1CFBA

Crystal structure of tandem type iii fibronectin domains from drosophila neuroglian at 2.0 angstroms
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
205
structure length
205
Chain Sequence
b'IVQDVPNAPKLTGITCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGEDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DROSOPHILA NEUROGLIAN
publication title Crystal structure of tandem type III fibronectin domains from Drosophila neuroglian at 2.0 A.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Neural adhesion molecule
total genus 39
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 1994-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfbA01
4AIZB 1KB9J 3EO1B 5DUPH 3NIDF 1QLRA 4YBHA 4BJLA 3S5LG 2BVUA 1S7QA 1HQRA 2HN7B 1FPTL 3KLDA 4ZG1A 3GM8A 4NQVB 4X8JB 3VI3F 5JHDD 1T0PB 1JWSA 2BSSA 3W5NA 4Z7WE 4M61A 4BUGA 1H0DA 4NWTH 4N1EA 4JFEE 3FOLB 4ODVL 1OTTD 4L3EE 2JELL 4EBQH 4LSUL 4H8WL 2H26B 5CIPA 5DJ0A 5H37G 3TA3D 3CUPA 2ATPA 5GSVB 1L7TL 2DM4A 2NZ9C 3ZKMD 2DQCH 5CHNA 1CDHA 1JI1A 4BZ2H 1ZA6A 4GAFB 3VFRB 4OJFH 1MCQA 3SE3A 3MLRH 2KZWA 4V2CB 3L7EB 1CG9B 4HX1B 2I5YL 3JTTB 3QSKB 5FF6A 1TENA 3QNZB 1J8HD 2Y06L 3T4YA 4Q9QL 1F11A 1J1PL 3MNWB 3MV7E 1N8ZB 3HAEA 3OPZH 3FQTA 1Q1JH 2NY3D 3H3KA 4PJAB 3D3VE 3VXQB 12E8H 3DX9B 4HJ0C 1J1XH 2F5BL 4YHKL 3C6LA 5TH2A 2OR9L 2QHRL 2I60H 4OLWL 2P1YA 4G9FD 1R3JA 5GZND 3WNNA 4X99A 4G8IA 1T20A 3OKMB 1CFNB 4E42A 4JCMA 4FQ2H 1MCPL 4MDIB 4MLIA 4LLYA 3ZDXF 1WZ1H 2OP4H 2IPUG 1MFBL 3TBWB 1WBZB 4L5FH 3QUKA 4OFDA 4Z7UF 2VLRD 4EDWH 4KGJA 1MWAA 1F02I 4WJ5A 2IWGA 4GW5B 2CKNA 3MRJB 1DBJH 1U58B 2ID5A 4JFDB 4DOHB 2BY0A 3TN0B 5IG7A 1A4KB 3W9DB 4LAJH 5CILH 1SJEA 2AERT 2G60H 4M8VA 2VLJA 2C7UB 3NOIA 1EO8H 4ZNEA 5IJVA 3MMEB 4ZTPH 3CXDH 1CLYH 5E8NA 1Q94A 4OZGE 1G9MH 2R0LH 5KZCD 1NBQA 2MPAH 5EC2A 4HS3B 5K9JL 1YNTA 4X6EB 4E0RA 1HOCB 5DFVD 3SE8H 3GI9L 2Z9TA 3VXMB 4IEFB 4RGNC 3PL6D 4OIAA 5FO8B 5IIEA 2X40A 4LVHB 2NX5B 4GRLD 4K8RH 4NQXB 4B7LA 5A2KH 3TPUA 3MCG1 4WEUD 4QRTB 5EUOE 1T1ZA 2Z31A 1I8KA 3IDGB 5E9DA 2B4CH 2A74A 3B83A 3FFDB 1FRGH 1KG0B 1MJ7H 5IMKA 2Y7QB 4QHMA 3K2UH 1J0JA 2FR4B 4PRPB 1P6AB 1YMMD 2ICES 4H88H 5GS2D 3U9UA 3GMLB 2HT4C 4FFVC 1BZ9B 1KGCE 3MRIB 1DE4A 1OM3H 1X7QA 1B0RB 5ACZB 5L7XL 1BLNB 1UFUA 4JZNA 1KTLA 4OF8A 5FYJU 5JW5A 1I8LA 2VXUH 1J5OL 2XTJE 3IRZA 5D2LA 2B5IB 2YD8A 4LSTL 3TJHC 4XPHL 4YIQA 5JORA 1X9QA 4MD0A 4L4VA 4PJFA 4OF3A 1QLRB 3C09B 4NN7B 1S7QB 1G9MC 1HQRB 1P7KA 3EZJB 5D1XA 1A7BA 4HBQA 4UOW1 4NQDA 5CZKA 1RHHA 2Z4QA 4YDJA 2IAND 1YJDL 2D9QB 4O5LH 4FG6D 1JWSB 2BSSB 1TQBC 1I3GH 4M61B 4YDKL 1H0DB 4XPGH 4JLRA 3O8XA 3DRTA 3U4AA 1DBAH 4NSKA 5CIPB 5DJ0B 4F7PA 2F54A 2D03L 2QSQA 3CUPB 2VZTA 2CPCA 2ATPB 2FECI 1SM3L 4KDWA 5I66A 1TVHA 2J7LA 5CHNB 2PTTA 1X5LA 2APBA 1ZA6B 4X6CA 4AK1A 1R3KA 4JO2L 2VC2H 4QRQA 5I8KH 3RGVC 3NPSB 2A0LD 5F9OH 3ZKXB 5JW4R 4Y5XC 4ELKA 5FF6B 3UJJH 2HWZL 3IDXH 3RDTA 3T4YB 1F11B 3EDFA 1XF4A 4R90L 4RISH 3HI1A 3HAEB 3FQTB 1OSZA 1IMHC 4HF5H 1T7VA 5L2KA 5D96B 2IGFL 3C6LB 5TH2B 4JO3L 1C5CH 5HI5C 4G6KH 5L88L 1HXYA 4R0LA 3V8OA 1NL0L 1R3JB 4X99B 4P2RD 4AL8L 4G8IB 1T20B 4OFVA 4E42B 3JWDL 3MRDA 3BP4A 4FQXC 4MXVE 2NPLX 1ODAA 3S97C 4LLYB 2WBJD 3VGAC 2P8MA 2D4FA 3PWJA 2ADGA 1YYMH 1NAMH 3BP7A 3QUKB 5J9PA 1MWAB 1QNZH 1JP5A 4WJ5B 1XF2A 3MRLA 5FOBA 5IUSA 4W68A 3V0WL 2MCPL 3VI4E 2G2RA 2PR4H 3MPCA 2OL3L 5F97E 3TC9A 2E27L 5IG7B 1RZGA 1T6WA 3MFFA 3BOVA 1SJEB 3DX6A 3EW3B 4NBYB 2VLJB 5T1LD 2EXWD 1MFDL 4YDLC 3CSBA 5HPMA 4AYFA 4XH2A 5IJVB 2EICA 2D7OA 5KS9F 4JKPH 4PTTA 2F53A 2XXCB 5E8NB 1Q94B 5D4QA 5DQDH 5CGTA 1LK3H 5INDA 1TITA 5EIQA 2AJYH 5BS0A 5EC2B 4DUVA 1HK6A 1YNTB 4E0RB 1FIGL 3RKPA 1UWGH 3SDYH 1TJGH 2WIMA 1J12A 3K1DA 5C08D 4MJ4A 4LGPB 2ZZUT 3IJYA 4TULH 5IIEB 1C7SA 4G6ML 3SBWA 4AQOA 2OI9B 3TPUB 2FDBP 4JAMA 3BGMA 2MWCA 1RURL 1T1ZB 2Z31B 1I8KB 4D3CL 4LGRB 4POZC 5E9DB 2A74B 2NY0B 3ULVD 1CK0H 1PW3A 4HC1H 5IMKB 1IL1A 4QHMB 3ULUF 3W5MA 3SHSA 4J4PD 4PJAE 4J3WA 5KANI 3U9UB 5EO9A 5GJSH 2JJUA 4UT7L 3ROLA 1DL7H 1DE4B 3KPRD 2PF6A 4DVRL 3HI5H 3BHBA 1X7QB 5F1OB 4LDEB 1AO7A 4JZNB 1QSED 1KTLB 1U3ZA 3P2TA 3EOAA 4AEEA 4B5EA 5JW5B 1FNFA 1EGJL 5D2LB 5DMKA 3FCTA 5MP6L 3GJFK 1JPST 1I1AA 3GBMH 2V6HA 4TUOA 4YIQB 5JORB 1FIEA 4MD0B 4JFDE 4L4VB 3U1SH 4PJFB 4DOHE 4DK6A 4WRLA 4UDTA 2EZ0D 5HHOA 5T3ZH 1LNUA 4TPRL 3BFOA 2VWEE 3B43A 3KLAA 1P7KB 5D1XB 5CZVH 3O6FD 1QLFA 5F8QC 5FEBA 5D7KD 4OF7A 4NQDB 5T3XE 1OB1A 1RHHB 2Z4QB 4YDJB 1DBMH 2P42B 2Y5TA 4APQC 5TF0A 1NBZA 1F13A 5HYIA 1IGIH 5JMOC 1A64A 4JLRB 1F5WA 3BN3B 2OJZL 3O8XB 3DRTB 5DXWA 5GHWH 3VXME 4LPTA 2F8XC 3LKNA 4KXZH 4NSKB 2NX5E 4F7PB 2F54B 4NO0A 1AGFA 4ZFFA 5SX4I 4YK4C 4ISVA 4Z8FL 1KTDA 3ARGD 4DZBA 5I66B 4U7KA 1TVHB 1XF1A 4XPAH 2PTTB 3RZCA 1YECL 3QWRA 4YO0A 2ZUYA 5FOJA 1F4YH 2FH6A 4GAYA 3RIFF 4X6CB 3K80A 4M1GH 4PY8J 1R3KB 1Z3GH 3SDDA 4XB8A 4QRQB 2A9NL 2EDXA 4PRPE 4ELKB 3O4LD 1OAZH 4GXUN 4M7ZB 1E6JL 1PKQA 1JTPA 3CFCL 3RDTB 4PRHA 4I4WA 5HHQA 4Z7UA 5F7UA 3WJJA 1XF4B 3HI1B 4PUBL 5C6TL 1OSZB 4U1GB 4Z76A 2A6DA 5L2KB 4XPTH 1W0YT 4O2FA 4WI2A 2JJWA 4WO4D 2DJSA 1HXYB 4R0LB 3DURA 1FH5H 1A3RH 3MRDB 3BP4B 4JVWA 2AEPL 2DD8H 4K94C 1JWUA 3GGWA 4CVUA 4Y4HC 3PWJB 2ADGB 3BP7B 2J6EH 5J9PB 4PGEA 1P4LA 1XF2B 5CZXD 3BKMH 3MRLB 5TFSL 5FOBB 1IAMA 5CWSA 2NXZB 2DQGL 2HT3C 5EOCL 1NCCL 3RVVD 2G2RB 4TNWK 5E5MA 2I27N 3F58H 3WSQH 1X5HA 3O2VH 5D7JA 1NKRA 1E4WH 1RZGB 4Z0XA 3G5ZA 3MFFB 1G9NH 3DX6B 4HWZA 5DC0A 1BIIA 3I9GL 43CAA 1KELH 1UM4H 3TT1H 4KUCD 5HPMB 4XH2B 1MQ8A 2FYYA 5CD5D 1EBAA 4JB9H 4PTTB 2F53B 3TBTA 1KYOJ 4X4XA 1W72A 5INDB 1F58L 5BS0B 3NCJL 4PS4H 3ISWA 2GTWA 4U6TA 4WI7A 2IAMD 5HSFA 3KGRA 4UQ2A 5EBWA 1WBYA 4K3HA 1MHCA 1CDYA 3IJYB 1FGNL 1CL7L 3GJFH 4Y5YC 1P4IH 2KQMA 2ADIA 4N90D 3GBNH 2X1PA 1PSKL 3FAXA 5KVEL 1A6TA 1KC5L 4JAMB 4TN9A 4XVUD 1HCVA 3BGMB 5C0CA 3HFMH 5IB2A 4V1DD 2XWJA 3U7WH 5DRNA 1UQSA 4L8SA 1D6EA 4KZEL 3BI9X 1I3RA 2DBLH 5I19L 3MA9L 4LFHD 2K7QA 5I1LA 1IL1B 1AP2A 1OAYH 4MDJA 3OMZA 3EDDA 5CEZD 3TESA 3S3JA 5EO9B 3HMXA 3ROLB 3PE9A 3RBSA 3BHBB 3DX7A 4NZUL 3UO1H 1AO7B 4ZUVA 4NN6C 3EOAB 3VD9A 2C26A 1NC2A 1RVFL 2YD6A 3UBXA 4OIIH 5DMKB 1NCDL 3FCTB 4ZOEA 2V2WA 5TE4H 1UACL 1WZLA 1RU9L 4UT6H 1I1AB 1NGPH 1ZE3C 4KVNL 4TUOB 3QI9C 4GW1A 2NW3A 4UDTB 5HHOB 1LNUB 1TJHH 5I9QC 4JCLA 1J87A 3KLAB 3GHEL 2DLIA 1QLFB 1FVCA 2DQEH 2VLJE 2ZUSA 3QR2A 4YHIA 2BOBA 2APFA 4FXKA 4ZNEE 1OB1B 4DGVH 1TXKA 3MV8D 4YR6A 1TCRA 2Y5TB 1C12A 1F8TH 5HVFB 2CKBH 1NBZB 3WO4C 5E95B 2ZUWA 2FCBA 3ETBF 4IRZL 5DEFA 3QXWA 2XOTA 2YSSA 3F6LA 1D5MA 5F7HA 1H3XA 3KPTA 1A6UL 1PVHA 3LKNB 3VFSA 5HHVH 3ULUC 3RRQA 1G6RA 2LVEA 4UNVA 4NO0B 4M3JA 1AGFB 5HYFA 1JFQH 4ZFFB 4ISVB 1F4WH 1RIVH 25C8H 1KTDB 4DTGH 4DZBB 2AGJH 5E9DE 4YDIL 2IPKA 4KU1A 3RZCB 1CZ8L 4YO0B 4PGZA 4RWYH 4GAYB 3RI5F 3SDDB 2UUDH 1EEYA 3VFMA 5K9QG 1CTOA 2EE3A 5CJ8A 4XWOD 1D9KD 2HJLA 2DWEA 5E6IA 3A6OA 1PKQB 2WUCH 4U1NA 2NXYB 1FFOA 4PRHB 3WBDA 1A6VH 4I4WB 4O4YH 5LQBL 2COQA 5HHQB 4OLUH 4Z7UB 4ONGL 4HUKB 3DYMA 1J1OH 1QYGL 4MD5A 4Z76B 2A6DB 4O2FB 3UTOA 5BRZD 3RY5A 1E4XH 3DURB 4OGXL 1VPOH 5D2LE 2HLFC 4OIBA 2EDYA 4LARH 1JWUB 3GGWB 4KAQL 1CICC 2CQVA 2PETA 4L4VE 5KS9A 4PJFE 3ET9F 4PGEB 1P4LB 2NR6D 5CWSB 1I9RH 4FZ8H 1GJIA 3B9KC 5E5MB 3O2DH 4NQDE 3QUXA 5D7JB 1SJHA 4Z0XB 3G5ZB 3NFNA 4FQLH 1KIRA 1JPTH 3IFNH 4HWZB 1BIIB 5D7IF 4OQTH 3ARDA 1AQKL 4JQVA 43CAB 1UCTA 1OD7A 3VJ6A 2FYYB 5T3XL 3TBTB 4X4XB 5TPWH 1C1EH 1W72B 2H1PH 5D1ZA 2FBJL 4LEOA 2O5ZH 5GGRY 5CINH 3W0WD 4X5XA 1C08A 3X11A 3T3PF 2BHUA 4W4OC 2V5TA 2F54E 2GTWB 4DKAA 5CJOL 1QTYT 4UQ2B 2G75A 1ZHBA 4M93B 1BJ8A 4K23H 1WBYB 1MHCB 2Z0BA 1FE8L 2BNQD 3L3KA 3NGBB 3DVFA 2ADIB 1KN2L 2DN7A 5EWIL 2DTML 1A6TB 3F8UB 4X6CE 1JYNA 1NLDL 5C0CB 1CU4H 5AYUH 5IB2B 1NDGA 3E8UL 2XWJB 5DRNB 1UQSB 2NY5L 1KBGL 4L8SB 1D6EB 5IJKC 3FN3A 1I3RB 1YN6A 3MCLL 5I1LB 1AP2B 4MDJB 2IQAA 4BK4A 1OAQL 2YZ1A 3QIUD 1ADQA 2OXGA 3QEGL 3IVKA 4JPWL 3CIQA 5E2TL 1DEEA 1WQVT 5L2KE 1GGCL 2D0GA 2B1HH 1BBJA 3DX7B 3KPQA 4HUXA 2F9BT 5DQJA 2ARWA 2JJTA 3MLZL 3MRRA 5CFHA 4P59H 3ARSA 4ZUVB 4P5TA 4XP1L 3MNZA 1NC2B 1N0XL 3UBXB 3P4MA 2XRAH 2V2WB 4F58L 4QTHA 1MQKL 2WQ8A 2IJ0C 3R0NA 3RTQA 1A02N 4GW1B 1MAMH 1DQLL 2NW3B 4KK6D 3MLUL 4OTXH 2GJ6A 1P53A 3LHPL 4S1SL 4TTDD 2XZQL 5TGBA 3GRWH 1FVCB 2O5XH 3LZFL 4YHIB 2BOBB 1KT2A 4FXKB 3OJMB 5HHXH 1WIPA 2F53E 4YR6B 1TCRB 1C12B 1KIPA 1R5WA 1RZJC 4HG4J 1FYTD 1T66C 3U0TA 5BS0E 3BQUC 1G1YA 4WTXA 3BSZL 5DEFB 2Z8VC 5TQ2L 1F4AA 1SEBA 4KKLD 2YSSB 4U1KA 1D5MB 1X5XA 1SJVA 5HD8D 4WFHD 3C5ZC 3VFSB 2JKXA 1A47A 2NZIA 1G6RB 4Z18A 3RU8H 3MV9A 5FUZH 1VERA 3MXWH 1B3JA 1K3IA 5DJZA 2HA1A 4JY4A 4J6RL 3P0VH 2IPKB 1U8MA 1BFOA 4HPOL 4LCIL 1P2CA 5EZJA 4U7MA 1F3DH 4XNUL 4Y4FC 1EEYB 3VFMB 3HE7D 1TETL 2F58L 1J7VR 1F97A 1V8HA 2KH2B 1R5IA 2HJLB 3GKWL 2DWEB 5E6IB 2R0ZL 4U1NB 3BX7C 35C8H 1FFOB 1KCRH 1IQWH 4E9LA 3AROA 2CMRL 4GG6F 1FLRH 3EFDH 3ARBA 4MD5B 1AO7E 3A6BH 4MAYD 1Q9LA 1YY9D 3JVGA 2YZ8A 5JR1H 2HVKA 4JFED 4HEME 3VA2C 1TZHA 4QY8A 4K07A 1VADA 4R7NA 3VI3E 5I8OH 2FJGA 4L3ED 1S9WA 3C2AH 2FX7L 1S3KH 3S36L 5MENA 3SQOL 1D6VH 5I1HL 1UJTA 4TRPL 4K7PH 4LMQI 4IMKC 2Y72A 1U2HA 1U41A 3D87B 1UM5L 3QNYA 4OFYD 1U91A 5KS9B 1JK8A 5HHOE 3TV3H 5GGRA 4X0KA 5KJRH 1EPFA 3C08L 4AMKL 2HLAA 4X80H 1LO2L 5ITFA 3QUXB 1SJHB 4DVBA 5C0RH 3CVIL 3NFNB 5IMOA 1KIRB 1KSRA 2BDNH 3ARDB 4I13B 3V52H 3VJ6B 4F9PA 3MV7D 3B4NA 3Q1SH 4HGWA 3CLFH 5D1ZB 1IGYA 3VD5A 1VA9A 3D3VD 4LEOB 1QQDA 3X11B 4X5XB 1C08B 3CFDA 5CGYD 2PW2A 4U1SA 5I1JL 1MRDL 4MS8C 1QBLL 1JNLL 1ZHBB 2G75B 4C56A 1UKTA 2CIIA 4I77L 4FFZH 3L3KB 1T7WA 4LHUG 4P46A 1LEKA 3TIDA 5DJAA 4JFFA 4MQXC 5BMFL 1T1XA 1R6VA 1B6UA 1NDGB 1TJIH 3PDDA 1PLGL 3AS3A 2FX8H 3QCUL 3ARFA 2PN5A 3MACH 1PKQE 1U3HC 1YN6B 3ZDXE 1OSPL 4PRHE 2J88L 2VH5L 3S34L 3U48A 2IQAB 4ZXBA 4G5ZH 3WNLA 3W11C 1HZHL 4Z7UE 3QPQD 1U3JA 4YXLH 4LLVA 5ID1A 3IVKB 1GOHA 1N64L 2R0WH 1QBML 1DEEB 5FYJD 5D2NA 1B88A 1IC5H 3MUZ1 1BBJB 4P23D 4PREA 1W8OA 4HUXB 3KPQB 1BBDL 5DQJB 3MRRB 2VMFA 3V4VH 1XH3A 2CRYA 4P5TB 2QADD 4OF0A 1JGUL 5C0FA 3MNZB 3T0XA 3P4MB 5EZOH 1AXIB 2BSTA 3VDBA 3Q0HA 1EO7A 5T33H 4QTHB 3RTQB 5D70L 3VGHA 4YHLL 3K8LA 2AV7A 2GJ6B 1T0NA 3LS4L 2FLBT 3AB0C 3FL7A 3MUGA 4M8QA 2YWZA 4WI4A 5TGBB 1F4XH 5TDPA 3G6AA 4NM8H 5KSUA 4XCNA 1KT2B 1I3UA 1UWXK 3VMPA 5ICZA 1BD2A 1OF2A 1J0IA 1R3HA 3GI8H 1KIPB 4RIRA 1R5WB 4GXUM 1L0QA 5IW3A 2Z8WC 3U0TB 4JY5L 3EKCA 4F57H 4WENB 4H20L 1SEBB 5CJQH 3D85A 4U1KB 3TPKA 4ODTH 3JV6A 2OJEA 1TQCC 4DN4H 4R97B 3UAJD 4LOUC 1MVFA 3MV9B 3EAKA 2XTJD 5DJZB 5C0CE 4F7CA 4JY4B 4N5EC 1G7JB 5KVFH 1U8MB 1BFOB 3BGFC 1P2CB 4MNHA 4ORZC 5EZJB 2ZNXA 4LDLB 2VLKA 1R5IB 4M7LT 3ZO0A 2PXYA 2FEDC 4JGJA 2R4SL 4IJ3B 2KUTA 1JGDA 1MY7A 1IGTA 4OBSA 3V6OA 2DMCA 4AM0A 4CJ1A 2DKUA 2Z92A 1U6AH 3GM0A 3ARBB 3CMOL 2UWEF 3UTTD 2Q8AL 4YXKL 1Q9LB 4RA0C 4CADA 3EIFA 3TF7C 1BPVA 4RFOH 2IBBA 2HVKB 2DAVA 1TZHB 3H9SA 4R8WL 4QY8B 1VADB 4R7NB 3FQWA 2FJGB 1S9WB 5J1SC 3KPLA 3LVEA 5BOZG 5MENB 4OCXH 4NKMA 4HDIA 3U9PL 2OZ4A 1KENH 5LCVL 3HC4L 3QNYB 4KHXL 1U91B 1JK8B 3GMOA 5FYJH 5GGRB 4RGMC 3ZZ1A 3T2OA 4X0KB 4U6XA 1QA9A 2GEEA 1AD9A 4M1DL 4XNXL 5LWYH 4GQ9L 2AKRA 2JK5A 3RVXC 1KCVL 1LO3H 3SGEH 4P9HC 1V3KA 2HLAB 5ITFB 4MNGA 4H0IA 1IE5A 3BPLB 4JDTH 4DVBB 3H6JA 5IMOB 3BAEH 1RUQH 2WZPD 4QXGH 2UZIH 3RIAK 5C07A 4OI9A 2FD6H 4QNPE 2DQTL 1PG7W 4HGWB 3U83A 4KQ3H 5DUML 1IGYB 5DD5L 5F9WB 1MIEH 1A6ZA 1QQDB 3VFOA 1CWVA 3CFDB 2PW2B 2EDOA 4U1SB 2ARJQ 4JG1L 5GGVL 4TOYL 2IG2L 3GSNA 5ALBH 3RPKA 4C56B 1DVFD 5CUSL 3KAAA 1OWWA 2CIIB 3WD5L 1UWEH 3UP1A 1YUHA 4P46B 5E8DL 1LEKB 1Z9MA 4KMLB 3TIDB 5DJAB 4JFFB 3MO1A 1T1XB 3LRGA 4UIKL 1BP3B 3QYCA 3UZQA 3T0EC 2FSEA 1DLHA 1PQZA 3ARFB 5F1KC 3QIWA 4ZXBB 5C71A 1YQVH 1JHKH 3TO4C 4LLVB 4GXVH 1WIOA 5IK3A 3F62A 5ID1B 1MNUH 5D2NB 1IAIM 5SX5H 3ESVF 1ZTXH 4HWBA 4PREB 3BE1L 7FABH 4G43A 3HMWL 2GJJA 3KG5A 1A7NL 1XH3B 2W0FA 2VDKH 5C0FB 1OW0C 3DUHA 5D93C 3QDGA 1A1OA 5KS9E 3D48R 2BSTB 2NY2B 2YMXL 4ODHH 3EZ8A 3O6LH 2AV7B 5F7YC 5T1DH 5MHSE 1RZ8A 1T0NB 4O2EA 3MUGB 2A6IA 4X5WA 1RMFH 2CDGA 4M8QB 5CP3A 5TDPB 3G6AB 1FNHA 1EH9A 1FO0A 5KSUB 3FRUB 4M6NL 2R29L 4XCNB 1PX4A 1MCOH 3GEWB 3U4EA 5ICZB 1BD2B 1OF2B 5EOQH 1R3HB 5JIHA 2VUYA 3U30C 1FNSH 5GS0H 2XZCL 3IDYB 4RIRB 1IAIH 4ETQA 3V4PH 4ZS7L 1TZGL 2MCG1 2VXTH 4YWGL 1E0OB 3D85B 1H3WM 3JV6B 4QTIH 3Q6GL 3S35L 2OJEB 2MSPA 4XGZA 5F3HA 4JE4B 5ANMA 2ZG1A 4GG6A 2WBWB 4X9GA 3LDBB 4NZRH 5DD3L 4F7CB 4EI5C 1DLFL 5KOMC 1NEZG 4MGXA 3S36X 4N0YH 4KTDL 1YC8A 4MNHB 1OQXA 4JFDD 2X4SA 4J3SA 2XNAA 5IHBA 2A6KA 1JE6A 4BQ9A 4YUEH 3TN0D 4HWEL 5FHAL 1TNMA 4YGAB 2VLKB 1B9ZA 2PXYB 4KH2A 1K5NA 3KPMA 4XPFL 1B2WL 2FNBA 1CE1H 1JGDB 1IGTB 2QHLA 4AM0B 3LQAH 4GG8A 3B3IA 2JJSA 4QWWD 2Z92B 4F7TA 4XBEH 3VFWA 3AS2A 3UPAA 1HQ4A 4ZTOL 3HN3A 4CADB 4G6AD 1OD9A 3H9SB 1GAFH 4XP5L 3FQWB 5FDYA 3VXMD 1U8KA 4XMPH 3KPLB 1J0ZA 1EEQA 4NKMB 4HDIB 2NX5D 3MLSH 4XCYA 4RMUA 2GKIA 4X8XA 4JO4H 3GMOB 2GJ6E 2C3HA 5JIPA 2W0PA 4U6XB 1QA9B 1AD9B 4AIOA 6CGTA 4OD3H 1AC6A 3TT3L 5T5FH 2AKRB 2JK5B 1BF8A 2VZOA 5JO5A 4MNGB 1Y0LA 4NWUH 1J05A 4PRPD 5JW4N 5D5MF 3SKUD 2E6JA 4G7VH 5L8KB 1OTTC 4NNPL 4UILH 5DLMH 1WWWX 4HKJA 3K46A 5C07B 4WHCA 5C86A 5JTWA 2ZCLL 1UT9A 3TA3C 1IZJA 1A6ZB 1YNLH 4FTVA 3VFOB 4RNRA 1HN1A 1XF3A 4JJHA 3ZKMC 4Y4KA 1ZLWH 2H2SD 4KJPD 1GGYA 4WDIA 3H42L 4LKXA 3GSNB 2FB4L 2V17L 3MV9E 1UZ6E 4JFZL 1IM3A 3QRFM 5IHLB 3QEUA 4X4ZA 1VGEL 4M6OL 1N2RA 4Q0XH 3PNWA 3NA9L 1YUHB 4UAOC 1C16A 1MF2H 5E1HB 1PGRB 1SBBA 1TCMA 3MRQA 1H3PH 5IWLC 2QQKH 3MO1B 1FZMA 3ZE1F 4MLSA 3H3BC 2FSEB 4YE4H 2EDWA 1DLHB 2Z8SA 4X4MA 2OYPA 1PQZB 5ESVA 4P2CG 4XCCL 2NY3C 5J12B 2LV4A 3QIWB 4ZO6A 4PLOB 2VXSH 2KZ1B 5IK3B 4XCFL 4RX4A 1HH9A 5IVZA 5KW9L 4CU6A 4P4KA 1RUML 4G43B 1NCBH 3DVIA 3IDNA 5EBGA 5DVOA 5MENE 5F9AC 5D1QD 1Y18A 2W0FB 1GC1L 1NCAL 4K94L 3QDGB 1A1OB 2EH8H 4URTB 3DNKA 2CRIA 4XNMA 2I9TA 2BY3A 3L5HA 4Q9RL 1K6QH 2UZXB 4LPXA 4EZMA 1W0WA 3R0MA 1RZ8B 4O2EB 4AEHL 2A6IB 4X5WB 1IBGL 2CDGB 1KULA 4FQCL 1A14H 2EECA 3DX8A 1FO0B 3PP4H 3CLEH 3NZHH 4L3CA 2R69H 5J06A 5FGBA 3U4EB 4O9HH 1FQ9C 1P1ZA 1DEDA 4GKZA 3BRDA 1MY5A 4QT5A 4ETQB 3IAPA 1EHNA 4FQ1H 3PL6C 4BQBA 1D3CA 3C6LD 4HCRH 2R0KH 1A5FH 4GRLC 2IH1A 1WGOA 4C56E 4HIJA 3L9RA 4XGZB 5F3HB 4OSUH 5ANMB 1CLCA 3ARRA 5GGSY 1G6RL 2BP3A 3QAZC 2DLFH 1REIA 5GRJL 4GG6B 4JFFE 5KSAA 3PDOA 1WCBA 3RGHA 3MRCA 2UWEA 1DANU 1J8HA 4I0PA 3T2PA 5EIIA 3WXWH 2X4SB 5DO2D 2XNAB 3DVNA 2A6KB 4EJ1C 5IBTL 5KG9A 5IHUH 2VSCA 1IGML 2B7DT 3I3BA 4PFEA 3FB8A 1DSFL 1K5NB 3KPMB 2VLJD 5D2NE 5HYJA 3U0WL 2CH8A 3H7LA 1B4JH 2W92A 5C3LD 1X3DA 4GG8B 1O7SA 4PLKD 3B3IB 3M07A 3M45A 4KVCH 3NFSH 4PG2A 4F7TB 5ADPH 2DICA 2NW2A 3VFWB 1HQ4B 2Y4SA 3BISA 2J5LB 4L1DA 5FXCH 5TE6L 5EG6C 4ALAH 2VLRA 3U6RA 4BH8A 4TUKH 4X9BA 1U8KB 3EBAA 2IALA 3QUML 5F7EL 3DUUA 4XCYB 3MX0A 2ZPKH 3NTCL 1CXKA 2Z31D 1GYAA 1ETZA 5DMGD 1RULH 1MOEA 5E9DD 2NY6B 4L9LA 4E5XA 4CRPA 2EEAA 2X41A 2XZAH 2AQ1A 1JYXA 2Q20A 3H9YA 1AR1D 4FG6C 3VXNA 5JO5B 1GGIH 1MJUL 1Y0LB 3OV6A 1BD2E 1J05B 2Y36H 5E4IA 4DFHA 1BAFH 2AJZA 4HKJB 3BUTA 3P4NA 1WLHA 3VD3A 2VXVL 4FTVB 4RNRB 1XF3B 4DEPB 4GRWH 4Y4KB 1F6AA 4KUCF 3ULUL 1Z6JT 4WDIB 2R15A 5FKAA 4LKXB 1KLFA 5LKNA 1Z9OA 1NSNL 5AZ2H 1IM3B 4GS7B 4Z7OE 3QEUB 4MQSB 4JM4L 3GUTA 1N2RB 3PNWB 3VU2A 2QQNH 2BVPA 3DI3B 4LVOB 3S88L 1C16B 2PYEA 3KLHD 1A7OL 3MRQB 1YMMA 3MRPA 1FZMB 3KWWA 1E6OL 1NAMA 1HINH 1MPAH 2VLKE 5ESVB 5D1XD 2RJMA 5I75C 3KPSD 5J57B 4S1RH 4NQDD 3QULA 5F8RC 3V6OE 4JHZA 4NDMA 3BT2H 3FMGL 3X3GH 4R4BA 3U7AA 1HH9B 4TVPH 5IVZB 4OLXL 4QRRA 4P4KB 3H9SE 1FFRA 3O8XD 4F33A 1JF5A 3IDNB 4PTUA 5ADOL 4Y2OA 1Y18B 3VW3L 4PJIA 5I1EH 4JM2A 3VFVA 1YEJL 3S35X 4XNMB 5ENWA 3SGDH 3S8WA 2I9TB 1JNJA 4LHUA 1CXEA 2VL4A 1QRNA 2X89A 3P9WB 1KJ3L 3W2DH 4RFEA 1WFUA 2HJFA 3TYGH 4OD2A 5F3BA 3O41A 1W0WB 4F9LA 2Q8BH 4UB0H 4MNGE 2EXWC 4ZFOA 3BKJH 3ZT7A 1UH4A 3DX8B 4NKIL 4OF6A 3EDKA 5FUCC 5HVGB 4L3CB 5FYKH 4HC1A 3KS0H 5C07E 4JG0H 5BV7H 3K7UA 1P1ZB 1SY6H 1YPZF 4GKZB 4QT5B 2RR3A 5L2KD 1MRCL 5FGCB 4WW2F 4MAUH 1UKSA 5CJXA 2IH1B 1NGQH 2BX5A 3T0BA 4PJEF 1IT9L 4HIJB 2F8VA 3L9RB 1ZHKA 1CCZA 5CKGA 1XF5A 3WLWD 1PZUB 2VDLL 2VXQH 3SOBH 5KSAB 3PDOB 1WCBB 3ULVC 4R6UA 1S7RA 4HS6A 3MRCB 2UWEB 1J8HB 4HIEA 1U93A 4I0PB 1MFAH 4NCC2 2NYYD 2NXZD 4JFQA 5EIIB 2APXA 4J4PC 1V05A 4OD1H 3DVNB 1SVCP 5FYLE 1GGBL 5DRZA 4KROD 3NABH 5KG9B 2HRPL 4YAQA 4MJ6A 3FB8B 4RMQA 4IIQC 4JPKL 4FZEH 3V5KA 5HYJB 1TNNA 3IAGC 2K1MA 4P2RA 3W82A 3RL2A 1QSZA 2APTA 2B39A 2B8OT 4HIXL 3QUYA 1J10A 2NW2B 2WBJA 4O02L 3SO5A 4KTEL 1BX2A 1G0YR 5AG9A 4M5ZH 4R7DA 2VLRB 3E2HC 3U6RB 4BH8B 2IMMA 3QDGE 5C7XH 5D5MA 3VRLF 1EVUA 3DWTA 4JEGB 5CD3A 1KCSH 2JIXA 2IALB 4WI8A 3MUY1 2EZ0C 1X5ZA 4G8EA 3DUUB 1MEXL 4X9IA 3O6FC 2V5MA 2Z35A 1ETZB 3WS6C 1FVEA 3RAJL 2AK1H 1Z5LA 4LCCA 4L9LB 4NM4L 4PV8A 4JFOA 4E5XB 3VXNB 1ZXQA 3WL9A 4M62L 2V5YA 4LSRH 4OZIF 3T2NH 4MA3A 2AABL 5FCUH 3GSQA 2AJZB 5C08A 1RZJL 1B0GA 2L7UA 3P4NB 3L5IA 2EO9A 2VDPL 4NUGL 2XZZA 4CVXA 5ANME 2VZSA 3ARGC 3D1MC 1F6AB 4Y8AA 2VN4A 4M03A 1G7QA 5GIRA 4GAJH 3O2WL 1JPSL 5FKAB 2WNGA 1RZKC 4LSPL 3UTQA 5L6YH 3AM8A 3EYSH 4GG6E 4NOFA 1U8IA 1FG9C 3BWUC 3UC0H 5IESL 1I75A 4DQOH 3GUTB 1HSBA 4ZSOA 3DOSA 5DA0B 1I1AD 2BVPB 4HZLA 2PYEB 2VDQL 1WEJH 3EDJA 2BMKA 3P4LA 5ETUA 3RWFA 1X6LA 1YMMB 3KWWB 3MRPB 1G7PA 2CLZA 4IRJC 2VRAA 3H3PH 5HHOD 3FONA 1NAMB 2J6EA 2ZWLT 3KPRA 4CMHC 5KOVC 4OT1H 1A3LL 1MIML 1NFDF 1QPPA 1FPTH 3QULB 4NDMB 3ARQA 2YXMA 2X1XR 4KUZL 5KBNC 2AI0H 4R4BB 4EXPX 4NHCL 4XPBL 3QIBA 4QRRB 3MGTA 1MLCB 4YXHL 1V7ML 3X17A 3FO0L 4ODVH 4F33B 1JWMA 4PTUB 2JELH 2J8OA 4H8WH 4NC1C 4NQTA 1UYWL 1G0DA 5CZXC 1DP0A 4UBDD 4QGTA 4X6FA 3WIFA 4L3AA 4PJIB 1TIUA 1OGAA 2IPTL 4JM2B 1KTKE 3VFVB 1BMGA 5ENWB 1KCUL 1AKJA 1L7TH 4LHUB 4IRSD 1QRNB 3GJFA 4NFBA 3RZCD 5HVHB 2LAAA 3QWRD 4RFEB 1UM6L 4CJ0A 2HJFB 1MRFL 1Q9KA 4OD2B 5F3BB 3O41B 3MRBA 3SDDD 1DQML 4Z7QF 3PXJA 2C5DC 4ZFOB 3UMTA 5CD5C 4P2YA 2WANA 3F7VA 4K2UH 2NXYD 4PRHD 4XBGA 2Y06H 2ZKHL 4Q9QH 3CFJA 1UZ8A 4HMCA 3V6ZA 4K3JL 3X12A 1J1PH 1AY1L 3AXLA 4QXUL 4XWGL 4FTVE 2R56H 5D9SA 2F5BH 2OR9H 2QHRH 3QO0A 1IGFL 3SJVA 1QFWI 4OLWH 4UT9H 3G08A 3FO1A 1H8NA 2HG5A 1ZHKB 4XVUC 1XF5B 4RQQA 4FN0A 3WCYA 4ZS6C 3MV11 1T89C 1MCPH 1H3TA 3GSVA 1MFBH 1A7PL 4LRIA 1S7RB 4HS6B 1LD9A 1BVLA 2EKSA 3D69A 4PJHF 4Z7VA 5IF0A 3LKOA 4YZFF 4HIEB 4LSQL 1U93B 3EDEA 2P46B 1BZQK 4X4ME 4XHQA 2RQ8A 4JFQB 4ONFL 2EH7L 3A6CL 3QHFL 3IRPX 5IROC 4AENA 5DRZB 5D7JD 3IFPA 3SEPA 4Q6YA 4YAQB 4HK3J 4MJ6B 5LJYH 1MUJA 4WO4A 4MYWB 3V5KB 2YD1A 4P2RB 3RL2B 1I9JH 3CVHH 3QUYB 2Q7YA 2O93L 4U7SA 4GLRI 2WBJB 2CKBA 4R4FL 3FN9A 5EBMA 1I3VA 1BX2B 5K9JH 2D31A 4R7DB 4LP5A 5IVXF 1T2XA 4KKBD 3U4BL 1BZ7A 1X5GA 5HHNA 3N0PB 5D5MB 5CD3B 2JIXB 3DLQR 2GUOA 4G8EB 3NACL 4K3DL 4JQXC 4TYUA 5FO7A 4LL9A 2DBJA 5E5UB 1NEZA 5LG1A 5JW4Q 4YHYC 5C0CD 2Z35B 1FORH 1FG2A 1FVEB 1Z5LB 4NQED 4LCCB 4PV8B 4JFOB 5AZEL 2DI8A 3RHWK 4L8BA 4BSWA 3FZUD 1MCNA 4QRPD 2CLVA 4PD4K 5B8CA 3OSKA 3EHBD 3WL9B 4CMMA 4MA3B 2DKSA 2IAMA 2YBRA 2N4IA 3GSQB 5FGCE 5C08B 1B0GB 4KJQC 1Z0MA 3D39A 1E27A 5IJKA 5L7XH 4HMEA 1FAIL 3AAZA 1RI8A 2MQ3A 4CVXB 5MI0C 3O81A 4JN2A 1G7QB 5GIRB 2WAHA 3AS1A 5FK9A 3UTQB 5KAQF 1NC2D 4U4BA 1J5OH 1U8IB 1KEML 3AY4A 4KPHL 2UWEE 3UYPA 1HSBB 1J8HE 4NJAL 4ZSOB 4HZLB 4LSTH 4XPHH 3MTRA 4LRNH 5IOPA 2Z93A 4XWOC 4ACPA 1FYHB 2BMKB 5ETUB 3RWFB 1G7PB 2CLZB 3FONB 3CXHJ 4MJ2A 4WU7A 3KPRB 3RJQB 4P3CL 4DN3L 2ITDA 4Z0BL 5HYJE 4WTZG 5GJTL 5GS1A 1T80A 3O2DA 4B7IA 5FYLL 2DDQL 5HPOA 1YJDH 2A83A 1YYLL 1JZ4A 3QIBB 4OQTA 2GT9A 5HGAA 3ZSSA 4YDKH 2VLRE 3MGTB 2DLEA 2BY1A 1JWMB 1TPXC 2YEZA 1RAMA 3KYOA 2NR6C 4X6FB 3WIFB 5B39G 2D03H 1IKNC 1OGAB 4DGIH 1YPZA 4ZAKA 1AKJB 2DQIL 1SM3H 2AJVL 3OG4B 6FABL 3GJFB 4WW2A 3QO1A 1RJZA 1QFUH 4Y89A 1Q9KB 4JDVA 4LSVL 3MRBB 3WFCL 1I1YA 4JO2H 4P9HL 2X4OA 4X83A 5EZLA 3SE9L 3L5XL 2AJUL 5E6ID 4C58B 3F7VB 2HWZH 1I8MA 5IBUG 4XBGB 4TUJA 1FV1A 3CFJB 1UZ8B 1EJ6A 3PWVA 3V6ZB 3X12B 3JUZA 3HLAA 4R90H 1I85C 3AXLB 4XNZC 4PGCA 3LEVL 5D9SB 4X98A 1K4CA 4PJXF 2IGFH 4NKQB 4LHQB 4JO3H 1UXWA 3QO0B 2VERN 4FQQA 3SJVB 5L88H 3G08B 1NL0H 3FO1B 4KV5F 2HG5B 4FXLA 4RQQB 3JWDH 4FFWC 1EZVX 1ZVYA 1OTUD 3GSVB 2PYEE 2E7LC 5LGHL 3VE0A 3ALXA 5BXFA 1D9KA 5C6WH 5DJ8A 1YMME 1PEWA 1LD9B 1BVLB 2EKSB 3D69B 4Z7VB 5IF0B 2VR9A 3LKOB 3ALPA 4R3SA 4WFEE 2ERJC 2MCPH 3SO3C 2P5WD 2OL3H 4Q6IC 2E27H 4AENB 3QUXD 5MHSD 2XA3A 3IFPB 5GGQL 2IBZY 3VXTA 1NH6A 4I48A 4X7CC 1H9VA 5EORH 1MUJB 4WO4B 1I1CA 3ARDD 3GRWA 1MFDH 4QRRE 1HDMA 3SDCD 2CUIA 3WJLA 5CLWA 2AJXL 7CGTA 2R2HA 4W4NA 5D1ZD 2Q7YB 1U8OA 3OKNA 1AR2A 5FB8A 2CKBB 3ZDYF 5EBMB 3BIBX 4XXCA 2D31B 1FIGH 4JRYA 4PJIE 3WFZA 1BZ7B 5HHNB 3C60A 1L9MA 2HTKC 2V2TA 4KK6C 5J7CC 1QRNE 1YEDA 1LO4L 2GUOB 3WUZA 1T83A 5FO7B 1K8DA 3SGKA 5IT2H 4KKCD 4F37F 1QSVA 3MJ6A 1NEZB 4OZFH 1NANI 1RURH 3IGAA 4KC3B 1FG2B 2GY5A 1F2XK 1JPGA 3VDCA 4HMDA 4D3CH 4OGYL 1ZS8A 4L8BB 5FM5M 4BSWB 4ZD3L 2CLVB 5B8CB 4JVPA 4MVBC 4OJFL 5K59F 2OQJA 4YHOH 3D0LA 1F3RB 4UDUA 4CMMB 4WY7L 2IAMB 2YBRB 2DB8A 5HD8C 4UT7H 4G7YH 5GGTL 1RZIA 3D39B 5LBSL 4D2NA 4CL7A 1E27B 1X5JA 3AAZB 1YEGL 4ODSL 5FGSA 1CD1A 1NFDA 4JN2B 4JFHE 4OV6F 4P5TD 5FK9B 1DQQA 1JJUA 1HNGA 4EN3A 5JPMA 3QH3A 2AJ3A 3U36A 5J13B 1JIBA 5MP6H 3HE7C 4N8VA 5C0EA 3MJ8A 4GQPH 3RTQD 3TZVA 5IOPB 2Z93B 3QIUA 4FQ2L 3EOBA 4PIRF 1WZ1L 2GJ6D 1K3ZA 5CSGA 4TPRH 5E2UH 4Q7DA 4BFIA 4C55A 5T3ZE 3T3MF 4WU7B 1MCIA 2VABA 3HC3L 2ITDB 3FT4A 4RRPG 2FHBA 5GS1B 4P2RE 3SKOA 5AEAA 4I3GA 3GSOA 2HMIC 3DXAA 1S7WA 3VI4F 5IBLD 2A83B 3JV5A 5CILL 3MLXH 2IFGA 4NO2A 2GT9B 5HGAB 1RK0A 4NCC1 1QFHA 1EO8L 3I2CH 1XGTA 4FNLL 5BOPA 2OR8A 3FB5A 1MCBA 2OJZH 4PLJD 5D5ME 2ATKA 2YEZB 5BQ7A 3KYOB 2MPAL 3BPNC 4OLVL 4LSSL 4RDQG 4DKDC 3MV9D 4D0CA 1YPZB 4ZAKB 4Z8FH 1UB6A 3MJ7A 3VWKA 3R4DA 2ZJSH 2Q86A 4WW2B 3QO1B 1RJZB 4LP4A 4JDVB 1I1YB 2ZUQC 2X4OB 2FGZA 2A9NH 5EZLB 3P4OA 3AUVA 4ODWA 3T0AA 1I8MB 3CFCH 3X3FL 2C3WA 4M9PA 4R2GB 5C08E 4TUJB 1FV1B 1W0VA 3PWVB 4NFCA 3ZE1E 4PJHA 3HLAB 1JRHL 4U49A 4XRCA 3OB0K 3LRSA 4PUBH 2V9RA 2XWBA 5C6TH 1H15A 4PGCB 4X98B 1K4CB 3NFPA 2IFFL 5D8JL 5E6ZA 3R1GL 5E2VH 1P6FA 1UXWB 4L4TA 4FQQB 4K7PX 1JVKA 3M1BA 4PJAF 3OKEA 2RFXA 4S10A 4U05A 4ZSOE 3X13A 5MEND 2AEPH 5E8OA 5FHBL 2W0KA 1MHPH 4ZFZA 3BP6A 3VE0B 3HI6L 1D9KB 2O5YL 5DJ8B 5ICXA 5I71C 3P9MA 1N6VA 1KACB 3K74B 4R3SB 5FM4A 3E0GA 3DHMA 3KPRE 2P49B 2DQGH 5EOCH 5IVXA 1FZJA 1NCCH 4M9OA 3NBNA 1F4HA 4MAYA 4I0CC 2V7HA 5DJDA 4P23C 3UZVB 3VXTB 1JTOA 4I48B 4EVNA 4XVSH 32C2A 4IOSD 5GZOD 3I9GH 1FCCA 3WFEL 4OCYH 5CBAA 1HDMB 1BWWA 4DWHA 5IKCA 3WDIA 4P4RA 1S5IH 2QADC 2R2HB 1U8OB 5I73B 3OKNB 5FB8B 5L0QB 1S9YA 1I7RA 2BHYA 3SCMA 5DJ2A 4MJIA 1I3GL 4JRYB 3VMNA 2YA1A 4HXAL 1FGVL 4RGOH 3C60B 1OGAE 2PNDA 3DJ9A 2V2TB 3VFGL 1FGNH 1CL7H 1YEDB 3AC0A 5J3HC 4P46D 1K8DB 1PSKH 3SGJA 5KVEH 4JFFD 1KC5H 4G6FD 4Q58C 2YRLA 4PJGF 3IGAB 2X1WL 1JPGB 4NN5C 1FSKB 1K4DA 1RIUL 4KZEH 1ZS8B 4C83A 3S3PA 3EJYD 2ZUUA 5FKPA 2VDRL 4ZXBD 1FNEA 2OQJB 4CDGC 3D0LB 4UNTA 4UDUB 1KCLA 4JKLA 2X4TA 1FLTX 5I8KL 2BZDA 1IEBA 1OL0A 2JB5L 2FO4A 2W9EL 3UYRL 1RZIB 3SJVE 3UAJC 2WLYA 4NZUH 4Y0GA 3K0WA 1KEGL 2XTJC 3QCTL 1CD1B 1NFDB 3TJEL 3BDYL 5H35A 1DQQB 2OTWA 4EN3B 2YD7A 1RVFH 4BZ1L 4WEBL 5JPMB 1BFSA 3QH3B 3VG0L 3UDWC 2AJ3B 4Z7VE 3U36B 5B22A 4BQCA 1FNAA 3I6GA 4N8VB 1UACH 5A16A 1RU9H 5C0EB 3MJ8B 1A8JH 4KVNH 1PX3A 3TZVB 2D7PA 3QIUB 4RA3A 5F1SA 3BD5A 3EOBB 4HIIA 5DT1L 4OCLC 1D5BA 4BSVA 1TTFA 4BFIB 3B9AA 2VABB 1QNZL 4HH9A 4QXTB 3FT4B 3BPCA 4MNQD 5A3ID 3SKOB 4A6YB 1JZ8A 1BD2D 3GSOB 3DXAB 3OB0H 3P9LA 5F6HI 1S7WB 3KVQA 4YX2L 4NO2B 3EJZC 1RK0B 4IRZH 5IFHL 4OFKA 1XGTB 3FB5B 3QB7C 4KMTL 4NC2B 2ATKB 1A6UH 1L0XA 1RUKL 4XP6H 5T1MA 4IM8A 3LIZH 5BQ7B 2EYSA 3EUUA 3HUJF 4MMXC 4RAHA 1FNLA 5EN2A 3IETA 4D0CB 2UYLA 4UTAL 1UB6B 3U2SA 3MJ7B 4ZPTA 3VWKB 2WUBL 3BZDA 4PJXA 4K71B 2Q86B 4KK8D 1CZ8H 3NPZB 4YHPA 1LHZA 3GFUA 3BRGC 2R4RH 3FRPG 3PF2A 2DQUL 3P4OB 4ZFOL 4ODWB 3TVMA 3LD8B 3DI2B 1ZMYA 1LK2A 2PXYD 3OKOA 1FZKA 3U79A 2N1KA 4I18C 4WTWA 1CXLA 5LQBH 1W0VB 1E28A 2LQRA 4BFBD 4HC1L 1GIGL 4PJHB 4XRCB 2XY1A 3LRSB 4ONGH 3D39E 1F2QA 4MXWH 2XWBB 4N90E 4S1DC 1QYGH 1H15B 2X1QA 3HC0A 4M5YL 5DHVH 4YQXL 3NFPB 2NY4B 2EIEA 1AE6L 3GO1L 4GMTH 4L4TB 4MA1B 5GJSL 4F15C 1DL7L 3H9SD 5I74C 4OGXH 3M1BB 1UH3A 3OKEB 2RFXB 1DBBH 3X13B 2EIDA 2D0HA 3OQ3B 4K9EC 5E8OB 1EXUA 4KAQH 4ZFZB 1BREA 3BP6B 4ELMF 2H2PD 1WFTA 2VISA 5ICXB 2F19L 2CSPA 4LCWA 1OP5K 3VMOA 3FQUA 3P9MB 3STZA 5IVXB 1FZJB 1HWGB 1YDPA 3K4ZA 3F7QA 4XX1G 1LGVA 3UTTA 4MAYB 2V7HB 3CDYA 5DJDB 2OR7A 1G7MA 4EVNB 2Q3AA 32C2B 1CFTA 1AQKH 3TBVA 5C07D 5CBAB 5IKCB 4KHTL 4G6JH 4P4RB 4GKSA 5T3XH 1X5KA 4YPJA 2HFGL 4AZ8A 1S9YB 1I7RB 3SCMB 3BH8A 4OCRL 5DJ2B 4MJIB 3REVA 1EUUA 4DW2L 5CJOH 1XAUA 2J3SA 3LPFA 1YPZE 4RBPK 2A38A 4ETYA 2Z91A 5F89A 1PY9A 1L7IL 2CGRH 5EU6A 5D6DA 2DTMH 3TWCL 4KJYA 1NLDH 4YBLB 4BFEA 3KS0J 1CGUA 1K4DB 2SEBA 5DR5L 8FABA 4C83B 5B38G 3CMGA 3MCLH 1II4E 5FKPB 4GMSH 3N1PC 1FNEB 1OAQH 4OQ1A 3WIHL 3DMMA 3ES6A 1PG7X 2X4TB 3QEGH 4OB5H 2GCYA 4JPWH 2CR6A 1IEBB 5E2TH 2C3VA 2QSCL 1GGCH 3V8CA 1DVFA 1OTSD 2FO4B 2WM0A 3RFZC 5C0JA 5BVPL 3NCBB 1EFQA 2FATL 3MLZH 4J8RA 3P0GB 2BCKA 4XVJL 5H35B 3HTLX 2OTWB 1M71A 2IF7A 3K1KC 3QDGD 4XP9L 1Q0XH 3D2UA 5ISZA 3I6GB 4WVRA 5A16B 3ULVL 4F58H 3TN0C 1A7QL 1A3RL 1MQKH 1MCFA 2VWEC 1DQLH 1MVUA 4HIIB 5DYOA 5D2LF 3VRLE 3MLUH 1NC4D 3UYOD 1D5BB 4BSVB 5F6IB 2J2ZA 2J6EL 4DKFL 2Q3ZA 1HWHB 3ARWA 1D7FA 4QWWC 2XZQH 4HH9B 3ABZA 3BPCB 4JREB 1OHQA 4JZOA 4G6AC 3HA0A 3AGVA 3P9LB 2J8UF 3OKLA 3NH7H 2DWDA 4N0CD 1G9NL 4Q9BA 2LU3A 3BSZH 5TQ2H 3CH1A 3QQ9C 4LVHC 4JRYE 1KELL 1UM4L 3CX2A 3MOAL 3CX5J 3TCLA 1ZSDA 3GNML 4JB9L 4NZTH 3QHTC 5T1MB 1VESA 3FQNA 1P9MA 2NY5C 2R1XA 2EYSB 4LLQA 5EN2B 1GGTA 3IETB 4JQIL 3S3SA 4WUUA 2UYLB 1E4KA 3U2SB 4ZPTB 1OP5H 2P5EA 4J6RH 4PJXB 4PV9A 4U6VL 4HPOH 4LCIH 4N0FA 3MREA 5DD0L 4YHPB 4XNUH 2VZUA 4NO5A 2NY7H 2Q6WA 3C5SA 2F58H 2ILLA 3LMJL 4LU5L 3ROOA 1L6ZA 3HFML 4NBZB 4YC2B 3TVMB 5DWUL 1LK2B 3IXAA 3OKOB 4WTZA 5A1AA 1FZKB 3BIKA 2R0ZH 4X6CF 5C1MB 2DBLL 2W0LA 1E28B 1AXTL 3I75A 3PXHA 2CMRH 2H2SC 1OAYL 4KJPC 4X4YA 1KN4L 3R06A 3SKJL 4U2YA 3C8DA 3HC0B 3OAZH 3WLBA 4JDZA 2B5IC 3MR9A 2AEQH 1NFDE 2XI9A 1YMHA 4OLZL 4KMQA 4ZUWA 1XIWA 4IBLT 3GSRA 3NCYP 4LCUA 1RZKL 4RBPH 5F7KC 2FX7H 5B39A 2Y25A 3HRPA 3S36H 3SQOH 5I1HH 4DGYL 2P43B 4TRPH 3C09C 1EXUB 3WMSA 1ZLUK 5GRZA 3U46A 1YY8A 3NIGE 4NN7C 1UM5H 3QFDA 2VISB 3HG1A 2XTLA 3RZWA 4LCWB 5DVNA 3OZ9H 3FQUB 4OIIL 3UXFA 3STZB 1N6QL 1IRAY 4P9MH 1K2DA 2YK1L 4ZOBA 1YDPB 3VG9B 3UTTB 4PB0H 3U7YL 4X7FC 1G7MB 1ZVHA 3DXAE 3CVIH 3GK8L 5DC9B 4U0RB 5C9KA 1CFTB 3J7HA 4PJGA 4WW1A 2DQEL 3TBVB 3JV0A 4X6BA 4GKSB 4Z7QE 2EEBA 4JPIA 3RNQA 4PLNC 5TDNA 4FTVD 3BH8B 3BPOB 3UJIL 1F3JA 3REVB 1S5HA 2M1KA 5I1JH 1MRDH 1AD0A 1SMOA 4HCRA 1QBLH 1JNLH 2BNUA 1HCFX 4U3CA 5IQ9A 4I77H 3PHQA 2Z91B 2QLVB 3FJTA 5AYQA 3SE3C 5F89B 3NPSC 3ZKXC 5C70A 5GRUL 5EU6B 3FQXA 1GRWA 5FDWA 3PP3K 4ZUSA 4KJYB 5BMFH 4HLZH 4KJWD 3QQ3A 1JGVL 4TNVF 4OZFG 1PLGH 2SEBB 1V3JA 3QCUH 1JHLL 8FABB 5GGUA 2I25N 2J88H 5D96C 3S34H 4WFHE 4RWYL 4PJHE 2KQNA 3DMMB 3ES6B 4Y5VA 3C6LC 4YZFE 2GCYB 4EDXA 4RX4D 1QBMH 4GW4A 2C3VB 1DVFB 2WUCL 4P4KD 5C0JB 4L4TE 4O4YL 4N9OB 2QEJA 4OI8A 4J8RB 1AHWC 5DD6A 1J1OL 2BCKB 3HKFA 3FN0L 3VFUA 4CW1A 3ZKSD 2VQ1A 1M71B 3LQZA 5I1IL 3LSOA 1NGWA 3D2UB 5ISZB 5GSRA 1VPOL 3S96A 4EOWH 4FP8L 4OGZA 4K8RD 5D70H 5IVXE 4MSWA 2V5SA 3I3EA 4YHLH 1MVUB 4LPCA 5CEZL 5DYOB 2C1OA 3O3UN 2FIRT 1JZ6A 4LEXL 1LE9A 4PLKC 1UCBL 1ZLSH 4PJ5D 3HUJA 3SKNA 4FZ8L 3S98A 1J9CT 4JZOB 2DLHA 1QFWL 3OGCA 2FJHA 3MNVA 5D1QA 3OKLB 1ZGLP 2DWDB 5HDLA 2DYPA 1KB9K 1ND0A 1JPTL 4MJIE 4KDTA 1HKLL 3CH1B 4H20H 4XP4H 3RGVD 2OI9C 3TCLB 1ZSDB 4CBPA 1KUMA 2Z31C 3FQNB 5DMGC 2R1XB 5TQ0L 4HKXA 1WC7A 4LLQB 4H1LH 3WFDH 5KSAD 2NY0C 4WUUB 4FMKA 2P5EB 2YUZA 5JOPE 1XZ0A 1BFTA 4I0PD 4PV9B 2P8LA 5ACLA 1JV5A 2GI7A 4N0FB 3MREB 4POYA 1XCTA 2XT1B 2XG5A 4NO5B 2Q6WB 3C5SB 3ROOB 4MZ3A 2XACC 2APVA 3IXAB 5D7SL 2OTPA 3BIKB 4R26H 4LQ1A 4WWKA 5F7WC 3ZYIA 4ELMA 2R4SH 5HYJD 5K9KA 2HYMA 3PHSA 3I75B 5ESAA 4X4YB 5JA9A 5FUOH 1I8LC 3R06B 2Q8AH 4YXKH 3T77A 1FCGA 3V2AR 1A6PA 3WLBB 4JDZB 3MR9B 4LIQH 2FX9L 3MZGB 4LVEA 1HIML 1S78C 4JZJA 1P84J 1YMHB 3P3YA 4HJJH 4ZUWB 4R8WH 1BFVL 1XIWB 2YPKA 3KLHC 3GSRB 1ZOXA 4LCUB 5E7FA 3V4UL 4UV4L 5B39B 4JR9L 1MCHA 3JZ7A 1KLGA 1TVDA 3U9PH 3EGSA 3U46B 1YY8B 5LCVH 3HC4H 3QFDB 4KHXH 5D1XC 4F2MA 4KI1A 3HG1B 1DQDL 3PP3H 2WK2A 4O58L 5FYJE 4YDVA 4XNXH 4M1DH 4GQ9H 4BYHA 1K2DB 1KCVH 4L8CA 1GPOL 1NMAL 1MAML 1CYGA 4IOIA 3AU1A 3B8SA 5IBUB 1UH2A 2RCSH 3O8XC 4BZYA 1N3NA 4PJGB 4WW1B 3DUSA 1BGXH 2FRGP 4X6BB 4M6AA 5HGDA 2DQTH 1FFQA 4JPIB 3RNQB 3PGFL 5DUMH 5DD5H 1H3GA 1SY6A 5TDNB 3VXRA 2HFTA 4YPGA 1F3JB 4MWFA 1S5HB 3IT8D 2VJXA 4JG1H 3HZMA 4OCMC 5GGVH 1AD0B 4TOYH 2IG2H 5CUSH 5LAXA 2BNUB 4OFIA 5IQ9B 3PHQB 3WD5H 3KDMA 2GK0A 2R39A 2VL5A 4PJXE 4W70A 1EHLL 5E8DH 4BQ6A 2PYED 3FQXB 2G5BA 4M7ZC 5FDWB 4ZUSB 3I3DA 1MCSA 4KV5E 3RDTC 5J8OA 3QQ3B 1RY7B 4WFED 3P0VL 4KY1H 4L29A 5GGUB 3KR3L 2FEEI 4U1GC 3ZTJG 2VB5A 4Y5VB 2E9JA 4Q2ZA 2EDTA 3AREA 4EDXB 4R0LC 5H94A 4F80A 2R1YA 4GW4B 3T2QA 3BRFA 4QRRD 4FHBD 5GRXG 1URLA 3BE1H 5IW1A 1F6LL 3DVGA 3HMWH 3B5TA 3EFDL 5GRYA 2CO7B 5DD6B 5DURB 4GBXA 3A6BL 1MJJA 3VFUB 2YD5A 4HZAA 4CW1B 2NXZC 2VQ1B 4M6ML 3LQZB 3LSOB 4JM2D 1NGWB 1S9KC 2ADFH 2J8UA 4LCWE 4APQD 4LHUD 5GSRB 1QRND 1SQ2N 1LO5A 3KPSA 2X89D 3S96B 4KI5F 3ZDYE 1W2KT 3W81A 2DI9A 3ME0A 1D6VL 5IEKA 2CDEA 3CK0L 4LF3A 4MSWB 4HFWA 2VKWA 2C1OB 3UTTE 3B2VL 2DOCA 4X5LA 5JUEL 1LE9B 1BM3L 1MCWW 3HUJB 5E56A 4DK3A 3SKNB 2R29H 4PRID 4MQTB 4A6YL 4PGBA 3OGCB 3CJJA 2FJHB 3MNVB 5D1QB 2BRQA 2XZCH 4Z95L 1HHKA 2WMPA 4DUXA 5JHLL 4ZS7H 1TZGH 2DYPB 1ND0B 1HHJA 4YWGH 2UV3A 4K3EL 5K59E 3PABA 3SBWC 3RWJA 3AVEA 3VXUA 3WFBL 3BYYA 3Q6GH 3S35H 3I6KA 1U8QA 3WNMA 1ITCA 4JFHD 4GRWB 4HKXB 4QNPF 5EU6E 4LBEA 3WFHA 1WC7B 5F70A 5I16A 4M48H 2EXYD 1U42A 5MEOA 3GSUA 1ZKAA 5DD3H 2APWA 3G9AB 1XZ0B 2P8LB 1JV5B 2CR3A 3O6KH 4KTDH 1XCTB 1ZANL 1X4XA 5T3ZD 5FHAH 3O6ML 3KLSA 4WWKB 3PUCA 4ELMB 4XPFH 1B2WH 5K9KB 1RUPL 3MACL 3UZEA 2AAVA 4O00A 1N5YL 1DUYA 5ESAB 3T3ME 4YEFA 3QUYD 2GTZA 4YXLL 1QACA 1KLUA 2C9AA 3T77B 2HT3D 2A73A 3EOTL 1BQLL 3BP5A 4JZJB 1I1AC 4NP4H 4ZMAT 1T7YA 5C0ND 2YPKB 2AQ2A 1RJYA 4XP5H 5ISZE 2JIXD 3GJEA 1T5XA 2PUQT 1KLGB 4UNUA 5L8JB 3EGSB 5DGRA 2QKIA 3BMVA 4F2MB 5EPMA 1T1WA 3K8KA 1SMAA 1IJ9A 4YDVB 2LFGA 5EOTA 3OHXA 3CFIC 3TT3H 4N1CA 2VOTA 1FNGA 4L8CB 5T1KD 3FRPA 5FCSH 3DHJA 4IOIB 3AU1B 4ZUTA 4NQSA 4TQEL 1N3NB 4NNPH 3MC0A 3S6CA 3NMEA 3UTZA 3DUSB 2EKJA 2XWTA 4UBDC 5HGDB 5BV7B 2ZCLH 1IFHL 1KB5L 1CLZH 1DANT 3KJ4B 5HVWA 4XNYH 3VXRB 4J3VA 5IB5A 5FECA 4YPGB 4MWFB 5EULV 2GSGA 3H42H 3QT2A 3HZMB 1M1SA 5C3TA 3RZCC 5I1DA 2V17H 4WUUE 4P49A 4JFZH 5LAXB 2YWYA 1UXSA 4N9GA 3KDMB 2GK0B 2P5EE 3SDDC 1VGEH 2VL5B 1TDQA 4M6OH 2WIIA 2F74A 2ICWJ 3NA9H 4JVUA 2G5BB 3DGGA 1U95A 3PGCA 3O3EA 2NXYC 3MRGA 5F7DA 4PJ9A 4M4RA 5DD1L 3WJJC 3NVQA 4G3YL 4L29B 4XCCH 2VNCA 3GSXA 1I7TA 4DZ8A 2ZSVA 2VDNL 4Q2ZB 3MJ9L 4D9RD 3AREB 4MHHG 4XCFH 5H94B 2R1YB 5HYEA 5EU7E 1GHFL 4WV1A 3MYJA 3QIBD 4O2CA 3HNTL 1RHFA 1RUMH 3J8F7 4YGVA 5I8EA 5IW1B 5SX4H 3P0YH 3DVGB 1QPXA 4FQHA 3CVHA 1U6AL 3QZWA 4GBXB 1MJJB 3TEUA 3V6BR 1IC4L 1NCAH 4K94H 2R2EA 1OGAD 2VDOH 5EOCJ 4CVWA 3HG1E 2J8UB 4YFLF 1AKJD 1DN2A 1OARL 1HE7A 3CDFA 1BOGA 1LO5B 3KPSB 4Q9RH 2IPUK 3NIFF 4NHUA 5D7JC 4CDHA 5DDHA 1MCDA 4OCXL 5IEKB 2CDEB 4LF3B 3LPWA 1XGPA 5KVGH 4HFWB 3WHE0 3OR7A 1DBKL 5AAMA 4AEHH 5B38A 5FYJL 4HQQH 1IBGH 4XT1C 4FQCH 4PYGA 5GQBA 2HT2D 5HI4D 1U8JA 4PJGE 3VH8A 3SPVA 4PGBB 1V3MA 3WUWG 3RBGA 4KKBC 1DFBH 1JNNL 1HHKB 3BAEL 1HHJB 4NZJA 5C0AA 4G80A 4GO6B 2UZIL 3PABB 3NGBC 4IRSA 4QXGL 3SJVD 3RWJB 1ZHNA 3VXUB 1X6NA 3NCFB 1P7QD 1AQDA 1CXFA 3I6KB 1OWRM 5F1IA 4Y2DA 1UJ3A 1U8QB 1T7XA 1MIEL 4LASL 1WUNT 3UBXI 4NBXB 3V0AC 4L8SC 4LBEB 3WFHB 3W9EA 5GRJH 4B53A 2K3TA 1S7TA 2BNRA 5I16B 5MEOB 4ZFGL 3GSUB 3FZUC 4M3KB 2BVQA 3EHBC 3ZKND 3HPJA 3D6GA 4XMLL 1UZ6F 4NUJA 3EYOA 4GKOA 3ZE0E 4PRBA 5E4EB 3VA6A 2HLFD 5IBTH 4P3WA 1DSFH 1KFAL 1KF9B 3RWDA 3U0WH 5E99L 1RQ5A 2AP2A 1GC1C 1DUYB 1J86A 2GTZB 3WNOA 1KLUB 2P8MB 3TNNA 2A73B 3RIFK 3BP5B 2ICEA 1JHTA 5JXEA 3HAEG 5TE6H 3RX5A 3WKMH 1G84A 1RJYB 4G8FA 5DEZA 2XV6B 3GJEB 3H7BA 1T5XB 3OAUL 3OL2A 1YQ2A 3QUMH 4KK9C 1DCLA 4KROB 4LNRA 2QKIB 4KWUA 5EPMB 4AEFA 1T1WB 5D72L 3KHQA 4JANA 5EOTB 2IQ9H 3OHXB 3QWQB 3HUJE 4S0TD 1FNGB 2EDQA 4N68A 3BGAA 3PWPA 1MJUH 3O6LL 3T04D 2D3VA 3ECBA 4ZUTB 4PJCF 1UB5A 3SE4A 4NQSB 1JPFA 1G7IA 3WS3A 1ZHLA 1M7DA 3OG6B 3CFEA 3UTZB 4J3XA 4DFIA 2XWTB 1WICA 1MCOL 3D39D 2BJML 5EOQL 2VXVH 1YC7A 1FNSL 5IB5B 2LVCA 5FECB 1T03L 3DROA 4GRWE 3ULUH 2GSGB 4GT7A 4NQEA 5I1DB 1HYSD 1UXSB 4N9GB 4QRPA 2WIIB 2F74B 3KYKL 3EO0A 5A2LH 1A7OH 3DGGB 3MOBL 4FRWA 1KYOK 1U95B 5E6IC 3PGCB 3O3EB 5JMRA 3MRGB 4R4ND 4XAKE 5F7DB 4PJ9B 2EDRA 5JW3H 4HLZG 3EFFA 3K4DA 4ELME 1HSAA 3WEXA 3GSXB 4WFFE 1I7TB 2OL3A 4DZ8B 2ZSVB 4PJ7F 1IAOA 3VGGA 1S8DA 5IB3A 4WGVB 5J56B 4WV1B 3MYJB 4OLXH 4TVPE 1DJSA 4O2CB 3KNBA 1Z0NA 5I8EB 4YGVB 1OTUC 3LQAL 3B8YA 2D2OA 4FQHB 3CVHB 3VD7A 2M26A 3RWHA 5I30L 5ADOH 3QZWB 2ESVA 5HYSG 1FBIL 4HT1L 1INEH 1FP5A 5IM7A 2AEIT 4P57A 3VW3H 4K9EL 3H2WA 2R2EB 1P69B 1U8NA 4ZPVA 3D25A 3NN8A 4ZAKD 1YEJH 1Z2KA 5IGXL 2EDKA 2ZG3A 5DS8A 1BOGB 3QUXC 3TNMA 4NHUB 1T66D 3BQUD 4JKMA 1KJ3H 5DDHB 5IQ7L 3RWEA 2Y1VA 4YFEA 2GQHA 1XGPB 3MLSL 3ARDC 3V79C 4POUB 4OZFA 4JQVC 3OR7B 4XAWL 5D1ZC 1U8JB 4NKIH 1UENA 4R2GD 3VH8B 2PW1A 3RY6A 4PJ8A 4EI6A 3MLPA 5FYKE 2BRRH 2IC2A 1O7VA 4PB9L 3V6FA 1N7ML 3F12A 3UPRA 1MRCH 3IDMA 3VXRE 1XR8A 2VO5A 5A2FA 4UILL 5C0AB 4G80B 4IRSB 1CE6A 4YFLI 4JPVL 1WT5A 1ZHNB 4KKCC 3QPXL 1IT9H 2YA2A 1AQDB 3BXNA 5F1IB 4Y2DB 1UJ3B 1YNKL 3RVWC 3S5LA 5HY9A 4ODUA 3W9EB 2VDLH 5KVMC 1S7TB 2BNRB 5DJCA 1V3LA 3AS0A 1KTRL 4ZO9A 1ZLVK 2IBZX 2W9DL 4TSAL 2C3GA 1AGEA 4H1LG 1OAXH 2BVQB 4HSQA 4QYOA 2A77H 1J88A 3HPJB 4BSJA 1IGCL 2RAMA 4KQ4L 2C1PA 1H5BA 4NUJB 2QR0A 3EYOB 2MQCA 4PRBB 1T22A 4Z7OF 5CS7A 2HRPH 2QQKL 3FHAA 5FIEA 3TGXA 5JDSA 4JPKH 2JJTC 3RWDB 1A4JA 2PO6A 3DYOA 2E6QA 1T04A 4P5TC 4PY8I 4NKOA 3PDGA 4HIXH 1LQSR 2BVOA 1I1FA 4G8GA 4O02H 5E8PA 1XGRA 3TNNB 4KTEH 4X7SL 3RI5K 2ICEB 3C8KA 1JHTB 5DEGA 4JRYD 4W81A 3RTQC 3KJ6H 3C60D 1WITA 2P44B 2J8UE 4G8FB 5FYKU 3H7BB 2P5WA 3KPSE 4HXBL 2YR3A 1MEXH 3UROR 4LNRB 5BJTA 1M05A 3HE6A 4JO1L 4OKDA 5I76A 3RAJH 4BUHA 4JANB 1INDL 1FVDA 1L4IA 3DGCR 1YEFL 3O11A 3SDCA 4XMKL 5IBLC 3PWPB 1NBVL 3BZEA 4RFNB 5JQHC 3ECBB 4FMFA 2Q1EA 2ICWA 1UB5B 5KVDL 2NTSP 1JPFB 2VLME 2YKLL 4PLJC 1G7IB 3Q2CA 3WS3B 5EBWB 4MQXD 1ZHLB 1A14L 1M7DB 3CFEB 2VUOA 3EYUL 4Y16A 1RZJH 5BZWA 3ZHDA 3BJ91 3CLEL 3V95A 4R97C 3QG7L 5E08L 3VXUE 3K2MC 2VDPH 1QR1A 1NBYA 2K9UA 2EDBA 1JGLH 3V0VA 5EO0A 3DROB 3O2WH 1JPSH 4LSPH 3W11D 4NQEB 4EN3D 2RGSA 1A5FL 2NY1B 1EV2E 5IESH 3IU4L 4QRPB 3O0RL 3TZVD 3EO0B 4PJDF 1A3QA 2VDQH 1MFCL 3LKRA 3LCYA 3RKDD 3MV01 3N9GL 4IJ3C 1CGSL 3EFFB 1UC6A 3ARBC 5DJ6A 4I3RL 1HSAB 1A3LH 3WEXB 2CK0L 2E7MA 1MIMH 2HH0L 1GH7A 2OL3B 3JVGC 1IAOB 1O0VA 3L1OH 4JKKA 3DXAD 4KUZH 1S8DB 5IB3B 5ILTL 1FN4A 4JFPA 4NHCH 4J1UA 4KFZC 3UJTL 3KNBB 2MQ0A 4WUKH 4YXHH 3MXVL 1V7MH 3FO0H 1BOYA 3IKKA 4WCYL 3CH8A 1MFEL 3RWHB 4LVNB 2ESVB 5F96L 1SYSA 4DKEH 1UYWH 5IM7B 4P57B 2XKSA 2CUMA 3D0VA 2IADA 1U8NB 4ZPVB 2IPTH 3D25B 3NN8B 5GISL 1T0MA 3VWKD 5DS8B 3CZFA 3TNMB 4XB7A 3BPLC 1UM6H 3RWEB 1MRFH 1FC1A 2B1AL 3V7AG 5GZOC 3T65A 1VEOA 4OZFB 3SDXF 3H9HA 3VXOA 4F9PC 1RULL 4I3SH 4M43L 3BZ4A 2BXYA 5IVNA 5F9WC 2ZKHH 1WWCA 2PW1B 4EI6B 4PJ8B 3F6IA 1XGQA 3IKCA 5DMJB 4N5ED 3PGDA 3WO3B 1AY1H 3O4OB 5HJ3A 3V6FB 4QXUH 4XWGH 3F12B 2V2XA 3UPRB 3IDMB 1XR8B 2NY4D 5I6XB 2ZUXA 4L4TD 1CE6B 1IGFH 5IEHA 4P46C 5SWZA 4KRNA 3BXNB 3S5LB 5HY9B 4JN1L 4ODUB 3LEYL 5DJCB 2JB6A 3ARFC 1RUAL 1A7PH 4M1CC 3EJYC 1X4ZA 4HG4K 1AGEB 4ZXBC 5DF0A 4LSQH 4QYOB 3FHQA 4ONFH 5SV4A 2QQNL 2C1PB 2EH7H 1H5BB 3GKZA 2QR0B 2BVTA 2ORBL 5D2NC 1T22B 5ESQA 2EC9T 3RVUD 5DMIL 3S37L 2EO1A 1SEQL 1AI1H 2OXHA 2X9YA 3MBEA 1CT8A 5JDSB 1A4JB 1BVZA 4NQUA 2PO6B 3ZL4L 4EXKA 1VFAA 5ACMA 3MFGB 1FC2D 1T04B 4S1RL 4NKOB 2BXZA 2BVOB 1I1FB 1WTGT 4G8GB 4OM1L 1XGRB 4R4FH 5E8PB 3SCMD 2NY2C 3C8KB 4J12A 4MJID 5I2IA 4XC1H 5DEGB 4AG4L 3U4BH 1MWAL 4PJCA 4U3XA 4IOFC 4NKDA 2VDML 2P5WB 4N8CL 3NACH 4OCWL 3S4SG 5BJTB 4NJ9H 1M05B 3HE6B 5L9DL 5I76B 4XXDA 4NFDA 5A3IC 5JOPD 3B9EA 3I85A 5CCKL 1FVDB 5AZEH 3O11B 3SDCB 4CAGA 5K33A 4OCNC 3IDYC 4P2OA 43C9A 4D9QE 3BZEB 1IEAA 4QF1A 1J8KA 5EZIL 5KANG 2ICWB 1IC7L 2JLLA 3BKJL 2ZNWA 5C09A 4N0RA 4Y16B 5BZWB 3HZKA 5C0AE 3P30L 1NFIA 3CGTA 3ZTNH 5BV7L 1MHEA 1FAIH 5DMYA 1QR1B 1NBYB 3LDBC 3V0VB 5EO0B 5DHVA 4QRUA 2ZCKH 4PJ7A 2BNRE 5ECJE 1KEMH 3N1GC 1NMCB 4NJAH 1T7ZA 4YJZL 4OKVA 3LKRB 3QCVL 4GRMA 2PXYC 3SOBL 3TBWA 1LDPL 5C0GA 2XKUA 3V6OC 1YEKL 1JZ2A 5DVKA 4Q97A 2VIRA 3JWOC 4DN3H 2DJUA 5DJ6B 5J0BA 4Z0BH 5ICYA 3MYZA 3MLYL 5GJTH 4TSCL 3CU1A 5FYLH 3QUZA 2AVGA 1NPUA 2CXKA 1EEUA 1JTTA 1YYLH 1FN4B 4JFPB 4FABH 1C5BL 4HUMB 4J1UB 4U2ZA 2F5AL 3UTSA 1LDSA 2DM2A 5FFLA 2H2PC 3QJHA 4WI6A 3QWOA 1SYSB 2DQJH 1HHHA 3WN5A 3WIIH 3MRNA 1MH5A 3D0VB 2IADB 2AJSL 1N4XL 2YUWA 1T0MB 2BFVL 5C7XL 3CZFB 3MROA 4MNQA 6FABH 3PQYD 2FLRT 3UBXG 3L6FA 5HTSA 1ED3A 4X6DF 1SVZA 3T65B 3PWPE 4LSVH 1UGNA 2LABA 3WFCH 4P9HH 3H9HB 3SE9H 3VXOB 2DQDL 3L5XH 3NAAL 3TVMD 3T4AA 2AJUH 3VWJA 3BZ4B 3DRQA 1I4FA 4LAQL 3DSNA 5CMAA 2M8XA 1XGQB 4EI5D 3IKCB 4MCYA 4I2XA 3PGDB 5HJ3B 1F90L 3P73A 4MB4A 4LSRL 4WIQA 3LEVH 1B90A 1HHGA 2V2XB 2DIJA 5J1TC 3QDAA 4NQEE 5IEHB 5SWZB 1IM9D 4OZHF 4RMVA 1XEDA 4QRPE 5ALCH 4HPYL 2JB6B 4PYHA 3H9ZA 3TYFA 5J12C 3EYSL 4LCWD 4LCYA 3QIWC 3B5HA 3C6SA 1P5VA 3UC0L 2FGWL 4MB3A 4YHZH 3CPLA 1ZK9A 2H41A 4I5BA 5ESQB 4GKNA 1OTSC 2XA8L 5GGQH 4HAGA 2DJ4A 4KI5E 3H3PL 2X09A 2FWOA 4ZYKA 3MBEB 4GAGL 1CT8B 1PZ5A 4HD9A 3ARXA 3WUWA 5LGJA 4OT1L 1VFAB 5J11B 4PP1D 3EYQD 2AJXH 2PTUA 3BN9D 1PDKA 1XGYH 5GS0D 4UV7L 2AI0L 2ESVE 4KRPB 3SDAA 1PBYA 1EAJA 1XR9A 5I2IB 4ONHA 5EFIA 4MA7L 4PJCB 2A1WL 4NKDB 1PKOA 4PR5A 1J0HA 2JJVA 1LO4H 2R2BA 4YH6A 4MD4A 5EU6D 2AV1A 4C57C 2FEEL 1Q38A 3BUYA 4XXDB 5CKAA 1CS6A 4OGYH 4OLYL 4P2OB 4XC3L 4ZD3H 1X5YA 3ZHLA 43C9B 4N0CC 1IEAB 4QF1B 2Y07L 4DUWA 3DMMD 3MJGX 1V7NL 4A2LA 2XICA 4WY7H 5C09B 4PJDA 1QHOA 3UCRA 4K2UL 3HZKB 5GGTH 1UEYA 4FXGA 1NFIB 4N1HB 1MHEB 5LBSH 4U1LA 3FKUS 1GXEA 1YEGH 3QRGL 4FQIL 1PYWA 4ODSH 4G6FB 5DHVB 4X7DC 1NLBL 4QRUB 2R56L 4DCQA 2ZP0T 4PJ7B 3LV3A 1P4BL 2EIBA 4WU5A 3MLWL 4BFGA 4HV8A 4UT9L 3D2UD 5ISZD 3THML 4CN1A 5CJBA 4D0DA 5C92A 3O9WA 4OKVB 4P99A 1UWXH 1VACA 1CI5A 5TE7L 4GRMB 2QJDA 3LKSA 2WLZA 3GIVA 2XIDA 2QQLL 5C0GB 1CDUA 1PG7H 1AHWA 5K9QI 2JJSC 3HC3H 2VIRB 1NGYA 2GY7B 5ICYB 1GOGA 1BECA 5TDOA 3HR6A 2QV2A 3RX8A 3QUZB 2J5LC 3TH3T 1U0QA 3STLA 1FL6A 2I24N 4G8GE 2R8SL 1RFDL 2DS4A 4LQFL 3UTSB 5AG8A 3SDXA 1F45A 4FNLH 1KPUA 1LO0L 4Y19D 1I9JL 3QJHB 3CVHL 3QWOB 3CSGA 2P5WE 1HHHB 3T0WA 3WN5B 1NC4A 3KPPA 5D7LA 5BO1L 3MRNB 4OLVH 2NY6C 4LSSH 1MH5B 4WUUD 5ELIA 2YPVL 5HGHA 2P5ED 3AFLA 2J8HA 3MROB 4MNQB 1IKFH 1GZPA 1HI6A 3L6FB 4HBCL 3ZMRA 4PJIF 3BIAX 5IR1A 1ED3B 5E2WL 4JM2F 1YEEH 4OCSL 1CQYA 1VB9A 1FORL 2E9WA 4LKCA 3T4AB 3VWJB 5DVLA 3DRQB 3OF6A 1I4FB 2EEDA 1FZOA 3X3FH 5CMAB 3U0PA 4DEPC 3DV6A 4Y4KC 4MCYB 4I2XB 1VCAA 1JRHH 4HH8A 4OLEA 5GGVY 3S37X 2AXFA 3P73B 2B0SL 3BH9A 1HHGB 2N7BA 4EIGB 4GS7C 4J3UA 2IFFH 3OJVC 5D8JH 3R1GH 2P24A 2X7LA 3KXFA 4LVOC 1XIWD 2EDNA 1A0QH 5HYSA 2W60A 4Z6AT 4P2QA 4KJWC 4QHLA 3NCMA 5DK3A 3MBXL 5FHBH 1T1YA 3G6JF 4QRSA 2ADJA 3HI6H 3TYFB 2O5YH 3HG1D 3OXSA 1QUNA 4LCYB 2NLJA 4M7JL 1JYWA 3KYAA 3C6SB 5LXGL 4IS6A 3CPLB 1FL5A 3LB6D 4I5BB 1AGDA 4LRNL 2XYCA 1Q72L 1OLLA 4GKNB 2DF3A 4P4KC 5F7LB 1A21A 3NIFE 3VD4A 2FWOB 1ZVSA 4DAGH 1AIFA 1I9EA 4ZYKB 4P5KA 1PZ5B 1OY3B 3VGFA 1JRHI 1HKFA 5JXAL 3WUWB 5FV2A 5LGJB 2F8OA 3WFEH 4XI5D 4HFUH 1D5ZA 3L3OA 2ZCHH 3SDAB 1CQKA 15C8L 1XR9B 1VFMA 1T6VN 4ODXA 4ONHB 5SWSA 5EFIB 5HDQL 4HXAH 1FGVH 4K8RC 4H25A 3VFGH 4M7KL 3RA7L 4PR5B 2R2BB 4MD4B 3U82B 2AV1B 3OKYA 4H1LA 2B4CC 3FO9A 3BUYB 1RPQA 4DGIL 5M7QA 3RPIA 5FGBC 1DR9A 4LPWA 4YHML 3MRKA 1RIUH 5H8DA 2H32H 3QXAA 4HUVA 3C9NA 2X44D 1CFQA 2LTQB 2WWMD 3DSFL 1UA6L 2VDRH 5EBLA 1QFUL 1W72L 3E1F1 4OM0L 4JHAL 3CSYA 1CFVL 3RNKA 3MA7A 4PJDB 2JB5H 1X5FA 2W9EH 5K93A 5E5RB 3UYRH 3N85L 4FXGB 3E3QE 5SWZE 4J23A 4QOKA 4U1LB 5KSAC 1KEGH 3ZT6A 1PYWB 3LN5A 5DURD 3CD4A 3QCTH 4ESKA 4I1NB 3TJEH 3BDYH 4I0PC 4DCQB 3LV3B 1WV7T 1H8SA 4WU5B 3HCVA 4BZ1H 4WEBH 3VG0H 5KTEH 4HV8B 1RIHL 3N1MC 4D0DB 5I1AA 3O9WB 1YEHL 1VACB 4B0MM 3IFLH 5DT1H 1NEUA 3LKSB 3GIVB 2BK8A 5GZNC 2B2XL 5GS2H 1AHWB 4CNIA 5E6YA 1UEMA 3HMXL 4RWHA 3OTTA 4PG2C 3LS5L 1KPRA 1NGYB 2EDLA 5TDOB 2ED8A 4GJTB 1VGKA 4RAVA 4CN6A 3STLB 1FL6B 1MLBA 4YX2H 4JHWL 1ORQA 2DYPD 5EORL 1EJOL 4X6DA 4WI9A 3SDXB 5IFHH 1KPUB 5I8CA 4PJCE 4KMTH 3FB6A 2AEWA 1MJ8L 1RUKH 4U6YA 3TBYA 4D9LH 1NC4B 3KPPB 5D7LB 4L9LC 1X4YA 2OM5A 2AS5M 4PJ5A 4UTAH 5HGHB 2WUBH 1KJ2H 1GZPB 2UY6A 4U1IA 4YBQD 1HI6B 5HYQA 4M7LH 1A9EA 5IR1B 5DFVC 3L7FA 5IT2L 4FS0A 4XAKD 1CLOL 4OZHA 4Z7NE 1QVOA 3CDGA 2DQUH 3REWA 4D8PA 4XVTL 4LKCB 2ITCA 5C09E 5F21B 1KIUA 4J7RA 4WWKD 1FZOB 3RGVA 1IZKA 2EDFA 2H45A 4Y5XA 1JNHA 4WFFD 1MFNA 3U0PB 4UTBH 1WBXA 1NUGA 1GIGH 3DV6B 5FGRA 1ZGLM 1CD0A 4LLMA 1ZA3A 2AQ3A 2AXFB 4YHOL 1D5IH 3BH9B 4HK3N 4M5YH 5EA0L 3BKCL 4YQXH 4TVPD 1NFKA 2P24B 3DETD 1AE6H 3GO1H 4J2XA 2X7LB 3KXFB 4PJ7E 5AWNL 4G7YL 3TBSA 5HYSB 1Q8MA 2FZ3A 2W60B 4P2QB 4QHLB 2WQRA 1T1YB 4QRSB 3BEWA 3E6HA 2BVYA 2ADJB 3FTGA 4FQXA 3OXSB 2F19H 2NLJB 4IS6B 1FL5B 5I15L 1ONQA 1SBSL 2ZOLA 1AGDB 4Z7VF