4JPKH

Crystal structure of the germline-targeting hiv-1 gp120 engineered outer domain eod-gt6 in complex with a putative vrc01 germline precursor fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGKNSDYNWDFQHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative VRC01 germline precursor Fab heavy chain
publication title Rational HIV immunogen design to target specific germline B cell receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpkH01
3H0TA 4DEPC 1VFOA 1BQHB 3DO7A 1GZPA 3MRQB 3HUJB 4X6FA 3U30C 3OF6D 1P7QB 4PJXB 3S35X 4FXLA 2NY0D 4S2SB 4LSPL 5AG8A 4MAYC 4FQXD 3W11D 1CFTB 1TTUA 4WEBL 3PHQB 3ZKND 1QBAA 4HJJL 5DHXB 2J5LC 4OZIF 4P4KA 5C08D 1T03L 3UBXA 1RUQL 4NKIL 1XF3A 2ENYA 3NIDF 4WHTA 4KKCD 5F3BA 1BEYH 1KPRB 3RY6C 3IRPX 2KKQA 4IRZH 3U9UA 5HHQB 2O5ZL 4P3WA 2D0FA 3QIWD 2RFXA 4P2QE 1E4WH 3DMMA 5IWLA 4XWGL 4XRCA 4WHDA 5CEXB 1XGRA 1C7SA 1L7IH 4JO4L 1TZGL 5IHZA 3EZ8A 3LN4B 4P2RB 2ID5A 4PJFE 4QHKJ 4DK3A 4WO4B 4BELD 4F37K 2O61B 3SDDD 3MROB 3LEXB 4EIGB 4B41A 2UZIH 1NGWA 2XKNB 2L7UA 4XNYH 5EULV 2FH6A 3AXLA 5HPOA 4XC3L 3O45A 2BJML 4CKVX 2EYRA 5I1CH 3GKWH 1DN2A 4Q6IC 3HRZA 5SWSB 1OP5H 2WWMD 5FHBL 1W72A 4Y5XB 1L4IA 1SJEA 1IAOA 4CRPA 4MD5B 1CN4A 4FG6D 4UILL 1DP0A 4X98B 1KJ3L 4P4KC 3A67L 5CEYB 4MD4A 4M7KL 1WCBB 4Y16B 1YC7A 4NQDE 4L8SB 2VLMD 4GW4B 3TGXA 3O41A 3HPJB 4I4WA 4GJTB 3ZTNH 5DD3L 3CC5A 1EJOL 4FZ8L 2VE6A 2UUDH 4Z7VB 1O7SA 5IWLC 1YPZB 2JB5L 2ZZUT 2F54E 4FRWA 4PRHB 3WNPA 4D0DB 1CT8B 5EWIL 3RIFF 4QHKI 4P0DA 4YQXL 4E9LA 4M1GH 4YHKL 5D5MA 1BM3L 3MRPA 2PW1A 2VH5H 4YHNA 2XNAB 4A2MA 1FGNH 4NP4H 3JV0A 5CZVL 3WHE0 1N0XH 3GSQA 4YXHH 2GJZB 3U79A 4L29A 5IBLD 1KPVA 4NNYB 4TUOA 1KN2H 1MFCL 3ULVH 5MEQB 2GT9A 5IB3A 4MAUH 4OZGA 4JFYA 2R23B 4HK0A 1BBJB 5FYLD 1J8HA 1IKFL 3FQRA 1T3FA 4H1LB 3ARGB 5E2VL 3W0WA 3MZGB 4KTDL 4BSWB 5EUOF 2NY6D 2VB5A 3L3IB 3DETC 2PTTA 1BLNA 4OIIL 2FEDC 4ZS6C 2UWEF 4FABH 3SBWA 3KPSB 3QUYB 3SKJH 5TDNB 1T20A 4ALAL 3FT3B 1OP9A 5EZJB 4JFDD 2ERJC 1SJXA 2CK0H 1EX0A 3RNKA 1UB5B 4ZOEA 1WJ3A 3VJ6B 4AG4H 4F57L 1FDLH 3JV4A 3C60A 2AK4D 3VXPA 3CDYA 5E7BA 5AYUL 1OQOA 3V9FA 3BFOA 1CG9B 3BP5B 12E8H 4QTIH 2ZJSH 5TF0A 5ESQA 5IFJA 3RZCC 2Z93B 3L9RB 3QUMB 3FO2B 5GRUL 4P2OA 1VHPA 3WIIL 3KHOA 1LO5B 4U3HA 5IVZA 2YD3A 1RZ7L 3Q5YA 4UB0L 4BFIB 4GG6A 3QUKB 1FVCB 15C8H 1A7OH 2R9HD 2F74B 1J88A 5HVHC 1UZ6E 1YJDL 2OXGA 3ESUF 4NO2A 5IROA 3D48R 5C0DA 4XMPH 2DMCA 1OGTA 4G6AC 4MYWB 4Q74A 5DO2C 2E7CA 3RVUC 2FX8L 3VU2A 3O9WB 5DJZB 2NXYB 4NRZA 3BI9X 5DWUL 3KR3L 3NIFE 5MENA 3VI3E 2X1XR 1Z0NA 4N0UA 4N5ED 3SBWC 4JRWA 3OSKA 4G80B 3UJTH 1C5BL 2DQUL 1K3ZA 5ADPH 1D3CA 4NYLB 3STZA 4NKDB 4HBCL 4JO1L 4Q6YA 5ALBH 4RISL 5HBBA 4UU9A 4TSBL 2PYED 4EKXA 1VGKA 3KS0H 3EO9H 1WZ1H 3X3FL 5DMGD 1HXMB 2AABL 3VXNA 5IFAL 1S8DB 1I1AB 1Q9LB 1MFEH 2LV4A 3E0GA 4HFWA 4E42B 2HFTA 4UOJA 1Q94B 2WBJA 4XAKE 1PQZA 2MHAA 2WAHA 5C0CD 3SDCD 1F6AB 4Z7OE 3MRBB 1P6FA 2VQTA 1XGYH 4LHJB 5GHWH 1VEMA 4FZEL 4D9LH 4P49A 4HHAB 4KROC 3RHWF 5C92A 3F12B 4JFFB 4JQIL 1MCFA 5E8NA 3IU4H 3O3AB 5C0JB 1UM4H 3BO8A 5D7JD 3HPLB 3QUML 2HRPL 4FQLH 3DTXB 3BRDA 3H0TB 4F7MA 3IT8D 4LP4A 3FB7A 3DO7B 1GZPB 5E08L 4X6FB 1QVOA 3RDTA 3SGKC 3WSQH 3MX0A 4P48A 2EDWA 2F8OA 5F88A 5HY9A 4JY5L 2A6DA 1T1WB 3HAEG 3UTZA 4Q97A 4LOUD 3MRGA 3PP4L 3CLFL 3HC4H 1URLA 3HRPA 1X6LA 3UBXB 1XF3B 5TGBB 1KJ2L 1GCFA 4WHTB 5F3BB 3W82A 1J0ZA 2OR8A 3RBGA 5AAWA 2AJSL 3K4ZA 5D7LA 4OF6A 2Y36L 4XI5C 3CZJA 3U9UB 8CGTA 1NL0H 2HFEA 3E3QE 3HTLX 5GGSY 1QHPA 2RFXB 1NLBL 1LDPH 2YOCA 3DMMB 1QFUL 4R0LB 4XRCB 1XGRB 2WBJC 1ZHLA 5DZLA 4ZPVA 2NX5A 4OM1H 1CE6A 1U0QA 5E4EC 1ZSDB 3MBXH 4I9WD 5FHAH 4LRIA 3HR5A 4KY1H 1R5IA 2BDNL 4NCC1 1R5WA 1ZLWK 4BZYA 1J7VR 4PGCA 5D1ZD 1KTDB 1KC5L 4NN5C 5GRZA 4WI4A 4R4ND 4AYFA 3AXLB 4KKNA 3MRMA 5CEZH 1DQJA 3O45B 2EYRB 4OF0A 1JF6A 3O2DA 4ZUVB 1A0QH 3HRZB 3ZHKA 4NQTA 3QI9A 3ARUA 3P40A 1RUPH 3QDAA 1W72B 1YNKH 3T4AA 2Y07L 2B8OT 1SJEB 2Q7YA 3OTTA 1IAOB 3C6SA 2OM5A 4NN7B 5F9WC 3IFPA 3ARFA 4M8VA 2EH8L 4HMDA 4IRZL 2CJUH 1GC1H 3VD3A 3O41B 4I4WB 5DZOA 4AIOA 1AI1L 4LIQE 3CC5B 5C0IA 2VE6B 5DJ6A 4FQQA 4PJFF 4HH9B 2ZOLB 4X7TA 4CVZA 5ECJE 3QQ4A 2Q3ZA 5D5MB 3ORJA 3MRPB 2H45A 2PW1B 4YHNB 3IFLH 4JVWA 3BESR 4IRSA 2B5IB 2UZIL 3GSQB 4GW1A 2B2XH 5DHVH 1KPVB 1S9XA 4TVPE 4TUOB 4XNYL 4LARH 1GC1C 4UAOC 2YPLE 5H2BA 1OVZA 1ADQH 4DKDC 5T3ZE 2GT9B 3CFDA 1HSAA 4OZGB 4Y5VA 4JFYB 3GKWL 4WFGE 2XOTA 4CNIA 4HK0B 4UT9H 1J8HB 4LCWA 1BGXL 2JB6A 3FQRB 3G6JB 4V2CB 1T3FB 2BNQD 4KMQA 3W0WB 4P2CG 2EDTA 1B0GA 2PTTB 1QBLH 1BLNB 1D9KC 5DQ9A 3K80A 3PV6A 1OT1A 1T20B 1LMKA 3WEXB 1TITA 1B4RA 3L1OH 4XPTH 3ZTNL 4D9QE 4MA7H 3FQXA 2B1HL 3JV4B 3C60B 3VWKA 3VXPB 5H37H 4AEHH 4EVNA 1W72L 4MQ7B 4M1GL 3C5ZC 3KPPA 2DWDA 4HLJA 4JLRA 5IFJB 4UV7H 3TIEB 1T21A 1FGNL 1VKXA 4XBPA 4KMLB 4P2OB 2KUTA 1R3KA 5J1AA 5IVZB 4IRSC 2GK2A 3I6LE 1CLYL 3JTTB 4RX4D 3IGAA 3K1KC 1KN2L 4Y5YA 1AGDA 3MJ6A 1V3LA 4GG6B 4XCFH 3OX8A 4LVNC 2Q87A 4MAUL 2CDFA 3OJVC 3KNBA 1IGJB 3GUTA 1OLLA 3ARQA 3RWDB 1PKOA 4NO2B 5JOFA 1IKNA 3FB8A 5IEKA 3DO3A 1OGTB 4I1NB 5HYQB 5I16A 3FRUB 3VXMD 3MA9H 5CZXD 4L3EE 4TSAH 4NRZB 4NZUH 4G9FE 2WLZA 5MENB 1FO0H 1R3LA 4LCYA 4N0UB 1JCKA 3NFNA 2AJ3A 2CK0L 2YRLA 4CVUA 2AI0L 3CU1A 3STZB 3T0DA 4TPRH 4OF7A 4XPHH 4P57A 3VWKC 3WS3B 4ERSL 1VGKB 1KB9J 4YBQD 1EXUA 12E8L 3ULVD 2ZJSL 1T4KA 5AZ2H 3VXNB 1RZGA 4ODVH 3QEGH 4GBXA 4HFWB 1CTOA 2MHAB 2XZZA 4KVNH 5EU3B 1XF5A 1FAIL 15C8L 1A7OL 4Z8FL 3LEYH 1U93A 4HZLA 3WMSA 4BSJA 3VMOA 3K74B 3RL2A 1T7ZA 2O5YH 3QPXL 3BEVA 4XMPL 2VERN 1IKNC 3SGJC 1JL8A 5E8NB 1EEQA 1E6JL 3HE7A 3BO8B 6CGTA 5KS9E 3B9VA 2YXFA 4PJCE 4F7MB 3QIBB 3FB7B 1CLOH 4G6AD 1QVOB 2EDRA 5FB8A 3RDTB 2AEQH 3C8DA 1RHHA 3DX6B 2VTFA 2WQRA 3UJTL 5HGAA 5F88B 5HY9B 3KPRD 5BQ7A 4Y4HD 1WWCA 3MRGB 3HB3C 5ALBL 3QUZD 4XXCA 4TNWK 2DJUA 3EO9L 1WZ1L 1VESA 2X4TA 2OMNA 3LH2H 2ATKA 4BQ8A 1DBBL 1TJIL 4HDIA 3U0WH 2C3HA 5D7LB 5J56B 2HFEB 5KSUA 1EHNA 4LLYA 3U7WH 4LKCA 4Z7OF 5A43C 2R2CA 4K3EH 3PP3H 1NEUA 4FTVE 3DECA 1F5WA 1ZHLB 4XB7A 4LRNH 3PL6D 1I3VA 1WGOA 3Q0HA 4ZPVB 3RJDA 1RK1A 3VI4E 2NX5B 2V5MA 7FABL 1XGYL 1J05A 1U8KA 1FVDA 3HR5B 3H9ZA 4P59L 4PJ8A 1U8PA 4MJIE 2LVEA 3D85A 1R5WB 4PGCB 1EAJA 1UM4L 1XCQA 4XP5H 4FQLL 2N7BA 2VDOL 3PNWB 4MQTB 5DFWH 3TLRA 5K9JH 3MRMB 1DQJB 1QUNA 1R5VA 5EDXA 1KGCD 5BVJA 3WSQL 4A2LA 4CU6A 4HK3N 3BUTA 4MB4A 2GTZA 1UM6H 3QI9B 4UINH 2JJSA 1DL7L 3T4AB 3BIKA 2Q7YB 5F8RC 3C6SB 1OGAE 3TA3C 1KJMB 3VFNA 1F3DJ 5D1XA 2PETA 5K33A 2ADFH 4L4TE 1DUYA 4M43L 4XXCC 3B9DA 4I3GA 3ARFB 5MERA 3O8XA 5FUCE 4JN2A 1JNHA 1NL0L 2D7NA 1IGCH 1MRDH 2BP3A 3OKNA 5E8OB 5IBTL 3HE6D 4JPIA 5KSBA 5C0IB 3VWJA 4ZS7H 1ES0A 4F15B 5T1LA 4ORGA 5DJ6B 4FQQB 4KPHH 1FG2A 4X7TB 4CVZB 2AS5M 4OM1L 1FYTA 3QQ4B 4DUVA 4QHNA 5I71C 3QNXA 1LP9B 5FHAL 1YEKH 5IQ9A 2R4SH 1JTOA 4ZUWA 2PUQT 2OZ4A 1QO3A 1ZHKA 5I1EL 4U0RB 1KUMA 2HJFA 4GW1B 3MREA 2IBZY 1S9XB 2X4QA 1DQTA 1XAUA 5H2BB 4LVNB 2R29H 2KH2B 5DJYB 5CEZL 4WI9A 3CXHK 3CFDB 1HSAB 2LABA 3LRHA 1CXIA 4Y5VB 2C9AA 3OAZH 2NYYC 5BVPL 3EOBB 4CNIB 4Z7NF 1RUPL 4LCWB 5EO1A 1U92B 2JB6B 3EOAA 4X6EA 3EOTH 5I0DA 1JGLL 5CFHA 2P8PA 4MXWH 3BHBA 1B0GB 5B22A 4U7SA 4MZ2A 3V6OA 1OAZH 2KQNA 2CJUL 1GC1L 1ERNA 3LQZA 1AJ7H 4HGWA 4S1SH 5DYOA 3O8XC 4JFPA 3O3EA 4TNVF 1A9BA 5IP4A 1NBVH 2J1KA 1M7XA 5EBMA 3U6RA 3VFMA 2DL9A 3FQXB 3VWJC 3O2DL 5F9JA 4OLYH 3R1GH 1EV2E 2BCKA 1RURL 4ONGH 1KNOA 4HIXH 4Y7MA 4HLZG 3KPPB 3V5KA 2DWDB 2IAND 1NCNA 4JLRB 4ZTOL 1MFBL 4G6FB 1CICA 4KGJA 1T21B 1VKXB 1CD8A 4XBPB 2EDJA 2MCG1 4Q0XH 4OFYA 1Q72H 5F97E 5J1AB 4HBQA 1A22B 4F7TA 1JRHH 1YYMH 4LARL 4Y5YB 4CMHC 1AGDB 1EGJH 1ADQL 3D9AH 3OX8B 1FJ1A 4LF3A 2BNRD 4G8GE 4XNUH 3VH8G 1IRAY 2XG4A 3KNBB 3K46A 1MCLA 3GUTB 3I50L 4UT9L 3S37X 2PXYC 4K8RD 2EEBA 1YY9C 1ZLSH 5JOFB 1JPTH 1GGIH 3FB8B 4H20H 4HPYL 5I16B 4BH7A 2DQDH 2GUOB 3NACL 1YN7A 4GUPA 4XNQA 4P3DB 4JY6B 4YEEA 1R3LB 1ZVYA 5HI5C 2HG5A 3UJJL 3V6OC 4GRWB 3NFNB 5D7KD 2AJ3B 5E0QA 3L1OL 4XPTL 1L9NA 2VLJD 4MA7L 1WISA 1Z3GH 4MJ5B 4NHCL 2X4RB 3VXSE 1JNNH 3NA9L 2FHFA 4AEHL 4P57B 2ARJA 3N9GL 1FFRA 5HD8D 1EXUB 3PV7A 4J8RA 5HHPA 1MCCA 1T4KB 5E6IA 3UYOD 1VFBA 1CL7I 1CICC 5ABDE 4GBXB 1E4XL 2OTUA 2P8LA 2UY7A 4JRXE 3C5ZD 1PZUB 3BISA 1AY1H 4C56E 5SX4I 5HPMA 4G6MH 3SE4C 1DJSA 4TOYH 1TXKA 1XF5B 4OZIB 5F6IC 5AD0A 2QEJA 2X70A 3DVNB 4HZLB 5HGDA 3TVMA 3LMJL 3HI1A 1PYWB 1IILE 2Y5EA 5E8EB 3RL2B 2R0KH 3BEVB 3EDFA 5I75C 1RI8A 1LNUA 4M1DL 5E2UH 3MA9L 3HE7B 3T8XB 4BH8A 4POZD 3IDJA 4TSAL 2A0LC 1UCBH 2D2OA 4Z7WE 1FO0L 3WXWH 1NGPH 3MJ8A 5C71A 2NZ9D 1AO7D 1NC2D 3EFDH 3TEUA 4PD4K 5FB8B 2GKIA 3UTTE 5CLTA 1HWHB 3SE3A 2P5ED 1QRND 3O2VH 4V1DE 5HGAB 2DQTH 3AM8A 1I4FA 2FL5A 3BPOB 5BQ7B 3MRRA 3QIUD 1OHQA 1SBSL 4XPHL 4JR9H 5I8OL 4N90D 4HDIB 5AZ2L 1ITCA 4ODVL 4AT6A 5L9DH 3TWCH 5ETUA 5E6IC 1I8LC 4PJIA 2LQRA 5A2JH 5KSUB 4LLYB 2Z31A 4HK3J 4YFLF 3C08H 2LU7A 3JTSA 2JCCF 3MLPA 5I15H 1RK1B 4JQXA 3LEYL 3HZMA 4P2QA 2HVKA 3DWTA 3ZDXF 3V6ZA 4UIMA 4F33A 2EDNA 5E94A 1P9MA 5L88H 4PJ8B 5TH2A 4UTAH 1U8PB 2B1AH 4EIZC 3D85B 4M3JA 4PJCF 4W6WB 1WVZA 3WLWD 1A7NH 1DQQA 3FZUD 3KGRA 4PJFA 4LCCA 4YDVB 3RIAK 1CD1B 1JTTA 5AWNH 3WO4B 5JW4Q 1R5VB 2C7UA 1J5OH 2AEQL 1LO3H 2GTZB 2IH3A 3SQBA 5MEOA 2VDLH 3FQUA 3VFNB 5D1XB 2GHWB 2XQBL 3VXUE 3F7YA 1MY7A 2HAZA 2Z8RA 3LH2L 1MI5D 1HNFA 1I9JH 4HUWA 3HFMH 2P4AB 4JN2B 1JNHB 3PG2A 1TNNA 3U7WL 3OKNB 1I9IH 4NC1E 3V5HA 2I60L 4JPIB 4K3EL 3VI4F 4N8VG 3VWJB 5T1LB 2X4SA 2X9XA 1JJUA 2H26A 4XTRD 3HAEB 4NQDA 5CCKH 4LRNL 3WKMH 1FG2B 3I2CH 1M6OA 1MCKA 3OKDA 3PHOA 4I48A 5I1IH 4QHNB 1KBGH 3B9KC 2G5BA 3QNXB 1ZE3C 4BJLA 4DJMA 4M7LH 4K55A 2YD2A 5EBLA 1ZHKB 2F54A 3PWVA 2IEPA 2HJFB 3MREB 2X4QB 4KK9D 3D69A 1IGIH 3RHWK 3BP6A 2CIIB 5DMKA 1BP3B 4EUPH 1ZT4A 5K9JL 3KYKH 2D7MA 4LCCC 3WN5A 4ZNCD 1B6UA 4JANA 4OSUL 5HVWA 3NPZB 1AR2A 1UM6L 2QADB 5HYJE 1QA9A 1X5IA 5EO1B 3RU8L 3EOAB 1A6PA 4X6EB 3GSWA 4NOBA 3RWJB 3MBED 1VFAA 1IC7H 3BHBB 2ADFL 1QR1A 4Z5RA 3EAKA 3AS1A 3NZHH 1G0YR 1NUFA 2EDXA 4AIXA 3LQZB 1J0KA 1RD6A 3U2SA 4HGWB 1IGCL 4JFPB 4P2YA 1A9BB 5JNYA 1MRDL 2ZOKB 3ULUH 2J88H 4I77H 5EBMB 3VFMB 3DRQA 4AM0A 5FA4A 4ZO6A 4ZS7L 4URTB 4KJYB 1F3RB 4YX2H 5F9JB 3BDXA 3QBTB 4MWFB 1A1MA 2BCKB 1DVFA 2VUOA 5H94A 3BT2H 1PZ5A 4RAUA 3O6ML 3G5ZA 5GS0H 3VRJA 2XTJC 4GAGH 1YEKL 4X5XA 2R4SL 3V5KB 1CICB 2XICA 3RX8A 1OARL 5F1OB 3PGDA 4HKBA 5E8DH 1IVLA 4WENB 2YR3A 5F6IB 3FJTA 4D9RE 3ULUC 1FJ1B 4LF3B 4X7DC 3NCYS 1XCTA 2VDMH 5E70A 4G5ZH 3OKEB 3VXRE 4KVCL 3V4VH 4AH2A 5I75B 4XZUA 1A6AB 1JGEA 3CH1A 5TDOA 3EOTL 4OB5L 4QRRD 5GS0C 4QO1A 2X4PB 1VPOH 4NDMB 1AD0A 1YN7B 3W5MA 5KVGH 1J0YA 2H2PD 4GUPB 4XNQB 2X41A 4JVPA 5HHVH 2HG5B 4GW5B 2DQJH 1UKTA 3JWOH 4IIQA 3M1BA 2EXWC 3NH7H 4OLYL 3LRGA 3R1GL 5J13C 5F9AC 1IM3A 4J8RB 4HUUA 2BVTA 3IDMA 4F7CB 2IMNA 5GGUA 3SE9H 3B3IA 1VFBB 3NPSC 2K7QA 4Q0XL 2OTUB 1Q72L 4ODSL 2AXGA 1BJ1J 2XN9A 4QKXB 5D7SH 4OD1H 5HPMB 1Q38A 2XTLA 3D9AL 4NFBA 5FCUH 5AD0B 4XNUL 2X70B 3JWOC 4UUJA 2QSCH 5HGDB 2CLRA 3TVMB 5KSAA 3HI1B 3SDAD 5HGHA 1JPTL 1CF8L 1GGIL 1MREH 2AXHA 4D2NA 1Q1JH 1LNUB 2KZWA 5L8LB 4JFXA 2DQDL 1WT5A 4M1CD 4BH8B 2HLAA 2RR3A 5IJVA 5HYSG 3IDJB 1CE1H 4NQCD 4EN3D 2Z8WC 4JFED 3CFCH 1ZLUK 1UC6A 4PLJC 4AMKL 5GS1C 4YHYC 3S6CA 4BFBD 1LO2H 1NUNB 1R3IH 3X12A 3VH8A 2X4NA 1ZA6A 1Z3GL 2FL5B 3K8MA 3MRRB 4W6YB 4W6XB 1Y6MR 1AGCB 4IIQC 4WJ5A 1JNNL 2LAAA 1RJZA 4OCXL 3FAXA 5D2NE 3FMGL 4I0CC 3KXFD 4ONHA 4RMRA 4AT6B 3OJMB 4YGVB 5ETUB 3S5LG 4PJIB 3WO3B 1TPXC 2Z31B 4CVXA 1T80A 1I8IB 3JTSB 5IIEB 4KJQC 4PRPE 3V95A 4Y4KA 4TOYL 5E2JA 4D3CH 2VR9A 4N1HB 2HVKB 2OI9B 4P2QB 5D8JH 4F33B 4UIMB 4U1JA 5E94B 5EOQH 2DIJA 5EN2A 5TH2B 4RGMB 5KSAC 2R0KL 5BRZD 5FO9B 3T0ED 4ZPTA 2IQ9H 2E8YA 5E2UL 1MHHA 5DF0A 1JPSH 2ED9A 1QFWH 1DQQB 1WT5C 1RY7B 4PJFB 4LCCB 3WXWL 3D39E 1NGPL 1AXTH 1INDH 2C7UB 3M07A 3MV01 3LCYA 2IH3B 1NFDF 2OL3H 1OD9A 3TZVD 3FQUB 5HHMD 5B39G 4X80H 2BZDA 2VLKD 1NCAL 5FYKH 1FC1A 1LGVA 3F7YB 1MCPH 4HUWB 5L9DL 2RIKA 4OI9A 4J4PD 3TWCL 5ELIA 2HTKD 3QAZC 5EORL 3P11H 4PJ9C 2MSPA 2X4SB 2PR4L 2FIKA 2ZCHH 4NQDB 3PDGA 5I15L 1PAMA 4Y4KC 3H9SD 3OKDB 3PHOB 4I48B 1P7QD 1S78C 5TQ2L 4UTAL 1N8ZA 1EEUA 2DQCH 3QDJD 2F54B 3PWVB 3RWEA 3OGCA 4MNQE 4ESKA 2ZUVA 3TBSA 1A7NL 2M8XA 2MQCA 1N6UA 3D69B 2JIXA 4LQFH 4Y88A 3BP6B 2A9NH 2YC1A 5DMKB 1ZT4B 5AWNL 3EYUH 3WN5B 1SBBA 4QLRA 4JANB 3BXNA 4K23H 4HCRA 4QRQA 3IFNH 1MRFH 5FF6A 4PY7A 4XCCH 1YEEH 2YPLA 1TENA 5ICZA 5BXFB 1NBZA 4IHOA 2ZG2A 1VFAB 1X5FA 5H8DA 2GITB 2P43B 4KAQH 1QR1B 2HA1A 3QA3B 4GRLA 4DQOH 1I9JL 3GHEH 4D0BA 4RGNC 5F7EL 2BY1A 3U2SB 2FDBP 3CX5K 1JYWA 1T5XA 5JNYB 1I9IL 3IRZA 4WO4D 2NLJA 4XP1H 3DRQB 5FA4B 5TPWL 2C3WA 4NJAH 3WJJC 5B4MC 4LSTL 1A1MB 3KPLA 1DVFB 3SY0A 5H94B 1MAJA 4KI5D 4D0CA 5I1IL 1RPQA 2BHZA 3G5ZB 1UJ3A 3VRJB 4M7LL 4OV5A 4RA0C 3GSVB 4ETYA 3WFZA 3JVGA 1BD2D 4NO3A 1HCFX 3KAAA 3PGDB 4U6VH 1F4XL 4HKBB 4G8FB 1FGVL 3UTSE 4GRMB 4N8VA 1IGIL 3P4NA 4O9HH 4Y16D 2W0FA 1XCTB 4NKMA 4M93C 3JZ7A 3MRDA 5D96C 3VW3L 4PRNB 4AH2B 4XZUB 4EEEA 1JGEB 1U91B 3CH1B 5TDOB 1MJUH 1UFUA 1IC7L 1JF1A 1YMMA 4Y1AE 1AD0B 4H26B 4WUUE 1AFVH 1N59A 5T5FH 2RHEA 3QWOA 2DWEA 3ARYA 1SQ2N 1OTUD 2CO7B 3FQNA 4GRLC 4TN9A 1SYSA 1ZAGA 3ULUL 4H8WH 1ZHBA 2J88L 2IALA 2H2SD 4L3EA 1TQBB 2H1PH 5GGRA 4I2XA 1OWRM 5JW4R 1MIMH 3GZKA 2Q86A 5C0ND 1IM3B 3VFWA 5GS0L 4JQVA 4HUUB 4GAGL 1BBDH 3FL7A 3IDMB 1ZVSB 5GGUB 1TPXB 3QEUA 3B3IB 2Q8BH 1NCCL 2Y5TA 3JVGC 2DD8H 1DQMH 2J6EH 5E8DL 2CKNA 4PP1D 3ARGD 1DSFH 4XPFL 2AXGB 1ZLVH 2W65A 3EJYD 5E00A 2APBA 1ACZA 4H8WC 4U1KA 4J3UA 5EO0A 3KPSD 4UUJB 4LU5H 4G5ZL 3QUYD 4IDJL 2CLRB 4NQVB 2R8SL 3PDDA 1NFIA 2JJVA 5HGHB 2QQLL 5KN5A 4LSQH 4JKWA 2VLLB 4AEFA 4JFXB 4ONFL 5D6CA 1VPOL 3T0AA 2HLAB 3GK8H 5CJQH 4JKKA 1QSEE 2WIIA 5DFVC 5GXBB 3J7HA 4L8DA 1BJMA 3CZFA 3X12B 4E41E 2DQJL 2X4NB 43CAA 1OAXH 5LBSH 1ZA6B 5KS9A 1WFTA 1U3YA 4PJCA 3NH7L 2YD8A 2Z35B 1X5ZA 1RJZB 5I1LA 4ACPA 2XFXA 1JZ6A 1Z9MA 3E2HC 4CAGA 4ONHB 2YBRA 4AEIH 3H2WA 2EXWD 3FFCE 4JPWH 3S35H 4LPCA 2X1PA 3SE9L 2VL5A 4KJPC 1B2WH 2R1XA 4ZAKA 3HZKA 1CI5A 5D7SL 2Z9TA 3MOAH 3O9WD 3ZDYF 1RZIA 1LVEA 2ED8A 2NXYD 4HKXA 5FCUL 4J1UA 1KYOK 2QSCL 1GH7A 4KHXH 3MFGB 5EN2B 3C6LB 4FTVA 2EO1A 3SCMC 1HHGA 1MREL 3CH8A 3KPNA 4ZPTB 4NFCA 1MHHB 4NHUA 1N4XL 1CE1L 2ZKHH 1F3DH 3CFCL 4FQCH 4L9LC 1A8JH 4LDLB 3ZTJH 4I0PA 4MJIA 4NWUH 5JIPA 4S1QL 3CK0H 2A73A 5GGVL 5E4IA 3BJ91 5I17A 1ZV5A 3W9DA 1I1AD 2AJZA 1EZVX 2DIAA 5F96L 2ESVD 2MKLC 3S98A 4M9OA 4GS7C 2V7HB 4JHZA 1X5JA 1KB9K 1OAKL 3QO1B 1AC0A 3ROOA 5HYSA 1U8LA 3T77A 3DOSA 1NAMA 5C9JA 1OGAA 5TQ0L 4PLNC 3BKCH 1MUJA 4X7SH 3STLB 4LLDA 5IMOB 1CGYA 3PIQA 3K8KA 2FIKB 2BXYA 2N4IA 4JRYD 1J1PH 3OAUH 5FYJD 3WCYA 1QSZA 2W59A 4KXZI 3GBLA 3O6LL 3EW3B 1JI2A 3MJ9H 3RWEB 5DJXA 2IQ9L 3OGCB 3S5LA 3TBSB 1JPSL 1S9YA 2GAZA 1FIGH 2JIXB 1KULA 2YC1B 4ZO8A 3ZLQC 2BVYA 2VDNH 1INDL 5IFHL 4NN6B 3BXNB 2XZQL 4I0PC 4JN1H 3MLXH 2JTDA 1S7UA 5FF6B 2B20A 4IOSD 5EG6C 2YPLB 1DQLH 3MGAA 2N56A 2Y25A 1CQKA 1NBZB 4IHOB 4X80L 1CR9H 3QB7C 1JUFA 4APQC 2WIMA 3B2VH 1MCPL 5DQDL 1HHKA 1EEZA 4D0BB 4LSDA 4HWUA 4CW1A 1VB9A 5EUKA 1T5XB 3GNMH 3P11L 4JY4A 2NLJB 5FKPA 2KDGA 3QJHA 2EXYC 2ZCHL 1A3QA 3OZ9H 1CL7H 2VN7A 3BH8B 5B39A 4R3SA 2QTEA 3L3OA 1I1FA 1ETZA 3QNYA 1MJ7L 4Y2DA 1UJ3B 1II4E 3ZYZA 1N6VA 5SX4H 4OV5B 1PGRB 3RPKA 1WIUA 2DQCL 4KRNA 5I6XB 4JHAH 5FUZL 4MMZC 4HJ0C 4N8VB 4YR6A 2WBWB 2ZUXA 5DK0A 5AUMA 3BD3A 1A47A 3P4NB 4U1SA 1MOEA 4Q2ZA 2Y7QA 5FYKD 3EYUL 2BNUA 2W0FB 3QO0A 1ZS8A 2VL4A 4NKMB 4K23L 3OKYA 1MRFL 2MTPA 4O2FA 2DF3A 1LO4H 4XCCL 5DGRA 3TBYA 4JHBA 1L7TL 3L5WA 4JZOA 2Y6SD 4G8GA 5DK3A 1JF1B 4KAQL 1N59B 3QWOB 4ELME 5HHOE 3AS0A 2DWEB 3GHEL 4NKQB 3FQNB 4X83A 5CD5C 3O0RH 2VZOA 1LE9A 2BVUA 2JK5A 1F4AA 1A2YA 1ZHBB 2I24N 2HT4C 2APVA 4XP1L 2IALB 5EO9A 3TCLA 4WV1A 4L3EB 2FO4A 4WU7A 4RGND 4YO0B 3S3PA 2BVEA 2DLEA 3CVHA 4G9FB 3VGDA 3KVQA 5GGRB 3CPLB 3RVTC 3OGOE 2LTQC 5IM7A 3IF1A 3SE8H 3FT4A 2IH1A 3WS6C 3VFWB 1FZMB 4Y2DC 5DSCB 3QEHA 1JYNA 4GAJH 3AC0A 3QEUB 3VXSA 5F70A 2NTFA 1WAAE 2Y5TB 1J8HD 3NAAH 1QPPA 3HC0A 4U0QB 1FN4A 2OP4H 1JGDA 4WW2A 1NFKA 1F58L 3W0WD 4NO0D 1DE4A 1T83C 1KEMH 5E00B 4G8IA 4U1KB 5I9QC 5MI0C 3FN9A 2G9HA 5EO0B 1SEQH 4JGMA 4JRXA 1NFIB 2RBLA 4X8JA 4R4BA 5KN5B 1CLZH 4AY0A 3D0LA 1MJUL 3FHQA 1JIBA 3C60D 3RX7A 5D6CB 3LKSA 4F9PA 4NUGH 1AFVL 2E9JA 2WIIB 3P9WB 4TRPH 4L8DB 4M4RA 3CZFB 1X5LA 5I2IB 4OZHE 3QFJD 1ACYL 4ZFZA 4H8WL 43CAB 1D5IH 5E9DD 1PG7H 1MCSA 1JGUL 4K3DL 4P2OD 5JZ7D 5KS9B 2IFFL 4WFFD 5T3XH 2KZ1B 4PJCB 4Z7WA 2FSEA 4F3FA 1MIML 2VXSH 5I1LB 1YZZA 3OG4B 4LSUH 5I1JL 3UTTA 4ODHH 2YBRB 5DD6A 1A6ZB 1BBDL 3GSUA 4L4VD 3KLHC 4OI8A 4PGZA 4LFHG 2VL5B 4NM4H 2R1XB 1F2QA 4ZAKB 2FJFA 4YK4B 2DD8L 4QRPE 3SGEI 3HZKB 3IDXH 4MS8D 4XVUD 5HYIA 2PYEE 1DSFL 2MMXA 1S7QA 4KRLB 5FAAA 2X6MA 4OIAA 5FM5O 1RZIB 1NCDH 4HKXB 5GRVL 3MRIB 2J8UE 1NMAH 4J1UB 4QHLA 5MEND 4N0RA 1KF9B 3NZ8A 3OG6B 3IDIA 1TVHA 4FTVB 1HHGB 4MQSB 4I5BA 4LSQL 1UWEH 3KPNB 5C0CE 3DV4A 3TYGL 2X89A 2M2DA 5C07A 1MJ8H 2DICA 2VQ1A 2X40A 3GK8L 1I7ZA 4NCDA 4O02H 5CJQL 2GW5A 1U2CA 3P4OB 4Y4FA 3RX5A 2I25N 5I74C 4MJIB 1SYVA 3ECBA 3AB0B 4NQUA 3RUGE 2A73B 4YDIL 3TC9A 1OAXL 5I17B 4X6BA 3HMWL 4YE4H 2XZCH 4E5XA 4DGIH 3BPNC 1YEJL 5IT2H 1UH3A 2ENSA 2YPVL 3S88H 4P23C 5IB4A 3ROOB 5ICXB 5HYSB 1U8LB 1NAMB 3LV3A 1A3LH 3OV6A 1ZOXA 1AXIB 1QYGH 4OGZA 3NFPA 5C9JB 4BSVB 1OGAB 4WEUD 4U1IA 1B2WL 5SWZE 1DBMH 1MUJB 4OFKA 4LLDB 4XHJD 4MCZA 4L4TB 3KJ6H 3PIQB 2K7PA 2XG5A 3FOLA 4JGJA 3VXUA 3MOAL 4LLAA 2VXQH 1XR9A 3WL9A 2ZNXA 3P77A 1JWMA 4HIIB 1LILA 4JJ5A 3OKLA 1YYLH 4RWYH 2ATPA 3QIBD 4S1DC 1LE5A 2APFA 2BERA 3IJSA 3RDTD 3U1SH 2XACC 2NY5C 1OP3H 3DSFH 1ZWIA 3SN6N 3CAFA 1GOGA 2CUIA 5DJXB 1TZHA 3S5LB 4LVOB 4KZEL 3MRNA 4MA1C 5F7MC 1S9YB 2GAZB 5L0QC 5DT1H 2BMKA 3PWNA 4OJFH 4FQCL 3SCMD 1JZ7A 3TM6A 4NWUL 3NN8A 3PWPE 4GQPH 3CDFA 2DLGA 3CK0L 4Y4FC 1AIFA 1Z2KA 1NGZB 1S7UB 4KHTL 4GLRH 2AXJA 4PJDE 4UT7H 4G3YH 4NRYA 1T66D 1CFNA 1CK0H 1U3HA 2NX5D 2EDKA 5J6HA 5HYJA 4M7JH 3U9PH 1HHKB 4F9LA 1EEZB 4DAGH 4CW1B 1RU9H 4EI6A 3F5WA 5EUKB 3T1WA 2XY2A 1WEJL 4POUB 4YHML 4JY4B 1P4IL 4X7SL 5FKPB 3GGWA 2VRAA 3DUSA 1KJVA 1C7TA 4K71C 3SDXE 4H0HB 4K2UH 3GSOA 5B39B 4X4YA 4R3SB 3L3OB 5J57B 1I1FB 1ETZB 3QNYB 4F58L 4Y2DB 4XGZA 1MWAH 2H32H 4RFOH 25C8H 3EYQC 3O11A 4BQ9A 2C3VA 2DI9A 1CDCA 3QI9D 2Q20A 2KPNA 5DZNA 1H3VA 1P4BL 2VDRH 1SVZA 3P9LA 4YR6B 1U41A 5AUMB 5GS3A 4QHMA 5I9QB 4Q2ZB 2Y7QB 2GJ6D 2VDNL 2BNUB 5JPMA 3QO0B 1HE7A 1J10A 1ZS8B 1NKRA 2D0GA 4JN1L 1A7QH 4OI7A 2D9CA 4O2FB 2X7LA 5IEHA 5KAQF 1U8OA 3TBYB 1MFDL 5BO1H 2WQ8A 3ILQD 3L5WB 4RA3A 1CR9L 4G8GB 4DCQB 4XMLH 2AGJH 2X42A 1FPTH 3B2VL 5ENWA 4R4FH 4JFQB 4MXQC 1U3HC 1T1ZA 2AKRB 1OAQH 1SJVA 3ARDC 3GNML 2JK5B 3T65A 1A2YB 5CP3A 4APQD 3D3VE 5EO9B 3TCLB 4WV1B 4X7FC 2FO4B 4WU7B 1OW0A 3CVHB 3PGFH 3OZ9L 3PGCA 4C83A 4BQ6A 1CL7L 4XWOC 5FCSH 2IG2H 5CBAA 1BJ1H 1NJ9A 2B39A 5IM7B 4U6XA 3IF1B 3O2WL 3QT2A 4KUCF 3FT4B 2YD6A 3RL1A 2FHBA 4OT1H 4OQTH 1IAIH 3QEHB 3S36L 5J7CC 2D7TH 4KFZC 4U7KA 3VXSB 2NTFB 4KTEH 4GKNB 3HC0B 4BA8A 1WK0A 3AU1A 1RMFL 1FN4B 1AH1A 1JGDB 4N0CD 4WW2B 4XVJL 1DE4B 4W70A 4G8IB 1ZA3B 4IRJA 4M5YH 2G9HB 4EI5A 4K7PX 1GGBL 4JRXB 4XVTL 4RCAA 4X8JB 4R4BB 1KLGA 4C56B 4JM2C 3D0LB 4ELMF 2QL1A 2DQEL 3OXSB 2LVCA 5I74B 3RGVA 2CUHA 3HUJF 1K8IA 4ZYKA 4WWID 4PJ7A 1SEBB 4MVBC 4PB9H 1F3JA 3O0RL 4CGTA 4QCIA 3T09A 1F8TH 1ZTXL 3MACH 4OGAC 4WNQB 5MEPB 1J8KA 5T1DH 3KG5A 4Z7WB 3LD8B 4F3FB 2DL2A 5CD3A 3UTTB 3SE8L 4FQ1H 3WUZA 5TF1H 4V1DB 5DD6B 3GSUB 4YEFA 4GAJL 1C1EH 3V6FA 4WI8A 4TUJA 5I8CB 2FJFB 2P42B 1P84J 5D2NA 1S7QB 2C4XA 4LMQE 4MNHA 4OKDA 2I9TA 4H25A 3BN9C 4PUBH 3S3JA 1HXYA 4PJ5A 4UOW0 3NZ8B 4IRJC 4EI5C 4ZO7A 3IDIB 4PRPA 5ESAA 4G43A 4I5BB 1CLZL 5DJAA 3DV4B 5L0QB 2VQ1B 5IGXH 3R8QA 5JW3H 4KI5F 2ICWJ 5HHXL 2OXHA 3QPQC 5J8OA 1IC5H 4Y4FB 1SYVB 3ECBB 2HT2C 3MLVL 2WBKA 1K4CB 1QBMH 4X6BB 1D5IL 1PG7L 5JHLH 3IVKB 1GOFA 4E5XB 4GBXD 5FGBA 3AUVA 5T3XL 1Z9SA 4LKXA 3D39A 4PTUB 3RY5A 4KKBC 4LSUL 4O2CA 3WNLA 4ZDHA 2VITA 3LHPH 3OKOA 5GISH 5IB4B 3LKQA 4JB9H 4AENB 4PRAB 3LV3B 3C87A 5F1NB 2R0ZH 4U1IB 3AMLA 2OS7A 3BWUC 4NM4L 4MHHI 5D1QB 1MFAH 2V2XA 4WIQA 4K71B 4Z7VF 5DQJA 2P8MA 2YS4A 1YPZF 3GSXB 4MCZB 1QSFD 2AJUH 3LB6D 4DZBA 3FOLB 3VXUB 1JHTA 2M26A 2OMBA 5JOPD 1NCDL 1XR9B 3P77B 1JWMB 4JJ5B 1YA5A 3OKLB 3ZYOA 5L8KB 4L1DA 2ATPB 4OLZH 1SMAA 5BS0A 1K2DA 3IAQA 1LE5B 1HCVA 1NMBH 3IJSB 5T33H 1VERA 3ZKMD 3HHRB 1ZWIB 2EECA 1TZHB 2F5AH 2ICWI 3VRIB 2PTVA 3RUGF 2BMKB 3PWNB 3IDYC 2QR0A 3UAJD 4WU5A 4CU8A 1LEKA 4WWKD 1E27A 4R97C 1AIFB 4MNQA 1AKJA 2DLTA 1YEIH 1MRCH 4YE4L 2XZCL 4DGIL 1PX3A 2PO6A 1NANI 4NRYB 3WHXA 2NY5L 5E5MA 1QLEH 2BSED 3S88L 2DAVA 3GO1H 5JORB 5J6HB 5HYJB 1A3LL 4NZDA 3BQUA 2BY2A 4EI6B 3F5WB 3PHSA 4FQ2L 3BH9A 1S7TB 3BZFB 3LS5L 5IHUL 4PJ8D 4M4PA 3GGWB 2I5YL 3DUSB 3KJ6L 4HQQL 1EUUA 5JIIA 3LOWA 5B8CC 3UC0H 2VXQL 3QJFA 5SX5K 3GSOB 4X4YB 1YYLL 4RWYL 1NH6A 4XGZB 3INUL 1XR8A 3Q5OA 3O11B 3MCLH 3ULSA 2VC2H 3DSFL 1I9EA 5M94B 2YHGA 5GZND 5DT1L 3P9LB 5D1XD 4OJFL 4LEXL 2QHLA 5KVFH 1NMCC 4OCSH 3P30H 4KQ4L 4PJDF 2DIBA 5F72S 4OUOA 3TV3L 1C5CL 1MLBA 3BSZH 2ICCA 3GEWB 2X7LB 3UTSA 5IEHB 1U8OB 4QXUH 4UT7L 4XNMA 4G3YL 3U83A 2X9WA 4QYOA 1Q0YH 5T1LD 3F6IA 2PO6C 2QQNH 3QHTC 1TQCC 4AL8H 2BSSB 4YBHA 1CK0L 2QHRH 5ENWB 2J3SA 3MV8A 4NIKB 1SMOA 1T1ZB 4DAGL 5HI3D 5IBUG 4S1RL 2FGWH 4UMGA 1P69B 5JQ6H 2EICA 4Y1AA 2Y72A 4XX1E 5FOBA 3PGCB 1I1RA 5CBAB 4DTGH 1NJ9B 5GS2D 4U6XB 5CUSL 1BZ7A 2ZSWA 3RL1B 4PBVC 4RFOL 25C8L 3TFKD 2B4CH 3MRKA 2P24A 2QADD 4CVWA 3WNMA 2P49B 2F58L 3DLQR 4WI7A 5EU6A 5KTEL 5CEZE 3DUUA 2IANE 2XI9A 4IRJB 1BFOA 4EI5B 1ZANH 2W9DH 1A7QL 2CLVA 2PCPA 5IOPB 2CH8A 2YUWA 4P5TA 3TT1L 1KG0A 1KB5H 5F8QC 1RZKC 4YJZL 1I1YA 32C2A 5BO1L 4OGXH 2NY3B 4XMLL 2AGJL 1EA9C 2VDKH 1TJGH 2Z8VC 2B4CC 4NZRH 3MV11 3RGVB 4R4FL 1K8IB 4ZYKB 1IE5A 4PJ7B 1OAQL 1F3JB 4QCIB 2XWBA 1GL4B 1K9TA 1X7QA 4XNZB 4OFYD 1QSEA 3TBVA 3PGFL 3TBWA 2DQIL 3L5XH 4KJWC 5CD3B 4H5SB 1I7TA 4ODUA 4E41A 1W0WA 4OQ1A 2QSQA 2GSGA 5IQ7H 2E9BA 4OT1L 4OQTL 1G1CA 4M8QA 2AJXH 2D7TL 2D31B 3EFFA 4TUJB 2GSIA 1FNSH 3IXAA 4QNPE 5D2NB 1XIWA 4LAJH 4MNHB 2I9TB 3FFCA 4H25B 3NGBB 5C3TA 1GJIA 1FL3B 3UZQA 4M03A 4PJ5B 5C0RH 3J8F7 1KPUA 2NNAB 4KK8D 4HULB 5IMKA 2EDEA 4PRPB 3GMOA 1G9MH 5ESAB 3ZKQD 4P5TC 4G43B 4KK5C 1ZGLP 5DJAB 3FHAA 2Z92A 5HJ3A 2FHCA 3UO1L 1INEL 1DZBA 2ZCKL 5MHSE 4PB9L 2VSCA 2NY4B 3U48A 1F8TL 1XFPA 4PJGE 1UG9A 3Q1SH 2DDQH 5FK9A 4NQSA 3MYJA 3OR6B 1FFPA 1OTTD 4LKXB 3D39B 4MVBD 5LVEA 4O2CB 1AO7E 2VITB 3OKOB 3LKQB 1G9MC 2CDGA 5CIPB 5TF1L 4IS6A 3QDGE 3W39A 1WTLA 3L7EA 5DA4A 3TVMD 5IB5A 1FL5A 5C6TL 3N06B 3AFLA 2V2XB 2IPTH 3OF6A 5DQJB 1BOGB 1VSCA 5DEFA 5C2BH 1JHTB 4JG1H 5F9OH 3D2UB 2GEEA 1A4KA 3EZJB 2HJLA 3A6BL 4RAVB 4PUBL 1H3XA 3UDWA 4CADA 1K2DB 1ED3A 1N2RA 2QBWA 3ARSA 3VA2C 3VFSA 4B0MM 5C08A 5CLWA 2GCYA 3BN9D 1B90A 3ZYJA 5IGXL 4QY8A 4NFDA 4OLXH 1HKLH 4XNXL 1IFHH 4J2XA 5JW3L 1AR1D 1X4ZA 3QIWA 2QR0B 4O51B 5EPMA 2X9YA 1ZEAH 4X6CA 4WU5B 1IC5L 3DVGA 1V3KA 4OZGF 2NY2B 2DM7A 4KRPD 1LEKB 4YIQB 4QF1A 4R7DA 4MNQB 5JXEA 1AKJB 1PJ9A 1QBML 3BRFA 2VXVH 3U0TA 5L7XH 4F2MA 1X5GA 3N1QC 2Z31D 2PO6B 5T1KB 3WHXB 5ICYA 2EIZA 5E5MB 2ZUQB 1CFVL 1NEZG 2EC8A 5GISL 3SDDA 5GQBA 4YDLC 4PGDA 5I19H 3IKCA 4P2QD 3BQUB 2R0ZL 4QXWA 5I73B 3HNVH 3MLYH 3BH9B 2V17H 2BVPB 2VXUH 1L0YA 1MFAL 1HIMH 1MHCA 2AJUL 3MNVA 4HWBA 1KCUH 2W1NA 1G7PA 2NY0C 2WUBH 3QJFB 4FQXC 3W11C 1EZVY 2FGZA 3THMH 2DJ4A 1MHPH 2XWTA 4OLZL 4MHHG 3S96A 2WUCH 1XR8B 4DW2H 5T33L 4LLQA 3VFTA 4NZTH 4HAGA 4P3CH 2F5AL 3FKUS 2GYSA 3MFFB 4KKCC 1RIUL 4FS0A 2DM2A 1IAKA 3P0VH 4X8XA 1DBKL 4GG6F 1A3RH 2E7LA 3V7MA 4HG4J 1CLCA 3QIWC 1DBJH 1FNGA 1PLGL 1T6WA 3OKMA 1NDGA 1MLBB 1YEIL 2P47B 1MRCL 3UTSB 3LIZH 4XNMB 4OZFH 4QYOB 2CIKA 5JR1H 1FNEB 5L2KD 3C2AH 1QLEL 3DROA 4FFZH 4X9IA 5EBWA 1KTRL 3AREA 4NQDD 4DKAA 3WFDH 3C09B 3QDME 3SDDC 1IC4L 1MEXL 3GI8L 1JV5A 4WDIA 1UXSA 2X4UA 3M45A 1OM3L 3ZL4H 1FZJA 3G04A 2F54D 4Y1AB 2DQFA 3QXTA 4I0KA 4WUUB 2Y4SA 4BZ1H 2ZSVA 5HHOA 2OJZL 2V2TA 3SGEH 4I3RH 2WWMC 5I1GH 1BZ7B 5IR1B 1U8IA 3LDBB 2ZSWB 4PGEA 3OJDA 2Q6WA 5CSZA 2XKUA 4P9HH 2X1OA 1BWMA 4FG6C 3MRKB 2P24B 2VC2L 3TO2B 5C0GA 3GB7A 5F71A 1F90H 5EU6B 4UQ2A 4DN4H 2VR4A 2OR7A 5C86A 4OCSL 3P30L 3S4SG 1JHLL 1YC8A 2E7LC 1BFOB 4Q9RH 1WAAA 4WFHE 3REWA 2CLVB 2PCPB 3ARPA 5F7NC 2V5TA 3BSZL 4P5TB 5FYLH 4DN3H 1KG0B 1S9WA 3EKCA 4U3XA 1V8HA 1I1YB 32C2B 1Q0YL 5ACZA 2QQNL 3ZE2F 5BV7B 4P9HC 1D5ZA 3MLSH 4AL8L 4LASH 1XGQA 2QHRL 1DVFD 5D71H 4HWZB 3H3KA 1RJLA 1UWXK 3LEVH 5D72H 3EDDA 1JGVL 2GY7B 3GSNB 4ORZC 5FO8B 5E7FA 5IBLC 1EMTH 2YK1H 2CUMA 3MUGA 2XWBB 2FGWL 4QRRE 1X7QB 2JJWA 2E7MA 2WP3O 4Y19E 1QSEB 3TBVB 4LPUA 3TBWB 3IJYA 1YEDA 3NTCH 4DTGL 1I7TB 4ODUB 1RZKL 4OZHA 2DQHH 1W0WB 4E41B 2GSGB 4M6NH 3O6FD 3CSYA 1FNAA 4OTXH 5LAXA 3I02B 5CJBA 5A3ID 2B4CL 4M8QB 1I8MA 2NY6C 2NXZB 3EFFB 2GSIB 3IXAB 1FZKA 3CSPA 1XIWB 5KSBE 3FFCB 4ZXBD 2D7OA 1H5BA 1S7SA 5HDBF 1ZANL 2W9DL 3BGFC 4QRPA 3WNOA 1KPUB 3T3MF 3FN0H 5IMKB 2PYEA 3MGOA 1FYTE 3GMOB 4XP6H 3TJHD 1KB5L 3KPOB 5EZLB 4KMTH 2V7NA 2J8UA 4OGXL 2FIRT 2Z92B 1FNFA 2VDKL 1J0JA 1TJGL 4PGBB 5HJ3B 5BZWA 1RZFH 4NZRL 1UENA 1KT2B 3EO1A 1CFQB 3LPWA 4PJEE 3CUPA 3ES6A 5C0CA 3HI6H 3TO4D 5FK9B 3GFUA 3GBMH 1FFPB 1HI6A 2CKBH 4JFEE 2R9HC 1XZ0A 3AROA 1YEGH 3DI3B 3RGHA 5ACMA 2G75A 5LXGH 4HUVA 3TN0A 2CDGB 3BAEL 3GHBL 3I6KA 4I18C 4IS6B 4U05A 3G08A 3W39B 3L7EB 3SHSA 5D7JA 3GMMA 4QNPF 5IB5B 5DUBA 3B2UD 2AJXL 3V6OE 4XAKD 2P48B 3VRLE 3TH3T 5GIRA 1YY8A 5DEFB 3B9EA 3QXDA 4M62H 1WICA 3UJIH 1A4KB 2V9RA 2HJLB 3ZSSA 3EYSH 3RTQD 5SWZA 5C0RL 1ED3B 4KGLA 3VFSB 2ZUUA 4OIBA 1AE6H 1G9ML 4JAMA 2GCYB 4JO2H 1FLRH 3H7BA 1U6AL 5DMGC 4WRLA 4QY8B 3WIHH 1N5YH 4QT5B 4PJGF 1Y6KR 3W81A 5EPMB 3GSRB 1RFDH 4PJBE 3DVGB 2XKSA 5BRZE 4QF1B 4R7DB 3P4MA 3Q1SL 4A6YB 3SDCC 3VMPA 4F2MB 5ICYB 2EIZB 3D5OF 35C8H 5IMMA 1T89C 3T2NH 4X7EC 3SDDB 3JWDH 1P7KB 4MA8H 1IC1A 2DMBA 1SY6A 4PGDB 3IKCB 3FO9B 1R6VA 4MCYA 4XX1G 3CCHA 3VD5A 4PJDA 4P9MH 5D7JC 3MV9E 5HHME 3C6LD 2IPTL 2DLFH 1KJ2A 1RUKH 1MHCB 3WE6A 3MNVB 5C2BL 3L5HA 4JG1L 1QKZL 5KJRH 5D9SA 3V4PH 3L7FA 5DJ2A 2XWTB 4JDVB 4LOUC 3FONB 3S96B 3NCMA 4MAYA 4DFHA 4RRPA 4LLQB 3VFTB 3MO1A 3SDXA 4FQJH 3MLUH 4Q7DA 1GOHA 4UIKH 1CDBA 3BEWA 4C57C 1A7RL 4OLXL 1HKLL 4Z7UE 1CGWA 1IFHL 1WWWX 2A1WH 1IAKB 4TUKH 1UZ8B 1OTSD 3CFJA 1FNGB 3PXHA 3QDJE 1V3JA 3OKMB 5FOJA 1NDGB 5E1HB 2VXVL 2KBGA 4XXDA 4P4RA 3RVWD 2VWEC 5SV4A 4OAWA 1D5XA 2CIKB 3DROB 5EBWB 3L5JA 3AREB 3MXVL 3A6CL 5I19L 4GRWF 3FAWA 1JV5B 2RCSH 4WDIB 4YPGA 4L3CA 5D1ZC 3HNVL 4YXLH 3MLYL 5FFLA 1UXSB 1JRHI 2X4UB 2VXUL 4HPOL 1FZJB 3G04B 4R4NC 4CDHA 2BVOA 5EIVA 2DQFB 2X05A 3ZHLA 1UQSA 2WWKO 2ZSVB 4ELMB 5HHOB 2WUBL 3ZE1F 5DMJB 2V2TB 1ZT7A 2D4FA 2BNQA 1NEZA 3KLDA 4UNUA 4PGEB 2FX7H 3OJDB 4XPBL 5CSZB 5C09E 1DQDH 4JM4H 3D3VA 2CQVA 4WTZG 1TTFA 4LQ1A 1ROWA 2NY6B 3HNTH 4NZTL 4Q6IA 2EEAA 4UOW1 2X5PA 4X0KA 1INQA 5C0GB 4TVPD 2XIDA 3GB7B 4IOIA 1BVLA 4DVBB 4GG8A 4UQ2B 5D70L 4PJIE 5EC1B 3P0VL 5T3ZD 2XPGA 5TFSL 4XC1L 2FWOB 1MCOH 4FMFA 1MHEA 1FCCA 2RB8A 3BGFB 1YEFH 3F58H 3REWB 5J89A 4HWBL 1VGEH 1T7YA 5DRWB 3V52H 1OB1B 2CLZB 3LAFA 5KVEL 1S9WB 3LIZL 2MQ0A 5JUEH 4PLOB 5ACZB 5JR1L 3C2AL 3WNKA 3VFPA 2IC2A 4FFZL 4KDVA 1D5ZB 5HDQH 4TSCH 5ISZD 1XGQB 3WFDL 3LKRA 1ONQB 1B6DA 1RJLB 4RX4A 5H37G 2ADJA 3KLAA 4X4ME 1IBGL 5FKAA 1RV6X 2BXZA 2EIBA 4U7MA 3MUGB 3K3QA 5BCAA 3ZL4L 4YUEH 5AZEH 3T3PE 3IJYB 1TJHH 2VDPL 3LQAH 1G6RH 4OZHB 3V7AE 5I1GL 1FL6A 2QLVB 5BW7A 3CSYB 4P9HL 3VXMA 5LAXB 3V4UL 2IAMD 2GQHA 3S7GA 2W0LA 1I8MB 1D5BA 3I6LD 4YWGH 5IBUB 3QCVH 1F90L 1FZKB 4R26H 4N0YH 4LLVA 2E3VA 4ZNEA 4DN4L 4UDTB 1NPUA 1H5BB 2HFFA 1S7SB 4Q9RL 5I18H 4GAFB 4QRPB 5FYLL 2PYEB 3MGOB 4HJGA 1MAMH 2XTJE 3V0VA 1U3JA 4RMWA 4CBPA 1C5DA 3HMXH 3WUWG 1WIPA 4L3ED 3DV6A 2V7NB 1VFMA 2J8UB 1FBIH 3HC3L 3MLSL 4G9FD 4P5KA 4LASL 1T22A 4M6OH 5BZWB 3MCKA 1A6WH 5D71L 5CWSA 3EO1B 3ZSTA 4XCEB 1NANH 3CUPB 4MXVF 4MZ3A 3ES6B 3S4SA 3ULUE 1EMTL 2YK1L 5C0CB 3RZCA 3R06A 1CGSH 3U4EA 3STBA 4U1HA 1DANT 1HI6B 4K7PY 4KK6D 4K3GA 1XZ0B 5KVMC 3NTCL 1I75A 1I7UA 2G75B 2ITCA 2MCPH 3RUGB 1ZGLM 4HUVB 3TN0B 4PBWD 3I6KB 4OTXL 3G08B 2CGRL 1GGUA 5BW7C 2O93L 3GMMB 4L3AA 5CZXC 3DXAD 3QCTH 4LSVL 5KSBF 1FH5L 2P5WE 3QXDB 5E2WH 5JMRA 1G7JA 4FFWD 4NC0B 3MPCA 1L0XA 3VG9B 2L0DA 4D8PA 3LZFH 3W9EA 1IL1A 4NT6A 4OLUL 5SWZB 3CMOH 4K94H 3LPFA 1Z6JT 3FN0L 1A5FL 1I3GH 1MJJA 3Q48A 2IJ0C 4XP6L 4JAMB 4CMMA 3H7BB 4YBQC 3ULVC 2EH7H 3ARBB 2FO1A 4KMTL 4XCNA 1HWGB 4X7CC 4PJEF 3O3DA 1OQXA 5I66A 1UA6H 4Z77B 4RMSA 3I9GH 2UVFA 4RFNC 4W4OC 3G6AB 3IAPA 4YDKL 3HI6L 1X3DA 4AK1A 3PL6A 3P4MB 4J3OC 2NY1B 4LVHC 4M7LT 1FC2D 4X6DA 3GBML 4ZAKD 2CKBL 4M7ZB 1XMWA 5DJ8A 1MCHA 4IBLT 5IW1A 1YEGL 4K94C 4OZ4A 3DI2B 1TZIA 3PWPB 1GGYA 1JYVA 1WZLA 3S3SA 4LPXA 2V2WA 4LSSL 4MCYB 1VA9A 4PJDB 4LGPB 2ESVE 1HQ4B 3FRPG 4HUXA 2A9MH 4FTVD 4MX7A 4R90H 3ETBF 4XPGH 3RIAF 1KJ2B 4IEFB 5JLZA 4AQ1B 3BYYA 2PW2A 3WE6B 4M62L 4JREB 1PW3A 1P2CA 3UJIL 1DDHA 5D9SB 2YKLH 4DEPB 3EYSL 3L7FB 3U30B 4Y4HC 3SGKA 2H3NB 3NCBB 4MAYB 2XXMB 5F7KC 2FB4H 1OP5K 4PRIE 3QUZC 3MO1B 5DD1L 3PJSA 5FYKU 4JO2L 5JDSA 3SDXB 2JKXA 4JRYE 5TE7H 3BEWB 1HOCA 3WIHL 2FZ3B 2J5LB 1BQLL 2RGSA 1W8OA 3KWWA 3NCJL 3SJVE 2YWZA 3CFJB 1UXWA 2XN9E 5J4MA 4PJHA 4NM8L 1OGAD 3S34H 4KRMB 4XXDB 1MCIA 3PL6C 5IVXE 4WFED 4EXKA 5I8KH 4OAWB 1D5XB 4L4TD 35C8L 4ZSOE 3T2NL 1T2QH 3QEQE 2WK2A 3O4LE 4LCIL 4MA8L 4OFVA 3GIZH 3LKNA 4L3CB 4P9ML 1A6UH 1DFBL 3WFBH 2YMXH 2IMMA 1HH6A 1UQSB 4M61A 3SOBH 1CGXA 5D4QA 4BQCA 3V4PL 5KJRL 4MGXA 3UX9B 5TE6L 5EZIH 1ZT7B 5JQHC 1NEZB 5KOMC 3D3VB 3ESVF 4POYA 3BP7A 4Q6IB 3MODH 4Z7UF 4FQJL 4E0RA 3MLUL 3FO0H 1INQB 4UIKL 5CILH 3VGAC 4IOIB 1SY6L 1BVLB 3O4OC 5JMOC 4GG8B 4YC2C 4TUKL 4P4KB 4XT1C 3VXOA 4PJAA 3HE6C 3BMVA 4GOSA 4YHIA 1OWWA 1EO8H 3QSKB 1YDPA 4DGYH 3I84A 4ZD3H 2IANA 1JMZA 3VFPB 2CSPA 5F21B 4XPAH 3LKRB 4I13B 2VDQH 1QFOA 1CZ8H 3CU7A 1K3IA 1LO0H 5IHZB 4RIRA 2ADJB 3KLAB 4YXLL 2AJVL 5FKAB 6FABL 2YRZA 2J2ZA 2MOVA 5I1AA 5ID0A 4O00A 1NGWB 3GIVA 3BDBA 4BZ1L 1FL6B 5E5UB 1O5DT 1DQDL 4JM4L 3TBTA 3HNTL 2AEWA 5E2TH 3N85H 1J0HA 2Y06H 4PJIF 4FQHA 4RGNE 1ZGLA 1D5BB 4MLIA 5CJXA 1JWSA 1A9EA 4OM0H 1DLHA 4Q58C 4GMSH 2CK2A 1D9KA 4HMEA 3BD5A 1OCWH 4MD4B 3F58L 5INCA 1BEYL 1VGEL 5DHVA 2ERJB 4YHPA 5FM5M 3V52L 4C55A 4K8RH 4HJGB 3CFEA 3EJJX 2IPKA 4WTZA 3V0VB 1E4WL 1ADQA 1C5DB 1DLFH 3BMWA 4JJHA 3DV6B 5HDQL 1L7IL 4P5KB 1T22B 3MCKB 2NZIA 1XF4A 3D18A 4RFNB 3E6FA 4HXAH 4OFDA 3C5ZA 3ZKXC 3T3PF 4H88H 5K9QI 1RIVH 3RZCB 1H0DA 3R06B 4LVHB 1UKSA 3NFSH 4JZJA 2MKWA 2WM0A 1CS6A 2W0PA 2AV1A 4EJ1C 5AZEL 4U1HB 5DA0B 4CDGC 4MLSA 4L29B 4DKFH 1TJHL 1I7UB 1F4WH 1SHMA 1JPST 2ITCB 3QFJE 4K8RC 5CIPH 4PJGA 1V05A 4WGWB 1IEAA 5E9DE 3QXUA 5HVHB 5IB3B 5I1CL 2RQ8A 4JRXD 4OKVA 2OK0H 4WFFE 1K5NA 1FNHA 1QFWI 1W0VA 4HC1H 3QCVL 4C56D 2OSLA 1AO7A 1NC2A 2DKUA 5CJXC 1NGQH 4N0YL 4FA8A 2P5EA 1UWGH 3QDGA 2D7PA 4L4VE 3VE0A 4D8PB 1JI1A 5IVOA 4YPJA 3VGBA 1IL1B 3W9EB 4LPWA 4NT6B 5FECA 5I18L 3OB0H 1RUAH 1MJJB 5KANI 1MAML 3MRFA 3GJFA 1MQKH 1HKFA 3HMXL 3RNKB 5HD8C 1KN4H 4PLKD 3KJ4C 4LHQB 1FBIL 3PXJA 3RI5F 2G60H 3O3DB 1A6WL 3UTOA 5I66B 3TNMA 3UTTD 5J12C 1DN0A 1FV1A 3TH4T 1RUMH 4V1DD 2VH5L 2G2RA 2Y9RT 3PL6B 5ESQB 1CGSL 4PYHA 5HHNA 4NP4L 4JZJC 1FO0A 5DJ8B 1N0XL 5ALCH 4YXHL 5LGHH 3X17A 4Z7QE 5IW1B 3WUWA 1JVKA 4Z0BH 4OZ4B 1H9VA 1TZIB 2MCPL 3GJFH 3ULVL 2V2WB 4OUUA 3C5SA 1YMME 5JIHA 3ZDZE 4KROB 5EOCH 4EXPX 3QCTL 4POZC 5F7WC 4MX7B 3SGJA 4DUXA 5C0DB 3HNSH 5JLZB 2Q3AA 1BQSA 2NZ9C 3BKYH 1G7IA 2DI8A 1P2CB 1AC6A 3LZFL 1GHFH 4FABL 5LQBH 2A74A 1UEYA 4I2XE 1K8DA 3QIUC 4K94L 3SKJL 1CFBA 1I3GL 2VIRA 2V5RA 4G7VH 3PJSB 5JDSB 4G8EA 2EH7L 1MI5A 4X4ZA 4AG4L 1RHFA 1OT2A 1HOCB 1FDLL 3VFRA 2W91A 3KWWB 3CMGA 4UU9B 1T1XA 1U8JA 1UA6L 5KG9A 4QHUA 4QTIL 1JPFA 1UXWB 1HINH 1MCRA 3MSPA 5D1QD 2APXA 3HI5H 1Z5LA 3N1GC 2WBJB 1PQZB 1UZ6F 2VZ1A 2VZ3A 5E4EB 1OLZA 2YD7A 3LKNB 3WLWC 1BAFH 1YNTA 3FZUC 2A9ML 3B6SA 3V7AG 3CLEH 4P46D 4R90L 4XPGL 4U2YA 3MV7D 1HH6B 2FJGA 3NIFF 3QDMA 4M61B 3VI3F 1S7VA 4NN5B 4LGRB 1XH3A 5BZDA 2AJYH 2YKLL 3MNWA 2BSTA 3CSBA 4LHUD 3BP7B 2FB4L 4EUPG 4M5ZH 4E0RB 5EH1A 5GGTH 5ADPL 2A6DB 3UTZB 3TA3A 3FRPA 2FJHA 5JHDD 3V8CA 3PF2A 1QSVA 3VXOB 5F9WB 5IVXF 4YHIB 3KLSA 2FX9H 1YDPB 4XTRC 2OR9H 4Y0GA 1BECA 4LPTA 1MFEL 5CSGA 5JTWA 5I8KL 2IANB 3T2QA 1PDKA 3V2AR 1T2QL 3VMNA 3UEZA 4KC3B 4ENED 2C1PA 3GMLA 4HGMA 1CE6B 2R0LH 3GIZL 4RIRB 4NGHH 3Q3GA 5GHWL 1VEOA 3EDKA 3Q6GH 4K7PH 4OD2A 4KK9C 2G5RA 4D9LL 3WFBL 3QUXC 5HXMA 1R5IB 2YMXL 3UYPA 5I1AB 3BPLC 4UQ3A 5ID0B 1MSPA 3IU4L 5D7IE 2FBJH 1SVCP 4UAOB 1JHKH 3GIVB 3HG1E 4R2GC 4QWWD 1X5AA 4QRRA 5D93C 3SEPA 4KI1A 3TBTB 1FRGH 3MBEC 4U1NA 1J9CT 4Y19A 1FSKC 4FQHB 3FO0L 3NIGE 5FDWA 5CILL 1JWSB 1A9EB 1DLHB 3OBAA 4PREA 2HKFH 2HTLD 5KSVA 1REIA 2VKWA 1Q9WA 3HC4L 3P0GB 5LG1A 1D9KB 3MYZA 2ICES 3VXRD 4PV8A 3IFPB 3LVEA 4GXVH 5INCB 3SKOA 4DGYL 1A4JA 1UKQA 5DHVB 3EUUA 4YHPB 1LEGA 2IPKB 4L8BA 4ZD3L 1LDPL 3N50A 3QFDA 3T04D 4QOKD 5I30H 5E56A 3JUZA 4XPAL 4LSRH 4XH2A 1XF4B 3D18B 3E6FB 1CZ8L 5C0EA 2A2QT 1LO0L 3C5ZB 3PWJA 4RMTA 4YAQA 3MBXL 4KKAD 3RKPA 1DTUA 1FFOA 4LP5A 4KY1L 5JW5A 4EOWH 2AV1B 2MNUA 1J11A 4IRSB 4UI2A 2CR3A 3SDAA 4LAQH 4PJEA 2VQUA 5HGGS 1I9RH 4PJGB 1OY3B 1IEAB 5FGRA 5E2TL 4NQCA 1A0QL 2PXYA 2Y06L 4EN3A 4JFEA 4RBPH 1K5NB 1U42A 1YNKL 1WBYA 2H2PC 4PV9A 1AO7B 3ZT5A 2R2HA 2NY3D 3BZDA 2YRPA 3QDGB 3VE0B 3P0YH 4JHWH 4JKLA 5DQ9B 5GRXG 5FECB 4AJ0A 3PV6B 1XGPA 4RMQA 3T0XA 2AQ1A 1Y0LA 4K8RL 3MRFB 1N64H 1EGJA 3KXFA 5AEAA 4CJ0A 1P53A 1R0AH 4CUCA 3TH2T 1A1OA 3VWKB 1HK6A 3TNMB 4EVNB 4U1LA 1V7MH 2ARJQ 1DBAH 1IQWH 1DN0B 1FV1B 2CD0A 3GM8A 4GXUN 4H88L 4X5WA 4J3WA 3PQYE 4A6YH 2W38A 2GK0A 3IFLL 5HHNB 1FO0B 1AXSA 1R3KB 2B2XL 1K6QH 4PJBA 3WUWB 3IGAB 3CDGA 3SE4A 4DKFL 2DKSA 3SDAC 3T1FA 5K9QG 2EE9A 5HI4C 5BRZA 3T0EA 2ILLA 3DGGA 3C5SB 4OUUB 3OHXA 1TCRA 2CDFB 4P5MA 2OTWA 4M1CC 1YN6A 1T03H 3SO5A 4EN3C 4NQXA 1N0LA 4GFTB 4MJ4A 4LBEA 5IEKB 4BFGA 1NGQL 1CWVA 5DVNA 5GGSA 1G7IB 3DHJA 2O5ZH 5IG7A 3NIDE 2ZUYA 1QBLL 2VLRD 3DUHA 3IS0X 2Q76A 4Y2OA 3MV9A 3TZVA 3U36A 1CD0A 4XWGH 1RUAL 1K8DB 4LCYB 3V0AC 4CL7A 3MLWH 2VLKA 5F7DA 2NY4D 4ZFGH 4JO4H 1QSFE 1MQKL 3MJGX 4G8EB 3QRFM 1KN4L 3BZEA 1MI5B 4MJ2A 2CR6A 2R1YA 1ZMYA 1MFNA 5E95B 3VFRB 1MCQA 1T1XB 1U8JB 2P7TA 3IETA 5ITFA 5K9KA 4QHUB 1WZMA 1JPFB 1JF5A 1RUML 1RZGB 4Z7QF 1I8LA 4UV7L 2O5XH 4Z7UA 2IFGA 3H9SA 5T3XE 3ALPA 1M71A 1BQHA 3CXHJ 5ALCL 3HS0A 4ZUSA 1Z5LB 2BJMH 3VFUA 5L6YH 5C0BE 5C6WH 3ZDZF 3D2UD 3QDJA 3UZVB 5FHBH 5T5NF 4XCFL 5GGQH 1BZQK 3T0EC 4GKZA 4MDJA 4R8WH 5JA9A 1U93B 4PIRF 4B7IA 4TQEH 5DGQA 2HT3D 1YNTB 1WV7T 3B6SB 1KJ3H 3A67H 3HNSL 3U82B 3QDMB 5GZOC 1S7VB 3FB5A 3UTQA 1XH3B 2IBZX 5BZDB 1GHFL 1AGEA 3VD4A 3MNWB 4NZUL 5LQBL 5J3HD 2BSTB 5I1KH 3OAZK 3TZVC 1BZ9A 2NY2D 4G7VL 1AKJD 1MVUA 1RHHB 4C58B 5K93A 4YQXH 1E4KA 3LN4A 3TA3B 1EHAA 1BM3H 5T1KD 2EZ0D 4TPRL 3RKDD 5JDJA 5C09A 4J4PC 2HTKC 1I8KA 3QP3A 2X4TB 2ATKB 2XA3A 3TNNA 3UP1A 1HINL 2XKNA 1K85A 4PTTA 3QEGL 1MFCH 3RRQA 1P6AB 3P2TA 3WJLA 1T6VN 3HI5L 4LKCB 4OF5A 3F7VA 1BD2A 4KVNL 1VEPA 2C1PB 5C07E 2NW2A 3QWQB 5EFIA 1G84A 5I71B 3HZVA 3B9KA 3IS1X 4MD5A 3Q3GB 1J05B 1U8KB 1BAFL 1FVDB 4LNRA 4HIHA 3AS3A 4OIIH 1C08A 2O5YL 5KS9F 5C7XH 4UQ3B 3WYRA 5EUOE 5SV3A 4PYGA 4ALAH 2AJYL 1XCQB 2NMSA 4X4MA 2UWEE 1IMHC 4XBEH 1CLOL 4QRRB 5BVJB 3SDYH 1UYWH 4M5ZL 1CT8A 4U1NB 4Y19B 2VYRE 5AYUH 5GGTL 5FDWB 3T08A 3UTSD 3ARWA 2WZPD 4M6AA 4Y89A 1E4KC 2E9IA 3BIKB 5D2LA 1J1OH 1AHWA 4PREB 5KSVB 2NPLX 3ZE0E 1Q9WB 1QFWM 1WIOA 5GRUH 1DUYB 4WO4C 4C59B 1QP1A 5M7QA 3SKOB 2FX9L 3U0WL 4B50A 5MERB 4Q9QH 3O8XB 1A4JB 2OR9L 1K4DA 1LEGB 2APWA 3BIAX 2C5DC 1OPGH 2DN7A 4L8BB 4EUPA 4KI5C 3EYVA 1QR4A 3WJLC 5KSBB 4Y1AD 1HHHA 1ES0B 4WUUD 5DRNA 4DFIA 3F65A 4ORGB 1GRWA 2R23A 5E5RB 4XH2B 1X9QA 5C0EB 1RAMA 1NBQA 1FYTB 2R0LL 3CX2A 2E9WA 3PWJB 4Y5XC 4YAQB 2FX8H 1FFOB 4O5LH 5IQ9B 4ZUWB 3CD4A 1QO3B 2DTSA 4B53A 2NR6C 1MAKA 5JW5B 3WD5H 4Y16C 4PD4J 3SDAB 4K3HA 4L8SC 5EZJA 4CMHB 4PJEB 4XP5L 5HSFA 1JK8A 5T5NG 3NCYP 3QUXD 1C5BH 1I85C 3NIGF 1BF8A 5E8PA 4B7LA 1FRGL 3NA4A 4HBCH 4NQCB 4EN3B 2PXYB 4JFEB 4TSBH 4UINL 1HILA 4ZFOL 3G5YA 2F53E 4R2GD 1WBYB 4PV9B 3GMPA 4H1LH 2AABH 2R2HB 1CFSA 2D7QA 1OTUC 4FQPA 1AHWC 2Z93A 3EHBD 2A6IA 3L3GA 2P8PB 3L9RA 4JCMA 2BOCA 2OJEA 4FXGA 5F44A 2H2SC 4GXVL 1CYGA 1PFCA 1ZKAA 4N5UA 1XGPB 4FMKA 5DYOB 1Y0LB 2P5WA 4BFIA 3O3EB 1FVCA 5C0NC 2QSTA 3U6RB 3UMTA 1X5YA 5I30L 1PX4A 1QSED 4WEMB 3NVQA 4LSRL 4KPHL 1KOAA 4E41D 4U1LB 4WI6A 3PABA 1KNOB 1R3HA 2VABA 4M6MH 4X5WB 4PP1C 3ARGC 3O9WA 2GK0B 3QUMH 3IDGA 2NXZD 3EJYC 3DIFA 5JW4N 1TNMA 2HRLA 1AXSB 5E08H 3B8SA 4G80A 1BOYA 3QUYC 4F7TB 4PJBB 2QJDA 3CDGB 3T1FB 1XIWD 2R29L 5BRZB 1I9RL 4JY5H 3DGGB 1JP5A 1TCRB 4YFEA 2OTWB 4RMUA 1YN6B 4NQXB 5FM8A 4LBEB 4U33A 4YHOH 4ETQA 5GGSB 4O2EA 2AJSH 3RWGA 4BH7B 2Y36H 1A7PH 5IG7B 4MXWL 3P0YL 1NLBH 4JHWL 5GS1A 2ESVA 1WQVT 2Q76B 5AYQA 3MV9B 4GLRI 1OAZL 5HHMB 2N7AA 4S1SL 1AJ7L 3ZTJG 2BHYA 1NBVL 5ANME 3RVVD 1R0AL 3P3YA 3ROLA 4Z78A 5J9PA 3BZEB 2R1YB 2VZTA 2QQQA 5CINH 2ARJB 4ONGL 5ITFB 4PRIA 1DBAL 2ZUSA 1IQWL 4HIXL 4PR5A 4MSWA 5HHPB 4JRYA 3QXAA 5CAYB 5E6IB 1YQVH 3HPLA 3O9WC 4Z7UB 2NXYC 3H9SB 1OOAA 5B38G 1M71B 1N5AA 1TFHA 3FO1A 1A7BA 2P8LB 3K81A 3HS0B 4ZUSB 3VFUB 3SJVA 1K6QL 1QEWA 1JRHL 1YYML 2ZUTA 3QDJB 2PYFA 1EGJL 1T1WA 2Y07H 3UPCA 1HH9A 1EBPA 4GKZB 1U3ZA 4MDJB 5IVXA 4ZSOA 5HI4D 2HWZH 1ZLSL 5TGBA 4PJ7E 4H20L 5C6PB 3QEQA 3O4LA 3REVA 4MB3A 2QV2A 2J7LA 2EH8H 3NOIA 3FB5B 3UTQB 3CDCA 2FEEI 1AGEB 5CJ8A 5FYJH 1AI1H 1I1AC 4PRBA 2IPUG 4R0LA 1MLCA 1SM3H 3MJ8B 1BZ9B 3MLWL 4ZFGL 5JXED 1MVUB 2E6JA 4MNGE 4X9FA 5HVFB 4KH2A 3HZYA 1I4FB 1KACB 1ZSDA 3RP1A 4WW2F 4Z9KB 5C09B 1FQ9C 2XA8H 2P45B 1I8KB 2MQ3A 3M8OH 2YXMA 1BVZA 3TNNB 1D5MA 4PTTB 1KTDA 3RI5K 2O5XL 3C5JA 4PJ9A 4YFDB 1V5JA 4PJ5E 1JZ3A 4NPYA 5L6YL 4HV8A 4ZUVA 2C1OA 3F7VB 4K9EH 1AY1L 1IAII 5DJ0A 1BD2B 4G6ML 2NW2B 1BGXH 5EFIB 2OL3A 5GGQL 3HZVB 3B9KB 2ZUWA 3HZMB 4R8WL 1HYSD 5IKCA 1AP2A 4TQEL 3V6ZB 4NQEE 4LNRB 4HIHB 4EBQH 1G9NH 5L2KE 2F5BH 1C08B 1FZOA 3CXDH 2VZVA 4J7RA 4Z7WF 3V8OA 1B4JH 4QRTA 4WHYH 1UCBL 5L2JA 4ZMAT 5I1KL 3DMMC 4JPVH 4XCYA 2B1HH 4KUCD 5DJDA 3H6JA 3EFDL 5GZOD 4R0LC 4U49A 4HH9A 3FT2A 4K9EC 2ZOLA 3I3BA 4WGVB 3O2VL 1W72H 2DQTL 5K59E 5MEOB 3MA7A 5D2LB 3O3BA 1AHWB 5I76A 4I8DA 1T7XA 4JR9L 3ARED 1OD7A 1G9NC 1CLYH 4U3CA 1K4DB 3N0PB 3PDOA 4DGVH 5BS0E 4EUPB 3LSOA 1OSPH 3EYVB 3V5HB 3QQ9D 1HHHB 3C08L 3WJJA 5DRNB 2H26B 1P1ZA 4UNTA 5HHOD 5EB9A 3G6JA 1M6OB 3RWIA 4DKEH 3OWEA 4HXBH 2XTJB 4NO0A 1KELH 2G5BB 5EOTA 2LAGB 5L88L 3QDHA 5EBLB 4NN7C 2B1AL 5C9KA 5C7XL 3S36X 3AVEA 1CXLA 3WEXA 5GRJH 5IHBA 1JK8B 1LWRA 4XBEL 1A6TA 3PWLA 5E8PB 2AI0H 3SDYL 1J5OL 1UYWL 2Y6SC 1V7NH 3ZE0F 1LO3L 5GRWA 4ERSH 1HILB 1QA9B 3G5YB 4MQ7A 3GMPB 1J1OL 3QFJA 2VDLL 3GSWB 1CFSB 3TIEA 3L3GB 4NJ9H 2A6IB 5E9DA 2BOCB 2OJEB 4FXGB 5IB2A 5KZCB 4Z5RB 3ZYIA 4D94A 4JVUA 2B5IC 3JTTA 4P2RD 4Q9QL 3HFML 1ZLWH 2HMID 1OPGL 2PN5A 2P5WB 1P4LA 1BPVA 1FAIH 4Z8FH 4AM0B 4L4VA 1EVTC 1IGJA 5C0AE 3RWDA 5CCKL 1UVQA 3WKML 3I2CL 5J13B 3QPXH 3HKFA 3PABB 1PZ5B 1AGFA 4RAUB 1JTPA 1R3HB 2X1WL 5HYQA 2VABB 3FRUA 1KBGL 1E6JH 3EYOA 4O5LL 3UTPD 4X5XB 4BZ2H 3NPSB 3RVXD 2CXKA 3IDGB 3LN5A 3DIFB 5SWSD 4Z6AT 3WD5L 5DMYA 2NCMA 1CDIA 2YUVA 3F62A 4RQQA 2NR6D 3KYKL 5A1AA 4BQBA 4QRPD 3C60C 5DI8A 3MV8E 3WS3A 2F19H 2PTUA 5IW3A 4K07A 4ETQB 1DBBH 1TJIH 4O2EB 4ZOBA 2BHUA 3RWGB 2APTA 4PRHD 3L5IA 5GS1B 4YHYB 2ESVB 3NZHL 2J6EA 2YZ1A 4P2OC 5JZ7C 5FIEA 3QWRA 4N0FA 4YHLH 3LS4H 3QHZH 2COQA 1PY9A 2R0WH 5EU3A 1G7HA 5IVNA 2JELH 3MR9A 3ELAT 1YNLH 3QZWG 4I77L 7FABH 3ROLB 5J9PB 4Z78B 4IIQB 1UJTA 4NWTH 3JV6A 2BSRA 3M1BB 4OFIA 2YN3A 4YX2L 3K7UA 1T2JA 4FFYH 2RJMA 1PG7X 4P59H 2A83A 1HNGA 3BT2L 4FNLH 4PR5B 4PRIB 5EU6E 5IROC 3TN0D 4M6ML 4MS8C 4MSWB 4XVUC 4JRYB 3QXAB 5FXCH 4JM2F 2VDOH 3VG0H 3QIBA 1N5AB 3FO1B 4PG9A 3SJVB 1QEWB 3DX6A 3WKNA 4OF3A 2XN9B 5EIQA 5TE4H 1DL7H 2PYFB 3DARA 2OX5A 2AK1H 3T0BA 2BFVH 1HH9B 3K1DA 2IF7A 4FFVD 5SWZD 2VDML 5IVXB 5F93C 5KSAB 3SCMA 5SWQA 5E6ZA 3BD4A 4ZSOB 3V4VL 2F8XC 1WUNT 4M43H 4YHOL 3QEQB 3O4LB 3REVB 3ARBD 4J12A 4K3JH 4OLVH 3CX5J 1A7PL 3GMRA 3OMZA 2IBBA 2D4DA 5IJVB 4L9LA 2BRRH 3LQMA 5IBTH 5KVGL 1X44A 2FATH 4PRBB 5HHVL 3WFCH 1MLCB 2Q7NA 5F1IA 3U4BH 1J18A 3VH8B 4RMVA 3HZYB 2NY1D 3JWOL 3UPAA 3KYMA 3H7LA 5CINL 4WJ5B 5DXWA 3S9DB 4JFOA 3PWPD 3F7RA 5I1EH 3JXAA 4XHJC 3OL2A 4LPVA 1D5MB 1CVSC 5C1MB 5F6HJ 1YQVL 1F4YH 3QAZB 3C5JB 5CGMA 4CJ1A 4PJ9B 3PNWA 5F89A 4CVXB 3MUY1 2WMPA 1FLTX 3QIBC 1T7VA 4NPYB 2VKXA 4HV8B 5DTFA 3B9AA 2C1OB 1YECH 1WBZA 1IEBA 3RDTC 4OD1L 5BVPH 4Y4KB 5DJ0B 5IK3A 2OL3B 4PJ7F 5I1DA 5IKCB 1KJMA 3ET9F 1JGLH 2CO6B 3K8LA 1TLKA 1AP2B 4MAYD 4U1JB 4Z7NE 1FYHB 2HWZL 2GJ6A 1CGUA 1CXEA 1FZOB 1Q1JL 5B38A 5E99H 3FB6A 4NO5A 4QRTB 5FYJL 4LL9A 5E8OA 5L2JB 4WCYH 3FOMA 2IADA 1SM3L 4XCYB 5DJDB 1LO2L 2HN7A 1T66C 1IJ9A 1CBVH 1R3IL 3O2DH 5DURB 2ZPKH 3FT2B 1RURH 3UPRA 5D7IA 1KENH 2H6PA 3HG1A 3MA7B 1U8NA 4JFHE 1LP9A 3O3BB 1J86A 3DHMA 5I76B 4ZTOH 3VXTA 1MFBH 2XA8L 4LRIC 4APQA 3M8OL 3BWAA 5F6HI 3MJ9A 4RGNB 4KV5E 1VCAA 3SO3C 1QFHA 3PDOB 4BUGA 4QRSA 5DJYA 2VXTH 4JFFD 3LSOB 2ITDA 4WVRA 1QBBA 5C08E 4K9EL 1P1ZB 3I50H 3EOBA 3QG7H 4C4KO 1KEGH 1U92A 1N26A 3QI9C 3RWIB 5ACLA 4HPYH 4D3CL 1BFSA 2SEBA 1XEDA 5D8JL 4NO0B 2EYTA 3D3VD 5EOTB