4JPKH

Crystal structure of the germline-targeting hiv-1 gp120 engineered outer domain eod-gt6 in complex with a putative vrc01 germline precursor fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGKNSDYNWDFQHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative VRC01 germline precursor Fab heavy chain
publication title Rational HIV immunogen design to target specific germline B cell receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpkH01
3RWCB 3FT4B 4JQIL 1BAFL 3MRGA 5I74C 1ZLSL 4HC1L 1MJ7L 1Q0YL 2NR6C 2NXZD 1OLLA 4XPHH 2JB5H 4HWBH 1TJIH 4MX7B 1CLYH 1MCFA 2G2RA 3G5ZB 5JUEL 3D18B 3DXAA 1N6QH 4PGEB 1DP0A 4HJJL 1QFHA 4M93B 2YD3A 1UM5H 3RI5K 1BEYH 4XCNB 2CIIA 4L4TE 5ICXB 4OF5A 5GRJH 4P5TD 2XXMB 3RA7H 4P49A 1LDPL 1Q94B 2BSTA 3C5JA 1WAAA 5BV7L 5CINL 2CKBA 4DKEL 2D0FA 3RIFK 5ACLA 3NH7H 4PJAE 2H26A 4QT5A 5E00B 5I19L 1F4YL 4NBZB 5FKPB 3D39E 1DBBH 4JQVC 1WAAF 4YXKL 4IRSD 5CCKH 3FJTA 3B3IB 1DANT 5EPMB 3WHXB 2IADA 3I2CL 4PG2A 4U1IA 4BFIB 3IFNH 4DVRH 5FGBC 3EBAA 2WZPD 3BUYA 3CSGA 4P99A 3SGKC 1DLHA 1NC2D 2ADFH 1I7RB 1R5VA 2DQIH 1DQJA 2NXYB 3RZCD 3DNKA 4ACPA 3CVIH 4LNRB 1RD6A 3EFFA 1ORQB 3GSRA 1CDIA 1AC6A 1ZHKA 5F9JA 5K9QI 1AGEB 2WBKA 4NDMA 5DLML 3SDDC 1MCCA 4HS8H 4WUKL 2DM2A 4GW1A 5D7IB 3L3KA 2CRMA 2R69H 3WLWD 5IVNA 4RFNB 2C7UA 5IOPB 1J0KA 4PJ8D 1WWBX 4NYLA 5HGDB 2VDQH 3I6KA 4BKLA 3CFDA 4ZNEE 1GC1C 4Z78B 4HJ0D 1EUUA 3Q1SL 1UA6H 4RMRA 4XC3L 1RZ7H 3U9UB 4X7EC 1I1AA 3L6FA 1CDJA 5TF1H 2A9NH 1DL7L 4F7MB 5H35A 2EYRB 4U1MA 5F7LB 2PW2A 1BBJA 2AK4D 1P7HL 5T1MB 2R9HC 5FO9A 4JM2B 5HGBA 3LV3B 4NQUA 3UTPD 3ULUH 2HRPL 1RJZB 5LGJA 1X5YA 4JDVA 1H8SA 5GGTL 4Q9CA 4ZFFB 1D6VL 1INDH 1CR9L 3UBXB 3NZHH 3JV0A 2RB8A 2XNAA 3L3IA 4MVBD 3G6DL 4F7TB 1OTSD 4RA0C 5KZCB 4JGUA 2XT1B 1K2DA 5D6CA 4KUZH 5CZVH 1RPQA 3HMXL 5F44A 4GKOA 4K8RD 1U92B 1FAKT 4RGNC 1K8DB 2ZCLL 2AV7A 5JW4N 5GSRA 4O51A 4G8FA 4ZFZA 3BH9A 1EPFA 2F54D 2B2XL 5IMOA 4LMQE 5FM4A 1A9BA 2DDQL 3VXRB 3QJFB 4J4PC 3BGFC 5HDQH 3ZHKA 2AJZA 3MNWA 5FYKH 5CILL 5IGXL 4WHDA 4EI5C 1FZMB 1TMCB 3INUH 4EVNB 1SVCP 3B8SA 3D85B 2YD8A 4RA3A 2DICA 1E4XL 2V7NA 1UYWL 1U8IB 4AH2A 5KANG 5MEQB 5BS0D 1B9ZA 2GITB 4S1QL 2YPKB 3NIGE 5F3BB 2VLLA 2G5RA 2AP2A 3BMVA 4PRPA 5IJKA 3DOSA 2VN4A 5AWNH 1S7TA 3WEXA 1KV3A 1IM9D 3IJYB 3QUKB 5E6ZA 1T7YA 3VXMA 1VGEH 4HF5H 3QWOB 2E6QA 1UWXH 1FO0B 3D48R 12E8L 1XT5A 2V5SA 4U1SB 5IBTH 4P0DA 2A38A 4H26A 4L5FL 4D9LL 1W72A 2VE6B 4O00A 5C2UB 1EEQA 4TRPL 1PG7L 4MA8H 2HLFC 2BRQA 1MELA 3C60A 2P1YA 1H3WM 5F6IC 3R1GL 1UJ3A 5TE4L 3UPAA 5ACZA 1HYSC 3EW3B 4WFFE 3U82B 5E5RB 2GQHA 3QQ9C 4PJXE 3C8HA 4MHHI 1T80A 1YEHL 5JPNB 2YMXL 4P2RE 3B9EA 5D71L 1LK2A 3BZDA 4ZUWA 5D7SL 5DJZA 5JW5B 5E24E 3T0WA 1FZKA 3BT2L 1EDQA 1HQ4A 1C8PA 5F9AC 1OSZB 2BNUA 2W9DL 5IW6A 3GBNH 1LDSA 3JWOC 3LS5H 3L5XH 3DGGA 1IAIM 3NTCL 4RQQA 2DAVA 3UTOA 1IAIH 4XX1G 5DYOA 1HN1A 1K3ZA 4X0KA 3SKMB 3GM0A 1FDLH 3P30H 4OD2B 3CVHH 1MCDA 3LD8B 1IGFL 3OWEA 1A02N 1TPXB 5E1AA 5E56A 5AZ2L 2Y07H 1DQDH 4XX1E 2DI7A 4LCCB 1ZGLP 2FD6L 3WFCL 4HIIA 3QO0B 2VDKL 2VNCA 4Y5YB 3VG9C 2I27N 2FCBA 1HNGA 4K7PX 3VFVA 1VSCA 5I1AB 3EZJB 4PJFB 3FFCB 3ZE0E 1FH5L 5F1NB 4ONGH 1UXSA 1S7QB 4I0PB 3P0YH 4JVPA 3P0VL 4O9HL 2DS4A 4TQEH 5IW1B 2KPNA 4NQDA 4GMTL 3ZKXB 1XR8A 1B3JA 4XBGB 2DOCA 3TZVD 5HI3C 5ETUB 5DJAB 3QA3B 4V1DE 4QO1A 1AC0A 2CDGB 1F5WA 1SEQH 3WV0A 4FFZL 1HWGB 3GIZH 3PL6C 3HRZA 4B50A 4NRXA 3PABA 4JPVH 4X9IA 3A6BL 3MJ9L 2BY2A 1QG3A 2P5ED 4PJBA 4ZS6C 3G6AA 4Q74A 4M9PA 4PRIB 3V6FA 3CXDH 5BO1H 3H7BA 4KTEL 3VE0B 1L0QA 4PJBF 3ZTNL 3FRPG 3BAEL 3FB7B 1I8KB 3LQZA 3NOIA 3JUYA 5LWYH 3O6FC 3E0GA 5D1XD 1T0NB 1TETL 3LKPB 4GMSL 4WTZG 3RKDD 4XP6H 5D7IF 3RVWD 1HZHL 1HHJB 3HZMA 1NBZA 3QIBC 4KRPB 1R3LB 2VXVL 3TO4D 3WIFA 1KBGL 1YN7A 3V7AG 5J13C 1Q9KA 4U1KA 1RK0B 1Y18B 5E1HB 3RWIB 1YJDC 3MRMA 4XPHL 2X42A 1TJIL 3TCLB 4WO4C 1AR1C 4ELKB 4IIQB 2DQEH 4K07A 1EAPA 4JLRA 4RZCB 5BQ7B 3N85H 5DRXA 3MA9H 1KPVB 3SGEH 2BFVH 2G75B 2XRAL 3OKNA 4G3YH 4LRIA 2Z91B 1JNNL 2EZ0C 4JG0H 3DVFA 2VLKA 4JM2F 4XZUA 5ALBL 5A40E 4OCLC 2AJUL 4JHWH 4RWHA 3W39B 5DJ2A 4MNQD 1P4BL 1DBBL 3VFSA 1MLCA 5CCKL 2ESVB 4UIMB 3TT1H 3OZ9H 4DVRL 1TQCC 3CIQA 3VWKC 4HUXB 2ADFL 2IWGA 4X9BA 2DQIL 2BX5A 3MROB 1FYTA 3CVIL 3E1F1 4HGWA 2J8UA 1P1ZA 1S3KH 5BW7A 1L6XA 3QEQA 3QUZC 5HPOA 5GPRA 3MLUL 4R7DB 2Q3ZA 3ARED 4NPYA 2J8UF 1QQDB 3F12B 1D6EA 3JUZA 1JPGB 5ADPH 3MV7B 5FV2A 1HXYA 2NLJA 3DHJA 2R69L 1LE5B 1WCBA 4HS6B 2P48B 1X5GA 2HFEA 4LIQL 3BKML 2VDQL 4P2QD 3SDCC 1F42A 3EDKA 5DJ8A 4CW1A 2FB4H 4YO0A 1UA6L 4RX4D 3NAAH 4HWZA 3VGAC 1ZMYA 4EXKA 2GIYA 1BFTA 1E4WL 2A9NL 4PGCA 3BZEA 4U7KA 3HI1B 2AKRB 4RFEB 1PYWA 5D7JC 2KDGA 3K2UL 2XWJA 4Z77B 2PCPB 4P4KD 1YNTA 3RGHA 3X11B 2Q3AA 3I02A 3V95A 1WT5C 3QFDA 5A2IH 3UJIH 5T3ZE 2W65B 3GMLA 4FNLH 4HIXH 4PP2B 3EGSA 1INDL 3ARPA 1DANU 1B4RA 1G1YA 3MV9B 2R1YB 1LD9A 5F1IA 4HKBA 3RJQB 3BP5B 2OXHA 5HPMA 2XKNB 2FJGB 5GGUA 3M8OH 5HHNA 1FHGA 2ICWI 2XICA 1T2QL 1XEDA 3REWA 4M8VA 2XZQH 2GEEA 4ZD3L 3RY4A 1KB9K 1K3IA 4YAQB 1WIOA 2ZUWA 1GOHA 5L2JA 3WBDA 3FZUD 1EMTH 3V6ZB 4RFOH 5LJYH 3SE3A 3BH8A 2MHAB 4M6AA 1CF8L 2XV6B 1N59A 2QBWA 1F8TL 2BMKB 4WTWA 3GJFB 4XH2A 1BREA 4Y8DC 1MFAH 1BJ1J 5HDQL 2DQTH 2UYLB 3LY6A 1P2CA 5K9QG 1BMGA 3MBEC 2AABL 1ZHNA 4D8PA 3BGFB 3LKSB 3BP6A 1J86A 4TUJB 4L4JA 4U6HA 4D9QE 5I1LB 3VMNA 4MAYC 4FOMA 3PWJA 4LKCA 3TJHD 3WS3B 4EI5B 2CDFB 4KZDH 1FBIH 5EUKA 4QHNB 1PZUB 4GAFB 2R2CA 5C7XH 3JTTA 3BVNB 4N8PA 1RY7B 2IALA 5IIEB 4M7KL 4PGBA 5FXCH 4IRJD 5D6DC 4CDGC 4L4VB 1RZ8B 3NA4A 1I9JL 2GY7B 3GMPA 1MCIA 3B9KB 2EH7H 5EH1A 4PJFF 4XP4H 1KTKE 5EN2B 4ALAH 5C8JB 4HULB 3PHQA 4Y16C 1G7LB 4PJDE 2X70B 1IQDB 4ZNCD 4QRSB 4ONFL 1IRAY 4C55A 1YMMD 2IBGA 1QFOA 2A6DA 1CFSB 2GJ6A 5DK2B 5F6IB 1JFQL 1CD0A 3DARA 3TESA 1MCWM 2DBJA 4NC1E 2J3SA 5DMJB 4LSSH 1MHCB 5IP4A 4G9DB 3OV6A 3AB0C 4G7VH 4X5LA 2P8LA 4ONHA 3OAYH 4B0MM 3WYRA 2Z92B 4NHUB 4ZAKA 3T1WA 1Z3GL 4OCRL 3QXDA 2X4SB 3GBNL 5IVZA 1FNEB 1MI5E 3QUYD 3NCJH 2BERA 1OOAA 1WEJL 2CUMA 1YEFH 3L5XL 1ZTXH 2DJ4A 4OUOA 4TVSa 2UWEE 3KYOA 3AAZB 2E8YA 4QTIH 5B39A 3MJ7B 1IAIL 1HSAA 4XCYA 5CEZD 5T3XL 4G8GE 4KXZI 1VPOH 1F4XH 2R8SH 3LN4B 1U91A 2FECI 4YFLF 2IC2A 1BVKB 5DURD 1OAYL 4KRLB 4MS8D 3RTQD 2J2ZA 2DRUA 4D0CB 2WBJC 1PBYA 3S36H 4C58B 2ADGA 4XVTL 3C6LC 2DLEA 1MJUH 4X8JB 1VDGA 4Y19D 4X6CA 3SOBL 3G08B 4HS3B 2J6EL 2PYFB 2W07A 1JCKA 2ZCHL 4ZUUB 1ZGLM 4ZO8A 5DR5H 1PZ5A 4TQEL 4FMKA 1BOYA 3K2MC 5L88H 2LVCA 2B4CL 2RFXB 4LCWA 4OI8A 3BWAA 5IFHH 5C09E 4HLZG 1NL0H 1DDHA 3DUHA 1QSED 1JGDB 1NMBL 1DLFL 1ULVA 4P2YA 3GIZL 2QV2A 1ZA3A 4MNGB 5E8EA 8FABA 3U0TA 4TSAH 3O11B 2NY5L 3WDIA 3EO1B 5FGBA 4AIZA 5ID0B 1I1RA 4WI4A 3B2VL 3PL6B 3SGKA 1N5YH 4F7EA 3WIHH 4MHHG 4JY6A 5I75B 5JPMB 1RSFA 1JPSH 1DE4A 4S1RL 1RUQL 3W0WD 2HFFB 1F11A 4KK6D 1I8IB 1U8NB 3IXTA 1UWEH 2KQMA 4JFOA 2Y7QB 3F58L 3RNKA 4WI5A 4LQFH 3SDDA 1QKZH 1KGCD 1S78D 2ZSWA 4WV1C 1ZANH 3O6FB 4MMZC 2AJVH 1N2RB 4JEGB 1J8HD 3MUJA 2ZNWA 3Q3GB 3CCHB 4OI9A 1A3LH 1QFUH 1A5FH 3EHBD 1MLBA 5I76B 5J13B 2CKBH 4JN2B 1FGNH 1WFOA 3TV3H 5EOTB 4J7RA 4DN3H 1RJLA 3U4EB 1AGDB 2YXFA 2KH2B 1C08B 1YPZB 4H1LA 3SKJL 4ODXA 4Y1AD 4WWKD 1GGBL 2VXQH 2IH1B 1KNOA 4JG0L 4UV7H 2VLMD 5ANMB 1VA9A 1GPOL 3T08A 5GZNC 4J12A 3QDJD 5TGBA 3DYPA 4JHWL 2HN7A 4NWUH 1BIIB 4FXGB 1S7RB 4JRYE 3KXFD 3S4SG 3S34L 1XIWD 2CD0A 3FT2A 3OKKA 3LEYL 4L8SA 2XWTB 5DMGC 5HI4C 3KPOB 3FHAA 3QHZL 4NSKA 4OF7A 3MOBL 4KJQD 4NUJA 4RMQA 1NKRA 5I17A 5ICZA 3TF7C 5FUOL 3I50L 5GJTL 2XN9A 5JHDE 1TQCB 5F3HA 3VWKB 4ZO9A 2C26A 2AAVA 3HPLA 1S3KL 2P5WE 1H5BA 4XGZB 1A0QH 2EEDA 1DQML 1MWAA 3VWJD 4LF3B 4MQ7A 3R06A 1C5BL 5ADPL 2X7LB 4YIQA 1OGAE 1PDKA 1NFDE 1BQSA 5FYJE 1M05B 5I1DA 4G6AC 4MCYB 3N0PB 5GGVL 4M4PA 1OSPH 3TO2B 2BDNH 4GW4B 1CICD 3KPMA 4GXVH 1NBYB 4YBQD 1YY9D 5I0ZA 1KJ2A 2FO1A 3AXLB 5H2BA 3BPCB 4KJWD 2VSCA 3QIWD 1NBQA 3TWCH 4G8EA 1MREH 4Y2DD 1JPFB 5DJ0A 1FV1A 4NC1C 3VGAB 4FG6C 5FOBA 3SGJA 2PXYB 4M5YH 5CJQH 3QYCA 5D7JB 4WUUD 4KDVA 2H1PH 4HK3N 4N8CH 4QHKI 1RIHL 1GYAA 4XP9H 3G9VA 3VXSB 5EFIB 5T1DL 1DQQA 2DTML 1I7ZA 5KVDH 5IEHB 3DMMA 4ZDHB 3UZVB 5KG9B 3Q48A 3MRQB 1ITCA 5CSZA 2XZQL 3CMOL 3ULUD 3BPNB 4ZOAA 1X5ZA 4H0GA 5I73C 7CGTA 5J8OA 1BD2A 1A7BA 2X4TA 1FC1A 3FOLB 3W5NA 4GRMB 1MH5A 4KTDH 5EIVA 4NKMA 3FONA 1S7WB 1KOAA 3P9LB 4D3CH 1KCRL 3FB8A 3ARDD 4PB0H 5F70A 1WFUA 1MFAL 2VITB 4UMGA 4R2GC 4WI6A 2VC2H 3WN5A 4P5MB 2YD9A 1N6VA 2QQKL 4L4TA 5GIRB 4X7DC 1V05A 3U6RA 2HLAB 4MZ2A 3UPRA 5E99L 2Z35A 3WNKA 2CJUH 3MBEB 3FB5B 4KZDL 4PJAA 4LPTA 3SCMB 3EJJX 3D39A 4YDIL 3VH8B 5A2JH 4Z7VE 1TJGH 3QNYB 2VLJE 3H0TA 2J12B 4Z76A 4PJAF 4V1DB 1P6AB 5FYKD 4JZJC 3DO7A 2A2QT 5C0JB 3T2NL 4MLIA 4MSWA 2NZIA 4R7NB 3E3QE 1U41A 3IT8D 3QEGL 4ZUVA 4P5TC 4G6KH 4JHZA 3FTGB 1ONQB 2FGWH 1H8OA 4DAGH 2WUCH 2XA8L 1A9EA 1OP3H 4KUCD 4ETQB 4Y16B 4UINL 1EK3A 2FLBT 5I1EL 3O8XC 3RWGB 1W0VA 4PTUB 1I9IH 1TTFA 2FEDD 4M9OA 4LSSL 1GZQA 2AK1L 4PD4J 4FQIH 2XI9A 4J3SA 5TDNA 4NRYB 3G6JB 3OX8A 4OCMC 1UB5A 3TBTA 2HVKB 4KTYA 4ZNEA 4K3EH 3WS6A 3IVKA 3AB0B 4J1UB 3B6SB 1UVQA 3F7YA 1ZTXL 4R6UA 4MGXA 1N0XL 4QTIL 1QLFB 2APTA 5BMFL 3OXSA 3VFGH 4PJ5D 1E0OB 1F4XL 1HIML 1VPOL 2DKSA 4M48L 2R2HA 3QT2A 4D0DA 4PRHD 2HJLB 4UNUA 4G6FD 5T1LD 3QIBA 3OR7B 4QRPD 2XIDA 4HK0A 3TFKD 1X5HA 1AFVH 3LS4H 3RPIB 5INCA 2ZUYA 2NY2D 2D03H 3VRIB 1MJUL 4OT1L 5EZLB 2Q76A 4JPWH 3BEWA 1A7PH 3EYFB 2JIXA 5CEXA 2WBJB 3C6LB 3DRTB 1A6AA 1U8LA 3ZKQD 1PQZA 1RZKL 1T66D 1PEZA 2I60L 5I1HL 2B20A 1MVUA 3CSYA 4JFHD 5FM5M 3FOMA 5DD5H 1NL0L 4LLYB 3KPRD 4GAGH 3W11D 3V4VH 4TUOA 5FA4B 5AUMA 3LKRA 3VFTA 3FN9A 4LHUA 1YQ2A 2SEBA 4LAJH 5HYJD 2W38A 1YEIL 1M4KA 5E6ID 1DEEB 2IAND 1QBMH 5DEGB 1LO0H 2HKHL 1J1OH 3HAEB 3C08H 4YLQT 4ODHH 3ILPB 1DUZB 1JPSL 3ULVH 1P7KA 3BIKB 4EIGB 3K4DA 5K59E 4OFYA 4K8RC 1ZEAH 2R15A 3QUZA 2P46B 2IQAB 1JK8B 4AQOA 4FQXD 3WFHA 5C0CD 1U58A 3KS0J 3NIGF 5I6XB 4LQFL 4LKXA 5SWQB 1UEMA 3LKQB 4CBPA 4A2LA 2VZ1A 2C4FT 1JWSA 4NJAH 5DRNB 3W9DA 1NUDA 1FIEA 5DJYA 3TIDB 1A3LL 3CFJA 3MLXH 3QWRD 3SDCA 3Q2CA 2CUHA 3SKNA 1F58H 5IHZA 2CKBL 3TM6A 3TCXA 1FGNL 3PNWA 1IE5A 1U8HB 3CH1A 4G9FE 3TV3L 4E0RB 1W8NA 1A3RH 1IFHH 1SY6A 2IH3A 3HB3D 1G84A 3NACL 1U9KA 4PJXA 5KSBB 4M62H 4P2RA 1GVIA 1OP5H 5I1JH 2ARJQ 2BJMH 3ARGD 3RY5A 3IGAB 3JWDH 4PJXF 5IWLA 4P57B 5EUOA 5GGVY 43CAA 3DTXB 4RIRA 5HHPB 1B0RA 3MRFB 3KPQA 4PGDA 2F8OA 3FQWA 1QSFD 5A43C 2HT2D 4NWUL 1I3UA 2WINA 4F3FA 1UH4A 3DWTA 2E9BA 4WI2A 1NANH 4K55A 4JCMA 5E2VL 1ZHBB 1XCTB 1KG0A 3U30B 1JZ5A 4YHKH 4ZFGL 4WHTA 1NCCH 3QPXH 2AEPH 1NSNH 4YUEH 4LSUH 5B8CA 4AG4L 1TZHA 1JTPA 1NBVH 3VFOA 4N0CD 1L0XA 1A0QL 5TE6H 2L7UA 3MXVL 2GKIA 2XZCL 4WHYG 4M61B 4X4YB 3WJJA 4PBVC 2PTVA 3T1FB 3QNXA 4HIHA 2ZOKA 3BGMA 4LPVA 5D96C 5L2KB 1FVDA 1X4XA 2M8XA 3UP1A 5HHMB 4LAQH 1PKQB 1FFNA 1ZVSA 4OZIE 1UWGL 1JYWA 2K7PA 1CD1A 1D3CA 1G9MC 1DBKH 1I85C 3MV8A 5CIPA 5JOPD 32C2B 5EO0A 1J0IA 4OLUL 2DMBA 2EC9T 4BSVA 4M1CD 3Q6FA 5B3JE 2E5EA 2XACC 3CUPA 2X9YA 3MRNA 4MAYA 3VCLA 1I9RL 2YN3A 4KJPD 5JR1L 4H88H 3P4NB 1B88A 3SDYL 1TZGL 4LSVH 1UM6L 3GSOA 4LOUD 1BWWA 3JBG7 4JFPB 5CJQL 2OL3A 4HUMB 5D6DA 3ILQC 3BJLA 4Z7UB 2HP4A 2DQJL 4HG4K 1QRND 2D9QB 3X13B 3FAXA 5L8LB 4PTTB 3QDME 2H2SD 5FYLE 1I4FA 5EZOH 3GDBA 4P3DA 1I1YB 2AJSH 2JJTA 5KVDL 5E2WL 2NY7H 3FQRB 2X89D 4XPBL 5JORA 1RVFH 4OZHB 3ARFA 3U46A 5GS0C 4ZPVA 3T4AA 4YHIB 3OB0K 5ESVA 3ROLB 1XGUB 4UNVA 2P7TA 4QWWD 4G8GB 1ITBB 3DUSA 3TPKA 4WFHE 4G6JL 1XF3B 3GUTA 1IKNA 1KN4H 2IPUG 3QUXD 3X3FH 4FQLL 1EJOH 2AXGA 2NY4C 4KTDL 2ZPKL 2ID5A 1SYSB 2H41A 4L3CA 3VFRA 3UXFA 3EZ8A 3G6JF 4NQCA 4LU5L 4D3CL 1QO3B 4WTZA 4MJIB 3V0AC 2BXYA 3DSFL 2UUDK 3ARWA 1UZ6F 1WZKA 1VENA 1RUPL 2VC2L 5HHOE 3TH2T 4OF3A 2YPVH 1OARH 1FAIL 2BHZA 1OAZH 5C0AB 4FA8A 1EEZA 1GOFA 3QFJE 4H25B 3PDOA 3MRJB 2OZ4H 3QXAA 1G9NC 5E2UH 4Y88A 4JDZA 3RVWC 5FECA 1FYHB 4LDEB 5HYIA 2CJUL 2DN7A 1W72L 2F58H 2GTWB 4OGYH 3U2SB 1D5MB 5I66B 4QXUL 1PG7X 1BFVH 1C5DB 4JPIA 5E08H 3QPQD 3MCG1 3BRGC 4M6ML 3FT3B 3Q5TA 2HKFH 1RZJH 1HI6A 4O02H 1KTLB 3FQTB 4NQED 1NC4D 2AQ3A 4JZJB 5D1ZD 2P44B 3O3DA 5JQ6H 1X5LA 2W9LA 1GGUA 1G7HB 2DQUH 3N50A 4X99B 2F53E 4KGJA 4P5TB 1KB5B 1CGXA 2OJZH 4JY5H 2P45B 1YEKH 1T20B 4OLWH 4NNXA 3QXVA 5JXED 1AGBB 2D7PA 4X9FA 4ERSL 3TIEB 3SEPA 1NQBA 4GRWB 1WBYB 3O8XB 4LLQB 5DD0H 5EIIB 4IRSB 1R3IH 3S3JA 2OP4H 5DGQA 4X98B 1U8KB 5BV7C 2KZWA 4RDQF 5ITBH 4K3EL 2UZYB 5SX4H 3LZFH 1T1YB 2DQHH 2YPLB 4PPTA 3HC4L 2EO9A 2ZCKH 3RZCB 1JNHB 4JO3H 1A7NH 2X4QA 4D94A 3VFGL 3P3YA 4QTHA 3U0WH 5DJXA 3PP3H 1BZ7B 2CLRB 4DGVH 1DBMH 3WFBH 2XFXA 4WV1A 2B0SH 1JGUH 2IQ9H 4CNIA 5FDYA 1QTYT 1TJHH 4TNVF 5CP3A 2CO7B 3D3VE 2Y6SD 4JRYB 2FHCA 3LS4L 3MRLB 3QQNA 5DWUH 1X3DA 2DIBA 2DMCA 4JPWL 5D72H 5DI8B 3GKWH 1A7PL 3KYNB 5J6HA 1AQDA 4HBCL 2NW3A 5KSBF 2X4NA 3WSQL 3V5KA 4ESKA 5CD5C 4ZG1A 1XGRB 4P4KC 1NCBH 2VWEE 2I07A 3B5TA 5A16B 1BGXH 2AK4B 3LKOB 1LMKA 5DD5L 1TVDA 1VACB 5EZIL 5IFAL 1KPRB 4GAGL 2Z4QA 4EDXA 5C08A 1GHFH 1KJVB 4OV5A 1JWUA 3MRRA 4MJ2A 5GGSB 3UJTH 2JLLA 1JYNA 3TN0D 5HHXH 4QF1B 1OP5K 5IR1A 3GIVA 1ZS8A 3O9WC 1H9VA 1H3PL 4XCCL 4X4XA 1J1OL 4QHUB 2R56H 2BVQB 2C5DC 4ODHL 2FX8H 3ULVL 2GK0A 3FZUC 1QVOA 3PQYE 1FNGB 3RVVD 1AIFB 3ZDYE 3V6OE 4KVNH 4Y5XC 3B2UD 3DGCR 1QLEH 1GC1H 2IPTH 1VFAB 1ZA6B 4ZPTB 1FLRL 1CFQA 1S7UA 4MA3A 4OZFB 1I7UA 5I8OH 3MRPB 4H1LH 3EOAB 3MLRH 2F54B 2GK2A 4JB9H 1QNZH 5FM8A 2E7LA 2VUYA 1S9WA 4NKQB 2K9UA 5HYEA 4PJDA 1FZJB 1J1XH 4YZFE 4LDLB 4HIJB 2YKLH 3KWWB 1HHKB 1C7SA 3KR3L 1A3RL 1CFTA 4OD3H 4O2EA 1YUHB 5DRZB 3T65A 3BD4A 2XWBB 3E6HB 2EE3A 2X10A 2X4RB 2A6JA 3C9NB 4IS6B 5IESH 5BS0B 2BJML 3JWDL 4IRJC 3VA2C 5EO9A 3VI4E 1G7IB 4NBYB 3D2UB 3IDJA 4PJ7B 5L9DH 4GLRI 4OV6F 2V9QA 4NM4L 1MI5A 1OTTC 3HNSL 2UWEA 2NX5A 4LCIL 4JZNB 1MWAH 1J05B 2EDJA 1XH3A 1FIGH 1XF1A 5GRXG 5KSAC 3GMRA 3LIZH 4U1HA 3V5DB 1NCCL 1PX4A 2FBJH 2EKSB 3HE7C 3K74B 3KPSD 4OZHF 4NZRH 3VXNB 1A4KA 4LL9A 3CAFA 3OAZK 3DIFA 1JF1B 1S5IH 2ORBL 4LSUL 1S5HA 5ACMA 3L9RA 1BFOA 4LIQE 1NBVL 1B2WH 1CZ8L 5TF0A 3WXVH 1MCWW 4N1HB 2H9GA 1HYRC 4YHYC 4IEFB 1XZ0A 1A1OA 1AGEA 3FRUB 4LCYA 3ZKMD 4LPXA 2MKLC 3QUYC 2C4FU 1XGTA 3IS0X 4X7TA 2E6JA 2PW1B 3I75A 2VXUH 2B39A 3EDFA 2L0DA 2QHRL 3QH3A 3GO1H 4BH8B 1DBKL 5CWSA 1T4KA 2X4PB 5D96B 3WLBB 4NC0B 1ZT7B 5ITFA 1OM3L 3HNVH 4FFYH 2C1PA 3UYRL 1U93B 3ES6B 1FCGA 5C09A 3E2HC 1J0YA 4FFVC 1WWCA 1GGIH 4LSVL 1HEZB 4MS8C 2FJFB 1GOGA 1I3RA 4JANA 4XP1L 4EQ3A 1PSKH 1EHLH 2O61A 3G9AB 2WAHA 1I3GH 3QQ4B 4NIKB 4BK4A 5DA4A 2FIKB 4DZ8B 4LEOA 3I9GH 2BRRH 3RL2A 1OB1A 3WMSA 1PY4A 3C6SA 4YHNB 4HUVB 1JWMA 1NMAL 5EZOL 5GSVA 2X4UA 1NUFA 2ZWLT 2XTJD 4HUUB 3L3HB 1XF4A 3DV4A 2NZ9C 4Z8FL 4ZYKB 5B4MD 5JIIA 1GGTA 1EAJA 4M7ZC 4F7TA 1UZ8B 3JWOH 1BQLH 3U9PH 4URTB 5IM7A 3FQXA 3TZVB 5E0QA 1KN4L 4QRUA 3X3FL 4M43L 4GRWF 2IAMA 5F96H 3RX5A 4APQC 1D7FA 1U92A 1AHWA 5KTEL 3I3DA 3JV4B 1WTLA 2NY4B 5HHVL 4CVXB 3REVA 2P5EB 3C8KB 2YRPA 5TPWL 1CD8A 3BQUA 5IBLD 4G80A 5T33H 5SX5H 3BN3B 3P0GB 1XCQB 4JDTH 5CHNA 5CGMA 2VWEC 2EXYD 3LEXB 3QG6B 2EICA 3VDCA 1A7RH 1S78C 4EVNA 4PLKD 1N8ZA 4FZ8H 3BEVA 3UTSD 3B5HA 3BYTA 2EXWD 1F90L 2F58L 5D1XB 5D7KD 3RKPA 4HXBL 1G7QA 4WI8A 5J9PA 4PRPD 2EO1A 1RUMH 1RUKH 4MDIA 3TO4B 3EHBC 3VDAA 2NTSP 2YC1A 3N9GL 4XXDA 2HKFL 3VFNB 1ORSB 3MLVH 3ARUA 1RZJL 3VXMD 4JO1H 5MENE 2AGJL 4L8CA 1TVHB 5E2JA 1TQBB 2MSPA 1FO0A 3S4SA 3UTTD 5JHDA 4J8RA 3MQIA 2YA2A 2K1MA 3C60D 2ZJSH 4U1JA 1U8OA 4PG9B 3V6OC 2CLZB 2OJZL 1KEMH 3GSXA 5FO7B 4JFXB 1A7OH 3MGTA 1HE7A 1K4DB 1WVZA 5LQBL 1S8DA 4NN6C 1DN2A 1OGAA 4U1LB 1NFDA 1EO7A 1MRFL 4AEIH 2EIZB 1JV5B 4G7YH 4N0UB 3FQUA 4NQVA 3T04D 1OAXL 3RVXD 4MXVE 5DD0L 3P9WB 2Q6WA 5TDOB 5T3XE 3WUZA 5JW5A 1IAKB 3IAPA 5JTWA 3S3SA 4XPTH 1CGSH 25C8L 4OSUH 4GUPA 3L3OA 2W91A 2DQHL 5FF6B 1UXWB 2GW5A 5BV7B 1BX2A 3IF1A 1BHGA 1NCDH 1A8JH 2R0KH 3MO1A 4OCYH 4UDUA 1QYGL 1X9QA 1A7NL 1IC1A 4NO0A 5HYSA 1YJDH 1KFAH 2I24N 4PJ9C 4EUPB 4HH9B 3U0WL 4LVEA 4YHPB 2DI9A 2ITCB 5BZDA 5EU6E 3RP1A 2ADJA 3AREB 1PX3A 4Q9QH 3IYLW 5JOEA 1TVBB 5C07E 4I3SL 3BHBB 1X5AA 2VXTH 4Z95L 5GGRY 1JYXA 2IQ9L 3ZE1E 2JCCE 2PTUA 3L5HA 5ENWB 1XGYL 3DYMA 4R4FH 1YY9C 5C0EA 4LCCA 4P2QB 2I5YL 2QQLH 3GKWL 4Z5RB 4KJWC 3QIWC 4XCEB 2GT9B 4CDHA 1YY8A 4ODBD 4Y2DC 5DHXB 2UV3A 2DQCH 5DJDA 5ID1A 1NAKH 2NY1D 1NCBL 3OKOA 4HSQA 3QUMA 4N9OB 4L8BA 3X17A 4NQDD 5LVEA 4GW5A 3U4AA 4P4KB 2ZUSA 4MJ4A 4PJ7F 4E41E 4JAMB 4XNYL 3I3EA 3WDJA 5M7QA 2QKIA 4XVJH 5I18L 3WFEH 4QRRA 5KAQF 4OCWL 1DBJH 1IC4H 2CRZA 5HHXL 3W5MA 1Q1JH 3SE4A 1SYVB 1T04A 3CFCL 3OJVC 5MHSE 4GG6B 1FGVL 1G7MA 3L7FA 4KV5E 4U6YB 3BP4B 5F7DA 3STBA 3KJ6L 5C2BH 3P4MB 1RK1B 4PRBA 1EGJA 4PJIB 2CSPA 4OZGE 4Z7VA 1CT8A 4PRNB 1B0WA 1JL8A 2VLJA 4XWOC 3GJFK 3I6LD 2V2XA 4I3RH 3NFPB 4F7PA 4ZO6A 2M26A 3ARDC 2QSCL 5I8OL 2YD1A 3IJHA 1MY5A 3TNMB 2WV3A 3ULVD 4FTVE 1YYLL 2A1WL 3MODL 4F2MB 4ZMAT 1OAKH 1NCAH 1MFDH 2LU7A 5HDOA 2L4OA 1J1XL 1I85A 1JN6A 4HWEH 4MD5A 1C1EH 1FFRA 3BMWA 4OD3L 1ZE3C 4YWGL 4CMMB 3N1QC 4X5WA 4R97C 1FNLA 1M6OA 3FB6B 4CL7A 2A83A 3NN8A 1JPTH 1BBDH 1GXEA 4YHMH 4YEFA 4YDJB 1BZ9B 4WDIA 2KL6A 2OXGA 4IRJB 2JF1A 1UH2A 1F4AA 3LRSA 5JDSB 4ZOCA 3D87B 1IT9H 5C0IB 2CIKB 1FN4B 3QDGE 1DVFA 1RJYB 2FR4A 2ADIB 2ICWA 1FIGL 1T3FA 5C0BE 3RUGE 3LIZL 1SQ2N 4NZRL 3NPSC 4LSQH 3L3GB 4K7PH 2W0LA 5KSAB 2CDEA 4UV4H 3GJEA 4NM8H 1NCNA 2FSEA 2W60A 1QHPA 3HE7B 5AG8A 3FO2A 1KJMA 5F9DC 1YEDB 5IV2A 3QEQD 5CIPH 4UQ2A 1MIMH 1KJ2L 3LB6C 1CG9B 2QL1A 3ROOA 2Q87A 2AJXH 3UJJH 2X09A 1KCKA 1MRDH 3STZB 4YHYB 2IPKA 1G6VK 2Z93A 3PWVB 1KEGH 2IG2H 3QUYB 3K4AA 1TDQA 1U3HC 5DO2C 2ATPB 2OL3H 3QSKB 5IB5B 4KKNA 3HTLX 1HH9A 1T7XA 3LOWA 1VKXA 3EO9H 2DD8L 1N64H 1OF2A 3RWEA 1MOEA 1Q38A 3ELAT 3BZFB 4R9HA 3HI1A 5DURB 3QDHA 1Z5LA 4I2XA 5CGYD 1XF5A 5D5MB 2ENYA 3E2HB 4LVHB 5IKCA 5SX5K 3RTQB 4MD4B 5DSCA 4AEEA 3FN0L 5DVLA 5AG9A 3IDNA 4JFYB 4Y19B 3VMPA 1VERA 3UCRA 5LAXB 1AGFB 1K8IB 3ZT7A 4PR5B 2DYPA 1IAOB 5DHYB 2OTWA 3HN3A 1E6JL 1K5NB 5CP7A 2IPUK 4PBWD 1LEKA 1BQLL 2CK0H 3KLAB 4M02A 4RAVA 4FRWA 1Q9LA 4ISVA 4ODTL 4PJEB 4XBEL 1NGZB 3IDIB 4HJGA 4GQ9H 5E4EC 5D2LE 4H0HB 5E6IC 1TZIB 5DF0A 2B4CC 1OP9A 4Z7QF 1IARB 3MX0A 4TNWF 2FEEL 2HA1A 2CQVA 4G9FA 3K1DA 4KQ4L 4LVNC 1KCUH 1I1FA 5T33L 1HILA 2ED8A 4JDTL 2NY5C 3GSWA 3CXHJ 3JSSA 1WUNT 3HE6A 3SE9H 1KLFA 1A7RL 1M71B 1V5JA 4I5BB 2OTUA 3QCTL 4IOFD 4OZFG 4Y4HA 2G9HB 3O41A 1I1CA 3ALPA 4P59H 4ORGB 1HQRA 1V3LA 4ETYA 5EC2A 4YHOH 3U7WL 4JG1H 1FVCA 2WM0A 5IB4A 3JV6B 3HB3C 4PLJD 4UIKH 5IMMB 4CRPA 4NP4L 5I8KH 4F80A 4LGSB 1KIRB 2RGSA 2VL5B 3HUJA 5TQ2L 1U8QB 2IJ0C 4JFZH 1I7TB 3S35L 3HAEH 5E2TH 4XNUL 4EI6B 4Y1AB 1EFXA 3TT3H 5KS9B 4QRSA 1FLTX 1KEML 4N0FA 2XPGA 1A7OL 1F6AB 2BY1A 5LGHH 1LO4H 2CMRH 2G60H 3JZ7A 2GJ6D 3RU8H 3QDJB 3WCYA 4N1EA 1CFSA 4AEIL 3L7EA 1A6VL 2PYEE 5DD1H 4N8VB 2V7HB 2OR9H 2FO4A 4OZIA 2EKJA 3RWJB 5K9KB 1GSMA 1NGPH 4CU7A 3EOTH 4XPTL 3E8UH 1CGSL 5A3ID 1MFBH 3O9WA 1V7ML 4Y4KA 3DV6B 4Z18A 5T3ZH 3KYMB 1RU9H 1U2HA 2AV1B 3HI6H 4N0CC 2H8PA 1NCDL 4L8DB 3PGCB 1M7XA 1MHPL 4OCYL 2VAAA 2YUXA 5CP3H 3GSVA 3TBWA 1AO7A 4PJIF 4FABL 4MXWL 4Y5XA 4J3WA 1R24A 4PP1D 4AYFA 3P40A 3LN4A 3WL9A 5CEYB 1BVKA 1IC7L 1YDPA 4KU1A 3ZSSA 4IM8A 3HMXA 3QDMA 4MD0B 3IB4A 3DUUA 2NNAB 3MRIA 2NR6D 4P4RB 4JRXE 1PKOA 4M1CC 2BY0A 2ZOLA 3ARZA 1SMAA 2CO6B 4FQCH 4F8QA 5J6GA 1P9MC 5HY9B 2OJEA 1NMCC 4LRNL 1E6OL 2Q8AH 1HWHB 5I15L 5KVGL 3QI9A 5F6HI 1IGML 3H3PH 1BZQK 3QIWB 1GL4B 1KTDB 4QY8A 4Y2DB 4NQSB 5JZ7C 1AXSA 4PREB 1RFDH 2ICEA 1BLNB 1U8MA 5F72S 4HUWA 3THMH 5ECJE 2HYMA 1CGYA 3F5WA 4WUUB 1FPTH 2MOVA 2A74A 4NZJA 1IC4L 3N1FC 3MNVA 5F1OB 4GG8A 5HHOA 4MA7H 2XG5A 3P4LA 4P2OA 1LP9B 1IC5L 3G5YB 4N68A 3KLHC 4H8WL 5C0DB 3QFJA 1T83C 2H32B 4BELD 1IGJA 4XNQB 3MRCB 2FJHB 3QUXC 1WIUA 5DEFB 1ODAA 1UCBH 1F3JA 2R1XB 5F93C 1T1XB 3NFSH 3OKMA 5GS1C 2FHFA 1S9XA 2BZDA 4I8DA 4LLWA 3L3JB 4WU5A 5FGSA 2X1QA 1CK0L 3SDDD 1TITA 1MCOL 1SY6L 2A6KB 5AEAA 1FZOB 2C4XA 3LSOB 4K2UH 3H9SE 2VDLH 4NBXB 5IHUL 2P4AB 4IOIB 4OKVA 1RIVL 1LILA 5F89B 3ARDB 1MFDL 2GI7A 4YDLC 1RZGA 4KH2A 3QIUC 2AXJA 2VH5L 1SJHA 2F53A 2WK2A 3BDXA 5GISL 4BQ6A 1DSFH 1C1EL 4JN2A 3MLWH 5KJRL 3PF2A 1AGCB 4NHCH 4WTXA 5DQJA 3S5LG 5CBAA 5HDBE 1FL3B 3QPQC 1AGDA 1EHXA 2AEQH 5E7BA 5GGQH 4XHQA 5D5MF 1PAMA 4YHML 3NFNA 4GKNA 2Q1EA 4HV8A 2ED7A 1FQ9C 1MRCH 3OKLB 5IMKA 3RBGA 2R9HD 2GSGA 2VR4A 4M1GL 1YN6B 4NCC2 5I1GL 4X6DE 4AM0A 2EDWA 4UUJB 2XXCB 5I8EB 1NEZB 3U7YL 3DBXA 5C9KA 5BRZE 3L5WA 4JE4B 1INEH 5IMLB 4BSWB 1FL5A 2X41A 1QEWA 1VFUA 3LKNB 4DQOH 1NFIB 1A1NB 2XN9D 2KBGA 2H3NA 4UV4L 2QSVA 3AVEA 1T21A 4AJ0A 3MREA 3NPSB 4XPFH 4PJEF 3BRDA 1G0XA 4APQA 4R4BB 1CQYA 3D3VA 4RGND 4U6TA 1MFNA 1ED3A 4LP5A 5SWZE 3HNTH 4DK6A 5LKNA 4OZ4B 2AJXL 5IQ9A 4NNYA 1MRDL 2QSTA 1EHNA 4ZOBA 4P9ML 4ZSOB 3RDTA 3L1OL 2IG2L 5EA0H 1KEGL 4MNQE 3SBWA 3RWDA 1JUFA 1II4E 5J4MA 4EUPG 1ETZB 2YD2A 1CE1L 4EI5D 1A6TB 2GTZA 3RL1B 3CDGB 3EOBB 3MJ9A 4Y5VA 5K9JH 1U3HB 3EO9L 2HG5B 1N64L 4PJ5B 2E9IA 2PO6A 2BNQE 2I9TA 4PRHB 1P6FA 3WFZA 1KB5H 4UT7H 5LG1A 3CFEB 4Q0XH 4G6FB 5T1LB 1H3VA 2Y6SC 1KLGB 1R5IB 4QRPB 4W4NA 3FFDA 4R26L 3HPJA 4GRWH 1WBZB 3O4LE 1X7QA 4J6RH 5IVXE 1P4LB 3J7HA 8CGTA 3VRJB 3OF6A 2DLFH 3LHPH 4QXTB 2VTFA 1Z0MA 4PY8I 2PF6A 5JW4M 1T5WB 5D8JH 3PQYA 2YRZA 4CVZB 5DQ9A 5KS9F 3VU2A 4LPUA 5E8OB 4XP5L 1KPUB 2XZZA 1HYSD 2P8PA 3M1BA 4AT6B 3DURB 1ZVHA 4M6NL 2FL5B 5BVJA 1OT1A 5FUCE 3GSUA 3VG0H 2AW2A 3TN0C 1RZKC 4P3CH 3KPRB 4X4ZA 4LSPH 5DZLA 3VD9A 4EBQL 4LASH 5DUPH 5C07B 5D70L 4TULH 4GBXC 3T3MF 3UPCA 4IMLB 5FB8B 3CJJA 5E4EB 1I8MB 5E6IB 5H94A 2CGRL 1QOKA 5CD3A 4L4TD 2Z8VC 3HG1E 4PJ9A 3BKCL 4FQ2H 2ATKA 1QA9A 4PB9L 2YSSA 1N4XH 4LVNB 4JKLA 1N0LA 2WWKT 1S9VA 4I18B 4PJGE 1KIQB 3KPTA 5HHQA 4YX2H 4XNZC 5C0CB 5LBSL 4TNVK 5ABDE 4YR6B 3OG6B 1AKJB 1LO2L 2BC4A 1QBLH 3D39D 1IL1A 2EH8H 3ME0A 4YGVB 3VI4F 4P59L 2VDOL 4QOKE 3IDGB 3SE8H 1B90A 3WJLA 2C3VB 1JZ6A 3PV7A 4UIKL 1LEIB 1M7IA 5I8KL 1HXMA 5D1QA 1AXTL 5FYJH 1LK3H 2Q7YB 2NY6C 3EYVB 3E6FA 5FDWB 1I9EA 3P4OA 3GSQA 4QGTA 3TT3L 3U4BL 3FCTB 1T1ZA 4BZYA 4R0LC 4LLDA 3C09C 5LGHL 3GMOA 2G60L 5HI3D 4PD4K 4ZQKB 2C1OA 1QSFB 5DD1L 1WSST 4K8RH 2W92A 4PG2C 5T1KB 2V2WA 3VXUE 3DVGB 3PHOA 1R3JA 4JPKL 4CU8A 4J3UA 5GZOC 3IDYC 3EOTL 2JK5B 2R29H 3G5XB 5EOQL 1JBJA 2ZNXA 3UTZA 4V2BA 2IBZY 4ZS6D 2MPAH 3P77A 5T3ZL 5KW9H 1J87A 1RU9L 3PP4H 4U1NA 2BVOA 3MCKB 4WW2A 2AERT 4ODUA 4O2FA 5DQDH 2X9XA 1IKFH 4OQ1A 3UTQB 1A4JA 1Q72L 1XF2B 4OM0H 3WUWB 1T5XB 5DGRA 5IEKA 2VERN 3RX7A 1YMME 3IXAB 1RHHB 5EZJA 2BSRB 3BO8A 3QIBD 3RWHA 1MJJA 3LPWA 2HT3C 1MEXH 3CLEH 4WNQB 4WO4D 1AR1D 4FQCL 5ISZA 4UI2A 1I1AC 1QLRA 3ZYJA 2JIXD 3O2DA 1N3NB 3DX6B 3OQ3B 1D5XB 3BZ4A 2B8OT 1E27B 5F9WC 2F8XC 2EZ0D 2GUOB 2D9CA 4OFPA 4S10A 4LFHD 4FQHA 5I1CH 4V2CB 5JW3H 1FPTL 3O3EB 5E70A 4R3SB 3O3BB 1QRNB 2DWDB 1EGJH 3OXRB 4LHUD 1V3MA 5DXWA 3OHXA 3IETB 3AU1A 5B4MC 1RZIB 2ZP0T 4M7JH 3MUZ1 1BQUA 4PJHE 5CJ8A 3GMNA 3TJEH 2N4IA 2Y4SA 4EDWL 3SGEI 4PJCE 1JHKL 3GK8H 5MERB 3IU3A 4KUCF 1CTOA 4UAOC 1UCBL 4OFYD 1GAFH 3NFSL 5DA0B 3TC9A 3BDYH 5E5MB 3V8OA 1NFKA 2VLKE 3AY4A 1G9MH 1HHHB 3QUZD 2IQAA 3QUXB 2ICCA 3WNLA 5IQ7L 1T89A 4MCZB 1L7IH 1H3XA 3QULA 2BSSB 4JFFE 5C6WH 1T1WB 5E9DE 4IDJH 5HBBA 2AJ3A 5MENA 3VW3H 2VDLL 4LCUB 2QR0B 3M07A 1KIPB 2MCG1 1A1MB 5EBLB 4HHAA 3BDBA 1MAMH 2EXYC 3SDCD 5D2NE 3O2WL 5C92A 4FQQA 1FYTE 4NT6B 4WFFD 4XWGH 4E0RA 1H15B 2A73B 3EYOB 1KULA 1ZOXA 4UU9B 4EEEA 5TH2B 1UACL 5IJKC 2BVPB 5FUCC 4EN3C 3KLDA 5GGQL 5JIHA 1FG2A 4DEPB 1UB6B 2LAGB 3GB7A 3JV5A 1XR9B 1OGTA 3HR5B 3T0BA 1R3HA 4HKJA 4JN1L 4OGXL 5JIKA 1AJ7H 5E94B 5GS0H 4LPWA 4OIIL 4G42B 4MXVF 5DT1H 3CDCA 1NC4B 2QQNH 3C60C 2EDRA 5LCVH 2PTTB 4LDOB 5MEPB 5AAWA 3P73A 1UJ3C 2HH0H 1J8HE 2MTPA 4UNTA 3L3DB 1HSBA 5FO8A 5IB1B 3BPOC 4LBEA 5FGCE 4K3DH 4JHBA 5EU6A 4OLZH 5JW4Q 1IEBB 1JF5A 3DX9B 1G0DA 4TSBH 2J6EA 3MUGB 4D2NA 3RVXC 3CD4A 1OAQH 4XPFL 4N8VG 3RHWF 1Y0LB 2QLVB 2JCCA 5FCUH 3MRBA 1YEEH 5DFWH 5JHLH 1G9NH 4KROD 5DJ6A 3VFWB 3GSNA 4C83B 1YEGH 4DZBA 3BKYH 4BH7B 4QHMB 5EC1B 5BXFB 2BOCB 1BQHB 3T1FA 1KLUA 4OIAA 4JHAL 1FJ1A 1GGYA 4F33A 3KPNA 3MLTA 2FX7H 1CBVL 1U36A 3MLYH 2OR7A 3NCFB 3MBED 4KMTH 4GFTB 3VFPA 3NIDF 5DTFB 3DROA 1WQVT 4WEMB 4MAYD 1G7JA 3ZDZE 4E41A 3JVGA 2OK0L 1PY9A 1BAFH 4V1DD 5CKAA 4Q0XL 1I8LA 4HC1H 3QR2A 1MJ7H 3MOQA 1Q0YH 5CJ5A 4LLMB 3BI9X 2A6IA 5DVKA 5JUEH 4DGYL 3PE9A 4HJJH 3QRGL 3OJDA 3IKKA 2HJKA 2FNBA 3QHFH 3K7UA 1LDPH 4U6XA 5KBNC 1MAJA 5BV7H 4OZGA 5CINH 3DVNB 3ARFD 3STLA 4MJ5B 3MRDB 3NIFF 1F4YH 3JWNC 1F2XK 2KQNA 1PFCA 4YXKH 5J1AB 3VG0L 15C8L 5JO5A 2DKUA 3I2CH 1WFNA 2P24B 4FTVA 4LASL 3R0MA 1SM3H 4ZODA 3ZKSD 4OAWA 4TULL 3TN0B 3PGDB 3DETC 3R8QA 1CVSC 2VLRE 5I16A 2OSLA 4JJ5B 1ZGLB 1SBSL 4GBXB 3MMEB 4ODSH 3F7VA 3OJ2C 4A2MA 4LLVA 1JI2A 1URLA 2VKWA 4X6BB 2OMBA 1Q9OB 3KPLB 4FQ2L 2ZSVB 4GKSA 5DLMH 2C9AA 4WUKH 1MCQA 3VJ6B 3NZ8A 5DK3A 1FO0L 3IFPA 4YX2L 4X6FB 1DN0A 2EE6A 2MMXA 2X1WL 1AP2A 3FO0H 3U1SH 3FQNA 5I9QC 1MHEB 3FO9A 1JZ2A 4XVUC 3ECBB 1S7SB 1UKQA 3OPZL 5B3NA 3QDGA 4F15C 4JCLA 3X14A 3MRGB 1ZWIA 5C0BA 4QCIA 4XC3H 1C5CH 3RUGA 3OJMB 1QR4A 2G2RB 1P9MA 5FYJL 1DL7H 1SEBA 3DXAB 1N5AA 3MLZL 4LRIC 1CFNA 4NKIL 1NGYA 2Y06L 4OTXL 2CIIB 5C86A 4MDJA 1J18A 4M8QA 4HCRA 5KSVA 4ELME 2HRPH 2YUZA 3Q6GL 2J7LA 2WWKO 4NKDA 2BSTB 3C5JB 4HFWA 4PY7A 5GGTH 1ERNA 4CMHC 1CR9H 2CKBB 1AGBA 2FX9H 2H26B 4QT5B 4HG4J 3JWDC 3UZQA 3SJVE 1T6VN 4MJ6A 1T7ZA 2IADB 4U1IB 2AQ2A 3G6DH 5JW4R 1T83A 1TXKA 4N0RA 4WW1A 1NDMA 3V4UL 1INQA 3BUYB 4R90L 2VDRH 1DLHB 2BVYA 3CPLA 2FH8A 1NC2A 1N7ML 1R5VB 3T0VA 3HMXH 5BW7C 4RGMC 4QRQA 4LCWE 5GS1A 1WC7A 2ZCLH 2YUWA 3EFFB 1W2KT 3GSRB 3IDMA 4BJLA 5EU4A 4IHOA 1ZHKB 5F9JB 2B2XH 1F00I 4NDMB 2VZUA 1WBXA 2XKUA 3LQAL 5T3ZD 4GW1B 3L3KB 4JFDE 3QUML 2C7UB 5CILH 5IGXH 4PV8A 4KPHL 3QIUA 3T4YA 4HDIA 4PJ8A 4NYLB 4XAKE 4FQJH 4JFEE 3I6KB 1E4XH 1KF9B 4BKLB 2VN7A 3CFDB 1E4KA 4S1QH 1FP5A 5D9SA 2Y25A 4UOW1 1I1AB 3L6FB 5CGYC 1IAMA 4XMLL 5H35B 1MCJA 4U1MB 5EBWA 5M94B 4RAUA 2PW2B 1BBJB 5D2LA 5J0BA 3ZLQC 2HVJA 2FBOJ 5GZND 12E8H 5FO9B 5F9WB 5HGBB 2CR3A 4L5FH 1KPRA 5JW3L 4D9LH 2Z9TA 4TRPH 3MYJA 3KGRA 1PG7H 4YBLC 3S96B 5LGJB 2AVGA 4JDVB 1EGJL 4DN4H 2Y36H 1QRKA 2UY6A 3R1GH 1KT2A 4XPAH 2XTJB 4R4ND 1HDMA 2XNAB 4C54A 4I48A 4D9QD 3L3IB 1NJ9A 6FABL 3CSBA 3EKCA 5ADOH 5D7SH 3BDYL 1K2DB 5D6CB 1G9ML 3BT2H 3SE3C 1QR1A 4UAOB 4PLOB 3ULSA 1L7IL 5L2KD 2W9DH 1JI1A 5D7LE 3V52L 1ZA6A 2HMIC 2AV7B 5GSRB 4JY4B 4O51B 4G8FB 4ZFZB 3BH9B 3NTCH 4IRZL 2GJZA 3EAKA 4G6AD 4XBPA 3BKJL 5IMOB 2F54A 1A9BB 1VCAA 2CRYA 5DMKA 3SQBA 2I26N 2BNRE 2AJZB 3ESVF 1OWRM 3KNBB 3MNWB 4Q9BA 4KVCL 3PIQA 1VADA 4IOFC 2IANE 3TBYA 5HJ3A 5IB3A 1U42A 1U8JA 5BJTA 1CIUA 1REIA 4ZOEA 1DQLL 2V7NB 1IGTA 1YA5A 5F7FA 4AH2B 2PYEA 3O4OC 1UGNA 5AZ2H 5BS0A 2FD6H 4FG6D 2VLLB 3GBLA 4PRPB 2Y5TA 4UDTA 1S7TB 3WEXB 1AJ7L 1NLBL 4MNHA 3KYKL 1IM9A 2C3GA 3VXMB 3MUHL 4ENEC 1MI5D 1CQKA 1FH5H 3P0VH 4O9HH 1JNLL 4H26B 4UILH 3BIAX 4NRZA 5AZEL 1W72B 2HH0L 5HYQA 3O2VH 1UEYA 3HRPA 4GMTH 2DQFA 4G8GD 3C60B 5T5FL 3OR6A 4K3DL 3D0LA 4OLZL 5F9OL 1UJ3B 5ACZB 1OAUH 2EDOA 3BPOB 1OAQL 4NUGL 4JGMA 2D31A 4N9GA 3VXTA 1LK2B 3ZE2E 3A6BH 4MJID 1YEEL 4ZAKC 2EDTA 1A21A 4TNWK 5HD8D 5DJZB 5INDA 3RNQA 3MJ9H 3GRWA 4QHLA 3WNNA 5C6TL 5JHLL 4JRXA 3MPCA 1FZKB 1HQ4B 1YEJL 5FOJA 1FCCA 2BNUB 4KTEH 3D25A 5IW6B 1JNJA 4R2GD 3BAEH 1WZ1H 4KI5E 3DGGB 4N0YL 1JTOA 5T5NG 4PP1C 4HQQL 4RQQB 4JZOA 1FNFA 1TETH 3WUWG 3K8LA 3OKEA 1KACB 1IILE 1BD2E 5DYOB 1X5JA 5C09D 4OLVL 4X0KB 2VXVH 4HAFA 1CD9B 1KBGH 3IS1X 3ZSTA 3VXQA 1HEZA 4NO5A 5E1AB 4NZTL 4WU7A 4HIIB 5EU7E 2QADC 4ZS7H 4DKDC 5F88A 3S8WA 3QHFL 1YMHA 4CVWA 2XRAH 5EWIH 3VFVB 1P7QA 4FN0A 5AYUL 1JNNH 4OBRA 1UXSB 1L7TL 2NY1B 5ALBH 3V5HA 2F19L 3VD5A 2AJUH 4R0LA 3MA7A 3O8XD 1P4BH 4NQDB 5E5UB 1XR8B 3H9SA 4YNYA 1BF2A 1RMFL 1TFHA 1I3VA 1SM3L 4WI7A 4XVSH 4Z0XA 1JHLL 5HI5C 5FUZL 3HRZB 1FVEA 2YPLD 4OFKA 5IVOA 5FKAA 3KHQA 2FECL 4NRXB 2E8ZA 3PABB 4UTAH 4PRDA 4HUNB 4U3XA 4PJBB 4ODSL 3BQUD 2V5RA 2MNUA 4NN7B 4Z7WE 3V6FB 3MLUH 3H7BB 2Q7NA 4Z6AT 4P46C 5HDBF 4DFHA 2QTEA 3LQZB 3CFBA 4X6DA 3FO0L 3U1SL 3S5LA 4JRYD 3QXWA 4LIQH 4OIBA 3HZMB 3S35X 1NBZB 5BRZA 3BKMH 3U7AA 3BWUC 3TEUA 3SDAA 5HVHC 3WIFB 4DOHE 1YN7B 3ZDXE 1Q9KB 4JFQA 4U1KB 3CFKA 4WRLA 1C5CL 3MRMB 2FZ3A 4QXGL 1RI8A 4F15B 3KAAA 2ZKHL 2OLDA 1E4WH 9CGTA 2H32H 1EAPB 4JLRB 4U1GC 3WFDL 1EXUA 3QZWG 3K2UH 3QJHA 2P5WD 5DRXB 3WIIL 3OKNB 1CDCA 3AUVA 1YQVL 1VGKA 4MXQC 5SWZA 2VLKB 1TCRA 3U79A 1ES0A 4XZUB 1HINH 1OGAD 4L8SC 5FYJD 2FX9L 4I77L 3WE6A 3GZKA 5DJ2B 1N6UA 3SKOA 3VFSB 4MNQA 4WY7H 1MLCB 1ND0A 4YK4C 1T2QH 4JR9H 4ZD3H 4I9WE 4KY1L 3MRHA 4PRAA 2VDRL 1JTTA 2BNQA 1U3JA 4JO2H 5I0DA 1H5BC 2HTKC 4HZLA 1CLOL 5FYLL 3CH8A 3SDXE 4U49A 1DZBA 4NO0D 4HGWB 3MFGB 2J8UB 5ALCL 1P1ZB 3ZYOA 4H5SA 4LLUA 1MCPL 3GHBL 1CF8H 3QEQB 2BHYA 4RGMB 1F8TH 4NPYB 2KKQA 1UJTA 2VQUA 1BQHG 1D6EB 1ZXQA 3O4LA 1F6LL 5IVXA 1HXYB 2NLJB 1C12A 3BHBA 3T0EE 3WD5H 1WCBB 1F4WL 1NKOA 4PUBL 2IBZX 3D69A 3VFMA 2AABH 1IGYA 2HFEB 3MFFA 1V3JA 2GCYA 4FQJL 1S7XA 5DJ8B 4CW1B 4YO0B 2H6PA 4HWZB 2XG4A 1JZ8A 4GS7B 1YYMH 4EN3A 1UCTA 4C56E 3SGJC 2YWYA 4M7KH 4PGCB 3D2UD 3BZEB 3EYUL 1PYWB 4L3EE 1I9JH 2XWJB 3RAJL 1OL0A 1YNTB 3GMMA 3LEVL 3EO0A 3I02B 3GBML 3QFDB 4DN4L 3GMLB 3ARXA 2Y36L 3EGSB 3UBXI 5JDJA 3DMMC 4ONFH 4KKBC 4YBLB 4XPAL 5DZNA 3RIFF 3HG1A 4BFEA 1KENL 1LD9B 5F1IB 4HKBB 3UZEA 1L4IA 5HPMB 5GGUB 5HHNB 4PJGA 1XFPA 4GRLA 1P69B 1JFQH 3REWB 4OB5H 5ADOL 1KCVL 3BP4A 3MRKA 1RULL 1JZ3A 5EUOE 3GI8H 1EH9A 2NW2A 1MPAH 5L2JB 1QSZA 2VLJD 5CSGA 4W6XB 1Z3GH 4OCRH 4QOKA 1Q9WA 3BH8B 1WEJH 1RV6X 2AXFA 5EU7C 1T03L 4ODWA 1N59B 3WN5C 4HKXA 1R5WA 2P47B 5A2LH 4XH2B 2R23A 1KYOJ 3O0RH 3MNZA 5T3XH 2AJYH 1YZZA 2Q86B 4F7CA 4BZ1H 1P2CB 2Q20A 1B0GA 5JA8B 2VJXA 5GS3A 4X7SL 4KZEL 1ZHNB 4D8PB 5GJSL 4MQXC 3BP6B 3TPUA 2ZUXA 1OAYH 4U6HB 4HKZA 3PWJB 1YECH 4LKCB 1WFTA 3L95A 5EUKB 3VXUA 3VFUA 2P8MA 5J11C 5HGAA 4XVTH 2IALB 4ZTOL 5JIPA 1LNUA 3ILQD 4PGBB 3SOBH 3DX7A 3PG2A 4FXLA 2E27L 1E28A 2J6EH 2MJWA 3F7RA 1D5ZA 2ZCHH 3GMPB 3MV8E 1DVFD 4UILL 2B4CH 3ZHLA 2FIRT 3RGVC 3O2VL 3PHQB 1CL7I 2R1WA 5DZOA 3P9MA 5GS0D 1NMBH 1DLFH 4XNMA 1OAUL 1YMMA 3PWPE 5FYKU 1OW0A 2A6DB 2GJ6B 3LDBC 2NY4D 1IZKA 2WMPA 2NY5H 5DFVD 5SWSE 3B2VH 4J3XA 3WS6C 3HLAA 1QUNA 3VRLF 1NAMA 2P8LB 5ICYA 2WUBL 3MOAL 4ONHB 3DRQA 3QB7C 1G9EA 4ZAKB 3H2WA 3STZA 3QXDB 2DM3A 4EOWL 2LE9A 4S1RH 4KJYA 5IVZB 1RUQH 1WZ1L 2VIRA 1CVRA 1NCUA 1OTUC 3KYOB 4BQ9A 3F58H 2DWEA 5B39B 3UDWC 2N7BA 1HSAB 3CX5J 4XCYB 5GGRA 1AD0A 3K80A 5C3LD 2N1KA 4OJFL 3T2PA 1U91B 2YD7A 5DS8A 1T6WA 3B9DA 4NQCE 3ULVF 1LWRA 2EDLA 4J3VA 1MCEA 5I74B 4UOW0 4PJHA 1U3ZA 2VZSA 2ADGB 3V7AE 4HWNA 4ZS7L 3SKJH 4PJCA 1GGBH 4MWFA 4X6CB 5EWIL 1JZ7A 2BCKA 5MP6L 4PJHF 3UEZA 4KKLC 5A1AA 1GPOH 2DYPD 1PZ5B 4OF0A 35C8L 1JPST 4JFFA 3S34H 4GOSA 4LCWB 4K9EL 4YEEA 5E9DA 3LEYH 3VGFA 3LQMA 5I71C 4HX1B 1JGEA 2F8VA 1DDHB 3T0EC 2LQRA 1QSEA 4XVSL 5EORL 2COQA 3QHZH 1NGWA 1ZA3B 3MOBH 4CN1A 5E8EB 8FABB 2FWOA 3U0TB 5FUOH 2YWZA 3I50H 5D2NA 4UTAL 5GJTH 4AIZB 1QACA 2V6HA 4G9FD 4F7EB 3CXHK 4JY6B 2HFTA 2V17H 1MFCL 1JE6A 1DQMH 1DE4B 2F74A 4NJ9L 1C5BH 4H8WC 1F11B 3W0WA 3QNZA 3ARRA 4M7LL 3IXTB 3CFIC 1ZT4A 1EZVY 4JFOB 3KJ4C 2E9JA 4GKZA 3RNKB 4E5XA 3BRFA 4YFLI 5GGVH 3SDDB 2B5IC 1R0AL 4U6VL 2ZSWB 1OCWL 4LNVA 1JZ4A 3C2AH 1VFBA 2LABA 4WGVB 3HKFA 1J8HA 3SPVA 3VGBA 5JMOC 3NVQA 1MLBB 1R3KA 3QEUA 1LO3H 4JKMA 3RIAF 4A6YA 5BVPH 5DK0A 3I3BA 5CD5D 1RJLB 1ZLUH 2X4OA 5IWLC 4H1LB 3HC0A 4ODXB 4ZUTA 1EFXD 4WWKA 1KNOB 4U1GB 3C5ZC 1F6AA 1MCSA 1RIHH 5B38G 1HINL 4ODVL 5TGBB 2HN7B 3A67L 2VL4A 3PHSA 4N8VA 5T1DH 1QFWI 3KXFA 5IB2A 3FT2B 2DTMH 3OKKB 4WY7L 3WKNA 1XIWA 1G6RA 4U0RC 5F71A 4HPOL 3EJZC 4JR9L 3CMOH 3O9WD 4Y4KD 3L5JA 3VXOA 4NSKB 4OLYH 1UWXK 4NUJB 5I17B 5ICZB 5B8CC 4F9PA 2UY7A 3PWUA 4JO2L 3KYMA 2XN9B 5F3HB 1MUJB 5HGHA 3HPLB 4KROC 3ZDZF 1H5BB 3BGAA 3WJJC 2WSKA 3U0PA 1MWAB 2EYTA 5C08E 4MQ7B 4RGNB 4DKAA 3VWJA 1KCRH 3R06B 5FEBA 3O2DL 4RAHA 4YIQB 4NN5C 2W0PA 2W9EL 3JTSA 4RCAA 1MNUL 4X5XA 2QQKH 3WD5L 3QDMD 4P23A 2EEBA 4MD0A 3C5SA 4TVPE 5E99H 4GLRH 4AENA 1D9KA 3HMWL 4PYGA 3KPMB 2WIIA 2QSQA 1CICA 5AAMA 4CADA 1KJ2B 5C9JA 3HZVA 5H2BB 3QG7L 4DGIL 4YDIH 4PV9A 3QI9D 1YYML 1BVLA 1FFPA 2LVEA 3PV6A 4G8EB 1HH6A 2VZVA 1FV1B 5DJ0B 4DTGL 5FOBB 3T2NH 3OSKA 5JLZA 2E7BA 2UZIH 3CU1A 2VLRA 3QEGH 1OTTD 1BWMA 1PW3A 4FHBD 3RPKA 3HC3L 2Z31A 2JJTC 3QXUA 4AIOA 3R8BB 5HHOD 4P2OD 4BUHA 3AM8C 1QZ1A 2XA8H 5KSAD 3ARFC 1LP9A 2MCPH 1DQQB 1SJEA 3QFJD 5JMRA 1HOCB 4Y4FA 1I7ZB 4UINH 5I1EH 3DMMB 3HE7D 2FH6A 4OB5L 4HT1L 5CSZB 1IKNC 1DUYA 3VGGA 3GI8L 5C0GA 2RJMA 3NGBC 2AK1H 2UZXB 2X4TB 4KK5C 1MPAL 1HHGB 5HYFA 2ZG3A 3DPBA 1MH5B 3S37H 3LN9A 1D5BA 4NKMB 3FONB 2Y72A 5JOFB 4NKOA 2W59A 2NX5E 2OQJA 1N0XH 4L29A 1S9YB 2GAZA 5BMFH 3FB8B 3O0RL 5BZWA 2AJYL 4M48H 1HIMH 3WN5B 4BZ1L 2D4DA 4N90E 2F53D 4L4TB 4M1DL 3TA3C 5DD6A 3U6RB 3TH4T 4ELMA 4XRCA 3UPRB 2V2TA 1UQSA 2B1AL 1B4JH 4G8IA 2Z35B 4U7MA 3TNNA 1PJ9A 4B41A 1YECL 4FFVD 4BK5A 4PJAB 4UTBH 3D39B 1LE9A 3SJVA 4AEFA 5D7IE 3H0TB 3MBXL 4OT1H 4Z76B 5FK9B 4YQXH 3DO7B 5BOZG 2G5BA 5J11B 2NYYC 5GRZA 3VG9B 2APFA 1EUTA 1RZKH 4MSWB 1BM3L 4X6CF 4KC3B 2I60H 3LMJL 5I1HH 4ZUVB 2J8HA 4GO6B 2NZ9D 1QSVA 5IBUB 3GSNL 1TENA 2OX5A 1NGQH 2OMNA 3HS0A 1A9EB 1CXIA 4NCDA 4PIRF 5AD0A 3T8XA 2BOBA 4QRTA 3UBXG 3MCLH 3RWFA 3KPPA 4JFDA 3RZWA 1VB9A 3I6GA 4NCC1 4APQD 1YEIH 3T0XA 1U2CA 3D3VD 4XC1L 1GZQB 3LDBB 3QRFM 1J11A 2HKHH 5TDNB 2X44D 4HMDA 4JFEA 5KVEL 3CC5A 4WFEE 1UB5B 3TBTB 3EUUA 3RDTD 4DFIA 3IVKB 2O5XL 4KHXL 3O45A 4D0BA 1UVQB 3F7YB 4YXLH 4QKXB 1ETZA 1QBAA 4P46A 3MSPA 2YOCA 3OXSB 3EOBA 3UROR 1T22A 2VISA 2PO6D 4Z0BL 4O58L 5EO1A 2R2HB 1DJSA 4D0DB 4O2CA 2K3TA 4AL8L 2R0LH 5E8DL 3QIBB 3N1MC 3AS3A 1U8PB 1QFPA 2ZG2A 4HK0B 2EC8A 4GAJL 3GMQA 2YHGA 1PLGH 3VXRE 3TVMC 4EJ1C 4P5KA 1H8NA 4R8WL 4YC2C 4WO4B 3NACH 5INCB 1K4CA 2Z8SA 3RQ3A 1E4JA 2Q76B 1JP5A 4NZUL 3BEWB 43C9A 2JIXB 5CEXB 1FE8L 5HVWA 1A6AB 1U8LB 3CVHA 3PQYD 1PQZB 1MVUB 3CSYB 3PWLA 4YDVA 3FOMB 5D7LA 4IMKA 1PG7W 4B5EA 7FABH 1L9MA 4KWUA 1GGCL 1UENA 5E2VH 3VA6A 4TUOB 1JIBA 3QP3A 3RFZC 3B8YA 5AUMB 4HIEA 5I71B 3VFTB 4YPJA 1CDGA 4LHUB 4R4NC 4ZFGH 4NNPH 2BNRA 4XAWL 2SEBB 3H9ZA 5HYJA 2JJUA 1I8MA 3AROA 1JHTA 1O5DT 1HHIA 2IANA 4AG4H 2V17L 3K3QA 2A9ML 3MXVH 1P7KB 2XZCH 4PJ9D 1AQKL 3IU4L 1M7DA 1UM4L 3QUZB 4HEPG 3V4PL 5BOPA 5FCSH 1XGPA 5ILTL 4EKXA 5C1MB 3OBAA 3WFHB 1U58B 3OB8A 4FQXA 4AMKH 3MGOA 4XI5C 4YPGA 4LKXB 3BXNA 2E7LC 1MQKL 1UWGH 4FMFA 1JWSB 3KJ4B 4XCFL 1FNSL 3W9DB 3C2AL 4OLUH 4K3JL 4HCRL 5DJYB 2B5IB 3IDGA 5E8NA 3CFJB 3SDCB 1IEAA 4Z7OF 3SKNB 3ARBA 1I9RH 5IHZB 1LO3L 3PNWB 1KN2H 5JR1H 3CH1B 3SDYH 5BVPL 1TZGH 4NGHL 2GSIA 3O6LL 2IH3B 1UM6H 4PJXB 3FMGL 3MYZA 4P2RB 2W0FA 1KTRL 2DQJH 3ARGA 43CAB 1K85A 1FNAA 1B0RB 3KPQB 2HWZH 3ZE2F 4PGDB 3FQWB 3H9HA 3IFLL 1YNKH 2WINB 3B4NA 3LRGA 4AZ8A 4F3FB 4KDTC 3G5VA 5E2WH 4XPBH 4FXKA 4OLYL 1KG0B 4UB0H 2NXYC 3FFCE 3X12A 4P9HL 4U0RB 2BY3A 4WHTB 4G6JH 5KOMC 4FQLH 2JB6A 4QYOA 3SGDH 5IFJA 2ZPKH 5E4IA 5HD8C 3TBVA 5B8CB 1TZHB 3VFOB 1U95A 4XWOD 2AQ1A 4HLJA 4LU5H 2JTDA 3DSFH 4L1DA 5FGRA 4QRRE 4KROB 4RFNC 4ZFOA 2CR6A 1RUPH 3QNXB 2EYSA 4HIHB 2ZOKB 3BGMB 1X6LA 1FAIH 1FVDB 1TNMA 4DVBA 2WBWB 1FFNB 1ZVSB 3EJYC 3OAYK 4J3TA 1CD1B 3MV8B 4PRIE 1KCSH 3DSNA 4UQ3A 5CIPB 1VESA 5DRWA 5EO0B 5TFSL 3W2DH 1W72H 2FHBA 3MJ8A 4BSVB 3MZTA 1U3YA 4QXUH 3CUPB 3UC0H 1VFOA 4OGZA 3MRNB 3QQ3A 1F6FB 4MAYB 5DUBA 3VCLB 4M6MH 1DQTA 3BE1L 4X7CC 1LQSR 4OD1H 5MEOA 1WK0A 5TQ0L 5E95B 3GSOB 4FQ1H 1P5UA 5F7UA 1SMOA 2OL3B 1LO5A 2UZIL 5DHVA 5ERWA 2RCSH 2CLVA 4Z7WA 5C0FA 1CU4L 1I4FB 2MCPL 3RGVA 1ACZA 4P3DB 5TDPA 4OLEA 4F57L 5JORB 3MLSL 4ERSH 3ARFB 3U46B 2F5AL 4ZPVB 3T4AB 2IAMC 5ESVB 1P4IH 1AXIB 4KMQA 3Q5YA 2P7TB 4MB5A 4WCYH 3DUSB 2R4RH 5I8CA 1AHWC 3GUTB 1IGIL 2AXGB 3LB6D 4KK8C 4WGWB 3S37L 2ZZUT 5K9OA 4DUXA 4I1NB 4L3CB 3VFRB 5MEND 1MCHA 4NQCB 3BQUC 3HC4H 2ESVE 4Q97A 4BQCA 3BP7A 5GRVL 1U3HD 5DO2D 1CXLA 4MZ3A 3UDWA 4RSVA 1EEZB 4Q9RH 4DWHA 4QNPE 3PDOB 3QXAB 5ESAA 5L7XL 1B4JL 5IF0A 5FECB 2AXHA 2WANA 3KVQA 2FATL 1A7QH 1W0WB 4S2SA 3PJSA 1WJ3A 3QZWA 4UTBL 2P42B 4R96A 3IDXL 2VR9A 5T3XD 4JPIB 3MV7E 2DI8A 4FP8H 5F7EL 2QEJA 4YQXL 1HI6B 1OT2A 4NO2A 3MACH 4HBCH 3WSQH 1JGVL 1YC8A 3IFOA 4NQEA 3G04A 4WEBH 3O3DB 1MVFA 4H1LG 5D1ZA 2NTFB 3SDXA 3IKCA 3GRWL 1EEYA 1ZKAA 1CXHA 1NGQL 1S9KC 5EZIH 5IFAH 5EU6D 5CBEA 2ITDA 3HFML 4PLNC 5C07D 4I2XE 1FSKC 3MCLL 4NNXB 4NO3A 3T0EA 2NCMA 5JXEA 4JVUA 3V2AR 4ZTPL 3QCVL 2HT4C 1ADQL 1T0PB 1H3PH 4XCCH 1D5IL 1OD9A 4DUVA 5EU5A 3MV9E 4KMLB 2Y9RT 3QCUL 4YXLL 4C56A 4K7FA 3S3PA 1PD6A 1AKJD 2YK1L 4NQXA 2IF7A 1FLRH 4L3EA 2X4QB 4L9LA 4Q6IA 4QTHB 2X9WA 5DJXB 4K94C 4E41D 1SBBA 2R0LL 3J8F7 2XFXB 4WV1B 3HR6A 3DX8A 4LCCC 5B21A 4RGOH 3SKUD 1S7VA 4Q2ZA 4CNIB 3TYFA 1A14L 4Y5YC 4BFGA 3VXPA 4F9LA 3GI9L 3KR3H 1PLGL 1EVUA 4QGYA 3AFLA 3ALXA 3LQAC 1V7NL 2OR8A 4RMWA 3TYGL 4I0PC 3O81A 5J6HB 4M03A 1AQDB 3CLFL 1Z9OA 4M3JA 2NW3B 4YC2B 2X4NB 3V5KB 5DD3L 2W1NA 4YE4L 3ZKXC 3N1GC 5ESQA 2I07B 1F13A 1ZHLA 4I3GA 5EUOF 3C5ZA 5T1KD 4NM4H 3LN5A 3HNSH 7FABL 4HBQA 4LCIH 2Z4QB 4PYHA 4EDXB 5IW3A 5C08B 4FTVD 4OV5B 1UKTA 3SE4C 1JWUB 3MRRB 5E8PA 4L4VE 3CZFB 4TOYL 4NNPL 2YZ8A 3BW9A 4FZEL 1UH3A 2DM7A 5IR1B 5FM5O 3GIVB 1FL6A 1MY7A 1ZS8B 2ORBH 5B22A 3HUJE 1ZGLA 3QO1A 4XMPL 4X4XB 5CJXC 2E9WA 1CZ8H 1FFOA 1M1SA 2GK0B 3BJ91 1QVOB 2DQGH 3KDMA 3BSZL 3PDGA 3GNML 4AMKL 3B9VA 4A6YH 5GRUH 3E3QC 1CFQB 5F7HA 3FHQA 1S7UB 2QHRH 4MA3B 1I7UB 4X6EA 5DUML 3OMZA 4WJ5A 3QDGD 3DI2B 1OM3H 5I1IL 2R0WL 3ZE0F 1S9WB 4AY0A 3UYRH 4IIQC 5C0BD 4PJDB 4XMKH 3V0WL 4GSDL 1T0MA 2FYYA 1KN2L 3OKDA 4XP1H 1CFTB 1AO7E 4O2EB 3PWPA 3ZZ1A 3T65B 4TPRL 1EZVX 2RR3A 1G6RH 2XQBH 2A6JB 3IJSA 4OCNC 5JZ7D 3NCMA 5SWSA 1H0DA 4NQTA 5IG7A 5EO9B 2HWZL 2XYCA 1NGXA 4DCQB 5J3HD 4CVUA 3IDJB 1YNKL 1DVFC 1NMAH 4Z7NE 1IM3A 1XGQA 2X1PA 1MI5B 4RNRA 4Z8FH 3H3KA 4HH8A 3AM8A 2UWEB 2NX5B 5GGSY 2HJFA 3KLHD 4KHTH 5IBUG 3FO1A 4ZUSA 4RWYH 2BVUA 1XH3B 1QP1A 4UB0L 3GMRB 5KVFL 4U1HB 3EYQD 3O3AA 3KPSA 1A4KB 4E42A 4M43H 1JRHI 3FRPA 3SY0A 3DIFB 1S5HB 5I73B 4L9DA 3L9RB 1ZVYA 5DFVC 1BFOB 4O4YH 3HA0A 2WP3O 2RQ8A 5KTEH 4I0CC 2H9GB 2ENSA 1OP3K 5HHVH 3TGXA 3HZYA 1XZ0B 1A1OB 2BHUA 2DJSA 5IT2L 4LCYB 5JNYA 5TPWH 4C4KT 4OUUB 3V0VA 2GJJA 4MNGE 1JMZA 1ROWA 1XGTB 3MR9A 4HGKC 4X7TB 3T77A 2M2DA 3I75B 3ZYIA 4R2GB 3QIUD 5KOVC 3FAWA 3QH3B 4CJ1A 2PKDA 4BQ8A 3TA3A 5CWSB 1T4KB 1KCSL 3W2DL 4LPYA 5ITFB 1F90H 2X40A 5H37H 2C1PB 2KZ1B 4HXBH 1HNFA 3UC0L 2YBRA 4G43A 5C09B 4FS0A 4GAYA 3N9GH 4OD1L 3HCVA 1I3RB 4JANB 2DMKA 2I9LA 3EOYG 1CI5A 5DMIH 1C16A 1Y6NR 2AGJH 4XXCA 4FQ1L 2O61B 1T2XA 4I4WB 1JJUA 1UC6A 4LEOB 2YA0A 3RL2B 1OB1B 2RCSL 3S96A 3C6SB 2OM5A 1JWMB 1MHHA 1NDGA 3NCBB 2VDPL 2ARJA 5DDHA 5GSVB 2X4UB 2R2EA 1XF4B 3D9AL 3DV4B 3ZO0A 5LQBH 4YXHL 2B1HL 3K46A 1YPZE 1MRFH 1J5OL 4LFHG 3GM8A 1P4IL 1BOGA 1OAXH 4PS4H 4Q6YA 5FA3A 1MCNA 4WCYL 5IM7B 2R4RL 3FQXB 5ANME 4QRUB 4UT6H 2IAMB 3KYAA 4LHUG 25C8H 3UYPA 3LPGA 1A2YA 1AHWB 1DCLA 2DB8A 4U3CA 4JY4A 1G7PA 2PETA 5GS2D 4ZXBA 1QYGH 4B7LA 3SO3C 3REVB 2VXSH 3BQUB 3HE6C 1WWAX 2GFBA 4B7IA 2BSED 4G80B 2YS4A 3R4DA 5E6YA 5CHNB 4Q9RL 2IFFL 3KNBA 4Y4HC 4I3SH 3U36A 4Z95H 2J5LC 2O5ZL 4WWID 1N8ZB 2HFGL 3BEVB 1A7QL 2JJSA 3UTSA 2PYED 1XGYH 5ELIA 3GGWA 5IROA 1G7QB 2F5BL 4DJMA 2K7QA 5J56B 5J9PB 4FP8L 4MDIB 3U48A 2I5YH 3D0VA 2YC1B 4XXDB 3B9KC 3TVMA 5B38A 3MACL 3P2TA 4L8CB 4BZ2L 3OGCA 3S4SB 2OBGA 5I2IA 4WEBL 5JHDB 3UTTA 1UG9A 4J8RB 5CJOL 1J0JA 2P5WB 1NAML 3HZKA 4U1JB 1U8OB 4XNYH 5DEZA 3GSXB 5DJCA 1A6WL 3MGTB 5I18H 1GRWA 2PR4L 4OCWH 5CZXD 1AD9B 5IJVA 1S8DB 5KN5A 4JO4L 1OGAB 1NFDB 2XZAL 2D7MA 3CFCH 1CE6A 1FSKB 3FQUB 4HUKB 4NQVB 2BK8A 4Y4KC 2Q6WB 4GBXD 1FGVH 4JRXD 5CEZL 5J1SC 2ICWJ 1AH1A 4HGMA 1GZPA 1MF2L 4U7SA 1TTUA 3A6CL 4G5ZL 3KJ6H 4S1SL 3VXSE 2R2BA 4GUPB 3TBSA 3L3OB 1A6ZA 5EBMA 1LEGA 5TE7L 1BX2B 4KK9D 3PWNA 3IF1B 3MO1B 4UDUB 1ZT1A 4NO0B 5HYSB 1OVZA 5KSUA 5CMAA 4U05A 2QSCH 5EU3A 5F8RC 5BZDB 2ADJB 3RWCA 1YYLH 2A1WH 3FT4A 3MODH 3ZT6A 1MFEL 4RGOL 3UX9B 2IBBA 1HKLL 1F45A 4MX7A 3DXAD 3G5ZA 3RIAK 3D18A 4PJDF 4PGEA 5C0EB 2Y23A 2Y5EA 4YWGH 2VAJA 2ICES 3QI9C 4XCNA 5ICXA 3WNMA 3VH8G 1P7QD 2NY6D 1YY8B 1DFBL 1L0YA 1H3TA 2EIDA 2YEZB 2APBA 5DJDB 1MCKA 5ID1B 1Q94A 3OKOB 3QUMB 4L8BB 4HMCA 5E00A 3ORJA 5FKPA 4GW5B 3H9SD 3QEHB 3B3IA 5EPMA 4KDTA 4P2OC 3WHXA 2QKIB 4CGTA 4BFIA 4QRRB 5LXGH 3NA9L 5GZOD 1EA9C 2X1OA 3JXAA 2UWEF 5I75C 4HWUA 1I7RA 1T04B 2J4WL 2WWMC 4LNRA 1G7MB 3L7FB 4B53A 1ORQA 2V9RA 5F7DB 3TP4A 2DQGL 1KJ2H 4K23L 4JKPL 4PRBB 4Z7VB 1CT8B 3QDAA 5D7IA 2VLJB 5L6YH 4LSTL 2V2XB 4A6YL 5GRUL 4OM1H 4F7PB 4AEHH 4OCXL 5IOPA 3IJHB 5BRZD 2IGFL 1FORL 4UT9H 5HGDA 3Q5OA 1X5IA 3SDAD 3G6JE 2HT3D 2PNDA 5CKGA 2C3XA 4NOFA 4OCSH 4Z78A 4XMKL 2DD8H 1UZ6E 2JB5L 1I1AD 4HWBL 3U9UA 1JN6B 1CLYL 4MD5B 4F7MA 1CGVA 2EYRA 2DQDH 1N6QL 1G6RL 1UM5L 4X5WB 1M6OB 2XQBL 1BEYL 4YHLH 5T1MA 2A83B 3NN8B 4JM2A 3T0DA 5GRJL 5DC4B 3LV3A 5SWZD 3RA7L 1RJZA 1F3DH 3FN0H 1U6AH 2P43B 1HCFX 4WDIB 4ZFFA 4M5ZH 3UBXA 4PGZA 3NH7L 3LRSB 1CGUA 3H8NA 4MQTB 5ISZE 1DVFB 1OWWA 3V79C 4KHTL 2FR4B 4RWYL 2VDMH 1E6JH 2ICWB 3IFNL 1T3FB 2VO5A 5HTSA 2VQ1B 2BNQD 4ODTH 1RQ5A 4XBEH 4GT7A 2CDEB 3AGVA 3GJEB 2E3VA 2FSEB 2W60B 4O4YL 5C0RH 1KCLA 1K8DA 3FO2B 1KJMB 5IV2B 1TNNA 4RDQG 4J23A 2R0ZH 4UQ2B 4D9RE 3HAEG 1BP3B 3RDTC 4MB4A 3O4LD 3VXRA 3ROOB 3QJFA 4KQ4H 1BJMA 3MXWH 4HS8L 1CGWA 3SBWC 2IPKB 2Z93B