2ZCLH

Crystal structure of human prostate specific antigen complexed with an activating antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
QVQLQQSGDDLVKPGASVKLSCKASGYTFTTYYINWMRQRPGQGLEWIGRIAPASGTTYSSEMFKDKATLTVDTSSNTAYIQLSSLSSEDSAVYFCARADYGFNSGEAMDYWGQGTSVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDCGCKPCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
molecule keywords Prostate-specific antigen
total genus 39
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2007-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zclH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zclH02
3TESA 2FATL 3CFEB 1XIWD 4JLRA 4URTB 4U1JB 4I18B 1MFBH 3BVNA 1MCRA 3BHBB 1OAUL 5HVWA 1SMAA 4HMEA 3BP4B 3PABB 3HC3L 4WUUA 3BZFA 4JO2L 2BOCA 3FN0L 4ZSOB 3VGEA 1KBGH 3X11B 1M05A 2Y36L 3HZMB 3BPCA 3DUUA 4GAGL 5E6IA 2HWZL 4PJAE 5ACZA 4KMTH 2Y5EA 5IMOA 4X7SH 3J8F7 2A77L 4UILH 4GXUM 1T80A 3EFDH 5EUOF 4E5XB 5F6IC 1A3RH 1ADQL 3EYUL 5HGHB 2FZ3A 5DFVD 1EJ6A 4OZIB 3WL9B 5ENWA 5KSUA 2C1OB 1C16B 1RUPL 2E7HA 5FOBA 3WUZA 3QI9B 2VITB 3G5YB 2HT3D 3TVMD 4JHWL 3AB0C 4F57H 3HRZB 3MLRL 5C86A 1WZLA 5EZOH 3ZO0A 1HH6B 5IFJB 5D6DA 5AWNL 2ITCA 1J1OH 4F58H 2EIBA 2A9MH 4U33A 3QRGL 3L5XL 4PJBF 3QA3B 1ZK9A 2OSLA 4LLDA 2B39A 5D1ZB 5T5FL 3CLEL 3VRIB 4U7MA 3TBWB 4NZTL 4RRPG 1FFPB 5DZLA 4APQD 3U9UB 1EMTH 3OBAA 4JZJB 4ONFL 4FQHA 5KSAA 1N8ZB 4AL8H 1A7OL 1DP0A 2XZZA 1R5IA 3WDJA 5F9OH 2VR4A 4KC3B 4EI6B 1B2WH 2ORBH 3QDJA 5CJXA 4Z8FL 3MRFB 5DJ8A 3KLAB 4M1GH 2P24B 4H0IA 2V2WA 4KI1A 4FFVD 4NQXA 4LPWA 2F53A 5IROC 2M8XA 4BFGA 1PX4A 2A6IA 3MCLH 2VOTA 3QUXC 5TE6H 4BQBA 1A47A 4RMUA 5GIRB 5KSAC 5D1QD 4FRWA 4KKAD 5JMOC 2P8PA 4MS8D 1CGSH 1ORQA 1RUML 5F71A 1XR9B 3VFWB 3GIVA 4UU9A 1HHJA 2GUOA 1JGEB 3M07A 3QCTH 3VFGL 1BJ8A 3SCMB 2P42B 4ONHA 4RGMB 3MRQB 1YPZF 2JJSA 1AO7A 1BBDL 2DQTH 4TNVK 1U8KB 3C87A 3OR6B 7FABH 4GJTB 3LKSB 4JZNA 3JTTB 4YR6A 2D3VA 4GW1B 4PY8I 1OQXA 2XNAB 4ZTPL 5L7XH 1IKFH 1UJ3A 5DMIL 5F89A 5EU3B 1AGDA 3GMNB 4XC1L 3RZCD 1A6WL 2GJ6B 3IKCB 3LRHA 4K7PH 1YEJL 3KYNB 1MHHA 3U4BH 1CXEA 1IQDA 4I3SH 3I75B 2Q8AH 3SKJH 3GGWA 5C09E 1EFXD 5I1EL 5F97E 4KGLA 5D2NB 2YD7A 1HHJB 4M1CC 3V0WL 5GGUA 4FXGB 1AGBB 4KJYB 2W60A 4HAFA 4Z7OE 1DBJL 2MWCA 4R7DA 4WW2A 3MV7A 3HPJA 1QFWM 3PHOB 3CU1A 5C0IA 2FLRT 4R0LC 5D7IA 3UTSD 3GMPA 5AAMA 5J0BA 2V2WB 1LNUA 1HE7A 1A8JH 3KYOA 1N2RB 4EI6A 4OQTA 2OXGA 3SE4C 4HAGA 3W82A 1JMZA 4MMXC 1GSMA 1ERNA 2FR4B 3CGTA 3TBSA 3QT2A 1MFAH 5DWUL 3CVHH 3PIQB 2A1WH 4DTGL 1HHHB 4E42A 3IFLL 2F74B 1FPTL 1T03L 4JFQA 3IXAB 5F7UA 3OKMA 1WITA 3L5HA 2XQYK 3B5HA 2DKSA 1KCVH 3RUGB 3ALXA 5CCKH 2C1PB 4MA3B 4TUJB 1NC2B 4K7PX 4Y16C 3SDCD 5JXAL 2PO6B 1U8IB 1AR1C 4L9LC 4WFED 1C12B 3CU7A 4FQXA 5GSVB 4WO4C 4WWKD 1FG2A 4MDIB 4WFGE 1KB5L 5IF0B 5DD6B 3HE6B 5EUOE 5E56A 5F7DB 3EYOB 4NP4H 4YFEA 1CR9H 6FABL 2DJSA 4RGOH 3DV6B 1CDIA 1WEJL 5HYEA 2VRAA 2RBLA 1RJLA 4TVPE 3KVQA 2AEQH 3O9WB 2NY4B 5INDA 2X1QA 1F6AA 4JGMA 3K4AA 1GGCH 4G6KL 5F1SA 1VGKA 4ENED 5FO8B 1BJ1J 4NJAL 1NKRA 3TZVD 3NGBC 4IRSB 5E8DH 4RMVA 4ETQA 1K4CB 1FN4B 3MCKB 5CKAA 3B3IB 4A6YB 5DGQA 1CICA 4KI5F 4LLUB 3HNVL 1CG9B 5GRUL 4OIAA 1T1YB 1MCWM 1JV5B 4QT5A 3C8HA 3T1WA 2H9GA 4PRHB 1ONQA 3MTRA 5EBWA 1AGCA 4N0FB 2LFGA 2YRLA 2JE8A 3D3VB 3C08L 2AJSH 3AS1A 5D72H 1WUNT 1GGIL 5I74C 3VDCA 3VRJA 4ELMA 2XG5A 5I76B 1A4KB 4YBQD 3OB0H 3QUZC 1NJ9B 3HUJF 3ZSTA 4JDZB 1T6WA 5SWSB 4NQDE 1FE8L 3DXAB 4ZPTA 1S78D 1QFWH 4X6DE 4PJEE 1I7UB 1ES0B 4Y19E 4PY7B 1MEXL 3GZKA 1AKJD 2FX7H 5BJTA 1EVTC 5DSCA 2BNRA 3WS6C 1KB9J 3V6OA 1OAYH 4M7LT 3X13A 4IDJL 4OZFB 1A6TA 2GSIB 1MIEH 3QQ3B 3QDME 1IILE 1NCDL 1RULH 2V5SA 2CIKA 5DEGA 2QADD 4HWEH 2XPGB 5GPRA 1L7IH 2X4OA 3OZ9L 4FQQA 4H20H 5HDOA 4OIIL 1FBIH 5J6GA 5BMFL 5H2BA 1QSEB 4IS6A 3PJSA 5E2TH 4X6FB 5D9SB 4GS7C 3NCJH 3BEWB 2XPGA 2P47B 2P45B 2ERJB 2LAAA 1S7UA 3MLYH 1CDJA 1A6TB 3U7WH 1DQJA 1HZHL 4FZEH 3EOYG 4L29B 5IB1A 5IM7A 2FJHB 3VD9A 1U8PB 1NCAL 3F7VB 3MUHL 3TO4B 1DBAL 1P9MC 5IESH 1QA9B 4PIRF 1KEGL 1MF2H 3C09B 4CDGC 3U7AA 4OFDA 5I8KH 4J4PD 1FIEA 1H8NA 4KRPD 4PPTA 1JZ4A 4MXVE 3SE4A 3UJTH 2CKBA 5E08L 1UQSA 1P4LB 1L9NA 3DOSA 3R4DA 4OV6F 4OCSL 3ARYA 4P5MB 2ESVD 3KPQB 3ILPA 2GY5A 4WFEE 4X6EA 2C7UA 3RY5A 1R3HA 1P9MA 1OPGL 5HYJD 4GRLA 1YNKH 2WBJA 3CH8A 3JWOC 4RFOL 2BJML 3ZE2E 2FL5B 2CDFA 5LJYH 4QOKD 5I8CB 2YMXH 1QSFB 5EBWB 2WLYA 4QRPD 1ORSA 4AG4H 3PWPD 4NO3B 1JNNL 2WM0A 4NO3A 3IDIB 1CG9A 1YMHA 3FO1A 4EN3B 5C08A 4R6UA 2NY7L 2NR6D 2EEBA 1N6VA 5BS0A 4PJGA 4PJCE 4IRSA 1VESA 4P46B 1X5HA 1IC5L 1JTTA 2WZPD 1AJ7L 1JI2A 1BLNA 4C58B 5CP3H 3T65A 3SOBL 2KPNA 4X9GA 3NZ8A 1TDQA 1I8KA 2HH0H 3FHQA 4I2XB 4JREB 4JY5H 5KSBF 3CFJB 4YHKH 4LBEB 5C0CE 4YLQT 3W2DL 1KACB 2XN9E 1L9MA 5DTFA 4Q6IA 2Q3AA 1OB1B 4RFOH 4J7RA 5IEHB 3T0EA 5IF0A 4LNVA 1JPSH 5IM7B 4YXLH 3T0EE 1C12A 1BREA 1EIBA 3TBTA 4GKNB 1LO5B 4HT1H 1WFTA 1AQKL 3PWUB 2P49B 1T2JA 3HNTH 5CGMA 4QRRD 1ZA6A 5I8KL 3MUY1 4TTGA 3PJSB 1BM3H 3TJEH 2R15A 5HPOA 5EU7C 2A38A 4HKBA 1KXTB 4HCRH 3VJ6A 2FO4B 5BZDA 2EDOA 4HC1L 3HPLB 3MLYL 2GIYA 5ID1B 4PLOB 5HYJE 1HINL 1BGXH 4PJ9B 4YJZL 3WD5L 1MY5A 4ZFGH 5CJ8A 4AEHH 3B6SB 1EA9C 4WV1C 3UPCA 3H9SD 4NN6B 3OR7B 3T3PF 4G9FE 3JWNC 12E8L 2WQ8A 4S1RH 1ZHNB 3MV7E 1H15B 4HEPG 1HHIA 5IR1B 3FO2A 3C5ZD 4MQXD 3S36L 4KZDH 2XY1A 3V8CA 2YD4A 5L8LB 2NY2D 2UZIH 4ZUUB 2PNDA 4ZPTB 4MNHB 5HI5D 4D0CA 3D69B 3GJFK 4KJPD 4I4WB 3UC0H 2EO1A 3AROA 3PWPB 2W65A 1LO3L 1RQ5A 4RWHA 1OSPH 5CSZB 4HS6B 3DROB 5FF6B 2IALB 3S5LG 1A2YB 2CKBH 1NL0H 3LMJL 1JNJA 1NMAL 4AT6A 4JN1H 3NOIA 3ARXA 4PRNA 3MV9E 4XWGH 5T1MB 2V6HA 5DEFB 1WTGT 3O9WC 1EHNA 3JTTA 1P5UA 1AFVL 5GS2H 5GS0H 4MNHA 1RIUL 4U05A 3IFNL 5H94A 3RHWF 3LHPH 2AJSL 3FO2B 4LHUG 3R0MA 3IU4L 3THML 3SKNB 1EEZB 1H15A 4OD2B 4KRPB 5C6PB 1T1XB 1AHWA 3LD8C 5HHOD 2HAZA 2H26A 5C3LD 1T1ZB 5T3ZD 3VFWA 2KH2B 4FFZL 3TO4D 1ORQB 4JQIH 1SYSA 2NY4D 2D0HA 5SX5H 5K9KA 3H9SE 4CMHC 5I71C 1I7TB 3IT8D 4RFNC 3HS0B 3LY6A 5JDJA 1U3YA 1X5LA 1JNHA 4NJAH 3W9EA 1E4WL 5KVDH 1WCQA 2EE9A 2BRQA 4FTVA 2FO4A 5BZDB 3HE6D 4FTVE 3L7EA 4PGEB 3CVHA 4F9LC 1J05B 3E6HA 5DFTA 5HXMA 1U8IA 5I0DA 1XGQB 5EU6A 2PO6D 4WHCA 1U8OA 3LB6D 4M02A 1T5XB 4NC0B 1AI1L 3RWIB 1WZMA 4L4VD 4XBEH 1NANI 4Y5YB 5EN2A 4UBDC 3OQ3B 4OTXL 3MPCA 4X83A 4L8SA 1NC4B 2VXUH 1KB5H 2JB6B 3GMQA 3VRIA 1K2DA 5I1CH 3SDXB 3G04A 3QA3A 2PXYC 2NZ9D 3BGMA 2ZJSL 5JA8B 5CCKL 3BDYH 3QHZH 2J4WH 3LSOA 4R0LB 1G7IB 4PBVC 4WUUE 1ZE3C 3TJHD 5H37H 2DWDA 3MLXH 4OZFG 3RWGB 1UH4A 2HTKD 3QDMD 4MMZC 4LSTL 4MAYA 4RBPK 5ENWB 1Q72H 1VA9A 3F7YA 3IRPX 5CSBA 3QIBC 2UY7A 3GMLA 5D7IB 4AQ1B 1R5WA 3FOMB 5DRZA 1T3FA 5JHDA 4X4YA 1AO7E 1N5AB 4JGJA 5E6YA 2VDPH 4KJYA 5IMOB 2OJEA 4FQ2L 3CXHJ 5JXEC 4MJIA 1Z3GL 3FB6A 2IPKA 2IAND 4JQXA 4ODSH 1PY4A 2BVQA 3O11A 3X11A 4MJ6A 5I1DA 2LTQC 5KN5A 1AP2A 1WFOA 3ULSB 1KNOB 2GJ6A 1ZLWK 2V2TB 3QIUA 5EUOA 3BVNB 1AGDB 1I75A 4I0PC 2XNAA 3VCLB 6CGTA 5FEBA 4LQFL 3OKKB 5DJCB 3V0WH 3LKSA 4JZNB 5C0DA 5I1EH 5KZCB 3SKJL 1UQSB 5L8KB 3QQNA 1EH9A 3MRKB 3U4BL 4MLIA 5E4EB 1ZTXH 5DQDL 3DBXB 2XWTA 4K7PL 4QHMA 4YHLH 2V17H 3DUSA 3MUZ1 4KDTC 4MNGE 5L7XL 3GIVB 4FMFA 4IMKC 1TVHB 4WWKB 3U9PH 2VLLB 4LSSH 2O5XL 5FUCE 2N7AA 1KLGA 2DLTA 2R69L 4TSCL 2YEZA 1NC2D 1T7YA 1P2CB 4NUGL 4GW5B 1S7UB 1MI5D 5BVPL 1I1RA 5CJ5A 1U3JA 3V9FA 1ETZA 3MODH 4RNRA 4N0YL 2ICWA 2XA3A 4XT1C 2R69H 3QCTL 4QF1A 1QFOA 5C09D 3T0EC 2O5XH 5DJ8B 4XMKH 3FQXA 5I8OH 2O5ZH 4U1NA 5TE6L 1SJVA 4OT1L 2P5WE 2R0LL 4PJGF 5GRWA 3ZE0F 3V4UH 2EYSA 4M7JH 4QTHB 5ADOL 4D9LL 4GMSL 5JR1H 4LQFH 4Z8FH 5J1AB 4P2QA 1Q38A 3T4YA 5IMKA 4AL8L 1LK2B 4Y7MA 5DS8A 2R0WL 2J8UE 1ITBB 2EYTB 3CK0L 2BCKB 2APWA 4FABH 1I7UA 4S1DD 4R4NC 4Y19D 2G5BA 4WI3A 1HCVA 4N0UA 3T4AA 2HKFH 3JV6B 5CP7B 3GSNB 4WW1B 4XNMB 1BOGB 1CQKA 4XP4H 1S9KC 1TMCB 1FNEB 2YZ8A 5LCVH 3W5MA 1I9JH 1RIHL 1C08A 5IROA 2A9ML 1AD9B 1W0WB 4M7LH 5INCB 4X5WA 3KPSD 4ZFZB 3RVVC 4EDWH 3MBXH 4B7IA 4GXVL 2XZAL 1NLBH 3GSVB 3MRMA 3BP6A 4PJ9C 4N68A 4PJFE 3EDJA 2EC9U 4RAVA 3MV11 2E7LC 4DCQB 1G7HA 4YXHH 3BH8A 4YDKL 5GGSB 1MHPL 1Z9LA 1KTDA 2CDEB 1JWMB 3O3DB 4ODTH 2DQJL 3OG4B 2DMKA 2FSEB 3QIWC 2OYPA 1J0KA 4RIRA 4JJ5A 4MVBD 5CJBA 1IGYB 1YJDL 3ARWA 2WUBL 5DD1H 3P4NB 5KOVC 2P7TB 3FZUC 4CADB 5ISZD 4YBLB 1IEBA 1RUQL 3QEGL 1FC2D 2EDWA 2AJYL 4KMQA 3SE9H 5F3BA 2X1OA 3L3GB 3GBNH 5F7EH 4DVBB 4FQXB 3INUH 1HDMB 4CVZA 5GGTH 5CBEB 1RK1A 4KHXL 4LPVA 2DQEL 5IV2B 4UINL 1G1YA 4AEEA 3U36A 4CUCA 5F9DC 3HUJA 4RMQA 3IXAA 3ARVA 1KOAA 4EUPA 4UB0L 1FNHA 4P46C 4PJEA 3BGAA 5I17A 1CXFA 2X41A 2W0FB 4JHBA 2GTZA 1ZEAL 1FNLA 4WU7A 5IVZB 1T89C 1KENH 2AJUH 1MCSA 5TGBA 3QXVA 4GG8A 3TCLA 4OI7A 2B5IC 1IT9H 5GS0L 4L4TB 5I19H 2AQ3A 5DUMH 3TVMB 2IAMD 3T2NL 2EIZB 3ARBD 1JPTL 5D6CB 5SX5K 4HPOL 1U8LB 4JN1L 2V5RA 1SEQL 2CO7B 5GZOD 1TETL 1FLRH 1U41A 4OGYL 4KROC 4L3EA 3JSSA 1OSPL 1E6JL 3HPJB 3V5DB 1FV1A 3REVA 3Q2CA 2D7QA 1XIWC 5C0GA 5KAQG 3RY4A 1M7IA 2B4CL 3VH8A 2F19H 1P7QA 4NWTL 5HDBE 3I2CL 3TYGL 1O5DT 3E8UH 1FNAA 3S35X 4X8JA 3QUYD 2P1YA 12E8H 2X9YA 1FZKA 4C4KT 3L5WA 4LFHG 3OF6D 4AEFA 5A40E 1P1ZB 1ZT7B 3QH3B 3GBML 1GOFA 1R24B 5HHMD 1EEYB 5I30L 3RWCB 2DQIH 4MJ2A 5IK3B 3TT1L 5E8OB 4O5LH 2EH7L 2ADJA 3IAQA 3VFTB 1DL7L 1R3LA 4CMMB 5EU4A 4JR9H 1CWVA 2ITDB 3PL6D 3CMOH 2UWEA 4NBYB 4UU9B 1XMWA 4XX1E 4OF6A 1S7WA 1CFTA 5C07E 2ESVE 2ZCKH 4OZGE 3L9RA 2AEWA 1AGFB 5TJWK 4BH8A 2J5LC 3NFPA 2UWEE 2VNCA 3RX5A 4WDIB 4NQXB 3UMTA 4WCYL 1KJ3L 5GGRA 4XNUL 3KXFA 3MGOA 1EUUA 4HGMA 1KIPA 1A7BA 4KHTH 5IP4A 1CD9B 2OR9L 4JZJA 3HC0A 1KGCD 2RCSH 4U3CA 4ELKA 4RWYH 1FZMA 3CX2A 5C8JB 1RU9L 4JFED 4OGAD 1FFPA 3KPPB 4YHKL 5KS9E 2DLIA 1NCBH 2X2YA 3ULVH 3SOBH 2UY6A 4GH7B 2DKMA 5L2KD 5AD0B 1IC5H 4WEBH 2ITCB 3PWVB 3RKPA 3QWRD 4KKAC 3QIWB 3QJFA 4NQED 4OLVH 5C0FB 5TDNB 1I85C 4IRSC 1JNNH 3FT2A 4D3CH 3ARFB 3TBVA 4PP2A 1EJOL 4XNXH 2W0PA 5DJYB 3TIEB 2YMXL 3ZKSD 4PRID 2NXYB 1GOHA 2R56L 4MD5B 1OTSC 3O3AB 3QCVH 3VGAC 5ADPH 5BVJA 3RWDB 3TYFA 3F5WA 3EZJB 4IRZH 5CINL 3DGCR 3O3UN 1LEIB 2ADIA 1NBYB 4LCUA 1B0RA 3VMOA 3E2HC 1FAIH 1YEDA 1YN6A 2YC1A 5E8NB 1YQ2A 2ZG3A 3L5WB 1ULVA 3N1GC 1MNUL 5E08H 3FQUB 4X8JB 2H32H 4O2CB 2X89A 1U8JB 5DI8B 5KVFL 3UTPE 5DF0A 3SEPA 1EAPA 4ODUB 4YHZH 1N26A 4I18A 4NQVB 3Q6FA 2X4NA 3IDYC 2KQNA 1YQVH 1FO0L 2IQAB 4ONGH 1CLOH 4LIQH 5ANMA 3G5ZA 5GGQL 4HWNA 3GSNH 3REVB 1X5KA 5D8JL 3OJDA 3P73A 2QL1A 4NRYB 4OM1H 2YPLD 2YSSB 4U3HA 4Y0GA 5EBGA 5GGSY 3KR3H 3U7YH 1TQCC 1PYWA 4HIJA 3DMMA 2NNAA 3QEQA 3MV9D 4Q9CA 1MLCB 2XV6B 3ARFD 1T4KA 4AIXA 3ULUH 4D0BA 4KVNH 1LEGA 1QO3B 2LVEA 4QY8A 3G6JB 4H20L 1SEBB 1I8IA 4G9DB 4TVPD 1F4YL 4WFFE 3QEHA 5DJ0A 3CD4A 3MLWL 1RULL 3X14A 3MR9B 3GMMA 5F7FA 1T20B 4FZ8L 4HKZB 4XBGB 3RFZC 4WU7B 1YJDC 1NQBA 3SO3B 4G8GA 1QBLL 3FQTB 2NY0C 4H0GA 4NHCH 2FX8L 1BQLH 2MCG1 1R6VA 4U2ZA 2FB4H 2D9CA 4NSKB 4RBPH 5JW5A 4PBWD 4I2XE 2Z31D 2HN7B 1QFWL 5L8JB 1H0DA 5HYFA 2BRRH 1CFVH 4HWUA 1MRCH 1FE8H 2FX9H 4ALAH 1B9ZA 5K9OB 4G3YL 5IQ7L 3BGFC 2I9TB 2GJJA 3MRHA 5A2FA 5IEKB 2K7PA 2RAMA 2VLRB 1NEZA 1I3GL 4G3YH 3P4NA 4OJFL 4ALAL 1MI5B 5DK2A 4HC1A 4PGZA 4WI8A 4XPFH 2Z35A 2GHWB 3RIAK 3QJHA 4P4RA 3O41B 4HIIA 2ZUTA 3STBA 1EERB 3WUWA 2EYRB 1JN6B 4HX1A 5B8CB 4WNQB 3QXWA 4XB7A 3QIBA 4UDTA 1QBAA 5IW6A 1J88A 3O4LE 4JO4H 3AFLA 4G6JL 3U2SB 1HYSC 4R4BA 3IF1A 2X70A 4FZ8H 3DV4B 4P2OD 1F58H 1UH3A 2AEQL 1JHLL 4ZYKB 1PG7L 4NCDA 1BIIB 1UKTA 1WEJH 3WFEL 1UZ8B 1M4KA 5EC2A 3EDEA 3LN5A 1QQDB 2FIKB 6FABH 3CSPA 1PSKH 2ADFH 1S9WB 3WFHA 4YAQA 4WW1A 4L8BA 1VADB 1G0XA 3U7YL 4N9GA 2VDNL 3HMXH 3KR3L 5CEZD 2MHAA 3GSOA 4LLMB 3IGAB 3VXOB 3O6ML 5D2LA 5J12C 4LIQL 4YHNA 1TVBA 5GGQH 5FDYA 1FO0H 1U8HA 4ZODA 4CU6A 1CE1H 2H6PA 2VC2H 3QQ4B 2C4FU 4OLYL 1J9CT 5MENA 2AI0H 2ZG1A 4JM2F 3QDMB 4PJ8B 3TFKD 1FPTH 4GRWB 4P0DA 4MSWB 1T03H 3MMEA 1D5BB 1MNUH 2D9QB 1T5WB 3MRPB 3BZEB 2DLFL 5I1KL 4WTZA 5EBMA 4K8RL 2ZUQC 1DUYA 2VQUA 4Y5YC 2E9BA 4HK0B 1EVUA 4HQQH 1R3KA 5CZVL 2NY3D 3FFCE 3MOBH 5CILH 1MCCA 2WUCL 4LEOA 4U1NB 3FT4B 4X4ZA 4MA7H 3QCVL 4N8CH 5BRZE 4Y4KA 4NFBA 4Z7VE 1G7LA 1H5BC 4LAQH 1EJOH 3DTXA 1A3QA 1F2QA 1DSFH 4OLVL 1G6RL 5I71B 1J1XL 3D6GA 1MQKH 4D2NA 1MFCL 4L8DA 4G42B 4WEBL 4OZ4B 2BNUB 1KLFA 2YWZA 3KDMB 5DVMA 2XRAL 4LEOB 2ZUSA 3BWAB 1SJHB 4L3EE 1FNSL 4X98B 1ZLSH 4L4VE 4FFYL 1S7QA 1JHTA 2BHZA 1BZQK 2GAZB 5EBMB 5FK9B 3OKKA 4RWYL 3VGAB 3MZGB 4PJIE 4CAGA 4HWBH 4G43A 1OGAE 3M8OL 5ESQB 1A6AB 2EO9A 3FN3A 1Z9SA 1BFTA 1VACB 2J1KA 4ZPVB 1WAAA 4JDVB 4PJHA 3O11B 2R2HA 4UUJB 3WSQH 2MHAB 4TYUA 3F58H 3QXDB 3C6SB 4N9GB 1JF1A 1ZHKB 3WJLC 1F5WA 5DURD 5AUMA 3HAEB 2H32B 4PV8A 2BSTA 1FL3B 1J5OH 1NSNH 1T3FB 3WUWG 4K3HA 2HVKB 1R5WB 4LCCB 1WICA 3RNKB 2E27H 1BIIA 2AABH 1U9KA 1HWHB 3VXMD 4PLNC 2IMNA 2BSRA 3S37L 1L0XA 5LXGH 4P2OB 1YEFH 1IM3B 2DWDB 2Y6SD 2X70B 4HUMB 1NGPL 3O45A 3QFJA 4PYHA 3V0VA 2R9HD 4R0LA 4LLYA 4JM2C 1DBKL 1GZQA 4DGIH 4HZLA 43CAA 4KVCH 2CUMA 1IKNC 3QG7L 3UYRL 1WCBB 3G04B 1FYTD 1M1SA 4FFWD 3WNMA 3DX9A 1S9VB 4LU5H 5HDQL 3I3DA 2BHYA 2N56A 1INQB 4U6XB 3MROA 3FQNB 4UNUA 3RBGA 3RTQB 4MCZA 4HCRA 3U83A 4F33B 5EIIB 4C56A 3L5XH 1YC8A 4YUEL 1X5ZA 5I16B 3HE7B 4P3CL 3MRCB 3DO7B 4D9RE 4ZUSA 2EZ0D 2VLRA 4PG2C 4OF8A 5C0BA 3ZL4L 3AU1A 4Z6AT 4XHJC 5EZOL 1QFWI 3MRJB 4Y4HA 5KSVB 1GIGH 1TETH 1QLEH 4NM8H 4JANB 4Y4KC 2VQ1A 3IJHA 5FGBA 1C5BL 1KCLA 4XPBH 5I73B 5FUOL 4OFIA 5EOTA 1RSFA 1JNHB 5D5MF 2VLJD 5CEYA 3IDJB 5JIHA 4EVNB 4Z78B 4C56B 4U6YA 1DQDL 4NT6B 1OP3K 4MCZB 5T1DL 3S9DB 3RTQA 3AM8C 2OJZH 5HD8D 2AJUL 1YN7A 4X99A 2PYEA 1FH5L 1G6RA 4UOW0 3U46A 1A5FL 4ODXB 2IADA 4UB0H 2YPKB 4OCRL 2VIRB 4XAWH 3VA6A 2P5WD 5DK3A 3FN0H 2OTPA 4MAUL 3X14B 3O3EA 4S2SB 2AW2A 2DL2A 2Z8SA 3MGTA 2Y07L 5H94B 1U2HA 1WT5C 3QFJB 5CBAB 1BFOA 1MFBL 3FT3A 4BFBD 4KK8D 1QO3A 1Z2KA 4P2RA 3FB5A 2DQEH 4A2LA 3DETD 5F44A 4UOJA 1T4KB 4KH2A 4P2QE 3AY4A 4DJMA 4NQCB 4NWUL 4UI2A 5I18H 2CXGA 3MRDB 4FXKA 4MNQE 4FP8H 3MRGA 5DUPH 1PYWB 5EUKA 4P5TA 2YBRA 3DROA 2H32A 1Q0YH 5C0JA 4V1DD 1IGCL 5DD1L 4NQTA 3MOAH 5DHYA 4HGKC 4LOUD 3O2DA 2VMFA 5IFAH 2F58H 2YBRB 2AK4D 4PJHB 3DUHA 4ODTL 3KPRA 3E1F1 5F1NA 3W0WE 1WFNA 2JJWA 4R7NA 2JB5L 4QWWD 2R1WA 2YR3A 5E70A 3IU3B 4YDKH 4HJGA 1IAOB 5HYSG 1BQSA 4OFPA 4QRUB 4UNTA 4Y5VB 2EXWD 4PJXE 4XVUC 2CUHA 1JRHL 2QLVB 4AM0A 3RWDA 3NACL 2MNUA 3C60D 3EDDA 4FQXC 3CMGA 4MD5A 5CJQH 1L4IA 1DN2A 4QOKE 1E28B 3QRFM 3U0WH 4GXVH 3LEXB 4HFWB 2Q86A 4NQEE 3AXLB 5ICYB 1Z0MA 2ATKA 4HKBB 1Q0XL 3P9LB 5BS0E 4MJ5B 4NQEB 4L8DB 5E8PB 4Q9RL 1SBBA 5LCVL 4K3JH 4KJQC 1FVDB 1QYGH 4ZO9A 4XVSH 1SYVA 4HS3B 2HYMA 1U93B 5D7JA 1ZANH 5C0ND 4XPHH 3EUUA 4P3WA 2VQ1B 4HIEA 3VGGA 5IHZB 1XCQA 3VXSA 3NN8A 3S34H 1A7RL 5IEHA 1P6FA 5CLTA 3QG6A 2ICWI 4RZCA 3TN0B 4ZDHA 4Q97A 5EFIB 1A6ZB 1Y18A 4JFFA 3L95B 5IGXL 2O5YH 2XA8H 1L0QA 4BJLA 3EOAB 4J3TA 3IETA 4TSBL 1D5BA 2JJVA 3MMEB 4X80H 1INQA 1E6OH 4MWFA 3VFPA 3KXFB 3DHMA 3OMZA 4IM8A 1Y0LB 3QUML 4IHOA 4IIQC 5DHXB 3HCVB 4WDIA 2O5ZL 1F02I 1RJYB 4NO0B 4XMKL 4I3RL 1NCWH 4P46A 2XWBB 3ZMRA 2RB8A 1D3CA 4UZGA 5LGHL 4FNLL 5ALCH 3D5OF 3DXAD 5LBSH 3GKWL 2FH6A 1MAJA 4XPGH 4HF5L 4LCYB 1SY6A 1CL7H 3HLAB 3JZ7A 5T1KD 4F7TB 1K8IA 2WQRA 2AJXH 3S4SA 3RWEA 2H41A 2D7TL 4YHOH 2WBJB 1PFCA 1VGEL 2FBJL 4LCYA 4LNRB 4ZNEA 2C7UB 1D9KA 1BEYL 2VXVH 1DQMH 2GK0B 1UKQA 3QNXA 3MACH 4C56E 4X4MA 3LRGA 1L6ZA 1KLUB 5TE7H 3U2SA 1NBZA 2XWBA 3ZZ1A 1MJJA 4LSUL 3HC4L 3SDDA 3FQRB 4KQ4H 3JV4B 2VL4A 4D9QE 2JJSC 2IQ9H 4ZUWB 4WO4B 1FO0A 15C8L 3NCYS 5IW1A 1A0QH 5TDPB 2VDQL 3D85D 4XAKD 4P5KA 1PKQA 4DKFL 1KB5B 3IDUA 4WWKC 1S9XB 4E41D 3BEWA 3VFVA 4PTTB 1MUJA 2IAMB 4R9HA 3R06A 3QDGA 5C0AA 1NEZG 2FWOB 4ZXBA 4AEIH 2E3VA 1NAKH 1G7QA 1FVDA 2ARWA 4F7EB 3LRSA 1MJ8H 4ZMAT 1A3LH 4LHQB 4YQXL 2R0KH 1DFBL 3QXTA 1WAAE 2ZG2A 4MJ5A 2LABA 3BDYL 3QHZL 1K5NB 1KJ2A 3D18A 3VXUD 2BDNH 1UENA 4Y8DC 1Z5LA 3R1GL 4J3OC 4NZJA 4ZXBC 1IE5A 2ZNWA 2ICEA 3EO0B 3UX9B 4U1GC 1IEAB 1IQWH 3JTSA 4XCNA 4X7TB 1CTNA 3U4EB 4OTXH 1LO4L 4YPJA 1NJ9A 4N0UE 1AI1H 1C5DA 3PQYA 5DFVC 1YY9D 2APTA 4PJ7F 1OGTA 4KXZH 3DGGB 3HRPA 4OI9A 4NJ9L 1ZSDB 1YMMD 4OKVA 4I0PA 1D6VL 1IGYA 1V7MH 1VSCA 4LSVH 3TWCH 1MELA 4LVOB 1RJCA 1J10A 4JDTL 5KVDL 3O8XD 1KIQB 5IQ9B 1CICB 5CWSA 3WO3B 3D39A 5J56B 1G9NC 2D7MA 4BUGA 1QSFD 1KF9B 2PXYB 1CF8H 3GI9H 3O6FA 5HDBF 5GGSA 1DQQA 2QSCH 1UWEL 4ZFFA 3FQUA 3SCMC 1BJ1H 2YD3A 5HPMB 3IRZA 4Z7NF 4JKMA 1CD8A 1FG9C 2ESVB 4UDUB 2DJUA 1QRNE 1NLDL 5B38A 3IFNH 4R8WL 1QFUH 3W39B 1JGLH 4PUBH 3RKDC 3LQAC 2BFVL 2IFGA 2VIRA 3MA7B 4C55A 2X1WL 3EYOA 5A2LH 1PQZA 4O4YL 5CD3A 1RZ7L 3WE6B 1JIBA 1DE4B 3LMJH 3QJHB 1BOGA 2CKBL 1IGJA 4TUKH 3QJFB 4Z7QF 4QYOA 2Q20A 2VB5A 4U6YB 2ICCA 3ET9F 4O2EB 4CMHB 1IM9D 1QPPA 3BYYA 4AIZA 3CIQA 1WTLA 2PCPA 2BY2A 1KPUB 5ESVB 3T8XB 1NEZB 4HZAA 4GQ9H 3NA9L 2IBBA 3LD8B 5A3ID 1TJIL 3T4YB 3EYVB 3O2VH 4IMKA 5KSVA 3GSWB 3ZDXE 1C5CH 4OCNC 4HWZB 1IAIM 1G9NL 3UYOD 3DO7A 1HKLL 2IEPA 4JZOA 4JO1H 4UQ2B 2IQ9L 3MREA 1KULA 4PBXA 3LOWA 3VGHA 4XHQA 5C9JA 4PJDF 1NFDE 3LKRB 4FQLL 4APQB 4F33A 2W0LA 2DIJA 1ZT4A 2CDGB 5GSRA 1JTPA 4LSUH 1E4KA 3MGOB 4JHAL 4N0CC 4YHYC 4JFDA 2ZKHL 1JUFA 4P4KB 4LVHB 3SDAB 5IT2L 3IFPA 4HCRL 4XBGA 4X4XA 1AGFA 4Y5XC 4WHDA 3NTCL 2IH3A 2FBJH 3RNQB 4E0RA 3O45B 2R8SH 5FM5O 2C3VA 1TVHA 2F53E 1U3HA 2OBGA 3ZTNH 1ZHBB 1G9MH 4P23D 1VFBA 4YWGH 1J1PL 1IQDB 2P5EE 3K8LA 3L1OL 1EXUA 1MCPH 2NNAB 3GKWH 4WV1B 5ABDE 4E9LA 4NQSB 4FN0A 3RWCA 2JK5B 2YRPA 3OJDB 1C8PA 1R24A 3G5ZB 1EGJA 4I3RH 3FOLA 3OKEB 5DURB 2IQAA 1JF1B 2K1MA 2H2PD 2IGFL 5JLZB 3JV0A 3QIUB 1F4WL 4NM4H 4RFEB 3OX8B 5DD5L 1AO7B 4ZPVA 2YA0A 5EU6E 4X80L 4OLZH 1F00I 3Q5OA 3FB6B 2O5YL 1SJEA 4PLJD 5FO7A 1QR4A 3BDXA 1OTSD 2A73A 3CNKA 2ADIB 5L0QB 1FV1B 5F8QC 2JF1A 3TJHC 3KPLA 4U1KA 5CJOH 4HS8L 3MV8A 4KJWC 4Z0XA 2BNQD 4GBXC 1CTOA 3DVGB 2NX5B 3F7YB 5TE4H 1I3RB 4I9WE 1ZHBA 1ZVYA 3TVMA 1QYGL 1MAMH 5B4MD 4C4KO 3LKQB 4GG8B 4UT9L 1QEWB 4PR5B 1RIVH 4OCSH 5D7LA 1DVFD 3FONB 3QSKB 2BNRE 3U9UA 4KPHL 1EX0A 2NY5L 5FV1L 5B39G 4NGHH 4U1HA 5FGBC 1NAMB 4M9PA 2ARJQ 3K80A 3V95A 5SWZE 5C8JA 2NY3B 3LB6C 5C9JB 3BZ4A 3H9HB 3O0RH 2VXQH 2B1AL 1RZ8B 4NKDA 5D6DC 1KPRB 4JFFE 3E6HB 1P84K 2GCYB 3L3GA 3QDJD 3QI9A 1A14H 5DC9B 2VO5A 2ENSA 5E2TL 5SX4I 5I75B 2VH5H 3MOAL 4KZEH 1KJ2L 1U8HB 3QBTB 1KPUA 5GJTL 1CIDA 4LDOB 4G9FA 1Q0YL 1IAIL 4OZFH 3HS0A 1FFNB 4U6HB 3L3IA 5D1QA 3HG1D 4Q7DA 1V7NL 2FSEA 4UAOC 5CS7A 1CFTB 5IHLB 4WO4D 3H3BC 3VD3A 1NCCH 4V2BA 3WE6A 1LO2H 1KTDB 5E6IB 5E2JA 4IDJH 9CGTA 2E7MA 3H42L 4XWOD 2DQCH 5CJXC 2CLVB 1EEZA 1AO7D 3WLWC 2FX7L 1MEXH 4RAVB 2AXHA 2YHGA 4N5ED 3S36X 1Z9OA 3HE7C 4HW6A 1HNGA 2ERJC 4LK4A 4QHNA 5E95B 5T1MA 2ZNXA 1D5XB 5HPMA 1W0VB 4O02L 1JF6A 4PRNB 1YNTA 2MPAL 2DQDL 3N1MC 2VE6A 2MQCA 2Q7YA 3CH1A 5E94A 1C08B 3GK8L 3O6FB 3VD7A 5B8CA 4OLWH 1N6QL 5CSZA 1FNEA 1MSPA 2W1NA 1IGFH 3OAUL 4G7VL 5AG8A 1YPZA 3GSNA 4XNMA 5ITBH 1D5IH 1KT2A 5GS0D 4U4BA 3T4AB 3MV7D 3C8DA 4XPBL 1HYSD 3IJYB 2OZ4A 4X6BB 4XP5L 4PJXB 5DK2B 2C9AA 1PLGH 1HWGB 1QLEL 1SHMA 2IPTL 4RGNB 3OPZL 1U92B 4G6FD 1GIGL 3FN9A 3UTSA 2HLAA 2HVJB 3KYKL 5DHVA 3P30L 2FGWH 4OKDA 5I66B 3DGGA 1LK2A 3OR7A 3WXWL 4RA3A 1C5DB 3PQYB 1WISA 4L4TA 5E5RB 5BZWA 3N1QC 3RL2A 1E0OB 3U4EA 2LQRA 5EO0B 3UTZB 1LO0H 1KV3A 3RIFF 4DN3H 1IEAA 2VSCA 1J0JA 1KTRL 2FJFA 1CK0L 5KJRH 4BQ8A 4Q9QL 2R2EA 4KTEH 1XZ0A 4M8VA 2GI7A 1U58B 5E0QA 4EOWL 3HFML 3T04D 3EGSA 3IXTB 1I1AB 3PV6B 2Z8RA 3C5JB 3HZVA 4UV7L 3DIFA 3VD5A 3FB8A 1MJUL 5LXGL 4J12A 1CXLA 4N8VB 3SDCA 4CU8A 2NZIA 5SWZB 5H35A 4NN7C 5A16B 2J88L 3E3QC 2AABL 1KIRA 1KCVL 3R06B 5EOCH 5EC1A 3MXWL 3S96A 1D5ZB 2AK1L 4MD4A 2X4RB 5DT1H 4IIQA 3UAJC 3UTTA 5BW7C 3BKJH 3O3BA 1W2KT 3CFDB 3KLHC 2ZPKL 2FEDD 2D31A 4GAYB 3EJYD 4LBEA 1S8DA 1RI8A 3V2AR 3CFJA 1QHPA 5IW1B 4FQJL 2XACC 3RI5K 2YPLE 1H5BB 5J8OA 1NCTA 3MBEC 4TVPH 4KUZL 2WWKT 1CL7I 1MJJB 4PRPE 3PGCA 5T5NG 1MVUB 2DM7A 4JPWH 1CICD 4WTWA 5EZLA 5B22A 3WXVH 1EZVX 5FHBL 2ZUQB 1N6UA 1O7SA 2MQ0A 4ORZC 3MLSL 1KN4L 5JHDB 2IWGA 3OAZK 3C8KB 1T7ZA 4HKXB 5I8CA 5FGCE 5C0AE 3OJMB 3QDJE 1YMMB 1KPVB 3QWQB 3EFFA 3TIEA 4HH9B 1RZFL 2F54B 3SJVA 3HLAA 1B88A 4XCEA 1DSFL 4PRIE 1JWSA 3GSRA 4ZOCA 3CZFB 4U6TA 4P5MA 1S3KL 3JVGA 3MJ7A 3QIWD 1A6WH 1EBPA 2VJXA 3X3GH 4NRXB 1IKFL 4GKSA 3TA3B 1CGUA 3EW3B 4GBXA 5AD0A 1ZVHA 3MC0A 1FGNL 4PJXF 3NFSL 4TVPL 5DS8B 2DQTL 2HT4C 2FHFA 1DTUA 4RMTA 3VXTA 4FQJH 1WIOA 5CZVH 1K2DB 4TNWK 1S7TB 4ODHH 5GS1C 2DLFH 5I1KH 2ZPKH 4PJIA 3KNBA 1ZAGA 1KELH 1CGSL 3N9GL 4YX2H 4ZDHB 3TIDA 1NUNB 4F8QA 5JW3L 1JZ6A 4NBZB 1U8OB 2WWKO 3BQUB 4IS6B 4XX1G 5JORB 5J6GB 2QQLH 5EOCL 4Z7UE 4HXBH 1BECA 2J88H 2MKLC 3O6MH 3TF7C 1FORL 1GPOH 1R3JA 4XI5D 2Z92B 3DO3A 4HS3A 3W9EB 3T08A 4K8RD 4MNQB 5MHSE 1RUAH 4FOMA 3N0PB 1A7OH 1JZ7A 3DRTB 5EPMA 1KLGB 5K9KB 3RWHB 1EMTL 1X6LA 2IAMC 2ATKB 2UWEB 4KTEL 3MRRA 4Q9QH 4HDIB 5EU4B 5I8EB 4CMMA 4YO0A 4OZHF 4BQ6A 2NXZC 3OHXB 5EWIH 4NZTH 3PF2A 4G8FB 1LO0L 2X42A 4NBXB 1DBML 5E8OA 1AY1L 3RDTB 1I8LA 2DTSA 4QXUH 5FYLH 4QRUA 5SWSA 2BVPB 3NIDE 1QOKA 5DEFA 5AWNH 5HYJA 1WBYB 3FZUD 3QULB 1CGWA 1IEHA 5FA4A 2FGWL 2GSGB 4LKXA 4ODVL 4R4FH 3RQ3A 1WWBX 2I9LB 4JHWH 3KPRB 4YFLF 5FXCH 3LH2H 1X4XA 4MJIB 2DF3A 4OGXH 3ULUE 3TA3C 5ITBL 1BOYA 1K3ZA 3ARDC 1UZ6E 1WT5A 1N5AA 2Z0BA 4OLWL 1XGPA 4HKJA 3BRDA 3H0TA 3GRWA 1I85A 5IQ7H 4IRSD 1BD2D 1KCUH 3TZVB 1T22B 4RX4D 5MEPA 1JJUA 4X7SL 3MLTA 1UADC 2VXTL 3NCBB 2MPAH 2CGRL 4S1SH 5GZND 4WI6A 4O02H 3QWOB 3RIAF 2NY0D 4CVUA 5HGGS 3IDNA 3UBXI 5EDXA 5MENE 4P2RB 3O9WD 1MWAA 1EV2E 3MRNB 4M4RA 1G7PA 2FRGP 5F3HB 2FB4L 2Z31C 1G7IA 2CMRH 2FATH 3EZ8A 5BOPA 5I9QB 4NHCL 3D2UA 3JV5A 3H42H 2W0FA 1MFNA 3P40A 4J8RB 2V5YA 2WV3A 4X99B 1JGDB 1KCSH 1WC7B 1ZXQA 1OD9A 2VAAA 1BHGA 3W0WA 4XP1L 4N1CA 2R1YA 3BPNB 3Q5TA 1MRDL 2P8LA 1JPFA 3E2HB 2VYRE 5GJTH 2BSSA 1KJ2H 4MXWH 1JPFB 4EI5C 3IJHB 3BP5B 1EGJH 5HD8C 4ZO7A 4UTAH 5ITFA 1WC7A 4Z0BL 1LK3H 4HUUA 2F5AL 1IC4H 2YK1L 3T0DA 3AU1B 1P7KB 3PIQA 4AENA 1PY9A 1CLOL 1QRND 1CDCA 2VQTA 5I16A 4LARH 4OUUB 3MQIA 1MFEL 1XF4A 4MA8L 1G7PB 5F3HA 3V4VH 1I7TA 4EI5D 3S88L 3ULVE 1AGEB 4G8EA 1YEKL 4KJWD 3MROB 1T2QL 4I2XA 2XQBL 4O51A 5JNYA 5KVFH 2H26B 3WIHL 3VWKD 4YDIH 3L3OB 2AJ3A 1MRFH 5KVEH 1NMCC 1BLNB 1X5AA 3CFKA 5FYKU 1FAIL 5AZEL 2D7PA 1GZQB 3OKYA 1NBVL 2OTWA 4LASH 2ZSWB 3VMNA 4U1MA 5CINH 2MMXA 4KMLB 3NCCB 4R7DB 1YMHB 4DQOH 3HMWL 1YYML 3BESR 3GSXB 5GHWH 1G7MA 1IC7H 1R3IL 3CSGA 3BUYB 3MYZA 3IDMB 1EFXB 4LHUD 4NKOB 3TP4A 3KPSB 5LGKA 3V52H 4D3CL 1A7NL 3WFZA 3RNKA 3SJVE 2BC4A 1AHWC 3OL2A 2A0LD 5CJOL 2HKHL 3SGJC 3RZCB 5D2NE 4NQCD 2EDRA 2BSTB 2F15A 1U95A 1YECH 3QFDB 1TITA 5CP7A 4NCC2 4GW1A 4PD4K 5BQ7B 5DLML 3B43A 4D0CB 3BO8B 4K3DH 1U8KA 4OF0A 1GH7A 3C60C 2PTTA 4TUOB 4LSDA 3V6OE 3VXUE 5EORL 3D3VE 3UTQB 4YO0B 3MJGX 5HHOA 4J3VA 3VE0A 4FQ1H 2D4DA 4GRWE 3F7VA 2MTPA 3Q6GL 3TO4A 2X4PB 4KQ3H 1XGRB 2EIDA 3DSNA 2VERN 2FLBT 5C0RL 3VFRB 4RRPA 1SMOA 2EE6A 1S7RB 5CZXD 1NMBH 3I6GB 1DEEA 1UCBL 1UACL 3EJZC 5IVXB 3NCMA 1CE6B 1U2CA 4H26B 2X6MA 1UT9A 4YWGL 3TNMA 2P24A 4NKMA 3TH4T 3WN5B 3BRFA 4PGCB 4IEFB 1WV7T 4GSDH 4Z5RB 4PJFA 3LS5H 3MNWB 4IOSD 2R8SL 4XH2B 2CLRA 2ZCKL 2QQNH 3QO0B 1I3VA 3ALWA 5JIPA 1DN0A 2OS7A 1K8DA 1P2CA 1UWXK 3FO0L 2GSIA 4LRIA 4KROB 3X13B 1KYOJ 4Y4KB 3PXJA 2VZOA 4OBRA 1YECL 3BW9A 4O5LL 3TGXA 4LLDB 1QR1A 1F3DJ 4QHMB 4J3XA 5MERB 1R3KB 1AXSA 1A7NH 1FL5A 3ULVD 5IMMA 4ZS7H 2QHRH 3KJ6H 3TNNA 3VXSE 2CQVA 1IC7L 1FVCA 1E4XH 4BH7B 3QFDA 2FDBP 3G5YA 3BT2H 1N0XH 5BV7H 1ADQA 1WZKA 2ZUUA 4ELMB 4MAYD 3L3DB 1N5YH 1KPVA 2F54E 2C3GA 2YN5A 4U49A 4DKDC 5AZEH 5D1XB 1ZLVH 1UB6A 5D71L 4N0FA 5DR5H 1AGCB 4NZDA 4OQTL 5DRNB 4B41A 3NAAH 4OZIE 5JQHC 2XQBH 1FLRL 3LKNA 2IANE 5EZLB 1SEQH 4KTDL 1S9WA 3LEYL 3B3IA 1GHFH 4A6YA 2IANA 4HXAH 4MA8H 1MFEH 5D1XD 3LN5B 1JMXA 4LARL 2ZSWA 3T2NH 3UPRA 3IFOA 2BFVH 1IKNA 3BZFB 2CD0A 3CFKB 4LCCC 4WUUB 4AQOA 1JGLL 3RVVD 4Y1AE 1U42A 2F5AH 4JPKH 1ZHLB 4QTIL 4O51B 4UTAL 1TTGA 4Y1AA 1KENL 5JDSA 1IGTB 1ZEAH 3ARGC 3EOBA 3RA7H 1T66C 3RDTD 3VRLF 1WAAF 4HLZH 4I0CC 1CGTA 3GI9L 1P7KA 5E1HB 2Y4SA 2RQ8A 5C07A 3SDXA 4HIIB 3BW9B 3PHQA 5B3JE 2AERT 2HFGL 1QFHA 4NZRL 4O2FB 1LD9A 5EZIL 4ZTOL 1MI5A 4PTUA 5F7EL 1LILA 3RWIA 2Y1VA 2UVFA 4NJ9H 4RQQB 5CHNA 2AJYH 3SE9L 2P8LB 3QZWB 5CD5C 5SV4A 1RUQH 4S10A 2YD1A 5C09A 1TLKA 4XMLH 2KQMA 5E2WH 2MCPL 1JZ2A 3IDXL 3LS4H 1XZ0B 3NPSC 5EBLB 2FJFB 1NKOA 4TVSa 4YGVA 4M5YL 2DD8L 3TBSB 1MCLA 3RVTD 5CEZE 3AREA 1OM3H 3AGVA 3E6FA 5DJ6A 3DURB 3RL2B 1MWAB 2BDNL 2YXMA 2VISB 1SYSB 2OMNA 4OGXL 1YY9C 3VE0B 1H9VA 4LAJH 2EECA 43C9B 1T04B 5A3IC 4P49A 1A3LL 3U0PA 3RU8L 4X0KA 5T3ZE 5CSGA 3SQOL 5I9QC 3IDGB 3RL1A 4ODVH 1NAKL 1NLBL 4APQC 4X6BA 3MBXL 3QO1A 1IARB 1RZKC 4HMDA 3H7BA 5HHQB 1GRWA 1UVQB 2W0KA 3O8XC 3N1FC 2E6QA 5GGUB 1KEMH 4NUJB 1ZLUK 4PRBA 4JG0L 1LEKB 3VWJA 1BIHA 3DMMB 3TT3H 5GRVL 4Z7QE 2NY1B 3HMXA 2IALA 5J12B 5FF6A 4NKOA 4P99A 4WTXA 1YNTB 3GMNA 3P73B 5DO2D 4Y4FD 3GRWH 3DVNB 3GJFB 4CBPA 2PW1B 2BVPA 4LLQA 5C7XL 2DTMH 1DDHB 2ILLA 5C6TH 5L88H 4ETQB 4POYA 4MS8C 4G8FA 1VGKB 4GMSH 5JR1L 3VXRB 5IWLA 3EHBC 4HIHA 3HG1E 3MRRB 2DJ4A 1BX2B 3V4UL 4H5SA 4HXBL 3RWHA 1TIUA 1BEYH 5ICXB 3GHEH 4XMPL 3UO1L 4Y16A 1FFNA 4JPVL 4OUUA 3LV3A 2A6IB 2B7DT 4G9FB 5C0NC 5ID1A 5EO1B 3V5HA 3MODL 2DKUA 4XPGL 4CKVX 5I1IL 2ZUWA 3WFCL 4CN6A 4G6MH 3NCFB 5BVPH 1F45A 4LPXA 5TDOA 4DKEL 4XCYA 1UB5A 2DDQL 3HNSL 5SWZD 1FGNH 3N85L 3BIKA 3KNBB 1U6AL 5M94B 2QSVA 4BA8A 4WENB 1A7PH 1SY6L 1CBVH 5D7SH 1S3KH 2VAAB 1GGBH 3CC5A 3IS1X 4EXKA 3OB0K 3J7HA 4QHUA 5LKNA 2OSLB 2NY5C 4TSBH 2V5MA 3RWFA 1RZFH 4MX7B 2IMMA 3FONA 1JI1A 5IGXH 2EDLA 1WWAX 4NRZB 4B50A 3QUXD 3TA3D 5ERWA 2F5BH 4RDQF 4LCWE 4PRHE 1KN4H 3SKUD 1UA6H 3QUMA 4LRIC 5DJAA 3MRNA 1JE6A 5GS1B 4KDWA 3V5KB 3IDNB 3NCEB 3KAAA 2KDGA 2NY6B 2VITA 3LAFA 4U1GB 1HEZA 5C0CD 5KSUB 1LNUB 4AY0A 3VXQA 4C83A 1CU4L 1H3WM 4XVSL 3BX7C 3HI1B 3KPSE 4QCIB 5EOQL 3REWB 2FZ3B 2Y6SC 2NX5E 1N3NB 1WZ1H 1Q0XH 5KG9B 4L4TE 3LQAL 3B8SA 4UT7H 5F96L 3X3FL 2C3HA 4QRPB 5E00A 1ZLWH 1DR9A 1QSZA 1OWRM 4W6YB 3SKMB 2J8OA 3PGCB 1RFDH 5K9QI 2ADJB 1E27B 3IB4A 1CGVA 1HIMH 1JRHH 3I9GL 3OF6A 1UJ3B 1R3HB 1W8OA 4JLRB 3MRBB 3A67H 5IIEA 4MB3A 5HVGB 2Y72A 3D87B 1IZKA 1OAKH 2WW8A 5I1CL 1GGYA 4WV1A 1FVEB 1F3DH 2A9NH 1RY7B 4UV7H 1SBSL 2VXUL 3SCMA 5DVNA 4NOFA 1A9EB 4JRYD 1RVFL 1EFQA 3O2WH 2GUOB 1DLHB 2PUQT 3WIHA 3OGOE 3UXFA 3HG1B 1DQJB 5EPMB 5E8EB 3RNQA 2YD5A 5I1AB 2VKWA 3PDOB 1KTLA 4FQIL 5EH1A 2BX5A 3IAPA 2NXYC 3X12A 5I18L 4X6FA 5D9SA 2WBJC 4J23A 4NFDA 4QO1A 3QHTC 4JFDB 5JHLL 3ARFC 4ZFOL 5LQBL 5HYSA 4J1UB 3WXWH 1DQLL 4NN7B 3ZE1F 3DYPA 5GRYA 4FQHB 2CIKB 3IYLW 3KYKH 5DEGB 5TGBB 5IVNA 4JQIL 2IPTH 4PJIB 3DETC 4UMGA 5EO0A 1A5FH 1Q1JH 3CSBA 3AAZA 4OZFA 3F7RA 3L7FA 3SY0B 2JIXA 3I50H 4PJEB 1ZGLP 4X8XA 3O6LL 3VWJC 3IU4H 3THMH 1NGXB 1T1WB 5JHDE 5BJTB 4EBQH 5C09B 4PGJA 1N6QH 1RMFH 2HLAB 2HVJA 3GK8H 5DHVB 2Y7QB 1QNZH 3LIZH 4GKSB 4PRPB 4L4JA 1PZ5A 3HRZA 1MWAL 1NL0L 3CZFA 4DVBA 4PRDB 3PHQB 1IGJB 1YPZB 3TN0C 5FOBB 3CPLA 5DD0L 3VH8G 3PL6B 3OKLA 3PGFL 1IEBB 4HH9A 5E2UL 5BO1H 3T0VA 4PRIA 1T0NA 2NX5D 3D3VA 4LFHD 5JHLH 2JKXA 1BJMA 1ZVSA 1VKXA 2DBJA 3Q3GA 1ONQB 4PRHD 3R0NA 4GOSA 1NCCL 3ESUF 4LU5L 3D9AH 5J4MA 2OTUB 2XZQL 2IG2H 4D0DB 1MLBA 4HSQA 5LWYH 3SE8H 4U1IA 1YA5A 3EOTH 3UYRH 3QG7H 5KANI 1K4CA 3O6FC 5CMAA 2X4TA 4HULB 2BVYA 4QGYA 4NO5B 1DQQB 1DQTA 3BP4A 3PABA 2VH5L 4MZ2A 5E6ID 4M6NL 5CP3A 4HJ0C 1H5BA 1NGPH 4Z76B 3WD5H 2XTJB 3CFEA 5INDB 5JOPD 3HAEG 1E4JA 5JPMB 1F90L 2YPLA 1IC1A 1OTUC 1T7VA 2ICES 4JREC 1AIFA 4YIQA 4X6DA 3I9GH 3UTTB 3GHBH 1J5OL 2P44B 2ZUYA 3CPLB 4JRWA 5FO9B 3UBXB 3HNTL 1IGML 3B5TA 4WFHE 1KIRB 4NGHL 4YE4L 5E7FA 1RFDL 3F58L 4O58L 4N0UB 2NY5H 5A16A 4PRPA 4XCNB 3EO1A 3L6FB 1OTUD 4UT7L 5F96H 1YNLL 2BY1A 3A0OA 2Y5TA 2GJZB 3C2AH 4TULH 4Y2DC 3V6BR 3DARA 2RHEA 4H1LG 5EIQA 3SDAD 2DL9A 4BFIB 3M8OH 1B0WA 3QDAA 2GKIA 4GLRH 1E4KC 4HWBL 5EOQH 2MFNA 4ZD3L 2YUZA 3H8NA 2FO1A 1DUZB 1JYWA 1UXWB 5IOPA 1TZGH 2AJZA 1DVFB 1IFHL 3GI8H 3MSPA 5JQ6H 4N0RA 3P77A 4ISVA 2Z31A 1Y6KR 25C8L 3BAEH 2FH8A 4S0SD 2FR4A 2NY3C 5KSAD 1CQYA 1OAQH 4K7FA 1P53A 2G75B 1YEHH 5C1MB 3LQMA 3WN5A 3K2UH 4NNPL 1LE5B 2ICWB 4H25A 2F53D 1CE6A 4H26A 4OLZL 1UH2A 1DLFL 3QUZA 3TPUB 4P5KB 1Q8MA 3QQ9C 1CDUA 4RGND 4ZUVA 3ZDXF 4AG4L 1IM9B 5EB9A 3KPLB 4U1KB 3NMEA 3VFRA 2X40A 3GIZL 2EKJA 3B9EA 1BBJA 1U8NA 1XGRA 4NC1E 2W60B 4CU7A 3DHJA 3ZT6A 3OKNB 4ZUWA 1QRKA 5D7LE 3ZKMC 3N85H 3VXPA 1LDPH 2XTJE 1YNKL 4K9EC 4GXUN 5E5UB 3I75A 2XWTB 1OPGH 1X44A 1A6VL 4NPYA 4DW2H 4ZOAA 2PTTB 2Y9RT 4RMWA 5K9JH 3U1SH 1D5XA 1BVLA 3PGDB 2ATPB 4PLKC 2I5YL 3PWLB 3D25B 4JPVH 2AI0L 4BYHA 3RZCA 4OLYH 2HRLA 1MF2L 2VC2L 3ULSA 1CE1L 3NTCH 4M43H 3G6JE 1NCAH 2FJGB 2DI9A 4MJ6B 3S98A 4R2GB 2AXGB 3TO2B 1ZGLM 3AVEA 3U7WL 1OGAD 1EFXA 4F7TA 5HHXL 1UKSA 2AV1B 3MJ9L 4JM2B 3STZA 5I6XB 2VLMD 1T83C 5DZOA 4F7CB 1AE6H 4D94A 2GY7B 3NCJL 1ACZA 2ADFL 5GIRA 4F15B 5D7KD 5BMFH 1LP9F 1ZGLA 3DX7A 3GRWL 4K23H 1FLTX 4UOW1 1PG7H 5AYQA 1GAFH 3UCRA 2A6DA 3EYSH 1JUFB 4P4KA 5ELIA 5MEND 3H9SB 1C5CL 3PNWA 1HEZB 1EZVY 5IFHL 3V5KA 3ZTJG 1Q9KA 4GUPA 1INDH 2OQJB 4JO4L 2ED7A 4IOFC 4GRWF 1NGYB 4BSJA 4Y5XB 4NRZA 2WNGA 2VZTA 4Y2DA 1U3HC 1NFDF 2OM5A 4MX7A 2IJ0C 4HUUB 3NGBB 5LVEA 4OB5L 5ITFB 3PQYE 4FFWC 1BFVH 3BIBX 5D1ZA 4JFHE 1RZ7H 2H45A 1L7TL 2X44D 5C0EA 3MLUL 4K9EH 5T33L 4RAUB 4K55A 5FDWA 1T5XA 4R8WH 1XGQA 5EU6B 1DEDA 1UB5B 4OFVA 5ACLA 4KKCC 4M5YH 3T09A 2W9DH 4XP6L 4OCLC 5T3XH 4GRMB 1CFVL 3EIFA 2BRRL 1JGUL 1OAXL 1E28A 2IBGA 4ENEC 4P57A 3IDXH 1UWEH 2MCPH 2HFFA 5E2WL 3ULUF 2QSCL 3C5ZC 2CR3A 3LV3B 4RA0C 5GRUH 3D85B 2PO6C 1A1MB 5KS9B 5KZCD 4Y16B 4DWHA 4KTYA 5LAXA 2FX8H 2VDML 4ZTOH 1T1ZA 3QEUB 5FO7B 1RJZA 2EDKA 5ACZB 3NZHL 3QWOA 4I1NB 5DJDA 5T1LA 4G6KH 3BPCB 3DUUB 3VXRD 1I8MA 1EHLL 2X05A 5A43C 1BVKA 2M2DA 4OD2A 4X7FC 1A1NA 2E8YA 4RCAA 2NTFA 5D70H 2AS5M 5IJVB 1H3VA 4LLQB 4CL7A 1LO4H 5C0JB 3P9MA 1MCOL 5GJSL 1DBBL 4K71B 5FYKE 2H3NB 2NW3A 3B5GA 1A6UL 1IQWL 2XWJB 1QLFB 1QLRB 2LTQB 3S4SG 3V7MA 4KU1A 5GZNC 3VXMA 4IOIB 3QULA 4JM4L 4JY6B 2P5EA 4DUVA 1YQVL 4F7PA 4JKKA 3QO1B 1QVOA 1J12A 4HIXL 4GG6B 4WJ5B 5I15L 4JQVA 3DPBA 4ODXA 1V8HA 3GNML 2VSDA 4DTGH 3QNYA 4AEIL 4TOYH 4FHBD 4JFZH 5CGTA 1MFAL 5DWUH 2EDJA 5GSRB 4QRTA 1XGTB 1N5YL 1NC4D 5FKPA 4ONOA 2H1PL 3HI5L 5DJ6B 1JK8A 4YHML 4F9PA 4N5EC 5HYIA 4K3EL 1VPOL 3NIGE 3RP1A 4UBDD 1H8SA 4YEFA 4JZOB 4M6ML 2Z92A 4OAWA 2DMBA 3G5VA 4P23C 4ZXBB 4XNXL 5F6HI 1A0QL 3GSWA 4LCWA 15C8H 3B2VH 3K74B 5B8CC 2Q6WA 4UQ3B 2ZOLB 4PD4J 3QZWA 4CW1B 4B7LA 3VFVB 5DUBA 1DBJH 1D9KC 2O26U 3PWUA 4YZFE 4HG4K 2RIKA 2VTFA 1OWWA 2CO6B 1XF5A 1MIML 1WFUA 1U8MB 4GKNA 4HJJH 2EH8H 5FYLE 3MACL 3ARPA 3TC9A 5BCAA 1MAKA 2PYED 1AKJB 1WCBA 4JFHD 4YHOL 5DJXA 5DMIH 3LS5L 4PB0L 2P5WA 2OR9H 5DTFB 4A6YL 5DK0B 1KFAL 2W9EL 3T3PE 4RFNB 5B38B 1II4E 1HQ4A 1UCBH 1T0MA 4UDUA 4FXLA 3CX5J 3NA4A 4KFZC 4GRLD 4WCYH 5ALCL 3FMGH 4JQXC 2WBJD 5LGHH 2J8HA 3VFGH 2VN4A 4KQ3L 4QOKA 3IFOB 4ZOBA 4HKXA 4P5TD 5E9DB 1GC1L 1MHCA 4HUXA 2OL3L 3D39B 3QUMH 4XZUB 5GRJH 4PV8B 3MCLL 3LKNB 1FL6B 5D7KE 3DSFL 1YY8B 1G9MC 3C2SA 3CMOL 1MVUA 4PJ5A 2NY2B 3BUTA 4XGZA 4HLZG 1A4JB 5C08D 2XA8L 1DL7H 1C7SA 5BS0D 2C4XA 2EH7H 4NO0A 4X7DC 1RZKL 4TTDC 5HGAB 2Z8VC 3VU2A 4DFHA 2HKHH 3HAEH 5I1JL 1B0GB 4ONFH 1REIA 2DWEA 2Z91B 3OXRA 4X7TA 3SGDH 4QRSA 3KPMA 2GAZA 1ZANL 1YC7A 3WHXB 2DI7A 5DRXA 5EA0H 3CLEH 3IDYB 5DMKB 1FZOA 3B9KA 4NWTH 2F19L 4NDMB 4IIQB 4Q9RH 3T0ED 4NQDB 1VFMA 2VLKD 3D18B 4NN6C 3B83A 5JOFB 4GG6F 4LHJB 1BQHB 3BP7B 4F37K 1HH9A 2FJHA 1OCWH 1P69B 1CD0A 4L8CA 2JJTC 4MCYA 1GC1C 4F7EA 3PP3K 1K8DB 3TPKA 4PG9B 4V1DE 1EUTA 1VEMA 4N1HB 4QRRA 1RUPH 3DTXB 3NACH 3S88H 1JF5A 3ARGA 4POZD 4XH2A 3V4VL 3BN9D 3MNWA 3VI4F 3GSUB 3OG6B 2YWYA 3BP7A 4JKPL 1Y6MR 3KWWB 4PGCA 3B4NA 5E2VH 2X4OB 2J8UB 5DC4B 4KAQH 1JRHI 2RFXB 2HP4A 5IKCA 4MQXC 1S7RA 3QQ3A 4U3XA 4X9IA 3V6FA 1FZJB 4PREA 5IFAL 2X4PA 1IAOA 3WKNA 4JO2H 4LLVA 2R1WB 1JBJA 3A6CL 1MJ7H 2ZCHL 3FQWB 4PS4L 2H6PB 3QQ4A 5I66A 5TH2A 4XTRC 1K4DB 3DX6B 3SDDB 3N50A 4XNZC 4YHNB 5AZ2H 4P46D 1NBZB 3HA0A 2GYSA 1NAML 3CVIL 3GSOB 4LLMA 2COQA 4PB9H 4F7MB 3BO8A 3BFOA 3VG0L 3VRLE 1RZIB 3GBNL 4ODWB 5EU5A 3KYAA 3QEGH 3MBED 3GJEB 4WUKH 4R2GD 1KYOK 2ZOKA 1NPUA 4XVJH 3UPAA 2VE6B 3F12B 2VDOH 1YJDH 3TEUA 1FH5H 2CGRH 2DM2A 1CDYA 2VXTH 2HFEA 4WVRA 3C9NB 2XI9A 3GSXA 5E03A 1KCUL 5T1DH 4I77L 4JKPH 4YXHL 5F9JB 4E41E 5FO8A 1RJYA 1FNGA 1NUDA 4LVNB 5J13B 5SWQB 3ILQC 4O9HL 4XAKE 2Z93A 5CFHA 4DZBB 3WUWB 1Y0LA 3KG5A 1F6AB 3LH2L 3ROLB 5B39B 4JY4B 4ZNEE 3EBAA 2IBZY 4R4FL 1CFNB 3QAZB 5IBUG 1XGUB 1KJMB 2WIMA 3H3PL 5M95B 5F88A 1MCJA 4EDWL 5D1QC 1RJLB 1OCWL 4CVWA 1V3KA 3LPFA 1I9JL 4FTVD 5DJZA 4ZAKA 1G6VK 3VXSB 3HE6A 3B2UC 3STLA 1P7HL 5KAQF 5K9OA 4QXTB 5GSVA 4IMLB 1GYAA 1AXTL 2PO6A 2H2SC 4NKDB 2QADB 1U93A 1NFDA 2DBLH 4G80B 4L4VA 1UYWH 3IVKB 1LQSR 2R1XB 4GS7B 3JWDL 1W72H 4HHAB 3W0WB 2HJFA 3I6LE 4HUWB 3P9LA 1YEFL 3PWNA 2HTKC 5D93C 2WSKA 2F74A 3S37H 4M7JL 4HFWA 1HHHA 2Q86B 2YKLH 4E42B 5K9QG 3FJTA 5GZOC 4HLJA 1JHKH 5DA0B 3SDXE 1QEWA 3MR9A 3L3KA 2HJLA 4GG6A 4LMQE 1X7QA 4K8RC 4OT1H 3QEHB 5DJ0B 4LQ1A 2DOCA 2J8UF 1NSNL 2DN7A 4Q6YA 5HYQB 3G6JA 3RTQC 2AKRB 2BY0A 3VXNB 3RJDA 2BOBA 3KLDA 5L2JA 3VXMB 3FMGL 1U3ZA 1VB9A 4ODHL 1RV6X 2X10A 1CCZA 2X7LA 5ECJE 1UWXH 3Q1SH 3QUYC 2HVKA 2AK4B 4HKJB 3P3YA 3GMRA 2R0ZH 5I2IA 1MCFA 4LPCA 5HHVH 3RWJB 4YFLI 4NZUH 1CXIA 3P9MB 3BWUC 5FV2A 5TQ0H 4LSPL 5J1SC 1WBXB 4V1DB 3T0WA 4PB0H 3D0LB 4OZGA 4UT6H 5DC0A 3RWJA 4MJID 4OSUH 2ZCLL 5DQDH 3V6ZA 1A1NB 2A6JB 1MHHB 5DI8A 4R96A 4JRYE 1SM3H 2BVTA 2EH8L 3WNKA 3IKCA 4Y88A 2XRAH 4PJ7B 3HKFA 4U1LB 2BOBB 5IBTH 4MXQD 1YEDB 4L9DA 4YXKH 1T83A 4GRWH 4X7EC 5D96C 4G7YH 4ETYA 2OCFD 4M5ZH 1MFCH 1HILA 5CBAA 1RHHB 3F5WB 4WI2A 4PJHF 3GUTA 3EYQD 4X9HA 3B2VL 5C9KA 5C08E 4LMQI 1EXUB 4P57B 4JPWL 2PTUA 3U46B 2DQHH 3K46A 1J0HA 2VKXA 5MP6H 4G8IA 4N8CL 3WIFA 4Z7OF 4BUHA 4F9LA 3LDBB 2NY4C 2I60H 2R1XA 3DRTA 4OLXL 5CILL 5GGVL 4MNQA 1OTTC 4FQCH 2GTWA 3L5IA 4K8RH 3OAYH 3FRUB 1GXEA 4LSTH 1JZ8A 4QHKJ 3KLAA 3I84A 3HE6C 5I15H 2YD8A 4PJEF 1B3JA 3STLB 5JORA 2X5PA 2X1XR 1UJTA 3BQUD 2XOTA 4L9LB 3LKRA 5D7IF 3VFMB 2ZZUT 4ZUSB 1X4YA 1ZLUH 1BD2E 3MXWH 2VZVA 2J4WL 2APBA 3ZLQC 2ZJSH 3DYOA 2OQJA 4M4PA 4AH2B 4BZ2H 1CT8A 4OFYD 3SO5A 5BXFB 3BISA 3CXHK 4U6XA 4L1HA 1UM4H 1GJIA 3MA9L 1OP3H 5HVHB 5MENB 3DI3B 2PF6A 1BWMA 3P9WB 4MDJA 4YDVB 1EAJA 1BZ7A 1PGRB 1DBBH 1MCOH 5FCSH 5GJSH 3BPOC 3V6OC 1CLYH 3ZDZF 1HHKB 1UEMA 4QRPE 5CZXC 4OCMC 3BD5A 1JCKA 5FIEA 3WYRA 4QNPE 3ZYOA 4LEXL 3S35L 3WFHB 5FCUL 2VDRL 1C16A 2F54D 4PJ8C 1PQZB 1OGAB 2ITDA 3WL9A 3NZHH 4Y2OA 3WDHA 4LF3A 2AXGA 4R90L 2DIAA 3ES6A 2NCMA 3RGVD 2X4SA 3C8KA 1OP5K 4LHUB 5IK3A 1TJHL 4NO2B 4E5XA 3P30H 4JPIA 3VDAA 3PWLA 4X4ME 4U6VH 3IS0X 1ZHKA 4FFZH 1BP3B 1PLGL 1OAXH 1JGUH 2E9WA 4YHIB 5D2NC 1JPGA 1PVHA 2WP3O 5MHSD 3EDFA 1R5VA 4XP6H 2W9DL 3ROOA 2FIRT 2FECL 3MRLA 4L5FL 4CRPA 3FQWA 1VACA 3BJLA 1RIUH 4GMTH 3ZE2F 1AFVH 3FKUS 1KIQA 5IQ9A 1D5MA 1RK0A 2CPCA 5EZJB 3QXAB 4K9EL 5FK9A 1MRCL 5TF1H 5BRZB 1G0DA 4ODBD 1JHTB 3MV8D 5IB4A 5J57B 2BNQA 1BFVL 3ELAT 4I0PB 3SDXF 3ZYZA 3U30C 2JELH 3CDGA 4JO3L 4RGMC 1INEH 4S1QL 5CIPB 4XCCL 4ZFOB 5B21A 4DZ8B 4D9QD 4QHLA 3GSUA 1T21A 5GS0C 3MJ8B 2DYPB 4GT7A 2KKQA 1H0DB 2Y23A 3TCLB 4I9WD 8FABB 3EJYC 4JRXD 5IFHH 4ZQKB 1AD0A 4HPYH 4HWBA 1P4BL 2XZCH 2M26A 1F6FB 3HZVB 4ISVB 1I1AA 3PV6A 3TH2T 3MLVL 2Q87A 5L2KB 1DVFA 2FD6H 4H88L 1SJXA 4M93B 4PG2A 1J18A 3EYSL 4PJDB 1OAZH 5I17B 4J3UA 5ICZB 3V4PH 1NFIA 4HBQA 3BGFB 4K23L 4JB9H 4JVWA 5JOFA 3FT4A 4KZEL 3VXRE 3T3MF 4TQEL 1A14L 1AE6L 5DMKA 3GMMB 4JZJC 3LKOA 2E7BA 5DDHB 5HHXH 3EO1B 4CN1A 1N7MH 4YK4B 1KCRH 3GSNL 1O0VA 2V9TA 2DWEB 4QHLB 5CUSH 4M43L 1H3PL 3P0YH 3QI9D 2NY0B 5HGDB 1S7XA 4G6AC 3E3QE 3ARBA 1B6UA 1AIFB 2CK0L 4YIQB 2FEEL 5EO9B 3SO3C 4P9MH 1T2XA 1R0AL 1MY7A 4M00A 4CVXB 5CLWA 4JHZA 4L3ED 5F7NC 5BRZA 1UM5H 4WHTA 4UIMA 5DO2C 1UC6A 1D5MB 4DW2L 1VADA 5L2KE 3AB0B 4WO4A 3QI9C 4XZUA 1TQBB 2P46B 4IRZL 1LDPL 2FNBA 2NLJB 5MI0C 4F3FB 2PR4H 1QQDA 1MAML 5E9DA 4WY7L 4KDTA 4NO5A 4IBLT 1UZ8A 3K4DA 5F1IB 1HI6B 4JFEE 1K6QH 1TQBC 1KLUA 4U1IB 3W2DH 1W0VA 3FRPA 4X6CA 2YC1B 3QNXB 4X6DF 3V8OA 3QQ9D 4Y4FB 2EDYA 4K2UH 4NO2A 1FAKT 5D7IE 3RAJH 1ZVSB 3OKDB 3TYFB 2G2RA 2B20A 4ORGB 3RGVB 5SWSE 2CLVA 3ZKMD 1NANH 4H0HB 2GT9B 5C71A 1EBAA 1OOAA 3RAJL 2B2XH 3PL6A 2OI9B 3O41A 4BELD 4I18C 25C8H 3BAEL 1NFKA 1XGYH 4YK4C 5C0FA 3GB7A 3GI8L 4WGWB 1V3JA 4UIMB 4U6HA 1U8MA 4R26H 3T2PA 5A2KH 4ZD3H 2DM4A 1YEIL 1QPXA 4WEUD 5DUBB 2EDNA 3RPIA 2BJMH 3LQZB 4F8TA 4WU5A 3EKCA 5HGDA 5C6WH 1MCPL 4MWFB 3VFPB 4LCWB 2ZP0T 2XXMB 4L4TD 4FMKA 4FA8A 1KPRA 1UM5L 4IRJA 5HI5C 1RZ8A 2X4UB 1A6ZA 4YE4H 4P9ML 3ARDA 5JPNB 4HD9A 2R23A 1JK8B 1NAMA 4KV5F 1H3PH 3P0YL 4QRTB 4U0QB 2B1HH 3H2WA 4HIEB 1N7ML 2L7UA 3FRUA 3JWOH 1X4ZA 3X12B 4HKZA 5D7LB 32C2B 4F9PC 3TT1H 2YEZB 1I8IB 4UTBL 5I30H 2Q76B 5E8PA 4RGNE 2CR6A 2NMSA 5HDLA 3VW3H 4GAJL 4HH8A 1OQOA 1S7WB 1OARH 4XXDA 1HKLH 4OIIH 4YEEA 1FDLL 2ED8A 4AZ8A 4JY6A 4ESKA 4DUWA 3V4PL 4ZFOA 2AEIT 1OAZL 3G08B 1NGZB 4W70A 1LP9A 3E8UL 3QEQB 3TCXA 2DLGA 4QRQB 2J5LB 3LZFH 3MRKA 1FVEA 4WEMB 1NDGA 4PGDA 1TJIH 3MV8B 4Z0XB 2JCCA 3D0VA 1RHHA 2HT2C 2M1KA 4NRYA 4GQ9L 1XEDA 1J8KA 3OAYK 4YDJA 4OF5A 4YFDB 5IW3A 1PJ9A 2VZSA 4J6RL 4HJGB 3FRPG 5DMGC 5E2UH 3FCTB 5I1GL 4S1QH 2V2TA 4ODUA 4LKCB 2IH1A 2Y06H 5FUZL 1AP2B 2JELL 4M7KH 2X89D 4B53A 5KN5B 1MWAH 2BVQB 4RFEA 4O4YH 2IPKB 2GITB 2BMKA 5JLZA 1JYNA 3LIZL 1NBYA 4LCUB 5DUML 5LAXB 2X1PA 1QZ1A 1EHAA 4PUBL 3T3ME 3MXVL 1ZKAA 3QEQE 5I2IB 5M7QA 2JCCB 3D0VB 3UZEA 4EBQL 1NDGB 4KRLB 4P9HC 4WFHD 1CDBA 5EUKB 2FHCA 3HI1A 4QRQA 2A83A 4J3WA 3MV9A 3VG9B 1CLZL 1UM6H 4MD0B 1FNFA 2FECI 5DJYA 4MAYB 2YUWA 4XVTH 4Z77A 3ARFA 4LGSB 2NY6D 1GVIA 1V5JA 5FUCC 1CF8L 3QIWA 3RVTC 1TJHH 2V9RA 2CIIA 2EKSB 4G5ZL 4OCXL 4XNYL 3BXNA 5LQBH 4TNVF 2HJLB 4UINH 2XFXB 1CN4A 4X9BA 4R90H 2IADB 3BGMB 2OZ4H 3BSZH 5C0EB 1CI5A 1GGCL 5JOEA 3MUGA 2EDXA 3INUL 4MQSB 4N8PA 2HT3C 3TVMC 1VDGA 4KROD 1CGXA 4APQA 4LRNH 3RVXC 3ZHDA 3IDJA 4EVNA 1KC5H 5FM5M 3MREB 4Y5YA 5EN2B 5IV2A 5F1KC 2X4UA 5J3HC 3O2WL 4OD3L 4L9LA 2FBOJ 2DYPD 1SBSH 4RMRA 4KKCD 2A9NL 4DN4H 5GRXG 1JGVL 2CJUL 4ZAKB 3C09C 4PGBA 4BZ2L 3I02A 4FTVB 1M71A 5ISZB 3PUCA 2P7TA 3NFPB 3VI4E 3T8XA 5ESVA 4OCYH 4NNYB 4XRCB 4RMSA 4R3SA 4YQXH 1CYGA 1J7VR 4XB8A 5D96B 5DD3H 4G8IB 1S9VA 3ROLA 3IFLH 2XZAH 4DZBA 3ZTJH 1T7WA 5SWQA 3CVHL 1CGYA 3LQAH 4M7LL 1WZ1L 2GQHA 4UNVA 4YBHA 4XNQB 5L6YL 4OLXH 1EEYA 1BAFL 3SKOA 2G60H 2JCCE 3T2OA 5J11B 2HFEB 1CU4H 1OW0C 2ATPA 4PJ7A 4U1LA 3S3SA 1H3TA 2DQHL 1WBZA 1FZKB 3QUYB 3F12A 2KL6A 3V6ZB 3U6RA 4F3FA 1UA6L 4KV5E 2F5BL 5LGJA 4M5ZL 2W65B 4G7YL 4YXKL 1F4AA 4HUVB 4I4WA 4D9LH 5ADOH 4F7MA 4MLSA 4I3SL 3W11C 1BD2A 2P4AB 3QUZB 5TH2B 2R0LH 1YEJH 1H3XA 2ZCLH 1A7PL 1EDQA 4XCFH 1G7JB 1VGEH 1T04A 5I74B 43C9A 2D7TH 5D93B 5ESQA 4OCWH 4LLVB 3GO1L 4I13B 4ZUTB 4DVRH 4K7FB 5TQ0L 1G1CA 4NZUL 4R4ND 3UJJH 4QTHA 5HYQA 3G6DL 5AG9A 7FABL 1EHXA 1NCUA 1FZJA 3JTSB 2DQUH 2XY2A 3VFNA 3WFCH 2QADC 2OX5A 4NUGH 2AJVH 3OKOA 4EUPB 4DVRL 1JWUB 2FYYA 5DMYA 2UUDK 3S37X 3W0WD 1FSKB 1FFOB 2V17L 4YHLL 4PJDA 5J6HA 4KUCD 4XCFL 3GHEL 1W72A 2ZUXA 1E6OL 2VL5A 1G7QB 3DJ9A 3HUJE 3EJZD 4MCYB 2W59A 5CBEA 2J12B 1BQUA 5JW4R 1T21B 2YD9A 4WWKA 3VFOB 1GL4B 5F3BB 3WFDH 3T0EB 3JWDH 5ID0B 4J4PC 4X6DB 4Q2ZB 4G8GE 3HTLX 1TZIA 3CDGB 4DEPC 4HK0A 4Q6IB 4NYLA 2BNQB 4LSRH 5IBUB 5KSBA 4ODSL 5HHPA 1XGUA 4FQ2H 1T0PB 3LPWA 5BV7B 1YPZE 3ETBF 3Q5YA 5T5FH 2CDEA 1BAFH 1N0LA 3LCYA 4HG4J 1D7FA 3G5XA 4MHHG 3T65B 3BN9C 4F58L 5E4EC 3UPRB 1QBML 2V5TA 4PJ5B 4XGZB 4HGWB 4B0MM 3NPZB 4D0DA 5SX4H 3MLRH 1DANU 4YC2B 3AMKA 4KK6D 3BH9A 5F70A 3RU8H 3GSVA 3MRMB 3Q3GB 3VDBA 3K1KC 1UB6B 4LHUA 4EIZC 3RWEB 1HHGA 1AXIB 5DYOB 1XCTA 2B0SL 4LF3B 4TTDD 1ADQH 3EYUH 3AS3A 1RZJH 3CSYB 2CRZA 3TV3H 4X6EB 4DN4L 5KTEH 5TF0A 4KMTL 2W38A 4OD3H 5AAWA 1BF8A 4N5UA 3V7AG 3BYTA 4GFTB 1KC5L 1MPAH 3QIBB 3L3HA 1OAUH 4LRNL 1YYLL 2AQ2A 1AKJA 3SE3C 1FYTA 2BNRD 1QSVA 2EDDA 5DUPL 5ALBL 2V7NA 2Q8BH 5JOPE 3VG0H 1ODAA 4PB9L 4F37F 2OZ4L 3BSZL 2CUIA 1ZOXA 4P9HH 3V6FB 3W9DB 5H8DA 1DN0B 1RZGB 3B9KC 4G5ZH 4PS4H 5C0BD 1FIGL 5IBLD 2I9TA 1F4XH 1QSEA 3KWWA 2XN9D 4JN2A 4L3AA 3L7EB 3OB8A 2AEPH 4D8PA 5I1LB 3CZJA 1Q9WA 2J6EH 4OAWB 1AQDB 1CLZH 2YD2A 4JKLA 4QRRB 2IBZX 1SYVB 4Y4FC 1DEEB 3ALPA 3UDWC 4ERSL 2YRZA 4GW5A 4KAQL 5DRWB 4X7CC 5JW5B 5JTWA 1DQDH 5E4IA 1B6DA 3P4OB 2VLLA 2CH8A 3AY4C 1BQHA 1DLHA 5FUOH 3DUSB 2VLKB 1EK3A 2LU4A 5HHOB 1GHFL 3LEXA 1A9EA 4X9FA 5MI0B 3EHBD 1NMAH 4NM8L 4OGZA 1FZOB 3HZKB 4CDHA 4U1SB 3QDGE 4PJFF 3PDDA 4W81A 2Y06L 3GUTB 3I6KB 2NY2C 1YEGL 3K7UA 2WWMD 2Z8WC 5AYUL 4QY8B 2GFBA 4F7PB 4MA1C 1TTFA 1VFAB 5FB8A 3RVWD 2C4FT 3ZDZE 4D0BB 4YUEH 3WJJA 1NGWA 4I0KA 2OL3B 1CVRA 1MLCA 5I76A 5HI4C 2DQFA 1KNOA 3S36H 4KZDL 2BC4B 2K3TA 4KRPC 1E4XL 3G6JF 5I1DB 5HDQH 3UYPA 5EG6C 2NW3B 2PXYD 5F93C 3IDMA 1CXKA 2QHRL 3GMOB 1TNMA 4Z95H 5DQ9A 4QRPA 4HBCH 5B3NA 3PWPA 3WIIH 5KG9A 3HR5B 2X4NB 4XPAL 5I1JH 1JP5A 2NTFB 1G9EA 4UTBH 4F2MB 3MCKA 3MYJA 4AEHL 3OV6A 2AK4A 4HUXB 4NKIH 5IHUL 4I48B 5F7WC 2LAGB 2OTWB 3FTGB 2N1KA 1HINH 3MRGB 2X7LB 5MEQA 4O2CA 3JWOL 1I7RA 4PJCA 5DJDB 4IJ3C 5T1LB 1XH3A 2B1HL 5JNYB 1YN6B 1HXYB 5DQJB 5KBNC 1KJVA 1PEZA 1AGEA 1HSBA 1BM3L 2W91A 4WI9A 1XF4B 1OL0A 4S2SA 3C60A 4PJ9A 5FYJD 4GSDL 2P5WB 1AQKH 4JQVC 1F8TH 4HT1L 4FQPA 2CRMA 4JEGB 5DJXB 2P43B 1J8HA 1TCMA 3WSQL 5FECB 5C07D 4XC3H 4QHUB 2R2CA 1JPSL 3KHQA 4MDIA 3GMQB 2JB6A 2R39A 4Q58C 1MCHA 2HJFB 1IL1A 4U2YA 5CEXA 3IVKA 3RUGA 1Q9LB 1Q9LA 2XT1B 3TH3T 1IGIL 5DMGD 5CEXB 4R26L 2ZOLA 5T3XE 4XCYB 1FHGA 3N06B 4FFYH 4BK4A 3ARSA 3CVHB 3ULUC 1FNSH 4XBPA 2DIBA 4ZNCD