2ZCLH

Crystal structure of human prostate specific antigen complexed with an activating antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
QVQLQQSGDDLVKPGASVKLSCKASGYTFTTYYINWMRQRPGQGLEWIGRIAPASGTTYSSEMFKDKATLTVDTSSNTAYIQLSSLSSEDSAVYFCARADYGFNSGEAMDYWGQGTSVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDCGCKPCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostate-specific antigen
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2007-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zclH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zclH02
3G6DL 1UCBL 3KLDA 1I4FA 2FWOA 3O3DA 3BGMA 2GSGB 1OAUL 3O4LA 2GJZA 4MNGE 3MMEA 2OP4L 1A7RH 5EN2B 5BZDB 2XZCH 2HJLB 2YD4A 1FPTH 2Y07L 4G8EA 2HH0H 5DLMH 3WS3B 2AQ1A 5MEPB 4G6FD 3G5XB 1DLFH 1U8QA 3RDTB 4MJID 2IF7A 5HHPA 4K3HA 4D0CB 2KKQA 1I3VA 5FA3B 4GAJH 4K8RH 1PAMA 4YHZL 5J1AB 2C3GA 2B4CH 4JGMA 4IEFB 3R1GH 4Q97A 3I84A 4MD4B 3X17A 3I02B 1AJ7H 2YRZA 3VWJC 4HUXA 1NC2B 2QKIB 3QCVH 1V3LA 3ROLA 1HYSD 1GIGH 2P24A 3DVGA 1KLGB 1JRHL 4JQIH 1I9IL 3Q5OA 4GMSL 1YEKL 4BQ9A 4FFYL 5KSBE 1T4KB 4RA0C 1T89A 3EOTL 5HGBB 4XBGA 3BE1H 1TQBB 5JLZB 4C54A 4ZO9A 3U9UB 4JG1L 1R0AL 3VU2A 3GMQA 4HFUL 3EO0A 3KPPB 4QHUA 1ZA3B 4HGKC 4G6JH 1L0QA 3RWCB 1U8LB 2RFXA 1OB1A 2VQUA 2Y72A 4NRZB 4X0KB 2IH3B 3KDMA 5T5NF 2VLJE 5TQ2H 3B2VL 3MJ8A 4HIJA 2VRAA 4Y4FB 1GZQB 1YEIL 3F7QA 5DXWA 4ETQA 3EFFB 5EU7C 3STBA 1PSKH 4PJAF 3T1FB 2HH0L 2VH5H 3BIKA 4ZQKB 4EN3C 4JZJC 4ZMAT 3MNWA 4U1LB 3TH4T 5IT2L 1DLFL 1KIPB 1JNNL 3D39E 2VZ3A 2ZCLL 4D94A 1T22A 3PWUB 2ZOLB 5IK3B 4JFED 1MFDH 1F2XK 2J5LC 4CMHC 2QQKL 2NY3D 3QIBD 3PUCA 5GGVY 1F6AB 4OLVH 3KXFA 3ARDD 2ADGA 4WIQA 2VNCA 2MKWA 3DUUA 3IJSB 4N8CH 4OQTA 3J8F7 4WWKD 4EVNA 1ZWIB 3Q3GA 2Q86A 2X70A 3GMMB 4OUOA 3FRUB 3WJJA 1IGFH 5IMKB 3ZHDA 2WWKO 1QVOA 4TTDC 5CIPB 5HHMB 4QRUA 4U6HB 3I50L 4UDUB 3UPCA 2MNUA 4XC3L 2CH8A 3GO1H 4LPXA 4YWGL 2C7UA 5HYJE 3QHFL 2ENSA 5FGCB 1OPGH 2B1HL 5GS0H 4X98B 4HWZB 3D18B 3EYOB 3SDAA 4WJ5A 3QIUD 5DJ2B 5SWSD 4DOHE 2XKSA 4G6JL 4QF1A 4A2LA 4PJIE 1CICA 2XWJB 3IJYA 4PLKD 2BMKB 3S36X 3JV0A 4AZ8A 4XX1G 2XFXB 3BDYH 3RAJH 3WDHA 2ZUUA 1JGUL 1E4JA 1UH3A 3OKKB 3SGEH 4JY6B 3VXQA 1RAMA 4ZUUA 4NC1C 4MNHB 4KZEH 3N50A 5DEGB 4PJ5D 4Z7UB 1D5IL 1QFWL 4C4KO 1SVCP 3HRPA 2PF6A 5HHXL 4G8IA 3EGSB 1G7LA 3MUGA 4G8GB 3ZE0F 3GRWA 1DQMH 5DD0H 1TCRB 3EAKA 4HK3N 3O6FA 5C0BD 2OK0H 5DJCB 3LIZH 3CFEA 5ANMB 4QT5A 5FDWB 5T3XE 1F4AA 4NC0B 4N8CL 1EX0A 1FL3A 2VLKB 1NBVL 2APWA 4HF5H 3NFPA 3CCHB 4FFWD 2Y5TB 1IAMA 2X41A 4Y4FC 1L0XA 3O2DL 2BNQE 3VXPB 4LSDA 2V5MA 5CZXC 5KG9B 1ULVA 2UV3A 3GMPB 5EOCJ 2QSTA 4KKLC 3DJ9A 3SJVD 4U3XA 2OZ4L 3SEPA 4PGEB 3LB6D 4JANA 5E99L 5ISZA 3TNNA 1FNSL 1A4JB 1AP2B 3CH8A 4MYWB 3NGBB 3DHJA 3RVXC 1CFTA 3GJFB 3ILQC 3ARQA 4ZD3H 2RJMA 4ODWB 4NO0A 1DDHB 3AXLB 4XP1L 4KDVA 3U4BL 4Z78A 2WINA 4MAYB 1QBML 3ECBA 4UTBH 1BF2A 3BD3A 1I7TB 1NCTA 1S5HB 4GXUM 2A74A 1TVHB 3V5DB 3BQUD 3TT1H 2BVOA 3WNOA 4MNQE 4OF6A 4HXAH 3BZFA 4PV9B 4GKSB 5CSZB 5BOPA 2BVQA 1WQVT 3VFVB 2P5EE 3RGVB 3W82A 5F7UA 1JMXA 1JGEB 2BHUA 2W9LA 4YHMH 5I76B 3P9MA 2YS4A 2FZ3A 3UTSB 1NUGA 4MA8H 5J06A 3QFJA 5C0JA 2EIBA 1ZSDA 4UBDD 5IVZA 2GJ6D 1IGML 2B1AL 4LARL 3D0VA 3BKJH 2FX9H 3LEYL 4O51A 3DSFH 2EYRA 2OJEA 3OZ9H 4RBPK 3W5NA 1B0RB 4NWUL 4ZTOL 1WBZA 2VB5A 4PJCA 1KEMH 3MRLB 3NIGE 4L29A 3TIDB 2ZPKH 3EYQC 4GUPA 3E8UH 1OM3H 1C08B 3BN9C 1NJ9B 3KPOB 4JAMA 1NFIA 2YA0A 3UC0L 5BVPH 5F1NA 1JI1A 5E2TL 4JN1H 3GSQA 4GKZA 4BK4A 1KB5A 4ENEC 1BFOA 4QWWC 4YDVB 1EEYB 1JPTL 4P3CL 3GKWL 3LVEA 3ARGC 4NRXA 4NPYA 4WCYH 3TBWB 4WI6A 5F96H 2R0KH 5A2JH 2VLRE 1AY1H 3WV0A 2D31A 4UTBL 2BDNH 1BEYH 5CWSA 4IRSA 4X9FA 5IW3A 2YSSA 3SKUD 4ELMF 1BAFH 1HWHB 2VN7A 2DKMA 1OAYL 2D0FA 5EU3B 3SQBA 1UA6H 5F7DB 1J11A 4JO2H 3RVTC 3NGBC 1QLEH 1ZKAA 3OJVC 1U41A 4X6FA 4JZOB 4XBEH 2NYYD 3BZ4A 1YPZB 3MRDA 4Z7WA 2GITB 3RJDA 3SDDA 4KK9C 4X7FC 4YBQC 3LCYA 3V0WH 4GQ9H 4AIZB 1NEUA 1W72H 1MFCL 5EZIH 3LQAH 1U0QA 3BKJL 1A6ZA 1MFAH 3DSFL 3ME0A 4WGWB 2AEPL 2HLAA 4YHNB 4KPHL 2FL5B 4L8DB 4PRBA 4S1QL 5DYOA 4HLZG 3IAGC 3M8OL 4OKVA 3S3SA 3CZJA 4JM4H 1ES0B 3O2WH 2X4TB 5BVPL 1MHPH 2G5RA 2Z8VC 3RGVC 4G5ZL 2P8LB 3QPXL 1BVLB 1TQCB 1UJTA 4JN1L 3R06B 1RK1B 3T2PA 4X5XB 3B3IA 1IGYA 4R0LB 1KB9J 1RZIA 4PJXB 3T0DA 3TVMA 1CL7H 2H1PH 2Y25A 4JKPL 4L3EB 5GRJH 4I1NB 4EDXA 4PG2C 5E8EA 3NZ8A 3PE9A 4OAWA 1MEXL 1GSMA 4N68A 2KBGA 1CLOL 5DQDL 4LLQA 3LS4L 3TBSA 4YZFE 3L3JB 3ZDYF 5DFVD 5D70L 3V9FA 1PX4A 4FHBD 5F7EL 3TYFB 4MDIB 3G6JF 5F1KC 1R5VA 3PG2A 4K3GA 2APFA 5HHVH 4EIGB 4APQA 1VGEH 1X5HA 1X4ZA 1OSPH 3F12B 4YDIL 1C12B 1QFPA 4DFHA 3JWOL 3VFSB 2VDKH 1H8OA 4LLVA 4XBEL 5F6HI 2YUVA 4OZIE 1LQSR 5C0CE 1FYTA 1ZHLB 4BSWB 1E28A 1EDQA 2XA3A 2YPVL 1MCDA 4OD2B 4XVJL 4JFYB 4OQTL 4TPRH 5ACZA 5C09A 4JFQB 5E1AB 3QQ9C 4LSSL 2F54A 3VG9C 1XGQB 3DRTB 1C5CL 2CO6B 4MHHI 5I8OH 4Q9QL 1IM3A 2D7OA 1Z9SA 2JJTA 1NAKH 5MEOB 4YGAB 5IBTH 2EDYA 4ZFFB 2YD6A 3DX7B 2E5EA 4FQJH 1SJHB 3BESR 1N4XH 2JLLA 4A2MA 4MD5A 3SKNB 5D71H 2DQUH 3ARRA 3CIQA 2XN9B 4PJ8D 4M5ZL 5HYSB 4PJ7F 3MXWH 3I9GH 4XT1C 3KYMB 3QDJE 4PP2A 1L0YA 4ODHL 4D3CH 1A7OH 3UPRB 3HNVH 1MRDL 4K3DL 4LOUC 3D6GA 1VHPA 4R26H 3W9EB 9CGTA 1KJVB 3HNTL 1ZLVH 2VXVH 4LSVH 1D5XA 4PJAB 5JDSA 2G60L 2PCPA 1DLHB 3MRJA 3O45B 3QFDB 3RVVC 43C9A 3MRCA 4KDWA 5DO2C 3L7FA 3RWGB 4HHAA 5BXFB 3L3GB 2NX5E 4OZHF 4HCRA 1LEKB 1YEHH 1OAXH 5TH2A 3GRWL 2QL1A 2X40A 4PBWD 5DMGC 3OR7A 2NY4B 5FECB 1BMGA 1TVBB 3CDYA 4ESKA 2BY3A 3L1OH 4Z76A 4BFIA 5L6YH 3V4PH 1YJDH 3IXTB 2PO6B 3QYCA 1RK0A 4OJFH 5IVNA 2CQVA 3JV5A 4F33A 4F7PA 3WIIL 3T2NH 3D2UB 2WV3A 1BM3H 3FFCB 1ZVSA 2F53A 1NCAL 3ULUH 1VFBB 4FG6D 5GGRY 4K8RD 4I3SL 3QEQD 4EI5B 1XF1A 2I5YL 3TEUA 3M17A 3V79C 1FGNH 5D7JB 5KANG 2ED7A 4YNYA 3MOAL 3QEGL 4U1GB 5EO9B 3MLXH 4HKXB 1ZV5A 3U0PA 4JPIB 3KHOA 4OZFB 2PYED 1OGAA 3C5ZD 4C56B 4LKCB 1FP5A 2XNAA 4P59L 2XZZA 3OF6A 2WBWB 4D3CL 4PJFF 4LIQH 3G5VA 3L3OA 2P42B 3P73B 3NAAL 4JRXA 5IB5B 5IQ9B 4NWTH 4E0RA 1PKQA 4LSVL 3FHAA 1FRGH 4QYOA 4LGRB 3QNYB 2I9TB 2P8PA 5KW9H 4XCFH 4NJAH 1I3GH 4I0PA 5FCSH 2EICA 2IWGA 2OJZH 3QJHA 4HLZH 5IEHA 5FHAH 3B9VA 1KSRA 4ZUTB 4P2OA 4LU5H 3KWWB 3QUYA 5I1AB 2PYFB 4K94H 4NUJA 1I8IA 3L1OL 4ZOAA 1RUKL 5IFJB 1XCTA 1JRHI 4P4KB 4LHUD 4FQQB 4RQQB 3OJMB 1CS6A 5CUSH 4P9HC 3UDWA 1U8NB 4HKJA 3K3QA 4J3WA 1QFWM 3S5LB 1I7UB 1WUNT 3EYFA 5C0EB 3ULSA 1CFQA 4DKDC 3GSUB 2FJGB 3OL2A 1KB5L 3IU3B 1KEGH 4PJ5E 4AG4H 2HVJB 3IXAA 3EHBD 3A0OA 2EDTA 3W11D 3KPSA 3BXNA 2DQCH 2H32B 2NY4C 5D9SA 4Q6IB 4HAFA 2YMXL 7FABH 3LAFA 4HIXH 5EU5B 2BP3A 4IRZL 4IMLA 2PO6C 4K23L 2BFVH 3WXWH 3MX0A 4NQXB 3BIBX 4K3EH 2NY1C 5MP6L 4BZ1H 5GS0D 3MR9A 2XIDA 1D7FA 3PV6A 1G7QB 1I3RB 1IM9D 1FRGL 1CDJA 5D6DA 5DHXB 3VA2C 1TXKA 3SJVE 4ZUVB 4XCFL 3P3YA 3MLZH 1M7DB 5T33L 4WHCA 3ARBD 4NGHH 4U1GC 1F8TL 2OJZL 2WP3O 3K4ZA 1U93B 1Y18B 3QDME 4N0UA 5CJXA 4OLYL 2CKBH 5ICXA 3NCYP 3V4VH 4PJDF 2H45A 1NSNL 2QV2A 3LV3B 2ZSWB 2Q7NA 2Y6SD 5GGRA 4JZNA 1FV1A 3ARXA 2EE2A 4RGOH 1FG9C 1HOCB 2HVKB 1B4JH 2IG2L 1CDIA 3UTTA 4PJ9A 3FKUS 2OSLA 5CEXA 3IDJA 3MA7A 2AJ3A 3VFRB 1AR1D 3O3BA 1VKXA 4HG4J 4U49A 2NW2A 2R9HC 2V17H 3PJSA 1CR9H 4XVTL 3FJTA 3WNKA 1EEUA 1LO2H 3OXSA 3LEXB 3LKRA 3WDIA 3BRDA 1UM4L 1AGFA 1I8KA 3KPRB 1G6RA 2H2PD 1EAPA 1K2DB 2AV1B 5E9DD 4LSTH 4OB5L 4YO0B 4P4KC 1NC4D 1QSEB 4LAQL 2GJ6E 4WENB 2D7QA 5JORA 3ZE2E 3T0XA 5I1JL 1PG7X 1IQDB 1FFOA 1EJ6A 2EKSB 5KN5B 4JO1L 4QRSB 3GBNH 2W92A 4ELMB 3WFDL 1KN2L 3K81A 1HWGB 5F3BB 2X4RB 1U8OA 5AEAA 5I1CH 3HFML 1IBGL 4XVSH 1W2KT 3I3EA 2RAMA 2ZUVA 5CJOL 1NCCL 1JHKL 4NGHL 5B8CA 5GZOD 4XTRD 4Q6IC 2Q8BL 4DN3H 2FSEB 1SYSA 5IJKA 3FB5B 2PW1A 3FO1A 2CKBL 3RWJB 4AT6B 1RI8A 1T7YA 3V8OA 4YXKH 2DD8L 4YHPB 3OKMA 5K59F 2C4XA 3L95B 1QQDB 1C5BL 2EXWC 3GMNA 4Q58C 1UCTA 4JKKA 4MD0B 1QRND 1QLRA 1ZGLP 5L7XH 1SHMA 1LP9E 3VG0H 1H8SA 2PXYA 3VA6A 3S88L 4HPOH 5F8QC 1MPAL 4QGTA 5IMOB 2VLLB 4WI3A 4XH2B 4LRIC 2DWEB 1UKTA 1YA5A 3IFLH 1MCSA 1RJCA 3QEUA 5FM8A 4MB5A 1PJ9A 4WHTA 1MIEH 1KJ2B 1CF8L 1WFOA 4JGUA 4TQEL 1XCQB 2HFGH 4U6YB 3WKMH 4N8VG 1CD8A 4O02H 4OIIL 1ZHKB 1QSZA 1MAJA 5KS9A 1Z9LA 2C5DC 2VABA 3GB7B 3PDOB 3OWEA 4CVXB 2WSKA 4Y2OA 1IARB 2BCKB 1XF3B 3U0TB 3BEWA 2B2XL 5B3NA 2KZWA 1R24B 2PNDA 2QR0B 2DQFA 5IW6B 2R2HB 2ID5A 3G6JB 1A02N 5L9DH 1F13A 2IALA 1XGTB 5ACMA 5L2KE 2APVA 1J5OH 3U36A 4WHDA 4XVSL 3BN3B 4X6CF 3EJYC 3H9SB 2ADJA 3S3JA 1M4KA 5I9QB 1P7QB 3J7HA 3ULVC 4HCRL 1MAMH 1YUHB 1RIUH 1S7QA 1NFDE 5CBAA 2DOCA 5ESVA 1QLFB 3FO9B 4WWID 4K9EC 1DVFB 1UQSA 3C08L 4OCRL 3PWVB 5CP3A 4Z5RA 1IKFH 3IJHA 4FXGA 5GZND 4HC1H 2J88H 2H9GA 3P0VH 3VWJA 1YY9D 5MENA 5EPMA 5TE4L 2A73A 3EOBA 4OFPA 3UYPA 3NN8B 1JNLH 3H7BA 1C7SA 1FNHA 3T77A 1QSFD 1X9QA 2AEWA 2QSVA 1KLUA 2EDFA 5F7YC 3QUZA 3TA3D 3H0TB 1A4KA 5I1EH 2O61B 2HFGL 4Z8FH 4LQFH 2QJDA 4JY5L 5C8JA 4I0CC 1HILB 3QUMH 2RR3A 6FABH 3S34H 5CJ8A 2JE8A 5HHQB 4PJ7B 4L4JA 2D7TL 5D1ZB 2JELL 4POYA 2OMNA 4GMTH 2CUHA 2RGSA 3QAZB 4MCYA 3QIWC 1GC1H 1R3KA 3SKOB 4NO5A 3SDAD 5EB9A 1WT5C 4EN3A 3V6FB 3GM8A 1A3RL 4JZJA 1I9JH 3IGAA 5E1HB 1NGXA 4J3SA 5TQ0L 1QOKA 1MLBA 1ZK9A 4OZHB 5KSAD 3CC5A 3MCLL 1RUQL 4X9IA 1WAAA 5D5MA 2VDOH 4HKZB 4ODTL 4ZUWA 3KPTA 1Y0LB 1AIFB 2J88L 3GSVB 4K7PY 2W9DH 1MJ8L 2H3NB 4KKBC 1LK3L 4YQXH 5BZDA 3U6RB 2OXGA 1PQZB 2HJLA 3NABL 2NXZB 4RZCA 1Z9MA 4X7TB 4E42B 1DQDH 4J6RH 1KPVB 5MEPA 5D2LA 4PTUB 4ZPTB 1FCGA 4JPWL 5I9QC 1S9WA 3R0MA 4LSPH 3DV4B 4WU5B 4R90H 5I1EL 1HZHH 1SYVB 4NHUB 3KHQA 2XZQL 4ZFOB 4XVUD 1M05B 4XMPH 5TGBB 4XAWH 1DVFC 4ZAKC 2Y7QB 4ZS6C 2WBJB 4PYGA 1CDGA 1CK0L 5HGAB 6FABL 1ZANL 4NKQB 1QEWB 1UVQA 1X4YA 1N0XL 1A6VH 5I71B 1KJ3H 2QKIA 4UT9L 2AQ3A 1U3YA 5I1GL 5I8KL 4G80B 1AGDA 3LH2H 3HI6L 4X80L 4ZNEE 1H3GA 1T6VN 2CKNA 2VMFA 1L6XA 2P48B 1T4KA 4WDIB 4UNVA 5HGBA 4HGWB 3BPLB 3PQYD 2X9WA 3U9UA 2W07A 4NZRH 1N26A 1NUDA 3PGFH 4OCYL 3KPPA 5C08E 5D72H 2CR3A 1ZA3A 5C2UB 4M7ZC 4H5SB 4PJBF 1LK2B 1RURL 2IADB 1EJOH 3ZYOA 4Y5XB 1BX2B 1IFHH 1DEEB 4P46C 1BIIB 3HC4H 4CVZB 4XP5L 1A7NH 3NFSL 4NRZA 4X0KA 4OF3A 3C8DA 4DKAA 4MA3A 2AK4D 4U1IA 3VH8G 5F9AC 2IANB 3MLPA 2HKFH 3MRIA 2R56L 3QAZC 4YQXL 5HY9A 4ZSOE 4XPAL 4EUPA 1A5FL 1CLYL 4YDJB 3T1FA 2UY6A 2NXYD 5IEKA 2FJHA 2UUDH 5JHDD 1CGSH 3SDXF 3V0AC 2V5TA 1CXHA 3MQIA 2CIIA 2VWEE 2ZOLA 3PWUA 5IK3A 4E5XB 4Z7VA 3B9KC 4G6FB 4O9HL 3QO0A 3WUWA 1A9EA 4MJIB 3SE8L 3STZB 3QXAA 1F6AA 2MHAA 3T8XB 1G6RL 2AXHA 4HUWB 2HRPH 5E0QA 4ZXBD 1ERNA 4QRPD 2VJXA 3GGWA 2GTWB 2VC2L 2DJ4A 3PGDA 3GMMA 3ULUD 1Q9KB 5IW1B 3VRIA 1X7QB 3LH2L 3V6BR 1F97A 5CIPA 1ND0B 2NXZC 1WCBB 2GY7B 4DGIH 1TJHH 4UDUA 5AUMB 4UINH 2CMRH 4PY8J 2QADD 2DAVA 4YC2B 3UTQA 4DVRH 1NGWB 5I30H 1N5AB 4KKAC 1E6OH 2EH7L 1OQXA 5ALCL 3GI9L 1DBKH 5B4MD 3NZHH 3QDAA 2IQ9L 3K2MC 2YEZB 2WBJC 3RU8L 5E5MB 3DYMA 1RZJC 3VGFA 2XWJA 2HTLD 1WEJH 2BMKA 3NIDE 5EO1B 1AGCB 4GXUN 3HC4L 5I71C 4FQXD 1N6UA 4PJDB 3ZSTA 3KR3H 4NBZB 1VEMA 3MZGB 2V2TA 1FFQA 5EZOL 2E7CA 5BS0A 3OKKA 2AJUH 2CPCA 2WBKA 1AKJD 3VGBA 5LXGH 1S7TA 3MLRL 1WGOA 4BSJA 1GYAA 2CRIA 4ODVL 2R23B 3C5JB 5LGHH 5C0RH 3PWPD 1EZVX 5DEGA 3BPLC 4MVBC 4Z7UA 1T5XB 5CGYC 1EIBA 2V9RA 3R0NA 1NMBH 5IHZB 1K4CB 1LEGB 1W0VB 2WWMC 1MFBL 2DQIH 1HH9B 1DQLH 3IDNA 4Y5XC 5DJCA 4JFEB 3BZDA 5F88B 3ARGA 1HHJB 1F6FB 5I0DA 3QIBB 4YXHH 2UYLA 2VLKA 1MRCH 3CCHA 2Y5TA 4PG9A 2AJVH 1VCAA 4G8FB 3VXPA 3P0YH 2DYPB 2M2DA 5C3TA 1NBQA 3SOBH 2CLVA 3HNSL 3N85H 4MJ2A 3BP6B 1Q0YH 3CJJA 1D6VL 4K3JH 3NIFE 3MGOB 1KFAL 5GXBB 3LD8B 2IPTH 1P4LB 2EO9A 1HINL 4QXTA 2K3TA 5AG8A 2GT9A 3VGEA 3OKDB 4L4TD 3BW9B 4HWEL 4CN1A 3FZUD 3QO1B 3GJFA 2VR5A 4MB3A 3CDGA 2ZUWA 1GRWA 1PLGH 3W0WD 1WEJL 4KTYA 3QIUB 4NKMB 4NUGH 5E9DE 5SWSB 1IVLA 3BPOC 4LCWB 4NQDE 5JW4R 3AXLA 3X3FL 4LLUB 4ZOCA 3VW3L 1JNHB 5JXEA 4IRJD 3UCRA 1J87A 4D0BA 1T3FB 2NY6D 3V7MA 5IVXA 4OBSA 1AQDB 1HYSC 1G7HB 2EE3A 4ACPA 1EA9C 4PV9A 5CSZA 5EORL 5EZJB 3C8KA 3C60B 1OTTC 2FHBA 3RGVA 1CVRA 4OT1H 3W9DA 3K1DA 5I76A 3DO3A 4WI2A 1IEAB 2EDEA 5DEZA 3DGCR 4MJ6A 25C8H 4GRWF 1AE6H 4PG2A 4DZ8A 1LO0L 3KJ4B 3HAEA 1KN4L 4L4VB 3IDGB 2GYSA 4JPKL 4NP4H 3RL1B 3MJ7A 2JCCB 4XXDB 5C0BB 2W9EH 1NAMA 4TSCL 3FOMA 2KQMA 4ONHB 4S1DD 5HHOD 1HN1A 2HA1A 1JTPA 4FABL 4EJ1C 3MRLA 3TIDA 1D6EB 3F5WB 4PJHF 3NPZB 4YFDB 4JFFA 1QRNE 3KPOA 5DF0A 4CJ1A 3N85L 3U2SB 4Y2DD 4I2XE 5JOPD 5ILTL 1X5XA 4WFGE 2BOBB 1BJ8A 4XPGL 1BIHA 3IFNL 5D2NE 1EEYA 4LEOA 1OAKL 2EC9T 4KI5D 3BGAA 3UYRL 4F37K 4XB8A 2HJKB 2NY3C 2EDHA 3QIBC 3VMNA 4WO4D 5C0AD 3BKCH 5HVGB 3ARDC 2P46B 2VZVA 3LQZB 4HD9A 4R96B 5C7XL 4WWKC 3RNQB 5J1SC 3EKCA 1SQ2N 5M95B 3BP7B 3VWKB 3QDGA 3LN5B 5IGXH 1HKLL 5JNYA 2NY7L 3MRGB 1MLCA 3LD8C 4P57B 1T20A 3MV01 4Z77A 3ZKQD 3IKCA 4MMXC 5B39A 1WZMA 1NEZG 4MA7H 3WO4B 4UDTB 3E3QC 1BZ7A 4MCZB 5AAMA 1G7PA 4FMKA 1YPZA 5DEFA 4L8SB 1P4BL 2D7PA 2YRPA 4XP6H 1WVZA 1BFVH 3MROA 3QUXD 3QIUC 4P4RB 4LRNH 1KELH 2D7NA 1MREL 4AIZA 5A3ID 3DX9B 4Y19A 3A6CH 4PLKC 4MQ7B 4PB0L 4YHNA 4URTB 3PHOA 3GIVB 4KROD 4U7SA 3O6MH 1NGYB 2X4TA 3CVHB 1VFOA 3C60C 3IVKB 3WFBH 3DROB 2VSDA 2P8LA 4HWBH 1N64H 5AYQA 3X11B 3MRNB 5D7LD 1RZKL 4PJXA 1U3ZA 4HG4K 5DJZB 4LSQL 2I07B 2IGFL 1B3JA 5E2JA 4OIAA 4KGJA 1MH5B 3EDDA 5L8JB 2BJML 1NCDL 5ADOL 2GFBB 4HWUA 4YFLI 2ZSVB 5D8JL 2XY1A 2YK1H 3EDEA 4GQPH 1DBJH 1IZJA 1R5WB 2HT4D 5T1MA 1GGCH 4FFWC 4WTWA 3MSPA 3PL6D 1Z0NA 1MVUB 1P84J 2VDQL 5FO8B 4XX1E 3GNMH 3V6OC 4OGAD 1D5BB 2FLRT 1QYGL 3LB6C 1F4YH 5B3JF 3TH2T 1GGYA 1CLZH 1UB6B 1Y6KR 4NN5C 3H9HB 1NKRA 3BDXA 1MJ7L 2AEQH 1H15A 5K33A 1OLLA 1KELL 4PRNB 1LO3L 3THMH 3X13A 3GJEB 5DJ0A 3BMVA 5ID0A 1EGJA 5JXAH 4HIIA 4N0RA 2OTPA 4EBQH 3MNZB 1TZHA 5F1IB 3Q1SL 4JFYA 2ICWI 1UWEH 1QO3B 4JFQA 3DYOA 3FCTB 2ZCKH 3T08A 4XCCL 1K4DA 3KNBB 4TSBH 1NCWL 2R1XA 3C2SA 3HMXH 4PBVC 3VXSE 4GW4B 3V52L 3T3ME 4XWGL 3GK8L 2X4PA 1JTOA 3VCLB 1G9NC 3WO4C 4DW2H 5MEOA 1A7PH 3AY4C 4UIKH 4KH2A 3X14A 3V7AG 1WJ3A 4L8SC 5BRZB 2MFNA 2ZJSL 5SX4I 5IKCA 1IGIH 1LEIB 1SJHA 3TN0D 1X5LA 3B2UD 5K9KB 3IDXH 4G6MH 3SKNA 1AXTL 3ZYIA 1UACH 4UBDC 1LO4H 4JG0H 4IJ3B 1BHGA 4Y4KD 3E6HA 5TF1H 5BQ7A 2AVGA 2XKNB 4OLZL 2Y36H 3W9EA 2Z35B 4GRLD 4TNWF 2JKXA 5EOTB 2DLTA 4XMLH 3TCLB 2GIYA 1A0QH 3BRFA 1KLFA 3O45A 4BK5A 4FTVE 2BOCB 3KPNA 4HW6A 4U0RB 3KYKL 3L3GA 1UM6H 3SDXB 3GSXB 3HRZA 1HH6A 1YY8B 4Z0BH 1LEKA 3D3VD 3MUY1 5K9JH 3L3DB 4BSVB 3MRBB 4KQ4L 5J12B 5FO7A 4M6MH 2DTSA 3ZT5A 1WZKA 2QQLH 3TNMB 1KXVC 2AK4E 3IF1B 3D2UA 4BFEA 5EU4A 1YMHB 5FYLH 3BKMH 1JPSH 1INEH 2ICEB 4UV4L 1WBXA 5GS3A 3TGXA 4IS6B 4J3UA 1UXWB 4M7KL 2P8MB 5EFIB 4UIKL 4U05A 4IDJL 3PHQA 1NBZA 4PJFE 4KZDH 2NNAA 2BY0A 3MFFA 2EIZA 1OARH 2NYYC 1F90L 5EO9A 1OY3B 2FGWH 2DI9A 1T7ZA 4NDMB 2F58L 3ESVF 1LE9A 4LKCA 5MI0B 4YHLL 3H42H 2BY1A 5ID1B 1E27B 4XRCA 4PJ8B 4X6DA 1TCMA 3ULUE 1CXEA 4ZTPL 5C2BH 1KCUL 3MGTA 4QEGA 3P73A 4MNGA 1QHPA 5IQ9A 3BIAX 5I1DB 4G7YL 2UZXB 1Q94A 2VISA 3QNYA 1JWMB 1DSFL 3RI5K 1RZFL 5D1QB 4M03A 2M1KA 3KG5A 3OKYA 1RVFH 1BJMA 3HG1E 4QHMA 1F45A 4G3YL 3C2AL 3CX5J 1T2QH 4HH9B 2E3VA 3KWWA 1Q0XH 3SKJH 1ZT4B 3IU4H 4IJ3C 3MLYH 1DQJB 4HPYH 4LCCC 4F58L 1NQBA 4P4KA 1FYHB 1NAML 4LIQE 3HB3D 5EH1A 4UT6L 3MA9H 4ZO6A 1S9YB 2WQRA 4QOKE 5DFVC 3S5LA 1KJMA 3WFCH 3EDKA 1I7UA 3KPLB 5FYLL 3VFWB 5C0EA 5J6GA 4G7VH 4QHLB 2XZAL 3GSUA 4H26A 5JR1H 3K2UL 1TTUA 3PWPE 3IU3A 3I6KB 3STLB 4MXQD 1YMME 5AYUL 1FZOA 1E0OB 1MHEB 3QEQB 2H32A 3VFOA 3QB7C 4Q6IA 4M6AA 3UZQA 4FQ2H 1QACA 2YA1A 5EU5A 5HI5D 1FDLL 5J12C 4H25B 4P2CG 1AD0B 2XQYG 5GGVH 3AS1A 4RFOH 4KTEH 4JLRA 1N5YH 3ZYJA 3EYUH 4YE4L 4TVPL 2PYEB 3BH8A 4CL7A 4NQXA 3OAYH 1ZT1B 1ZTXL 3GHBL 1FVEA 2OTUA 4Y4HD 5I73B 3VRJA 1MF2H 1AQKL 1IAII 4MSWB 4X7CC 4WI5A 1I3RA 3VXUD 4X83A 4LRIA 3V5KA 4XI5D 4ZUVA 5EULV 1M7DA 5KOVC 3KYOA 1RVFL 1UC6A 5IB1A 4L4TE 1N59A 4PGCB 1S7SB 2H6PB 4F15C 1T03H 1A6TB 3SBWC 4GRWB 5FGSA 2R4RH 5JO5B 3JVGC 4LFHG 1BQHB 1YC7A 3LKQB 1FJ1B 5MI0C 2DQEL 4LCYA 3BYYA 2I27N 3LV3A 1IEBA 4JFDB 4PJ8C 1HHHA 2ZSWA 5ALBL 5GHWL 4KK8D 1NDMB 1HHGB 2VQ1B 4LHUB 3MJGX 3PABA 1HXYB 1T7WA 3GMRA 5ECJE 3V6ZA 4U3HA 1WIPA 2VDNL 4HS6B 3H3PL 3UAJD 3PWNA 4M9OA 3D69A 3P0GB 5HYJA 4PYHA 5CEZH 1B0WA 3KPRA 1EO8H 3VRLF 1T21A 1K2DA 3RWFA 1GVIA 4HIEB 4YO0A 1FZJA 2L0DA 4G9FE 4YLQT 4Q9RL 4PJCF 1QSEA 1ORQB 1U2HA 2YR3A 4AL8L 3AS0A 5IHUL 1FNLA 4L8CB 1NLDL 5F1OB 1IQDA 5IR1A 4NIKB 1SM3H 2EKSA 2QHLA 5KN5A 1V3MA 1S3KL 4ZNCD 4ELMA 3KPQB 1CE1H 4RMQA 1BVZA 1WIOA 1GZPB 5F3BA 1LE5B 2X4RA 4FG6C 5CZVH 4K8RC 1I1FB 1XF4A 5JOPE 4YHIA 3QI9B 5D6CA 4HS8L 2NY5H 1IM9B 2R0WH 1PW3A 4OGXH 1RJZB 4LNRB 2FSEA 3U79A 1MWAA 3DV6B 4AT6A 1QKZL 2XY2A 3ARBB 3VFPA 2YPKA 5HVFB 1JPGB 5KTEL 3KLSA 4OLXL 4IBLT 3DMMA 5FOBB 5D7SH 4DKEH 1QQDA 4NNXB 4LEXH 1SY6L 3MV7D 3C5ZC 4NN6B 2X9XA 2DTML 1JHTA 1JE6A 5IMOA 3VI3F 3FB6B 2XACC 2DWEA 1LDPL 3QIWA 1S7RA 3BP5A 4I4WA 4M8QA 4Z0XB 4Z7WF 1WT5A 1FSKB 1CYGA 1CDHA 1JGLH 1NBYA 3LOWA 4RMTA 5GIRA 1KJ2A 2NPLX 2YUZA 3BO8B 5LVEA 1YECH 1CG9B 4U6YA 1HHKB 3L5JA 4P2RB 5ITBH 4BKLB 3MACH 1J18A 3BP4B 4X6CE 1XH3B 1J1XH 3GB7A 4DZBB 5CILH 5E94B 1RZ7L 1OP5H 5J6HB 1A1OB 2VXQL 3G5YA 3PDOA 2EE9A 2AGJL 4OD1L 4MAUH 2BCKA 2RCSL 5I1IH 3T0ED 2Z92B 4CN4A 3MZTA 4P9HL 3HC3H 5GSRB 3EJZD 5IW6A 3WLBB 5F9JB 4MNQA 2EZ0D 3BPCB 3NA4A 3TWCL 3O0RH 5E6ZA 1ZHNA 3HPLB 3CPLB 1TPXB 3GBLA 3RVUC 2O5YL 1GOGA 3MUJA 5EBWB 4Y1AD 5D7KD 1P7QA 2IFGA 3D5OF 3MRKB 5F7NC 3S35L 4UNUA 1DFBH 1OAZL 1S9KC 1QLFA 1J8HB 4GS7B 3KYAA 4RMSA 4ZAKA 5GSVA 1V3JA 3PWVA 5I6XB 1I4FB 1RUAH 2FWOB 4R97B 3ZE1F 3O3DB 5EWIH 1ACYL 3NCFB 1DBAL 3VFTB 1JTTA 4KHTH 3OAUH 3NN8A 4G8EB 5J13B 4BJLA 2F19L 15C8H 5GS0C 3Q0HA 4WY7H 1IE5A 4M6NL 2FDBP 4MB4A 5HHPB 4FMFA 5LJYH 1QBLL 3OSKA 5CINH 3ARBC 4NKIL 2O61A 5FCUH 2DI7A 5KJRH 3QRFM 4CADA 5ITBL 3HI1A 1TLKA 2NY2D 1S5IH 1HILA 4ZFGL 1FL5A 4P46A 3BHBB 4M4RA 2UVEA 4O58L 4RAHA 4TVSa 4HUXB 5HHQA 2VLRA 4MAUL 5FM4A 2Y6SC 2P24B 2X10A 1ZLUK 4C59B 1F11B 2B0SL 1FIGH 4UQ3A 3MODH 4XP9L 3RZCA 4JO3L 1P5UA 1AR1C 1CIDA 4XBGB 1FSKC 1YQVL 4TUJA 3CVIL 2Z31D 3V6FA 4R3SA 5FUOH 2I60L 4PLOB 1MIMH 4LPVA 4M3KB 2ZKHL 4J7RA 1WICA 4KI5F 3GSRB 3B9KA 4S1SL 3C09C 2H2PC 1UEMA 4WEBH 4UTAH 1OB1B 1FORH 4QRRD 5FKAB 5T5FH 5T1DH 4HKZA 3VFMB 1RUAL 3MJ8B 1Y0LA 4KQ3L 4ZOEA 3GBMH 3NCJL 4X4XA 2H3NA 2HFTA 3ZDZE 2BNRD 4K7FB 2DM2A 3QQNA 5CSGA 4ETQB 2DICA 5IBUG 3VGAB 1KPUA 1FGVH 1U3JA 5A2FA 1TPXC 4X7TA 4E42A 1T7XA 4U1SA 1FH5H 4MA1B 4ZPTA 1T22B 1RY7B 1YNLH 5IESL 2IPUK 2FYYA 1QSFB 3DV4A 5GZOC 4XTRC 3IDIA 5DMKA 5JQ6H 5TGBA 1M05A 2EH8L 4E41E 2Y7QA 2HT3C 2WBJA 3L3KA 3DUUB 4WU7B 3RKPA 4EVNB 3Q3GB 1Q9LB 4R97C 2Q86B 2X70B 3OGOE 2ZOKB 1QEWA 3BUTA 5A16B 2BVPA 3OB0H 1QVOB 4ZUSA 2O5XH 1FC2D 4PJBE 4PUBL 4XGZB 5ITFB 1ZVHA 1CZ8L 1XGRA 4X9BA 3HE6D 4Z7OE 4NO2A 2C7UB 4UB0H 3O6LL 3LZFL 2GSIA 2EEBA 2DM4A 4J2XA 2LU7A 4F9LC 3HR5A 2R29L 4CDGC 4GW5A 3SDAB 4WJ5B 2Y9RT 4XPHL 4PD4J 1A14H 1GGUA 3P4MB 2IAMD 2Y5EA 1CICB 3R8BB 2IADA 1CLCA 4Y5XA 4HXBH 1BX2A 1K3ZA 1DEEA 2OR9L 5C0CA 2RHEA 1BD2E 2DQDL 4PJGB 3WIHH 5DK2A 2P47B 3SN6N 5ADPL 5TE6L 4I48A 2XTJB 3VXQB 2VXSH 1CD1A 4XMKH 4AMKH 3O8XD 4WTXA 4DVBB 5DVNA 4EQ3A 4YDJA 1CDYA 2E6PA 5JIHA 2WW8A 1P84K 3EO9H 3G5ZA 2GEEA 1PX3A 2WMPA 1YNLL 4MS8D 1TETL 5JA9A 2J6EA 4DKFL 5KAQF 1DQQB 2V2XB 1K5NB 4MJIA 3STZA 1IILE 4OI8A 2R1WA 4A6YH 1MCEA 1R5IB 3CFEB 3T8XA 4JHAH 4HUWA 3AU1A 3S96A 3RL2B 1SBSL 3ULVL 1R3IH 1FL3B 2K9UA 5JA8B 3NFPB 5FYLD 1A6UH 2WUCL 4WGVB 3U7YL 4K9EL 4LBEB 2DQHL 4MLSA 1X7QA 5GZNC 1V5JA 2D2OA 1YY9C 5AUMA 2XPGB 2JTDA 5ISZB 3TNNB 3DNKA 1NGWA 1Q72H 4LDLB 3EYSH 4OGYL 1CFVL 1YNTB 1MCHA 1RPQA 4OZGF 1UWGL 1A14L 3LQAC 3TA3C 3PQYB 1MCFA 4GFTB 5E5MA 1MWAL 3CFBB 1AGCA 1EHNA 1N3NB 3JWDL 4M1DH 4ZYKA 1S78D 1A3LH 2YPLE 4Z78B 4OLWL 5CP7A 1IAIH 2WINB 3S4SB 3ECBB 2A1WH 5T3XL 4ETYA 4Z7QE 4GSDH 3RHWK 1S7UA 2E6JA 4MX7A 2BVOB 3FAXA 2VXSL 5E7BA 3ZKXC 2AAVA 3C5JA 4CU8A 2AJZB 3T1WA 4FXLA 4OV6F 1KBGH 3GSNA 3G04B 1ROWA 3SDAC 2FZ3B 1K4CA 5F7FA 2D9CA 3NCMA 1HH9A 5LCVL 5JHDB 4GG8A 3C6LD 5IVZB 4JFEA 5F88A 3DX6B 3RKDD 3D0VB 4MJ5A 5D7IB 2VZSA 4O51B 3QIBA 2EYRB 1YYLL 3BT2H 1OW0C 4DQOH 4LHJB 3HPJA 1HQRA 4DFIA 3CXDH 2X4OA 4PJCB 3ARDA 4CRPA 4L29B 3QG6A 4S2SB 4U1KA 4GUPB 3NMEA 4ZXBB 3RHWF 3P9LB 5B38B 4QRPB 4WWKA 4PRHD 1NFIB 1BBJB 1AO7E 3D85D 3FOLA 4NQCD 4F80A 3HE7D 4O2EB 3GSQB 4GKZB 1KB5B 1BFOB 3QHZL 4Z95H 1RZGA 4YUEH 4JHWH 2NY0B 2QADB 1LILA 3DWTA 4O4YH 3HMWH 2OL3H 5CBEA 4JDZA 3MV11 4JRYD 4KRPD 4K2UH 4QHNB 1CFNA 1ONQB 3O2VH 4M02A 2FJFA 5TPWL 3QIUA 4XVUC 3C5SA 5SWSA 4G6KL 4PRPD 5T1KD 2NMSA 1MCLA 4OF7A 4NT6A 2A1WL 2D31B 4X7SL 1JNHA 5CWSB 4IRSB 2YSSB 2BSTA 2W38A 2DJSA 1I7RA 4XAKD 1RU9H 1P53A 1EHLL 1AQDA 1YDPB 4DK6A 2WUBH 1G7HA 3NCEB 2VDMH 5DHVA 1Q9OA 5DJ8B 1O7VA 3W39A 5EZJA 2ZCHH 2VDRH 3L5WA 1KBGL 4P3DA 4X6FB 4PJHE 4PJ5A 3WD5L 1HI6B 1G1YA 4YHKH 3ES6A 3DBXB 1CU4H 3BAEH 3OKOB 3WHE0 3IDGA 3PGCB 3CX5K 5GRVL 1EFXD 2JCCA 4XXDA 3EOYG 4GOSA 1A6ZB 5C0BA 4AEIH 4ONHA 5DMIL 4DQOL 2HLAB 4WNQA 2APXA 4PRBB 4GAGH 2AW2A 5DYOB 3OXRA 2PN5A 3L9RB 4OKVB 4H0IA 4LSRH 1RULH 4UOW0 1J1PH 3S36L 5CEZD 2UWEE 3B3IB 4HQQH 1F02I 3V6OA 1MHHB 2NXYC 4NQEE 4YUEL 4GXVH 3TVMB 4ZO8A 3SJVA 2A2QT 4X8JA 5C0ND 2FNBA 3QQ4B 4NM4L 5E8EB 1T5WA 4Y16D 1CE6B 5LGKA 3I3DA 4NBXB 2EDKA 1VSCA 4KXZH 1YJDC 5KS9F 1KXQE 4JM2D 1PZUB 1QFHA 1H0DB 3LQZA 4ZXBC 4HX1A 3W0WB 3TV3H 1AFVL 5KOMC 2IBZX 5EU6E 3RNQA 3U1SH 1D9KD 4XP4H 3ULUC 1KTKE 4NZTL 3BP7A 35C8H 1R5VB 4J3XA 3T0EE 1FFNA 4APQB 4U1HA 4P57A 3BQUA 1GGBL 3WHE1 3RY5A 4ONFL 4S1RH 3UO1L 1G0DA 1UKQA 2NY0C 2QADC 4UDTA 4DAGH 4GG6E 5BO1H 4LLVB 3AY4A 4U31A 4P2QE 2CKBB 1A9BB 5I74B 1Z0MA 4L8SA 4TUKH 5B4MC 1GOHA 3IB4A 4P4RA 4QXUH 4UOW1 4Y1AE 5D7KE 1E28B 4XC1H 1OGTA 3DX9A 4KUZH 2ESVD 2HTLC 1YNKL 1WZLA 5DTFA 2GJ6A 2P1YA 3B5GA 4FQXC 3QR2A 3ZHLA 4DK3A 5F7HA 4RDQG 4V1DD 3LQMA 5HHOB 1RULL 2HKHL 2X89D 1AH1A 3IVKA 1BBDH 3DROA 4GAFB 1IM3B 4UIMB 4M5YL 1A8JH 5JZ7C 1EXUB 1MJUH 2ZUSA 5DC9B 4DUXA 4Y2DB 2ORBH 1ZEAL 3VXME 4K94C 3EZ8A 4MD5B 2C9AA 4NZUH 2R4SL 4N0FA 1OT2A 4FQHB 5DUMH 1R5WA 3MLTA 3U1SL 3BX7C 4PP2B 5DQ9A 35C8L 1C5DB 1LP9A 1MVUA 3T0BA 1K8DA 1BGXH 3T04D 2ICWJ 3SE4C 3O4LE 4BQCA 1IGTB 3MRJB 43C9B 1WWWX 5E2WH 4P0DA 3FONB 1T7VA 3QZWG 5DDHA 1IC4L 1NDGB 4HHAB 3EFDL 2BSRB 3ZTJG 1MCPL 5DT1L 5DJ6A 2J6EL 2NR6D 3FZUC 3OR7B 5E95B 1WAAF 1QFUL 3DVNB 4PRNA 5D5MF 4KUZL 3DYPA 1EHAA 3GJEA 4Z76B 3QUXB 3LHPH 3TBTB 1RK0B 4QRRE 1Z3GL 4F7PB 3FCTA 4JHZA 5SWZD 5DC0A 3KNBA 2MQ0A 4APQC 2NY6C 1QZ1A 4KMTH 4KUCD 1C7TA 4YDKH 1OVZA 2BNRE 4X9HA 5D2LF 3CFCL 4LP4A 3VCLA 1PY4A 5EUOE 4L9LC 3MV8D 1XFPA 5I74C 5JPNB 4M62L 2FX7L 1XGYH 2GCYB 5D7LB 4YNYB 1QPPA 1ADQA 1WC7A 1GCFA 1P2CA 5DFWH 3UBXA 5I15L 4U7KA 1DE4B 4R4BB 4P23D 1H3UA 1I9RH 5GRXG 4PS4L 4DGYL 1OGAB 3A6BH 2VLJD 3ZT7A 2D4FA 2X09A 1X6NA 2FX8L 1II4E 4LCCA 1CBVH 2P43B 4S1DC 1QBAA 1IRAY 2CO7B 2XKNA 4YGVA 3NCYS 1MFNA 1FAIL 2Z35A 3VMPA 5BZWB 4JRXB 3WIFA 5EOTA 3A6OA 3TCLA 5FO9B 2UZIL 3X12A 2XQBH 3D39D 3PL6B 4QYOB 3S6CA 3Q6FB 3SE9H 2P8PB 1JWUA 1MQKL 4Y2DC 4P9MH 3NH7L 1ZLWH 3GSNL 5BV7L 2FLBT 3QXVA 2BOCA 3RUGE 3ORJA 3QJHB 5IEHB 4X9GA 3GSXA 5CIPH 4PTTB 2C3XA 3Q6GL 3QUYB 4KI5C 1BJ1H 5CMAA 2AV7B 1E4WL 3L3DA 4TRPH 4WUUD 3MRBA 1G0YR 4M48H 4BSVA 1B4RA 4UV7L 1RIVL 1SVZA 1XCTB 5KBNC 1EBAA 4WO4C 3SDYL 4RA3A 4RWHA 2Y1VA 1E4XL 4U4BA 1OCWL 4S10A 3KXFE 2VOTA 3KS0H 3IF1A 3QNZB 5F44A 2R1YA 5IB3A 5JUEL 1NCBH 3EYFB 3ULSB 5I0ZA 1HQ4A 5IM7A 1RQ5A 3CLEL 1CFQB 2AJSH 2ICEA 1B6DA 3REWB 4S11A 3HLAA 1AC0A 4X4YB 3VI4E 4WI9A 5H35A 4Z7VF 4RRPA 3WSQL 3TM6A 4OBRA 2YZ8A 2MJWA 3ETBF 3BXNB 4R4FH 2E6QA 5E6ID 1IAKB 4JFXB 4OZGB 2V5YA 4OM0H 5J4MA 1UYWL 4JB9L 2XG5A 3QUXC 4M7LH 2HRLA 4U6TA 3TN0B 5EBLB 3LRHA 4NDMA 5A3IC 4IMLB 3SBWA 1TIUA 3OGCA 3JVGA 4J3OC 5BOZG 4PRID 1CBVL 1OWWA 1JN6A 1V7ML 2WM0A 4PJ8A 4JREB 3HI5H 4NN7C 3O9WD 5JW4M 3B43A 3ZL4L 4D9QD 1MRFH 3SE9L 3P11H 4GRLB 3DO7A 1U8MA 4FQ1H 2FB4H 5IFHL 1P6AB 3N9GL 3TF7C 1H3PH 2MTPA 4PRDB 3MV9D 5F9OL 5C3LD 4N0UB 1MI5D 2E8YA 3IS0X 4HH9A 3RQ3A 3T3PE 3S97C 4U6VH 3NACH 3SGJC 3MRHB 1J0ZA 5GJSL 5KSVB 3D3VB 2BNQD 4LCUB 5GGRB 1RUMH 4I77H 1FV1B 1L7TH 1KUMA 4QHKI 1A7QH 1J05B 2EXYC 3GJFH 2HT4C 4P5MA 2COQA 4PJ9B 2OSLB 5CEXB 3IDJB 3MA7B 2E27L 3NCCB 4KY1L 5J11B 3VFWA 3PL6C 4ZNEA 2Z8SA 5T1LD 2J4WL 2FH6A 2NW2B 2XA8H 4OGAC 3PJSB 5C0GB 4M9PA 4EXKA 1ODAA 5GGQL 2XTLA 1ITCA 3LKRB 1AGFB 2Q8AH 3QUYC 1F00I 1MHEA 4R4FL 3QEQA 1F4WH 4XNXL 1G6RB 5ISZE 5JMOC 3RIAK 5DURB 3DXAD 2LVCA 4TSAH 5HYSG 1YYMH 1I85C 2Z91A 2AK1L 4XZUA 3GSOA 5T5NG 4G9DB 2PYEA 3OMZA 2F5BL 4PJEB 4MNQD 1YN7B 3QSKB 3RTQD 1ZT1A 3C5ZA 3ZTJH 3HI5L 2F5AH 2P5ED 1AD9B 5J56B 3E2HC 4I3RL 3L5HA 4NQCE 1U8OB 2VITA 5DVKA 2A9NL 5TF0A 5IF0B 5IVOA 4NZJA 1BPVA 2W65B 4NC2B 4H88H 2ITCB 2FB4L 3SGDH 4GKNA 4DGVH 2W0FA 5EOCL 4WUKL 1SYSB 3BWAB 2PW1B 3FO1B 2BC4A 1S7SA 2H6PA 4W6YB 3TN0C 4KJPD 4FQLL 4HUVB 2VZTA 4JRYE 3B2UC 4LLYB 4LAJH 4PD4K 2C3WA 3OKMB 3GI8L 2KH2B 1FJ1A 4OCXH 1DL7H 3QCTH 4OF8A 3GMNB 3EDJA 3CLFH 3QFJE 4GLRH 5IBLD 4JREC 3UTPE 5IVXF 5JW3H 3N1QC 4LHUA 4HZLA 3GIZH 1T80A 1RJYB 3WDJA 2QQNH 4RWYL 4GRLC 4U1NB 1MJJA 4HS6A 4I13B 4FS0A 1GGIL 2QLVB 1B6UA 4WHTB 1GPOH 5CJXC 3FTGA 4OZFG 4HBCH 2N7AA 4XNZB 4HIEA 4MXWH 4H20H 4DUVA 3UJIL 3MLUL 4RGNE 2QTEA 3V7AE 1ORQA 4KTDH 1T0MB 2VDLH 4L8CA 2DLGA 5HYFA 1VACB 5K9QI 3RZCD 4P5KA 1X5GA 5J11C 3BEWB 3LKPA 3FFDB 4LASH 5EDXA 3KPQA 3PXHA 2VYRE 4KVNL 3DECA 1CTNA 1REIA 3A67H 3V4UL 3U36B 4IDLA 1ZS8B 1M71B 3E1F1 4UT7H 1I1FA 4FZ8L 3DURA 1IC5H 2EDRA 3VXUB 4C83A 1IM9A 2ADJB 1U95A 2ARJQ 4LNRA 4OTXL 3VI3E 1TZGL 2IMNA 3ARBA 1S7QB 3RWHB 5CBAB 4QTHA 3AMLA 5ESVB 2FIRT 4OCXL 1UQSB 4Z7WE 4NNXA 5E08H 2OM5A 4CDHA 1CD0A 2BVTA 1UZ8A 3IJHB 4FXGB 4AYFA 2AI0H 2H9GB 5MENB 3VXRD 3EOBB 5C07D 4NOFA 5TDPA 1JGVH 3T77B 3G9VA 2EDDA 5KVFL 4JJ5B 2G2RB 4LPTA 4F57L 4JCLA 5IJKC 3QUZB 1YEGL 4HMCA 5GGTL 5E8OB 1DUYA 1KCVL 4X99B 4F7CA 2BRRH 1X5IA 3S8WA 1ADQL 5HI3D 1KXTB 1HHKA 1RFDH 1B2WH 3F58H 1XH3A 1JL8A 3OAYK 5E9DA 1DBML 2HAZA 2ESVE 5E94A 5IROC 1OTSD 4L1DA 1V05A 5IFAH 3HB3C 1NC4A 4RNRB 4DTGL 5HDQL 1BVKB 4OD3L 5INCB 3MJ9H 4EZMA 4V1DE 4MCYB 4CMMA 4N0YH 3A67L 1X3DA 1R3KB 1EGJH 3FO2A 4QXGH 4NO5B 3BPCA 2XXMB 1KULA 3JWNC 3ZE1E 4NHCH 3CPLA 4NNPH 4JZJB 2AJYH 2JK5A 3IGAB 1NGXB 1UB5B 3ILPA 2A77H 4UAOB 5C6WH 4XNZC 5E2VL 3O11B 3O6KL 2J5LB 4CMHB 4EI6A 4PIRF 1W0WA 2AKRA 5HI5C 4BM7A 2ATKA 2DMBA 4Y88A 5D5MB 5L2JB 1J1OH 1X5JA 2BXZA 1DBBL 1FYTE 2R39A 5IQ7H 4F7EA 3VFTA 3MV7B 3U7AA 1QRNA 5KVGH 3DUHA 4Y4HC 5C09E 4RZCB 2DQJH 2P5WD 4YXLH 3T4AB 1PG7L 2F54E 5D2LB 4I2XA 4YHOL 4XI5C 1S9WB 2FBJH 2A83B 1XR9B 2VDPL 3QRGH 5F7MC 3BJ91 4F9LA 1IGCH 5E24E 2RBLA 2YD7A 1WIUA 4XB7A 3BKYH 4XNUH 2CDFB 4WFFD 2DQTH 2J1KA 4YJZL 1UVQB 4BZ2H 3BHBA 3QDJD 1DN0B 4FRWA 1JF6A 3ZDXF 3HKFA 1EERB 2R8SH 4QTIH 1U8KA 1AGDB 3O3AA 2C4FT 4KK8C 4JVWA 1Q1JL 1F11A 5SWZE 1F58H 4M7JL 5CHNB 3K1KC 2VXTH 4TTDD 5EOQL 3QUZC 4NNPL 3MPCA 4L5FH 2NX5D 2PR4H 2CLZA 4UNTA 1DZBA 3UAJC 2NW3B 3MV8E 2AXGB 3RDTD 3DGGA 5DUBB 3D9AL 2NQCA 3U30B 3GSRA 2JB5L 3K8KA 3EUUA 4TUOA 4HT1H 1OT1A 5FKAA 3X3GL 4MA3B 3VFMA 5J1TC 4U1IB 1JPFA 4KC3B 3MRIB 5HDBF 5IQ7L 1A7RL 4K7FA 5HY9B 1HNGA 1NC2D 2QHRH 2XZCL 3OJ2C 2EYTA 1I1YA 4OZFH 1FPTL 3OKEA 4EUPB 5DLML 4GBXD 5IEKB 1U8HA 2FJHB 2HFEB 1J86A 1KCRH 1UZ6E 5SV4A 2DQGH 1OSZA 4HS3B 4YEEA 4UAOC 2K7QA 2FBJL 3PXJA 2F53E 2CIIB 3WCYA 3WNLA 1FNFA 4Z7VB 3QRGL 1QSFA 4GAJL 3QO0B 4K8RL 3WUWB 4LVHC 1A9EB 3QXAB 2MHAB 2B4CL 4Y5YC 3TA3A 3R1GL 3RX8A 5FYKU 4WU7A 3GGWB 4WUUE 1AJ7L 1Q9LA 5JQHC 3PGDB 2ZOKA 5A16A 3QCVL 3LN4A 4QTIL 3VRIB 1RJLA 1GIGL 1B0GB 4XGZA 5ITFA 3MNVA 4JQIL 2NZIA 5I18H 5JHLH 4Y4FD 4BUHA 1BJ1J 3UTQB 5IB4B 2DLFH 3BE1L 3MFGB 3U82B 5F7WC 2R0ZH 4LL9A 2PR4L 3TFKD 1EEQA 1BECA 1KYOK 2MKLC 1PKQE 2Z31B 1VEOA 3HZVB 3RWIB 3P4MA 4EOWH 4Y5VA 2GY5A 4OSUH 4LHQB 2VL4A 5KSAA 4X6DF 3OHXA 4LVOC 3ILQD 4NQSB 4PJGA 5TQ2L 2VR9A 2X4UA 1OW0A 2V2TB 4AEEA 4PRIE 5BS0B 5SX5H 2F15A 2QHRL 1S7TB 4DVBA 1RZKC 1PSKL 4RAUB 5I19H 3RRQA 2VH5L 3EJZC 3VXSA 5HHMD 1F3DH 3LKSB 2EZ0C 4D9QE 5DFTA 2HLFD 3U30C 5I1KH 1MFDL 4DCQA 4U6XA 1DQQA 2V2XA 1K5NA 3IDNB 3NFNB 5ESQA 5IG7B 5HYQB 3MV9E 4OLVL 2A6IA 1R5IA 2VAAB 5F9DC 1MI5E 3ARGB 3RL2A 1KF9B 1QD0A 3KPSE 2UYLB 4XCEB 1LNUB 3HTLX 4EDWH 4PG9B 2NZ9D 3U48A 4LBEA 1IGFL 5CFHA 3OJDA 2HYMA 2CLVB 2MPAH 4PR5B 3MYJA 5KSBF 3K80A 2XPGA 3GO1L 2X4SA 2J8UB 1G6VK 4KUCF 1XIWD 5F89A 3I2CH 1JV5B 4QXTB 5FXCH 1OPGL 2GT9B 5JIIA 5GS0L 3QDMD 3HE6B 5T3ZH 1YNTA 4FTVA 3RFZC 1VGKA 3CDGB 3PQYA 5DRNB 4P3WA 1E4XI 4G8GD 4R8WH 3H7LA 3WXVH 3MCG1 3CFBA 3T0VA 1N3NA 4OSUL 4CNIA 3DXAE 1JVKA 1YEEH 5J7CC 2VN4A 5BW7A 2NY2C 4LKXB 3BDYL 3RAJL 3S4SA 4D0BB 4NM8H 1RIHH 5LBSH 5IVXB 1T83C 4KVCH 2DI8A 3P2TA 2AK4A 4KZEL 3GKZA 1C16B 3C8KB 3MXVH 5E8DH 2AJZA 3GSWA 3W9DB 1TMCB 3UTTE 3G04A 5TDNB 2B20A 4RBPH 2Z31C 1FCCA 4BFGA 1DQML 5DD0L 2O5ZH 5FUZH 1CGXA 4MJ6B 1QP1A 2OK0L 3LMJH 4LLWA 5JHDA 4DZ8B 5J9PB 3HAEB 3OAZK 3LIZL 1PD6A 2V5RA 1JHLH 2I9LB 3DX6A 3MJ7B 5HHNB 1ZVYA 1NAMB 5D7IA 3FOMB 3DVIA 1O7SA 3QQ3A 4HF5L 1U3HD 3DSNA 3LKOB 4S2SA 3MLVH 4ZXBA 5J57B 1GAFH 3P9LA 4QRPA 4JFFB 1IT9H 5B38A 4MAYD 1WFNA 1BBJA 3DI3B 5CAYB 1F5WA 2E7BA 4O2EA 1Q8MA 3O3EB 2CGRH 4ONGH 5F6IB 5B22A 1BWWA 1KC5H 5FB8B 2ADFH 4MWFA 4LEOB 4FZEH 3UZVB 2OXHA 3CUPA 4HAGA 1OP9A 4XWOD 3SKMB 3ULVF 2RIKA 3FMGH 4QHNA 3UTSD 3DIFA 1ONQA 2XWTB 4ZD3L 1JGDB 1YEEL 1NEZB 2JJVA 4ZS7H 3ZKMD 2L7UA 4FFVD 1CD9B 4X7DC 2DIJA 5KZCD 3FAWA 3TT1L 4FQXA 3FN0H 3QDGB 2SEBA 2FEDD 4YIQA 5JNYB 1HHIB 4HXAL 1YDPA 2D7MA 1JZ8A 3VG9B 4RCAA 4QCIA 1MLCB 1P5VA 1T20B 5DJ8A 4Z77B 2DKSA 2EKJA 3IKCB 5B39B 1AKJA 3HE6C 5DZNA 4YHML 5GRZA 1BZ7B 3PWPA 1G7PB 5DEFB 4MA8L 3BH9B 1HI6A 4P48A 2ENYA 3MROB 3DBXA 4M6OH 3HZMA 3OKOA 4Y19B 2IFFH 3PGCA 5DVOA 1ETZB 4IIQB 2FX9L 1A22B 2R0LH 5DD5H 3OZ9L 4OCMC 3RWDB 5JXEC 3GHEH 3C6LB 1A3QA 1KEML 4G42A 2ZPKL 3L9RA 4KRNA 3QWOB 3E8UL 5HYIA 1OM3L 3MRMA 3PHOB 4M7LT 5KS9E 5L2KD 3S37X 3FQNB 1NGPH 4HJGA 4JFOB 3VXRE 1DANT 5F1SA 3O8XC 4PRHB 5C07E 3D85B 1MHHA 3B4NA 1N2RB 1I9EA 1FNGA 3SE4A 2B8OT 3IETA 1FZKB 1A6WH 4FZEL 4OLUH 4AEHH 2K1MA 3BEVA 3QQ4A 6CGTA 3CGTA 4MS8C 2KPNA 1CE6A 3OQ3B 3Q2CA 4L4TA 4WCYL 1JFQH 1MCOH 5F96L 4ALAH 1H0DA 2R0KL 4PRAA 4D9LH 1HK6A 1AY1L 3W0WA 1BLNB 2BDNL 1BEYL 2D9QB 5T1MB 1INQA 1N6QH 1BAFL 3HUJB 4PRPB 4IRJA 1UA6L 1DUZB 3JUZA 5F6IC 4JO2L 2UZYB 4IOIB 1I1RA 2FEEI 1V3KA 1I1AD 2BK8A 1QLEL 3L3IB 3NA9H 1MNUH 1UM5H 4L9LA 5GRVK 4W81A 2CKBA 1A9BA 3N1FC 2YXMA 3QXDA 1H15B 4HUUB 4L3ED 3V0WL 3TO2A 4GQ9L 2FO4A 4OCSH 2Y06H 5DZOA 1W72L 3X13B 2Q87A 5DJ0B 3PP3K 5EZIL 1H3WM 3LQAL 4S0TD 5ID0B 5DD5L 1MCWW 1MFAL 4HIIB 2CDEB 1TZHB 4HDIA 2XWBB 5DMGD 3ZLQC 1S78C 3FO0H 3NIGF 3QCUH 1EFXB 5DI8A 4JM4L 5TE7H 3QJFA 1K4DB 3FB8B 3O2WL 5HHOA 2R1XB 4HK0A 1MHPL 3PP4H 1JZ3A 2X4PB 4UIMA 1ZLSH 2DF3A 4MZ3A 1UJ3C 1CFSA 2R2CA 1EXUA 2I26N 1CL7L 2P5WE 2H1PL 4JR9H 3X14B 4Y2DA 5GRJL 2Q76A 5IKCB 1Z5LA 5EU7E 4Q9BA 4IIQC 2DLIA 1BZ9A 1XZ0B 4K7PX 5GRYA 3KLHD 3C6LC 4FQHA 4D9LL 1YEFH 4WFFE 3RKDC 4NQVB 3E6HB 4WO4A 5C0AA 1CXFA 5BQ7B 4OGZA 4PB9H 4IOFD 1WAAE 4HKBA 3VXOA 1G9MH 4KV5E 5D5ME 1C5DA 5HHVL 1YEDB 1VGEL 3P4OA 4JO4H 1RZJH 4XPFH 1OSPL 5HDLA 4D9RD 3HE7C 4NZDA 1IGTA 3TZVD 3FONA 1VFMA 2VDKL 3KPNB 2A0LD 1F4XH 2X44D 1NDGA 2BSRA 4Z9KB 4LLAA 3HRZB 1HH6B 4M1CD 1N8ZB 1IQWH 1JF1B 3O41A 4WFED 4J12A 3T65A 4OCSL 3DVNA 4KRPC 2DM3A 4F9PC 5GGUA 2CRYA 1WITA 5FO7B 4HEPG 1NKOA 2X7LB 1T1ZA 3QUXA 2YC1A 4RISH 3QWRD 1AXSB 4TPRL 3TBTA 3ALXA 1P7KA 5CCKH 5C70A 5TE7L 4N90D 4L1HA 5K9OA 4PP1D 5C1MB 5M94B 5EU4B 3SCMD 1JZ6A 5L8KB 1QR4A 1SEQH 2NY1B 5I8OL 1WBXB 1CGUA 2HFFB 1VDGA 12E8H 1NAKL 2VIRA 4JPVH 5DD6B 4ODBD 4GAYA 2R15A 5IBTL 3PHQB 2P44B 1NBZB 5C08D 5JPNA 2NNAB 4LMQE 4FQJL 2GCYA 5D7LA 3MFFB 1N4XL 2EIZB 5GS1B 1KG0A 4I3GA 4PLJD 2F8OA 5D71L 2DQUL 1DE4A 3CSBA 2ZG3A 4R4BA 4NQTA 4EIZC 3WMSA 3UJJH 4J3TA 3SGJA 3MLWH 1LE9B 5DJAB 5I75C 4YZFF 3MXWL 3I9GL 5JW4N 2EDWA 4XRCB 4X6DB 2XV6B 4HEME 1FC1A 1A7OL 4AH2A 1J0JA 3HNVL 2PO6D 3AUVA 3MGTB 4R26L 4MNGB 4WW1A 4B5EA 5CD3A 4H1LB 2XRAH 5BZWA 5FO9A 2VXVL 4XPFL 3MOBH 3PL6A 1Q94B 2VISB 3FFCD 3Q6FA 3QNXA 5E6YA 5DMYA 1BREA 1T1XA 4EI5D 3P30H 1OHQA 1YEHL 1OAXL 4QHMB 4OZIF 4PTTA 3U7WH 2DMCA 5C0NC 3OG6B 4Y16C 4KDTC 5D7JD 2AV7A 3UXFA 5DZLA 1KENH 4Z7NE 2DDQH 5L6YL 1MCJA 3V4PL 1VPOH 4JRWA 4HC1A 1X44A 1YJDL 1FZMB 1I85A 5C9JA 4OJFL 4D8PA 3EIFA 5HDOA 2BRQA 3IDYB 3T2NL 1SEBA 1D9KC 1KJMB 3QNZA 4WW2C 1BM3L 5A40E 5J6GB 1S7WA 3ULUL 3WYRA 3REWA 5LGJA 4H26B 2NY5C 5KSBB 5EG6C 4X4YA 1QR1A 4HJ0D 3P9WB 3LKNA 5HHME 2HWZH 1JK8B 1MHCA 4YDLC 4CVWA 1J0YA 1FGNL 1QA9B 1FZOB 3VFOB 3FRPA 1Z2KA 2OBGA 1B88A 4GW1A 3QULA 3MLXL 1IAKA 1KCSH 3QG7H 5FGCE 1HSBA 4JFXA 4OZGA 4D2NA 3OB8A 3TN0A 1BWMA 5EBLA 4JLRB 1UWXK 2LAGB 5D1XD 4JE4B 5HTSA 3SQOH 1OAQH 4P23B 4J8RB 3AS3A 3DETC 3BH8B 2VLJB 3VFGH 5EZLA 3H8NA 5IV2A 1TNNA 1U42A 2GK0A 1FVEB 4LIQL 2OTUB 4Y4KA 3VRJB 1HIMH 2HT2D 4NWTL 2MQ3A 3V5KB 1E6JH 4MHHG 1ZAGA 5KW9L 2EDOA 4GRLA 4NJAL 1I3GL 3KYOB 3WHXB 3D39B 5GS1C 5IB1B 3VXTA 5FHAL 4PRDA 1N59B 3FQXA 4LU5L 4Z7UE 3MRHA 4K94L 3TYGH 4TTGA 4G8GE 4LCYB 1KNOB 3PF2A 5KSVA 3D3VA 1IEBB 1HHHB 3RA7H 2LVEA 4LCUA 5AG9A 5CUSL 2ZG1A 2ADIB 5ANME 1J05A 1C1EH 1N7MH 4AIXA 3PHSA 2VLKE 4JGJA 3PABB 3LRGA 5C9KA 3GMRB 1MELA 5BMFH 4YAQB 2IH1B 3V6ZB 5DUPH 3PWNB 4LGSB 3D69B 5C0GA 1KEGL 5HYJB 4KK6D 4AG4L 3N06B 1QBBA 2GKIA 2DQCL 1NMAH 2D0GA 7FABL 1T21B 4HIXL 3RWFB 4DOHB 4N1EA 4NQDD 2NR6C 4RFEB 4X5WA 5LQBH 1FZJB 4OI7A 4PJIB 1URLA 5EA0H 3IDMA 3IDYC 3KYNA 4G9DA 2BFVL 3WXWL 1RZ8A 5I66B 5IR1B 4PJEA 3ARTA 1QFWI 1YN7A 4JKLA 1FVCA 3QPQD 4K3EL 2XG4A 5BCAA 1PYWA 4BZ1L 1KTDA 4HJJH 1AD9A 3G6AB 4JFHD 1H8NA 3MO1B 4NJ9H 5IF0A 1J9CT 3MLZL 2W65A 1XF4B 1H5BA 4YHIB 1Z6JT 2ITCA 2E7LA 5D6CB 3CAFA 4J3VA 2EEDA 1N0LA 4BFBD 3BWAA 1YC8A 1MWAB 3VFPB 2YPKB 4HUVA 5CSBA 3V4VL 2RB8A 4LLYA 3DMMB 3UTSE 5JPMA 4P23C 4TOYH 1P4IH 4TN9A 1NH6A 3QT2A 3ZT6A 1FNEB 5DA4A 2DWDB 4RGOL 3MC0A 5IROA 1B4JL 1N7ML 1YEJH 4W4OA 2VE6B 3OV6A 1JHTB 1RJYA 5C0DB 4WFGD 5BJTA 3D48R 5L88H 3B5HA 4U1NA 1WF5A 3QIWB 4IMKC 4RRPG 1S7RB 2V17L 2H2SD 1CR9L 3BP5B 4I4WB 4M8QB 1WK0A 1LO2L 2OTWA 3BMWA 1BQLH 5T1LB 1NBYB 4F3FB 1OLZA 1FBIH 5GIRB 1WTGT 4A6YB 2JCCF 5INDB 4LSTL 2ITDA 5DD3H 1J7VR 3SGEI 4M43H 1C8PA 1G9NH 4FFZH 2FD6H 1T0MA 3G5YB 4OCLC 5CZKA 5I17A 3MGAA 3OR6A 1I75A 1U8IB 1IMHC 1VACA 2XT1B 5FYJH 3JV4A 3FFDA 3GBNL 2KUTA 4MXVE 1MCNA 4N9OB 4MNQB 3RTQB 5I1CL 1PZ5A 3BSZH 4NJ9L 1ZHNB 4Y4HA 2EIDA 2H26A 4KAQH 1ZS8A 1M71A 1K6QH 2P5EB 4ODSH 5AWNH 4XNYH 3VXUA 2JIXD 4DN3L 5HI4C 2R69H 1HE7A 3CVHH 4YXKL 1RUPH 3RWHA 2OYPA 5E6IC 3MLSH 5SV3A 1EVUA 3AMKA 5FYKH 2W60B 4NCDA 1TZIA 1YPZE 4ZAKB 2EDNA 5GSVB 1F4HA 5FM5O 3SDCD 5H2BA 1V7NH 5C6PB 1FNAA 5C86A 5L7XL 3ARVA 1F3RB 1RV6X 1S9VA 3VG0L 4HPOL 3O9WC 2P49B 3IFLL 5A1AA 2YKLH 4JJ5A 4YHYB 2R2EA 4CW1B 2G2RA 2YWZA 1MIEL 5E8OA 5DR5H 4X99A 2AERT 3DMMC 3JWDC 3WKML 5FHBH 4PJXE 3H9SD 4CADB 4L3EE 5AZ2H 4O02L 3HI1B 4M7ZB 1M6OB 3BI9X 4M43L 1FL5B 4LCIH 4P46B 2DBLH 5GJTH 1FG2A 3HS0B 4FQIH 1EHXA 1OTUD 2VLRB 4NFDA 5E5UB 1NANI 2LU3A 2D03H 4RNRA 1BVKA 2X5PA 5D93B 5INCA 4XPBH 4Q2ZA 4PGBB 5IOPA 4UQ3B 5L9DL 3RZCB 5MERA 4B7LA 1J5OL 1L7IH 3MRRB 4TUJB 4ZODA 1EEZA 2Z9TA 3W2DH 4R3SB 3F7YA 5CKGA 1JYNA 3WBDA 1UB5A 4G6AD 2R69L 2GTZA 3JTSA 3O11A 5E4EB 1MAML 3B9KB 5I16A 1RIUL 2VXUH 1BQHG 3GMLB 3U0WH 32C2A 4Y5YA 5L2JA 2FCBA 3UJTH 1J8KA 3JTTA 1IKFL 4WHYG 4CAGA 4N9GB 4HC1L 2X6MA 4LHUG 1LP9F 3P0VL 4X4XB 3VXSD 1EMTH 2A9MH 2L4OA 3MV7A 3RTQC 5D1ZD 3ABZA 1KPUB 1JNLL 3MBXH 3MJ6A 3REVB 5I2IA 4RMVA 2JF1A 4P5TD 3T4AA 4U1SB 2UWEA 1TJIH 4D9RE 3MRQA 2G75B 3ZO0A 2ZUYA 2FYYB 2A83A 1XR9A 1LVEA 2DIAA 4M61B 3IDIB 1V8HA 1U6AH 5DMKB 2VQTA 4LSUH 4OKDA 3WNPA 4Z8FL 3QXWA 2CDFA 4LQFL 4WFEE 5F71A 4KJPC 4RX4D 5EC1A 3L3KB 3QUML 4JDTH 5GJTL 3S34L 1DN0A 2BVPB 4I9WE 1M7IA 1NCNA 3EYVB 3TIEB 2XN9E 1KT2B 2D03L 4ZUSB 5IWLC 3RNKA 4M93B 4GMTL 1J0IA 4N90E 1T66D 1GC1L 1XGRB 4NO2B 5CHNA 3T0EA 4FP8H 4YHYC 5ELIA 3DLQR 4RGMC 1AGEB 3G6DH 1UCBH 4FTVD 4HUKB 2GSIB 1OAUH 3HR5B 3VH8A 2FHCA 1I9JL 1KB9K 4GW5B 2NW3A 2OP4H 4GG6A 2AXGA 3QXUA 3OKNA 5DUBA 2Y07H 4PJAE 2FR4B 3W5MA 1I8LC 5CJQH 4OZIB 4AIOA 4JKWA 3CMGA 5C0CB 4Y1AA 3RP1A 1BOGA 2VDOL 3P4LA 5AAWA 5DK2B 3RIFK 2JB6B 4YHZH 5D93C 1AHWA 2W9DL 5C0FB 3F7PC 2X4QB 4I48B 4JFZH 4X6BB 5DD1H 1CL7I 1CD1B 3RZCC 3WS6C 4ZO7A 5GRUH 2A6JA 4KFZC 3TO4D 5CJ5A 3MBXL 1BP3B 4OZ4B 2HFEA 1DQDL 4J6RL 2YD1A 3G5ZB 2YD2A 4HS3A 4B0MM 4Z18A 3FFCE 3S98A 3MBED 1AXIB 1FVDA 4Y89A 4LSPL 1JRHH 1PEZA 5E4EC 4R90L 1CWVA 4GMSH 1YEKH 4FFYH 1HZHL 2R1WB 2J12B 3EOTH 4XMPL 4XAWL 3AU1B 3S96B 1EUTA 4HUMB 4GO6B 1K3IA 4JG1H 1R0AH 3FB7B 5F21B 1A6VL 4HFUH 3BPOB 3VD7A 1KJ3L 3RBGA 2E9BA 3B9AA 1B0GA 4Q9CA 3QDJB 2YD9A 4XBPA 2I24N 4HWBA 4C56E 5E8NA 2IAND 1T83A 4IOSD 1U58B 3NTCH 3B2VH 1E4KC 5IB4A 2FBOJ 5AD0A 3QA3A 1WV7T 3HG1D 2MMXA 1YEIH 4NZRL 1YN6A 3EO1B 3PGFL 3TBYB 1R3HB 5D72L 2Z31A 3RWIA 3HZVA 2VZ1A 2NX5B 5CJQL 4JDVB 1EJOL 5IT2H 1IFHL 4PGDB 1JNNH 2ZCLH 2H8PB 5HI3C 4ZYKB 1A7NL 2FHFA 1XF2B 5CP7B 4KJWD 3ZE0E 2JJSC 4NQSA 4QOKD 2QQKH 4M93C 1OTSC 1S7UB 4QRRA 2HKFL 4JFZL 4MX7B 2BVEA 5DD1L 5GRUL 4UMGA 4ZDHA 4WI4A 1OP3H 5D4QA 5MHSD 1AGBA 1INDH 4RAUA 7CGTA 2VO5A 2OQJB 2BNRA 1YMMD 3LKSA 5FAAA 3GSNB 5BV7B 1CGSL 1FN4A 2F9BT 1UH2A 1DEDA 4GBXB 5EUOA 5MEQB 1ZGLM 3BPNC 3I50H 5LWYH 1OTTD 1KIQA 2DM7A 1S7XA 1BOYA 3NFNA 4XC3H 5I8CB 5IG7A 5HYQA 4DJMA 4GG8B 3IDUA 4YWGH 2VAAA 2HRPL 3QHFH 4MJ5B 4OCWH 3EOAA 3S3PA 2NY3B 4XCEA 2B1HH 1FO0H 1LNUA 2CK2A 3HPJB 2BSSB 1MCQA 1HQRB 5DRZA 2X4OB 3ARDB 3QG6B 4U1KB 2WIIA 4E9LA 5DRXA 4WWKB 1JWSB 5FM5M 3HMXA 4C57C 3FOLB 4R6UA 4QO1A 4DGIL 1TJHL 4PR5A 4GRWH 4UINL 2CMRL 1D5MA 3NTCL 2J8UA 5JTWA 1NGQH 4DVRL 2DS4A 5I30L 1RZGB 1JV5A 2XKUA 1JGUH 1E6OL 3HE6A 1DBKL 4WHYH 3NZHL 5CBEB 4JDZB 3RUGA 5EIVA 3VD3A 5DRNA 1CFNB 1QG3A 2O93L 1D5IH 1QFWH 2FJFB 3N0PB 4WRLA 4LLDA 3K0WA 3C5SB 5HHXH 2GAZA 1JUFA 1CT8A 2IAMA 3VFUA 4NT6B 4LKXA 3KR3L 3OPZH 2PTTA 2B7DT 2EE6A 3HZKA 3AC0A 2BSTB 2JJUA 1I7RB 2GUOA 2AJUL 5LXGL 2C1OB 2DMKA 1INDL 5DHVB 1NBVH 1Q9OB 2DYPD 5C0RL 3W39B 5LGHL 1C16A 4R2GD 3L5XH 1Q9WB 3L5WB 2H41A 5T3ZE 4EKXA 4JFHE 4QXWA 4POZD 4HZAA 1XGUA 3O2DH 4JQVA 3CFDA 3O8XA 1RMFH 5TDNA 4P3DB 1NMBL 3K8MA 1OL0A 4NCC1 1U8JA 4PJ5B 5LWYL 1VFUA 2DQIL 4OFYD 1DQLL 2OZ4H 4G9FD 3ES6B 3RDTC 2BVUA 4PREB 1SJEA 5E99H 5J9PA 2I9LA 1FNSH 5HHNA 5LG1A 4OCWL 4YXHL 1FO0L 3KPRE 1MRCL 1J0KA 4WNQB 1XR8A 1SBBA 2ZWLT 2YUWA 3OXRB 5EBMA 2AJVL 3LKOA 3BUYB 4LCWD 3ULVE 2FRGP 3P0YL 2F74A 3CU7A 3UZEA 1QSEE 3MREA 3SOBL 4AM0A 1KCKA 1Q0YL 4XP1H 1QNZH 5ERWB 3U4BH 5BV7C 1VFAA 2VTFA 4K3JL 3UYOD 1NGQL 3O3EA 4PY8I 1QBMH 4P49A 2IPTL 1FL6A 4GBXC 4HMEA 3SJVB 5FB8A 4ELME 3C60D 3O3UN 4X8JB 3RJQB 1XIWB 2ZNWA 4F2MB 3FQTB 1T5WB 2HP4A 3FT3A 3SKMA 4NN5B 1TQBC 3ROOA 1PLGL 3QDMB 3NIDF 2XWTA 4G43A 4NUGL 1R6VA 4LLMB 1JGDA 1U92A 1PVHA 1KOAA 1NEZA 4L4VD 4RAVA 4HX1B 4KKNA 5SX5K 3VXNB 3OPZL 2YN5A 3B83A 2BHZA 4HFWA 2UVFA 4EXPX 1IGMH 2B1AH 2PTVA 4BQ6A 4LARH 1HHIA 1FFNB 3E0GA 3LEYH 3CFKB 4YR6A 4U1HB 1A2YB 3BQUB 5K93A 3L5XL 4NWUH 4ZTOH 8CGTA 4AQOA 4OT1L 1RMFL 1UJ3A 2Q1EA 1T1WB 2J2ZA 3HCVA 3DUSB 2IMMA 4BA8A 3UC0H 3TFKC 3V5HA 3BH9A 25C8L 1AE6L 4O2FB 4F37F 5E2TH 5CD5D 2VSCA 5EIIA 1OGTB 4NP4L 1ETZA 4IIQA 2W9EL 4X7EC 4I5BB 1BQSA 3RWDA 1JPTH 4H8WH 5EIQA 3C6LA 4P3CH 3GKWH 5DTFB 2GJ6B 3QWOA 2C3VA 2X05A 1U3HB 1GXEA 3FQNA 4JFOA 1T04A 1TDQA 1QNZL 5H94B 3VWKD 3NIFF 3KLAA 4PRHA 2Y4SA 3D85A 4NQCA 2IQAB 3ZDYE 2WK2A 1N2RA 3HE7A 3VDCA 1UXSA 1FZKA 1OAYH 4NSKA 3G6JE 3ALWA 1D5ZB 2HLFC 5F70A 4XHJD 2VUOA 4N0FB 1NANH 3F65A 1KTLA 1CGYA 3BKCL 5FYJD 4POUB 3H9SE 4JRYA 3S4SG 4F9PA 5F6HJ 2D4DA 5CEYA 3QZWB 1BLNA 3MLTB 3AAZA 2NZ9C 3HUJA 5DQ9B 4PRPA 5T1KA 1MFCH 1LP9B 5IGXL 2MSPA 2BVYA 1K8DB 2X42A 1DUZA 5KZCB 2AEPH 3LSOA 4KPHH 1T0NB 4IOIA 4S1QH 4MA7L 3M8OH 3L3IA 1XIWC 3K4DA 5DDHB 4OV5B 2AJXH 5FYKD 4NQUA 4R7NB 1MY7A 5DJ6B 4G5ZH 4XP6L 3QPXH 2Z93A 4HUUA 1BFVL 5FA4A 4LRNL 2VL5A 4HSQA 4ZPVB 3A6CL 1SY6A 2C4FU 4JKPH 4U1MB 2CDEA 4H8WL 2XWBA 2AS5M 5B38G 3EDFA 1EFXA 5IIEA 1DP0A 3O6ML 3UP1A 1MEXH 3ARED 3FB8A 4NFBA 3BQUC 5DSCA 1CLOH 3WFBL 5HD8D 3R8QA 4HWBL 1N64L 5DQDH 4AJ0A 3LS4H 4PJ7E 3L7EB 1NGZB 4XPTH 5L2KB 3T0WA 5D70H 2CXGA 1YQ2A 5F7EH 2HMID 5C71A 4X4MA 4TYUA 1WC7B 2N4IA 1P2CB 3UBXB 3NOIA 4YDIH 4ELKA 1XZ0A 3HC0B 5KANI 3JWOH 4KDTA 1NFDB 4Y16A 4RIRB 5EBGA 2YK1L 4LCCB 4NQVA 4FXKA 1DBJL 4OZHE 4JM2A 1GGCL 3WE6A 1U3HC 2P4AB 4YGVB 1U2CA 2YPVH 3CSYB 4JN2A 4F7TA 4MAYC 3WIFB 1D9KA 1YEDA 3GNML 4WW2A 5FGBC 3X12B 4XVJH 4OQTH 5DA0B 2N56A 1JWUB 4UI2A 4LSSH 4OQ1A 1F4YL 2AJXL 3C8HA 1CLZL 2K7PA 1I1AB 1C5CH 2AEQL 1N8ZA 4E41D 1JF1A 4Q9QH 4XWOC 5CMAB 5BRZD 2Y23A 3THML 4I0KA 5JXAL 1TJGH 2X7LA 5F97E 4EBQL 2YN3A 5HGHB 1AXSA 2QSCH 1UWEL 1K8IA 2ESVA 3ZKMC 2ZCKL 4FFVC 4QKXB 4JY4A 4B50A 1QFOA 4TSBL 2R1YB 5IB3B 3BFOA 3HMXL 1HQ4B 5IM7B 4M5ZH 2FEDC 4V1DA 3HLAB 2HFFA 4XPTL 4DW2L 1A7PL 5DD6A 1G0XA 5H35B 2X89A 5EO0A 4ODHH 3TBVA 3CK0H 1MRDH 4K3DH 1IGIL 4WTZA 1DTUA 2MOVA 3HNTH 4QRTA 5GS1A 3IDXL 43CAB 4WFHE 4G6ML 1EO7A 4L9DA 5J3HD 2G60H 3WUZA 2A6KB 1UACL 2BXYA 1BD2D 4F15B 1LO4L 4JG0L 4CUCA 3OGCB 3OKLA 1FLRH 5DJAA 5TF1L 1JN6B 3GRWH 2LFGA 3HA0A 1SJVA 1EK3A 2Y36L 3DI2B 4XMLL 4H1LA 5ETUB 3D0LB 1A0QL 3G08B 4ODXB 2IANE 5I1LB 4OF0A 5ICYA 3ZMRA 8FABB 3K7UA 3DO7B 1U8MB 3P4NB 3WIIH 2QSQA 3G9AB 1UM6L 4D0DB 2IEPA 1IAOA 4Z0BL 1NCAH 4F7MA 3TZVB 3CH1A 5K9JL 3RX5A 4I3SH 1FLTX 1HNFA 1WWCA 1A64A 2I5YH 4PJGF 1TJGL 4M6ML 1XAUA 1BFTA 1BQUA 4MJIE 1FZMA 2QSCL 4R9HA 3MOAH 3QEGH 2QQLL 2ZP0T 3TJHD 4P5MB 2V6HA 5HPOA 3BKML 3T3MF 1JPSL 1INEL 5SWZA 1IGJB 5DJYA 5KSBA 1T6WA 2M26A 3SCMB