4JPKH

Crystal structure of the germline-targeting hiv-1 gp120 engineered outer domain eod-gt6 in complex with a putative vrc01 germline precursor fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGKNSDYNWDFQHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords Putative VRC01 germline precursor Fab heavy chain
publication title Rational HIV immunogen design to target specific germline B cell receptors.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jpkH01
1I3RA 1DBKL 4L4TB 4PJ5B 4N9GA 3OKDA 1QLFB 3O3EB 1DUZA 3QUMA 3WFEH 1C16B 2C9AA 4P5TB 1NAKH 35C8H 4ZTOH 5C08A 3W0WB 5LKNA 3HZMB 1A9BB 1CK0H 4HS6B 5I1LB 5AUMA 1VPOL 4ZUVA 3ZDXE 4GW4B 3NOIA 2J2ZA 5T1KA 5D8JL 2WBJA 3MFFA 4XVUC 4P9ML 3UO1L 1Y6KR 3LZFH 1MHCB 3S8WA 5KSVB 3K4DA 2UY6A 4NNXA 5D6DA 4H1LG 4IOFC 4C54A 2XQBH 1LO0L 4XH2A 3SBWC 5CP7B 1JE6A 4BQ9A 1YQ2A 1S9YB 1SQ2N 5HGHA 2X1PA 2IPUG 4HJGB 3SY0B 4MJ2A 4ONHA 1OTTD 4NYLA 2H2PD 2APWA 3EYSH 5F3BB 5HVHB 3CX2A 1NGYB 1FN4A 4JFPA 4PJXF 3VI3E 4BFGA 5AD0B 1ETZB 1KB9K 3AFLA 1PAMA 3IDGB 1KJMA 1Q8MA 3WLBB 3CUPB 4OF5A 4OM0L 1GGBH 2A73B 4U33A 2JCCA 4EI6B 5DVKA 4P9HL 5DUPH 1IAKA 4PGEA 1HXMB 5FEBA 4GBXA 4YLQT 5IWLC 4L29A 5E08H 1I1FB 1AXIB 1UCBL 3ZKNC 3T2NH 4XVJH 1LDPL 1UT9A 3RKDC 1JP5A 4BZYA 4CDHA 3EYVA 5DO2D 3QYCA 4G7VH 5HPMA 3T1FA 5JQHC 3TZVA 1ZLSL 4NM4H 4AH2A 3RWEA 1X4YA 3TN0C 3MGTB 2F8OA 1JGDA 2FX8H 3IDYC 3HC3H 1MJUL 4JFFB 2BDNL 2QSQA 1X5XA 1JTPA 1CL7I 2EXYC 1P4LB 3OSKA 4E0RA 2GJJA 3BO8A 1G9EA 3FFCE 1DVFA 3MUY1 3MRFA 3GMMA 1Z9MA 2NTSP 1ZV5A 5I0DA 3ARRA 1D5XB 3QXDA 2PO6A 5BVJA 3LKOA 3L3GA 1MQ8A 2YXFA 5I1DB 4ODBD 3UTSA 2EDLA 4ODVH 3BZ4A 1WWWX 4M61A 3U7WH 3OJDA 3S3SA 4PGBA 4X5XB 1EXUB 3ILQC 1MFAH 1GCFA 4HDIA 5C0CA 3EZ8A 5D5MF 2YMXH 4HC1L 3UYRL 3K0WA 1KXVC 4HHAA 1KLGA 2DTSA 3G04A 4X9IA 3QDGB 2R23A 4K7FB 3GSUB 2GUOA 3SKJH 4GS7C 5HGGS 3LH2H 1T80A 4XPGH 5I76B 1KTRL 2HFFA 4HT1L 5ANME 3ULVL 4E41D 1CZ8H 2A1WH 1HDMA 2Q86B 3V7AE 1JIBA 3ROLB 2DQIL 1QFWI 4GG6A 1T0MA 2ICES 3JV0A 1QRNB 4IRJA 5DJAB 4ETYA 5IFHH 1BZ9B 3FO2B 2BERA 4LLVA 4KI5E 5KTEH 3QSKB 4WDIA 4JQIL 5DLMH 1MNUH 2ADFL 2AK4D 4XGZB 2YPKA 5I66B 5D1ZC 1DANU 3MV9B 5I8CB 2HKFH 3U36A 4BKLB 4LNRA 4LARH 1NBZB 2BHYA 1YNKL 3KHQA 5IMMB 2OI9B 4OZHE 1EJOL 4MDJB 1A1NA 3N1QC 4LPCA 2NZIA 4EIGB 4APQA 2VXQH 4P2OC 5CP3A 2CKNA 2RCSH 1FYTA 1UH2A 2VZ1A 5BRZA 1UJ3B 3WKMH 4P5MB 1KOAA 4WI5A 5D2NC 1WGOA 5I1GL 3H7LA 4C4KO 2X7LA 4DN3L 2OXHA 3B2UD 4LPYA 5FGRA 3TN0D 1WVZA 5FHAH 3QH3A 4KAQH 4XBGA 1SBSH 3QUKA 2DICA 2AXJA 1HHGB 3AXLB 3U2SA 5KVFL 5KSUB 4ZSOB 4CU6A 4NN7B 4ODWB 1CG9A 1HHIB 5L2JA 5HYJD 3HB3D 1FGVH 3N0PB 4HS3A 2R8SL 3AM8A 4KC3B 3U82B 3BMVA 2F19H 1R3KA 1KPRB 3OGCB 5C92A 3ARBC 3MO1B 1ZOXA 2ICCA 1FL3B 3O6MH 1T1WA 3WMSA 3VGFA 4HWBL 3ILQD 3QI9C 5JHLL 1G7LA 2G5RA 4YX2H 3IFLH 2XWJB 2XOTA 4XPFH 3C2AH 4Z7WF 2P5EE 4LVOC 1T4KA 8FABB 4JM4H 2EE9A 4KRNA 3T1WA 5I8KL 3P11H 1T7YA 1S7WB 3I2CH 3KPSE 1T21B 4O2CA 3VWKC 1OW0C 2BVQA 2DMCA 1H3VA 4XC3H 3UTQA 2EDNA 3ARDB 4MJ6B 4MLIA 4RDQF 5HGDB 2MOVA 3GJFB 4ALAH 5DSCB 4F7EA 1N0LA 5T3XD 5KOMC 3TYFA 1FFNA 5IEHA 1ADQL 2BFVH 3GIVA 5C9KA 4I3SH 2GHWB 5D7JB 2KH2B 4AYFA 4H8WL 3QPXL 1P4IL 3MRRA 4JDVB 1AE6H 1LQSR 5GRXG 4FQQA 4ELMA 1CVSC 4K94H 3RJQB 4HMCA 4NO3B 1INQB 4PJ8B 4JQVA 5FA3B 3THML 3BGMB 1I75A 2GSIB 5CINH 1OSZA 3WFCL 2B7DT 3SDXF 2R2BB 4GKSB 1G7QB 1AGEA 3NH7H 3SGEI 2AV1B 4AT6B 1CCZA 1J1PL 1RVFL 4RZCB 1K4CA 3ROOB 1MAML 1AO7A 1D5IH 1N0XH 1AHWB 1T1YA 2Q7YB 3BKYH 4P2OD 2FX7H 4HIIA 3K4AA 1U93B 5GGRY 4PJIB 1ZLWH 1CL7H 5L7XH 4U1NA 1FSKB 1RZ8B 3WHE1 1YPZF 4FQ2L 4GJTB 4FQJH 1F4WH 1OARL 1VKXB 3L3OB 3TO4C 4RWYL 3WL9B 4KK9C 2DWDA 3MJ9A 1S5IH 5B8CB 3WXWH 5FGCE 4PJXE 4Q9CA 3VFWB 1A9EB 5IF0A 5J9PA 1UVQB 3TNMA 3M8OH 3BRDA 2VLRB 5FDYA 3QNYA 1MJ7H 4LSPL 1MJ8L 3MV01 2VL5B 4YQXH 5E8OB 5GJTH 1S78C 1QSFA 1OAZH 3G08B 4O02H 3VD5A 1U8LB 1TVBA 4YHIA 1KULA 3VMNA 1YMHB 2ED8A 5DI8A 3SDCC 5EU5B 1NCCL 4JZNA 4YHZH 1JPGB 5E99L 4RX4A 1AR1D 4CAGA 5IGXH 1EZVY 2D7TH 4H20H 4DCQB 3QI9D 3MBEB 1AP2A 4QT5A 3H7BB 4PJFB 3B4NA 4ZO7A 1QVOA 3E2HB 3MRIA 2X70A 3U4EB 3AAZA 1E0OB 3OKNA 4YAQA 2O93L 4GQPH 1DBJH 2CIKA 5SWZE 4P2QB 3TYGH 1QZ1A 1LK2A 3LD8C 1GC1H 2CDGB 3IU3A 3H3KA 1OGTB 5F7EL 1QFWH 1UADC 4LASL 3G5XB 3QQ4A 1OAKH 4OI9A 1I7ZA 4WFED 4U6XA 2F53D 5CIPA 4Z7UA 1WCBA 5IROC 1MCPL 1NKRA 1I7TB 2GITA 5DJ6B 3FN9A 3DVNB 2OSLB 3FFCA 1EA9C 2ZUWA 5F9WB 4EN3C 2P8PA 1GGIH 4G6AC 4RWHA 1DN0B 1NSNL 4ZXBB 3FO0L 5ICXA 4JPVH 4GW5A 4NP4H 4A6YB 3JWDC 3MFGB 5GIRA 5FF6A 5D5ME 5DEZA 1I8MA 4UAOB 2GFBB 4C57C 4XPHH 1JPST 4ONOA 4LRIA 2MKWA 5MEQA 3MNWA 3G6JF 4UTAH 2H8PA 2EDOA 2P8MA 3ARVA 4MNQB 2VIRB 1HINL 1ZS8B 4OT1L 3BIKA 4WWKA 5HHNA 1CICB 4NC1C 5EUKB 1T89A 3RJDA 2MCPL 4K8RC 1F3DJ 1NMAL 3ZLQC 3AUVA 2P43B 2BOBB 3D3VE 2CLRB 3O0RL 2VITA 2OTUA 1E4WL 1T66C 2F8XC 5FOBB 1FG2A 5T1LD 5T5NF 5IMOB 2DD8H 3TO4D 4PV9B 5E9DD 5ISZB 3GSNL 3ZMRA 3BKMH 5DT1H 3BP5A 1PG7H 4H26A 4YNYB 5F6IB 2C26A 1DFBL 3LOWA 3OG6B 5HDQL 1JHLH 5INDB 1HSAA 5FO8A 3KPQA 3WE6A 3SDDB 5HHOB 1QA9A 3H0TA 3OF6D 1JGUH 4CRPA 1KCSL 1OL0A 2XXMB 3ARTA 5DHVA 3S7GA 3K2UL 3EOBA 4F8TA 3ULUF 2YPLB 2Q1EA 2X40A 3OJ2C 5EA0H 3RHWF 3SPVB 4PRPE 4N9OB 1RUML 4YDVA 1LP9F 1VENA 3VFGL 4GAYB 4POZC 3BN9C 3C5JB 4YHLL 3OKKA 4KDTA 1XR9B 1J0HA 3O2DL 4M48L 5HYSA 1UWGL 4GUPA 4Y19E 3HE7D 4YPGB 1NC4A 4LMQE 4N5EC 2JELH 2DM4A 5GSVB 5K9JH 1MPAL 4LIQL 2Z91B 4Z7NF 2W0KA 3KYOA 4ODHH 4B0MM 3JV5A 3MLRH 5E8EB 2JB5H 2OL3A 1AGDA 2YRLA 4LSRH 3UPCA 5I9QC 5C1MB 4J3VA 5FUZH 1T5WB 4QOKE 5C0GA 3P4NB 3MRDA 5JW5A 1WICA 2VLJB 2CJUL 4UDTB 3B9VA 1H5BB 5EIVA 3I6KA 3BD5A 3WIFB 3Q6FB 4I0KA 4WWID 3CFBB 4PJHA 4LVEA 4U1IB 4X8JA 4NDMA 1BFVH 2R39A 2HT2D 3QEQE 3RIAK 1FV1A 5KSAD 1PEWA 3LKPB 2EH8H 4NQSB 2I07B 4X7DC 3OR7B 3WFZA 1Z5LA 5H35B 1IL1A 4CADB 4Y16C 4X4XA 1GOFA 1AY1H 2FD6H 1KCLA 4Z7WE 3T0EC 4MMXC 2CDEB 4LLQA 4CKVX 4NKIL 1YN7B 4JFDB 4UDUA 1UWEL 3NACL 3EDJA 1WBXA 5MENB 1A5FH 3MACH 3B3IA 4G6FD 3SDAB 2AI0H 4TUKH 4QF1B 4JKPL 3OR6A 3SCMA 5C0BE 1QFWM 5T3ZD 1U8MA 2AEPH 2GSGA 4YH6A 5DS8A 3DO7A 3IRPX 4M8QB 3N9GH 4PJCF 4ZPVA 2ATKB 1TENA 4Z95L 2Y9RT 1OAQL 1GZQA 3KHOA 2Z31A 4HFUH 4UILH 4PJEA 4ACPA 2DI8A 2XKNB 3CDFA 3C9NB 3ZSSA 2FLRT 1YEJH 4JHAL 5LQBH 4F9LA 2BSTB 4M62L 4KRPB 1G9NH 1OAXH 3SDXE 2BCKA 1Q1JH 4DN4L 3KYKL 4OZGB 4MB3A 1FL6A 4RMTA 1X5JA 3I50L 1M7IB 4RFEA 2HN7A 3RNQA 4H25A 4YO0A 3DV6A 1P7QD 3TBYA 1G7HB 4LK4A 3JBG7 4X7TB 5H37G 1YPZE 4EQ2A 3VJ6B 4JB9L 4WO4C 4F7CA 1HCFX 1UZ8A 3BI9X 3CFEB 3UCRA 3FRPG 4WI9A 4Y4KC 1N3NA 4X4MA 3T0XA 4UQ3A 1G0DA 5IT2H 4P2RA 2FJGA 1NCAH 3NIFF 2IF7A 3DSNA 4Q9RH 1C5DA 2VNCA 4O2FB 4OF0A 4JFHD 1HHHA 5GGTH 1T83C 4WTWA 2Y6SD 1J0ZA 1MHHB 3CC5B 4XMLH 4XTRC 3LIZL 5KJRL 4Y2DD 2IG2H 2Q3ZA 3ZL4H 1A21A 3IJYA 1RZKL 5HD8C 1ZANH 4MAUL 4OV5A 1R5WA 5C0RL 3EJZC 1XGPA 3WD5H 2Q76A 3MUGA 2YZ8A 4R97B 4OD3L 3DGCR 5MHSE 4I48B 1JZ3A 5LBSL 3H9HA 1FIGL 2CH8A 3R8QA 1CBVH 2A83B 5FYLE 1VFBA 1IEAB 3PUCA 4JY5L 4Y16D 4OZ4B 3EOYG 5J13C 1IM9B 1AQDA 1UKTA 2MFNA 4Q9QL 2X10A 4ZTPL 3G6AA 1QBBA 1TDQA 2AABL 3IFPB 4XBEL 3IAPA 4FTVB 1I9IL 3HE6B 3O6FA 4R2GD 2ADJA 2J6EL 4BQ6A 3MLWH 3NA4A 1SY6H 5SWZA 3MRJA 1ZT7A 4R7NA 4HJ0D 4L3AA 5JLZB 1A6PA 5AAWA 3BPLC 3UYPA 4WV1A 4JG1L 1FL5A 1IC5H 3CXDH 1MVUB 2BNQE 1V7NH 4HXBL 3RX5A 1KJ3H 2AXGB 1INEH 1NGZB 2BXZA 4CU7A 3BW9B 1NAMH 3D9AH 4OI7A 2NQCA 3AREB 2C7UA 2NNAB 2J4WH 2JJTC 3TFKC 4WW1B 2BSRA 5DQ9A 5FA4B 1MFCL 1MRDL 5IHZA 4CN4A 1W72H 1MRFL 3G6JE 1A3LL 4JFQB 1JPSL 4NQEE 4JVPA 3BVNA 4X99A 4NBZB 3UTOA 2GJ6B 3RU8H 3MLPA 4YFLI 1KIQA 5C6WH 2CK2A 2EC9U 4KZDH 1EO8L 2ED7A 3LEXB 1DDHB 5CZVL 3HAEA 2IANE 3GGWB 1OCWH 4MJIE 3O2WL 5IVZB 1H0DA 5EZOH 4EI5D 1N7ML 4HCRA 2WBWB 2NX5A 4XT1C 4NPYB 2R69L 4HGMA 3DVGB 2OTWA 4M7JH 1JK8A 4JJHA 3KYNA 4XMPH 3TV3H 2CQVA 3OZ9L 1YA5A 4K9EH 3PNWB 3G5ZB 2X09A 3HPLB 4H1LH 1I8IA 2XFXA 1RK0A 3T65B 2BRRL 4GXUN 1B2WL 4ODXB 5GGQH 2C4XA 4JDTL 2F74B 1N5YH 3RWJB 2OR9H 3ULUE 1E4JA 5KN5B 3MZTA 4X80H 1PGRB 1LP9E 1OAUH 4EUPA 2A0LC 5SWSB 5I74C 5CBEA 4BFIB 3BQUB 3VG0L 4AM0B 3HR5A 1FO0B 5CEZL 4JO4H 1DEEB 3UTTA 2VZSA 3GFUA 2ZOLB 3NCJL 5E2WL 1A3QA 1AGCB 4N1EA 4ZS7H 4Z7NE 1S8DB 4MNGA 1FJ1A 4LRNH 5FK9B 3NTCH 4IMKC 2BK8A 3B9KC 3RL2A 1ZK9A 4WGVB 4JEGB 4KDWA 5J12B 4QXGH 3VXNA 1FPTL 3O9WC 2H32B 2RGSA 1OGAA 2HVJB 4C55A 3KPNA 4MD4B 4F2MA 1IE5A 4ZAKC 1I4FB 4K94C 1U8NB 3B9EA 5KVGL 1K6QH 3BJ91 3C5ZC 4QEGA 3ZDZF 2CO7B 1C08B 1HQ4A 4UT6H 3GMNB 1FDLL 5FKAB 4AQ1B 5KVMC 2QADB 5GZND 1CD0A 1RIVH 3P77A 2UWEB 2GTZA 4U1KB 3VRJA 5L2KA 4MA1B 4N0CC 1IKFH 4GXVH 1RK1A 3QIBC 2JIXD 5JXAL 5L8LB 3BWAB 5I71B 1XAUA 3KXFB 2R1XB 1P9MC 3LRSB 2BY2A 4MQXC 3SBWA 5EWIL 1RZJL 3VDAA 4E41A 2O26U 3OAZK 3VCLA 3GBLA 3ESVF 2K7PA 3HRZA 2VDOH 4NO2A 9CGTA 5CJ8A 5ERWA 4LBEA 3LPFA 3NA9H 4PRDA 5FIEA 5FB8A 4B41A 1EAJA 2JTDA 4JFEE 3DSFH 1LK3H 3QG7L 4NQXA 3B43A 3V4PH 2PTVA 4XHJC 2XN9A 1NUFA 3WIHH 2DKUA 4PJCE 4DK6A 1QSEE 1R3JB 3KNBB 3HR6A 4Z78A 5IQ7L 3NZHL 5B38A 2Z92B 3I9GH 2AK4A 3ARZA 1RZGB 2DQCL 4X98B 4KI5D 1KEMH 2E6JA 1XT5A 5C7XL 1HH9B 1GOHA 4KZEL 1ZGLP 1JL8A 2Y4SA 4XXDB 4D0BB 1FZKB 1ZA6B 1RPQA 1KCVH 4DFHA 4Y4FC 4M5YL 4QRPE 5IWLA 4Q7DA 4R0LA 5HYQB 3EGSB 3EDEA 2ZKHH 2FB4L 2H9GA 4LCUB 4HV8A 2DIAA 1QLRA 2Y06H 3KJ4B 1AQKL 4TULH 3MRMB 2NXZD 1TMCB 5ESVB 5GGRB 1YNLH 1C12B 3TN0A 5J11C 2J12B 1R0AL 4LHUB 4AIZB 2A0LD 1GC1C 2H45A 3QO0B 5HGBB 4F15B 5ITFA 5ELIA 4BH8A 3FQXA 3BAEH 2GIYA 4UT7H 3DHJA 5JW4M 4HKXB 1FNSH 1A6WL 3BUYA 2V2TA 4ZPTB 1YPZA 1T0NA 3BFOA 3PP3H 2EECA 3MV7B 1JZ7A 2NY0B 5C0AA 1LGVA 3RVVD 2NW3A 3BH9A 4HWZA 4AIOA 2XPGB 5E7FA 1HQRB 5CJBA 5DTFA 4U0QB 4XC1L 2Z93B 3O9WD 5BZDB 2CXGA 2AVGA 3UJJH 1RUPL 5BS0B 1G6RB 4KMTH 1A7BA 3STZB 3DBXA 3T2QA 1NANI 3C5ZD 4NSKB 3RBGA 4UI2A 5IBLC 2X1WL 1JZ8A 1RUAL 5I1AB 5BW7C 2ZPKL 4PJ9B 3LS5H 7FABH 2O5ZH 2CLZA 3MLVL 1TPXC 3CCHB 3QIBD 3MLTA 4YDLC 1BPVA 1BJMA 1YMME 5DJDB 2P5ED 3RWGB 1V3JA 3VFOA 4YGVA 3QUML 2LFGA 3PQYB 3RVWC 3KPSD 4XX1E 4KTYA 1G7MA 1DLFL 3CZJA 4LSVH 5DJYA 3MXWH 1HHJA 3QEUB 1XGTB 4L5FL 3OKEB 1UH4A 3VXQA 1AGFA 3WUZA 1SEBB 5DJ8A 1ZWIB 5CJXC 1IT9H 3BPNB 1P2CA 1TNNA 5BCAA 2MNUA 3BGFB 4HF5H 3QDME 5JIIA 1YEHL 2VE6B 4NQDB 5EN2B 3LN5B 5D1ZA 2R4RH 3PWUA 5CMAA 5A3IC 5EZIH 3KGRA 3HG1A 2BNQA 4IRZH 2XRAH 3S88L 2XTJB 3QFJE 4Y88A 1EMTL 4PY7B 2W9DL 3U9UB 2ESVE 5ETUB 1YJDL 4BYHA 3MRGB 4XBPB 3BPOC 2W0FB 3RQ3A 3F8UB 1KGCE 3P3YA 1UYWH 4LGPB 3S34H 5IB2B 4PRIA 2DN7A 2VC2L 5GS3A 5D2NA 2IAMB 2FIKA 3QJFB 3BH8B 4QHLA 1J8HE 5AZ2L 4JLRB 5F89B 4OF7A 5MI0B 4JHZA 1VESA 1HSBA 5DEGA 1MI5D 4F9PC 5KAQG 1MCOH 4PB9H 3VH8B 1QHOA 2EIBA 2DQFA 3D2UA 1BEYH 4M3JA 4XP6L 1HXYB 2Q8BL 3BWUC 5JIHA 4YIQB 1W2KT 4PJ5E 4K7PH 4WGWB 3MJ7B 4R4FL 4GSDH 1BLNB 3QRGH 3B8YA 5DEFA 3ARBA 1X44A 1FRGH 4YHKL 5C3TA 2D4FA 5CSZB 5CD5C 3W39B 5I1KH 4PREA 3SO3B 4AG4L 1ZHKB 3EYFA 2CD0A 3IJHA 1AXTH 2GAZA 3MRQB 1QPXA 3CMGA 3SE3A 4G5ZH 4YUEH 5AYUL 5IB5B 2IALA 1XF3B 3ARSA 3RUGA 1U3HC 2BZDA 3TO2B 3DUUB 4OQTH 3RAJL 1CU4H 1MLCA 2B5IC 5D71H 1P69B 4GAFB 3VWKA 2EE3A 1OW0A 3BPCA 2B1AL 3VRLF 1HH6A 4OFDA 2L7UA 3Q0HA 4HIXL 3RVWD 4LVNC 5E24E 4OD2B 3QJHA 2F53A 4LCYB 5FFLA 1OD9A 4Y5XB 3QUXD 4TVPL 3U9PL 2Q3AA 3MMEB 1QNZH 1B6UA 4O51B 2FHCA 1L0XA 5I16B 1FNGB 3V0WH 3FQTB 2P47B 1IGYB 2PCPA 5CD3B 4IJ3B 4YK4B 5F9OH 2NTFB 5C0IB 4NQCE 2D4DA 1AXSB 4OIBA 3DXAA 2X4RB 2ITDB 2SEBA 3QR2A 4S10A 5D6CB 4FABH 2VWEE 3P0YL 3WDHA 1G9NC 2AQ3A 3ELAT 1A1MB 1GAFL 5KG9B 1RJZA 1PY4A 4MAYC 2E7HA 5I6XB 1OP5K 5L88L 4W6XB 1F11A 1KT2B 2Q8AH 1GSMA 2X42A 4Z8FL 5F3HB 2DQEL 1T1XA 3NPSC 3D18A 4KUZL 4P46C 4PJFF 2F54A 1A7PL 5TDPB 3U30C 3CDCA 3RVUC 3Q6GH 4HUUB 4O2EB 4OLWL 1WTLA 4OIAA 2IQAA 2G9HA 2R1YB 5DMKA 5J6GB 1ORQB 3CVHA 3QIWC 5TDOB 4XZUB 1TVHA 4YDJB 2J8UB 5EU7E 3K1KC 3VXRB 4D9RD 3NABH 3TO4A 1NCBH 3D3VD 5E8PB 3DX6B 3IYLW 5FKPA 1JMZA 1KN4H 3HMWH 3D6GA 4XCNB 4X8XA 2R2HA 3QUZD 3OF6A 1WFOA 5KVDH 1HI6B 3UXFA 3EYQC 4N0UB 5EORL 2R29H 2ADGB 5I30L 4LSTH 5JPNA 5C0EA 2DQGL 2GEEA 4KU1A 4W81A 2GT9B 4HBCL 3LQMA 3L6FB 3SDCA 2BMKB 3UROR 2YRPA 3PWPE 3FOMA 1XF4B 5ACZB 2HMIC 5EZLA 5FXCH 2EIDA 4PRPD 3IKCB 4RA3A 3HNSL 3GRWA 4NO0D 1XIWB 3LQAL 4JVWA 3WSQL 2Y07L 3DMMD 3VE0B 5JORB 4GMSH 4WI6A 4A2MA 2VDMH 4JGJA 4TSAH 3FFDA 5DRXA 4C83A 4PBXA 4Y19D 1J12A 1CLYL 2WIIB 1SEQH 2HA1A 1BGXL 1CLOL 4U1GB 2IPKA 1AGBA 3MZGB 3CMOH 4PLNC 4DTGH 4G9FE 2ZJSL 2I9LB 4HIEA 4LQFH 3H9SD 3PIQB 4GRLC 4QOKD 5EU6A 1N26A 5IROA 1MAJA 3PDGA 5M94B 4PJGF 1A22B 2HT3C 1X5LA 3C6SB 1KCUL 5IKCB 4EN3A 3FCTB 5TDNA 5DWUL 1KELL 4CN1A 3QEQD 3A6CH 4HZAA 4HUKB 1LO5A 3HZKA 1VADA 3OKLB 2MHAB 2C3GA 3KPOA 1JF1A 4LLMA 5F1KC 1N6QH 1SYVA 4PJDB 3TVMD 1RJYA 2V2XB 3Q2CA 4K3DH 3QXTA 2BY0A 5JOFB 1MCQA 1XH3A 5F9JB 3UJIL 1OSPL 4KVCH 1CDJA 3D39B 2HT4C 5DUML 3CDGB 3QUYC 1MWAB 2NW2B 4XNXL 1P6FA 4B50A 4RCAA 2H1PH 1FNEB 2LU4A 2AQ1A 3Q1SL 4P3WA 4TSBL 3C60B 3QIWD 3X3GL 1RU9L 4KJYA 4LHUG 4OJFL 4Z6AT 1ND0B 5C0BD 3UPRB 1WWAX 2W9LA 3FT4A 4NZDA 4WENB 3L95A 4S1DC 2G60L 3TP4A 3LPGA 4LAQL 4BK4A 4UIMB 5HI4D 4R96B 2QSVA 5CSBA 1FZMB 3QWOB 3RIFK 3MV8A 3T08A 5J1AA 2AJSH 4K9EC 4ZUWB 3KYMB 3FO1B 3ECBB 2AJXL 2JJWA 3O4LA 4JM2F 1VFAB 3NAAH 1QSVA 4BSWB 4WFHE 3EYQD 4M43H 2ICWI 2N4IA 3INUH 3MJ9L 5J89A 3E0GA 5B3JF 1LO2H 1Y18B 1RULL 4G8GD 4X6DB 2NY6C 4HEPG 4JRYE 5GS0H 1WUNT 4L4VB 4KKAD 4KKNA 5FUOH 4Q74A 5DK2B 2HMID 2ED9A 3DTXB 1R5IB 1CLZL 1V5JA 2ZG2A 1FZOB 4X7CC 3IS1X 3ES6B 4FQCH 1IGJB 1IGTB 4GAJH 5DJ2A 2PW1A 2C3WA 4P57A 3QQ3B 3DROA 3RZCA 5D7IB 1JCKA 4XNUH 3DUHA 5DJXA 1BAFH 3IS0X 1TJGH 4WU5A 3TJEH 2HTKC 1M7DA 3V5KA 3PWJB 3O2VL 3SE9H 5CJ5A 5HGAA 4FP8H 4I3RH 4L8DA 3GB7B 4QHUA 3TBWA 1E6JH 2CSPA 2EEBA 3SKMB 2JK5A 4KV5F 5E00A 2HT3D 3QCVL 1LO4H 2XY2A 3QULB 3OTTA 4JN2A 3ULVF 3WNOA 3AROA 5MHSD 4UUJB 4BSVB 2MSPA 3BIBX 1KYOK 4LDLB 4ISVA 3T0EA 5TE7H 1NDMA 3FTGA 4OUUA 1U8PA 2ZSWA 1RFDL 3WEXB 4OGZA 3D1MC 5FYJL 3VRLE 3O4OB 5F1NB 5DD6A 5DMGD 1NCDH 3MROA 3MOBH 3GJFH 2VZTA 4PRBB 5F1OB 4IHOB 1KACB 1AI1L 4I0PC 4PIRF 1BF8A 5I1EL 2E7CA 4KKBC 5I2IA 5KSBF 4FZEL 5TH2A 1T3FB 3VW3L 1QKZH 5A16A 1UB5B 3LY6A 3VH8G 1I1CA 3V52H 4S1DD 4OUOA 2NLJB 1VGKA 4RISH 3FN0H 3MBXH 1J10A 1K2DA 1VACB 5EIIB 3IDNB 1MAKA 5JXED 4PJ7B 2HFEB 3BDBA 5BOPA 3EYUL 4QTHB 4CMHC 4MD0B 2GK2A 1AJ7H 2EDDA 4O58H 5CCKH 4X6CA 3NZ8A 1U6AL 4PJFE 1UXSA 4PJBA 1NUDA 3MFFB 3V7MA 5IIEB 5E4EC 3UTPE 2MPAH 3AVEA 5DJ0B 1UENA 5SWQA 1WZLA 3QEHA 1UZ6E 4G8FA 3L3DA 3C8KA 4NNXB 3V6OC 1HCVA 4CVZA 5JQ6H 4WO4A 2R4SL 4RGNE 2VR9A 3S35H 5GS2H 2QSCH 3Q5YA 3I02A 1FYHB 4Y4KA 3VFUB 2PR4H 4K3EL 5T33L 1FVEB 4YDIH 5D7SH 3LRHA 2IAND 2NY1D 5IM7B 4QGTA 4MJID 43CAB 4NYLB 4U7MA 2NY4C 2CMRL 4Z0XA 3VXUE 1T83A 1SMOA 4EOWL 4ORZC 2Y5TA 2EE2A 3WJJC 4I77L 4ONGH 2R0ZH 1RJLA 3LQZA 3EFFA 1RUQH 2HRPH 4BELD 1KJMB 2ERJB 5T1LB 2VLKA 3I3DA 3RVXD 2HAZA 4R8WH 2Z4QA 2J8OA 1WIUA 4WTZG 2OL3L 4S1RL 3ULUD 4UIKH 3ZE0F 5J6HB 4ETQA 2R0WH 1IAKB 1R3LA 3RIAF 1B0GA 4V1DB 2BSSA 4MNQE 3AS2A 1DQJA 3KJ6H 5HPOA 3EYOA 4L29B 3CXHJ 3P0GB 3NMEA 1KC5L 2JJVA 3MLYH 2XZAL 4JANA 2CGRH 4K3JH 3PGCB 4AH2B 1NDGB 2QHRH 2UUDH 1YY9C 3H3PH 3JTTA 5LGJA 4S1QH 3P4MB 1EEYB 4LSSH 1UM6H 3QHFH 3D25A 4LPVA 2DQHH 5KS9B 5I8OH 4OCXL 3UMTA 4I0PD 4QTIL 5TJWK 3V6ZA 4E0RB 4L3EA 1ZMYA 4PJGE 3HE7B 4QRSA 15C8L 4G6ML 3GMMB 4OTXL 4OM1L 4UV7H 5CEYB 3E8UL 4A6YH 2BNRE 1B0RB 5J3HD 3AY4C 4OAWB 3T0WA 3I85A 4YXKH 2R0KH 5ECJE 5EOCL 2YPLE 1LDSA 2JJTA 1QO3B 4WJ5B 2V2WB 1FLRL 3ZHLA 3QWRD 3FB5B 3MUHL 4IMLA 4DGVL 4URTB 4LOUC 4HPOL 1MEXH 4OLYL 2MJWA 4G80A 2VXTH 5LJYH 1DANT 3MNZB 4QCIA 1CFQA 1R3HB 5KSAB 3WJLC 5BV7L 3F7PC 3NFSL 3FN3A 4FXKB 3RZWA 1S3KH 2AXFA 4PS4H 1I8KA 4M7ZB 2YOCA 4JFED 3BSZH 2YZ1A 4GMTH 2HFFB 1F2XK 4GRWH 4WU7A 1IGCH 3HI5H 3X11B 3GSQA 1QSED 2YXMA 2QTEA 4JZOA 4KHTL 4PRHE 5FYKL 2PTTB 1ODAA 4WW2F 1TQBC 4GG6B 2BVOB 1T0MB 5CGMA 4G6FB 5FO7A 4LCWE 1ZVHA 2VZ3A 3QHTC 4NFDA 3P0VH 1I1AB 3CZFB 4WDIB 2V5YA 5GS1C 3U7YH 2E5EA 1T5XA 4CVWA 2CDFB 4QRPD 1F2QA 3V6FA 1Q9LB 3ZO0A 5HJ3A 1JWUA 3VXTA 4KJPC 4KQ4H 2YA0A 1L9MA 4LNRB 4L8CA 4HX1A 1BVZA 2W1NA 3QDHA 3V0VB 2C1OA 4MJ5A 5EPMA 4Y8AA 2VLME 4Y5YC 1Y0LA 5CJQH 3O3BA 4DVRH 3BEWB 1OTSD 3GI9L 1KBGL 3ZYJA 4JY4A 1NFIA 3FQNA 3LKNA 5JO5A 5BRZB 2IFFH 5MEPB 4JPKL 1VERA 3VXSE 3MYZA 5E5UB 4IMKA 4ZUSA 1J5OH 3B9KA 1IC7H 1I9RL 4RRPA 3QUKB 3OHXB 4P5TC 5F7FA 3EOTH 1P7QB 4DKFL 3U2SB 3O9WA 4NFBA 4YJZL 1DSFH 4U1MA 3WCYA 3E3QE 2QQQA 5F7DB 4ZAKA 5JUEH 2ID5A 2DQTH 4AENA 3C5ZA 1E6OL 4KV5E 4HG4K 1MQKH 4HS3B 1MJUH 4M4RA 4KRMB 2APXA 4K71B 4L9DA 3ULVE 1KCKA 3QIBA 4IDJL 1KENH 3FOLB 4BZ2H 2DKMA 2WLZA 2ZUUA 3JTSA 5CWSB 2IWGA 1P9MA 2GKIA 32C2B 3O3AB 4WVRA 2UZIH 4OGYH 2V5TA 4WUUA 4QRRA 3IAQA 4G6JL 2FYYB 5GSRA 1YMMD 4Y1AE 1XZ0B 4MQ7B 4PD4K 1BOGA 5AZEL 3VXME 3O41A 4AL8H 1FVDA 1LNUA 5IJKC 3D0LB 1ZVSA 3AMKA 3R1GH 4RAUA 2WQRA 4QXUL 1NPUA 5HVHC 3SO5A 5JHDA 2DMBA 1AIFA 1MY7A 3BT2H 5KANI 3A6OA 3C2SA 2OQJB 3HNTL 2P44B 2WUCH 2YSSA 1KJ2B 3NN8A 4F7EB 3V4VL 3B5TA 2D9CA 5F1SA 2V7HA 2D0HA 2HJFA 5DFWH 3OXRA 4MVBC 4OFYD 2DRUA 1KLUA 4G7YH 3QDMD 5DYOA 4R2GB 3EO0B 3BYYA 3K1DA 2Q6WA 3MCKA 4YFLF 4Y4FA 1U8JA 4MB4A 4LSUL 1P6AB 1UEYA 3QEGL 3VD4A 1ZT4B 2OM5A 4MXQD 3QFJD 4XP1L 2ZWLT 5TQ0L 3QHZL 4HCRL 2ESVD 4ZUUB 5IVXA 1XCQB 3WDJA 3ARPA 5DD3H 5E5MB 2GYSA 1KGCD 3IRZA 4F7PA 2FGZA 1F13A 3O45B 3FO9A 4EBQH 1MI5A 1PVHA 3VFTB 5EU7C 5DQJB 3SGJC 1J8HD 3FMGH 1K4CB 1RHHB 1R24B 4Z76A 3QIUC 2Y7QA 5C0DA 4KK8C 1UXWA 3RY6C 2LQRA 3P4OA 4M7KL 1TZHA 1NL0L 3QB7C 3DX9B 2A38A 4PB0L 5HYIA 3L5IA 4ELKA 1X4XA 1EJOH 4PJ5D 4GXUM 1YDPA 4NZTL 3RGVD 3FRUB 2QKIA 4ZNEE 4NM8L 3TNMB 2UZYB 4U3HA 1TTGA 4BQCA 5SX4H 2EKSA 5EO9B 1UQSB 1V3MA 1AKJA 4EI5B 4UNUA 5A2FA 3T77B 1TZGH 2YPVL 3HI1B 3HLAA 3ZE0E 2FWOA 5BW7A 4DZ8B 5DF0A 2BNUA 1U2CA 1EHXA 2E9IA 3ZSTA 1CGYA 2NY5H 3WBDA 5IESH 1P4BH 1PX4A 4NKDA 2DL9A 1OM3H 1SM3H 4HKBA 2VZUA 5FCUH 3LEVL 2X70B 4NWTL 5IFAL 4GT7A 4TQEH 3I6GA 2L4OA 5D9SA 2CIKB 1J88A 1LK2B 1T20A 2FR4B 5KZCD 1S5HB 5T5FL 4TUOA 3OMZA 5CJXA 3VFNA 1FVCA 5TPWH 5ILTH 5C86A 5L6YL 2FH8A 1QLEH 5AG8A 4X9GA 4Z7UB 3CSPA 4I2XE 3MXVL 2PW2B 1A2YA 3EOAA 4AIXA 1J1OL 2GITB 5DD0H 2FO4A 5SX5K 3FFCB 1J05B 5GZOC 2OI9C 3GK8L 2NR6D 1F3JB 4DW2H 1IC1A 4IOIA 4XAKE 4JN1L 3CH1A 3HS0B 4GW5B 5CIPH 2AK1H 5GS0C 2H26A 1UJ3C 4OCLC 5GIRB 3QXAA 5FF6B 3SJVE 5CILH 5EU3A 2HFTA 3ZYOA 3C08L 2BY1A 2B2XL 4MCZB 4JRXE 3GHBH 2DQJL 4OSUL 4AEHH 3H2WA 2R9HC 4JFFD 5TF1H 2WV3A 3P30H 5I1CL 2EXWC 1CGVA 1V7MH 4HQQL 4G42A 4F9PA 1F4XL 2JIXB 3RWDA 2X4TA 2DI7A 3RWIA 1CE1L 4WWKB 5ENWA 2VDKL 4KGJA 4NN7C 3NPZB 1KPUA 1F97A 2VN4A 4XVTL 3S35X 4E5XA 5KW9H 3HUJF 1BQHB 1ZSDA 3CK0H 1QG3A 1HEZA 4ORGB 5ANMB 5T1MA 3PXJA 3GBNL 3QNZA 4JFZL 1KF9B 1I3GL 1ZLUK 4JO3L 2WAHA 1S7XA 5K9KA 3S36L 5LXGL 3CLFH 1G9ML 4OLUL 1G7PB 1HSAB 4QXWA 4S1SL 3QAZB 3KXFE 5C70A 5FCSH 5BOZG 4RMQA 2E7LC 1WIOA 1IGML 1U3HA 4NHUB 4OKDA 3QDGD 5C09E 3ZE2F 1KEGH 1FO0H 3ARDC 2F5AH 3TBSA 5EOTB 1F8TH 5GISH 2ZZUT 5DHVH 4LCIH 1BD2A 3S37H 4FFYL 4F58L 4FFWC 3H9SA 4HWEL 1KN2H 5CBAA 4OZHB 4GUPB 3VFVB 3VMOA 4EQ3A 1NC4B 4AEFA 3WUWB 2NXZB 3CFJB 3W5NA 5D7JC 2B20A 4G9FD 3DO3A 1QRND 3U48A 4X4YB 4L8SB 1YEFL 1KUMA 5ESAA 4Q9BA 4D9QD 2JE8A 3TJHD 2A6JB 2OL3B 3UYOD 1OPGH 1FG9C 2YN5A 3SGDH 3MA9L 3MRDB 2PYEA 4UB0H 5E6ID 3MV9D 4OCYH 2VDQL 4GLRI 5FYLL 1IGIH 1ACYL 2X2YA 1WT5C 3M1BB 4BUGA 4MAYA 2H6PB 2Z8SA 5HI3C 6FABH 1H3PL 3EO9L 1AHWC 1FV1B 4JREB 4MX7B 1A7RL 1JPFA 4P46A 1O0VA 3TH4T 4EEEA 5JW4Q 1GL4B 1FSKC 3HC0A 4H0HB 1IL1B 4EDWH 1OD7A 3Q3GB 3W11D 1TIUA 3QIWA 4RGOL 4CW1A 5B8CC 1FBIH 2DLTA 1F4YL 1VHPA 3PWLA 2R9HD 4KMQA 3QDJE 2J7LA 4BH7A 4K07A 5L9DL 1K3IA 4NZUH 4DQOH 3B3IB 1ITCA 5GGTA 1MFDH 4MZ2A 5GJSL 2P5WA 1WC7A 3GJEA 5JW3H 3DV4B 1MREL 4L8BB 5IB3B 1U8MB 5FDWB 3KPSB 4LSQL 2AW2A 3MC0A 4Q6YA 2B8OT 4P59H 4LKXA 2DTMH 5KSBA 3T4AB 1LD9A 4P3DA 4UOW0 4XP4H 2EYSA 5DDHB 2NYYD 1MCEA 4WFHD 2ICEA 4G8GA 5CUSH 5T1DH 2FH6A 2MCPH 3DIFB 5ADOL 5BV7B 4TSCL 1BZ7A 1CDCA 4PGCA 5E2UH 5HSFA 2IEPA 4LIQE 2EKJA 2IH3B 3E2HC 1LILA 1KJVA 2Z35A 4KROB 5J7CC 1CT8B 5DJCA 3KS0J 4LLYB 4JRYD 2D7NA 2NXYB 2X41A 2XNAA 4JPIA 5KVEH 2VXUH 1JGVL 4M6NL 4M6ML 1YNTB 5HHME 1MIMH 1WZKA 3UTZA 4I9WE 3V9FA 3BHBA 1D5BB 4HZLA 4U1SA 4G9DB 1HE7A 1JNJA 2AEQL 4WI4A 1SY6A 1X5GA 3WNLA 3WNNA 1UB6A 4YHPA 4FQIL 4FFWD 2DJSA 4GRLA 4JFYA 1M6OB 1Q9WA 4EKXA 3RNKB 5F9WC 1F3DH 3VFGH 5EZJA 2FJGB 4ZXBC 4U6VH 4BSJA 5JZ7C 4OLXL 4R90H 4N90D 1YZZA 5BJTA 4HIHA 3RY4A 1FCCA 4CVXB 1HHHB 3BDXA 1G6RH 1NAMA 1ZHNB 4JVUA 4UAOC 1OOAA 1DQTA 4OBSA 1LE9B 4PJ8D 5GHWL 1F90H 1N64H 1BVLA 1RIHH 3CNKA 3W2DL 4YWGH 5FGCB 5LCVL 3QFDA 3MRLB 4PJXB 4F57H 5C0ND 4WEBL 2O61A 1LEGA 3D85D 1JWSA 1CGSH 2CLVB 3IJYB 1W72A 1I1RA 4AMKL 4OV5B 2I27N 1SJXA 2XKSA 2HP4A 4X6DF 4Q0XH 4KMLB 1T04A 2YD6A 3WFBL 1CICC 5DMIH 5DZNA 1NC2D 4H88H 1T2QL 1UA6H 3QUYA 4OLVH 3U4BH 3UJTH 5I18L 3VWJB 2HJLB 5I1IH 4HUXB 2MQCA 3ZTJG 3VFSA 5DD5L 1XGRB 2OMBA 4U2ZA 3G6AB 4LLDB 3RDTC 2VKXA 4NQVA 3TA3B 2ADJB 3DRQA 2VLRD 3IU4H 3SDDC 3BP6A 5SWZB 4H1LA 5F88B 1ZT7B 5F96L 1AR2A 4G8IA 1DQDL 3RL1A 5F72S 4JFOA 3ZKXB 3CVHL 1QFUL 1U8IA 2EC9T 5EUOF 4ZD3H 4LKCB 2A6IB 5I15H 1ZT1A 4PP1C 2J88H 4HFWB 3REVA 5C0JB 5FUCC 3TCXA 1XF1A 5INCA 1P5UA 2JJUA 4J23A 4UU9B 4XNZB 3MBED 1NLDH 1JI1A 4D0DB 5FO9B 4LDOB 3X13B 5ICZB 2A74A 2BSRB 1ZGLA 3UTPD 1BF2A 4OCWL 1LO3H 1S9VA 4P2QD 5D5MB 3MRKA 3CSGA 1CIUA 5ITBH 1BFOB 4WFFE 1OF2B 5BZWA 5DMJB 1UWXK 1KIQB 5F6HJ 4C58B 5DVMA 1A6AA 3HUJE 1H5BC 3I6LD 2GJZB 3MOAL 3GRWL 1NFDA 4FQLH 4R4ND 1I9JL 3OV6A 2HG5A 1X7QA 3HAEB 3VXUD 3TBVB 4GLRH 2XT1B 1X6NA 2NX5B 4JPWL 3AS0A 3I50H 3OKOA 4NN5B 3JV4A 5EOQL 3L9RA 4ZXBD 3D3VB 1TCMA 2OTWB 2ZCHH 3KYNB 5F7LB 3BISA 2WWKT 1JYWA 5D70H 1NEZB 3KLSA 1I8IB 1JZ4A 3LDBB 4QKXB 1E28A 1GIGH 3QUZB 5E8DH 3GEWB 4FXGA 3ZE2E 3STBA 4MNQD 1JHTA 5D93B 1H9VA 1GHFH 4OFVA 5CJOH 3PP4L 1N59A 1QBLL 4HLZG 4F8QA 3SDAC 1JNHA 3VGAB 3L1OH 4EUPB 4ZFZA 1N8ZB 1CICD 1BIHA 3EBAA 4DFIA 5CBEB 5C3LD 5IQ9B 3VA2C 3HR5B 1JYNA 4HS8L 2VZVA 1DLHA 4P5KA 3WIHA 4I0PA 4PRPB 2E27L 3IF1A 3X14B 1VFMA 2HFGH 4M4PA 4NO0B 1B3JA 3PHQA 1HILA 3DMMB 3WIIH 1C5CL 4UV4L 1JPTL 3CVIH 5K9OB 1SMAA 5IMKB 4CNIA 1EO7A 2RQ8A 1S7TB 1GGUA 2CRMA 4KRPC 3MA7A 4FQXA 3N85H 1E4XL 3VXNB 1BQHG 2FGWH 4K8RL 3RIFF 1OGAB 3GO1L 4Q9QH 3ZKQD 3O3DA 1WQVT 2JCCF 4WY7L 2YPLD 4QOKB 4HUNB 4OB5H 4GW1A 3TT1L 2PN5A 3V7AG 3P77B 1MFEH 4NOFA 2GTZB 3VRJB 1BBDL 2OZ4H 5IJVA 2VQ1B 12E8L 3QEQB 4UTBL 4UQ2A 3V6OA 1Q0YH 3LB6D 2B0SH 3MX0A 4F80A 4QGYA 4XPBH 5D1XD 5CHNB 5MERA 1NBVL 3BP4A 1TLKA 2PXYA 5EBMB 4C56E 1YYMH 3QA3B 3HRZB 4NO2B 1EAPA 3HC4L 5ERWB 4PRDB 4KK5D 3JV6B 3MYJB 3U0TA 4XPTL 5GPRA 5E2TL 3MTRA 1J18A 3G9AB 4PRHD 3WJJA 3JUZA 4R9HA 5F8QC 3UC0L 1PYWB 3HPJA 3WUWG 4Q58C 3ZTNL 3GSVB 1PZUB 4WTXA 3MLXL 4LCWD 1HHKB 4JM2D 5TQ2L 4HK3J 4QHKJ 1TETH 4R97C 3BZEA 4P4KB 5CEZE 5C0BB 2XYCA 1RZ7H 1U8QA 1FFRA 3C5SA 4YHYC 1JNNH 4JAMA 1JGLH 5E1AB 2EEDA 5D2LA 5FV1L 3PHOA 3B6SA 1NBYA 1KIRA 4NJ9H 4G3YH 1TJHH 1JWMA 4R0LB 3WFEL 1OLZA 3D39E 1NAKL 35C8L 4ZTOL 2H9GB 5DGRA 2VLMD 3ZKSD 5BMFH 4JFDD 4HV8B 4OF8A 4DEPC 1CK0L 3BE1H 2E3VA 1QSZA 3HE6C 4XP9H 1XGYH 5GRUH 1SYSA 1CFTA 3SDXB 5C07E 3LZFL 2BRRH 4HAGA 2IQ9H 5C8JB 3VXSD 4P48A 3K74B 2XQBL 3QNXA 1DQLH 3WS6A 1L7IH 5GGSA 3V5HB 2V5RA 2R2CA 1NGQH 2AEWA 2WBKA 4M6AA 1G0YR 1NCUA 4ODSL 3GSWA 5DUBA 2V2TB 4ZNCD 1YPZB 2YD5A 2VL4A 2QR0B 3TH2T 4MNHA 3AY4A 1KPVA 2P42B 1AD0B 3L3HA 2HWZH 3EYSL 1MCIA 2NZ9C 1UWXH 3K81A 3ULVD 4MXVF 5DC9B 1AD9B 2ZCKH 1L6XA 4X6DE 3H6JA 2BSED 4NKQB 4HW6A 2I9TA 5HHPB 4PRNB 4L4VE 3DBXB 2A2QT 4MCYB 5DFVC 1GGBL 1MWAH 2D3VA 2FEDC 4Y1AD 3WJLA 5DUPL 2VDNH 4I18C 4OGAC 3WNMA 2DJ4A 4MA3A 5E08L 2FJHB 1D9KB 3PDDA 4RIRB 3T2NL 1FDLH 4OCSL 4XVJL 4BQBA 2R2EB 1D5ZA 4G7VL 4GH7B 3PXHA 4TVSa 4NM4L 4XPAH 5JXAH 4RGMC 4KDVA 2FX8L 3HC3L 1MFBH 4U2YA 2V9TA 1PLGH 4KPHH 3MREB 4ZS6D 2ZNWA 1G7JB 5B21A 5T3XH 4DGYH 1P2CB 1S7UB 4J12A 4HGWB 5GS1A 4JO1L 4R4BA 1EFXB 5D1ZB 3QG7H 3FB6A 4D0CB 2YUWA 1MIEH 2ZP0T 3MJ8A 1B90A 5CMAB 3BQUC 2A6KA 2R1WA 3DVFA 1P84K 1Q94A 4OQTA 2BNQB 3HG1B 4N1HB 4Y5YA 3FQRA 4ODVL 1KNOA 3ZKMD 3U7WL 2A6DB 4XNQA 2FZ3B 1MFAL 4HUMB 2F5BH 4MWFA 2P8LB 2WW8A 4GOSA 4PRIB 1Z9OA 5D2NB 2YMXL 3HE6D 2JJSC 3T8XB 4L4TA 5J12C 3G6JB 4NQEB 1R5VB 3W9DA 3O3EA 1C16A 4PTUA 3SKJL 2CKBB 4P5TA 5IB1B 2FB4H 3W0WA 3LH2L 1G7IA 4XPGL 1INDH 2DQFB 1YEEH 3D2UB 4HS6A 3JXAA 1ZLVK 4POYA 3QPQD 4XMKL 2QADC 5I1LA 2LAGB 3CFKB 1CZ8L 4GW4A 4OD1H 5ALCH 2CPCA 4KK6C 4MA1C 4JGMA 5KSVA 5I71C 5DZLA 2IANB 2NY1B 5C08E 4ELMF 5JPMA 3ARED 4MJIB 2VISA 5DEFB 4EDXB 3IDUA 3ARBB 5IFHL 4A2LA 1XGQB 3WNKA 1S9YA 1A6WH 5GGVY 5KTEL 4U1LB 4HJGA 2AJYH 1TNMA 1FQ9C 3NVQA 5DLML 4PREB 1MNUL 2X89D 3BKCH 5HTSA 3UAJC 3N1FC 3EYFB 1KV3A 1IEBB 1W0YT 3RA7H 4ENEC 5IJKA 4J1UB 3K8LA 1I7UA 2HKFL 5F3BA 5E56A 1NGYA 4LARL 5B39A 4WNQB 4RMWA 1LP9B 5AD0A 5IMLB 1IAII 4QWWC 3IDGA 2VXQL 1HH6B 4FG6D 3CUPA 4FZ8H 1IGFH 2RCSL 3OB0H 3WKML 2A73A 2VDPH 1WJ3A 3BP7A 3NCMA 1YEKH 4EI6A 4WHTB 3T04D 1B88A 1CD8A 3QCTH 5BQ7B 4NKMB 2DWEB 2PCPB 2QBWA 5FHAL 4KAQL 1CXHA 2WWMC 3FQUB 1SBSL 3B8SA 4B5EA 1KB9J 3HAEG 3S5LB 1DQQB 4XCFH 2JCCE 2SEBB 4XAKD 3MGTA 3OB8A 1IMHC 1FGVL 1FFPB 1CTOA 5K33A 3SJVD 4JFFA 5DHYB 4YHOH 2X1OA 3BQUD 4F15C 1F11B 2F19L 1NEZG 4JRXD 3SGJA 1P4LA 2D2OA 5JIKA 4EIZC 5GRWA 3QIUA 3O6ML 1P1ZB 3F7YA 4YX2L 3MRHA 3IFLL 1CE6B 1D5XA 4L9LB 1TVHB 2NY0C 3C2AL 4XPFL 2RIKA 4EUPG 5I1DA 4NHCH 3N1GC 4JM4L 3VXPB 4X5XA 3P11L 3I2CL 1EXUA 4IBLT 4XC3L 5FKPB 1DBBH 3STLB 1KB5B 1S7SB 1VA9A 5BO1L 3GDBA 3UTSE 3SE4C 4S2SA 4ALAL 4W6YB 4C4KT 4PJCB 4B7LA 2Y36H 3NCYS 5C71A 4KK6D 3QDGA 4K7FA 3GSUA 3SE8H 2BFVL 5C0CE 3KXFD 4P3CH 4I3SL 5FGBC 4TVPE 2UVFA 4XP6H 1AE6L 5C09D 4FHBD 3MCLH 1REIA 3ZDYF 1XF2B 4YPJA 3VGDA 1A6ZB 4KY1H 3ROLA 3UAJD 4QRPB 5CINL 1K8DB 4Q6IB 2BVUA 1QRNA 5DJAA 3NH7L 2D7OA 3FO2A 4C83B 1H15A 4NUGH 1V8HA 1XGUB 2IADB 3BPNC 1D5IL 1N0XL 3GKZA 1JGEB 3LS4H 1AGBB 4MZ3A 4XVSH 5I66A 2FX7L 5L7XL 1CL7L 1A6VH 2VDLH 3QXUA 4HIEB 5I8CA 5I8EB 3L5XH 1NBZA 4FQJL 1F4WL 2XTJC 5DRZB 4X6BB 3SOBL 5IMMA 3VU2A 2I25N 3WXWL 1BJ8A 2IBZY 4MXVE 2AS5M 5HDLA 3M8OL 4RDQG 3UPAA 4NC0B 3VGHA 2IAMC 3KR3H 1JF1B 1MJ7L 1WBZB 1TFHA 3FB7A 4YHNB 3QG6B 3PWVB 2NCMA 4YQXL 5GJTL 3G6DH 1RJYB 4M1CD 3E6FA 5MI0C 1A7OH 1OAZL 4MYWB 4O02L 3S96B 1FYTE 4NNPH 5BRZE 2DDQH 3JWDH 3AXLA 1IAOB 1B9ZA 1C7SA 4M3KB 5KSUA 2QQKH 1ZEAH 5F70A 2DLHA 4ZSOA 4ODWA 3GSXB 5DRWB 1HHIA 3FJTA 5IW6B 4YHZL 5IGXL 1MCBA 2D7TL 4H20L 1FORH 1A4JB 1YMMB 4WEUD 4YC2C 3WYRA 5EO1B 4KJYB 2OR7A 3GBMH 2H2PC 1DBJL 3FT4B 3MO1A 3SEPA 3KPRA 3L95B 4KUZH 3TYGL 1GC1L 1FL3A 4FFVD 5T3ZH 4FMFA 1QFWL 4CMMB 2EEAA 3MV8B 1IZKA 3ULSB 3FHQA 3SO3C 5BVPH 4PJHF 4KRLB 1OAKL 5C6PB 2XWJA 5ID0B 1N5AB 4XCEB 4ZG1A 5TFSH 8FABA 5EUOA 3FRPA 5SV3A 4PJ9D 2PYFA 4NZRH 2E7LA 2R56H 2H2SD 3QDMB 3ARDA 2R0LH 1GGIL 2BHUA 1EHLL 4MJ6A 3PQYD 4JPVL 1ITBB 5EBLB 4PLKC 5HHMD 4NP4L 3GJFA 1UM5H 1L6ZA 3ALPA 1IAIH 4Y5XC 2DYPD 1RZKC 4I9WD 4NOBA 4XPHL 1BVKB 1T03H 1C1EH 4IJ3C 4YK4C 1MFNA 5FM5M 5D7JA 3F12A 3DROB 3RZCB 4UTAL 4JDVA 5D7LA 4NIKB 4QRTB 3MODH 2W07A 3X12B 2QJDA 3VRIB 4WU5B 1J8HB 4NO3A 1INQA 6CGTA 3FT2B 4U05A 3LN9A 3U1SH 4PJEF 5I6XC 2R2BA 1EVTC 3OWEA 2X4SB 1WT5A 1MHPH 3MRPB 2AV1A 4ELME 5DR5H 4AT6A 1RUKH 1OTUD 2DD8L 5I1JH 2JK5B 1A14H 4HXAH 3ROOA 4D2NA 2O5YH 1AHWA 5IW1B 2Q7YA 4ZUTB 1OQOA 2G5BB 3BKML 5DT1L 5DA0B 1PG7L 3RGVB 3P9WB 4PJIA 3U7AA 1WEJH 1RZ8A 2DLFH 1JHLL 3TGXA 2IAMD 2OJEB 3L3OA 3WL9A 4OUUB 1QYGH 1AO7E 2ZOKB 2ZSWB 2VDRH 5B8CA 3VFWA 1A9EA 5EA0L 1UVQA 3ARFB 5DD6B 3BXNB 3MROB 3LHPH 4KUCF 5HI5D 1KJ2H 4D3CH 1Z9LA 1VB9A 2VL5A 5E8OA 2B39A 3MLUH 3PL6B 3G08A 5TE4H 1U8LA 2W0LA 2JELL 3PGDA 1YMHA 5K9JL 5EU5A 4LFHG 5DUMH 4ODHL 5FGSA 3MLRL 2JB5L 3P4LA 5HHVH 3TBTB 1QSFE 2EO9A 4GKZA 5KZCB 4DCQA 5FUZL 1XIWC 3NCFB 5EBWB 4YXLH 1GGYA 3ZTJH 3RWFB 1I7RB 3MLZH 1RU9H 1T6VN 4TRPH 5GRZA 4NQCB 4JR9H 5T5NG 3MRNB 2DM3A 4JY6B 2CDGA 1BFVL 5CAYB 3IKKA 1OGTA 1FLTX 3VGBA 1YUHB 1TQCB 1UXSB 3HNVH 4U1GC 2YKLH 2CUHA 1ZKAA 5JDJA 4PLKD 3QEHB 4G8FB 3C8KB 2OLDA 1AY1L 1I7TA 2FD6L 3OKMA 5DJ6A 3B2UC 3DVNA 2YN3A 2FBOJ 4ZO8A 1NGXB 2BJMH 2ICWA 1A5FL 4Z7UE 3KDMA 4A6YA 3LKQB 3MACL 2AI0L 4TUKL 2GFBA 1J11A 4TOYH 2WUBH 3HB3C 1OLLA 1RY7B 1VGEH 2HLFC 3CXHK 2AEPL 3LQZB 3E1F1 5FYJE 5GRJL 3N9GL 2X4PB 2VIRA 4OZFB 1PZ5B 1ZS8A 2UYLB 4Z0BH 1D5MB 4HFUL 4UILL 1OAYH 1ZLWK 4M02A 1CICA 3S5LG 1CXFA 4PG2C 4O4YL 5EUKA 1YEJL 3ZDYE 4M1DH 4R3SB 2A9MH 1A7NH 3IFNH 5LQBL 2BOBA 1JF6A 2BSSB 2CLRA 3C60C 3CFCH 4PTTA 3A67H 3U0WL 4GQ9H 5ID1B 1G9NL 4BFEA 4KTEH 2Z8WC 5FOBA 2X4QA 3V4UH 3VXRD 1A4KB 2XICA 3PWPB 4PV9A 1OAXL 4FRWA 3W81A 5E70A 5CSGA 1IAIM 5LWYH 1Q1JL 5ISZA 1QFHA 4J4PA 3RDTA 1DBMH 5J8OA 1IFHL 5INDA 1QQDA 2X4OA 3DX8B 3WN5C 5HHOA 3SDDA 3ZYIA 4L3EB 3DRTB 3IXTB 4D9LH 3AU1B 2ATPB 4XI5D 2V5SA 5IT2L 4OIIH 3O6LH 1NCAL 4G9FB 1U41A 4GAYA 4NQUA 2DOCA 1X9QA 4UINH 4X9FA 4Q9RL 1J0YA 1CDYA 4KKCD 4L1DA 4MHHG 5GGTL 3F7VB 1H3WM 1N4XH 1XIWD 4XMLL 5B4MD 3U6RB 5E6IB 1T7VA 2IG2L 4FQPA 3ZL4L 2Z91A 1ZANL 4PGDB 1NGPH 1GXEA 5E8EA 3NFNB 2ARWA 4XNMB 4W4OA 2VABB 1T5WA 4N8VB 2QHLA 2UV3A 3P4NA 2ADIA 4C56D 3W5MA 2VLJA 1CBVL 3MUZ1 3WIFA 2AXFB 2CUMA 3Q6FA 3CFBA 4U1IA 5B3NA 4MD5A 4NRXB 3GHEH 3ILPB 3D5OF 4MA7H 2VXVH 1NMCB 4LPXA 2AQ2A 3LKPA 4JZOB 4NQSA 5JNYB 3OR7A 4P23B 3ZYZA 5H35A 1QPPA 4PJHE 5CEZD 3MLWL 2LTQC 1SY6L 1O5DT 3RRQA 3VGGA 4RQQB 1CXIA 1AFVH 1FH5H 3N1MC 2CDEA 2HLFD 1YN7A 3CXDL 1KTLB 1T5XB 2I5YL 1V7NL 5MENA 1KJ3L 3G9VA 3O4OC 5HJ3B 1INEL 4P99A 3D39D 3SDAA 3VXTB 2HKHH 3B83A 4QF1A 5AWNH 1NAML 3MRBB 1AR1C 2C1OB 3D9AL 4NRYA 4M8QA 2J4WL 4FNLH 2ATKA 3C60D 2D9QB 1ORSB 4F7MB 2WM0A 3LCYA 1NFIB 3HMXH 5JTWA 3ARQA 4M7LH 1W72L 4JRYB 5JO5B 1G84A 3C9NA 3O8XD 2DMKA 4HWUA 2XA8H 3TT3H 1U8KB 3RU8L 2RAMA 2C1PB 2DI9A 4ZFFB 3RTQD 4IRSB 4U7KA 4MB5A 3QRFM 4R7DB 4KZDL 4PJEE 5FM4A 3OPZH 5IHBA 1OCWL 4XX1G 1UG9A 1CGWA 5EZOL 1M7IA 2X4NB 3TC9A 3WO4B 2NY7H 3MPCA 4YGAB 1KFAH 4M7JL 1CFNB 4L4VD 4XMPL 3TV3L 2VKWA 4PGJA 4X7TA 4KHXH 3LSOB 4K9EL 1QEWB 4PP2A 4UBDD 2RFXB 5J1SC 3CFEA 2P48B 4DOHE 5GGQL 5FYKE 1Q0XH 4U31A 4UT9H 5GSRB 3D85B 2C3VB 1N5YL 1DUYB 2OR9L 4X80L 3WHE0 1LNUB 1OAUL 1ZTXH 3NCBB 2XZZA 1MHHA 2R15A 3ARGD 4LCCB 5E94A 1BQLH 4X4ME 1NC2B 4QYOB 4MLSA 4P2RE 4N0YH 3VFPB 4JO4L 2CK0H 1RD6A 1IRAY 4HPOH 4ERSL 2ERJC 3UDWC 4TTGA 2AJUH 3P9MB 1WTGT 4LMQI 1CFSB 4ZS7L 4QRUA 4XWGH 2FX9H 4TNWK 4I48A 3U0PA 3TIDA 1MRCH 4LRNL 1EUUA 3NTCL 3IGAA 4FXLA 3IXAA 4J3WA 2A83A 4Y5VB 5DYOB 4WI2A 1J1XH 4LEOB 2Q6WB 3OAUH 1IM9A 5IV2A 3IFOB 1U8JB 1MCRA 3NCCB 5E4IA 3FZUC 2Z0BA 3IFPA 1K6QL 4FTVA 4M5ZH 4UT6L 2V17H 3HE6A 4ZOAA 1FNFA 4MXWH 2H3NA 4Z9KB 2WP3T 1CF8H 2FHBA 3W9EB 4F7PB 4O9HH 1D3CA 3FO9B 1IKFL 4GXVL 4N8CH 3HFMH 5TGBB 5F8RC 4BZ1H 2YUZA 3HE7C 5CS7A 1X5HA 1MVUA 1VFOA 5GQBA 5C0DB 2AXGA 1NGZA 1UXWB 1EERB 2EE6A 3BW9A 2VDOL 3P4OB 5ACLA 5IK3A 3GMRA 4RGNB 4P49A 5I73B 3DSFL 4O00A 1LK3L 4ELKB 4NBXB 1YDPB 4WW1A 3V4PL 3LMJH 2YUXA 4Z7VF 2IPTH 3NCYP 3WIHL 4CUCA 5J1TC 2VOTA 4ZQKA 3VXUB 3I9GL 1NUGA 1NJ9B 2HT2C 4P4RB 1UKQA 2YK1L 1AKJB 2GJ6A 3BRGC 5T1KD 2WBJD 5KSAC 1KEML 1EFQA 1T7WA 2FWOB 2BNUB 1GPOH 2A77H 2GK0B 2ZUXA 1Z3GH 4M7ZC 3LEXA 1PBYA 1R3IH 3F6LA 1HKFA 4I18A 4NCC1 4ZOCA 1BWMA 1DDHA 1KTDB 4UOJA 1KCVL 5A2JH 3GGWA 1E6OH 4KI1A 2ZKHL 4NPYA 4EZMA 1M7XA 2Y06L 3DVGA 3DX7B 3F65A 1YNLL 3PNWA 2KDGA 3L3IB 3G5ZA 3HPLA 4LLUB 4ODXA 2VERN 4OF6A 2NX5E 4O5LH 1RMFH 1I1AC 2F74A 3BAEL 3SGKC 2ORBH 3NGBB 2ZSVA 4HSQA 4UT7L 1FVCB 5AZEH 2K7QA 1EH9A 4K7PY 5F7NC 1EO5A 1FNSL 3KPLB 3J7HA 4ODTL 5SWSA 3EOAB 1BIIA 3K8KA 4AM0A 2FO4B 1YEGH 1FO0A 1I1YB 4PJGB 4V1DD 1DEEA 4GBXD 4X4ZA 3EW3B 3KVQA 1LMKA 3T0VA 2ZOLA 2Y23A 1TXKA 3O3UN 4ZDHA 4OZIF 4JKWA 2BNRB 1AGCA 4UMGA 3UJJL 5BXFB 1YEIH 3FZUD 3QXAB 4OZFG 3RUGF 1CXKA 1S8DA 3V0AC 4KMTL 5IB4A 5EU3B 3TZVD 2XZQH 5FK9A 2YC1B 1ZA3A 3MNVA 1DBAH 2NMSA 3UTTE 2BP3A 2CUIA 2D31A 2JJSA 5D1QB 4M93B 1KCRH 5DK0B 3LS5L 7FABL 2O5ZL 1SJHB 4U6TA 2HVJA 3PHSA 4PBWD 4L1HA 5ENWB 4MNGE 2KL6A 5A2LH 1I4FA 1U8NA 4N0FB 3WHXA 1JJUA 1DVFD 3GMNA 5F7KC 1OT2A 5D1XB 4PR5B 2UWEA 4LSVL 4U1KA 5DXWA 3MXWL 1OGAE 2PO6D 2W60B 3BWAA 5T1MB 3SKNA 3QNZB 2R1XA 2Y6SC 4HH8A 3LRSA 1PQZA 1S7XB 5K9KB 3BZDA 4NT6B 4XP5H 4PRHB 4Y2DC 2YWYA 3OKYA 5HY9A 1L7TH 5C0CD 3M17B 3RP1A 1IT9L 5L2KE 2ITCB 4TVPD 1CDUA 2V6HA 4JM2B 4HF5L 4LCWB 3X3FH 2R4RL 3UZEA 2QL1A 3CU1A 5FECB 4K2UH 4E41E 5EZIL 3DPBA 4IRZL 2XRAL 5CGTA 3KNBA 3SKUD 4JHWH 1JFQH 5DD1H 1F6AB 1U58A 1HN1A 1RZGA 2X4UB 1BD2B 4X98A 4LVNB 3S34L 1UYWL 3DURB 1RZIB 2XN9E 3FB8A 5J4MA 4DKEH 4N8VG 4R2GC 4D0BA 1FZKA 1ZA6A 4Q2ZB 2QV2A 5E2JA 4IRJD 3GIZH 2WQ8A 2AK4E 5D4QA 5ESAB 2IGFH 4K55A 3I75B 5HYQA 1MCSA 3EGSA 4HJ0C 1MCOL 1KSRA 2IPUK 2M8XA 3VXSB 4PB9L 1I1AD 1U91B 1BEYL 3MRMA 5GGRA 4HH9B 5ESVA 1C12A 3LKSA 3QXVA 1P7KB 2NY3D 2FL5B 4LHUA 4K7PL 3WXVH 3CD4A 1KIUA 4MAYB 3QO0A 5HGBA 5EC2A 3RBSA 3QRGL 1X5FA 4APQD 3WLWD 5IOPB 3CU7A 1JPFB 3NPSB 1FRGL 1FHGA 1FYTD 1X5IA 4N68A 5BRZD 5E6ZA 2AV7A 4ZPTA 5I1KL 1A1OB 1E27B 3MV7A 1AXTL 1MCNA 4LP4A 4G5ZL 4YUEL 3DUSB 1G1CA 1CS6A 4MSWB 3K4ZA 3PWLB 5FHBH 2XPGA 1HQRA 1GOGA 4OQTL 1A64A 4Y1AB 4BH7B 1CLCA 1CU4L 2Z93A 3DGGB 5D71L 43C9B 5BZDA 3VXMB 2VLLB 5BS0A 5I19H 1G6RA 1G6VK 3STZA 2P5WB 3GJEB 4NSKA 4EI5C 3BJLA 5C0AE 3WFHB 3SE4A 4Y7MA 1RURH 1S7RB 5I1AA 4POUB 5KSBB 2CR3A 2VH5H 1QNZL 3CCHA 3JWNC 2EYSB 3O11B 3V0WL 1CE1H 5DJDA 3RWGA 5F9OL 1A3RL 5FGBA 1J0KA 3BEVB 3PQYA 2ZCLH 4GAGH 4OCNC 2O5XL 4LPTA 3BIAX 3VXOB 1KG0A 4FABL 4WFGD 3QEUA 1XGTA 2IBBA 4NN6B 2Y25A 3OKEA 4JPIB 4XRCB 5ADPH 5J06A 3FONB 1SEBA 2EYRA 4NGHH 5LXGH 5HDOA 4XAWH 2Q8AL 4NUJA 2HTLD 1EGJL 2QQLL 3R0MA 1ONQA 1RZFL 3LEYH 3GUTB 1N2RB 1QD0A 4Z77B 2VE6A 4NQDA 1AC6A 5EN2A 3LN5A 5HYFA 3Q6GL 3LV3B 2VN7A 2XACC 2XG4A 3NABL 1NCBL 5EZJB 4PY7A 3U9UA 5ETUA 1CFVH 3RY5A 4XBPA 1S7QB 4HIHB 2PUQT 1NAMB 1KN4L 5IB2A 1LE5B 3HMWL 3F58H 4OF3A 2APBA 2IAMA 3BH8A 3HG1E 5GZNC 4U6YB 5KVDL 1W72B 4JLRA 3GSOB 5F89A 2R29L 4LSTL 1FGNH 3CX5K 4U1JB 2JB6B 3RPIA 3VH8A 1A7QH 4PRIE 5D2NE 3U79A 1AO7D 2B4CH 2MMXA 5GGUB 3PP3K 4M6OH 5FYLH 4YIQA 1SHMA 2XWTA 4RAVA 3IVKA 2CIIA 3MJ7A 2EDHA 1CD1B 4H0GA 3PJSB 4GMSL 2VDML 4TSAL 1S7VB 2YA1A 5CSZA 4FOMA 5H8DA 3DRQB 1SEQL 3W39A 3BP6B 5F6HI 3QAZC 5HHQB 3MRQA 3CMOL 4DTGL 4G8IB 4RGOH 5IB5A 1QSFD 4KI5C 4M9PA 2DIJA 1U8IB 4LQFL 1F4YH 1VEPA 4RFOH 4OFKA 3TO2A 3G5YA 4ZO9A 1A0QH 1JYXA 4OKVB 4X0KB 4OZIE 3RI5K 3SDYH 4X6EB 4I2XB 4QO1A 2NY6B 4RX4D 4YXHH 3RUGE 1LEIB 1JVKA 4LCYA 3A6CL 1HYRC 1MELA 4GRMB 2FSEA 1YECH 1HOCA 2NXZC 3TWCH 3L3JB 1N6QL 4O51A 4CN6A 4GKNA 5FV2A 1W0VA 5I16A 1FNGA 2HRLA 3FQTA 2DM2A 1IGYA 1R6VA 4L8SC 3JZ7A 5DA4A 3H42H 3HKFA 3SJVB 1GVIA 2KPNA 1IC4H 2CKBH 5C0IA 4KVCL 4WFEE 2F53E 5BZWB 4JRXB 1AXSA 5ESQB 2X4RA 5D6CA 1BBJB 1BP3B 4Y4HB 1F58H 5KG9A 2K9UA 2H1PL 2HG5B 2FJFB 1P53A 1KT2A 3FFCD 4G43B 3PDOA 1F4AA 3OKOB 3DXAE 3JV4B 4JREC 3RVVC 3L9RB 5FYJD 1GZPA 5C9JB 2I24N 4GG8B 5TDPA 2EH7H 5ALBH 2WINA 4WW2B 5EC1B 3HZYB 2OZ4A 2AJSL 3KPTA 2R1YA 5J6GA 1I85C 4KTDH 4XZUA 5TDOA 4YDJA 5I1HH 5IR1A 1JV5B 2J8UA 3NAAL 4YZFF 4X6CF 4U3CA 4X6FB 2F58H 3HI6H 4PJBF 2F54E 5EU4A 3ULUH 4XWOD 1JHTB 1NH6A 4M43L 5E8PA 3VA6A 3H3BC 3INUL 3NCEB 3KS0H 1N59B 4XNYH 4WUKH 4WWKD 1JNHB 1C8PA 2V9QA 4JO2H 4ZFZB 1U3YA 4LEXH 4XCNA 3UBXB 1LO2L 4PYHA 4MQTB 4ONFL 2DQUH 5GS0L 5C09B 3ARXA 5JMRA 3C09B 3C6LB 5FUOL 1HI6A 3EJYD 4W70A 1DLHB 1KXQE 2BOCA 4N0UA 4P5KB 3VI3F 4DWHA 2ADGA 4IS6A 2DBLH 3PHQB 1HILB 1DR9A 4FQCL 4GAJL 2GT9A 5EO0B 2G2RB 3L6FA 2BMKA 4I4WA 1EX0A 2KUTA 4XNUL 4CNIB 1BAFL 5BV7C 1XF4A 4F9LC 1TJGL 3TJEL 3IKCA 1JRHI 3MA7B 4FQXB 5DZOA 1II4E 2CXKA 3IDMA 5E5RB 3SE9L 3VE0A 1MCWW 4FP8L 4I3RL 1PSKL 4JFXB 4MJ4A 4ZO6A 2OCFD 1O7SA 1E6JL 4TUJB 4GW1B 4QHKI 1RI8A 1IQWH 1FNAA 4KKLD 3RWCB 5MEOB 1LO4L 4JJ5B 4QXTB 4V2CB 3GNMH 3SN6N 5HHXH 1GH7A 3PIQA 1NC4D 1C5BH 4WI7A 3GI8H 5TE7L 1J86A 3OXSA 3C6SA 2EDQA 2PXYB 3FCTA 4PV8A 4WCYH 1RIUH 4NWUH 3GSNB 4XCCH 2ZUQB 1KB5H 1DE4A 5F71A 5EU6E 3KPMB 2MHAA 3OKLA 1S9WB 3MOBL 3DWTA 5HYJA 4PJDA 3QDJB 2CR6A 3HPJB 3NIFE 1D6VH 4LVHB 5JOFA 5F1IB 1N6UA 4U6HB 5F9JA 5GXBB 3BZFA 1MHEB 1OB1A 3L3KB 4U1HB 5E0QA 5IBUB 3RGHA 2OP4H 1QKZL 1K4DA 3F7RA 3CDGA 1MWAA 3V52L 3VWJC 2NW2A 4PG2A 1RJCA 4RISL 3FN0L 3MBXL 3PHOB 4HIJB 1FNEA 4BUHA 3B6SB 3C60A 1NBYB 4X5WB 4HGKC 3UPRA 5EOQH 1UC6A 1LVEA 1AJ7L 4NC1E 4O58L 5CCKL 3WS3B 3F5WB 4UIMA 1ES0B 1YC8A 3EAKA 2VMFA 4BJLA 3TA3C 1FZMA 4YDKH 1ZE3C 3AMLA 4ZUWA 3H9YA 1EIBA 5JR1H 2I60H 3FO1A 3SCMD 3WN5A 4U49A 2MPAL 1VFAA 4ZOEA 5HHMB 4NBYB 3ZKXC 5IBTH 1EEUA 4J6RH 4BSWA 1Q9KA 5JQ6L 3QUXC 2DYPB 3OQ3B 1ZGLM 5GGSB 4QHNB 2QSCL 3MV8E 1RV6X 4KQ3H 2Z31D 1TZIA 3ZHKA 2PR4L 3CFDB 5L0QB 3GSWB 5CLTA 1Y18A 3O4LE 4I0CC 4YDIL 5D7SL 1CYGA 3PE9A 4RMVA 5DK2A 2Y72A 1KPVB 1R5IA 4KROD 1EDQA 1FZOA 1JZ2A 4Z7VA 4ONGL 1IGTA 1IGJA 3DOSA 2R0ZL 4JG0H 2NXYD 2I26N 1RUQL 3QQ3A 2HRPL 5D7IA 5DK3A 2OX5A 4YEFA 3WFDH 2HJKB 5FYKD 4R8WL 4OCRH 4OLZH 3PWJA 4UIKL 1N6VA 2R0WL 4P2OA 2P46B 4JZJB 3GB7A 4JDZB 2ARJB 3KJ6L 4KUCD 3W82A 3HA0A 3IDIB 4NN5C 4ZYKB 3SQOL 3SKMA 3MLYL 4TTDD 2P24B 3DLQR 4K3JL 2HH0H 1K8IB 3QULA 3PGFH 2QHRL 3L5WB 3H3PL 4BSVA 4S1QL 1MF2H 2QLVB 4LSSL 3LDBC 5H94A 3QUZC 1DL7H 1UM6L 3QHFL 5F7MC 2DQHL 5I8OL 2XWBB 5D93C 3VFRB 3WEXA 3K46A 2NY2D 1CR9H 3VGAC 4KFZC 3UEZA 2D03H 3CPLA 5F1NA 2YD9A 3FB6B 4AEIH 4UV7L 3MJ8B 3T0EE 4PRBA 1IBGH 4A6YL 3VWJD 4IHOA 2OBGA 2R1WB 4F3FB 1KYOJ 3P73B 4YXKL 2R0KL 3QI9A 4NNYB 1KNOB 3SKOB 3DMMC 4MQSB 4XNQB 4FFZH 3ZE1F 5I75C 4NJAH 4FQ1H 1UB5A 1MEXL 2NLJA 3S36X 3O6FD 1CDBA 2W9EH 3TA3D 3BDYH 2VXTL 2KBGA 4MDIA 1MJJB 1VACA 2BVPB 5EIIA 4KJQD 5SWZD 3W9DB 3IDNA 1WAAA 4PTUB 4PJ7A 2HFEA 1JRHH 1FZJB 1S3KL 4PS4L 3EHBC 5DMYA 1G7IB 4QTHA 3BSZL 4MD0A 4GMTL 1NMBH 1IGCL 2PKDA 4RNRB 3HUJB 3HI5L 5LGHH 1SJEA 5IIEA 5DJ0A 5EG6C 2UZXB 5JPMB 2VISB 5IG7B 3ZDZE 3HZVA 4E42A 4YZFE 4X6CE 2DB8A 4PJBE 3TVMC 5IVXF 3P0VL 3VFUA 4ODSH 4YBQC 3U7YL 1FVEA 1NCTA 3EFDH 5IM7A 2VAAB 3MLSH 43CAA 3MGOB 3CSYA 1EJ6A 1XEDA 3GMOB 5IVOA 1I7UB 4KQ4L 5JW4R 5JOPE 2WK2A 2YRZA 3KLAB 3QISA 5B39B 4QY8B 1FFOB 5CJQL 4DVRL 4DAGH 1U92B 4EVNB 1RAMA 3OX8A 4P4KC 3UDWA 5T1LA 2NX5D 5C2BH 1EEZB 2DKSA 2IFFL 1PEZA 3U46A 2FEEI 5E9DA 3BP7B 1KXTB 5HI4C 5J6HA 4V1DA 3HRPA 2FATH 2E9WA 1J5OL 2AAVA 4IIQC 1IC7L 3MGAA 4NCDA 2BVEA 4R0LC 2QQNH 2VLKE 3LN4B 4L3CB 4OCSH 4LHQB 3EOTL 1DSFL 3RWHA 5JUEL 1NCWH 3PGCA 2DQTL 1Q72H 1NDGA 1TCRA 3GJFK 1MQKL 4ZFOA 3P4MA 1EEYA 4KKAC 2X9WA 5KS9A 1KENL 3UTTD 4BZ2L 1G9MC 4PLOB 1GGCL 4RBPH 1U95B 2AGJH 4JO1H 4N1CA 3QIUB 2X9YA 3HE7A 2ENYA 1XF5B 2UZIL 4OGYL 1UCTA 1BQSA 3F7YB 4G8EB 2EDTA 1D6EB 1QBMH 3MRHB 5CEYA 1HKLH 1B0RA 2J3SA 2YEZB 3JWOH 4AL8L 4OAWA 3UBXG 4TPRL 2XZCH 1DP0A 5DC0A 3R1GL 1VFUA 3OJMB 4L3EE 1EBAA 1QO3A 4C56B 4WJ5A 2V2WA 3FB5A 1OGAD 3BT2L 5K59F 4R26H 3EHBD 5ICYB 4OZFH 3DYMA 3WV0A 7CGTA 3E6HA 1FC2D 2WUCL 3OAYH 1MH5A 4LU5H 4S2SB 3MNZA 1PKQA 1R3HA 2EDEA 5KSAA 4XVUD 5L2KD 4G7YL 3QZWB 4FXKA 4I5BB 1QUNA 1D9KC 4BA8A 4IOFD 1U36A 4LGRB 3PABB 4XMKH 2B4CC 3TCLB 3X11A 1W0WA 4HJJH 2W65A 4YBQD 2PTTA 2DL2A 1CQYA 4YBLC 2YHGA 4Y0GA 5F7YC 5DD3L 2BVOA 5DMGC 2XV6B 1B0WA 2XN9D 1K5NB 4EBQL 2E8ZA 1NCNA 3B9DA 1H15B 4W68A 3FMGL 1I1AA 3CZFA 1PDKA 2EICA 3SGKA 1ROWA 1T22B 2CDFA 3L7FB 5C07B 1Q9LA 4P4KD 1WF5A 4HKZB 3C8DA 1A6UH 3WDIA 1L4IA 3ZT7A 3V0VA 3O8XB 4TNWF 1W8NA 5IEKA 3BEWA 1PX3A 3D69B 3RTQB 3ZKND 5JXEC 3RKDD 3JSSA 3A6BH 3IDJB 4HKJA 5MEPA 5IBUG 1JNLH 2UUDK 2QEJA 4Z5RB 3FB7B 5K93A 2D7PA 1DQMH 3E6FB 1TZGL 2AJ3B 1M71B 3CGTA 3OHXA 1P7QA 1CDGA 1L0YA 4CU8A 2EYTB 5F7DA 2EXYD 2NY5L 5IESL 1P4BL 3IETB 1OM3L 1SM3L 5FCUL 2NY1C 3TLRA 1EBPA 1ZHLB 4TQEL 3VDCA 5C0AD 3FOLA 5CWSA 4HEME 3KPRB 3ARGB 5C6TH 3BKJH 4DJMA 32C2A 3O3AA 1JUFB 4RMSA 1NGWB 4Y2DA 1WV7T 2FYYA 3DYPA 3PWNB 2AJZB 1FAIH 1XZ0A 4MQ7A 3SE3C 5TPWL 5ILTL 1Z0MA 4HG4J 1NQBA 4PJAA 3RVXC 3D0LA 1YYLH 2G75A 3MR9B 1QLEL 1UH3A 3GMLA 4HUWB 4X7SH 5EUOB 3L5HA 2E9JA 3ULUC 2PYFB 1IVLA 1IILE 4WUUE 4QRRE 5DD0L 4KVNH 4NRZA 4JRWA 2OQJA 4F7TB 5H37H 1D9KD 4Y16A 4DW2L 4YR6A 2HVKA 3ZE1E 1YC7A 2AK1L 5BO1H 1KJ2A 1LEKB 4RAHA 5CZKA 4PD4J 2DQDH 4YE4H 5JHDE 4K23H 1UM4H 5FYLD 5CILL 3G5VB 3T4YB 1ZHBB 2W92A 3EO0A 3GHBL 3GMPB 4AEHL 2XQYK 3F12B 3P9LA 5TF1L 3P30L 5D7LB 1JN6B 1WFUA 1YQVH 1V7ML 4NKOA 1PY9A 2BXYA 1G1YA 4LPUA 1A8JH 1ZT4A 5GGVH 3CFIC 3IJSA 3QCUH 1CXLA 4M8VA 5KW9L 4ZUUA 4OGXH 1EFXD 5D1ZD 1XCQA 3ETBF 2YS4A 5E5MA 2EIZB 3O45A 4ODUA 2N1KA 3CK0L 5J3HC 3UZQA 3VFTA 3HG1D 2BNQD 5DQJA 2LVEA 4X83A 1RHHA 1R24A 4DGIH 1I3RB 3B2VH 5DVNA 1DJSA 2NPLX 2FBJH 1ED3A 3OKDB 4N9GB 2KKQA 5EFIA 5IVXE 2ZUTA 1VEOA 1DUZB 3QUMB 4U7SA 2IFGA 3CLFL 5F7HA 4OI8A 3F62A 5C08B 1HIMH 4GFTB 4PRID 4L9LC 1MI5E 3TESA 4YBHA 3DX9A 3HN3A 5AUMB 4ZUVB 3SOBH 4BK5A 5T1KB 2WBJB 3GKWH 4NCC2 5IHUH 4NQED 3REWA 3V8OA 3FRUA 1KEGL 3WO3B 1FO0L 1EVUA 2OJZH 4LFHD 2F5AL 3MSPA 2Z8VC 1F8TL 1UEMA 1XR8A 3D2UD 3QDAA 4FN0A 4XH2B 5EO9A 1UQSA 1I3VA 1URLA 1XCTA 3O6KH 5GISL 4M1GH 4EI5A 1KIPA 4LCIL 3S37L 3T77A 5HGHB 3HI1A 3V8CA 4ONHB 4DZ8A 1KN2L 1BJ1J 1X3DA 2PTUA 4J7RA 5E2VH 3PGDB 5GRVL 3ARBD 2GW5A 3MV11 1FN4B 1BM3H 5D72H 4JFPB 1OPGL 4GKZB 1GJIA 2XG5A 4WHYG 1UACH 2AJVL 4Q6IC 4UB0L 4OCYL 4ZFGH 1IGIL 2XXCB 4YHMH 1IZJA 4QHMA 2JCCB 3CLEH 3IDXH 2FR4A 1IKNC 4PGEB 4NZJA 1S5HA 3VWKD 1WFNA 6FABL 1H8OA 1OTSC 1FE8H 4GBXB 4F33A 1H3UA 3EYVB 4EDWL 3ZZ1A 2RR3A 5EOCJ 2PW2A 3T1FB 5HPMB 3OKMB 3TZVB 5A2IH 3RWEB 1BOYA 1J05A 2B1HH 1JGDB 1FBIL 5B39G 25C8H 1ULVA 1F3JA 1EHLH 1VEMA 2ICWB 3HS0A 3O81A 3JVGC 5K59E 4OFIA