2ZCLH

Crystal structure of human prostate specific antigen complexed with an activating antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
b'QVQLQQSGDDLVKPGASVKLSCKASGYTFTTYYINWMRQRPGQGLEWIGRIAPASGTTYSSEMFKDKATLTVDTSSNTAYIQLSSLSSEDSAVYFCARADYGFNSGEAMDYWGQGTSVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDCGCKPCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostate-specific antigen
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2007-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zclH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zclH02
3VJ6B 1A0QL 5IR1B 2BVEA 2PO6C 2VKWA 2HKFL 3BIBX 2AXFB 4JZOB 4OZFH 2ADJB 2XXCB 3WIFA 4ISVA 2Z93B 4KTYA 5DQJA 3VCLA 3DX8A 1I7RB 2VLKA 5JQ6H 1G1CA 5IHUL 4CVWA 2EDFA 4OT1L 1ADQL 1OPGH 1P84K 4OZGE 1YEGL 1HSAB 4O2EB 4Y8DC 4MA7L 3V4PH 4WTZG 1FIGL 2LTQB 2ATKB 5ESVB 4H1LH 1WZ1H 2JB6B 1TZGH 2VDMH 4QKXB 2C7UB 4ZTPL 3MUY1 2Z8WC 2A1WH 4MX7A 4LLQA 3PDOA 5F1OB 1JV5A 5IHZB 1QLEH 1VSCA 3PNWA 2FX7H 4JPIA 5GS1A 2M8XA 4LP5A 3HZYA 2HTLC 2JJSA 3TBYB 1B0WA 5JPNA 1HI6B 4FFVD 1E6JL 2Q7YA 4NQSB 4YZFE 1Q0XL 3BYYA 5TE4L 4U0QB 3NACL 1SJHB 3QXAA 2J6EH 3SKNB 3GBNH 1JUFA 2ARJA 3GUTA 3MBEA 5DHYA 1TJHL 1X6LA 4X6FA 5B38B 2M1KA 5TE7L 1QBAA 1BOGA 3PWLB 1RUPH 2FATH 4GBXA 4GRWB 2NZIA 5HPOA 4YHOH 1U8QB 3S4SA 4WU7A 3BISA 5K9JH 2NW3B 5E2JA 4KI5C 5F8QC 5A43C 4JFDE 4XCNB 1ZHBA 5KSAD 2D7PA 3LPWA 4Q6IC 2MKLC 1S9YA 3VRIA 1JHTB 3GKWL 2OMNA 4I9WD 1MCNA 2A9ML 3H3PL 2IFGA 2CLVB 4KJWD 1NANH 4XVJH 2DBLH 2ICWA 4D3CL 3RTQB 2OX5A 2YPLE 2EICA 3DETD 4OI9A 1T3FA 3VA2C 3D2UA 5DMKA 3TVMD 3DTXA 1A02N 2O5XL 4PGDB 4OSUL 3CZFA 4U1HA 4JEGB 1L6ZA 4KQ4L 2AI0L 4PBVC 4ONHB 5D7IA 4YR6A 3TZVC 3BHBB 3RBGA 3VFRB 1IAOA 1CFSB 1MRDL 1NGZA 3V6ZB 5I17A 1HCFX 3O2DL 1A4KA 3VXUE 1H15B 43CAB 1KJVA 1F6LL 3MRIA 1OWWA 2APVA 1VEOA 1NGXA 4AMKH 1QFUH 1WGOA 3ESUF 2OJEA 3D0VB 1ITCA 5JOFB 1DQDH 3KPTA 4HEME 2IH3A 3WJLC 4GQ9L 1KJ3L 2AP2A 4EXKA 2DQFA 1RAMA 1JGEB 3LS4L 3BP5A 2YZ1A 1EO7A 2X1PA 3VH8G 2BHZA 4TPRH 3MCKA 2DLHA 4AL8L 4GOSA 3BIKA 4Q7DA 4OQTL 1P5VA 2FR4B 2VLRB 4JB9L 5GS0D 3L3HB 2MHAB 3ZYIA 1CXLA 5C07B 4NCDA 4PB9H 1RIUH 2IPKB 4HGMA 1MWAB 1U2CA 4GXVH 1VEMA 4DW2H 2Y9RT 1X3DA 2ENSA 4P46A 1YECL 4U1GB 1F5WA 1LE5B 3PXHA 2IADB 3OKKB 4KK5C 3U0PA 1C16A 4MXQD 2R0ZL 5C0RL 4X5XA 5HHVL 3RVWC 1FE8L 3SDXA 4MWFB 3WKML 1Y6NR 4HKXA 4HKJA 4R8WH 5FYLD 4HIIA 1MY7A 2WUBL 1T7WA 1TDQA 2WWMC 4OFVA 3JVGA 1TNMA 4ZG1A 3VGEA 1U3HA 3MRJB 1FYHB 2MTPA 4NO2A 3HMXA 3DV6B 1AR1C 4LGPB 3ALWA 4XPGH 5D1ZC 3C8KA 5ISZE 2H26B 2H8PA 2BOBB 3QEHB 5E94B 1S8DB 3UAJD 2D03H 1IVLA 1J18A 5D2NA 3OXSA 3SKOB 1A2YB 2VDLH 5T1MB 5L8KB 4NO0D 4DOHE 4FTVD 1KTKE 3IFNL 2X89D 3QJFB 4Z7VB 5GRUH 3VRLF 4AJ0A 4X83A 4Q9RH 5KS9E 3ZDYF 3NFSH 1Q1JH 1QSFD 3L1OL 5GIRB 1KTLB 1DJSA 4JFZL 3ARPA 4P4KB 3D1MC 5TF0A 4G6AC 3VH8B 1XGPB 1NUNB 5BMFH 1BLNB 4D9LH 2QSTA 3SE8H 3MLVH 3C6LB 5D1QD 4V1DE 4L3EE 1IE5A 2C5DC 4L4VD 4L8DA 5JW3L 2ZUXA 1IILE 4I3RH 4IMLB 1CT8A 4YGAB 1GJIA 5C8JA 2GTZA 5FUOL 4KKCC 4ZO6A 2DQCH 3RUGB 5F93C 1QRNA 5IB5B 3WFBH 5C08E 4MJ5B 3CXHJ 4P2RA 1ZLSH 1HEZB 4XBEL 5GGQL 1VFUA 4IRZL 2AV7B 4M02A 3QZWG 4H5SA 4FABH 1DQLL 4RFOH 2OR8A 4BK5A 2FGZA 1YYLH 5HD8D 2ZP0T 4JFYA 1YUHB 1KACB 4HF5L 5F9JA 3KR3H 1M1SA 4BH7B 1JPFA 4HGWB 4LSQH 5F7YC 5IP4A 3ARWA 2DM7A 4JO3H 4NFBA 4HWBH 3QIUB 2OP4L 4QTIH 1DP0A 4LLWA 1OAYH 2DI9A 5IEKA 4EXPX 4MCYB 3BWAB 2F74A 1AXSB 5DD3L 1MHPL 4PJBA 2HMID 1F3JB 3QEUA 3EJZD 2DIBA 3EGSA 2VXTH 4M9PA 1EO8H 1PZ5B 2Q8BL 3RZCC 4JREC 1E4WH 1IKFL 2XZCL 4MJ6A 2DLFH 4OAWA 4X8XA 3EYUH 4YPGA 4BFIB 5IROA 1S9VA 2YUXA 4APQD 2HFEB 3WO4B 1UACL 3MZTA 5ANMA 1T20A 3GSOB 3QUYA 3MNVB 3W9DA 3WHE1 3LDBC 5IM7A 1BWMA 1EUUA 2ZUWA 1LEIA 1JF1A 1F4AA 5D7KD 5KSBB 1ACZA 2AJSL 4J8RA 4YHKL 4MVBC 3IJHB 3UYOD 1XCTB 4WUUD 1UB6A 4YAQA 1IEBB 3V2AR 1EO5A 4E41A 3NOIA 5DJDB 4OZHB 1NLBH 2YWYA 5T5NG 5B8CC 2V5YA 3GM8A 4NQEA 4WWKD 3FO1B 3OKLB 2GJ6B 2CUIA 3JTSB 4OF8A 4JZJC 4G6JL 3Q6FB 4LHUD 1MRCL 2B2XL 5DURB 1AQDB 4WGVB 5F72S 1G6VK 1K4DA 3HA0A 5FGBA 3HUJE 4ONGH 1H5BB 5F9OH 1L9NA 1UJ3B 5C0EA 1CR9H 4HWZA 2DQDH 4GRLA 4QXGL 4X9FA 4XNYH 4BSVB 4ZTOL 5ID1B 1F4WH 2EDNA 3D48R 1SYSB 1TCRB 3DXAE 2P5WB 3E6FA 3TM6A 1F6FB 1JN6A 4OZGF 1BEYL 4ZOCA 5FAAA 2EO1A 2J2ZA 3RWIB 3C60C 4GMSH 5GSRB 1NPUA 1S7WB 4WUUB 4MA8H 2EE3A 4QRPA 1AGBB 1JGDA 1OSZB 3MLSH 1P6FA 5BS0E 3B9KA 1S3KL 1U9KA 1EFQA 1EJ6A 2X4OA 4PJFA 4XCCL 3RFZC 3GSUB 3GJFK 2OTUA 1P4BL 3K1DA 3V7AG 1N59A 2NZ9D 1EBPA 2QQLH 5D6CB 1HH9B 2EIZB 4XBPB 3T1WA 3BGMB 1IM9B 4K3GA 2CIIB 5D7LD 4F7EA 4KUZL 5DC9B 1QVOA 3LKPA 2EDTA 4PLNC 4G6MH 4P59H 5C0CB 1UKQA 2J88H 3ULVD 4YZFF 3U4AA 3KPOB 4M7ZB 1YZZA 1R0AL 2NY4C 1VGKB 4X7EC 5FA3B 4YDJB 4YEFA 2WBJC 4PGEB 3QUXA 3EDKA 2J5LB 3LKOA 4X5WB 2F5BH 3LVEA 2EDXA 1FCCA 3FO2A 1ZHLA 4XAWL 4KVNL 4HPYL 4NQVB 5ETUA 5K33A 4OM0H 4DN3L 4PP2A 1G7LB 4KGLA 1QD0A 4CVXB 4ZUVA 4MDJB 4JY5H 4PLKD 4UNTA 5JIIA 2Q76B 4JFFB 2CRMA 3OGCA 4UIMB 5IMOB 2E7LA 4HT1L 3PL6A 4HMCA 4HJJL 1ETZA 5E24E 2AEQH 5FOBB 3EO0B 4RNRA 2Q3ZA 1HZHH 4NJ9L 4TNWK 5EH1A 2DRUA 4Z76A 4WFHD 4KRNA 3MQIA 4HG4K 5DF0A 4G42A 2QR0A 2NX5E 3U2SA 1ZLWK 5I1HL 3T2QA 4F9LC 5B3JE 4ZFFB 2GT9A 2PW1A 5SWSA 2X44D 2VMFA 2VXUL 2K1MA 4O58H 4F9PC 5FCUL 2VL5A 3QFDA 2XV6B 1EHLH 4NGHL 4M00A 4BFGA 2GJZA 1SY6L 3PHSA 1AP2B 3VGGA 3QXDB 4GKOA 1BECA 1KXQE 2J8OA 2F58L 4OFKA 3RVTD 4M7JL 5DQ9B 3MRMA 1XGQB 2PXYD 2AJUH 1NL0L 4XB7A 1A3QA 2GTWB 4HUMB 1V7NL 2IAMA 3HC3H 2NW2B 1PX3A 4OGAC 3BAEH 3LN5A 2X05A 3ARDA 3I75A 1QLRB 4J12A 3UYRH 2VERN 1KIPB 1Z3GL 4ZNEE 1A7PL 3VFWB 5HGBB 4HV8B 2RIKA 1N64H 5GS0L 1FVEB 2BC4A 4R97B 3ROOA 4G9FE 3VXTB 3MUJA 1MFCL 3NGBC 4Y5XA 1KT2A 1YPZB 1U92A 2GK2A 1IJ9A 2IPTL 1N4XH 2CJUH 1CLOH 5FXCH 5L2KB 1HYSC 3V8CA 2V7HB 3CMGA 3VXNB 3DX6B 5D1XA 1X5LA 3TO2A 4N8VG 1FYTA 3D0LA 5DMYA 1NFIA 4CADB 3IS0X 5AAWA 3LQZB 4RA3A 2IANE 4AT6A 5DA0B 1B6DA 3VMOA 1WCBB 1S9XB 5IK3A 3VE0A 5CJQH 3AUVA 4PJAA 3QDGA 1FGVH 2WM0A 3FONB 5FYLL 1ED3B 2C4XA 2DI8A 5C71A 1NCDL 1BFOB 1MJ7H 3OR7A 4LOUD 5I1AB 3TPUA 5DJXA 2VWEE 4CVZA 1J9CT 3NZHH 4PRNB 4WEBH 5I1LA 1QA9A 1UM4H 4ZXBC 2E9WA 4Y5VB 4YHMH 2IG2H 1U8PA 5HGHA 3B5GA 2G2RB 5C0FB 5FYJD 1WEJL 3LAFA 4FQHA 1CICD 4OZGB 3G6JA 4DKDC 1QHOA 2XQYG 1O5DT 1ZT4A 5IW6A 1UQSA 3N1MC 5GGUA 5E2TH 4LU5L 2VLJB 1PKQA 1NQBA 3IT8D 3ZDZE 3U6RA 4D8PA 3BZFA 3VXOB 5KS9F 5HHOD 2YK1H 4I0PD 1DLHB 1OHQA 4DKEH 1B4JL 2H45A 5CGTA 2Y5TA 4LNRB 4WHTB 1YEIH 4NOFA 5FCSH 5MERA 2R2BA 4HAGA 3TEUA 3T0WA 1BVKB 5TDNA 4OGYH 4OUUA 1AO7D 2X7LA 3UTSE 1YYML 2OQJA 1NFKA 5IMMB 4ZUUA 4K3JL 2F8OA 1EZVX 3WN5A 3MRCB 3Q5YA 4OJFH 3BD5A 5DUML 1OTSC 5BOZG 1IBGL 4HLJA 5CJ8A 1TVBA 5IJKA 2IC2A 4XC3H 3OR6A 3RX8A 3PGFL 3F7YA 4DVRL 3G5VB 1KBGL 3VWKA 3GSNB 2W0FB 1VADA 3FFCA 3ZTNL 1QSED 3LY6A 3QIWD 1IGTB 4NRXA 4JFDB 3L3DA 4I0PB 4MXWH 3FB8B 4WW2F 4HC1L 2PTUA 3M45A 2NY7H 1N6QH 3WEXA 5D7JA 3WE6A 3QHTC 3BFOA 1EIBA 4OCXH 5IUSA 3MODL 5AD0A 4R26L 2QSCL 3AREC 3B8SA 1G9NH 1YDPA 1ONQA 4JFHD 4JDZA 2OK0H 3BRGC 1MUJB 4ZOEA 4I3GA 4G8EA 4ZS7H 1YEEH 4Y16A 1QLFB 3PHOB 3I50H 3VFGH 1SEBA 1X5GA 1Z5LB 2F54D 1BPVA 4AK1A 2W9DL 4JJ5A 3LPGA 4OI7A 4MYWB 1A1MB 1CLYH 3N9GH 2KH2B 1UKSA 2YD1A 3BUTA 2A6IB 5ICYA 2FX9H 2UUDK 3BVNB 3D18A 4JZNB 2P8MB 2VDRL 3ARRA 1SMAA 5AZ2H 4DN4H 3C08H 1YJDL 3QIWB 4M5YL 3MRGB 5GISH 3BPCB 2GJJA 2YUWA 1JGUH 5DD6A 3WO3B 4J6RL 2DBJA 1NC2D 1U8LA 1MFAL 3B83A 2MMXA 1CXEA 2MFNA 3OKNA 2XN9A 4EQ2A 1QKZH 3VMPA 3Q48A 4EN3C 3CSPA 3CVHH 1OP3H 3UZQA 2W60B 5I1JL 1H3UA 1DVFD 2HT3C 3ZKXC 4MAYD 4D2NA 5F3BA 1A7RH 1KCSL 2AJZB 2JJTC 3BP4B 2GK0A 2FHCA 3KVQA 5HVWA 4FQIH 3TN0B 3VFSA 3BKJH 3CFBA 3O0RH 4TSBH 4M5ZH 3UPAA 3NCMA 1I8LA 4AQ1B 3QQ4A 4RAVB 3ZL4H 5FO8B 4U6TA 1LP9B 2FJFB 5D8JH 1FSKB 3QNXA 3WD5H 5BXFA 2LABA 2XWTA 2WQ8A 3C5JA 32C2A 4UT6L 2Z31B 4KHXH 5CHNA 2V6HA 3RRQA 3HE7D 3G04A 5EOTA 5FYLE 2X1QA 2BSRB 3DV4B 3NIDE 4LSDA 4MNQD 2YHGA 4PJ8A 5E1AA 4OF3A 1XIWD 1RVFH 2H1PH 1P7HL 4HUVB 2FZ3B 3ZYJA 3C09B 1OSPH 1D5BA 3VD4A 4OZIA 4HS3B 4IRSD 2D7MA 3F12A 4PD4K 3PUCA 3QDJB 5F71A 3PV7A 3R06A 4Z7UB 1DVFB 5DJ2A 5F6IC 4NKIL 1NKOA 5IFHH 2E9JA 5IBUG 4NQTA 1T89C 4FTVE 3VFOB 5JLZA 4N1HB 1DBMH 2OJZL 5ISZB 4L3CB 5E70A 5KBNC 5I0DA 1QSFE 1MHEA 5EUOE 4JDTL 3ULVL 3RU8L 1FH5H 4FMFA 4DOHB 3JWOL 3M8OL 2XA8L 4AG4L 4LASL 5H2BB 3OF6A 1XF5A 2HYMA 2VZ1A 4NM4H 4OBSA 4Y2DD 1MCDA 2BCKA 2HVJB 1EVUA 4MNQB 2BVOB 1NAKL 1XIWB 2EDEA 4L4VE 1QFPA 4JPVH 1I7UA 1FG9C 3NMEA 4A6YB 2NY0B 4JG0L 4M61A 1RZJH 4IRSB 5E6ID 5BV7B 5BVPH 4ZOAA 1YEJH 3BO8B 4ZUSA 1DN0B 3K1KC 3VRJA 3WIHA 1JNHA 4PG2A 2P47B 1MCPH 4KAQH 3HE6A 3PWNA 4ZUTA 2VDQH 5DRXA 4DZ8A 5EO0B 5EIIA 4QRTB 4ZFOA 1DDHB 3BDXA 3UC0H 1R5WA 3WS6A 1EEZB 1TVHA 4MD0B 5FV1L 2P8LA 5E4EB 5ENWB 4BQ9A 5LGJA 1P4IL 2F19H 4N90D 1ACYH 4FQQB 3RDTD 3DX7B 1U8JA 2ZSWA 1D7FA 4I77H 4PTUA 3SGDH 1LMKA 5F88B 2OR7A 3TBTB 4Y4HB 4FQPA 3OXRA 4QF1B 3ZE2E 1ZSDA 3HPLB 4EUPB 3GSXB 5LG1A 4XGZB 2DDQH 5JOEA 4H88H 3VXQA 4P4RA 1F4YL 3WHXB 1A7NL 4WW2B 5B3JF 2IBGA 4RQQB 3WLWD 1N0XH 3MJ8B 5E6IB 4J4PC 5IB1A 4JE4B 5DK2B 2HJFB 2FO4A 3KWWA 4QRSB 1JIBA 4UT7L 3WXVL 3SCMB 5ERWA 3T0EC 3RVUC 1G7MA 1L7TL 2EO9A 5J1SC 1ORSB 1I8KB 2XZZA 3Q2CA 1LO5A 3VXMA 3O3BA 1CCZA 1I9JH 5SX5H 1OGAB 2R1YA 1CDIA 1CVRA 4NKDB 2X4TA 4D9QD 4GAGH 4YC2B 2FL5A 2LQRA 4R0LB 3UTZB 2A6JB 4K3DL 4CRPA 3T2NH 1PG7W 3FT2A 4JFQB 1YNTB 5DT1L 3S9DB 5EO9A 2EYRA 3KPRB 2DYPA 3TO4A 4JQXC 2YRPA 5J9PB 4PJHA 3MJ6A 3V6OA 5C9KA 5JHDE 1E6OH 3NAAH 5JUEL 4NBYB 2HG5A 4OLXL 2B5IB 2QL1A 3VW3H 3B9VA 4LVNB 5DS8B 2G60H 1RUML 5DI8B 1NUFA 1Q72H 4POZD 4JLRB 5T1DH 5KVEH 3QHFL 4PG9A 5KVDL 1I9IL 2FWOA 4K94L 4R7NA 5IW1B 1AHWA 4GS7C 3EFDH 1KLGB 3GSRB 2CGRL 2XKNA 3AM8A 5TPWL 3ZLQC 2BVPB 2J4WL 5FYKU 5HVGB 4FQLL 4IDLA 4ZPVA 4ERSL 3VD3A 1KG0A 5I16A 4OZFA 4GW4A 4ZPTA 1YEFH 4G80A 4C58B 1GGUA 1VFAA 4KJQD 4N0RA 1A47A 3PABA 3N85H 1DUYA 3QDMA 3QUZA 4I4WB 4K7PH 4LLUB 4MNGE 2MCPL 2Q87A 1EXUA 4HK0A 3HI5H 4R4BA 3JUYA 4HIEB 2OS7A 5TDPB 1MCWM 3OTTA 4L8SC 1BREA 4HFWA 3MXVL 3QCUL 1VACA 3D3VB 1KB5H 3ZDZF 5I1DA 5IT2L 4H1LA 4ALAH 4UTBH 1M7DB 1NH6A 1S7XB 1U8HB 3O6FB 1BVLA 2DWDA 1VPOH 1D6EA 3F7VA 4NPYB 3BE1L 3RGVA 3WLBB 2ITDB 3O4LE 2BVUA 3KXFA 5T33H 4N9GA 2DQJL 1FZJB 4ZNCD 3GI8L 1HOCA 3U9PH 1LDSA 4X6BA 1S7QB 3KPNB 4NM8L 3LIZL 3IFLL 5HJ3B 3D25B 1BBJB 1N5AA 4FP8L 4PB0L 4U6XA 3I2CH 4IEFB 4WNQA 4X8JA 3GK8H 2JB5L 1DQJB 4XTRD 2ZCKH 3KYMB 4J3SA 5HYSA 5I1IL 4Y1AD 3BPLC 1I1YB 4NC1E 5DLMH 4RAUA 5EO1B 1IC4H 3P40A 3AU1B 3V6BR 5GHWL 1EGJA 3BYTA 3O11A 4PJCE 4LARH 4OF7A 4WFHE 4S2SA 3IKKA 4WVRA 1A7QL 1VGEH 3WJJA 3JV5A 4U1SB 3ZZ1A 4P48A 2BMKB 2Z35B 4HJ0C 1KJ2B 2OM5A 1BZQK 1CDYA 3DMMD 2R0KL 4U3XA 2OZ4L 4HZAA 1YEDA 3BH9A 4X6EB 3ZTJH 4U49A 3MUHL 1GCFA 2CSPA 3O45B 4NJAH 1LD9A 1BGXH 3MROA 1AI1L 4R3SB 5DJCA 4K7FB 1A1NA 3SKMB 2XNAB 4UQ2B 5JPMB 5DJ6B 1D5IL 2BDNH 3BPOC 4I5BA 1IQDB 5IVZA 2XPGB 3TNMA 3QCVH 4G8FB 1H3PH 4TUJB 3IDYC 4NQUA 4E0RB 2XTJD 1ZHNA 4O5LH 4GRMA 5GGSY 1OAQL 3IXAB 1YMHA 4LCWE 3HZKA 4JVUA 5DHVH 4F33A 1UVQB 1UXWA 1EAJA 1AH1A 3HNSL 4K55A 3G5XA 3VG9B 4QOKA 1GHFL 5K59E 3EZ8A 1TETL 3UBXA 4ELKB 35C8H 1YMMB 3ILQD 2Y72A 3NTCL 1RJLB 1J87A 1E28B 4R2GC 4WEMB 5FM5M 5DD0L 1TZHA 3VDBA 3ILPA 15C8H 4S1SL 1KCVH 3M07A 1R5VA 3P9LA 2AVGA 3SBWA 2IGFH 3CPLB 4MQXD 1HDMA 3JXAA 4W6WB 2AJYL 3ZT6A 1JMXA 2EDDA 3O3EB 4L29A 2NR6D 5DHXB 3NIDF 3T77B 2OR9L 5I2IB 4QXTA 1MJUH 3LEXB 5IFJB 3MNZA 2B4CC 2ZNXA 5I66A 1EHAA 3V5DA 3X3GL 1U2HA 3K3QA 1I85A 3ALXA 4RFEA 2B4CH 4RRPA 3NBNA 5GPRA 3B2VL 4UB0L 2FH6A 2IFFH 3KYOA 4XAKD 3C5SB 5AWNH 3VWJA 5I71B 1LEKA 4HBQA 4KGJA 4RISL 5F1NA 1A6VL 4JFOB 4XMKL 3ZKSD 4WHYH 3MJ7B 5C09D 4M93B 3I9GL 4KDVA 2WNGA 5D2LA 4B53A 3D69A 1L7IH 1A3LL 3PQYD 5EOCL 5EUOF 3D9AH 4HWNA 4PLOB 1RZ8B 3P30H 5SX4I 5L0QB 5C0AA 4LAJH 1B88A 2VQ1A 3P9MB 4KFZC 4PY7B 5FO7B 4HQQH 4DVBA 2FBJH 1NJ9B 2HTLD 5KJRL 1OD9A 1AO7E 2Y06H 3SDYH 1T2QH 3AXLB 3EYSH 1MQ8A 4ODBD 1NDMA 3A67H 5FYKH 4IMKA 5EN2B 3LKQA 4LAQL 3RAJH 4CN1A 1X4XA 3V4UL 2HVKB 5CP3H 4QRQB 3IAGC 2NNAA 3I85A 1T7YA 3RWCB 4YX2H 3L5WA 2Q1EA 5CEZH 1QO3A 4XNZB 4D0BA 3RIFK 5C09B 4M1CD 3QPXL 1EFXD 3O3UN 4WV1C 1QSEE 1A6TA 3PQYB 5E2UH 2KQMA 3V0WH 5C0GB 5D7IF 1T2XA 1K4CA 2A6DA 5DMGC 5I8EB 3SDAD 1MCCA 1WLHA 4LQ1A 1DSFH 3TLRA 1D5XA 1Z0NA 3OB0H 4ZD3H 5IG7A 3UJTH 3IGAB 4IOIB 2N56A 4JFHE 4TOYL 2AQ2A 2BNUB 1SBSH 3MUGA 5JW5A 1QR4A 4FQJH 1XEDA 4NWUL 4HWBA 5IBTL 5J11C 3WFHB 2VXSL 4Y4FC 3V5HA 5L88L 4C83B 1DLFL 2F54E 3MFFA 4XRCB 1MLBB 4PJIE 1NBZA 1Q8MA 4P23C 5CIPH 1QBLH 4JRYD 1QHPA 5C3TA 1JRHH 1NCBL 1ZA6A 3D85D 4YFLF 3B3IB 1VFBB 1N7MH 3IDUA 5C2UB 3RPIA 1KLUB 5HYJD 2BSSB 1ZHKB 1I1FB 3SKUD 1T5WA 3A6CH 4B50A 3SGJC 1A0QH 5D4QA 1CD8A 2HKFH 4L4TD 5BW7C 1MY5A 2VLKD 1BZ7B 2R4RH 1ADQH 2CKBB 4U2YA 1T83C 3CDGB 3BKYL 1CFVL 4N5EC 5FGRA 1H8NA 1LO0L 1WCQA 1IAII 4NHUB 2OCFD 5F6HJ 5EBMA 3L95B 1FRGL 1CD1A 4HCRH 1VKXB 1PSKL 3FT3A 3HAEG 3TYGH 1AE6L 4KK6C 3GB7B 4KDTA 1FIGH 3O41B 1IAIL 4JDVB 4LIQE 3KPQB 5D71L 1Q38A 3BJ91 3NZ8A 4ZTPH 1FBIL 1I1AC 4GQPH 2YA2A 4NT6A 5BZWA 4Z95L 4WI3A 1X5HA 4NN6B 3QUMB 3OHXA 5T1LA 3U46A 3WL9B 4TTDC 4KTDL 1W72A 2DKSA 5IB4A 1Z0MA 3ZT5A 1OGTB 1E6JH 3JWDC 5ECJE 2AXGB 3VMNA 3WIFB 4ISVB 1Q0XH 4PRBA 5DQJB 5IHLB 3VCLB 4I1NB 2RCSL 3DX8B 3QFJD 4U6HA 4JQIH 2VLKB 4KKBC 4UOJA 3S5LG 1PZUB 4XHQA 5I30H 3NCFB 4ZAKC 3JWDH 4PJ5A 3NACH 4FQXC 1INEL 3BSZH 4BUGA 2Z4QA 5DUPL 3QNZB 4PGBA 1IEHA 1BD2D 3MBED 2ZSVA 1TJHH 5TQ0L 3SQOH 2AK4A 5DR5L 4IM8A 3WDHA 2W07A 3OZ9L 4HIHA 1EK3A 2BVYA 2QADB 3HG1A 3LKRA 2NY3D 1PY9A 2EH7L 2W0LA 1OT2A 1NSNH 4LLQB 3PDOB 4MX7B 5D1ZD 4PJ7A 4OGXL 3PNWB 1RULL 2EDBA 1K8IA 3GKWH 4JPIB 4YHPA 1FIEA 2C3WA 1V5JA 2A9MH 2LAAA 2UWEE 3HZYB 4S0TD 5JPNB 4P5TB 2Q7YB 4D3CH 3W81A 4HSQA 2YD8A 2C9AA 4U05A 1UG9A 3D2UD 3L5XL 3LQMA 2O5XH 3MV8A 3SGEH 3FOMB 4EI5A 3U7YH 2E7MA 3QXAB 4KQ4H 2AI0H 1F90L 1JUFB 3ES6A 2ARJB 3RNQA 3MBEB 5DHYB 3CLFL 2DQUL 3AS1A 1X9QA 1MRDH 4J2XA 4GBXB 1EZVY 3O2DH 3S4SB 2ADIA 4UDTB 4WU7B 4PBXA 3PWPA 5F7NC 1L0XA 3DO3A 5FHBH 4ODHL 1F97A 5ABDE 1C12A 4KKCD 1ZHBB 3TT1H 1Z9LA 1S9YB 3VRIB 4X4YA 5EBLA 4MAUH 2XICA 4N8PA 4GQ9H 1KJ3H 3C9NA 4MCZA 4PJCF 1JBJA 2ICWB 3BN9C 3LS4H 1P4LA 4CJ0A 4POYA 3DTXB 2EDWA 4NUJB 1B3JA 3CZFB 3LHPL 4U1HB 5LAXB 4AL8H 2H2PC 4YR6B 5D7IB 5L7XL 4OQTH 5ID0A 1U91A 4LBEA 5FDWA 4Q6YA 4JB9H 2HH0L 3IDXL 3MRFA 1TJGH 1IAOB 5F7EL 5J6GA 2X42A 2F53A 5BZDA 2ADGB 1NGZB 3KPSD 4RGNC 5I74C 1IGIL 5I17B 1G7IA 5CCKL 4KKLC 1KJVB 3MRIB 2JCCA 4G6FB 5IMLB 5JIHA 2ARJQ 4EIZC 1NGXB 1YECH 5DD1L 4LNVA 1MPAL 2OJEB 1G9EA 4HHAA 2D7TL 2ZUVA 3O8XC 1DANT 4GKNA 2R0ZH 2DQFB 2GKIA 4D9QE 1DQML 4MZ2A 5C0RH 3QO1A 3BP5B 1DANU 4JZOA 3DUSA 3O9WA 1GSMA 1FE8H 2LAGB 3WKMH 3UZEA 3DI3B 4JY6B 3MCKB 4TRPL 3TJEL 5BVJA 1F6AA 3BIKB 1YY9C 1J11A 4YDKL 2RAMA 1HSAA 1JI2A 3PWJA 1YQ2A 4MVBD 3QAZB 4E9LA 2P5EA 5K59F 4F7MB 5EU7E 5KTEH 3VFVA 2R9HC 2C7UA 1OB1A 4P46B 4RFNB 1LE9B 5CBEB 2RJMA 3IFNH 4AYFA 3LSOB 4TNWF 4NWTL 3X13A 4RGMB 1IAIM 3U0PB 1JNNL 1NBYB 3L1OH 2YN3A 1C5DA 3QI9C 5MI0C 4X5XB 1HI6A 5HTSA 4JFZH 4OZIE 3SDXB 1OOAA 2XOTA 3WFCL 4HKJB 2DKMA 4HIIB 4KUCF 5SWZE 1SJHA 1E27A 1J7VR 2CDGA 5D93C 1U3HB 4Z0BH 5JW3H 2BNQD 4NO2B 1W0WA 3TGXA 1QRND 2OI9B 1CDCA 3C8KB 2XKUA 2H8PB 5FUZH 4P2RD 1U8QA 3S3JA 2PKDA 3C60D 2EDHA 4XBEH 5DRWA 3OAUL 5D2NB 3FQUA 3OXSB 4PRPA 2A1WL 3NCYS 2K9UA 2NY6B 4Q97A 4ZXBA 1QLEL 1Q9WA 4O2FA 2FX7L 4MNGB 4W4OC 1JHTA 2NTSP 1W0YT 3CK0L 2BRRL 1R5IA 3HNVL 3IJSA 5GRJL 3AB0B 4U1KB 1D6VL 4HF5H 5BRZD 2CLVA 3F58L 4YHIA 4YBLB 1RUKH 3GIVA 5J12C 4PJDE 1C1EH 3SDCA 2X1OA 3QJHA 4IRJA 3SE9L 4PGDA 2OP4H 1JZ4A 3PE9A 4L8DB 2H32H 1P2CA 1CT8B 3BEVA 5DD3H 5C8JB 1MHPH 2GTZB 1QRNB 3HC4H 4WTZA 4ORZC 4P2RB 1IM3A 2C4FT 5DJZA 4NCC1 1NANI 5GXBB 4H5SB 4Y1AE 2XZCH 3QHZH 3RBSA 2C4FU 3D0VA 1EUTA 5FDYA 4DKFH 1K9TA 4JFYB 5F9JB 1UACH 1JPFB 4OCYL 4OKVB 1B2WL 2DJSA 3UDWC 3WFDH 3EYVA 3ESVF 3EBAA 2V5SA 3L3JB 1INQA 3GRWA 3OAZH 2FR4A 2DJUA 3QDHA 2AJSH 4PJCB 2AQ1A 4WU5A 3SGKC 4PJBB 2IPKA 1CLZL 3QEUB 1U93A 2GW5A 3EGSB 1MFBL 4Z7NE 4PJIF 3LCYA 1FQ9C 4NQED 3SO3B 3WS3A 3X14A 3FZUC 4G6JH 4H8WL 2B2XH 4MJ6B 4OAWB 4YPGB 3T0VA 5ILTL 3LEVH 1DQDL 1S9VB 2GFBA 2IADA 3OKKA 4PGCA 3V0AC 1JNLL 3B2UC 5ANMB 1T20B 2NY1D 3QUYB 2EDYA 1CGUA 3W9DB 1T1ZA 4GMTL 4QXGH 2XTJE 5IM7B 1K3IA 2DQTL 1LEIB 2J8UE 3B6SA 4UAOB 3SE3C 4J8RB 4FZ8H 1BEYH 3CX5J 3ISWA 3VFTA 1SVZA 4R90L 1UB6B 4YAQB 1CGVA 2JE8A 4E41B 4QRPD 2W38A 1JJUA 3L7FA 4X4ZA 3PGCA 1S3KH 1OD7A 4GXVL 1X5ZA 4XCCH 4NQEB 1P4BH 3SKOA 2YBRA 3CVHA 5T1MA 4PJAF 2V9RA 3GBLA 3OKOA 5LQBH 3QXWA 2VYRE 5GJSH 4FFVC 1HYSD 1MEXL 4KUZH 2ICES 3RTQC 1KNOA 4OFDA 3TCXA 1K4DB 5E6YA 5GGVL 4LDEB 4M62H 4Y4KA 1JCKA 5C0EB 5E8EA 3H9SE 4HWZB 4Y19A 1A6PA 4GRLB 1CZ8L 5K9OA 1CD0A 3VH8A 2Y25A 4ZO9A 1R0AH 3QUXD 3UTPD 3BZ4A 5I9QB 4YHNA 1JN6B 4WFFE 3EYOA 2ZG3A 4B7LA 3CGTA 5CLTA 1Z9OA 3EOAA 4R9HA 4J1UB 3HCVA 4XAWH 2Y07H 4XPGL 3QRFM 4KVNH 4HPYH 4QRPB 1PYWB 1JGDB 1NFDA 5IB5A 4DN3H 3B9KB 2BVTA 2X4OB 4PJFB 2OTUB 1N59B 1OW0C 1PVHA 5DZOA 2KKQA 4ELMA 1CXHA 4F7EB 1QVOB 3LKPB 5D70L 3PL6D 4JGMA 4HJJH 2VUYA 3NFSL 1Q1JL 2IQAA 3WIIL 1NEZG 2UWEF 4P2OA 4X9BA 1WT5A 4JJHA 5KSVA 1E4JA 2BFVL 3RIAK 5F21B 2V2WA 3QIUA 3TNNA 3C5ZB 2V5MA 4XPAH 3QUXB 2CRIA 3WNPA 4Z7WE 3LKOB 4NZRL 5F44A 5I1HH 1HXMA 4CGTA 3LRSA 3FO2B 1ZHLB 3UX9B 2VXUH 1NAML 2DQCL 4U1GC 5H35A 5ETUB 5FCUH 1ZV5A 3DYPA 4PP2B 1JWUB 1ZLSL 4NGHH 3Q5TA 4M3JA 2P24A 1SY6H 3I3BA 4ZUVB 1OP3K 1GGCL 4FABL 3S8WA 2C1PA 3OGCB 3IF1A 4BFIA 1OTSD 2F58H 1XT5A 4PTTA 3PL6B 1ETZB 4KI5E 5I73C 5EPMA 3KR3L 1I75A 2GITA 1NL0H 2IAMD 1V7NH 4P49A 4U6YB 4RNRB 4KV5E 5EU4A 3T2OA 1Z3GH 1U8NA 1A7PH 4Z76B 4NO5A 4N0UE 3K2UL 4NN7C 1F2QA 2DD8H 4G42B 4S10A 2QR0B 3H8NA 5J8OA 2GT9B 2PW1B 1H3GA 1MFCH 1P7QA 1X44A 1YN6A 4LKCB 4I8DA 5SWSB 1MIML 3ARUA 2X4RA 3O4OB 2H9GA 3VD7A 4X7TA 1KV3A 3QFDB 4W4NA 4JRYE 4WDIA 4WI9A 2FJHA 2GJZB 5D1XD 1I7ZA 4YDLB 3P77A 4MXQC 3JTSA 5IMKA 3QZWA 4LLYA 5HYJE 3L3KA 4P4KC 2XWBA 4GXUN 5EZJA 2Y7QB 4OLEA 1T21A 4L4TE 3HC0A 3C6LC 3T3PE 3LN5B 3ARDB 1IL1B 3I75B 1OCWL 3TH2T 1U6AH 5FYLH 3HI1A 3BZEA 1CVSC 4IHOA 1NCDH 4XVTL 3TWCH 5DZLA 4EEEA 1KPRA 3SPVA 1U42A 3HMXL 3MV9A 3X3FH 3ROOB 5A40E 2EKJA 3UAJC 1JTTA 4Y5XB 1JZ7A 1U92B 1IC5H 1S7WA 4C56D 4XPBL 1RQ5A 2BY1A 3J7HA 1TNNA 4RMRA 1WEJH 3GMNA 4OD2A 3GSUA 5D1XB 4XP9L 4MMXC 1YN7A 5CILH 1MHCA 1J0JA 3ULUC 1EJOH 1S5HB 3TO2B 5D6CA 3U0WL 1FYTB 3D0LB 5DVLA 4CMHC 1NFIB 4LU5H 3VXRD 5GGRY 3MC0A 4AT6B 2AEWA 3CDCA 1CGTA 5DRZA 4ONGL 4XXCA 5IK3B 3VE0B 1J8HA 4PJAB 2W92A 5D1QC 3QDGB 1KIUA 5FKPA 2G75A 4OZIF 1B4JH 3QFJE 5SWQB 3ARFB 3OR7B 4YDJA 3TPUB 5DJXB 3OKEA 3NH7L 4I3SH 4CVZB 1QA9B 2AGJL 4R6UA 1JZ3A 1BD2E 1JI1A 5HGHB 4GMSL 1YYMH 4PRID 2R2HA 4ODWA 4LMQI 2P48B 2YD2A 2C3VA 2BNRA 1TPXB 4FQHB 4G3YL 1MCKA 5D2LE 3G6JB 4AEIH 1IBGH 3FB6A 3LKSA 2YPKA 3WO4C 5HD8C 3UMTA 3ZDXE 5LXGH 1ZT4B 5IW6B 2AV1A 1UQSB 1LVEA 3M17A 3WSQH 1KEML 5GGUB 3X17A 1PKQB 4DVRH 4UIMA 1Z9SA 3VWKD 3U6RB 5HYIA 4BFEA 3BZFB 4U7KA 3FFCD 4G6ML 5E99L 3ZTNH 4J3TA 12E8H 4PJDF 3GHBH 3UTQA 2PYED 2C3GA 4HC1H 3GSWB 4X4XA 2Y5TB 3PWVB 5SX5K 5K9KA 2R2BB 3EJZC 5DEGA 3ARGB 2F5BL 5TDNB 5F89A 3QCTL 2Z8VC 4R26H 1OTUD 2QSCH 5E9DD 2X7LB 5IB3A 2OQJB 4HEPG 4ZUUB 1RZFH 2RBLA 4P99A 3WN5B 4OM0L 2PCPA 4XMLH 4Y16D 3DPBA 1MF2L 1ZTXL 1G6RL 4XCEA 1FNFA 4RX4A 2W59A 1TVBB 2W9DH 4APQC 4JQVC 4JY5L 1H5BC 3OR6B 4JPWL 2IBZX 4PS4H 2V2TA 1UJ3C 2CXGA 4LVOB 5LWYL 3S37H 3OPZH 1YJDC 2EZ0C 3RWGA 1RK0A 3LH2H 4P3WA 1XGQA 4OFYA 4WENB 1AD9A 1VADB 2OXGA 4GXUM 5LCVL 2AEQL 2W9LA 1YJDH 4NRXB 1IMHC 4M5YH 3L3DB 3P4MB 1QPPA 4OCRL 4OFIA 5D6DC 1IKNC 1HZHL 2OLDA 2DQGH 4IS6A 4F7TA 3WEXB 1S7SB 5D7JB 5FYJU 4FN0A 4G7VL 4AENA 5AD0B 2XN9D 4RSVA 4RGOH 1YDPB 4LPTA 2E9BA 5C2BL 5J3HD 1ONQB 4WWKC 4JDZB 4LRIA 5I1JH 1JZ6A 1R3IL 3KPSE 3OGOE 4U1LB 4G8EB 2Y1VA 1N3NA 5ADPL 3NPSB 4Z7NF 4H0HB 3IDMA 3T0BA 4G8IA 4R4FL 4JJ5B 1GAFL 1KCSH 1FNGA 2NY2B 4NZJA 4J4PD 3TT3L 1T66D 4Z18A 3CH1B 4PJEA 4CADA 5ICYB 1KELH 4DZBA 3GDBA 4M7ZC 1NC4A 1WCBA 2AJUL 2A74A 4YXHL 2J5LC 3DBXB 3RWEA 4UT6H 5DD6B 4PY8I 1U8LB 1BFOA 2Y6SD 4NQXA 1N64L 1B0RA 3ARYA 5KAQF 2J8UF 5GGTA 3QO0A 2XN9B 4Y5VA 3O6KL 1WWAX 1OAKH 3GSVB 2NZ9C 3GEWB 2VAJA 3DECA 5GSVA 5E5UB 4NKIH 4RZCA 1FZOA 1X4YA 3IRPX 5F3BB 1HQRA 2N1KA 1WZKA 3L5HA 2GK0B 1UFUA 2W0PA 3MOAH 1E0OB 4F57L 4MGXA 3VFSB 3CFBB 3ULVC 4F37K 4N0CC 2OJZH 5J1TC 3QQ4B 1F3DH 4ZOBA 2VABB 4ZDHA 2XXMB 3M1BA 4I18A 5CJQL 3QNXB 5BXFB 3ULVH 3RU8H 2XWTB 2FJGA 3C5JB 5AZEH 1FGVL 32C2B 1TFHA 5CHNB 1EEUA 3JWOH 3FHQA 2XA8H 3M8OH 3OF6D 4AG4H 5EOTB 1J1OL 3BIAX 1LK3L 1PLGL 3G08A 1XR9A 4PJ8B 4LQFH 3NZHL 5ICXA 1A6UH 1NAKH 2BNQE 4JG0H 1D5BB 4OZIB 4W81A 3HLAA 4OGZA 3F12B 4PLKC 3JV0A 2XZAH 3R06B 5E00A 5SWZB 4DKAA 3NA9L 5F1KC 3HE6D 1KFAL 3V52L 2XG4A 2WBKA 3UTTE 1FNSH 4MLSA 4LMQE 3S36H 5JLZB 4N8VA 1KPUA 4KC3B 2HAZA 2I25N 3V5KA 3W9EA 6CGTA 3Q6GL 2W0FA 5BRZE 4BELD 1MHEB 4XNQA 1OARL 2PR4H 1F45A 4PJ9A 4R97C 4JFDA 3ORJA 2A2QT 4DKEL 4QHKJ 1ERNA 1XF5B 5LGKA 2K7PA 3RY4A 3K8KA 4Z7WF 1I7UB 1HHKA 1XGRA 2CDEA 1F4YH 5I75C 2CK0H 1C08A 2YPLA 2WK2A 5IQ9A 4ZUSB 5KAQG 5GGRA 4OJFL 3VRJB 1LO2H 2YR3A 3PHOA 4PV9A 3JV6A 4JN2A 4ODUB 3WV0A 3HE6B 3PWNB 4ZUTB 5JQHC 3RVTC 4P5KA 1KGCE 4MJIE 4X80H 5DRXB 4DZ8B 3WUWG 1L7TH 2PXYC 4XC3L 4ZFOB 1A1MA 5B4MC 5CEXA 1Q9OB 1TVHB 2P8LB 4XVUC 1RURH 3B8YA 2A6IA 5LGJB 1Q9KA 4YDVA 1CK0L 1IRAY 1KN2H 2P8MA 3VXUA 2FLBT 4KI5F 3W0WA 5IHBA 2ZSWB 4MHHG 4MB3A 4PTUB 5ALCL 5E8OA 3BPCA 3F6IA 2OL3B 4JKWA 2NY7L 2IH1A 2FYYA 3OXRB 2OTWA 1ZSDB 4FFZL 3VXQB 4P4RB 1FCGA 2DLEA 5E8DL 1FO0A 4G9DA 5DT1H 3RWDA 4JANA 3CIQA 5ESQA 4I0KA 1RHHA 5IB1B 4JG1H 4KHTH 1I9RL 2IPUG 4MXVE 2FO4B 4LEXL 3KWWB 3VFGL 5JUEH 5E5RB 5ERWB 1G7MB 4HAFA 4OLXH 1CLYL 1LO5B 3VXMB 3O3BB 4K94C 3MRLB 1TTFA 5FO8A 5LVEA 1RUMH 4LOUC 3E3QC 5CIPA 3C08L 2R1YB 5GISL 1CS6A 4K94H 2X4TB 2XACC 3T3PF 1JGUL 2X41A 2FL5B 2BSRA 4X9GA 2C1OA 2CGRH 4P9HC 5CGYC 5TPWH 4KK9D 1UCBL 1RHFA 1CGXA 4FQLH 4LSUH 5DFTA 2VXVL 3FHAA 4HUVA 4ERSH 7FABL 5HDBE 2X4UA 3MCG1 4P9HH 3NN8B 2EYRB 5EO9B 2DYPB 5FYJH 3DX9A 4K3EL 4CMMB 3TO4B 3SGJA 3QDMD 3QUZD 4KTEL 2MCPH 1ADQA 2HG5B 2QSVA 1A7RL 1HYRC 2P4AB 4NQDD 3DHMA 2YD9A 4P2YA 1ZKAA 3P0GB 4AH2A 4FQIL 4ZS6D 4WO4B 1B0GA 4I0PC 3GSNH 2GQHA 3MGOA 4M5ZL 5ISZA 3QCUH 5CZXD 2AW2A 2KBGA 5H8DA 1MCQA 5IT2H 2UY6A 5HGAA 4PG9B 4P57A 1IZKA 2FWOB 4R2GD 4R7NB 3QEQD 1AHWB 4TSCL 1HK6A 1CYGA 5C70A 1PAMA 2BY0A 4S1RH 3BQUA 1CXKA 2XKNB 5FECA 5MEND 3BE1H 5KS9A 1RVFL 4EI6B 3KXFD 1UJTA 4ZPVB 1KG0B 2EE6A 3IAQA 5I16B 2DQJH 4GW4B 4OZFB 3CSGA 3AS0A 4ZPTB 4LFHD 3SJVD 3GI8H 4G80B 3IU4H 1X7QB 3PABB 4NM8H 1DUYB 3LIZH 5IFHL 3OB0K 3BPNB 3IFLH 1EXUB 4HK0B 2V9QA 4V1DA 4L3EA 5E0QA 1O0VA 5D2LF 4FP8H 4PB0H 4R4BB 2KPNA 4QRTA 3ZE0E 3QIWC 5CZVH 2JB5H 4HFWB 4DGYL 1T1XB 5I1IH 1VACB 5C08A 5I1DB 5JHLL 4FQQA 3DVIA 4H1LB 3H3KA 4KMTL 5GHWH 4XP4L 1U36A 5DMJB 4L8BA 1ZWIA 4NM4L 3EAKA 2DWDB 1D6EB 3F7VB 2KDGA 2XWJB 5CJXC 3RGVB 5CBAA 1A7QH 4JPVL 3KXFB 4N9GB 4TTGA 1MJ8H 1J0IA 3VGFA 4X6BB 1K6QL 5BVPL 1BOYA 4LPXA 4EDWL 3ZKND 3TN0C 4KAQL 4QRSA 1N5AB 4U6XB 4WNQB 1FSKC 4X8JB 1FL6A 5CEZD 5HYSB 2Z31C 1AI1H 1JYWA 3O2DA 1D5IH 2Q86A 3GMPA 3L7EB 3O11B 4NKDA 3OV6A 4OZ4A 1QRKA 1IGYA 3IS1X 2JIXA 2DDQL 4CKVX 1G7JA 1DVFC 4WFED 1OAQH 5JW4R 2FSEA 1QQDA 2FEDC 1N8ZA 2Y23A 3L9RA 4NUGH 5I15L 4M6AA 4A2MA 3QIBD 3HNSH 2ESVD 4W70A 4IDJL 1GHFH 4OQTA 1Q9LB 4HIXH 5FUCC 4P2QE 3HMWL 3NTCH 4Y4FD 5DK0A 1LD9B 5DQDL 3EUUA 3OG6B 5CINL 1EA9C 1HILA 3MROB 3TZVB 5DJCB 3HE7C 1A1NB 4P23D 2EH8L 5FGCE 3PF2A 4S1SH 4XX1E 5CD3A 1T0MA 1XIWC 3EDEA 4O2CA 5IW1A 4QT5A 5IVZB 2AJYH 1KLGA 2E6QA 3LD8B 4IRSC 3EJJX 2HP4A 2OR9H 5HHME 1MQKH 3HUJA 5T1KD 3UCRA 4FMKA 1CFTA 1T7XA 4GRMB 3TYFA 4KRLB 4ENEC 5DVOA 3MACL 1YMHB 5D96C 2I24N 5DYOA 3HZKB 4C56E 2FH8A 2FHFA 2DQHL 4F33B 4YXKL 4JM2A 4PPTA 4YJZL 1UXWB 4I4WA 1E6OL 1GOFA 2QKIB 3DXAA 1MI5E 4KU1A 3MYJA 4ONFH 4KWUA 4QOKB 4UB0H 5E4EC 3UBXB 1FFOA 3VWJD 5JZ7D 1T1YA 4RISH 1A6VH 4FQCL 4HIEA 3VXRE 2X09A 3NCCB 5D5ME 4XMKH 4DUXA 4QXUL 4YWGL 3BGFC 5BS0A 2NXZD 4Y4HC 4Y2DC 3ILPB 3I9GH 5T1DL 3I6LE 1F02I 1A3LH 2DS4A 1R5VB 2R4SL 3P9LB 1R3JB 5EOCH 1I1AD 1S7RA 1HDMB 4AM0A 2UVFA 5C0AD 1DBJH 2I5YH 3DROA 5E6IC 4TTDD 4CJ1A 4FFYL 4QXTB 1BZ9A 2Q8AH 3TA3A 3S88H 5KJRH 3MNZB 1TCMA 1TXKA 5SX4H 2ZUUA 2O61A 2X5PA 3SCMC 4POUB 4PRIE 3V5DB 1YEFL 1OTTC 3WIHL 4RFEB 3QI9A 1KUMA 4LAQH 4K7PL 4PJ7F 4X6DE 4FQXD 5EBWA 3VGDA 3KYOB 1J5OH 3V4UH 1FFPA 3VWJB 1LEKB 3RP1A 5F1NB 3ARBD 4TQEL 4UQ3B 1IEAA 1V05A 4YC2C 2NXZB 5D2LB 4ALAL 3O6LL 2X4PA 3D69B 1K3ZA 2PYEE 4BJLA 1XZ0A 5C0AB 4U1MA 1VPOL 2VZTA 4H26A 2VQ1B 3WLWC 6FABH 3IKCB 5JTWA 1AFVL 1T0NA 1ES0A 1H9VA 5T33L 5E9DE 1KLFA 3BI9X 1FAIH 2YRLA 1NDMB 3U9PL 2B5IC 1OF2B 4GG6E 4NWUH 3LKQB 3EOBA 3MV7D 5IBTH 4K8RC 5L88H 1Z2KA 2NX5A 3BWUC 2V17L 4G7YH 4LVNC 3QWRD 3I2CL 4Y5YA 4K8RH 2NNAB 2WZPD 1NCBH 3L5WB 3GK8L 1QO3B 4D0BB 1A6AB 1TJIL 4BZ1L 2VO5A 1H3XA 1H8OA 1A6TB 4Z78A 1K4CB 2BP3A 1P84J 2A6DB 3UPRA 4IIQA 3BRFA 5EU6E 3V8OA 4L5FL 4JAMA 5C0BD 1VGEL 1D5XB 5DVNA 4XBGA 1CFVH 3BN9D 5AEAA 3IXAA 1LO0H 2X4SA 2R56L 2Q6WB 4ZNEA 2JCCF 3MUGB 1R3KA 5JW5B 1FRGH 5MEQA 5EBGA 3H9HA 1PSKH 5JXAL 3V5HB 2DQEL 1VERA 1AE6H 3MFFB 3VFPA 3ZE1E 4NQCE 3UDWA 1F00I 1NBZB 4G9FA 5D71H 1WK0A 4POZC 1ZGLM 4MLIA 2QSQA 3H6JA 3P9WB 1T7VA 4HUUA 1BGXL 3VFUA 4RGND 4Z95H 1S7VB 3O6FC 1CDJA 4JRXD 3T0EE 5T1LD 3RPIB 4UT9L 4KKLD 1T5WB 2BDNL 5DGQA 3RWJA 3CPLA 4L9LC 3T4YA 4I2XE 2IANA 3O8XD 3RZCB 4JREB 5JDSA 5I2IA 3L3GB 3RHWK 5IFJA 2RQ8A 3QA3A 1INEH 1AQKL 5HDBF 4JHBA 3PGDB 4TUOA 5EBMB 1CD1B 3FT3B 3OG4B 4W6XB 5TQ0H 1P7KA 1YY9D 3PHQA 2E7BA 35C8L 3U7AA 5FFLA 4QNPF 3NZ8B 3HG1D 4NT6B 2EH7H 3MJ7A 5M94B 4OGXH 4XWGH 1QBML 3OHXB 1RULH 2R9HD 3U46B 1KCVL 2NTFB 3QUKA 1W72B 5IB4B 3G9AB 1PEWA 5ITBL 4PRBB 2I60H 5JXEA 4AEFA 3L5XH 2EDOA 4U6VL 5HI4C 3MV8D 5FO7A 4EI5D 4PJ5B 2ZOKB 3W82A 1VA9A 3P0YL 1ZS8A 1F90H 4PGBB 2A38A 3NIGE 2ZSVB 4UNUA 1W0VB 2DQUH 5GRVK 3OAZK 1AIFB 1KCLA 4JKLA 4XTRC 2AK4B 5DJ8A 1SYVB 3DUHA 4HIHB 3PWPD 1HSBA 2YC1B 3UTSA 3HG1B 4OD3H 3ZE0F 4ODHH 5DZNA 3SE4C 1LQSR 4PJ7B 2V7NA 3VFMB 1K8IB 1ZEAL 3FCTA 4YHPB 3U83A 1L7IL 3LZFH 3ET9F 2MPAL 1MCOL 1XR8A 5KSAA 3GMRA 4JFED 3P30L 4OBRA 5I8EA 4J3OC 1U8OA 3F5WA 4DUVA 3MV8B 3HHRB 2FBJL 3LHPH 5T3ZD 4EI5B 4JR9H 3VG9C 5C86A 1FVCB 3T04D 4WWID 5CFHA 3ES6B 1WITA 5FYKL 3RNQB 4XT1C 2NMSA 3TVMA 4NBZB 2F53D 4F7PA 5FEBA 1A22B 1IGIH 3EIFA 2ADIB 3ZKMD 4GFTB 5DWUH 1N5YH 2NY4B 5LGHL 3P3YA 4OLUH 2WBJB 4YX2L 5CEZL 3E1F1 3DURA 1C12B 2BY3A 4KMQA 1H3WM 3DVGA 5DD1H 1MPAH 3RQ3A 2IBZY 2ICWJ 2MSPA 4X4YB 3OSKA 5EBLB 3DO7A 1NBVL 1ZHKA 4PRAA 2D7TH 5TFSH 2VLMD 3V0WL 3C9NB 1DQMH 4CUCA 1NGWA 4MCZB 5ITFB 9CGTA 5HY9A 1P4LB 3O9WD 3LOWA 1DSFL 4NNYB 3WDIA 3TJEH 4LSVH 3UJTL 4LRNL 1U91B 4LBEB 5FDWB 3S34L 3MRFB 3MV01 5A2LH 4YDKH 5I71C 5J6GB 4R7DB 2DMKA 1MAKA 4LGSB 2F53B 5BZDB 5IEHA 2RHEA 2VL4A 2P5ED 3O41A 1G7IB 4XVSH 1HNGA 1QBLL 1VEPA 3PP3H 2JCCB 3AAZA 3ETBF 3FAXA 5HGDA 4MQXC 3R0MA 3RL1A 4OLVH 5L0QC 5BO1L 4HHAB 4LKXA 4MB4A 2QQNL 2NR6C 3CU7A 4NWTH 1RZGA 3RIAF 1BMGA 3LV3A 1JNNH 4GKNB 4RMVA 3F65A 3T8XA 3H9YA 3QO1B 1OGTA 3ARXA 4DQOH 3DUSB 3FO0H 2AXGA 3O9WB 1HKFA 4F7CA 3WFCH 4X99A 2R4RL 3B2UD 5BVJB 3HFML 1F6AB 3KYKL 5FM4A 4Q2ZA 5HDQL 2ERJB 3WNMA 3QNZA 5HVHB 4ZSOE 4HS6A 2YA0A 4HCRL 3PWJB 4XXDA 5I76B 1CL7I 4ODVH 3TYGL 4NNPL 4XNZC 4LPYA 4PUBL 2BXYA 2P5EB 4NQDE 3BDYL 3GJEA 3VFVB 3CSYA 3OAUH 3D39E 1OB1B 4DEPB 1CL7L 4WI2A 5K93A 5D5MF 3VDAA 1UCTA 5EC2A 3X13B 4OCSL 2CMRH 4WTXA 3ALPA 3CK0H 2BRRH 4X4ME 4JO4L 3HNVH 5GRJH 1D6VH 5GRXG 3QEQE 1C5DB 3F58H 4DJMA 4FTVA 4P5TA 1OWRM 3RTQD 4M1DH 5MENE 4JQIL 1QSFA 3SE9H 5I30L 1I8IB 3JWDL 4G8GE 5EUOA 3FOMA 1NFDF 2V9TA 5KG9A 3IRZA 1XH3A 1E27B 2CDGB 2I27N 3BSZL 1OM3H 3I02A 3TIEB 4ELMF 1ULVA 1W0WB 2VDNH 3HAEA 3SQOL 5D1QA 3MLRH 4X6DF 2COQA 4L4VA 2FRGP 4M1CC 4UDTA 2R23B 4GSDL 3B9DA 5DRWB 1LO3L 4XZUB 3CCHA 3FQUB 3I84A 4PRPB 1NSNL 1HKLH 4ZXBB 2FLRT 4WFGE 1Q9WB 4BSWB 4O2FB 1DCLA 3QISA 4PP1C 3SDAC 4OM1L 1R5IB 1EHXA 3IJSB 2NY5C 4HW6A 1M7XA 4YHIB 3SGEI 3GIVB 3KLAA 3G5ZB 3SDCB 3STLA 3K7UA 4OCYH 1B2WH 2ARWA 3QJHB 4IRJB 2CPCA 4NUJA 4LPVA 4XX1G 1CXIA 2QBWA 3S5LA 5LAXA 3U7YL 1CDGA 4LCCA 2VLRD 3GMQA 1P2CB 5C07D 3BEVB 4HC1A 4DCQA 5FYKE 2ADGA 1CLZH 1QP1A 3I3DA 3P4OB 4XP1L 4MQ7A 1MFBH 1X5YA 1DR9A 3FOLA 4H8WC 4HMEA 1IM3B 3W0WE 3REVB 1EX0A 5DJZB 5FHBL 5IMLA 3TT1L 5CEZE 4HBCL 4H8WH 4N8CL 2UV3A 4URTB 4OV6F 5ILTH 1GGBL 4MAUL 1CGSL 5LBSL 1M7IA 1JNLH 5IVXE 1J10A 4GMTH 1OQOA 3EYVB 4KDWA 4JY6A 1INQB 2CIKA 2XQBH 4WFEE 2DQTH 4QHNA 1TQCB 5JW4N 4YO0A 2OSLB 5E03A 1TJGL 4WU5B 1AKJA 2KZWA 1IGFL 2VTFA 1RUAL 2XG5A 5DSCA 2ITCA 4R90H 1SQ2N 1FVDA 1GXEA 1U93B 4K2UH 2ESVE 1MOEA 2FDBP 5CZKA 1A6ZB 4F7MA 4ETQA 5GS1C 3VA6A 3VXSE 3WS3B 3X14B 1YNLH 1SJVA 1BFVH 3V0VA 2JJSC 1LE9A 5CBEA 2R2CA 5JHDA 1MEXH 4F2MA 3LSOA 2GFBB 5GJTL 4PGCB 3E8UL 4WWKA 1NBYA 4ODXA 4RMUA 5GGVH 5IW3A 1DFBL 2JLLA 4LHUA 1D5MA 4GT7A 4TSAH 5F96H 4P4KD 4YUEL 4PRDA 1T1ZB 1CZ8H 2NYYD 2QQKH 3H2WA 3MBEC 4HFUL 4PFEA 4LLDA 1MNUL 3C6LD 3B6SB 4WI7A 4Q9CA 4GBXC 1OT1A 4CU8A 4WHDA 3VFTB 2WBWB 1VFMA 2NY3C 2ZJSH 3L7FB 1T0PB 1W8NA 3PGCB 5KTEL 4ZFGL 4FXLA 1QFWI 2YBRB 3CVHB 4TVPD 4U33A 3OKOB 1G0YR 4HJGA 4JKKA 1NBQA 1MI5B 4MNGA 1JL8A 1KNOB 5D70H 3GKZA 1QFWL 4U1KA 3WIIH 1KCRL 4C4KT 3ULUD 3ZKXB 4UV4L 4HG4J 5D7LA 4Y4KB 4Z7QF 5E8EB 1MJJA 4Y19B 2BFVH 3AMLA 5K9OB 2ZKHH 4M7LT 3QIUD 5F70A 2VZOA 3EDJA 5EORL 1INDH 4FG6C 3BZ4B 2Z0BA 4NZRH 4YHNB 5HGGS 4Z0BL 3EYOB 3D5OF 5T5NF 3UJIL 3ELAT 1A7BA 2D0HA 3NIGF 4U7MA 3EOAB 3HCVB 1NAMH 1NFDB 5FUZL 3O4LA 3W2DL 3ZKQD 1KENL 4Y8AA 4Z0XA 2B0SL 3BOVA 4Q74A 1SMOA 2CLRA 1IARB 4YGVA 4ELMB 1UZ8A 1GGCH 1AXIB 3V6FA 2O93L 1P9MA 4GUPB 3W39B 2IQAB 2BOCA 1M6OB 1RUKL 5F6IB 1C1EL 4P2OB 3INUL 1CFNB 4OKVA 5KSVB 5C6PB 1H0DA 3QQ3B 4CVUA 3S6CA 2V2WB 3K2UH 3TNNB 3L3JA 1ZVSA 1DE4A 5F6HI 1HXMB 3QAZC 4PJCA 4UU9A 5HYEA 3LRSB 3MV7E 1T4KA 1MIMH 3PV6A 5H35B 3HC4L 1FN4A 2AJ3B 5D7SH 5TE6L 4F37F 2APBA 2P24B 1ZAGA 4RGMC 3MRKA 2GJ6D 3GJFA 4RMTA 2D0GA 4HS8L 2VN7A 3VFNA 3QHZL 5HHQA 2C1PB 3BP7B 3IF1B 3OAYH 5DURD 4PTTB 4DKFL 3CC5B 5EPMB 2GITB 3JVGC 3NCJL 5EU4B 1OCWH 3FN3A 1U3HC 1YNKH 3WFDL 2EZ0D 1U8NB 4NO5B 3H3BC 3AY4A 2PXYA 5C0BE 3SKJL 4XVTH 5GRVL 5C7XL 1XGUA 5KZCB 4LSPH 2ILLA 2LE9A 2P5WD 2R1XA 3MV9D 3HMXH 1U3JA 1P7QB 1YN6B 2GSGA 2W65B 2LU3A 4FA8A 2X4RB 2H9GB 4PJEF 4XPBH 4QRRE 2NY6C 4X7TB 4EBQL 4C4KO 2P8PA 4WDIB 4G5ZL 2FJHB 3OJ2C 3AVEA 1G1YA 4LCWA 1I7ZB 4XP9H 3AB0C 1N26A 5B22A 2GSIB 3P77B 5IMKB 4RGNE 4YBLC 4JRXE 3B43A 3U0WH 3QZWB 4D9RD 1IM9D 2G9HA 4LLYB 3L3KB 3LEVL 1E4XI 2XWBB 5EZJB 5IQ7H 5ADOL 4DAGL 1PBYA 1T21B 1WTLA 1RZIA 1J8HD 5C0CD 4JFXB 3HC0B 3OKDA 1EHNA 2ZCLL 1FV1A 1E4XL 3HI1B 3T0EB 4RIRA 3BZEB 4IHOB 5JO5B 1KPRB 1FAKT 2AAVA 3SPVB 3NH7H 4OCWH 3MV9B 3KJ4C 2AGJH 4FZ8L 4UZGA 5CMAA 3T4AA 5F3HA 5T3XD 3EOTH 4J1UA 4EOWH 1OP9A 1PYWA 4JHAH 4G3YH 1P53A 3GMNB 4OD2B 1CE1L 1YN7B 1LEGA 4FS0A 1MHCB 4EDXA 2X4QA 3HI6H 3OWEA 5LQBL 1KEMH 1FL5B 5GJSL 4JFFD 3CLEL 1CICA 1E4KA 4JPKH 2R29H 3QYCA 5DRZB 1JGVL 1EEYA 3MNWA 1J8HB 5E99H 5C92A 4M62L 4V2BA 1GGIL 2VQUA 4N0CD 5FKPB 2G75B 5JNYA 1YY8A 3C5ZA 1QFWM 3OKEB 5AG9A 1V3KA 2HJKB 5BJTB 2YN5A 4YDIL 3BKMH 3QCTH 3FB5A 3MJ9A 2HT2D 4JO2L 1FNEB 3SO3C 3VGAC 2R2HB 4ODWB 3L3OA 2Y07L 2C3VB 2UZIL 2BNRB 3VGBA 2Z92A 5K9QG 3EJYD 3I6GA 1MCHA 4PRHE 4KRMB 3TCLA 3FT4A 1JWUA 1AO7A 1MF2H 1G6RH 1ZTXH 4IJ3B 4ODSH 4RX4D 3FB6B 3LKSB 5IROC 2YPKB 2AV1B 3E2HB 3M17B 5F8RC 4JPWH 4AIXA 3V95A 3BEWB 5LWYH 3QUYC 4HUXA 3HN3A 3GMLB 3ZTJG 5LCVH 2EXWC 4JFEE 1JPTL 5TGBA 1O7SA 3FRPG 4U6YA 1CIUA 3UTQB 2Q7NA 4OCRH 1PDKA 4X4XB 5EZOL 1KB5B 1QSEA 4XPAL 5K9KB 1EV2E 5DEGB 4G7VH 1WFNA 4LLMA 1MVUA 5F89B 4U2ZA 2VB5A 5IB3B 4LKCA 5JOPE 5C2BH 5A2FA 1HHHA 1MWAL 4M7LH 1R3IH 1S5IL 4LLVA 4BA8A 2PCPB 2ID5A 4M8VA 5L2KD 1F4HA 1F4XL 5ADPH 4HK3J 4O00A 1SM3H 4XCEB 5INDA 5MEOA 4R4FH 1GAFH 4KY1H 5FGBC 2EYSB 4HX1A 3TT3H 2V2TB 5DO2C 1YQVH 4YEEA 1C5CL 2NY1C 4F8TA 2F54A 4GRLC 2NLJB 3RWGB 1RK0B 2VLME 4PJIA 2OZ4A 1AD9B 1J1XL 5B4MD 2Y7QA 1NEZA 4YXHH 2XY2A 2FEEI 5I9QC 4XVUD 2JTDA 1IL1A 5IVXF 4BQCA 1BP3B 2ZUSA 3MRQB 4IS6B 4F7TB 1I7TA 4LVHC 2DD8L 4AENB 2FEEL 1F8TL 2Y36L 3BPLB 1P69B 4NRYA 3O6KH 1T1WA 1NC2A 4Y89A 3RGHA 3NPZB 5EA0H 4LSRL 4TN9A 3TP4A 1N3NB 4XPFH 4U1NA 2HLFD 1QACA 3IDMB 4G8IB 3RY6A 3CVIL 1FNGB 5CWSA 2WP3O 4DTGH 3R4DA 1S5HA 5F7KC 4PJEB 3K8MA 4MAYA 2VLJD 4F57H 1JWMA 4DZBB 1J88A 1NC4B 4F58H 5HXMA 2A74B 3QUXC 3RWEB 4WHYG 1U6AL 3TH3T 3O81A 5SWQA 1J1OH 3ARFA 1LK3H 4NQXB 3TWCL 4YK4C 1PLGH 2X4NA 5I6XB 1B0RB 3X3FL 3AROA 1GRWA 1JFQH 1MFDH 3TC9A 3QO0B 3HE7A 4J23A 5DGRA 1M71A 1IC5L 5CGYD 4GRWE 4MS8C 5DK3A 5GSVB 4R4ND 3NA9H 4RZCB 3Q1SH 1FZOB 4TVPL 3PL6C 1KFAH 3V52H 1HQRB 5CILL 1EJOL 3EW3B 1XGTA 2IQ9L 3ULUL 2EC9U 3Q6GH 2NXYB 4ZDHB 3M1BB 4I18B 1OARH 5HDLA 4PJ9D 4JFDD 2FJGB 3MUZ1 3OJDA 1SJEA 3GSWA 1KIRA 5IWLC 3KPPA 3G08B 3PWVA 1XR9B 1WBZB 2UWEA 4I3SL 5ICXB 3ARGA 2VC2H 1HXYB 1UA6H 5HHPA 4GAYA 4Y2DA 5DC0A 1D9KA 5J13C 3HLAB 2YPLD 2IJ0C 4YDLC 4P5MA 3B5TA 5GRYA 1R3HA 5E00B 1UM6L 3REWB 4AEIL 1MCRA 3GHEL 4NNXA 5LXGL 1XF4A 3WSQL 2GIYA 2IAMC 2YKLL 4N8VB 1KPUB 3ARDC 5FOJA 2DQIL 1JPGA 4Y88A 3V5KB 4I9WE 3W9EB 5E1HB 1ZANH 1CK0H 1BQHG 1SHMA 4XNQB 5F1IB 12E8L 2E27H 4PJ9B 3GHBL 5ALCH 3P4MA 1MLCA 1PD6A 5FK9A 1I1RA 2CUMA 4Y5XC 3AGVA 2FIKB 1A7OL 3RDTA 1N2RA 4P0DA 1S7SA 1ZK9A 3OMZA 2VLRE 4FFZH 1HHKB 1XGRB 2CDEB 4OD1L 5E8DH 5C07E 3IFPA 1C08B 5D1XC 2YPLB 1RZFL 5IQ9B 4PYGA 4U1LA 1ZXQA 5GGRB 4XMLL 1I9RH 4LEXH 4PV9B 4X0KA 3JV6B 4JN2B 4CW1A 4P5KB 1WSST 3BZDA 2GCYA 4NCC2 3TJHD 4PS4L 5CEXB 2VZSA 3CH1A 1FPTH 3S37L 3TN0D 3OPZL 3MLWL 1Q9KB 4YDVB 3LH2L 1J0KA 4KZDL 3VXUB 3W0WB 1UB5A 4FFWC 3P0VH 3G5YB 3G9VA 3DBXA 5E8OB 4WUKL 4FHBD 3IXTB 4ZYKA 2Z31D 3CXDH 2A77H 2DQGL 2IH1B 1RIVH 2FYYB 2OTWB 1UCBH 4OUOA 4UOW0 2VXVH 1FO0B 4G9DB 7FABH 4RGOL 3RWDB 5CEYA 4JANB 3GSVA 4K3EH 3TBVA 2O5YH 5ESQB 3QDJD 1RHHB 1NMBL 5B39G 4WI6A 4LPUA 3ZYZA 4M6OH 1RD6A 4KTEH 2FEDD 4ORGA 1GGTA 2BHYA 1Y18A 4HZLA 1HINL 3SDDA 4H25A 4Z7VE 4KZEL 1KELL 1V8HA 5ISZD 1X5KA 2O26U 2FX8L 1RJYA 2VABA 5CIPB 3HUJF 1BQHB 5J11B 1GPOL 4OLWL 5AUMA 4NBXB 5BQ7A 4TSCH 1UEYA 2C1OB 3MLZL 4JM2F 3LEYL 2EXYC 4OTXH 3WN5C 5L8JB 3L6FA 4UBDD 4NKOA 4S1QL 2NY0D 2X4UB 1AJ7H 1OAKL 2RFXA 5I1EL 1K2DB 3DX9B 5IJKC 1P5UA 3RUGE 1CFQA 3E6HA 4UINL 5SWZA 1Y6MR 4LVOC 2UZYB 4LCUA 3RVXC 4DWHA 4ENED 3JWNC 1DQTA 1CGWA 4OLYL 3VWKC 3S3SA 4HIJA 4NDMA 4NN5B 3MGTB 3MOAL 4AH2B 4PREA 5KOMC 1B0GB 3F7QA 1YA5A 3MLXL 3MGOB 5A3ID 4DGYH 1WC7B 3ULUE 5JHLH 4K23L 1I3RA 4KMTH 5HGAB 4P57B 5D7JC 5ICZA 5AZEL 5JDJA 4XP4H 1TTGA 5EOQH 3FO9A 1OTUC 3IB4A 4Y4HD 5HI5D 4TNVK 3BQUB 5FECB 5KS9B 4LQFL 1A6UL 2GEEA 5I1CL 4PJDA 3CMOH 3NPSC 4Y16C 3UJJH 1XAUA 1K6QH 1R3LA 4K9EC 2XZAL 1OP5H 3T0XA 4EDWH 4NYLB 4ODUA 4V1DB 3SCMD 4L3EB 4AEHL 4HH9A 4K9EH 3QNYA 4OCMC 1FNSL 1OTTD 3EFFA 2ED8A 5F7MC 4QYOA 3S36L 1Q9OA 1U8IA 4XNMA 1KTDA 4QEGA 5C08B 1JYNA 5ACZA 2D7OA 4ZUWA 2PR4L 5C6TH 1OGAD 2JF1A 3RHWF 1JVKA 2CUHA 3DUUB 2OL3A 4Y1AA 4L8BB 1ZWIB 1DEEA 5J3HC 3FAWA 5CBAB 2KL6A 5KSBE 3MRBA 2VN4A 3FMGH 2DAVA 2CK0L 2KZ1B 1ODAA 3KPRD 2BSTA 3W5NA 1T66C 2F9BT 1MSPA 1LO2L 5E6ZA 4OZHE 5I15H 3IU3A 1U58A 4YHZL 5GGVY 4IDJH 4X80L 5IBUB 2GJ6E 3DMMA 2P7TA 3KGRA 3HMWH 4K8RD 1FL6B 5DQDH 1RURL 5CINH 3UP1A 4NFDA 1FL3B 3MRLA 1KN2L 2EH8H 2R0WL 2Y6SC 2AKRA 1WIPA 3GMPB 2Q86B 3RY5A 2LU4A 2WAHA 4K7PX 4OZ4B 2D0FA 1RFDL 1MCWW 1IGYB 2CR3A 4BH8B 2P5WE 4WJ5A 5GGTL 5D7KE 2JIXB 1G7JB 1H3VA 3MACH 3VG0H 3NN8A 2FSEB 3H42L 3MTRA 4WUUE 4CMMA 1QQDB 2VISA 1UH2A 4JG1L 2DQHH 1N8ZB 4KHTL 4YXKH 3L9RB 5T5FH 1OAUL 1A8JH 2J8UA 2ZCHL 5F9WC 5IV2B 1WBYA 1TIUA 2IALA 2AEPL 1ND0A 3GGWA 3WUWA 4FQCH 5DK0B 4WO4A 1HILB 2OMBA 5FM8A 4QXUH 3D3VD 4YWGH 3SY0A 5C0CE 5JA8B 5CD3B 2R4SH 4OCNC 1T0MB 3ULSB 4UMGA 4O2CB 3THMH 3O6FD 4QT5B 1AC6A 3TF7C 4FFYH 3HUJB 1CFTB 4LSUL 4EI6A 4PG2C 3TYFB 4PLJD 1FFNA 5DYOB 1JNJA 4JN1L 3HE6C 4P9HL 2BK8A 2JK5A 3H9SA 5FYJL 2CO6B 4N9OB 3WIHH 1UKTA 2PO6A 4JM2B 1X7QA 2CR6A 4GRWF 3WS6C 5DTFA 3DXAB 3MYJB 4JFPA 1CWVA 2BERA 1FFOB 3GMMA 4RMSA 1T1YB 5F97E 1A14L 1X5IA 2HT4D 4JFFE 5D7LE 2Q20A 1REIA 3GSNL 1LK2A 4TQEH 2E6PA 2FD6H 5C0IA 1T1XA 3MLUL 5BS0B 4UTAL 4L1DA 2MCG1 4JHWL 1ORQA 3O6LH 5I18L 5I1KH 2DMCA 5IJVA 2HJLB 3K8LA 2A0LC 2H6PB 3ULVE 4JO1L 1S7RB 4AM0B 4O9HH 5E8NA 1TQBB 2AEIT 3QWOA 1T80A 1KYOJ 1EERB 4S1RL 2DKUA 2XWJA 3DROB 3SEPA 1C8PA 1BZ9B 4KVCH 1AFVH 3TA3B 2IWGA 1EAPA 1A5FL 1FLRH 5JMRA 2O61B 3CD4A 3UYPA 4DGIH 5C9JA 1B4RA 4Z9KB 3QG7L 5HI4D 5FKAB 3IU4L 5EUKB 3QI9B 1JE6A 1BHGA 5MI0B 3DVNB 1UM5L 5EBWB 4Z7WA 1V7ML 1KCKA 1FFPB 2V17H 2J6EA 1JZ2A 4Z8FL 4OB5L 4MNHA 2LU7A 5CZVL 4NOBA 1HNFA 1IEAB 2P1YA 1C5BH 4PRHB 4JVPA 1TJIH 1A9BA 4FQ2L 4BZ1H 2DIAA 2X4PB 3U0TA 3PP3K 2I9TB 1KCUL 3L7EA 4TULH 1XZ0B 3ZHLA 2D7NA 4U1MB 3VDCA 4F15B 4H26B 1DBKL 4RWYL 1SEQL 2FGWL 4L5FH 5ALBL 5C1MB 3LQAL 1FO0L 1T0NB 1ZLUH 3V6OC 1ES0B 4P2CG 5EG6C 4Q6IA 3MYZA 3MA7A 1YPZE 1MJ8L 2R56H 3ZHDA 1Q0YL 3IAPA 3U48A 4N0UA 2L0DA 2I9LA 3EOBB 5L2KE 5JXAH 2DQEH 2IPUK 2NX5B 4O4YL 1I9EA 3ARTA 4G9FD 4Y5YB 1Q9LA 1YMMD 5B38G 4X5LA 3U30C 2EE2A 4HKBA 3TZVA 4JRYA 3X11A 4H20L 4MD4A 4UT9H 3AM8C 4Z78B 4KK9C 1ZT1A 2ADFH 4XI5C 1CG9A 3UPRB 1UWEL 4IIQB 5HYJA 4JAMB 3JTTB 5JR1H 3CFDA 4NP4H 4JVWA 3QUZC 4L4TA 4XBGB 4LLAA 3BPNC 4GW5A 3N1QC 2X4SB 3C2AH 1AQKH 1HE7A 2VAAB 1R3KB 3WJLA 4KRPB 5MEQB 3QH3A 3H9HB 4N0FA 4NUGL 4ZS6C 4HWUA 1MHHB 2QKIA 2R69L 4RBPH 3VFPB 3RKPA 4IOFC 5EFIA 4G9FB 5CZXC 4HIXL 1JYVA 3ZSSA 1F42A 3CZJA 5CP7A 2VLJE 2YUVA 4HUUB 1QSVA 3VFUB 4LP4A 4Z7VF 1QBMH 1VHPA 5IOPB 4BYHA 4MJ2A 1QNZH 3RGVC 1R3JA 1NGYA 4QHKI 3RWJB 4NFCA 2R8SL 2HWZL 2DL9A 1BVZA 5ITBH 2X2YA 5E2WL 2VH5H 1WF5A 3E3QE 3T4YB 5JXED 3RKDC 2IANB 5JDSB 4HKZA 1AY1H 1MQKL 4U6VH 4A6YL 3JV4A 3WFEL 4MA1B 1JK8A 3UROR 3QA3B 3P0YH 5BV7L 4GJTB 2ZUTA 1I1CA 4TUOB 3QFJA 5E08L 5FYJE 3RUGF 1T22A 3F8UB 5EZIL 2B7DT 1P7KB 4ONFL 4O02H 1AGEA 3PHQB 1LNUA 1AR2A 1BD2A 3GFUA 4BKLB 2W0KA 3UTSD 4E42B 4QCIA 2BVQA 2I07A 4UQ3A 1S7UB 4NRZB 2L4OA 2BXZA 1ZEAH 1EGJH 4HUWA 3ULUF 3QUKB 5HHOE 1VESA 2MPAH 3WJJC 5D1ZA 1MCOH 4XCFL 1ROWA 3OBAA 2Z8SA 1DBJL 1MRFL 5EZLA 2I5YL 3IKCA 1NLDL 2YPVH 2Q8AL 4E5XA 3BDBA 3S88L 1CI5A 3ZKNC 1ZS8B 2XKSA 3LKNB 1OF2A 4XCYA 3VI4E 4LPWA 3P73A 2VR4A 5DJ8B 1WICA 2C3HA 1J5OL 3D6GA 1HSBB 1U0QA 3QR2A 4CU7A 2WSKA 3UTSB 5IBLD 5LGHH 3TIDA 5DVMA 1CD9B 1A3RL 2V7NB 1A6AA 1NAMA 3FB7A 3FCTB 1CDUA 1Y0LB 3LD8C 5EU3A 1NBVH 5C0JA 1XR8B 2ZUQB 5KSAB 3GMRB 4PBWD 3C6SA 3K4ZA 1GYAA 1U8OB 3W11C 4PP1D 3ZE2F 3F5WB 6FABL 2CK2A 4F8QA 5DUBA 5KSBF 2DIJA 3DJ9A 2ZUYA 4LRNH 3QIBC 3S34H 1FAIL 2Q6WA 3RI5K 3TVMB 1U8KA 2O5ZL 5DJYB 4F7PB 3MMEB 4OZHF 4G7YL 5GS2D 2DB8A 4K8RL 1RZ7L 1U8MB 3DURB 1QFOA 3SBWC 3KPSA 1X5JA 2W9EH 3DVGB 1S7VA 1R24A 5BO1H 1LP9E 5FF6A 2HA1A 3DO7B 2QQNH 4PRAB 1RJZA 4XP6L 1NGWB 1JHLL 5HY9B 1FNLA 3GI9L 3ROLA 3RZCA 1XMWA 5KN5B 1I85C 4OIIL 3L3GA 1CTNA 3HFMH 3KYKH 5J57B 5HDQH 2X70A 3VWJC 5JZ7C 3PGDA 5I73B 5MHSD 1KIQA 3QDJE 3RZWA 2YXFA 4Z7UE 5HI3C 4KKAD 5TJWK 5IEHB 2SEBA 4NNPH 4PUBH 3LS5L 1NDGB 2NXZC 3BDYH 4ZFZA 3OB8A 1LDPL 3BJLA 3IDGA 3AAZB 2QADD 4NN7B 1CL7H 3DWTA 1UXSB 5HGDB 3RL1B 1XF3A 3OKMA 3MBXL 4LKXB 4AZ8A 5FUCE 4OCSH 1RZGB 4PV8A 1BQSA 2YEZA 2NTFA 3LV3B 4JO4H 3MRDA 2R0LH 3T8XB 4P5TD 5B8CA 4MNQE 4F7CB 2LVEA 4IMKC 1TTUA 3CJJA 4X99B 4JZJA 3BT2H 4Q2ZB 1BF8A 2ZOKA 4FXKB 4JGJA 1F13A 2W1NA 3SO5A 1KEGH 5CLWA 4U0RB 2VIRA 1JGLL 4HS6B 3UEZA 5L9DH 4EKXA 5J56B 4XXDB 5EWIL 4LCIH 1W0VA 5CJOH 4PY8J 1FNHA 3FQXA 3A6BL 1AIFA 3ARBC 1KF9B 4GBXD 3BN3B 3KJ6L 1SYVA 3GJEB 1OAZH 2BNQA 5DDHA 2YC1A 1DL7L 4GSDH 4O51A 3CSYB 1LO3H 2VR9A 1HQ4A 3D87B 5IB2A 4U3CA 5INCA 4M8QA 1GC1L 4XWGL 3VFMA 3C60A 5EC2B 3A6OA 2EDLA 1BX2B 2VDKH 3EHBD 4M6ML 4OM1H 3UTTA 4NO0B 1RMFH 4FTVB 4GG8B 3ULVF 2MKWA 3OAYK 1FGNL 2I60L 4KPHL 1J12A 5BRZA 1QSFB 43C9A 3ME0A 5EUOB 4CMHB 5KG9B 3U79A 1XH3B 1FVCA 1KJ2L 2ORBL 4MDIA 4OIBA 2RB8A 3I02B 3FN0L 4FG6D 4HDIA 4XP1H 3KS0J 3HAEB 5D1QB 4YXLL 1WFUA 4L4VB 2FECI 5GZOD 1HHIA 4K07A 1PJ9A 5CD5D 2E8YA 1KTRL 3CCHB 3FQWA 4G6FD 4OD3L 2WBJA 1EH9A 1JHKL 4HBCH 4ETYA 5A16A 4N8CH 4N90E 1WZLA 2FECL 3H0TA 4AIZA 1GGBH 2AJXL 1OGAE 2D7QA 1G6RA 1CGSH 3B4NA 3LZFL 4MJIA 5LBSH 2PF6A 3JBG7 4LHUG 3KLAB 3RJQB 3STLB 5ITFA 1YC8A 3K4AA 1Y6KR 1IGJA 4NNYA 4ONOA 3S5LB 1QOKA 4JR9L 4LCCB 4KDTC 2RGSA 3GMQB 1A6WL 3KPRE 3STZA 1FJ1B 3LRHA 1YPZF 2GYSA 1AKJD 3PWUA 4R7DA 1IGFH 1TZIA 1OAXL 1RUAH 1OL0A 4DCQB 5BCAA 4XPHL 3HR6A 2BHUA 4MQ7B 4C57C 3QQ9D 5DWUL 3FOLB 1N5YL 3F62A 1I8MA 4OLUL 1RK1A 4P46D 3EO1B 5HDOA 4MJ4A 4F9LA 1KPVA 5JHDD 4M6NL 5GJTH 1W72H 5TFSL 3E8UH 3T0AA 4F9PA 3UPCA 1M7IB 5C0DA 1DFBH 4OF6A 4BK4A 1D5ZA 3MPCA 4YUEH 4APQB 5DC4B 3RWHA 2DF3A 4HFUH 1FG2A 2CIKB 1XFPA 5J1AA 4LSVL 4QHNB 1MNUH 3MA9L 4YO0B 2VNCA 1U3HD 4M48L 1AKJB 1NCAL 5DSCB 2ITCB 5KOVC 1FVDB 5I76A 3MXWL 4NSKA 3LMJL 3DRTA 1KOAA 3ZSTA 1UWXH 4XVSL 4ETQB 1MELA 4ZFGH 3V0VB 2NY6D 3D3VE 4OLVL 5JHDB 1NCNA 4F2MB 1YEHL 5ACMA 3CFEA 4WWKB 1MIEH 2XFXB 1QFWH 1J1PL 4ODXB 1KCRH 2C26A 4LHUB 1D5MB 4EI5C 1DBBL 1RIHL 2F8VA 4UV4H 4DQOL 1HWGB 3FO0L 4PRDB 1AC0A 3IDNA 3QP3A 5AG8A 4LLDB 3DVFA 1XF2A 4W6YB 1I8IA 5EORH 5A2KH 2XT1B 2QQQA 5TH2A 3UJIH 3TIEA 2Z91B 2G5RA 4NIKB 4ODVL 4U1IA 3L5IA 3O4LD 3MLTB 3W2DH 1KENH 2B0SH 2R23A 1I3GL 3G6DH 3P4LA 1QTYT 4XZUA 4Z5RA 2E5EA 1T2JA 5EU5A 3G6AA 1IC7H 4GW1B 4HJGB 8FABA 2DLTA 4BSWA 2CMRL 4LEOA 1T03H 4PJGE 4UILH 2PN5A 4GLRI 4D0DA 1XCQA 3AC0A 3G5ZA 3INUH 5D7LB 4F80A 5I8KL 1MJJB 3GMOB 4M1DL