4YIQA

Structure of the ceacam6-ceacam8 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 8
publication title Diverse oligomeric states of CEACAM IgV domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yiqA00
5TE4H 3B9KA 1S8DA 1YMME 5FAAA 3WD5H 5HI5C 4G8GD 5HHMB 3ARRA 5CWSA 1U8PB 2CRYA 3KLDA 1G9MH 3B6SA 3MRHA 5JOFB 1NC2B 4MGXA 2GSGB 5FYKL 3WXVL 3WHE0 4PJAA 1AD0B 1MFEH 3PP4L 4WFFE 4UNTA 1KV3A 4KZEL 4UNUA 3ZYOA 3DMMB 4LPXA 3AMKA 4PJ7F 4JFXA 3WNNA 1S3KL 1NGWB 3QIWC 5J3HC 5E24E 3LV3A 4LSSL 2AP2A 4YGVB 2X4RA 1OB1B 2BVUA 3O3UN 2A6IA 3IKCA 4MCZA 3MJ9H 3V5DA 5GSVA 2UWEA 5CSZA 4M7JH 4K3EH 1MCHA 4F9PC 1HHIB 5DJAA 3WNPA 5HHVL 1S7RA 1TTUA 2APFA 3B8YA 2BVYA 3MGTB 4JHBA 4ODHH 1J8HB 3NOIA 2DMKA 8FABB 4N0FB 4YE4H 3UBXB 5IQ7L 4HGMA 2X4SA 4DGIL 2C3VB 4OQTH 4X6CF 3VXMD 1NCBH 2XT1B 1P7KB 3MACH 4I18B 4Y1AE 3MMEA 4LHQB 2W65B 3MRKB 3SDYH 1MUJA 1DQLH 4R97B 3DVNA 3K74B 3CXHJ 1Y0LB 2VLJB 3HZVA 1YNTB 1GIGH 2PR4H 3RJQB 4E41B 1S5IH 3QDJB 1OGAA 2V9QA 1A7RL 4FQ1H 3KPSA 5FV1L 3UEZA 1MPAL 1KCUL 2Q8BL 2ZUWA 4ZFGH 3UTQB 4N0YL 5SV4A 5ERWA 2X4OB 1TIUA 1OF2A 4K07A 4FQ2L 1QBMH 1UWGL 3ZDYF 4NNXB 4CL7A 4L5FL 1U8PA 3VH8A 4IRSB 2PW2B 4EUPB 4FQJH 1RZ7L 3GDBA 4GRMA 2DM7A 4PJCE 5FM8A 3AS0A 2Y5TB 4NC0B 5CJQL 4NRYA 2GSGA 1LDSA 1KNOB 5E99H 2H2PD 1AD0A 4ZOBA 5T1LD 4XNYL 3F7YB 2A73B 4CADA 3DMMA 4GMSH 3SKJL 1FPTH 5IB3B 4HC1A 5KVMC 2JIXB 5B3NA 4YGVA 2I25N 3PL6C 4LQ1A 1OB1A 3UTSD 4DCQB 4PTUA 3D87B 5E8EB 3BPNB 1OAUH 1HHIA 5GS1B 3V52H 5EUOB 1P7QD 4N90E 2FATL 3GMRA 3D2UD 3WEXA 3RWGB 3MGTA 4FXGB 4N0FA 1T5WB 2HTLD 1N64H 5HVGB 3OPZH 5F7WC 4Z76B 1EAJA 2C3VA 2F19H 3TT3L 5ILTL 4KJWC 4RISH 4I18A 2ZOLA 2W65A 3MRKA 5E4EB 3C8HA 1Y0LA 3SKMB 4DQOH 2VLJA 4TNWK 4HK3J 1KJMB 1YNTA 1RZJC 4E41A 5AD0A 4DTGH 4P23C 3SGJA 1Q9WA 1HCVA 2GJZB 1YNLH 4C56B 4KTDL 2XWJB 5FECB 4X7CC 1DR9A 1IZJA 3QUXD 1RZ8B 3G5YB 1DE4B 2GJ6B 2ESVB 3TNNA 3WUZA 1BHGA 3ROLA 5DGQA 4JM2C 2PW2A 3OWEA 3QH3B 1ZOXA 2Y5TA 5I1EL 1RHHB 4JCLA 1H3UA 2OR9L 1UYWL 4CW1B 4J4PD 2CH8A 3F7YA 2A73A 3P9MA 3ZE2E 4JO1H 3OAYH 1U91B 3S88H 5HPOA 1P84K 1F2XK 2HFFA 5IB3A 4LK4A 5EA0H 2AKRB 4J3SA 3H9HB 2PO6D 3QIUC 4JN1L 3N1MC 5SWZB 4NQVB 1IAKB 1DUYB 4DCQA 2OP4L 4GAGL 1JIBA 3BKML 3DNKA 3N85L 3RNQA 5CP3H 2DF3A 3VG0H 3CC5B 4TTDC 4RMVA 1FO0B 3RPIB 5EUOA 3GB7B 3T0WA 4ZAKA 2GY5A 3RWGA 4RRPA 4FXGA 4LSQL 5ID0B 4FQIH 4NYLA 1F58L 1T5WA 1ACZA 3L5JA 4IIQC 1BLNB 3BD5A 4Z76A 3QUKB 4JRXE 4XPAH 2XKSA 5IR1B 3DYPA 4B5EA 2ICCA 4U6XB 5C0BA 3HMXH 1S9YB 3OGCB 3PE9A 4PJ9C 4Q6IB 3RUGE 4POYA 2HVKB 1KJMA 2QADB 1XH3B 5DA4A 3HPLA 2IF7A 2ARWA 5D1QB 1J5OH 4HJJH 5E1HB 1IGIL 3F58L 5DTFB 3O8XA 4NKOA 4C56A 2WWMC 4WWID 2XWJA 1I9JL 5FECA 3ARFB 1ED3B 3TH4T 5GZNC 5DLML 1RZ8A 1DE4A 2GJ6A 4K9EL 2ESVA 2NY4C 1E4XL 3MR9B 1MCNA 1JNNL 3DX8A 1RK1B 4U1NB 4FZ8L 4F57H 3FONB 5IROC 5T33L 1UCBL 4P49A 4PJHB 4A2LA 2CD0A 2EXYC 3QEGH 4OCRL 1KC5H 4XC1L 3QH3A 5FYKE 1RHHA 1QVOA 4JR9L 4QRUB 3RIAK 3ZTJH 4CW1A 4QHNB 1UM4L 4BUGA 1U91A 4ODSL 5GQBA 3GZKA 3O45B 2IAMD 4GKSB 3RWHA 2VAAA 3H9HA 5C07A 2P44B 5HVWA 5DRWB 1MAJA 3B5TA 1X7QB 3O2WH 1L7TL 4NQVA 1IAKA 5IP4A 2EIDA 3DI3B 1OTSC 3AS1A 4H88L 1F4YL 4YHLL 4ODVL 4Y16C 3CC5A 1MCWM 1B90A 1FO0A 4KHTL 4HXAH 5CUSH 3RPIA 3WJJA 3GB7A 2AK4E 3PWPD 4C58B 1DVFA 1KIUA 4MZ3A 2W0PA 4ZTOL 1BLNA 1BM3L 4K8RC 3GBML 3G08B 1Z5LB 4WTZA 1UACH 1RUPL 4HJGB 5L2KB 1D7FA 3IFOA 4U6XA 4YBQD 2JF1A 5CSBA 1S9YA 3BYYA 3VGBA 3OGCA 3P4OB 4Q6IA 4PJ5E 4KRPB 3GO1H 1HXYB 5DJ0B 1XGYL 5D1QA 5C0DB 3X13A 3WIIL 4KVCL 4NQDD 4K23H 1FL6B 3CPLA 4WI9A 3VGGA 4FZEH 4R6UA 3ARFA 1ED3A 3LOWA 1ADQH 1H5BC 1JPST 3V4UL 4H1LA 1Y18B 2B2XH 4X6FB 2KDGA 2EEBA 2F53B 3FONA 1FYTB 2E8YA 4H26A 4PJHA 1ZE3C 4X4XB 1LEIB 2A9MH 2HYMA 4J6RH 3RA7H 4WO4A 5KN5B 1G7HB 4GXUN 2GT9B 2CK0H 4QRUA 5GS0L 1QPXA 3QFJE 5MI0C 4Y19D 2BVOB 4KMQA 5IEKB 5L8KB 4W4OC 1MLBB 1WCQA 1UQSB 4HIHB 1B2WL 3D39D 4GKSA 3QDMB 4QOKE 4MAYB 3FHAA 1X7QA 3KYKL 4OM0L 5D6DA 5F7DB 3OAZH 1XGQB 1OTTD 2NX5E 3QFDB 4KVNH 4GG6A 1NDMB 4NJ9L 3HB3D 4MYWB 4Z7QE 2OZ4H 1MREH 2Z9TA 3FO2A 2IMNA 4L3ED 4P2RD 1ZWIB 5E1AB 1EZVY 1T2QH 4NO0D 4A6YA 2HH0H 3O9WD 1MQKH 1ZXQA 2ENSA 4KK5D 1FGVL 1FNSL 3G08A 1Z5LA 5D72H 3UBXG 4UT7L 4HJGA 4NWUH 5L2KA 5DD3L 4UT6L 4I2XE 4MNGE 1F42A 4N0UB 2VXQH 4KTEL 5DQJA 2HN7B 4WU5B 4TSBH 5SX5K 3HI6L 2R0LH 1OD9A 1HXYA 1BQLH 4F7PA 1FL6A 4M3KB 2Z93B 4Q9CA 2HT2C 5DGRA 1JGVH 1QFUL 1WGOA 5F72S 2FX9H 5IHBA 5FO7B 1Y18A 4U1MA 3WKNA 3BKYL 4Z7VF 4X6FA 3IU4L 2F53A 1I9RL 4U1IA 2DQHL 1FYTA 1IGJB 5DMJB 1LEIA 1IGYB 5HYJA 5DC0A 4N1HB 5KN5A 2Q86A 5J1SC 4EUPG 5KVFH 1P4BH 4PJEF 1OGTA 5ELIA 1PSKL 3TO4D 2BVOA 5IEKA 1YEJL 1FFPB 3EFFB 5D2LB 1UQSA 4HIHA 2UWEF 3QDMA 4G7VH 2ORBL 5EU6B 3RQ3A 1XZ0B 3GSNL 2DIBA 5F7DA 3P11L 1XGQA 3QFDA 5ESQB 3FQUA 1KB5L 1UM5H 1NDMA 4BQBA 2BNRE 1ONQB 4XI5C 2GCYB 4ZYKB 3LRSA 1WEJH 3MRFB 1X5KA 1YEGL 2C4FU 2IFFH 3PDDA 3IDXL 2NY0C 2YEZB 5E1AA 1I75A 3KXFB 1RIVH 4WEBH 4U0RB 1TNNA 3EO9L 4HS6B 2VLRE 2VDKH 3CXDH 3NCMA 4HLJA 3L3KB 2P49B 2VZOA 1JE6A 4N0UA 7CGTA 1MVFA 4XVSH 2ZCHH 5DHYB 4WU5A 5T1DH 4YPJA 4RSVA 5JHLL 5HGAB 5J06A 1U8QB 3HRZB 1GGBH 3BUTA 3KPOA 4Y5VC 4DFIA 3QULB 5FO7A 4OKVB 4NQEA 1AKJD 1HKFA 4WFGE 2EKSB 1JWSB 2YPKB 3MUGB 4XP6H 5JIPA 1FG9C 4HWEL 5HGBB 2BXZA 5EU7C 3V4PL 3LB6D 1INDH 4QTHA 3QEQE 1ZGLM 3O6LL 4KV5F 4OAWB 5ACZB 3BRGC 4WUUE 3MCKB 15C8L 4TRPH 3LKNB 3EFFA 5D2LA 3HHRB 3AY4C 4I1NB 5IMOB 5IF0B 2H8PB 3HTLX 1AR2A 2DIJA 5GIRA 5E8PB 5EU6A 4CVXB 1XZ0A 4R90H 4QXWA 3EYQC 4WDIB 3CFEB 4PTTB 1W0VB 1NL0L 3LQAC 3WIHL 3LY6A 3MRFA 5I1DA 2MQCA 4OT1H 3MOBL 5I1LB 1IKNC 2YEZA 1E4XI 3EUUA 4ZQKB 3KXFA 4R4BA 3U0WH 4HS6A 3MV8E 2GTZB 4HPYH 1KGCD 1KENH 3SE4A 1IC5H 3K81A 4Y2OA 1EGJH 3WKMH 1TMCB 4R2GC 2WM0A 3SJVD 5BOZG 2YMXH 1TPXB 4Y4FB 4C4KO 5B3JF 1WCBB 5TFSL 4M6NH 5MENB 1F8TH 3TWCL 3UPCA 1U8QA 1EIBA 3AU1A 2C3HA 1U6AH 2WIIB 5HHOD 2OM5A 3Q3GB 3C5ZD 1NEZG 3MC0A 4OKVA 1EFQA 4LCWD 5KSAB 2EKSA 1JWSA 1DN0B 2YPKA 5DT1H 4X80L 4DK3A 5HGBA 1QPPA 4ZXBB 1JZ2A 3RU8H 3CSGA 4OAWA 4EI6A 5ACZA 3DSNA 4M48H 4BH7B 1AD9B 1UH3A 3CK0L 1C1EL 3UAJC 5C8JB 4PY8I 5HY9A 2XQBL 1AH1A 3LKNA 1Q9OB 4XPGH 3NH7L 3UP1A 1IFHH 4FTVB 1I1FB 5IF0A 2H8PA 5D70H 4HUNB 5EZLB 1KJ2L 4YNYB 5C08E 1OAZL 5E8PA 4CVXA 3WUWG 4ZSOB 4MA3A 5EC1A 1LWRA 3CFEA 4XNQB 1I1YB 1T5XB 1F90H 5KS9F 4AEIH 4U1SB 2E9JA 5I1LA 4ZQKA 4Y5YA 4Z0XB 4YZFE 1FIEA 5C3LD 3CSYB 4KKBD 4PJ7B 2GTZA 4RMRA 3QG7H 4UQ3B 2Y4SA 4P46C 5IV2A 4Y4FA 3U4BL 3DJ9A 2BVEA 3GMPB 3NABH 2NNAA 1VFOA 4EOWH 1HNFA 2W60A 3O3DA 1XIWB 2P42B 1NCTA 2G60H 3TJEH 2WIIA 2DQUL 3KPLB 3Q3GA 1A7PH 1AGDB 2BNQB 1OPGL 3MODH 5D4QA 3T4AB 3FZUC 1DN0A 5DHVH 1HCFX 2QHLA 2APBA 4OCYH 4P2QD 4ALAH 3MJGX 4GKZB 4TUKH 3DPBA 4ZXBA 3ULUD 4RDQF 3WXWH 3ETBF 3QRGH 1CE1H 3DOSA 1UXSB 4KQ4H 1T03L 4YHZL 5AYQA 5E00B 5C8JA 5GJTL 1BBJA 3BRDA 1Q9OA 3O2DH 2YD4A 1UFUA 4WW2C 5FUZH 4LLMB 2J5LB 1I1FA 4CVZB 3OKKA 4ZPVA 5D5MB 1U3HC 2XA8L 3FFCD 2OK0H 5ICZB 1CK0H 4HFUL 4PRPE 3I6KB 4L1HA 4ZSOA 5BZDB 1UZ6E 3EJZD 4GLRH 1CLYH 4XNQA 1T5XA 4LSTL 4U4BA 2OTUA 3EIFA 4U1SA 1I8KB 5F70A 3VWJD 3RY5A 2BVQB 4TTGA 4O2CB 4JM4L 1M7IB 4MXQC 3BAEH 5F7FA 4OLWH 4Z0XA 1F4AA 3L3DB 4QT5B 5C7XH 1QSFD 4X9BA 3CSYA 3V0AC 5DEGA 5EULV 1CYGA 1MQ8A 4UQ3A 2UYLB 2I9LB 2XTJD 2F5AL 3D1MC 1HQ4B 1KXVC 1YYLH 4OZIB 2E7LC 3QUZA 4L9LC 5KSBB 3HKFA 4PJXB 1XIWA 3LZFH 4NUGL 4JHWL 4P2CG 4IDJL 3W81A 5EZIH 4NQSB 1KEGL 3KPLA 4NQXB 1AGDA 4FFZH 3FO9B 3U6RA 5E6IC 5HHMD 2FGZA 3QDGD 2Q3AA 5ACMA 2XTLA 5C0JB 5TF1H 3GIZL 2HMID 5TQ2L 1NC2D 5KG9A 2XNAB 4LGRB 4POZD 1WIOA 4HKBB 5HJ3B 3C60C 1RZJH 2ZUXA 2DQJH 4L29B 5L7XL 5J11B 2E27L 1UXSA 4PB9L 3ARWA 3RVXD 4XMKH 5E00A 5E6YA 4D3CL 4WHTA 4HWNA 5AZEH 4LLMA 4CVZA 1IM9B 4GG6F 4FQXB 4EEEA 1I1AA 5BZDA 3MJ9A 2EE3A 3H9YA 4G8EB 4KI5C 3REVB 3NTCH 4OCWH 5D71L 3N1GC 5FM4A 1J8HD 1HKLH 4JAMA 4XP9L 1I8KA 2DICA 5ADPL 5T3ZD 1A6ZB 3RGVB 4L4VA 4M7LL 4O2CA 1M7IA 2WLZA 1ZS8B 2W0LA 4UTAL 5JIKA 1NCCH 4OQTA 5FCUL 5M95B 5C2BH 2UYLA 3EO0B 2I9LA 1X4ZA 1X44A 3P4LA 1M05B 4WFEE 3QDJD 2P7TB 2FHCA 4OZIA 3TLRA 3QWRD 2X89A 3D0LB 5KSBA 2O5ZH 5I75B 4QHLB 1KJ3L 4K7PY 3SDCD 2ZUTA 5CIPH 2HJLB 4NQSA 5I9QC 5IMMB 3BD4A 1JTTA 4YXKL 3FO9A 3O0RL 4IRSD 3VGAC 5EORH 2VLKA 3BPOC 3QA3A 3VFVB 1SYVB 3GMOB 5F9JB 5C0JA 3K2UH 1T7ZA 1U58A 2I24N 1U3YA 4D9RE 5HJ3A 25C8H 2NY7H 5J56B 1FZMB 3EYFB 4L29A 4N8CL 4NN7B 5GRUH 2ATPB 2VXTH 5C0GB 4JQIH 1JFQH 1ZSDB 1DQMH 2JIXD 5DJZB 4YXLH 5ISZB 1A3LH 1QLRB 3MRDA 3HR5B 2FJFB 1GAFL 1IM9A 2DWEB 2BY1A 4L4TA 3D85A 2I26N 2R9HD 3RWDB 3QPQC 3O4LD 2PN5A 3A67L 3T1FA 4HBCL 4G8EA 2A6JB 3NGBB 5EU7E 3REVA 2CDEB 4ZOEA 2J3SA 3VFOB 3MQIA 1J1OL 2DKSA 5DRZB 3RGVA 5FO8B 5E08L 2BRRH 5FYLD 1ZS8A 3BW9B 2Y07L 5C0RL 3UBXI 2BX5A 4EI5A 4M93B 2R2HA 3FJTA 1Q1JH 3F6IA 3SDXB 2FJHB 5I8EB 4Q2ZB 1J05B 4OLXL 2P7TA 3HNTL 4Z5RB 4W70A 3D0LA 4XPHH 4PB0H 2R0KH 4HZLB 1DBML 4AQ1B 2K3TA 3RKDD 3S3PA 2APTA 3LDBC 3UJJH 2EDEA 2HJLA 5IMMA 4K8RH 3OZ9L 2PTTA 3EYUH 1Q0YL 4O2EB 2W9LA 4PV8B 3RAJH 4HMCA 3VFVA 1SYVA 1OAXL 2HTLC 3GMOA 4QRRD 1G6VK 3HMWH 1T0MB 5HDBE 7FABL 1CZ8H 2D7PA 1FZMA 4OLVL 4NO2B 4NSKB 5BVPL 1XR8B 5DJZA 1IL1B 4HCRL 5ISZA 1QLRA 2ZSWB 4K3DL 5SWZD 4HEME 3HR5A 1NBVL 1K8DB 4I77H 5TJWK 5I1IH 3HPJB 1FAIL 4DKDC 1JRHH 4RMSA 1ORSB 1JNLH 2A6JA 3QUXC 4O5LH 5C71A 4D0DA 1MI5B 2CDEA 2X5PA 2H2SD 5CP3A 5HDQH 1L0XA 4EXKA 3P77B 5DRZA 3C6LB 5FDWB 3T3PF 2PYEB 4UV7L 1G7LB 3BW9A 3MRJB 3ZKSD 1FDLH 3IU3A 2KKQA 1OM3H 2DQEL 4Q9BA 2DS4A 4KY1L 4QRSB 4RBPH 2FJHA 3SDXA 5I8EA 3MRIB 1FRGL 3HMXA 4Z5RA 1U93B 1GJIA 4OBRA 1IGCL 4HZLA 1AI1L 4LNRA 2DKUA 3PXJA 5CZVH 4PRHB 2LVCA 3MLUL 2V5SA 3C87A 4AH2B 3FQRB 1AQKL 4YO0A 4PJDF 3QCVH 5LQBH 2H32B 1YMHB 3PWUA 3O6FB 4PV8A 4XCFL 1OY3B 1YMMA 5LWYL 3HR6A 3ZLQC 5DMGD 2I5YL 1T0MA 4MA1B 5GGVL 4G3YL 1A8JH 2OI9C 1ZEAL 4KKNA 3ARGB 4GS7C 5ITFA 2HWZH 1C5BH 5HHXL 4NO2A 4NSKA 1OAKL 3T2OA 4RGMC 4Z8FL 1XR8A 2VJXA 4G43B 5BV7C 3IAGC 2HRPH 1OSZB 2ZSWA 1K8DA 4HW6A 3HPJA 1TJHL 3BVNB 2V5YA 5LJYH 1F02I 4HPOL 4U6VL 2ICWA 1ORSA 4OD1H 4OCLC 2EECA 3C08H 3MV7B 1MI5A 4HUMB 3LN4A 4OI9A 1CFBA 4MNHB 3C6LA 5CINL 1EX0A 2ZWLT 2PYEA 2AEWA 4PLNC 4Q9QL 3KPNA 1KTDB 3UJIL 2XQYK 2IPUK 5MEQA 4YFLF 2FR4B 4Y1AA 1NH6A 4KRPD 3ZDXE 2IAMC 4LVHC 4ZO8A 5D6CA 4CMMA 3MYJB 4UILL 1LP9B 1U93A 3HG1B 2I27N 2RFXA 3RP1A 5DHXB 2AEQL 3FQTB 1UJ3B 1R5WB 4AH2A 1H3VA 1RUQL 1REIA 1FFRA 3FQRA 4ZFOL 1IC7H 3X3FH 3ARBD 1ADQA 1YMHA 2YPVL 3T08A 1JZ6A 4PJFE 4M3JA 3TPUB 5EO0B 1TQBC 3HNSL 1SM3L 1CXLA 1CF8H 3DYOA 1N4XH 4BZ2H 3MBED 4LRNH 3ARGA 4F7MB 4NZUH 4JKMA 5TPWH 2LE9A 4YBQC 3BPCB 2VXSH 4LSDA 5HDLA 1KG0B 4MAYD 2PUQT 1ZLWK 2O5XL 2VQTA 1OSZA 4PJ8B 3WCYA 2AS5M 3LAFA 4CNIA 3SQBA 4WI3A 2WIMA 4XPFL 4RFNC 3BVNA 2VWEC 4HK0B 1IE5A 1AJ7H 1QRNE 3T65A 4DGYL 4J3UA 1A3RL 5IVXE 5JHDE 3AVEA 3MV7A 3RBSA 3DXAB 3UZVB 3TA3B 4K94L 4FABL 2G2RA 3JZ7A 4Y4KB 2OZ4A 5TDNB 5JORB 4MNHA 5E95B 2IG2H 5C0CD 4X4ZA 3BKJL 3O4OC 1NMCC 3LHPL 4Z7OF 5DUBB 3QI9A 4PRIE 3VG9B 5DMKB 1T89C 1C7SA 2A1WL 3Q5TA 1PFCA 5EU3B 5A43C 1SEBA 2XWBB 1MVUB 3MYJA 3C6SA 4KI5E 2IFGA 4HZAA 4WI8A 3E8UL 3D9AL 3LQAH 2VDMH 3VXPB 5HHPA 4G8GE 1OTTC 4H20L 2XQYG 3FQTA 1ZLSL 2IPUG 1UJ3A 2V5MA 3ZT7A 3M1BB 4NRXB 3FT3B 5ABDE 3TYFB 3HB3C 5E2VL 4XPTL 5IUSA 3RFZC 2E5EA 3O6KH 1BVZA 1GPOH 4OGZA 2B0SH 3TPUA 4HS8H 3O9WC 4L8CB 4KK5C 3SOBL 5EO0A 3H7BA 4QRPB 5DQ9A 2VDQL 4RZCB 4R26L 4FQQB 4DN3H 1SHMA 4F7MA 4D94A 3TBTA 5IG7B 4TPRL 3BPCA 5F1IA 5EBWB 4MLIA 1KG0A 2DWDB 4OLZL 5A16B 3PV7A 4TSCH 1BIHA 2YZ8A 4N9OB 4JFQB 3GSXB 5IGXL 4YXHL 4HK0A 2VXUL 3VI4E 5MEOB 3LKRB 4NOBA 1I4FA 3DXAA 4R3SA 3VXME 1L0QA 3HZKB 4OGXH 4G8FB 5F1SA 4GXVL 4YBLB 5TDNA 5JORA 1PKQE 1AE6L 2QHRH 1YECL 2P5WB 1EEYA 1EEZA 4K2UL 1MRCH 1KIPA 3GRWL 4DVRH 1CICB 5B8CC 3DLQR 1BZ7B 1J86A 1XGUB 4MB4A 5DUBA 4YDLB 3X12B 1B0WA 1U8LB 5DMKA 4M7LT 4O58H 3TO4C 3TVMB 4PGCB 3ILPA 5EN2A 2XWBA 2BJML 5F21B 5E8OB 4G9FB 1MVUA 3U83A 5KOVC 4KJQD 4AIOA 5JR1L 1KACB 2BY3A 3SKNA 3VXPA 3TIDB 4YHIB 1DBJH 1S9VA 3FT3A 1R24B 3MLVL 3QCUL 4M61B 2R56L 4W6XB 3L5WA 4P2OA 4PYGA 3JTSA 4L8CA 4HUWB 5K9JL 4QRPA 4RCAA 4RZCA 5E2WH 5EBMA 4HEPG 3IETA 4ELKA 2N1KA 1JF5A 4FQQA 2BSRA 3F5WB 2FL5B 1BIIB 3UTSE 1RURL 2W9DH 4LCCC 1MHEB 2W07A 3MXWL 3WN5B 1N6UA 1QA9B 3H42L 3MJ7B 5EBWA 5D8JH 1TVBB 3GSXA 3KJ6L 5TDOB 4WJ5B 1AO7E 2DJUA 5GISH 5E5MB 5H37G 3LKRA 3L5XH 5JDSB 1Z9SA 3INUH 5A40E 3E6FA 4G8FA 3V4VL 1I8IB 2OJZH 4POUB 3U79A 1W0YT 4JRYB 3QHZL 1E4KA 3LB6C 4YHNB 3ZKXC 1CICA 4OZFH 2BVPA 1XGUA 4PRNB 5F7LB 4HDIB 3QIWB 1RVFL 3X12A 1U8LA 4HG4J 1GC1L 3DSFL 4PGCA 1EGJA 1CDGA 5MEND 5E8OA 2EYTB 35C8H 2JK5A 1VGKA 2Q3ZA 4PJ5A 1F6FB 5KVDH 5K33A 4YFEA 3CMOH 1RZKH 3B8SA 4ODXB 3TIDA 4YHIA 3K8KA 3ZHLA 4HH9B 5E9DD 1KXTB 1R24A 4M43L 5KSAD 2EICA 1A7NL 1RQ5A 1TXKA 5JQ6L 1CLOL 3IXTA 2EEDA 3QUYA 2F8XC 5JOPD 5CD3B 4TOYL 5TQ0H 4ZUWB 1HHHB 4HUWA 4M5ZL 3UTTB 3LCYA 4QEGA 4XNMB 3OKLB 4M1DL 2WUCL 4HUUA 1JHTB 5TE6H 5D2NC 3HE6D 4RGOH 4LAQL 3QNXA 3F5WA 1BIIA 4HWBH 5L2JB 4F58L 2DQGH 3WN5A 3QFJA 5DD6A 1QA9A 2R1WA 3MJ7A 4KKCD 5JW5B 4FTVD 1FBIL 2HJKA 4OCNC 1TVBA 2CRMA 3ZO0A 4MXVF 4QOKA 1YUHA 2BC4B 3PGFH 2VN4A 3PWVA 4Z7WB 1IARB 3QBTB 3C5ZC 5ESAB 2IPTL 2VDRL 4PY7B 2V5TA 1I8IA 3AREC 4O00A 3NIGE 4FQLH 2HFGL 4I3SL 1QSED 4JRYA 4KFZC 4YHNA 4YDVB 2P47B 4UUJB 4PRNA 2Z91B 4HDIA 3QIWA 4N1EA 3V0VB 1NFDB 3DGCR 2PCPB 4LU5H 1EO5A 3PL6B 2WMPA 4R7NB 1YYML 2ZG1A 3SN6N 2NZIA 4F9PA 3IFNL 5E7BA 1CQKA 3ZDZE 2BNQD 1D5ZB 2A83A 5FUOL 4JVPA 5KSVA 1DFBH 1J8KA 3QXDA 5DI8B 2E7CA 4Y4HB 1P4IL 4LBEB 4U2ZA 1JZ7A 4HIJB 5CD3A 5DHVA 1KFAH 4ZUWA 1HHHA 1OP3H 5JXAL 4KKBC 4XNMA 3OKLA 5D96C 1TQCC 2ZKHL 4HV8A 4LPYA 3DX6B 1F4WL 4N9GB 5D9SB 2CKBL 5L2JA 5E8DL 4P23B 5BJTB 1D9KB 2J2ZA 5JW5A 4Z77A 4OSUH 1M7XA 1Q38A 3TFKD 3O2DA 3PWPE 4P3CH 1FCCA 1KBGL 3GK8L 3JXAA 3MRNA 1O7VA 1X5ZA 4Z7WA 5I15H 4JM2B 4PS4H 2CUIA 5K9KA 1VCAA 2BNRA 4JB9L 4NWTL 4M6OL 2V17H 4JFPB 1SY6H 4LDEB 1Y6KR 4JO4H 3DV4B 3ULUC 4WCYH 5IIEB 4YDVA 2UUDK 4PG9B 4QHKI 2GQHA 2Z91A 4ZUTA 2R15A 5KTEL 1FSKC 2PCPA 1I85C 3QIUB 3JV4A 2EDHA 3PL6A 4XBEH 4X9IA 2VWEE 5D7SH 5CKAA 4GMTL 1LDPH 5MHSE 4WWKD 3N0PB 4QXUH 1KJVB 1NLBL 5E2UH 1X6NA 5LGHH 3BZFB 3PWJB 1WQVT 2OBGA 4U1KA 4HUXB 3OB8A 4GRWE 1JWMA 5CIPB 2PYFB 4LCUB 2HRLA 3O2VL 4EIZC 4IIQB 4F3FB 3VWJC 1V05A 4Y19E 2X4UB 4JPWH 4XB7A 4PJCF 4LBEA 4HIJA 3GSRB 3GJFK 5JW4M 3U9UA 2VDLL 2AJVH 1TVDA 4PJ9B 1BJ8A 5I66B 5T1KD 3VDAA 3NCEB 3NIDE 3BSZH 4N9GA 5D9SA 2XTJC 1GRWA 5BJTA 1OVZA 2LVEA 1K85A 2L7JA 2A9NH 4D0CA 2BHZA 4F7EB 4RIRB 1A7OH 5AAMA 3L7FA 3WFEH 4FQXD 2A77L 1KCSH 4L3EE 2NY4B 5F6HI 2QKIB 5DJ8A 4JM2A 4DGVH 3MRGA 2AGJL 3BT2L 2DYPD 1YN6B 2HMIC 2VXVL 4POZC 5EZOL 4F9LC 3DV4A 3CNKA 4PG9A 4M6MH 1G7QB 3RVXC 4JY4A 1KIRB 3QIUA 3NZHL 4LFHG 3B2UD 5BRZB 3QEUA 1KJVA 3P0YL 3QEHA 4Y16B 1A64A 1RIUH 3BZFA 1LK3L 5HDOA 3UO1L 4GJTB 1RJLA 4NGHL 3ARXA 4JG1H 5EOCJ 3EHBC 1ZHNA 4ZOCA 5EOCL 5CIPA 4S1SL 4TYUA 1AHWC 2ZNXA 3MLWL 4LCUA 4IIQA 1A6WH 4NQCB 1N5AB 4F3FA 1LO3L 2W92A 3STZB 2X4UA 2D0FA 2IMMA 2FYYA 3FT4A 4DKFL 1YY8B 4XVTH 4X6BB 4UIKH 4WV1B 3VXOB 2H1PH 5FYKU 4Y5XC 4PJ9A 3ZE2F 5C86A 4OUOA 4KAQL 1BBDL 5D1XD 2EH7L 2EKJA 4ODTL 5TE7H 4M1GH 5C0AE 5I18H 3CIQA 1MFNA 5DUPH 1EZVX 1S78D 4PJDB 5JA8B 3SDCC 5K9OB 1WIPA 1HHJB 1DLHB 3NCYP 4YDKL 2RCSH 3LS4L 5IROA 3WXVH 4XBGB 3MRBA 3ORJA 1V3JA 4KRMB 4WHYH 4KZEH 3CLFH 4IRSC 3D25B 2C1OB 2X41A 4PLKD 3ZSTA 1YN6A 2O93L 2Y7QA 5MI0B 1YQVH 1SQ2N 1MCEA 5BV7H 4NKIL 3IT8D 4RDQG 4XMLH 5DMIL 1G7QA 1K2DB 1G0XA 1MHPL 1BGXL 1KIRA 3RUGF 3WFCL 4LMQE 2K7QA 3A6BL 5BRZA 2XN9B 2GSIA 5HHVH 3MGAA 2R9HC 4Y16A 3W9EB 3VXSB 3VFTB 5GS1C 1JZ8A 1JP5A 4KH2A 1K9TA 4LLAA 4QYOB 2CGRL 3DYMA 1VHPA 4U33A 3WFDH 4NQCA 1N5AA 3STZA 4PGEB 1YY8A 3ZYZA 4X6BA 4DOHB 3ISWA 4HC1L 1R3LB 4XMPH 4XCCL 3TCXA 3MLYL 1A47A 1OP9A 4HGWB 5E4EC 1BJ1H 2X1XR 3LMJL 1KCUH 3H3BC 1A1OB 1RULL 5FYJL 3RTQA 1BQHB 4OJFH 4FQ2H 2DQTH 4OCMC 1H5BA 3WLWD 3RKDC 5E94A 2RQ8A 1A0QH 3B83A 3MA9L 5K9OA 2GTWB 3F7PC 1HHJA 4QGTA 1DLHA 2ADJB 2IQAB 3EGSB 4PRPA 5CJQH 1PX3A 3FRUA 4XBGA 1CGTA 1KGCE 2JELL 2R0ZH 3D25A 3CVHH 2C1OA 1KN2L 4XHJD 3D69B 1OSPL 1T7XA 4GW5B 4BQ6A 3RDTD 1OARH 4ZUVA 3FOMB 4I13B 3BMWA 2ZPKL 5DD1H 1NUNB 1WLHA 1K2DA 5BZWB 2OL3B 3NFNB 4W6WB 2EDRA 4NNYB 4PBXA 3JBG7 5HHOE 1CIUA 5CJBA 1S7QB 3LPGA 4XH2B 3PQYD 5BW7C 1A4KB 5JO5B 4YGAB 4PRHD 3UYRL 3CFKA 3OV6A 3VFTA 4PYHA 2AJZB 3S9DB 4H0HB 4QCIB 3ARYA 4GRWH 2D7TH 1NGQL 4ZODA 1RAMA 3EOBB 4HAGA 4K3JL 1CL7L 2H2SC 3O6FD 3MBXL 4LHUA 2YD3A 1X3DA 4M02A 2D4DA 4PGEA 4OGYH 1CGWA 2AJ3B 4LSUL 3S8WA 3ARGD 3QUMH 2X4TB 3OKNB 4RMUA 3MYZA 5EBLB 4HGWA 4NM4H 4JDTH 1JHLL 3RWEB 2YKLL 1A1OA 2ZUUA 5J1TC 5IVZB 5ANMB 3MLSL 4O9HL 4P9HC 4TQEH 1G6RH 4BJLA 3TJHD 4Y5VB 3EO1A 1WICA 3JSSA 2CUHA 4ONFL 5C0EA 5INDB 2GTWA 3S4SB 3SGEI 3U46B 5E70A 3OJ2C 1P53A 4Z7QF 3BGAA 1TLKA 3BESR 1UYWH 3R0MA 4NHCL 5I2IA 3GMQA 1GSMA 1N59B 3TM6A 3JWOC 1JF1B 2IBZY 1INEH 3J8F7 4GW5A 5CD5D 4X6DB 3HLAB 5DMGC 3NN8B 3FOMA 1NLDH 1ZHLB 5EU5B 4JN1H 3BH9B 2ADGB 5SWQA 2OP4H 3NFNA 3QJHB 4HHAB 3TESA 4BFGA 5I1HL 1YNKL 3FN3A 4NNYA 2VITB 4Z78A 2R2EB 2YOCA 3HG1D 4XH2A 5ITBL 1A4KA 5JO5A 4U6TA 4G8IB 1QTYT 3LQMA 1OT2A 5B39G 2XZQH 1MRFH 1QBAA 4ZS7H 1Z3GL 2AJZA 2W0FB 4QCIA 5GGQL 5F93C 4Z7NE 2H26B 3T2QA 3CDFA 4PJAE 5CFHA 5JPNB 2VZSA 1DQDL 1A14H 1EDQA 1K4DB 3FRPG 3MFFB 3VXTA 1I8MA 4R2GB 1XGRB 3HS0B 4Z7UF 4J1UB 4KHXL 3OKNA 4UT9H 1EAPB 1G9NC 1SJVA 5DVOA 1KLGA 4NNPL 4B50A 3I75B 3CH1B 3GSUA 4KRPC 3RWEA 4KQ3L 3CJJA 3MLXH 5IVZA 1K6QL 2NLJB 4BYHA 5IFHL 5ANMA 4PJ8D 4AMKL 1FO0L 1NMAL 4QGYA 3EZ8A 2EDBA 4Y5VA 2CRIA 1WAAE 2VE6B 1DBKH 4ZPTB 2MJWA 5INDA 3KDMB 3SE9L 3U46A 3TA3D 4E5XB 1LVEA 1QSFE 3ARBC 2DDQL 4Y4KD 3IB4A 3LEYH 2GI7A 1N59A 3X14B 2B4CL 2VC2H 5JZ7D 4ODSH 2VLLB 4U31A 2IANB 2XTJE 4OCSH 5FGRA 4Q0XL 4X6DA 3HLAA 4JLRB 3NN8A 5IK3B 3Q0HA 1OGAE 1MFCH 5A3ID 3MBEC 4MCYB 5EU5A 4UOW1 3EOYG 3BH9A 2ADGA 4KKLD 4U1JA 2BY2A 5IBUB 3AY4A 3WFZA 2AJSL 3QJHA 4HHAA 2APVA 1E6JL 2VITA 2IPKB 1OAYH 4P59L 2PXYC 4QHMB 3NA9H 4AIXA 3Q1SL 5HHME 2JJVA 3VGDA 5IKCB 1FFOB 4G8IA 5IFAH 1TNMA 1V3MA 3LEXB 2W0FA 4BQ9A 2AXFA 5CEZL 1HXMA 2N7AA 2I60L 3CCHA 2H26A 3MJ6A 1IKNA 1WZLA 1MCSA 2ID5A 4JEGB 5CILL 1K4DA 3GGWB 4UDTB 3MFFA 4C57C 4QRPD 3QO1B 5B38G 1E4WL 1C16B 1XGRA 3HS0A 4P46B 4J1UA 1EAPA 5F3HB 4HQQL 1OQXA 4HF5L 3CH1A 1KCVH 5FYJE 2NLJA 4YDIH 2AABL 4ZD3L 1G7IB 2BOCB 2J6EH 1J8HE 1NBYA 1O7SA 4LVOB 2P43B 3K4DA 4ZPTA 4A6YL 3THMH 3KDMA 4YDJB 4MXWL 2CO6B 4JFEB 2R1YA 5JW3H 2DI8A 1JWUB 3SY0A 4JHZA 3X14A 5IB4A 4KMTL 3VWKD 2P5WD 2VLLA 2VLJE 4E41E 3DROB 3QDJE 4LFHD 1B4JH 1QO3B 4TUJB 3H6JA 3MV11 5I1CH 2R1XB 3TVMD 2NY6D 1QFWI 4WW2B 3V5HB 1QKZH 3VFUB 1U3HB 4G9FD 3MREB 4QHMA 5F9WB 4EDWH 5IMKB 1CFSB 2DBLL 1I9IL 5F8RC 5AG8A 1FFOA 5DS8A 2ENYA 3LEXA 2YC1A 3DRTB 3D3VB 2IQ9H 1LO0H 1P69B 5F89B 1KULA 1X5IA 4UDTA 4Q9RL 1OOAA 4JFFD 4U0RC 3NFSL 3QO1A 3HFML 3KYAA 3BZ4B 1C16A 1T3FB 3QG6B 4MX7A 4P46A 4XP5H 5C6TH 2JJUA 5DVNA 3B43A 1OHQA 4L9LB 2MSPA 3QJFB 2DQIL 4FFYL 1BFVL 3MRLB 5EUOE 1GOHA 4KJQC 3B4NA 1G7IA 2BOCA 1VFAB 3IU4H 4M8VA 5HI5D 3HZMB 1BQHG 5E6IB 4WEUD 1T21B 1DLFH 4QXGH 2CJUL 3LEVH 5L6YH 5C09D 1LEKB 5F97E 1CD0A 3FN0H 4YHKL 5I76B 1H9VA 1JWUA 4OIIH 4DW2H 1IAOB 3C60B 4MQSB 4YZFF 4YR6B 2IBGA 5FGCB 3DROA 4UB0L 1HINL 3LN9A 1NAML 2CMRH 4TUJA 1J11A 1CR9H 2QTEA 3IVKA 3GSNH 3R0NA 4C56E 1YPZB 4WW2A 2N7BA 3V5HA 2DN7A 5HYSG 1U3HA 3MREA 3LPWA 3GMMA 4KJPC 2GJ6E 2ESVE 1T6WA 5IMKA 3QHTC 3OR6B 5FK9B 3GBNL 5KW9H 1XGTB 2X05A 1YEHL 4PD4K 2WV3A 4AZ8A 3DRTA 2ZG3A 4OFDA 3FO1B 3SE3C 3ULUH 3OHXB 4ERSL 3FQNA 2VH5L 2FGWH 1QR4A 3MLRL 3AXLB 1A22B 3UTTD 4PJFA 3BZ4A 1EERB 1S7SB 4OZGB 5SWZE 3GSVB 3QG6A 2BDNH 3GEWB 5J6GB 1TPXC 2V2WB 3W0WD 2E7LA 5B22A 4L9LA 3QJFA 1N6VA 4LSRL 1ZKAA 1JL8A 3MRLA 4HWBA 3EFDL 5I19H 5I9QB 1MFBL 1VFAA 2VQ1B 5C0FB 1UZ6F 1K5NB 2DI7A 4OCXH 1ZA3A 2X7LB 5E6IA 1MEXL 4ZOAA 3V4PH 1IEBB 3BPLC 3GI8H 3V95A 3VGAB 4NZRL 5E56A 5KSAC 1YEFL 1QRNA 5I1JL 5JHDA 3S4SG 3AUVA 2P45B 1MFDH 2P5ED 3G9AB 3C60A 5HGGS 1RMFL 1W8OA 4PUBH 4YR6A 3SQOL 3QCTL 1HN1A 5HI4D 1X6LA 4YHOL 3FB5B 4ZUSB 5J7CC 5L88H 1MLCB 3HE6C 1GOFA 1YPZA 3C9NB 1FIGL 4PRIA 4JKKA 3GHEH 3EW3B 4KKCC 5A2IH 3K80A 2M8XA 2NY2D 3WIHH 4HT1L 5EUKB 3OR6A 5FK9A 1A7QL 1MNUH 1YJDL 4IJ3C 1T2XA 5IHZA 3BN9D 3QZWA 5AEAA 1XGTA 5CJOL 4JGMA 1G0DA 1LO4H 1Q0XH 1JF6A 4G8GA 4S1RL 5AAWA 3FO1A 4BFIA 2VDNL 4Y4HD 1V7ML 3OHXA 4NM8H 4ISVB 43CAB 3EYSH 1NQBA 4L3AA 2EDWA 3IDNA 2MHAB 3ABZA 5T1LB 3AXLA 1F3JB 2DKMA 1ZHBB 1KELL 1S7SA 3CMGA 4C55A 3GSVA 4P23D 2AJXL 1AY1L 3IS1X 1AGFB 3QXUA 1D9KD 3T04D 1FLRL 2VZTA 3LDBB 1OQOA 1KLUB 1TTFA 4EXPX 1S7VA 4PP2B 2FLBT 3GM0A 2VQ1A 5C0FA 1P7QB 5T3ZH 1NGYB 2X7LA 2DD8L 5TDPB 3WJLC 5I8OH 5CLWA 4X6EB 2EO9A 2XY2A 3OAYK 5IVNA 5JW4R 3QQNA 4RMWA 5L2KE 1VPOL 3GM8A 1EFXD 4MB3A 5J9PB 2OR7A 3REWB 1YC8A 1C1EH 3VXMA 3L5IA 3U36B 4JZNA 2P8LA 2V7HB 4FQPA 4HGKC 1GOGA 3FB5A 5ALBL 2LTQC 4NN6C 1SY6A 3V8OA 1CDJA 4MDIB 1WWBX 4X9FA 3C9NA 2XZCH 2XICA 1UB5A 3TH2T 1LEGA 1TZGH 2J5LC 2B8OT 3FO0L 5F3BB 5F96H 1A6UH 2XI9A 1HZHL 1CBVL 3TFKC 2O5YL 5EUKA 1F4XH 2F53E 1YEKL 2YBRB 1FYTE 4EUPH 1BX2B 3BDYL 3MZTA 2E9WA 3WFBL 1XF4B 43CAA 4YHMH 5I74C 4XCEA 1WWAX 5HI3D 1T04A 2MHAA 5T1LA 3QDME 1F3JA 1ZHBA 4FNLH 4OD3H 2A74A 4JKWA 4Y8DC 3UROR 2CLZA 5DQDL 3KR3H 2FEEL 3UTSA 2CLRB 4WWKC 2D2OA 1P5VA 1ULVA 2IEPA 4WFHD 5GZND 1MCOL 1MIEL 2D9QB 4JFZL 2DM4A 3BIAX 3KJ4C 2NY4D 1P7QA 3D2UA 1TENA 1NGYA 1T80A 2CSPA 5FYLH 5TDPA 2EH8H 2QR0A 3B9VA 4X6EA 2MPAH 5FKAB 1A4JB 1IC4L 1VACB 1FZKB 5J9PA 5F7YC 3JVGC 4N0UE 3I02B 3SHSA 4E0RB 3U36A 2OI9B 4K71C 2XZAL 2DQDH 5BOPA 5J11C 5LGJB 4N8PA 4RGMB 4M5YH 4MDIA 3KVQA 3TNMA 2HP4A 4GT7A 3MO1B 4ZTPL 5SX5H 1XCTB 4U49A 2J8UB 1DQQB 1EPFA 5INCA 1CFTB 3ARTA 1PG7W 1S5HB 4PLJC 5JPMB 2A6DB 2G9HB 4JDZA 4FQXC 3KHQA 4OLUH 2YBRA 3QUXA 5TE4L 4WRLA 1CIDA 3FAWA 3H7LA 1BX2A 4PJIB 3WD5L 1BFOB 4U3HA 4M03A 4HFWB 1HILA 5DD5H 2K1MA 3EDDA 3PG2A 1XF4A 1G9ML 3DUSB 1FZJB 5FUCE 1YN7B 1MFEL 3KNBB 4OF0A 4J4PA 4XVUC 5D2LE 3WSQH 5HDBF 1YEDB 3VU2A 3MNVB 3ZZ1A 2IAMB 4LVHB 5EU6E 4GAJH 3MOAH 4XHQA 2X44D 3ULSB 4FFVD 4ZUUB 3VW3H 3MJ9L 2QSCH 3B2UC 2CLRA 1FV1B 4M7JL 4K3EL 5L0QB 5AUMB 1QNZH 3GIZH 2QQKH 3KXFE 2D03H 4ODHL 1F00I 1ZANH 4YE4L 2KZ1B 3P9LB 5L7XH 1A4JA 1QRKA 4YIQB 2WW8A 4LASH 1FZKA 4OQTL 1TQBB 1NCBL 4MA8H 3I02A 4XXDB 1QQDB 3CVHB 3SDYL 1DQLL 1I9EA 1FYHB 4AL8H 3OAZK 1QLEL 5LGJA 4NN7C 4P9HH 3ZTJG 1GIGL 4R96A 4CU6A 1S5IL 4LCIH 5IQ9A 2CK2A 3MO1A 1IKFH 4OZHB 2XN9D 3LN5B 5D1XC 4FQ1L 4NQDB 1DQQA 1CFTA 5JPMA 1S5HA 4ZFGL 4CKVX 3VXSD 2G9HA 1JI1A 2YN5A 3JWOH 1S78C 2Z31B 4KUZH 5F71A 4NJAH 3M17B 4PJIA 3KAAA 1QBML 4CAGA 1JYWA 4HFWA 5FKPB 5E2TH 4FQJL 1J9CT 1WUNT 3OKDA 3RY6A 2R23B 1QYGH 3DUSA 1MY7A 2I07B 1EA9C 4PLKC 5MERB 5E99L 3O4OB 1NMCB 1FC2D 1VB9A 3KNBA 3DECA 3R8QA 4KJYB 1C8PA 3K3QA 2JB5H 3G6JB 1A1MB 4U3CA 3BDXA 1YEDA 4GMSL 1FPTL 4M93C 3QSKB 1CFVH 1H3GA 2IAMA 3A0OA 4XAKD 3D39B 1DEEB 3HZYB 1ZGLP 1EHNA 1D5BB 3ARVA 4JFYB 4XBPB 1OAUL 3LQZB 3VE0B 4XPBH 5D7LD 4ORZC 5DZLA 5AUMA 3V52L 4HIIB 5FO9B 5KVEH 1MFAH 4KZDH 3KPMA 1G6RB 3VFGH 3E1F1 3PWPA 1NGPH 5EIQA 1YEEH 4P2RB 3LS5L 3UJTH 1N64L 3P9LA 2JJSC 4I48B 4NO0B 3OPZL 3O9WB 4YIQA 3VD9A 2F19L 1G9NH 2G5BB 2X09A 4R8WH 5B4MD 1VEPA 4RISL 1IJ9A 1IAIM 4XXDA 4Z7UB 4XGZB 3L9RA 1QQDA 3MRRB 3CVHA 4F7CB 1A6TB 3AB0C 3ULVE 1GHFH 5MENE 3VDBA 3VMPA 4DQOL 2PW1B 1W72H 2GJJA 1WITA 3ZDXF 3S34H 1YNLL 4OZHA 3LN5A 4TVPD 4NQDA 4DFHA 2J88H 3BXNB 2VLME 1C12B 4XCNB 1BQSA 4XI5D 3WLWC 4U7MA 2CXGA 3KG5A 5IFJB 2GEEA 1MELA 5A2LH 3FB6B 5FKPA 1UT9A 2R23A 1HI6B 1NANI 5MERA 4EIGB 5B8CB 2HFEA 3RDTC 3ZMRA 1OW0C 3FL7A 2Y72A 3G6JA 4XNUH 1A1MA 4JO1L 4Y19A 5I1AA 1XEDA 1T89A 4FTVE 3TO4B 3S88L 4UTBH 4GQ9H 1JYVA 3HC4H 3FB8A 3NPSB 3D39A 3I85A 4YFLI 4ZSOE 3Q5OA 1DEEA 3HZYA 4JFYA 1D5BA 2VZVA 5GGTL 4RAUB 4IMLB 3VFRA 2BXYA 1W2KT 3VG0L 1Q0YH 4HIIA 5DK0B 5EC2B 1NMBH 4MLSA 1G6RA 1IGMH 5IVXF 5IB5B 4JG0H 4FQIL 1BPVA 4L3EA 4PJ7E 2VKWA 4P2RA 5T1MB 3OB0K 4NO0A 3O6FC 3O9WA 4J8RA 5T3XL 4X9GA 4APQD 3MSPA 1ND0B 4CDHA 5ADOH 3RWJB 4XPAL 1FN4B 1ERNA 4XGZA 2XACC 4MA1C 3MRRA 4X7FC 3HMXL 4F7CA 4LCCB 4M9OA 1NBVH 2PW1A 3TGXA 4UOJA 2YN3A 4AT6B 3SKOB 3L3JB 5LBSH 1J5OL 4HJJL 1C08A 5KZCD 2F54D 4S2SA 2HKHL 1DEDA 1A5FH 3CU7A 4KI5F 3H0TA 3VFSB 1HWGB 1I7ZB 2BNQE 5JUEH 2Z92B 1TDQA 1C12A 4XCNA 4J23A 4NC1E 5DFWH 5DXWA 4IOIB 3TZVC 5EIIB 4LCYB 5EFIB 5IFJA 1AKJB 2NZ9D 4W4NA 1IEAB 5ID1A 4F57L 4UIMA 3FB6A 1WFOA 4MJ6B 3HUJB 3PXHA 4QF1A 5GRWA 3CXHK 3QEGL 1BD2B 1KC5L 3RVWD 1HI6A 1MF2H 1N3NA 3ZKXB 4JFDB 5B8CA 2VQUA 5CD5C 4MJID 1VADB 2DJ4A 4ENED 4PJBF 3NBNA 4J12A 3TO4A 1IQDA 4XP1H 5D5ME 1KTRL 5CGYD 3VXNA 1G0YR 4X7SH 3HI5H 2DL2A 2YK1H 2B1HH 2ICWJ 3O2WL 4NKDB 5L9DH 5DJ6A 4CN1A 1KT2B 4RAUA 1AQDB 2R29H 3X11B 1NFIB 4J3OC 5CP7B 5DK0A 4UV4H 4HXAL 4RWYH 4CJ1A 3P2TA 2FSEA 3VI4F 3ET9F 3BEWB 3DGGB 4WI4A 5HGDB 4NZTL 5JW4Q 4X99B 3MPCA 5T1MA 4JFOB 3KPPA 4KPHL 1UH4A 1X5AA 3HNVH 3BI9X 2R0WH 2IAND 1ND0A 1D6EB 1UACL 3BN3B 3RWJA 5E8NB 1JV5A 4U1LA 3HRPA 3OXSA 5D2NB 3QNZA 3SJVB 5KSBE 1M6OB 5HYFA 4PJXE 1JHKH 2FBJH 4G7YH 4OF5A 4AT6A 3L3JA 4HPOH 5HBBA 3BE1H 4K23L 3VFSA 4WI5A 4O4YL 4PJ8C 2FIRT 4YQXH 2Z92A 4BA8A 4FZEL 1ADQL 5HHOB 4R7DA 8CGTA 3C5ZB 4IOIA 5EIIA 4LCYA 1AKJA 4LCWB 2D7MA 3AREB 1HYSD 1BVKA 1UCTA 3HUJA 4J6RL 3RA7L 3K2MC 1JJUA 1SEQH 4TULH 5JZ7C 2CK0L 3MNWB 5DUML 4JPKH 4XWGH 1VADA 5A3IC 4UILH 2OLDA 4NT6B 1H8NA 1A6AA 4KKLC 4L8BB 3AS2A 3PGDB 2GIYA 4Z95H 4RGNC 1JPTH 2NXYD 1KT2A 1AQDA 4KVNL 4PLOB 5CP7A 4N0CD 2IADB 1MREL 4BZ1H 2X6MA 2P4AB 2J6EA 3BEWA 1CU4H 4JFED 5HGDA 2LABA 2X9WA 3HNSH 1IILE 1T2QL 1VFUA 2AQ3A 1KIQA 3HI1B 3KPRD 5I8CB 2HH0L 4JFOA 3MUY1 1N8ZA 1MQKL 3O81A 4PFEA 2YPLD 1RUMH 2P24A 5D72L 5SX4I 1YZZA 3SE8H 5E8NA 5D96B 1TQCB 4NWUL 1FNLA 2NR6D 5D2NA 12E8H 4JZJC 4RWHA 2VXQL 3SJVA 4I0KA 4HIEB 1M6OA 4TSBL 2R0LL 1IBGH 4P57B 4YWGH 5DC4B 1BQLL 3GSNB 3N9GH 3B2VH 4FOMA 3OKMB 5HHOA 3C5ZA 3I2CH 3BQUD 4L8DA 4FN0A 4HUVB 4LCWA 3D3VD 2I9TB 1CWVA 3AREA 1U8IA 4P2QB 5T3XD 3MGOB 2BFVL 4LIQH 1U2CA 3BGMA 4V1DB 3ZE1E 4PGBB 3VWKC 5BVJB 1EV2E 5KVFL 3MNWA 5ISZE 3O3BB 5DYOB 5I1KH 1HIML 3K4ZA 1FSKB 4NT6A 3ELAT 4Q58C 4L8BA 5DK2A 2NY6C 3OQ3B 1E0OB 4G7VL 5IM7B 3PGDA 3CDCA 4JREB 2Y6SD 3E2HB 3FFCB 1UM5L 3O41B 1R0AH 1QEWB 2V9TA 3R8BB 1WEJL 2J4WH 2J12B 2IFFL 5CMAB 5FHAH 4LF3B 5HSFA 1JZ4A 2EDYA 3M8OH 3VWJB 2ZSVA 1IAIH 2CIKB 4WEBL 2BHUA 3NIGF 4WFFD 3P30H 1A2YB 2VDKL 1JI2A 2D7NA 3CXDL 4TPRH 1F5WA 3SDXE 4M4PA 3MTRA 1N7MH 4XVSL 2ZCHL 3OKEB 3O8XC 4OF7A 5T1DL 2FO1A 3V7AG 1IM3B 3GSNA 3P0GB 3VRJA 4FP8H 1CE6B 1CLZH 2Z8SA 4WU7B 5I71C 4LRIC 3A6OA 5D7IB 3C2SA 2R8SH 2IH3B 3OKMA 5ETUB 2BZDA 4A2MA 3ZDZF 5CHNB 4HUVA 4XP6L 2W9EH 3QDGB 2I9TA 2VR4A 2HKFH 5BXFB 1V7NH 4NRZB 1F11B 4DWHA 1S7UB 4P2QA 3MGOA 1INDL 5DO2D 3RL1B 5DDHB 5DK3A 1YA5A 1DSFH 4PGBA 5HVFB 4M6AA 5BVJA 4GSDH 3CU1A 1R3HB 3HE7C 1NSNH 4TRPL 5HXMA 1I85A 1UWEH 2DTMH 4GQPH 4QKXB 5IM7A 2Z0BA 1EXUB 4PJGB 4R90L 3WJJC 3UTPE 3FFCA 1MI5E 5D1ZB 1AXSA 1DVFC 4JPIA 2AXHA 3FCTB 2XKNB 3O41A 3EYOB 4XNZC 5EZJA 1BAFH 1T1WA 3DUUB 1AHWB 2PYEE 4Z6AT 2L7UA 4LF3A 5IHUH 1WAAA 3VWJA 2CIKA 3V5KB 1HSAB 1KPUB 3T0AA 3U0WL 3PV6A 4LQFH 1P4LB 1QSFA 4Y5XB 1FE8H 5C0IA 1KENL 4LARH 1IC5L 1P9MC 1EGJL 3WKML 2YMXL 2D7QA 5M7QA 1CD8A 1V3KA 4MJ5B 2DLGA 4PRHE 1F8TL 1IM3A 3QPQD 1CE6A 4WU7A 3W2DH 2YA1A 3SDCB 1ORQB 5DVMA 1U6AL 1EUTA 4G6FD 1JPFA 4NFCA 4N90D 5D7IA 5ETUA 4C83B 3WIHA 2J8OA 1I3UA 3VXUB 4R4ND 5CHNA 3QDGA 5DT1L 4O02L 5BXFA 4NRZA 3EDKA 1F11A 2XRAH 1S7UA 2XA3A 1NC2A 5JOFA 1H0DB 1Q8MA 5DDHA 2IC2A 1NEUA 3RU8L 4F9LA 2QJDA 4MWFB 4M48L 5IEHB 4KWUA 1R3HA 3L1OH 1FVDB 5HI4C 1NGWA 4P4KD 1BJMA 1XGPB 1YC7A 4JQVC 3T4YB 2Y23A 1ACYH 1SMOA 4XPGL 5DWUH 3NIDF 2MQ0A 1IFHL 4OFIA 5D70L 3TCLB 3PIQB 3DX7B 4PJGA 1KCRH 3MV7E 2WUBH 1PVHA 3O4LB 3S5LB 2NY2C 5CZXC 1JNHB 1A7NH 1FNAA 3FCTA 1K8IB 1DUZB 3BN9C 1F90L 2F9BT 2R4SH 4AEIL 3DUUA 3PNWB 1J8HA 1AHWA 4TOYH 8FABA 2P8PB 4JJHA 3UBXA 4Y4HC 3V5KA 1NDGB 4ZNCD 3KYOB 1QACA 4DUVA 1P7KA 1VGEH 2NTSP 3KS0H 4Y5XA 3AGVA 3QG7L 1BFSA 5DRNB 2VKXA 4F2MB 4YPGB 1CDBA 1LP9E 3HG1E 3NABL 4AEHH 4MJ5A 4EOWL 3QDJA 3K0WA 4OFKA 3T0EB 1D9KC 2HLAB 3QWRA 1U0QA 3UC0L 4RNRB 2G60L 1HH9B 2AK1L 3UTQA 3SDCA 2CDGB 1ORQA 3GUTB 2X4OA 4P3DB 2UVEA 1A7PL 3SCMD 3MODL 5DZOA 1LO5B 4JZOB 4NNXA 2F15A 4IRSA 1YDPB 4EUPA 4OCYL 4QRRB 2FZ3B 3V6FB 4ALAL 4TUKL 3ESUF 4RBPK 2DI9A 3DIFB 1ZTXH 4JRXD 1KNOA 4JN2B 3T09A 3WXWL 3QRGL 1CE1L 4MWFA 4KQ4L 5DURD 5IEHA 3ZKQD 3TYGH 1FVDA 4MQXD 1T20B 2ZOKB 3DTXB 1XGPA 5TGBB 2UY6A 1MJUH 3O2DL 2JIXA 5FUZL 1N2RB 3TCLA 4FG6D 3PIQA 1ZLWH 5E8EA 1T1XB 2OK0L 3JUZA 1CK0L 3NCCB 3DXAE 2JCCB 3O4LA 5GS1A 3FOLB 1JNHA 1K8IA 2IBZX 4NKMB 5SWSB 5A2KH 3LPFA 2NY5C 2OMNA 3VXRB 2BERA 2X2YA 3BAEL 4OLWL 1C5CH 1E6OH 3B9AA 5FYKD 5C7XL 1NBZB 5HI3C 4K3GA 3CDGB 4MMZC 3EYVB 2FO4B 3V9FA 5DRNA 3UPAA 4YPGA 3SKMA 1FFNB 1ODAA 5GGUB 4M7ZC 3SDAD 1YYLL 1NPUA 4H5SB 1EEUA 1Z0NA 2GJZA 2HLAA 3NCYS 4XXCA 1NEZB 1F2QA 3LZFL 4OIAA 2FHFA 1HH9A 4R9HA 5EZIL 2CDGA 1KN4H 5FOJA 1N6QH 2NY3D 4P3DA 4UZGA 3G5YA 4LP4A 4M6OH 4FFZL 1LO5A 5KAQF 4JZOA 1D5IH 3CLEH 3U82B 4QRPE 1YDPA 5TF1L 5C92A 4QRRA 1CDHA 2FZ3A 3BWUC 4ELMB 3NIFE 5B3JE 1PLGH 1RZJL 4JN2A 2DQJL 3K1DA 2JJTC 5J1AB 1MJJB 4XMKL 1OAQH 5H37H 1QZ1A 1T20A 2GFBB 3DTXA 2AKRA 3WUWB 5AZEL 3SGEH 2YXMA 2CR6A 1D5XB 3PUCA 1EJOH 1N2RA 1J12A 5SWZA 1DUYA 2O61B 5BW7A 3CFCH 1MWAH 2JCCA 4QO1A 3O2VH 3FOLA 4OCWL 1HNGA 4RFOH 1HKLL 4X7TB 2P5WE 4WW1B 5BMFH 5ID0A 4IMKC 4LSVH 3QUKA 3QQ4B 1N5YH 4J3WA 4NFDA 1NCCL 5H8DA 4U1HB 5IR1A 1EUUA 4FFWD 4WV1C 2YS4A 5C2BL 4G9FE 4EN3C 3FKUS 2HVKA 5DD0H 1XH3A 1FFNA 2D9CA 4H5SA 4FFVC 4QRQB 3R06B 1QFOA 2O5ZL 5DTFA 1MAMH 4IOFD 5GGRY 1MAKA 1NEZA 1W72B 2NX5D 5IJVB 4HUKB 5CJ8A 1Y6NR 2H32H 2QSVA 2Z31D 2YA2A 4UNVA 4QY8B 4K7FB 2WLYA 1JGUH 3MR9A 3ARBB 4U1NA 4CN6A 1RK1A 5EORL 4I3GA 5I73B 3K2UL 2KQNA 5D7JB 4ELMA 1S7TB 5HYIA 2YXFA 25C8L 3MBEB 3LIZL 4C54A 4QHNA 3MNZB 5GRUL 2EIEA 4OM1H 2VXTL 1IT9H 1T7WA 1BEYL 3O45A 5D7KE 1JFQL 2GFBA 3A6CH 1DQML 3Q6GH 4WHDA 4O2FB 4P0DA 3X3GH 4YXLL 4UI2A 3WUWA 1A3LL 5DRWA 1YEIL 4JJ5B 2PXYB 3V8CA 3JWDC 3PP3H 2X4NB 1FNHA 2R39A 3RJDA 3HAEB 3OX8B 2Y25A 4YK4B 1GZQB 1LO3H 1NCWH 4Y5YC 4JRYE 5I1GH 4WW1A 2XG5A 1ZHKB 2BRRL 3RNKB 5C0CB 5BO1H 1MIMH 4PJBB 1I3RB 4U1HA 3U48A 4EDXB 4NBZB 4N8VB 2GYSA 1Q1JL 3P4OA 1N0XH 5F8QC 3W9DB 4MJ4A 2VISB 2OR8A 5DJ0A 4QRQA 3R06A 4XPHL 5C0DA 4PB0L 2R0KL 2Z8RA 1BWWA 2WANA 1W72A 5IJVA 3L95B 4NQUA 3C2AH 3UJJL 2ITDB 1JTPA 1MCWW 4AJ0A 1U41A 1WT5C 4K8RL 4J3XA 1XR9B 4QY8A 4K7FA 3EYUL 1OT1A 3ARBA 4Z7NF 4PJAF 4WIQA 1J0KA 3UTTE 4IRZH 4X4XA 1BOGB 1IVLA 4K7PH 4Z0BH 3HMWL 2EE2A 2VLRD 3MRMB 3ZKMC 1G7HA 4UINH 5B4MC 1S7TA 4YJZL 2GT9A 1CZ8L 4UQ2B 2OJEB 3MBEA 2VL4A 1XFPA 3MNZA 1LK2B 4NIKB 2WINB 4HMDA 4HLZG 4BUHA 1UM6H 1MLBA 2C4XA 1A6VH 1SBSH 4O2FA 4MAYA 2WBJD 3UTOA 2AXJA 3CZJA 3QAZC 4KI1A 3T1WA 2X4NA 1KCLA 4I77L 4U6YB 3VD5A 5I1IL 3GI9H 4Z7WE 5FYJU 3U2SB 1T66C 1JRHL 1JNLL 4KUCF 3OX8A 1GZQA 4O5LL 1WAAF 1FGNH 4XT1C 3S5LG 5FF6B 5HDQL 5LKNA 2YD6A 2ZCKH 4NBXB 1ZWIA 1QFWH 3QEQD 1CXKA 3TN0B 3RNKA 5GRJH 5C0CA 1NFDE 1FDLL 4Z18A 1PEZA 4GG8B 3CSBA 1OM3L 1LMKA 5MEPB 1CXFA 3LKOB 4OTXH 4M7KH 2HN7A 1U8NB 4O51B 3W9DA 4KDTC 2QL1A 2W1NA 3E3QC 2Z93A 1WVZA 3RL2B 5CZVL 1HH6B 3BHBB 3ZT6A 2AJUH 1TETH 1EHLH 1MCPH 3QCVL 5LQBL 1DANT 1XR9A 1GVIA 4N68A 3G04B 1IGJA 2AJYH 1BD2D 1BOGA 1G9MC 2D7OA 3MV8D 5DJCB 1IGYA 1EHXA 5J13C 3MRMA 4JFDD 4HXBH 4MAUH 4APQC 3LD8C 4UQ2A 1I7RB 1T22B 2ZNWA 2HWZL 1C5BL 5F9AC 2WINA 1FFPA 1MRDH 1RZFH 4IRJB 2HRPL 3WDHA 1MJ7H 2FX8H 1L6ZA 5ESQA 3U2SA 2VAJA 5DJYB 4OD1L 1GH7A 3F62A 3C08L 1ONQA 2BHYA 2GCYA 4ZYKA 3S6CA 3MLZH 5HGHB 2NY1B 3GSOB 2NZ9C 3WNKA 1KTKE 3OAUH 1R5VB 4MD0B 1BP3B 1UH2A 5KSUB 3RVWC 4ORGB 5GS0D 2GUOB 1WFUA 4B7LA 3L3KA 4LLQB 2FH8A 5MEPA 3LKOA 4ENEC 4NZJA 2EC9T 4F80A 5DHYA 4LPUA 1U8NA 1NJ9B 5CGYC 1J0JA 4O51A 5C08D 3F7QA 5HGAA 3HRZA 3RL2A 3BHBA 3PDOB 3QULA 5E9DB 1IC7L 3BPLB 3X3FL 2VSDA 3Q48A 3MUGA 3ARED 4EZMA 4YFDB 2R4RH 3CH8A 5DJCA 5GGRB 1N4XL 1CF8L 4H0GA 4BZ2L 3NACH 4LRNL 1T22A 4NZUL 5TPWL 3HE6B 1WBZB 3MCKA 3MX0A 2VXSL 3ROOB 4OZFG 1HHGB 2OTWB 5IMOA 3ZE0E 1IQWH 2OSLB 3P0VH 4PP1D 4FQHB 5EUOF 4GAFB 4IJ3B 4WDIA 1AJ7L 1DCLA 3GKWH 5DJYA 4PTTA 1OTUD 2E9IA 1W0VA 3U9PH 2FB4H 3SE3A 1OP3K 5HGHA 3VRLE 3GSOA 4B53A 2E6PA 1HYSC 1R5VA 4MD0A 3P4MB 4GBXB 2IG2L 1QSEB 2FLRT 2MOVA 5KSUA 2OCFD 3NZ8B 2O26U 4ORGA 3CUPB 5DJXB 4XP4H 5MP6H 4KQ3H 4LLQA 4NOFA 5BRZE 4GKNB 3PABB 2ED8A 3H9SB 1WCBA 4CMHC 5DSCB 5MENA 3PHOB 1GGTA 4HWZB 2B5IC 3LQAL 2VDML 2NXYC 1M7DB 3CFBB 2DMBA 2VUYA 5IWLC 5KANI 1VA9A 5GRZA 3PDOA 4NQCE 5E9DA 4N0CC 1NUGA 4LVOC 3O6KL 5KSAA 1GPOL 4MNQB 4X6CB 2DM2A 4HS8L 2A6KB 4P5TD 4V1DD 2RR3A 1RZIB 5I8KH 1CGYA 2CDFB 1ZVHA 2LTQB 1UKTA 4NN6B 4BH7A 3DARA 4DN3L 4ZDHB 1AD9A 2NR6C 1AXTH 4P59H 3H8NA 1WBZA 3HE6A 3ILQD 1IMHC 3ROOA 2B20A 1HHGA 1AP2B 4S1QH 3MV9B 2OTWA 1UB6B 4FTVA 1GXEA 4PJDE 5EZLA 2VSCA 4YNYA 1NC4B 2OSLA 4FQHA 2VZUA 5F9WC 2NMSA 2CO7B 1JYNA 1A02N 5GRXG 4QTIH 1I1YA 1KEMH 3HAEG 3BQUC 5IJKC 4IM8A 4OGXL 3ALPA 1QOKA 5I74B 1KPVB 1WIUA 5F44A 3FT2B 2QHRL 1QSEA 1BREA 1URLA 2JLLA 4DVRL 1MRCL 3NZ8A 1DN2A 4PJ7A 4W68A 5DVLA 3ALXA 2XN9E 4O58L 2P48B 3PABA 3GMPA 3VXSE 4WWKB 3GIVB 3KLAB 1KB9J 4N8VG 5EDXA 2ARJB 2Z8WC 2B1AH 1M7DA 2Y6SC 3O6MH 1Q9KB 5I30H 3KJ4B 1DBJL 2L0DA 3LH2H 3WJLA 2BNQA 4PJHF 3T4AA 1T1YB 2AERT 4UBDD 3GNMH 1OLLA 4DOHE 1CTOA 3C8DA 3F65A 1TJIH 4GKZA 4K71B 3RRQA 2A6KA 2PNDA 4WHCA 4KXZI 1RZIA 4XAKE 5E2WL 4LPVA 2CRZA 4ZDHA 5T1KB 2W9DL 4OUUB 2HVJB 4WFED 5JLZB 4XNXL 3AROA 3R1GH 5DRXB 3N1FC 4D9LL 1LILA 2EYRB 5D8JL 1RIHH 5D5MA 5D1ZD 3V6ZB 5ICZA 5EO9B 2XOTA 3I6KA 3AC0A 4R0LC 5GISL 4RQQB 4J2XA 4KK8D 3T0DA 1TJGL 4PR5B 1MCRA 3EHBD 4DN4H 3IS0X 3L5XL 3I3DA 3INUL 1AGCB 3BD3A 1NAKH 2FECL 6FABH 2OJZL 2BVQA 4F33B 1KPVA 2DYPB 4OD2B 3FT2A 3L3DA 1Z9LA 1Q72H 2BOBB 5DO2C 3D0VB 4QT5A 5JDJA 1PG7H 3DBXB 3BOVA 4P5KB 4KROD 1PAMA 2M1KA 1HHKB 2X4QB 2AI0H 3AM8C 3G6DH 3RWFB 1HQ4A 1QHPA 1DL7H 4FMFA 4G6MH 5ENWB 35C8L 4WWKA 4G9DB 4PJXA 5KVDL 2ARJA 1OCWH 2AXGB 3CMOL 2NY5H 1RZKL 5K93A 4OGAD 4GW1B 5CLTA 3IJYB 1GYAA 2IBBA 4NQXA 2FRGP 1A7BA 3VXUD 4RX4D 1CGXA 5LG1A 1T1YA 4OFYD 1BWMA 3WS6C 1HDMB 4LNVA 4LEOB 3JVGA 1NAMH 5TQ0L 2XNAA 4HKBA 4S0TD 5TE6L 4W81A 1UXWB 4RGOL 3U0TB 5ANME 2HG5B 5T1KA 4HWBL 4WUKH 2W59A 2HVJA 2DQGL 1AXIB 5JLZA 2ZJSH 1AC6A 4JANB 5D1XB 3ZL4H 3GBNH 2AW2A 2EYRA 3L3OB 4JKPH 4DK6A 1LO2H 1PW3A 1RFDH 4FQXA 5EO9A 3VJ6B 4RQQA 4HKZB 4PR5A 1VKXB 4OF8A 3MRQB 3GSQB 3OF6D 2XXMB 3VGHA 1AGCA 1JN6B 1NGXB 4R4NC 4X6DE 1A6ZA 1KTLB 4FQLL 4JO2H 2DYPA 3QIBD 4OD2A 1KCKA 2BOBA 1LE5B 3D0VA 3ES6B 3SO3C 3H3PH 3DBXA 2VABB 2X4QA 3EO0A 4P4KC 4LU5L 1M05A 5EIVA 1RU9H 4L3CB 5ENWA 1MFBH 1U8KB 3IAQA 3T0ED 1P1ZB 4G9DA 4QHLA 4WVRA 2AXGA 3IJSB 3F8UB 4GW1A 4LSPH 3IYLW 1MCDA 3IJYA 3ZKNC 1IEHA 4LLYB 1KYOJ 2IALB 4F8TA 5AZ2H 4X98B 1DFBL 4RA3A 3BGFC 2F58H 1EVTC 3BYTA 1HDMA 4LEOA 5F9JA 5AYUH 4PREB 4IS6B 1KFAL 4PV9B 3C8KB 3ZTNL 3RGHA 1Z2KA 3AB0B 1VSCA 3EYFA 5ICYB 1HYRC 5D2LF 3JV6B 4WNQB 2ATPA 5CEXB 4DZ8B 5C0GA 4X5XB 4PBWD 2HG5A 4HD9A 2Q7YB 1XMWA 1ZSDA 5BQ7B 4TSAH 5IBTH 1MH5B 4JANA 5D1XA 3EDFA 4OSUL 3L3OA 3NCBB 2FJFA 3U7YH 2DWEA 4C59B 5CJOH 4LLDB 3HCVB 3RWDA 4P3CL 4S1RH 4NBYB 2ZUSA 3VJ6A 1O0VA 1Z6JT 1MWAB 4HKZA 1EBAA 5EOQH 5SWSD 2FEDD 5I15L 1VKXA 3SCMC 3MRQA 3GSQA 4PS4L 3RVUD 5DC9B 3VFOA 2Y5EA 3VXRD 2IANE 1JN6A 1NGXA 3WO3B 2AEPH 1EEQA 2UZXB 1RZGB 1KTLA 5FO8A 2V17L 4BSWB 2EIZB 3S37H 3RDTB 1SY6L 4JO4L 1LE5A 5EOTB 1U2HA 2AJXH 4WCYL 5IB2B 3ES6A 5EO1B 3UZQA 1A21A 3JWDH 3ARPA 3V6OC 5GJSH 4MQXC 1R3IH 2NW2B 4Q2ZA 4XBEL 5D7SL 1J05A 5F7EH 3PHQB 4L3CA 1LDPL 4IBLT 1U8KA 4QXUL 1QG3A 3O3AB 5E2UL 3T2PA 4YUEH 1P1ZA 2MCPH 1FCGA 1ZMYA 4FG6C 3PQYB 4YAQB 5LGHL 1JMXA 1SJHB 4BQ8A 2X9YA 4BSVB 1NANH 3I9GH 4PBVC 4P2OC 2PTUA 1RJYB 4X98A 1B6UA 5I16B 2C1PB 3VFNB 4O2EA 2JJSA 3W5NA 2EDTA 3GHBH 4JPWL 4PREA 4HG4K 3SGDH 1NCNA 4PV9A 1AC0A 2AJVL 4I0PB 1I3GH 1XF3B 4M62H 4DZ8A 2D31B 3BSZL 2J1KA 4X5XA 1AIFB 2CLVB 2Q7YA 1R5IB 1XF5B 4AQOA 4EBQH 3CSPA 4ZNEE 1IL1A 3SDAC 1MH5A 2A9NL 1PDKA 5ALCH 3TPKA 3VRIB 1A7OL 5F9OL 1IGFH 4LLDA 3HCVA 4EVNB 4JFEE 2KZWA 1KCSL 3NFPB 3TZVB 3CVIL 2GY7B 4Z7VB 3B9DA 2NY3C 1MWAA 3MRHB 4XVJH 1SJXA 1UEMA 1ZVYA 4GRLD 1MOEA 3G9VA 5J8OA 4DGVL 3P77A 1RZGA 5FDWA 4JFXB 2EIZA 1G7LA 4PJEB 3RDTA 3MRJA 5C2UB 3LV3B 5EOTA 2OL3H 1OW0A 4FA8A 3V79C 2X4RB 1ZV5A 5EO1A 1CGSH 5FHBH 5GZOD 4M6ML 3V5DB 5GSVB 4YLQT 2UWEB 2WSKA 5CSZB 3ULVF 3T0XA 4LVEA 4TVPH 4QRSA 2NW2A 3MRIA 1TZHB 4FXKB 3PHQA 1K3IA 3O3AA 3PQYA 1SJHA 5L0QC 1XAUA 4PRHA 3D3VE 4BSVA 4JG1L 2X4SB 3B9EA 1RJYA 2H32A 3MMEB 2VDOH 4X8JB 5I16A 2C1PA 3VFNA 5C3TA 1Z0MA 1A6WL 3O6FA 1JBJA 1MUJB 2QQNH 2FECI 5D7JD 3HZVB 4NPYB 4NCDA 4UIKL 1OP5H 2H1PL 2YD9A 2G75B 4C4KT 5CJXC 4FFWC 3KPSB 2PETA 4OLEA 1AIFA 4XTRD 2CLVA 2C7UB 4JFHE 1ES0B 4G43A 4XX1E 2CXKA 2PXYD 1OF2B 5TE7L 3VRIA 3TT1H 4M1GL 2DTSA 4HX1B 5T5FH 4IOFC 5I18L 5DUPL 4FXLA 3VH8B 2OXGA 4EVNA 3NFPA 4GRMB 3TZVA 3VA6A 4Z7VA 2Z31C 4NRYB 2RCSL 5LCVH 5FGBC 5IT2H 3S36H 1OLZA 4CADB 3CLFL 2DQCH 5FGCE 1DTUA 5T5NF 2WAHA 4LPCA 4MA7H 4PJEA 1YQVL 1KTDA 1YPZE 5BV7L 3QO0B 2ZUYA 4XMLL 3S3JA 3LKPB 4PTUB 4DZBB 3RY4A 2FR4A 4MDJB 3FMGH 1TZHA 4FXKA 4X5LA 4RGNB 4XAWH 5F1NB 3T2NH 4F15C 3GMRB 4X83A 1FVCB 1LP9A 3HG1A 4ODBD 2CUMA 3WEXB 2UV3A 1AGBB 1RUAH 1R5WA 5GHWH 1XF2B 4NO3B 3WFDL 2ZOLB 4X8JA 3PJSB 5JMRA 1UWXK 1JGLH 3AFLA 1QLEH 2EDJA 4ZMAT 4N5UA 4OZGE 3H2WA 4NPYA 5AD0B 2MKLC 4JZJB 1Q9WB 2G75A 4XMPL 1BJ1J 4NZDA 4PRDB 3UDWC 1BMGA 4U0QB 2XY1A 1ZLUH 4DEPB 1J10A 5D5MF 1EK3A 3N1QC 1G7MB 2C7UA 3ZHDA 1ES0A 4JO3H 3N50A 4PJ8A 3TNNB 2D4FA 4OJFL 2DQTL 3ROLB 4HX1A 3BWAB 5E2JA 5JW4N 1A0QL 1MJ8H 4LEXH 2HFTA 5SX4H 3RIFF 3ARUA 3TBVB 3TA3A 2C3GA 2DQFB 3P9MB 4AG4H 3FN9A 2DLFH 4Y4KA 4DVBB 2R0ZL 3CVHL 5KAQG 3VWKB 3TN0D 2HFFB 5CGTA 1OARL 5F88B 4YHYC 1HE7A 4KU1A 5DD1L 3QO0A 3QXAB 2M2DA 3LKPA 4OZIF 1L7IH 4AYFA 1Q94B 4DZBA 5KSBF 2NY6B 5EU3A 3BP5B 4MDJA 4PJXF 3RNQB 2Z35B 3NPSC 3MXVH 5F1NA 5IW3A 1EMTH 2WBJC 2P46B 4ONOA 1FVCA 2Q8AH 4ZAKB 2ZCLH 2MNUA 1LQSR 2NW3B 3M45A 1AO7D 3QT2A 4NYLB 3LS5H 1AGBA 4G5ZH 4OV5B 3M1BA 4NRXA 4QRTB 5KS9B 3WBDA 3TYFA 2D7TL 4K9EC 2Y36H 1XF2A 4NO3A 4CRPA 1QBLH 2OYPA 3RWIB 3SDDD 3PJSA 2YUZA 5C0BB 2FD6L 4OGYL 4JFFB 1DBAH 5CCKH 3RPKA 3HPLB 3QUML 4JZJA 1F97A 2RGSA 2VDPL 4K55A 3O8XB 4NKOB 4PRDA 1VENA 4JDTL 4NM4L 5IG7A 3JTTB 3GJFB 1G7MA 1AFVH 2DWDA 4IRJD 5A16A 1DBBH 4KJPD 4TQEL 1G6RL 5I71B 4JFQA 4MSWB 3DX8B 2BMKB 3BWAA 1ZLVH 2YUWA 2L4OA 4GUPB 5MEOA 2MCG1 3ZHKA 1WV7T 3EOAB 1QVOB 2NY1D 3DV6B 3HZKA 4OLYH 2N56A 3TBVA 2DQFA 5C09B 4DVBA 2DBJA 3E6HB 3MLPA 1GGCH 3FQWB 1INEL 1J18A 2KBGA 4AENB 3VWKA 2P5WA 3OJMB 3RWHB 2VAAB 1NLDL 2V6HA 5C07B 4R4FH 3HE7B 5F88A 1BZ7A 2DLTA 3QXAA 2ZG2A 3QHFH 4FQCL 5GGTH 3Q6FB 3TVMA 2QQLH 1Q94A 3QQ3B 1P7HL 3BP5A 1PKOA 3SEPA 2Z35A 3U7WH 1FORH 4G9FA 3I84A 1DVFB 2WQ8A 4G6JH 2NW3A 4XNZB 3T77B 2XZQL 1NCAH 1MRFL 4ZS7L 4OV5A 4QRTA 5KS9A 1CXHA 3GMLB 5T3XH 5KJRH 4M61A 2OQJB 4PG2C 3SGKC 3GKZA 1PX4A 1A14L 1FH5H 3IFOB 4LGPB 3RWIA 2BSED 3BZDA 3S35H 3V6OE 4DUXA 1NUDA 4JFFA 5FB8B 2LAAA 5GS0C 3ZE1F 5IESH 5HYEA 3X13B 4UT9L 2W0KA 3CPLB 2FL5A 2HKHH 1WZ1H 1H3PH 1MHEA 2BNUB 3JTTA 3W0WB 3GJFA 3MLXL 3QNYB 4H1LB 5DF0A 3RZCD 3IDGB 4MJ2A 4MSWA 2MWCA 2BMKA 4LRIA 4TN9A 4WJ5A 5TDOA 3SBWC 4H26B 1DBKL 5E5MA 4G6KH 2A2QT 4GUPA 4RA0C 5JIHA 4WO4B 2VN7A 4HAFA 5JDSA 2BY0A 2Y06H 3EOAA 3DV6A 2ICES 3LEYL 5C09A 4HIXH 4I3RL 1U8OB 2VC2L 3E6HA 4GBXD 1XCQB 2P5EB 3FQWA 1RD6A 4AENA 1KUMA 4OCSL 3VD7A 1UENA 1ZT4B 1MFCL 3HE7A 3SDXF 4GOSA 5F7MC 2PF6A 4PGDB 4AK1A 2J8UE 3Q6FA 3QQ3A 1WZMA 4GG6B 3H9SD 4UMGA 1OAYL 2B7DT 2EYTA 4OB5H 3NA9L 2NY2B 4PJIE 3CX2A 3FO2B 3B5HA 5FCSH 4PP1C 1UA6H 4X5WB 5LXGH 5IFAL 4HWUA 4NZTH 4ODXA 4A6YB 3T77A 4HH9A 4WENB 2UZIH 1OTUC 4KPHH 4P9MH 4ACPA 2GAZB 3GMLA 4XC3H 2VIRB 2OQJA 4PY8J 4KGLA 3BDBA 4MNQD 3QP3A 1H15B 1T0NB 1KLFA 4RMQA 5DQJB 3CDYA 5FB8A 1P9MA 3UTTA 1JHTA 4F7PB 2XG4A 3RTQC 2FX7H 3D48R 2JB6B 4O4YH 2BNUA 4NQTA 3MV9D 3W0WA 1KCVL 5MHSD 3QNYA 4YDIL 1NC4D 4U1MB 1DQTA 5IOPB 2YHGA 3IDGA 3U7AA 2J6EL 2BC4A 4U1IB 3I6LD 3THML 1D6VL 4Y2DD 5HYJB 5DA0B 1UKSA 5ESAA 2Q86B 1I8LC 3VH8G 5JW3L 1BF2A 4PY7A 4X4ME 2K7PA 5DUMH 5I6XC 1OGTB 1J1XH 1U8OA 1H8OA 1EFXB 4JY5H 5KBNC 1XCQA 2P5EA 1F6AB 4EQ2A 1FZOB 4P5TC 4XCYB 1ZT4A 4UUJA 1NCDH 1B4JL 4PGDA 5I1CL 4JQVA 4OZHE 3LRGA 3V0VA 4NQDE 3V0WL 1NFDA 3ILQC 3FQUB 3STLB 1QKZL 3U1SH 4R7NA 4ESKA 5EB9A 4GH7B 5B39B 4EDWL 1J1PH 3LRSB 4JREC 3HC3H 4ZO9A 3E2HC 4X5WA 3MA7B 4KK6D 4DAGH 2FJGB 1FFQA 1D5ZA 1RY7B 2HLFD 5FDYA 2GAZA 5DI8A 2VIRA 4MHHG 2IQ9L 1LO0L 1M1SA 4Y4HA 5IHLB 1OWWA 4ZS6D 3NCJH 1H15A 1T0NA 3G6JE 3V2AR 4ONGH 5EWIH 3D18B 3EJJX 3D39E 1RSFA 1JPSH 1KPRB 3EOTH 1NAMB 4XP5L 5C6TL 3VMNA 3DX6A 1G1CA 2WK2A 4M7ZB 2JB6A 4P23A 9CGTA 3KPOB 4P99A 5IW1B 5DR5H 1D9KA 1GGIH 2HT4D 4OBSA 4PLJD 4NQEB 3L6FB 5IOPA 5EBGA 2SEBB 5GS3A 4P2RE 2OMBA 3IRPX 4DKEH 3ARDD 2BFVH 3IJHB 4QTHB 1DLFL 2R69H 4QXGL 3L3HB 1MHCB 3LEVL 4D2NA 5L6YL 3M07A 3PWLB 4Z7UE 4UBDC 2EYSB 3FN0L 4OIIL 2HAZA 1EFXA 4DW2L 1HIMH <