAC 4LLMA 1T7XA 3VDBA 1JHKL 4FXKA 4KRPB 3VXSA 5KTEH 2WUCL 1UM6L 1YEKL 2ZOLB 4NKOB 1T03L 3NPSB 4UU9B 5D93C 1J05A 4NSKA 4G8GE 3O6LH 4Z77A 2D4FA 4OCRH 4BH8A 5HDBE 1DFBL 2R0WH 1P2CA 5FA4B 3BN9D 3SKJH 4YWGH 3QG7H 4NP4L 3QUXC 3T0BA 5JQ6H 4H26A 4MB3A 5JIHA 1VFAA 3FFDA 3VJ6A 1G0DA 4E0RB 3V4PH 1ZSDA 4WW2C 5ACLA 1ZLUK 1DUYB 1D3CA 1LE9B 2HFEA 3FRPG 1JNHB 3ZE1F 3X12B 1YN7B 1AGEB 3S36X 2AS5M 4Y5XC 4NZJA 5EBWA 4YFDB 5HI3D 4IOSD 4IRJC 1JGDB 2HLAB 4RDQG 5CZKA 3CFCL 4HPOH 5F7HA 4UT6H 3W9DA 1RJYA 2H2SC 3PWPD 4D0DA 1BQSA 4CADA 4MJ6A 3G6JE 4CBPA 3O2DL 1A6UL 4OFYD 2YD6A 4RFOH 3JWDH 1NMAH 4NM4H 1DBML 1CGXA 1U3HD 4DN4H 2BOCB 4CKVX 5I16B 2WBKA 3SDDC 4YDLB 2FIKB 1Q9OA 3AY4C 3SGEI 2W92A 3AFLA 4DGVL 3REWA 4Q6YA 3B8SA 1H3WM 1R3JA 1MF2L 2NY4D 3L6FB 3QO1A 4GKSB 1IAKB 2DQDH 1OARL 1M7DB 1NCWL 2Z91A 1DBKH 4WEUD 1FNEB 4KDWA 3NACL 5J57B 2GTZB 2IPTL 4DQOL 4U1LA 1BJ1J 1HN1A 2BVQB 1I3VA 3JV4A 3HE6B 4JRXE 3PDDA 4YXKL 4XPFH 5DWUL 2VLLA 4ZXBA 1UA6H 2LVEA 3ARBD 3OKYA 1ZXQA 3L95A 3QEGL 4OZHB 3TZVB 4RGNB 5D9SB 1XR9B 5LQBL 1KCRL 2YEZA 1ZHKB 1NLDL 3D69B 3TH3T 3VGGA 5I8EB 3T4YA 1HCFX 4ODXA 2VLME 1U3JA 2A6IB 1KTDB 1Q1JL 2EE9A 3GSUA 5I1GL 3QQ4B 1MLCB 1T4KB 2JCCB 1HZHH 2ENYA 1WVZA 1MSPA 3Q1SL 1H3XA 5C70A 3BN9C 3EYVA 4WGWB 3QHFH 5FDYA 3O4LB 4OBSA 3RDTA 2BC4A 4O00A 4OUUA 4E41B 4XP4H 4C57C 1IGYB 2ESVE 4EUPA 3EIFA 4YBQD 1I3GL 1RIUH 4RAUA 1E27B 3ZYIA 1CFTB 2NTFB 2DM7A 1U93A 4PYGA 3LHPH 3VFTB 4ZOCA 2X4NA 1YEFL 5IROC 2CIIA 3F6IA 4CNIB 2C4XA 4PJGE 3BH9B 3UTZB 3LKPB 4Z5RB 5HHOB 5HI3C 2NY0D 2VQUA 3QCVH 3KPSB 3RY6C 1G9MH 4KPHL 4KKNA 4N0FB 4N8CH 4WUUA 3BX7C 1GXEA 2EDFA 3MBEA 3VXUD 5E7FA 1Z9OA 5TDNB 3U0TA 3ARPA 1H5BA 3MLRL 4W4OC 5DYOB 4EDWL 4OZ4B 4HXAL 4JREC 4JQVA 1U3HC 4JVPA 5E6IA 5IMLA 4Z7OE 5ICXB 2FJGB 1B6UA 1S7SA 4X6EA 4ONFH 5GZOD 1NGYB 1GCFA 2WSKA 5JORB 5IKCA 1PX4A 5E8DL 1P4LB 1QFWH 2WINB 2Q6WA 1XF5A 1KSRA 5ENWB 4X0KB 2HMIC 2BHYA 3MNVA 2HFFA 1IBGH 2NY4C 4O2FB 4J3TA 2DQHL 2R2HB 3OKOA 4UDUB 2BSRA 4X99B 3ARGB 4R90L 4MNQA 4P2OB 1SJVA 1DQQB 1S7UA 5EU3B 3QG6B 2I60H 3G9AB 4DKAA 4Z7WB 1JNLL 4YDIH 1SM3L 4S1SH 1G7MB 3GJFH 4HCRH 2PO6D 1CFSB 1RUQH 3CFIC 2NXZB 1A6AB 3IKKA 3MYJA 4YDJA 5HYSG 3S37L 5GS1B 3N9GH 2XWJA 4DK6A 1NUNB 2PXYD 3X13B 1EEZB 4GMSH 5F9OL 3T1FB 3CMGA 4PGDA 2BY2A 4R7DA 4OFPA 2AV1B 2ZOKA 3KLDA 3KPPA 4MD0B 2GITB 3PV6B 2GEEA 1S7XB 4M7LH 3TBSB 2CK0L 3GSWB 5C0BE 2EH7H 1BOGB 3QNYB 4NQVA 3L3OA 2XACC 2IH3B 3ULUH 2XRAH 1DVFA 2IG2H 4OGXL 3QDMD 5DUMH 2EC9U 1DN2A 3MLSH 5BS0A 3Q6GL 1K8DA 4DUWA 1F58H 3WJLC 1ORQA 4U6YA 3O3AB 4XBEH 3GMRB 5KW9H 1VGKA 4LVOC 4G6JH 4G9DB 3SDXB 3CFDA 4Z7VA 1BBDH 1L0YA 3RWHB 3RWIB 1K4CB 4OTXL 1PJ9A 1UWEL 3MUGA 2R4SH 5IHUL 3BDYL 1A1OB 1MH5B 3EHBC 5IFAL 2VZOA 5FDWB 2NY0C 3VWJB 3WFHA 5DC9B 1AHWB 1F3JB 2A77L 4K7PL 4OGYH 3HHRB 1E6OH 4NQTA 3PE9A 4KJWC 5BOZG 3X3GH 1WQVT 2JIXD 4QOKE 3EO9L 3LV3A 1FLRH 1D5MB 5FM8A 3B9EA 4WUKL 3QQNA 4DVRH 4WENB 1FPTH 3KG5A 4ZFGH 5BO1L 3B43A 3OAZH 2BOBA 2DYPB 5GZOC 1IKFL 4X6DF 1YPZB 1JVKA 2VZUA 2XTJE 4MSWB 3DX7A 5EB9A 3FB5B 3O3BA 1KGCE 3MA9H 4IMLA 3TT1L 1BLNB 5DI8A 3L3HA 3MV8E 1HQRA 1YMME 4JQIL 4RBPK 1V8HA 1CWVA 1JUFB 3W9EB 1IZKA 1KCKA 4Z7VE 1CT8B 1QUNA 4M93C 2PTUA 3EOBA 4QTHB 3DTXA 2YS4A 3ZKXB 5I2IA 5I19L 1S9WB 1ADQL 4F9PA 1A3QA 3OAYH 3MRGB 3PJSA 4UQ3B 5F72S 1UB6B 2ICCA 1Z5LB 2P24B 4XI5D 1BVKB 3RWCA 4OLUH 5F89B 5K9QI 3M8OL 1IC5L 4XRCA 5EU7C 2VLKD 5I1LA 5IHZB 4MVBC 3TCLA 2YPLE 1AY1H 2PO6C 4IDLA 4C58B 1MCRA 1ZLWK 3MC0A 5K9QG 3PHOB 3QQ9D 4MCYA 4OCXH 5ELIA 2YHGA 1CGYA 4LIQL 2XKNA 2IFGA 2ZG2A 4PRBB 2FR4B 5CGTA 1U95B 3CDYA 3EDEA 3NCBB 5A2KH 4M1GL 4JRWA 1MI5B 3UDWC 5CILH 1ED3B 1HDMB 2VDOL 4LPWA 3OJVC 4WDIB 3DI3B 5FOBA 5F93C 2F19H 4R26H 2B2XH 4PJCA 4XP6H 3L1OL 5H94B 1IRAY 1CDYA 2X9WA 4HAGA 4UB0L 3VD4A 1RUMH 2ZUXA 5EUOB 2BNQD 4GSDH 2Y4SA 3M1BA 1F4AA 5FV2A 2D7NA 2V6HA 1JF1B 3FQXB 5DMGC 1MJ7H 5EOCH 1QLRA 5ANMA 2NCMA 5HVWA 3BMVA 3W82A 5IP4A 6FABL 5JLZA 3U46B 3MRCA 1OGAD 5C07D 4WU7B 5DRXA 1HSBA 2FL5A 4JFDE 3QDJE 4GW1A 4A6YA 5I30L 4N1HB 5L6YL 4U6XB 3HN3A 1CFNB 1RZJL 1T1YB 5TE7H 5AZEH 5E5MB 3B6SA 3MOBL 4F33B 1KIRB 2X09A 3HC4L 3T2NL 4YGVB 3M17B 3VXTB 4PY7B 4JANB 1N0LA 3QXDA 1A9BA 2Z9TA 4PB0L 5HGAA 4LBEA 5LGHH 1RZ8B 4GKZA 3OZ9H 3D1MC 3T0DA 1PVHA 4ZO6A 3QUZC 3VMOA 4M8VA 3BVNA 1JL8A 4NQDA 1CL7L 3H9SD 1AR2A 1UZ6E 5MEQB 3TJEL 3D0VB 3UBXI 2F74B 1KT2B 4AZ8A 1T89C 2DWDA 4ZFOL 1N8ZB 2P49B 4XH2B 4XVSH 2IPKB 2OP4L 2ICWI 3UBXG 3ARSA 5TGBB 1IT9L 2YN3A 4ZS7H 4HG4J 4L29B 5ICYB 1T80A 4XI5C 1RV6X 5FA4A 4PLKD 3KDMA 4NO3B 5D5MF 1EFQA 4K3DH 1XT5A 3P9WB 5KVGL 5B21A 2CXGA 5DHVA 3P4NB 1QO3B 4NRYB 3B9KA 5CZXC 5LJYH 3D2UB 4E0RA 1CFVH 2EXYD 1N0XL 5HHXH 1QBAA 1CLOH 4EOWL 5I8OL 2CJUH 3CK0H 1I9JL 1DUYA 1LE9A 3QQ9C 2E7LA 2JB6B 1JNHA 4AM0B 4P2RA 1YN7A 5D2NA 1AGEA 4P2QD 3O4OB 3PHQB 1JNNL 3AS3A 4XPAL 4YAQB 1AP2A 1LEGB 1NDMB 3LRSB 1JGDA 4ONGH 5T5FL 5EH1A 4JHBA 1S7VB 1IQDB 25C8H 1FZKA 5AAMA 1DQLL 5CSBA 4K3JH 1E0OB 3BPNB 1K3IA 1ZLVK 3GMMA 1KULA 4I3GA 3V5HB 1QOKA 3MROB 4LGSB 1NC4D 4WI3A 3TESA 3KVQA 4AEIL 2G9HB 3WNKA 4QNPE 4X6CB 4XAWH 4YC2C 2BOCA 1F6FB 2DS4A 3BZDA 3V0AC 5AD0B 5I16A 5F96H 5AYUH 4ALAL 3V4VH 3DOSA 5JW5A 4Y4FD 5DVKA 4UINH 1K2DB 1U8NA 1U6AH 4MYWB 3KPQB 1HI6B 4PJEB 1GGIL 1FZMB 1QR4A 2ZSVB 2EECA 2CR3A 1ZT4B 5GXBB 3L7FB 1DUZA 4HF5H 4JQXA 3QRGH 4X4YA 3I50L 2Z31D 3EW3B 1Y18B 3L6FA 4XNYL 1IAKA 4HGMA 1QR1B 2B8OT 3P4LA 3IXAA 4GJTB 4WFED 1CD1B 3WO4B 1M7DA 1OQXA 2ZUQB 1MFEH 4NQEB 1FNEA 1OY3B 4NZRH 1XGQB 1YEJL 1RQ5A 4KUZH 1AXSA 2RGSA 2BVQA 4JM2C 2MTPA 5KVEL 2X4SB 3F8UB 3PQYE 3W2DH 3V2AR 3GI8L 4XCCL 1DQML 5DJAB 3ZYZA 5ERWA 1CXIA 3ZL4H 4J1UA 3TFKD 4OZHA 4D0BB 4HPYH 3TZVA 5D9SA 1XR9A 3ARFB 5F6HI 1AGFB 4HJJH 2EYRB 1ZHKA 1IC7H 1ZGLB 1WK0A 1IC4H 5I8EA 4BM7A 5JOPD 3DGGB 4HS3A 1KTDA 3BXNB 3TA3D 2DBLL 2AK4D 1UQSB 2PUQT 5SWSD 3TN0C 1XIWB 2JCCA 1CLYL 3CFEB 2AJSH 1J18A 1SEBB 3KPNB 1MWAH 1BZ9B 4PLKC 4KVNL 3PP3K 4PRHE 3O4LA 3GNMH 4E41A 3BKCH 3BW9B 1IGYA 5GGUB 3QUMH 1Z9SA 1U3YA 1A7QL 4JJ5A 1FNFA 1XGYL 4O02H 3QAZB 1E27A 2ARJA 2EXYC 5HJ3B 5CUSL 1TVBA 1CFTA 2NTFA 2LTQB 5EOQL 3NMEA 3VFTA 1JHLL 2VUOA 5CMAB 3OKKB 4I18C 1INQB 4PGCB 2X42A 2JJVA 3O6KH 1M6OB 1FGNL 1Z3GL 3OKNB 4CNIA 1I9EA 2YD1A 4OD3H 1DLFL 3UTZA 3LKPA 1V05A 5JPMB 1I1AB 1YNTB 4NCC2 4OCNC 4RGNE 3KPSA 1X6NA 4DFIA 1OGTB 4IEFB 5E8PB 4N0FA 2EDDA 5F3HB 5HHVL 3IFOB 3NZHL 4BUHA 5E6ZA 4B50A 3LY6A 4WY7L 1ZANL 3H0TB 4OZ4A 1MCWM 3DMMC 4FZ8L 3VMNA 1LD9B 1OHQA 3B4NA 2FJGA 3RY4A 2W65A 4JFHD 2AQ1A 3O4LE 5IBLD 4J3VA 2DLIA 1NGYA 4N0UE 5IWLA 4KI5D 1VGEH 4Y4FC 5CWSA 3SKMB 1P4LA 1P7QD 3EJYD 5C0AE 2X70B 2WINA 3EJJX 5E9DB 2VTFA 1J0JA 5ENWA 4WWKD 3HZVB 3DVFA 4X9FA 3BGFB 5I1EL 3WD5L 1JV5B 4MQTB 2Z31C 4JAMA 3QXAA 3WS6A 5HPMB 4Y5VB 4WFGE 5I71C 1L7TH 3CAFA 3OG6B 1CI5A 1W72B 5HHOE 4FQQB 3FB6B 3ARGA 4X99A 5D6DC 1RUPL 3CCHB 1VFOA 1U8MB 4P2OA 3UPRB 4Y1AE 4ETQB 1DQQA 4Z7WA 3QG6A 5EU3A 1KJVA 3FFCD 5ABDE 3S4SB 4Q9QL 4ODHH 3KYMB 5D6CB 4FXGA 3BIKB 3QUKB 1G7MA 3CLEH 4FQ1H 1RK0B 1CFSA 3NCCB 5HSFA 2A2QT 1GC1L 2VLRD 3C9NB 5KSBB 3O3UN 3QDGB 2QTEA 5A43C 1A6AA 4LAJH 3TFKC 4PJFA 1FCCA 3WKMH 3WE6B 5GS1A 2W9EH 2DDQH 1ZOXA 3VFMB 4PBXA 1JZ5A 3X13A 2B4CL 3CSGA 1GGCL 4M1DH 2R8SL 1FO0H 1UXSA 5CKGA 3T1FA 3C5ZD 2DI9A 2PW2A 1K8IA 2AV1A 1MNUH 4MD0A 3TA3C 2GITA 3PV6A 1Z0MA 1RJZB 1OAKH 1S7XA 5EFIB 3MV7B 3QWOB 1FE8L 3TBSA 2GY5A 3WIIL 2LFGA 3GSWA 2CMRL 1QNZL 1BOGA 3QNYA 4LKXB 3MLWL 4N0RA 1FZJB 4U49A 3P9LB 4NBXB 4GS7B 4Z7WE 2Q7NA 5ID1B 3BPCB 2ADIB 3O3AA 4YFLI 4PJ8D 3W0WD 1BPVA 1U8JB 5J89A 5FYJD 4G9DA 3SDXA 4CN4A 2WBJB 3DRQB 5KAQF 5FV1L 3VFOB 3MLVL 4QF1B 2FGWH 3CH8A 4Z7QF 3RWHA 3KPOA 1R3LB 3U36B 3RWIA 1K4CA 1MCSA 4KKLD 1A1OA 5FDWA 3CX5K 1CGTA 4IRZL 4EDXB 3VWJA 4HT1L 3LMJL 5LWYL 2FB4H 4O51A 4CN1A 1X7QB 1IAOB 4GUPB 1AHWA 2YD5A 4ZFFB 3G5ZA 4KV5F 3LKSA 4N5ED 5DO2D 4Q9RL 3GM0A 5F1IB 3NCYS 4Q74A 1VB9A 1NUFA 3V0WH 3NABL 1OAQL 5F44A 1JTTA 3V6ZB 4QYOB 5IBLC 2DYPA 4JM4H 4C56B 2HJFB 4KI5C 4LLUB 2VWEC 1RPQA 1BLNA 5L7XH 1GVIA 4WWKC 1E28B 1T7WA 3WDIA 1JUFA 3W9EA 5B38A 3NZ8B 1H3UA 2J12B 1Q72H 1CT8A 5GS0L 3T2OA 2E3VA 3SDAB 1JPGB 1PY4A 1OM3H 1N2RA 5I8CA 1M71B 1S9WA 5C2UB 2D7MA 3HNVH 2G60L 1UB6A 5T33H 4P59H 1Z5LA 2P24A 1BVKA 3FZUD 1FDLL 5CJ8A 4XX1G 7FABL 1QD0A 1KJ3H 1AGBB 2AK1H 2CDFB 2H1PH 5JA8B 1DQDH 4YX2H 2D7QA 3MGAA 3PHOA 4Y19E 3V5KB 5IW3A 2V5TA 4GMTL 2NY7L 1YPZE 4UMGA 4Z7VF 2MQCA 2J8OA 2FR4A 4G8EA 1K5NB 3D18A 3NA9L 1A6VL 3SOBH 1XF4B 1ED3A 4M62H 4UBDC 5K9OB 1T7ZA 1HDMA 3MCLH 3MLTB 3EO0B 4MJID 3NFSL 4JPKH 4WDIA 4NHCL 1RZ7L 1OTSD 3VFGH 1N6VA 3IXTB 3EFFB 2IFFL 4G43B 5C0IA 3BOVA 2CLZB 3V7AG 1OSZA 1OOAA 1RZKC 1BGXH 2QKIB 5EUOA 4B7IA 3VXMD 1GGBH 2VDMH 1PLGL 1A4JA 3RWFB 1JF1A 2VO5A 3FQXA 2AEQL 3AS0A 2YBRB 4DUVA 1A02N 3P77A 4RMVA 3UJIL 3DVGA 1T1XB 3U0WL 1RZFH 3HC3H 5BVPL 3H3BC 1TZGH 5J1AB 3U46A 1F45A 1E4KC 1KCVH 2OR9H 4ZTPH 3SHSA 1SY6A 4E9LA 4KKLC 2EDQA 2EC8A 4GO6B 4GAGH 3S34L 3WXWH 4KY1H 2VDPL 4KJYB 4JFZH 4UAOB 4RGOL 3KNBA 4MJ5B 3FHQA 1T1YA 2Z4QA 2MSPA 1MI5E 4M61B 4N5EC 4Y5YA 1JWUB 5DO2C 4IOFD 5E5MA 4F33A 1KIRA 3GBML 4ZNCD 2J8UB 5FKAB 4QWWC 3M17A 3VXTA 4PY7A 4LVHB 4HC1A 5C71A 5KVFH 4JHAH 3T0XA 5T1DL 1MFAL 4LSVL 5E08H 1F97A 5GRUL 5JUEH 1U8QB 2GJZB 3REVB 4ZTOL 1QQDB 4KAQL 3RIFK 1MJUL 4TVSa 2IAMA 3LEVH 4OFDA 5FHBL 1DJSA 4OQTA 1MHPL 4ODSL 3P9MB 3JTTB 3VDAA 3D0VA 1P4BH 2F74A 3LB6C 3VXRE 2QHLA 3MRBA 4N8VG 3OR7A 4S1DD 4XH2A 1RZIA 3BMWA 3KYOA 4KQ4H 2IPKA 4EKXA 3WL9A 3VGHA 4X80L 5T1LD 5TGBA 4L29A 5ICYA 1N4XL 4ODTL 4K9EC 4JZJC 5T3XL 4RMRA 2IJ0C 3FZUC 3SGKA 4PJCF 3DBXB 1FGVL 1F11B 2Y07H 3FN0H 4YZFF 4KK5D 1XMWA 2CLVB 3P4NA 4NRYA 4I9WE 3VRIB 2FD6H 3D2UA 1MFDL 5H2BA 5DSCA 3O9WD 2YRLA 4ZUWB 1ZAGA 1KENH 2YKLL 4JFXB 1SBSL 3V5DB 4L3CB 2LE9A 2JB6A 3SE8L 4KTEH 4AM0A 4BQBA 4JG0H 2K1MA 4L9LA 3PHQA 4XPTL 1Q9LB 3BKMH 5AZ2L 1DDHB 4PG2C 3SDYL 5MHSE 4YAQA 2HA1A 4QO1A 1LEGA 1NDMA 3LRSA 2HTKD 5CGYD 5DUBB 4GRWF 3QB7C 4WHYG 1S7VA 1IQDA 1OTSC 1QRNB 2E9WA 1I1CA 4JFEE 4DOHE 1LP9A 4HS8L 4PY8I 3MROA 4HBCL 5LCVL 5D1QB 3NAAH 1TMCB 1HH6A 2D7TH 2VQTA 4CMHB 9CGTA 1LO3L 5AD0A 4M9OA 1WC7A 2IQ9H 1MJ8L 4HIEB 1WZ1L 1K2DA 2XZAL 1J0HA 2A9ML 3KPQA 1HI6A 2VXTH 4PJEA 2OL3H 2ERJB 2NXYB 2ZSVA 4L4VD 3G6AB 1NUGA 4GBXB 1ZT4A 3L7FA 4ODBD 2FSEB 1Y0LB 1Y18A 3RP1A 5EORH 5HDQL 1MFBL 3P0GB 3BZ4A 1JWMB 4NO5B 4OCLC 3GMNA 1CD1A 4IOFC 4J3WA 4NQEA 1XGQA 4JKLA 5IW1A 1MRCL 3GSNH 5IQ9B 2CUHA 4AL8H 1AR1D 4A6YL 5D1XB 5GGQL 4HX1B 4K2UH 4P9ML 5DJAA 4BFEA 4RRPG 3LH2L 1S9YB 2FLRT 4HXBH 4X6CE 3LPGA 1UT9A 1XCTB 4X4ZA 3H7BB 4D0BA 1BECA 2ID5A 3PHSA 3AB0C 1YJDL 4NKIL 3ARFA 5I74B 2EC9T 1J1PL 1AGFA 1QVOB 3NCJH 4H0GA 4NJ9H 5AWNH 3ZT7A 1ZGLA 2NY2D 5J6HB 1MHEB 2V9RA 1UM5L 4V1DB 4PRHD 1NCCL 3ECBA 3DGGA 4WU5A 1H3PH 5K59F 3BXNA 2AJ3A 4H0HB 4I8DA 3IJHB 5EN2A 1XIWA 2BDNL 2FO4B 2D03H 3CFEA 3HPJB 1V7NL 5DMIH 4W81A 5CEYB 3KPNA 1BZ9A 1X5LA 4JN1L 3O0RL 3SE4C 1NKRA 4KK5C 3BW9A 1R5IB 3TEUA 3F58L 3OX8A 1X5YA 5GGUA 1OSPH 4POYA 4XPHH 4F57H 1WTGT 2XZCL 1KCSL 5HJ3A 1D6VL 3O9WC 3OBAA 2QR0B 2Z92B 4LCIH 4OLVH 2P47B 5CMAA 3OKKA 2FNBA 1INQA 4PGCA 4DGIH 1PDKA 5DHXB 3HNTL 2YD3A 5CP7B 1ZHNB 3BUTA 3MV9E 5ALCL 2X7LB 1ZLSL 5F88B 2IPUG 1U8LB 4P4KB 5JPMA 1YNTA 2HTKC 4MAUL 4WNQB 5CGYC 3FMGL 5CEZL 1DANT 1R3IH 3C2AH 4JKPL 3BPLC 1UM4H 4DVBA 5D70L 5F3HA 1SQ2N 5LXGH 2NLJB 4P4RB 3IFOA 3S37X 2VXVL 3FB7B 2EIZB 2IAND 4UTBH 1ZA6B 5F1KC 3ZO0A 5BJTA 2UZIL 3H0TA 3LVEA 3AREB 3CVIL 3BJLA 3IDMB 3FOLA 1LD9A 5JR1H 2J6EH 2APVA 2DBJA 3OXRA 4LHUB 3MACH 4LSUH 4Q0XH 1FH5L 3WFBL 3LD8C 4LP5A 2OZ4A 5C9KA 3SKMA 1EK3A 1IGJB 2VDRH 2YD9A 5C08B 1CDJA 2X70A 3IDGB 5DJ6B 5E9DA 1BWMA 4YIQB 3TH2T 1QKZH 1T5XA 4FQ2L 4OZHF 4JFYB 4Y1AD 5KG9B 4PV8B 1JV5A 1JGEB 4RSVA 5HPMA 4Y5VA 5KSAB 2OS7A 3PGFH 3H9HB 2AJUH 1W72A 4KH2A 3FB6A 4FQCL 4QRTB 4X7SH 5CBAB 3MRQB 3CCHA 1U8MA 3UPRA 4ETQA 1T21B 2ZPKH 1CLZH 3S4SA 4EI6B 3S9DB 1FFOA 3KYMA 5D6CA 1AR1C 2JCCF 3K81A 1F8TL 5ITFB 3BIKA 5JO5B 3QUKA 4HGKC 1NJ9B 1CXLA 1I8IA 4G6ML 1KJ2L 3FONB 2GJ6D 5IBTH 5DD0H 5D7LE 2RCSH 1YQVL 1N64H 3R8QA 5L8JB 5KSBA 3QDGA 3F7RA 4OIIL 3SJVD 3O6FD 4RCAA 4U2ZA 5ETUB 2MCPL 5J1TC 4KTYA 5GRWA 3WE6A 4WEMB 4NT6A 3LKRA 4HG4K 1QPPA 1UH3A 3VFMA 2DTMH 2SEBB 2X4UB 3RKPA 1EMTH 4PG9B 5E9DE 2NY2C 5FCSH 5INDA 1F5WA 4EQ3A 4HQQL 5ADPH 4M5ZH 4I0KA 1C16B 5L8KB 5DT1H 1RJZA 2Y5TB 1A3RH 5C0CB 3OF6A 2F8OA 3MV7A 3P3YA 2NW3B 3QWOA 2VXQL 4B7LA 5EG6C 3GB7B 1DBJH 2Z8WC 4LRIC 1SYVB 4LKXA 4YHZH 1D5IH 1M7IB 4KJQD 1QFOA 5C8JA 4U6VL 1BJ8A 2PYEE 3Q0HA 3UJTL 4YDKH 1YNLL 5C3LD 4P5TA 1KIQB 2OI9B 4HH9B 5ID1A 4ZO9A 2DQEH 4P23B 4YO0B 4LQ1A 5JNYB 2WBJA 3DRQA 3VFOA 4QF1A 5F9WC 5CKAA 1BF2A 1KLUB 2CGRL 2R0ZH 1R3LA 5GZNC 5LVEA 3IT8D 1CGSH 3E3QC 3KJ6H 1B0WA 1BFSA 3DGCR 4JO1L 4PS4L 4EDXA 4BZ1H 4OAWA 3K8MA 3TVMB 5E2VL 1KCUL 5CP3H 1JFQL 1X7QA 1IAOA 3MRKB 4GRLA 4GUPA 4LCWE 4TOYH 1JYWA 32C2A 4Q58C 2FZ3B 3MNWA 1YUHB 2Z35B 2IBZY 2C7UB 1G7QB 2APBA 5F1IA 5BZDB 2EDTA 1ES0B 5IHLB 2XPGB 4Z7WF 3BQUC 4NJAL 3RU8L 1S9XB 5CSGA 5EC1A 4APQD 3ET9F 1NH6A 2ED9A 2HJFA 2MPAH 4LLUA 5A3ID 1BFOB 2EDEA 2AEWA 4J6RH 3UO1L 5IBUG 5GSRB 2R0KL 4JZNB 4JDTL 3V7AE 1Q0XL 2A9NH 3CFJB 5HI5D 2W0FB 3SY0B 1D9KD 5GHWL 3QIBB 4PJFF 4OD1H 5IJVA 2FHBA 4R4BA 3MRMA 2EDNA 4LSQL 2GAZB 2PF6A 5D8JH 4N0YL 5FOJA 3KXFA 3MBXL 1LDSA 2PR4L 3DV6B 4EVNB 2F9BT 2WWMC 2R29L 2BRRL 5B8CB 2YUVA 3OKLB 1BD2B 3WN5C 1QFWI 3EYOB 4JFFB 3DPBA 2R2CA 4XB7A 2P5WE 1NC2D 4Y19D 3T3PE 1AGBA 4ELKB 2EH8H 1FNSH 2CDFA 4OIAA 5EU4B 2YN5A 3VW3L 5BRZB 3CLFH 1XGTA 3SO3C 3O6FC 3DHJA 1C5BL 3RY5A 3V5KA 1X5AA 1W8NA 1I7ZB 1MIEL 2O93L 3SDXF 4C56E 4MMXC 5FO8B 1VPOL 4H8WL 1NLBH 1MAKA 2IC2A 1K5NA 2UY7A 1XF4A 2WZPD 4JPIB 4FTVD 1IILE 1AKJB 3MLTA 5E5RB 1RZKH 3EO0A 4ZPTA 4MA8L 5HGHB 2R69L 1ZVSB 3I84A 5E7BA 3DX6A 3AAZB 3EFFA 4G43A 1WEJH 2BK8A 3ZE2F 2RBLA 4MXVF 2R2BB 1LGVA 4X7FC 2QKIA 2ENSA 3QPXH 5FYJH 1HHGB 2UVEA 5CHNB 4I77H 3AM8A 1A6ZB 3RWFA 3VMPA 2AERT 2C1OA 2AGJH 2YBRA 4DKFL 4K7FB 1N5AB 1B4RA 5IFHL 4Z7UA 3ME0A 5L88H 2PW1B 2ADJB 1U58B 5F70A 3CVHB 3S35H 3UZEA 2VDNL 3ILQC 2B5IB 3C6SA 5FK9B 1HOCB 3BEVB 1AD0B 3HRZB 4FN0A 2XN9A 4HUVA 3HUJB 2W9DH 4MJ5A 4J8RB 1JPST 2Y23A 4OCYH 4D9LL 5DJXB 4F37K 2PKDA 4M61A 1CZ8H 3CIQA 1JWUA 5J6GB 3B2VH 3QO0B 2J8UA 4HUWB 3B9VA 5FKAA 5E8OB 1GZPA 5EU5A 1EEYB 1B88A 4Z95L 5DUPH 3CDCA 3P73B 4APQC 1YEIL 4R8WH 4D94A 1ZTXH 2GJZA 2VITB 3REVA 3VU2A 4GQ9H 1JYXA 3MLZH 3B83A 5A3IC 2HKFH 1FJ1B 1A7OL 2IWGA 3QRFM 3C6LD 5HI5C 1CDGA 3UMTA 3ULVF 1X5GA 3P9MA 3PGCB 2PN5A 3JTTA 2EDRA 2EE3A 1AFVL 1YEHL 4LDLB 3KPRD 1YZZA 1EDQA 3BGMA 4K9EH 3PG2A 2ADGA 4WV1C 3SPVB 3TPUB 2DF3A 3QCUL 2E8YA 1OAZH 4DZ8B 1H3VA 1JGVL 1KLFA 4R96B 5HY9B 5C6PB 5HGGS 5TE6L 4D3CL 2C9AA 5EC2B 4BJLA 4LSSL 5GGVY 1JP5A 1XEDA 1QA9B 4TSAL 4LCCC 4NN7C 1EA9C 4NWTH 2CLVA 3VE0B 1BM3L 4HIXH 4P46D 3VRIA 1CF8H 4JO4H 5EUOF 2D0HA 4ZUWA 1WFOA 4WO4B 1ZE3C 1URLA 4OJFH 1BFVH 1LK3L 4HV8B 5I1CL 1B2WH 3V5DA 4L3CA 3T0EB 4NWUH 4XVJH 1TDQA 4JRYB 4KFZC 1MCNA 1DR9A 4NOBA 1J8HD 5MERB 1Q9LA 3DIFA 1N6QH 4TVPE 1DDHA 3WIHA 3N85L 3CXDL 4PTUB 4R6UA 5B39B 5DUBA 3AUVA 3WXVL 4HFWB 1D5BB 1RZJC 3QWRA 5B38G 3ULVL 4BH7B 1H15B 5JW4R 4L8CA 4PRPB 1V7MH 1BIHA 5CINL 3BH8A 4PBWD 1TJGH 1M1SA 4HW6A 3JWNC 1LO2H 3EOTH 4J7RA 4PRIB 4HUNB 4X9GA 4NC1C 1INDH 4ERSL 2HJLB 4XNQB 3HG1E 1JGLH 4KUCF 1JHKH 2WUCH 1UM6H 1YEKH 1BAFL 1T03H 4JDZB 3MJ7B 3G6AA 3MFGB 1TNMA 4FQLL 3ULSB 5TH2B 1IAIL 3U1SL 2ILLA 5ISZB 3SQBA 3AGVA 1Y0LA 2P7TA 4FHBD 1DFBH 3GSRB 1KPRB 1JWMA 2P5EE 4BQ6A 4GAJL 4Z7NE 3E6FA 4NP4H 5SWZB 5IR1A 4XB8A 2NNAB 2HRPL 3OKDB 1SY6L 1CFQB 3MV01 1QRNE 5IQ9A 4U1JB 5EO0A 2E7MA 3VXSD 3PWJA 3Q48A 2YZ8A 1B9ZA 5IF0B 4HX1A 4QTIL 1AXTL 2BVTA 1RULL 2L0DA 3D3VA 3SDDB 5CS7A 3MLUL 4YPGB 1S9YA 4OT1L 1CGWA 1PEZA 5K33A 1CICC 3H7BA 3CFCH 4HC1L 4HDIB 3T3MF 3GO1L 3O2DH 3TO4B 1A6UH 3TBWB 7CGTA 4V1DA 3OGOE 3SGEH 3RTQC 3RWDB 3GZKA 4NZTL 1IARB 3GDBA 4NDMB 3BZFB 4X7DC 1IEAA 4LFHG 1DBMH 4OQTL 3HPJA 3CX2A 4NNXB 4ELME 2XKSA 1PX3A 2FHCA 4EXPX 1LP9F 1JPSL 4BZ2L 3T0AA 4MB4A 1R5IA 3OMZA 2ED7A 4P46C 4G80B 2EDYA 1A7RL 15C8L 4DGVH 1OTTD 4ONHB 1QSFB 5F7YC 2Z92A 5FGRA 4ZAKA 5IB5A 3QFJB 4J4PA 1MF2H 1CVSC 2EEBA 5CP7A 5E00B 1ZHNA 4PJEF 1OARH 4JO3H 5F88A 4P4KA 4OBRA 1NCWH 5IMOB 1CQKA 3NACH 4KTDL 2IPTH 4W6XB 4DQOH 4P4RA 3EJZD 3FB7A 2EIZA 5INCB 1SJHB 1ZA6A 4YXKH 1LDPL 4F80A 4I3SL 5J56B 1DEEB 3AREA 2FEDD 5DWUH 4X9HA 3S3PA 3MTRA 4IIQC 3D25B 3QEGH 4LHUA 4K3GA 3R06A 4H1LH 1KB9J 3CGTA 3FO2B 4TRPL 2R39A 1KCRH 5LQBH 1IGJA 4LKCB 3QUMB 5DMKA 1NLDH 3OKEA 3RX8A 4DK3A 1MQKL 1Q1JH 4JFYA 5I1GH 4D9RD 5KG9A 4PV8A 1JGEA 2AP2A 3LDBC 3GI9L 1I8LA 3FRUB 5KSAA 1Q9KB 3H9HA 3Q1SH 4ZXBD 4QRTA 5FYLL 5CBAA 3OHXB 1AGDB 1OWRM 2WWKO 1G0YR 4NQUA 3BDXA 1T21A 3ZDZF 1I3GH 4EI6A 3JTSB 2FX9L 4JREB 5ITFA 1NJ9A 4HWZB 1U3HB 43C9B 5HXMA 1DEDA 1KEGL 2FGZA 1YEFH 3U30B 4OZGE 1U8PB 2JJWA 4R4ND 5AUMB 2E7HA 3PABB 1N59A 4X5XB 1LEIB 3STBA 5ETUA 4HKJB 4BSVB 1FP5A 3MUHL 5MEND 3B9DA 2SEBA 2V2WA 2X4UA 5C08E 4P57B 4HJGB 4PG9A 2EYTB 1KLGB 2NY4B 3MLRH 3BRGC 1C16A 1W0YT 1YYLL 4EDWH 2PYED 5HD8D 4U1NA 2QQQA 2Y5TA 2NTSP 4PLJD 5ID0B 5C0CA 4JZOB 4X4MA 2BNRE 1KG0B 1SYVA 3GMLB 4MD5A 5E6YA 4CL7A 1M7IA 4KGJA 1LE5A 1S9VB 3ARQA 5IW6B 1PQZA 3DURB 1P6FA 4RAHA 3LQAC 1KIQA 1OW0C 4HH9A 4CVZA 1OTTC 1T22B 2WQRA 4KK6D 4P23A 2V2TB 3DX8B 3LZFL 3ARBB 3MBED 5JNYA 1IMHC 5DHYB 1KLUA 4PJ7B 2DQHH 4LCWD 2XNAB 3UTTE 4TTGA 5I1JL 4ZPVA 3G5VB 4R90H 1PGRB 4DWHA 2FBJL 3HE7D 5GS0D 5CD3B 3WFDL 5C0JB 4N90E 5F7MC 4JFOB 3TVMA 4ZOBA 1E4WL 3MRKA 1JNLH 1SM3H 4ZDHB 4O58L 3MLPA 4FFWC 4AMKL 4MNGA 2FZ3A 3EJZC 1FO0B 1YUHA 4FQIL 2Z35A 5CJQL 3VG0L 1UVQB 1QZ1A 1WTLA 4WI9A 2VN4A 3WO3B 1G7QA 3S36L 5SV3A 5BZDA 2FEDC 5D72L 5IVXB 1NCUA 2XPGA 1S3KL 3S96B 1S9XA 2VC2L 3QEHB 2MQ3A 3SDCD 3IJSA 3S37H 1GC1C 3T2PA 4LHQB 4LEXL 4WFHE 4MNQD 4YHYC 4O4YL 5GSRA 5F9OH 4JZNA 5KSBF 5KS9A 3EZ8A 1G7HB 3CFJA 5C0RL 4JG1L 2W0FA 3SY0A 1BHGA 3WUZA 3QIBA 2B4CC 2J1KA 3RUGA 2Z8RA 4HAFA 2VDQL 5A16B 5HYJB 4FQJL 2GAZA 2OZ4L 1FAKT 4L8SB 1Q9WA 1UEMA 1VFUA 4ZXBC 3Q5TA 2DQTL 4IOIB 3L3IB 3DV6A 4HUXB 4OGXH 3VXUB 4EVNA 3RIAK 1NEUA 3Q6GH 3OKLA 1CQYA 4QRRE 1EHLL 4EBQL 4X83A 3MCKB 3CDGB 3QNXB 4R0LB 2EDHA 3N1PC 4ELKA 5JIPA 1UKSA 3RZCD 2OSLA 2DL9A 4WTZA 3DETD 3SKOB 1W72L 3C8DA 4R4NC 5EU4A 1MCHA 2BERA 5TQ2L 4OTXH 5BRZA 5C7XL 1UWEH 5IHUH 3VCLB 1F4WL 3BDYH 5IFAH 1Y6KR 1HINL 1U8IB 3TNMB 5T5NG 4HK3N 4PJAE 2D3VA 1NAML 4JO2L 3ULUE 3RDTC 2A77H 4K7PH 3L3KB 2OYPA 3IAPA 4Y16D 3FCTB 5BS0D 4PYHA 1AKJA 4QRPE 3EO9H 1RVFL 1EO8L 1ONQB 5HGHA 3THML 4PLJC 4KK9D 4WUKH 4YHPB 2HT4D 2X4PB 1X5ZA 2VQ1B 3RI5K 2C5DC 5BO1H 3CC5B 2R2BA 3IFLL 4U7SA 4V2CB 2H6PA 4C4KT 1IKFH 4YDVB 4KKBC 1JWSB 1HHGA 5CHNA 1BD2E 5DD1L 1A6ZA 3TT1H 2KDGA 4JFFE 3KR3L 2PO6B 3TT3L 4JQIH 1N5AA 2HWZL 4JLRB 3MBEC 3IDJB 4PJ9D 4QHUA 4U05A 3GHBL 3IGAB 3LPFA 1H5BC 1JYVA 3FQTB 2PW1A 1U58A 3BP4A 3CVHA 2E5EA 5BRZE 5DFTA 2PXYB 1NCNA 5I19H 4JQVC 3PWUB 5FECB 1ADQH 5E6IC 5GS0C 2C3XA 2VIRA 3BEVA 3HRZA 1AD0A 3HUJA 4LDEB 4J8RA 3MREA 4UTAL 2ZSWB 3ZYOA 3WFEL 3K80A 4G8FB 3BP7B 3I9GL 4MWFB 3M8OH 5J13C 1IC5H 2NY5L 1VADB 2DQUL 5HYIA 1AO7E 3QO0A 2ZUUA 4XCNB 2G2RB 5TDOB 4HUWA 4WHDA 5E8OA 3IRZA 3QDMB 5L2KE 4NPYB 1EEYA 3HLAA 4YNYB 1Z2KA 3P73A 5BCAA 3T0WA 4OZIA 2VITA 1I9IL 3VXPA 2HT2D 4Z0XB 4LIQH 1FJ1A 4QXGL 4MXQD 5JOEA 1TXKA 3UTSB 2VDOH 5H8DA 3TV3L 2D31A 1TZHB 3L1OH 2DLFL 2OXHA 4U0RC 3SPVA 3TPUA 4UB0H 1UYWL 1IQWL 4DZ8A 3N50A 4PJIB 1A9EB 4RNRA 4R96A 2VRAA 5A2FA 4XBGB 3BN3B 5HY9A 3FT4B 2VJXA 1GPOL 5EC2A 1WZLA 1CE6B 2JIXB 5DF0A 2W0KA 3EYUL 5I6XC 1KTKE 1QA9A 1J1OL 2EDBA 4YE4L 3RX7A 3IDXL 4HIJB 3VE0A 3CFBB 4HGWB 6FABH 3DETC 4M6AA 1JMXA 1KFAH 4J3XA 4WO4A 1PEWA 4HV8A 5I30H 1EX0A 3T0EA 5L6YH 4YHOL 3DLQR 1RZJH 2P44B 4Z7UF 1HSAA 4B53A 2K3TA 2XTJC 4Y16C 2AW2A 5FYKL 1PSKL 4PTUA 5B39A 1W0VB 5DC0A 2LU3A 3MOBH 3IDIB 3BZEA 3HC4H 4HFWA 1D5BA 3T2NH 2KZWA 4K8RL 4BH7A 4OCWL 3VRLF 4KK9C 1H15A 4GG6B 2V7NB 5MI0C 4GH7B 2HT4C 4PRPA 4PB0H 3U7WL 2EKJA 1ODAA 2LVCA 2VR4A 4XHQA 4XBPB 2VLKB 1RI8A 2J8UF 5KN5B 4PRIA 2YD8A 4XMLL 1HXMB 4PREB 1CL7H 2HJLA 4XNQA 3TJEH 3W39B 1GRWA 1RSFA 5TF0A 2V9QA 4JDZA 2P5ED 2QADD 2ZP0T 3MJ7A 4LF3B 2OP4H 3ULSA 5TH2A 2F53B 5ISZA 4WHTB 1IT9H 4JRYE 1C7TA 4MQ7B 2UVFA 2GSGB 3GSRA 1MVFA 5M94B 1KPRA 4LSPL 5KVGH 2BCKB 2QSTA 2QQNL 2C4FT 3VWKA 4NQDD 2X4OA 3OKDA 4M43L 5F7UA 1JZ2A 1CFQA 3OR6A 4B0MM 4I2XE 4MX7B 1N0XH 4PRPE 2BNQB 4LSRL 5TPWL 3BKYL 4EOWH 5I8OH 2YUZA 5IF0A 5IV2B 1I9JH 4YK4C 3RGVD 2DD8L 4M1CD 4R2GD 2O5ZL 5I1KL 4GRMB 4TNVF 1X5FA 3SDDA 1VACB 2HT2C 1J88A 3HI6L 4F9PC 4PRIE 1JNNH 1TQCC 4I3RL 4MXQC 4XPAH 3VH8B 1OGAB 2DM4A 5C07B 1KV3A 4DGYL 3ESVF 3W11C 5T5FH 3IB4A 4HDIA 4UV7L 4GG8B 5E99L 5I17A 1DQLH 3B9KD 2CH8A 4XTRD 3TO4A 1T0PB 2Q8BL 3RWDA 2QQLL 4Z7NF 3MRHB 1LHZA 5I75C 1LO4L 3QEQA 3BZFA 1CG9B 1CDHA 2NY6D 4AEIH 4NNXA 4P2RD 1OD7A 2L7UA 5EIQA 1JN6B 5DGQA 5SWZE 1TVHA 4ALAH 3ZT5A 3NIFF 4XPGH 4G80A 1OD9A 5E2UL 3GSNB 1GGIH 5C0GA 5J3HD 1QSFA 3ZTNL 1KN4L 2JELL 4LASH 2X4QB 3QFJA 3S98A 2GTWA 3I50H 5F9AC 4XNYH 3WSQL 3IRPX 5E00A 2F8VA 2FJFB 2XQBL 5IMOA 5IM7B 4RWHA 5ALBL 2WM0A 3BDBA 3WNPA 1YEJH 3EYSL 5KVEH 1EVUA 1B0GB 3TGXA 1FBIL 1MLBB 3GI8H 4XCCH 1DQMH 1DEEA 4RAVB 3VGBA 3HR5B 3WIHL 4LLYA 2R56L 1XR8B 2WANA 1EFXD 1IGIL 2KUTA 4ZUVA 2Z8VC 3D25A 1R5WB 1EVTC 2ICEB 5CZVL 5IGXL 1RJCA 1ORSA 3FO2A 2ZCLL 2I07B 3QUMA 3TP4A 2QBWA 5IROA 2RB8A 2QADC 4KRMB 1DBAL 1QSFE 4WI4A 3S8WA 3PIQB 1YJDC 3G6JB 1ETZB 3DXAA 3GMPB 2DBLH 4O5LL 1IKNA 2IMMA 3ALXA 5JHLL 1CLYH 1TJHL 3FRUA 3I6GB 1Q9KA 1BQLL 4KVNH 2DLHA 2D9CA 3BO8B 3OHXA 4OFYA 4MA3B 5ACMA 2BJML 4PP2B 1A7QH 4U6HB 1XGYH 1UADC 3JTSA 5FGCE 1U2HA 5CUSH 4NUJB 1F4YL 5EOQH 5C0EB 2I9LA 1JHLH 2R0LL 4R2GC 2AEPL 4OM1L 1U8PA 4WIQA 3UAJC 2E9JA 4C59B 5I1HL 1FGNH 1JTOA 1Z3GH 3PABA 4XCYA 4X5XA 1DLFH 3JV5A 4OGAC 4HKJA 3RIFF 4BSVA 2Y5EA 3WUWB 2ATPA 4PJ5A 2PTVA 4HJGA 3B9KC 1PG7W 5HHVH 5J0BA 3NZHH 2EYTA 1HE7A 1KLGA 4MLSA 4XTRC 4U1KB 2BNUA 4EI5A 4WY7H 4Y89A 5I71B 1ZANH 2AXGB 1PKOA 5GJTL 2VE6B 3V52L 1KPUB 4FZ8H 4MCZB 2E7LC 4JZOA 4U3HA 5D2NC 4L3AA 1KG0A 3PWPE 3GMLA 3LIZL 5F7WC 3W5MA 1E4XL 43CAB 3DURA 3MGOA 3KPSD 4GW5B 3SCMB 1T22A 1NCBL 5EPMB 5J3HC 5F21B 3DX8A 1GHFL 3ARBA 3FQWB 5FUCC 3D39E 5I1EH 3GMQA 3WD5H 5DHYA 5GS2D 3WS3B 1I7RB 2AEIT 1EV2E 2MHAB 4TUJA 4WFFE 5EBMB 3LN5B 1E4XI 3G5VA 1I4FA 5MEOB 1RUPH 5CD3A 5C0JA 4JFOA 1KC5L 2P8PB 3U79A 3K0WA 4YDLC 4Q9QH 3TA3B 4ZDHA 2AK4B 2O61B 4IJ3B 5SWSB 3RL2B 5E8EB 1UVQA 3MJ9A 3NOIA 1TPXC 4F7PB 4JHWL 4RIRB 5IVXA 1GC1H 1QRKA 1N26A 4JQXC 2VMFA 2A1WL 4BFIB 3QEHA 4LLVB 3A6BL 4HMEA 4YLQT 3TYGL 2P43B 4MZ2A 5F7NC 2B4CH 5I76B 2R8SH 4P2OD 3EOAB 5F7FA 2EE2A 4ESKA 4LLWB 1W2KT 1G7HA 2UV3A 3OTTA 4L4TD 4U1HA 3CZFB 3RPKA 3VD3A 2P4AB 5KBNC 4PJ7E 2UWEA 3WIIH 1FE8H 5A16A 5HYJA 5FF6A 3V6OA 2CMRH 4L8SA 1QNZH 5FM5O 4HS6B 3MLWH 1F2XK 4IOIA 3L3IA 4HUXA 4U4BA 1FL6B 3TZVC 5ADOL 2EEDA 2XZQL 3LHPL 1FFRA 3QNXA 4R0LA 5CFHA 5I1DB 4LRNL 2BZDA 2PYFB 3DHMA 2CDGB 2CKBB 3MLVH 4NM8L 3SKOA 5FB8A 4PTTB 1S7TB 4N0CD 4D0CB 5KSVB 1FORL 5JW4M 3V6BR 1P7QB 1R5VA 1BX2B 5ESVA 4EUPH 4IRZH 1G9ML 2DN7A 4HT1H 4QRPD 2KKQA 4WWKB 3ZE0F 3LMJH 5LWYH 4M5YL 2DM2A 5AYQA 5HYQB 3L3KA 4KK8D 4AIOA 3F12B 1NBYB 2BHUA 4RA3A 4Q9RH 3S7GA 3P2TA 1TQBB 4JFQB 4MGXA 5JW4N 3NABH 1OAQH 1MRFL 4YHPA 3F65A 2VQ1A 1WUNT 5I8KH 5IFJA 4FG6C 3CC5A 1OPGL 3VXUE 4YDVA 1R0AL 3I3BA 1VERA 2IBGA 3VWJD 2E6JA 1GOGA 4HK0B 4U1MB 4HKBB 4ZFZA 2VLRB 4JLRA 2RR3A 3NIGE 3IDJA 4ONOA 2OJEB 5GS0H 1QSED 3FQTA 4M8QA 4XNMB 4AJ0A 3KHQA 2GT9B 3HC0B 2PXYA 3UYOD 3DI2B 2WIIB 5KS9F 3PWUA 4NO0B 2NZIA 5FECA 3KGRA 1AO7D 3C5ZB 2G60H 1ZWIB 3K46A 5GRJL 1U8HB 3RUGF 2N4IA 4G8FA 5IWLC 3BP7A 1VFBB 1F6LL 1HWGB 1IEBB 1FDLH 1D6EA 4MWFA 5L2KD 3RWJA 5FA3B 7FABH 1VADA 3E6HB 1JCKA 4EQ2A 2NR6D 1UCBL 4XCNA 2G2RA 4POZD 2ITCB 3QDMA 5E4EB 4LPXA 4YNYA 4PB9L 5JOFB 2ZUTA 1VKXA 4PJ8B 4GMTH 4HZLB 1FL3B 2NY7H 1NCDL 3W0WB 2HT3D 3ARGC 5EU7E 1FNLA 1KB5L 3VFWB 1U3ZA 4P2OC 1PKQA 3UTSA 3NA9H 1A6VH 1BIIB 1JGUL 3TH4T 3Q3GB 3VXNB 4I48B 3NFSH 5GGVL 1IAMA 4POUB 4NHCH 1RZ7H 1DE4B 4H8WC 2AJZB 3VXQB 1TZHA 2IFFH 4EZMA 4QOKB 4FMFA 2NXZC 4OFVA 3JVGA 2VISB 1DL7L 1JI1A 2H41A 1OLLA 4PJIA 1A9EA 3ULVD 4YEFA 4XBGA 1T2JA 3KS0J 5D7JD 3FT4A 5IOPB 5GS1C 1PLGH 1CE6A 4MXWL 2AEQH 3E0GA 3UJIH 4NYLB 4P5KB 2PETA 3L5WA 4YGAB 1BVLB 5E8NA 3U0WH 5BVPH 1YYML 3ZHLA 4M48L 1YMMB 3CFBA 4N0CC 1ROWA 3FQRB 3DSFL 4BK5A 2HLFD 3QDAA 2GHWB 3S34H 1TTGA 1NCAL 2VDPH 3QYCA 1T04B 4RGOH 2GSIA 5IMMB 1CU4L 3U9PL 5J06A 4Q9CA 5DMYA 2M26A 4KK8C 3LKOB 3QZWB 5J11B 3QHZL 1V3JA 4F7EB 3IS0X 4NNPL 3QIUD 2FYYA 3GBMH 3IDIA 3QH3A 1KPVA 2H26B 1WSST 3MZGB 3ZKMC 3OB0K 4GG6A 3HUJF 2V7NA 4L8BB 3MOQA 2NZ9D 3TBTA 3D6GA 5T1DH 1MFAH 3MRFB 3N06B 3NGBC 4LSVH 5GRUH 4N5UA 1I7TA 4OQ1A 4ZTOH 5GS3A 1K85A 5EU6A 1KIUA 4XBPA 2VLKA 2DJUA 4KAQH 5K9KB 3VWJC 5KN5A 5EO9A 1MJUH 3RNQB 4UIMA 1HXMA 4PREA 1BREA 3O2VL 5EZOL 4ODWB 1MHPH 4ODSH 3W39A 3HZKB 3N1FC 4X9IA 4XC1L 4OZIF 3P0YL 2X4RA 4NHUB 2VDKL 3B5HA 1MVUB 3DYMA 1RIHL 1LNUB 5FAAA 4LF3A 5I66B 4X80H 2F53A 4WHTA 4KUCD 1N4XH 4ODTH 2GSGA 4OLUL 4OKDA 2DIAA 4MJIB 1SBBA 4WHYH 4XCEB 2APTA 4PJHB 4WRLA 5EZJB 1FGVH 1CGVA 4HUKB 3ARXA 5EIVA 4N8PA 1T3FB 2IAMD 2VL5B 2NR6C 3CVHL 3VGAB 3QUXD 3MXVL 3EBAA 1MFDH 5FYJU 4MX7A 2BNQA 1WBZA 3VXMB 3BYYA 2UUDK 2YKLH 3VG9B 1SBSH 1AH1A 3SE8H 4GRMA 2F5AL 5D7IE 3ZKXC 1GJIA 5HPOA 2HT3C 2VLKE 3QDJB 3EAKA 4LVNB 2H32H 4XPTH 2O5XL 3I3EA 5AZ2H 3VH8A 1FNHA 2E9IA 4Y2DA 3OGCB 1OGAA 5C07A 1EEUA 1N5YL 5GRYA 2B39A 4GG8A 4YH6A 3VFRB 2VSCA 4IRSA 3R0NA 4KHXL 2DMCA 4HS8H 4MAYB 3MRHA 1FNGB 4HBCH 2VLJE 3ISWA 4AEHH 3ULVC 5LCVH 4PUBL 1CG9A 2H45A 3NCEB 2O5YL 3U83A 1T1ZB 2VAJA 5ECJE 1LO3H 3IU3B 3ZDYF 2DIBA 4DUXA 5DGRA 1MJ8H 1NGPL 1WZ1H 1A1NB 5DJ0B 2XZAH 2A9MH 3GSNA 3LN4B 4JVUA 4PRDB 4BKLB 1J10A 4UT7L 4WI7A 1TCRB 2X4QA 2ZCHL 1HCVA 3GUTB 5HDQH 1MFBH 1OGAE 4HKXA 2DLTA 5IM7A 3QIUC 3T77B 3ILPB 1OP3H 1MRCH 4OD2B 4UNUA 4GRWH 1I75A 4A6YH 5JW3L 2NZ9C 4NBZB 5FYLD 4ENED 5GGQH 4P9MH 1MLBA 4UOW0 1XGUB 4RAVA 1HQ4A 2OLDA 3C09B 4XVUD 1XR8A 3LH2H 1T6VN 1R5WA 1WGOA 2ICEA 1YJDH 4NKIH 1J1PH 2FWOA 4Y5YC 1E6JL 1EUTA 3Q5YA 1JHTB 3K2UL 1UM5H 1IGCL 3L3GB 3BIBX 5F7EL 1NCCH 1OP9A 3G6JA 3Q5OA 1LEKB 3GMPA 5IVZB 2NMSA 3H9SE 2HVKB 5IG7B 2BDNH 2FX7L 2QQKL 3FO9B 3PDOA 1V7NH 3SKUD 4ZSOE 3BPLB 3I75B 3O0RH 4JN1H 1U41A 5IB1A 4LU5L 4KZDL 3IAGC 2IAMC 3X3FL 4F37F 4MA3A 3F58H 4H25B 4PP2A 2HJKB 4U6HA 3LQMA 2XZCH 3HAEG 1GAFL 1D6VH 3RPIB 4NUJA 1U42A 2CJUL 5C0EA 2Z8SA 3DRTA 5CCKL 4Q6IB 1I9RH 3MOAL 5JHDE 1HXYA 2CD0A 4P2YA 3HNTH 5I9QC 5ALCH 5DHVH 2APXA 2BXZA 2J6EA 1ZLSH 4EEEA 1XIWD 4MAUH 4MD4B 5SX5K 1BEYL 3ZHKA 3FMGH 2B0SL 3SGKC 5CEZH 1P7KA 1INEH 3RVXD 4JKPH 3A67H 4L4VB 1GIGL 3WUWA 5HBBA 2YRPA 1DP0A 5D70H 1F13A 1F00I 2J5LB 5KANI 2VXVH 3TM6A 4P2QE 3OL2A 4U1KA 4XHJD 4U3XA 1C8PA 3P4MB 2UZIH 4AIXA 2C3HA 2VE6A 3PQYB 3CVIH 4JRXA 5CSZA 2K9UA 3S97C 3NCYP 1T5WB 3CX5J 3QI9B 5KANG 3O4OC 4L9LC 1FH5H 2EZ0C 3CSYB 5KOMC 3NA4A 4NRXB 3WFBH 3NN8A 1CTOA 1FL5B 3D39D 3KYNB 2QL1A 3SCMA 4NKMB 4G9FD 4WFFD 4XMPL 1O7VA 3D85B 1BF8A 5EPMA 4FQ2H 3O8XA 3R1GL 1E4JA 1FFQA 3I3DA 3BPNC 2QLVB 1I7RA 2ZUSA 1HEZB 5DR5L 4LCYB 2HMID 4PJBB 5EBMA 3U82B 3LN5A 1VSCA 5EULV 2EDWA 4FQCH 4JKWA 2NY2B 4IBLT 1U8KB 4TSBL 4PRHB 1F02I 2P8PA 2X89D 4S2SB 1L7IL 1K4DB 1HIML 3B5TA 3TA3A 3OWEA 2ESVA 1F8TH 1F90L 1P69B 5CAYB 3RL2A 4ENEC 4NQSB 4G6MH 1KJ2H 4KROB 1WWAX 1X5KA 4RIRA 4WFEE 4XVUC 1YQVH 1MY5A 2FECL 3EYFB 4OIIH 2HG5B 2ZJSL 2MCPH 4BFIA 3LSOA 4LLVA 4WI2A 1P84K 4H88L 4PJGA 5HTSA 2YK1L 3LS4L 4LPTA 4QT5A 3EOAA 2XWBB 3GMOB 5F9WB 3J8F7 4LLWA 1X9QA 3C2SA 4HQQH 3O3DB 4F8QA 4ZUUB 1RIVL 5DEGB 3FO1B 1WIPA 5HYSB 4GXVL 2WLZA 2VXQH 3NIDF 4UT9L 3RVTD 4MZ3A 1BQHG 4X8JA 4HS6A 4U6VH 4FFYL 2P8MB 4O9HL 5EWIL 3UJTH 5JOPE 1PG7H 1YNLH 1RUAL 2IANB 3ZSTA 4AIZB 2XXMB 1FL6A 3TYFB 2VXSL 3GJEB 3IKCA 2I5YL 2YA0A 5F1SA 2AK4E 3GIVB 4N0UB 3ARFC 4MDIA 5SWSE 4QRUA 2G5BB 5I1DA 5C0AB 4BSWA 2CDGA 2CKBA 4H1LG 2P42B 2CGRH 4PTTA 1S7TA 3LCYA 5KSVA 5F1OB 1XIWC 1P7QA 3MV7D 1SYSB 4JO1H 4PS4H 2BFVL 5FEBA 5JA9A 2XTLA 1TLKA 3EHBD 5E2VH 5F1NB 3CXHK 3RVXC 1KCUH 4DCQA 1JFQH 4YR6B 5HYQA 1S7WB 3TIEB 4NZUL 5B3JE 4Y1AB 1UACL 4P5TD 3MR9B 3R0MA 1G0XA 4XHJC 1O7SA 1NBYA 3QAZC 5D2LE 3KPTA 3PNWB 4KJWD 1CDIA 4JFQA 3GRWA 1T66D 5DFWH 1U0QA 4NJAH 3RU8H 2P45B 4QXTA 3WN5B 5BMFH 2AXFB 3NCFB 4UQ2B 1IM9A 1KTLA 5GS2H 5IVXF 3UO1H 1G9EA 2BHZA 2R0KH 3OJMB 4JDTH 1J9CT 3I2CL 4GRLD 4LDOB 5DQDL 2VLRA 4BQ9A 5GHWH 2CLRB 4G7VL 3JZ7A 4WWID 3SJVB 2UYLB 2OJEA 3MRLA 4JFHE 1TCMA 4KRLB 2R1XA 1Z9MA 4JCLA 4LSQH 4S11A 2GT9A 1ZLUH 4KI5E 2VWEE 1MCPL 2CO7B 2WIIA 3PV7A 5DEFA 4N0YH 4NO0A 5C0BA 5A40E 3MBXH 2PR4H 2APFA 3C5ZA 2R29H 1ZWIA 2BRRH 3SN6N 1U8HA 1YY8B 2UWEF 4TUOB 2GUOB 1IEBA 4U7KA 1MCJA 2BVOA 1UJTA 5GRVL 3E6HA 1D7FA 4CMMB 3PGDB 2ITCA 3HFML 4RZCA 1FVEB 4MVBD 4ACPA 3BGFC 3VW3H 1KACB 3G5YA 4XP9H 1C5BH 3QXVA 3FFCE 4Y5VC 1DZBA 1MIEH 4PJ8A 4HZLA 4U1SA 3QUYB 4WTWA 1VPOH 4QHMB 1LVEA 3KXFD 4H8WH 3MJ9L 2K7QA 2XA8L 1BIIA 3QNZB 2VLRE 4WJ5B 1JI2A 3Q3GA 1MIML 4I48A 1VHPA 3QIWB 4MA8H 2AKRA 3B3IB 1DE4A 2R69H 2AJZA 3VXQA 5FYKD 3KYAA 1FIGL 4QOKA 3OB8A 3RVTC 1NEZA 3DO7B 4AH2B 2GFBB 4XWOD 4LCUA 4K8RD 5IOPA 2AXJA 5DQJB 3QULB 4DKFH 4NYLA 4P5KA 5DLML 1IFHL 5IFHH 1AJ7L 5J12B 5DMGD 2FGWL 3MV8A 4KMTL 2VYRE 1YMMA 2YC1B 4APQB 2C3GA 4Z78B 5F9DC 1R3KB 3FQRA 1P9MA 4QXUL 4TULL 1RMFL 1FYHB 2OR8A 3PL6A 1OT2A 1T04A 3W0WE 1D9KB 1L6ZA 4LOUD 3HA0A 5FYJE 5IMMA 1AQDB 5IB3B 4D9LH 4ZOEA 4P5TC 3LKOA 3QZWA 5E4IA 2E27L 2E7BA 4E5XB 4F7EA 3W81A 4J12A 1NGZB 4JY4B 2H26A 4X7TA 1T66C 4FS0A 4L5FL 2WBJC 2YPLA 4Z95H 3H7LA 2NY5C 1EBAA 2DM3A 4E42B 2BMKA 1YEIH 4P99A 1U8OB 4PLNC 1NC2B 4Y19B 1QBML 5K9KA 3KLSA 1A7OH 3JWOL 2XN9D 3QUZD 4GRLC 4PLOB 1F3DH 4ODWA 5HHNA 5I0DA 3QP3A 4S1RL 1AFVH 2RIKA 3HZKA 3GSXB 1YEHH 1JZ6A 3IDNB 4NHUA 1NMCB 4DJMA 1WISA 3ORJA 5CIPB 5F6IB 2HRLA 1MVUA 4P49A 1LNUA 3QCUH 5I66A 1MFNA 4LEOB 4UIKL 1JGVH 1TETL 4KMQA 4PG2A 5T3ZL 4P59L 5FM5M 5TE6H 4XCEA 4AEFA 4X9BA 3VI3F 4LSSH 3MMEA 1OTUD 5FO9B 4TSAH 3MA7A 1J1XL 2VL5A 1MEXL 4HBQA 1HYRC 2I9TB 1BM3H 4PJIF 1YEDA 3P11L 1JRHL 3MSPA 4F7TB 1SVZA 5C0NC 2Z93B 5CZXD 3UBXB 1QEWB 1UJ3B 5I1CH 1LK3H 3F62A 4CVWA 5HGDB 1A6PA 5GGTA 4JFDA 3QDJA 1YMHB 3BPOB 5I18L 2ICWB 3OGCA 3N85H 3CXDH 2WV3A 2YWZA 5JPNA 3BGAA 5DD5L 3WXVH 2VLJD 1LMKA 3NCMA 3CSBA 3ULVH 3VFRA 2A83B 1A7PL 1KN2L 4ZOAA 4XC3L 1YY9D 3JV6B 3FRPA 4ZFOB 3ZDXE 3DECA 1B0RA 4K7PY 3INUL 1G9NL 2IMNA 3H42L 4MAYA 4P5MB 4XWOC 1EO7A 1FNGA 2PTTB 1CK0L 1Q38A 4K8RC 4Z0BL 5BV7L 1P1ZB 4MJIE 1T1ZA 3ROLA 4ISVB 4PJHE 3RIAF 4GG6F 4ERSH 1PYWB 3IU3A 3HZMB 4M6NL 5ACZB 4I5BB 3GBLA 5DJ0A 3RNKB 1BAFH 1RUKL 3FJTA 4I0CC 1AD9A 5DFVC 3F7PC 1GL4B 3LN4A 3QWRD 4PRDA 4BKLA 3VXRB 2IADA 4GAGL 3VXME 5JDSA 3V4UL 2V17L 1D5ZB 1TCRA 4FQLH 3U1SH 1IAIH 3C6LB 1HKLL 1KBGL 3C60B 1G6RB 2Z0BA 2BY0A 3GUTA 4LOUC 3CDFA 4Y4KB 4GAJH 3KPRB 1A14H 3AM8C 2Y06L 3L5XL 1K9TA 2HRPH 1SY6H 3T77A 1KIPB 3ILPA 5JW4Q 4OD2A 1X4ZA 3HCVB 4G6KL 1EHXA 2EYSB 3DNKA 4QTIH 3WHE1 5DVNA 1AXTH 1JF5A 1RULH 4JM2D 3RWGA 3S88L 1XGUA 1XF2B 1A5FL 1HNGA 3RI5F 4Q2ZB 3MLUH 1J12A 4OT1H 4QHKJ 1U9KA 4P46B 4UNVA 4NFBA 2EDXA 4HMDA 5DK0B 5BVJA 8FABB 4OM0L 1YDPB 3RJQB 2Y6SC 1A6TA 4O2EA 1JHTA 3GO1H 4K23L 5DMJB 3G04B 3FOMB 3QFDB 4PJXE 2ZOLA 4NKOA 4NZTH 1LEKA 5IVZA 4UU9A 4JFEB 4DOHB 4IHOB 2XI9A 2HVKA 5IG7A 5LBSH 4OQTH 3FO9A 3D3VD 2VKWA 4YXLL 1OTUC 3TN0D 1CL7I 2IBZX 1JPSH 2JB5L 4BZ2H 5JHDD 1NGQL 4JY6B 4XP5L 3TC9A 1OP5K 1A7RH 15C8H 3ARZA 3RPIA 2Y36L 5IIEB 1OAUL 5EIIB 1MHCB 4DFHA 4RX4D 1QACA 4Q6IA 4V1DD 1S8DB 1H9VA 1UGNA 2MJWA 2QEJA 1EZVY 1NBZB 3X12A 1CR9L 4MD4A 4KHTH 4NN6B 1CIUA 1S7QB 4TQEH 5HHQB 4L4VA 2Q86B 3D0LB 4KTDH 2HLAA 3MUJA 4F7MB 1LWRA 5KVMC 3TBYB 2Y72A 1YY9C 4OZFG 4RBPH 4AEEA 3LDBB 1T83A 1LDPH 2XWTB 4I3SH 5HDBF 2DWEB 3P4MA 3LS5L 5IEKB 3PQYA 3AXLB 5EOCJ 3ZMRA 5LGJB 3HNSL 5BXFB 1KEML 1T5WA 4ZAKD 4J4PD 2GKIA 3P0VL 3QI9A 2QSQA 1VCAA 3DMMD 1FZOB 3G08B 3CSYA 4KZEL 4NRXA 1FL5A 3MRIB 4TRPH 3BE1L 1A6WL 4NKMA 1J05B 3D85A 1H8SA 2FIKA 2Y9RT 4NSKB 1MQKH 4KDVA 3H6JA 3T8XB 3CSPA 5B4MD 4BH8B 3FAWA 2WQ8A 1G7IB 2RFXB 1P2CB 2ZUWA 5KJRL 1HEZA 4LCYA 3GI9H 4PJBA 1ZLWH 3KAAA 4GAFB 5FYLH 1BJMA 4GKSA 4CMHC 2X5PA 1KCLA 1U8KA 3L5IA 4LHUD 4MS8D 3G6JF 4PRHA 3VJ6B 4L4VE 4OSUL 1ZSDB 1K4DA 1IGFL 4F15C 2FX9H 1OVZA 1DSFL 2GTZA 4NQSA 3ZSSA 1KEGH 5MP6L 2ERJC 5A2IH 3MLXL 2NXYC 4JY5L 3HE6A 8CGTA 4I4WB 3EYFA 1AC6A 2CXKA 3STLB 2HG5A 2ZNWA 3RKDD 2EXWC 4W4NA 4XWGL 3MV9B 4M02A 1RU9L 4M6OL 5CJXA 1WJ3A 1WITA 3GMOA 2OXGA 2XV6B 3SO5A 3O3DA 4ZUUA 3D69A 5DEGA 4RGMC 4UUJB 3FO1A 4X4XB 3MJ8B 3DVIA 5HYSA 2A6IA 4PJBE 1A21A 2OTWB 3QQ4A 1MLCA 4I13B 1WT5A 1T4KA 3L5HA 4BELD 2P8MA 2IANA 5CBEB 3TYFA 1MRDL 5MEPB 3R8BB 3ZKSD 3GIVA 1SMOA 4N0UA 4PR5B 1R3JB 3S5LG 2G5BA 4K3EL 4LCIL 5D71L 3GHEL 5C0AA 3LZFH 5J4MA 2LU7A 4DGIL 4QHNB 2X9YA 5E2JA 3BP6B 3KJ4B 2EDJA 5E1HB 5I1JH 3VD9A 2Z91B 2BSED 4GOSA 5C09E 2FBJH 2D2OA 3WFDH 3BH9A 5HHOA 4Z5RA 5F1NA 4YR6A 1E4WH 3JV4B 3TIEA 3WHXB 4O58H 3O45B 4Y1AA 4AMKH 3MR9A 4FQIH 5DEZA 1K6QL 5CJQH 3VG0H 1L6XA 1NL0L 3PNWA 5F97E 3E3QE 3S36H 4ZXBB 5TDNA 4K94L 5D72H 3JXAA 2NY3B 3L95B 5DYOA 1S3KH 4ZAKC 4J4PC 5D7LB 5E24E 2VC2H 4WTXA 3UX9B 2AXFA 1T6WA 3LQAL 4AY0A 5ICXA 5L9DL 1CXEA 1FRGL 2IANE 4LEXH 4P4KC 4S10A 4UQ2A 5T1KB 1CS6A 3K8LA 3QJHB 1HHHB 2AAVA 3AMLA 4O4YH 5I15L 3TVMD 2PNDA 1C08B 3VFVB 1AE6L 5JORA 2F5BL 5C0RH 4JG1H 4IDJL 1FVCB 1QYGL 4R97B 5B4MC 2UYLA 1AI1L 4PJGF 1C5CL 4X0KA 4OLWL 3PGFL 2VDQH 5MENB 3K1KC 4FQJH 1FHGA 2OZ4H 5DZNA 2HFGL 4OUUB 2GY7B 4O2FA 3KPLB 2R2HA 3BKJL 2DQTH 4OLXL 4UDUA 1GOFA 4MS8C 4M7JL 3WLWD 4JB9L 2PYEB 4TUOA 1EHLH 4EBQH 2GUOA 5C86A 1WZMA 4F9LA 4CMMA 3PGDA 4B5EA 4Z7OF 1W72H 1FVEA 5TQ2H 4M4RA 5C92A 4FMKA 4M7ZB 5C7XH 1F4WH 3RKDC 1ZLVH 4Z6AT 5K9JL 5KSAC 1HINH 1I8LC 1XF3B 4XP1H 3OJ2C 2FJHB 3QUYA 2F54E 1NAMH 4JO2H 3MXWL 3MBEB 4I0PB 2GJ6E 2MMXA 4UILL 3U0TB 5TQ0L 2DB8A 3QNZA 4LCWB 1EIBA 1EEZA 1G9MC 3QEUB 3SJVE 3QIWA 1QP1A 3B3IA 1RVFH 1EO8H 3OV6A 4UBDD 3THMH 3HE7B 4RFNC 3WYRA 3N0PB 3DUHA 1GGUA 2GFBA 3AU1B 2OK0L 1KELL 4HD9A 5B22A 3IFLH 3UTOA 1G84A 5I1AB 5GISL 2G75B 2B20A 2IH3A 5DD1H 4IM8A 3QULA 3OQ3B 3TT3H 2M8XA 2YMXL 2HWZH 2A74B 2HFFB 5JMOC 3UYPA 1H0DB 2YC1A 3GHBH 3GMRA 3SDCB 1R3KA 3OKOB 4Z78A 1AKJD 1ZEAL 3DWTA 2WIMA 4MNQB 1BP3B 2OM5A 3QHTC 3IVKB 1MH5A 4G8IB 1D9KA 3RJDA 4UTAH 3RRQA 1QPXA 1VENA 3WFEH 3I9GH 5CJOL 5CEXB 5SV4A 2CKBL 2V5RA 2NY5H 1F3JA 2OI9C 4E5XA 3QDHA 2DQUH 3CZJA 4JY4A 4U0RB 4Y8DC 2P5WB 4P23C 4W68A 2B1AL 3EGSB 4CU6A 3R4DA 3QWQB 4QWWD 1D5MA 5I6XB 1U8OA 1I9IH 3BP5B 4TNVK 1NC2A 4Y19A 2QSCL 3RZCB 4QXGH 3TVMC 3PP3H 3CJJA 3ZHDA 1YPZA 2A6KB 4MSWA 2ZOKB 1QG3A 3FB5A 3GRWL 4EUPG 3TV3H 3GSXA 1UWXK 4LPYA 3UJJL 4YXHL 1AGCB 5CIPA 2DLFH 4Q7DA 3LB6D 4DTGL 4NQCE 1MJJB 4OCSL 1UYWH 4QTHA 1IQWH 1GOHA 3H3PL 4G7YL 3Q6FB 4LEOA 4Y16B 3UXFA 1F4XL 4J23A 1C1EL 1K8DB 1GPOH 4U6YB 3WLWC 2V2XB 1ZHLB 3MRGA 2DQCL 4UQ3A 4LIQE 1CGUA 1VGKB 1J1OH 1S9KC 4QCIB 1HHIB 5MI0B 2IPUK 4N8VB 4YE4H 3IU4L 1WWBX 3IDXH 5F89A 2I9TA 3DO3A 4F7TA 5IHZA 3DV4B 2Z93A 3MUGB 2OTPA 4K71B 3V95A 3UBXA 1QEWA 1UJ3A 1T20B 3MYZA 3WFHB 3UC0L 5IT2L 2HYMA 2OCFD 2FH8A 1YMHA 4PJ9B 5KAQG 1T2QL 5FYKH 2ICWA 4NBYB 1PSKH 4PRBA 1U95A 1OWWA 3LV3B 4LSDA 2ATKB 1MI5A 5L0QB 4K8RH 4OCWH 3BAEL 2X6MA 2D0FA 4OLZL 3JV6A 1RFDL 4ZFOA 1EGJA 1XH3B 3DX9B 2BRQA 3ES6B 3U7WH 3DSNA 3ZTJG 3HPLB 5H94A 2PTTA 4HZAA 5D96B 5HDOA 3O3BB 4IMLB 4WO4D 1KJMB 4M3JA 4FTVE 3BT2L 5DI8B 5CLWA 5IHBA 4ISVA 4XMLH 3G5XB 1PYWA 1WFTA 4WW1B 3HZMA 2XA3A 1YC7A 5ACZA 4XNZC 5A1AA 3VXRA 4NC1E 4WU7A 2V5YA 3C6LA 3C08L 1CDUA 5FUOL 3LKNB 3C60A 5ILTL 1G6RA 1Q94B 3H2WA 4Y4KA 5D1ZB 2H32B 4U6XA 2NX5E 4LSPH 3TCLB 1CFNA 2QQNH 1UG9A 3VRJB 1WCQA 1KIPA 2ZG3A 2CKNA 4M43H 1N7ML 3RZWA 4LLAA 4KGLA 5I75B 4LSRH 2E7CA 5TPWH 2EYSA 2EICA 3IDYC 5HGBB 4YGVA 1NEZG 2NQCA 4MCYB 1TZIB 5DRNB 2DD8H 4JANA 5LG1A 5I1KH 2O5ZH 3S3SA 1XF2A 1RZ8A 3HI6H 5ISZD 1A22B 4I3RH 4NFCA 4Y7MA 4NC2B 4DGYH 5TF1L 5DK0A 5FOBB 4UV7H 1NANI 4YBHA 3H3KA 3VWKD 5E99H 2KL6A 3HMXA 5MEQA 4TUKL 3E1F1 1II4E 3G04A 3A6CL 2AJVL 3FOMA 3L3JB 4D8PB 2Q8BH 3QFDA 1KT2A 2FX8L 2QQLH 4ETYA 3HRPA 3WJJA 1LO4H 1N8ZA