3HR5B

M1prime peptide from ige bound by humanized antibody 47h4 fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGIAWVRQAPGKGLEWVAFISDLAYTIYYADTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDNWDAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab h47H4 light chain
publication title Antibodies specific for a segment of human membrane IgE deplete IgE-producing B cells in humanized mice.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 220
sequence length 220
chains with identical sequence H, I, J
ec nomenclature
pdb deposition date 2009-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr5B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr5B01
1UADC 2PTTA 4U1LB 1AE6L 4G8EA 4ZSOA 2X40A 4L8SC 4WFGD 2VKWA 5LGJB 1TTGA 4LRNL 1R5VA 3C5JA 2X05A 2ORBL 1NEUA 1ZTXH 3QIWD 3VXPB 4YDKH 3QEGH 5E4IA 2YWYA 3KPSB 2A6DB 1V3KA 4FQPA 4Q6YA 3TNNB 5H2BA 2CLVB 2HRPL 4N1EA 3WLWC 4YQXH 1X5JA 5HHMD 3Q3GA 4XPFH 2EKJA 4M6OH 4QTHB 4EJ1C 3DX7A 1I8MA 2VH5L 3WFCH 3TF7C 2E9WA 4QXTA 4PJDB 5MP6L 3ARPA 5ACZB 5IVXB 1C1EL 5C0EA 4QHUA 1NDGB 4JFPA 1I1RA 2HVKB 5DD0L 3MLYL 1GC1H 3BP4B 2XPGA 5HYJA 1WISA 2FEEL 2FH6A 1N26A 4JFYB 3FB6A 2X7LB 4XP6L 1T2JA 4KJQC 1T22B 1M7DB 3ULSB 4OZGB 2AK4A 1DUZB 1ZLUH 1I7RA 4JM2C 4WEBL 3WHE0 2J7LA 4XNQB 4F58L 1RIHH 5E5RB 5GQBA 5DRZA 5DJ8A 1FIGH 1NFDA 2H32B 1DLHB 4L3CA 1JWUA 3S36H 3CFJB 1BX2B 4M61B 2CLRB 1MREL 1ACYL 2CO6B 4LHUG 2IAND 5FB8B 1NCBH 4BFIB 2Y36L 3DRQB 3D39D 1YN6A 2NY5C 1UM6L 4NZRH 3T4YB 4UQ2A 4NQCB 2H3NB 3WIIH 2VMFA 4OFYD 4IRSB 2CDFB 3QUMA 4RBPH 3O3DB 3VRJB 3UTSE 5SX4I 3IVKB 1A6AA 1R3JA 1E27B 2ZJSL 4KKBC 3KJ6L 4MNQD 5EBGA 4JFZH 1F13A 3P9MB 5DJ6B 1S7UA 4KKNA 3QFDB 1I4FB 1CYGA 2R9HD 1JI1A 2F5AH 1WK0A 4D9LL 4JFFD 1ND0A 1EJOL 2MHAA 4NUJB 5D2NB 4POYA 3TVMB 3UJTL 4WHCA 2ICEA 4X0KB 3HRZA 3LHPL 4FQJH 4OM1L 1T3FA 4HXBL 3BWUC 1GGYA 1H8SA 2L4OA 2F9BT 3M8OH 2LE9A 5C2BH 5GGSB 5JW4N 4Z7UE 4WO4B 2DM4A 1KYOJ 3OF6A 5IF0A 2WAHA 4I1NB 3NTCL 1KCKA 4PRDA 2QADC 3HNTL 1JGLH 5BV7C 1H8NA 4EUPH 4ONFL 1EXUB 4KAQL 3GSNL 4A6YA 4KKCD 1S8DA 4OAWB 5B8CA 4D8PA 5D93B 2XNAA 3JWDL 4HWZA 1I8IB 2BVYA 3FQUA 2DLFH 1A4KA 3DTXB 4RQQA 1N5YL 1U8KA 2IAMC 2X4QA 4XAKD 4XMLL 3CFBB 5E56A 3PQYA 4HUMB 2YN3A 2OQJB 3GM0A 1FGNL 3VDAA 5TPWH 3UBXB 4EN3A 4LVEA 4NKDA 5DJ2A 4ZFZA 3O8XB 4LARH 1P4LB 1I3UA 1NGZB 4JRXB 1JPFA 5B21A 5SWZD 1XF5B 2R4SL 3P2TA 4YHMH 4TUOA 4U6XB 3HE7B 4UU9A 4QTIL 1EEZA 2B0SH 4AL8H 3U0WH 3DX8A 2IAMA 5GSRA 3QDME 3EOYG 4NCC2 1KOAA 3G6AA 4JAMB 1P1ZB 1OLZA 3BH9A 1FG2A 5TE6H 2L0DA 2PO6A 4FQQB 4HG4J 3QDGB 2WLZA 5FYJL 4MQTB 4N0FB 2KUTA 3O2DA 3G6JB 5FCUL 3SN6N 2R4RL 2YPKB 2V5RA 2WV3A 3MRNB 2NTFB 1A9EA 4HWUA 2NLJB 4KK8C 4NKMB 4Y2DD 5IMLB 4JFOA 1KB5H 4OGAD 4L4TA 5EOCL 3R8BB 1CCZA 2CXGA 2H8PA 4Z7QE 3QIUB 3MV7D 4KHTH 4XI5D 3QIBB 3P77A 2VDNL 1B0WA 3LKQA 1MRFH 4Z0BL 5C0RH 4LNVA 5CEZD 1KPVA 1HH9A 3DLQR 3UDWC 1XF2B 1R5WB 4WJ5A 3ZT6A 2DQGL 3RZWA 1KCSH 3NN8A 5GS3A 2W9DH 1S7WA 3W2DL 3MTRA 1X5HA 2NY2D 3OB8A 4FQ1H 4Z7UF 1NBYB 2IADB 4EDXA 3X12B 4XX1G 1IKNC 4NNPL 1R3KB 2J8OA 2H2SD 5I1GL 4UB0L 5I8EA 2HG5A 4PLOB 4YPGA 5CSZA 1KLUB 2BHUA 2NY0B 1FFPB 2VZ3A 1K4DB 3CD4A 4YFDB 1CXEA 3SQOL 1NCTA 4GXVH 2VQ1A 3OSKA 5ID1B 2VLRA 5TGBB 3FN9A 5D70H 3ARWA 4HJ0D 2ZOLB 2E7BA 3RAJH 3FT4B 1ADQL 3SPVA 3SE8H 2JELH 4LP4A 3IGAB 4BKLA 4BSVB 3KYAA 2V5TA 1IC4H 5DHVB 5JZ7C 4EI6A 2DQIH 3IAPA 4KZDL 2VZTA 1RFDH 4MYWB 4NKOA 2KZ1B 5L2KA 4PJAB 1MELA 4TRPL 2R1WB 3V5HA 1SBSL 1NGXA 3MRMB 3NGBC 2YS4A 4OCXH 5H8DA 3FO2B 1A6ZA 1X7QB 3BQUD 1SMOA 5A43C 2J3SA 5ESAB 4P2CG 4HC1A 3L5IA 4DWHA 4KQ4L 5FYLH 3S3JA 1S5HB 1WEJH 4J1UA 5DK3A 4PJXB 3QDMD 4MB4A 5I1DB 2FH8A 4NO2A 4JPKL 5I2IB 1MRDL 3OKEB 1JHTB 2GITA 2Q8BH 5GGQL 2GFBA 1HINH 4D0CB 3P73A 1YEEL 3ZKMD 2OX5A 2EC8A 3VXUB 1U93B 3B2UD 2V9TA 3MUGA 5FGCB 3V0WL 3TJEH 4Z7QF 1W0WB 4NRYB 4YHLH 3LQMA 1QR1B 2YPVL 1AJ7H 3RWJA 4XBGB 3KWWA 1WAAE 4O2EA 1BMGA 2C4FT 3OKDA 5IB4B 2IPTL 2DJUA 4K8RC 1II4E 1INEL 3VFOB 4KK6D 4HF5H 4OB5L 1QFWM 3C5SB 3MRFB 4XZUA 4WI6A 4GBXC 3U7WH 5DYOA 1VERA 1KIPB 1IEBB 4ZUWA 2Q86B 4HIXL 2OXGA 2EDOA 4HH8A 1JZ3A 1WCQA 5IROA 4DN3H 4WRLA 4HKBA 3RPKA 4PLNC 1F58H 3MNZA 5EZOH 5HVWA 2AJ3A 3GSWA 1NAKH 3WN5A 5K9KB 5FFLA 2XACC 3G5VA 3STBA 4LSVL 5IM7B 2F8OA 4S10A 3RX8A 3QJHB 1MLCB 3TJHD 4JFDB 4M5YL 2EXWD 2HTKD 1RY7B 2AEPH 1N8ZA 5EC2B 1F6AA 2ADFH 1XGTA 3HPLB 3RBSA 5C9KA 1HXYA 1O0VA 2VXQH 1CR9L 2EDYA 2YXMA 2EH7L 4HUWA 4LVOB 5IHUL 5GS0D 4RAVA 2BNRB 3HG1D 3ILQD 4APQC 4G43A 3FZUD 4AT6B 1CI5A 3HI6H 4I2XA 4L8DA 4DFIA 3MLUL 3WD5L 4L8BA 1KCRL 3MROB 4LDLB 4PJEE 3SE4A 4F7PB 3ROLA 1T4KB 3H9SB 1VADB 3K8LA 3L5WA 4XNMA 1SVZA 4F80A 2EDQA 2LVCA 4X6FB 1NUNB 2ADJB 5I73C 4GLRI 4TTGA 2Q76A 1G6RH 2ZSWA 5H94B 5E08H 5FV2A 5KZCB 4YR6B 3MNVB 3A6CH 1XGRB 1FG9C 3FRPG 4PR5B 5F1OB 4XHQA 1OSZB 2J1KA 3SKOA 5CGYD 1HNGA 3VD5A 4LCCA 2R8SH 4NQED 3MRJB 3JWOC 2NYYD 3GNMH 2EDBA 1LNUA 3KPMA 3T0WA 1JHKH 5BMFL 5F9JB 4M6MH 3HN3A 4CNIB 4NGHH 3LIZL 1PEZA 4QY8B 1WAAF 5LWYH 4IRJD 4LLVB 2VXUL 4JN1L 4F3FA 3WE6B 4K71B 4P2RE 3T3PE 3BWAA 3IB4A 3KYMA 4YNYA 4N0YH 5HYFA 5HHXL 3SDDA 2MNUA 1GSMA 1NAMH 3MJ8A 3DMMD 5AG9A 3TIEA 5I1HL 1W72H 1FFOB 1LP9E 1OHQA 3HAEB 3EW3B 2W9LA 3GI8L 5DD1L 2Z31B 4XCFH 2A77L 2QQLH 1KJMB 4N8VG 5C08A 3EJJX 3HZVB 3D25B 3LH2H 5IUSA 1OF2A 3G9AB 3WO4B 3SDXA 5IW1A 4YEEA 1A6UL 3HZYB 2G5BB 1N7MH 2D7NA 1MHEB 5EU4B 1TTUA 1QNZH 1NMBL 3QG7L 1F4XL 2DTSA 3F5WB 3FQXA 5HYEA 1FVEA 3VFMA 3MRQB 3P9LB 5B39G 4R4BB 1DL7H 1CXHA 1ZLSL 1AGFB 3GJEA 4JRYE 5D7JA 4ZAKB 1CICA 3RKDC 2GJJA 3P0VL 5IMKB 1UM4L 3OG4B 1D9KD 4PRNB 2FB4H 3CFDB 1E6JH 4IEFB 3SGJA 2ARWA 5DD5L 5F1IA 5E2VL 5ISZA 5I1EH 1XGPA 1RULL 4PJEF 3L5XH 2Y07H 2DJSA 1LDSA 4M1CC 4GUPA 5L88H 4U1IB 3MOBH 2PR4L 4F8QA 4MA1B 5GGRY 2YUWA 3HI5H 2I9LA 5E03A 1FFNA 5IP4A 4WW2C 3FRPA 5HI4D 4I3RH 3CPLB 3C60B 3GRWL 5EU6E 1CN4A 1ORSB 1XCTB 3DUSB 4G3YL 1QD0A 5EO0B 1KCVH 1NLBL 5DEFB 4E41E 3IFPB 2ZCHH 3MZTA 5C7XH 1L9MA 4HGWB 5DWUH 5IG7B 3QJFA 4FXGB 4KROC 1G7PA 4G9DA 1S7XB 1ZAGA 4GRLA 1MRCL 3L9RB 4XPTH 2XZZA 3T3PF 1U3JA 1FL5B 2FCBA 1MFCH 3OX8B 1RZFH 4HPOH 3DGGB 4R0LB 1IAKA 3BGFB 4P2RD 4HCRH 4ZTPH 5SWSA 3H3KA 1BPVA 5J11C 4GG6B 3SKUD 4H25B 3RPIB 2DJ4A 4DN4H 4Z7OE 3OZ9L 4R4ND 1LP9F 1FO0L 2NMSA 4HFUL 3KVQA 1MI5B 2DBLL 4N8VA 4GAFB 4FQXB 5TQ0H 1T21B 4FTVB 1A7BA 3AB0C 5SX5H 3GKZA 4TOYH 4P5KA 1AD9B 3PGCA 3WDIA 5JXAL 4K3DL 4YHYB 1XCQA 4QRPE 3L3JB 1NGPL 1HXMB 4PRPD 5C6PB 4DCQB 4JEGB 4X8XA 2GJ6E 4WV1C 1R0AL 5B39A 5ICYB 5F96L 4MJ6B 2AGJH 3Q5OA 4MNGE 3MLZH 2VLKA 1TCMA 4NT6A 1A1OB 3ARXA 1IE5A 5EU3B 2YK1L 2VC2H 1MFEH 2ZCLH 1OP3H 3C6SA 4JRYD 5EZIL 4HIEA 2XZAH 1TFHA 3FN3A 4RFNB 3V52L 1NC2A 1ZHNA 3VGHA 5J13C 3O4OC 1R3HA 3CSBA 2XWJB 3QHFL 4WDIA 3WUWG 5E5MA 1DQJB 4AENB 4WUUE 4J6RH 1JK8B 2N4IA 4JO4L 1T5WB 1U8NB 2I24N 4NYLA 4D0DA 4PB9H 5FM8A 2Z92B 1NUGA 4TUJB 2JJSC 3BUYB 3VFUB 1P9MC 4MJIA 4MD5B 1KBGH 3X14A 4Z76A 4IRZH 1Z3GH 3S88L 3LVEA 3VXOA 1JPTL 3PWLB 4ZQKB 3FB8B 3V9FA 1IRAY 1YJDH 4GKZA 1DQDL 2HKFL 2E7CA 1HYSD 1AFVL 2OLDA 2P44B 3BE1H 3BPLB 3FO9A 1YQVL 1YY8A 4E41D 2CK0L 3P11L 2F54E 4GT7A 5D72L 1BQLL 5ILTL 1OGAE 5FO7A 4XPAH 1L6XA 1MLBB 2VYRE 3ULVC 1JNLH 3MRCA 4PJHB 4Y4FA 3NFNA 1U9KA 3QA3B 3DROA 4WHYH 1BJMA 4MX7B 3T1FB 4G6FB 4IJ3C 5CJQH 3TH3T 5LQBH 5F88A 3WBDA 5F9WC 4Z7OF 3PWVB 3EFFB 3MUJA 3PL6D 4GH7B 5L0QC 3O6MH 1OAKH 2AV7B 4ZFOL 4HPYH 1KC5H 4NWTL 2VL4A 5ICZA 4ELME 4RA0C 3LN9A 2DWEB 3OB0K 5JIKA 2QJDA 4YHOH 4DK6A 1H3WM 2IBGA 3S3PA 1MFAH 4QRPD 2ESVE 3LD8C 3WCYA 4Z7NE 1OW0C 3LEYH 5C1MB 3PWNA 1QBLH 1MIML 3O6KH 2GJ6D 2XQYK 4HULB 1A0QH 1FN4B 4GMSL 4RNRB 5EBWA 4K3HA 3SDAD 4HIHB 5DJZB 5DJ0B 4LQFH 4OGXL 1RZIB 2G9HB 5T3XH 2PW2A 4Y4KD 1RZJL 4TPRL 1XF4B 3I85A 3KXFB 1VGEL 4G6KH 1F2XK 3WUWA 1BLNB 3EYVA 3OJVC 2OI9C 3BKCH 3MRDB 5IFHL 5HYQA 2AQ3A 1YYML 4YGVB 5CWSA 1OW0A 1WGOA 4WUUD 3OKNA 4AK1A 2VABB 5CCKL 4RZCA 1J18A 3MA9L 1OTTD 4LCWD 3KPPB 1JPGA 3B9KA 1DDHB 2NY7H 1ZT7B 5E9DA 4A2MA 3VRIA 5HGDB 5HDQL 4WGVB 3REVB 3MLVH 5AUMA 5INDB 4DOHE 2XA3A 1HKFA 4MVBD 3P4OA 4LCYB 3RGVB 1TQCC 5JA9A 5FGBA 1ZTXL 2B5IC 5EOQH 5BS0E 5IWLA 4YDKL 5F7DA 3QEGL 1ZA6A 5A3ID 2DWDA 3V79C 2VAAA 4FFVC 4YQXL 1VKXB 1B0RA 2VTFA 5EB9A 5DA0B 5DMGC 1IMHC 5KSAB 3C8DA 5CGTA 1PG7H 4M6OL 3V6ZA 4OUOA 3UTTD 5EZLB 3EDJA 1J8HB 3VXTA 5DRNB 3WFCL 2XQYG 4LVNB 4XPHH 1T1XA 4PJCE 1KV3A 1CXKA 4NC2B 4PJ5A 4PGJA 2JCCE 3IDGB 3O41B 4WWKB 4YHIB 3RHWF 4LHJB 5EO1B 5HHPB 4KKLD 3E3QC 4ELMF 1FSKB 4PJ9C 3TT1H 2V7NB 5J7CC 1GC1L 3IF1B 4OSUH 1J0ZA 3V4VH 3SKNA 1AXIB 1TVBB 3C08H 4JZNB 5HJ3A 2OTUB 5GGUA 2ESVD 1OB1A 3LEVH 3L3KA 4JLRA 2YXFA 1DVFD 1YC8A 4Q6IC 4ISVA 4WI9A 2EDFA 1JYWA 3UJJH 3UP1A 4ELKA 4CVXB 2HJKA 3EOAB 5HHOB 3N1MC 1FIGL 2NNAB 3KPRE 4PJ8D 3HE6B 4XCEA 3S36L 2WQ8A 4JZJC 2EICA 2ICWA 1VFBB 4KK9D 5I1CH 3F62A 1BFOB 3OR6A 2WUCL 1HILA 3DX9A 3RWFB 1VGKA 3O6FC 5I15H 4PJ9A 4QXUH 1NBVH 1SBBA 1Z5LA 4HBCH 3C5ZB 4P46A 3PHSA 2ZUSA 1NCBL 4QXGH 1T0NA 3DV4A 3VG0H 5DFTA 3KYKH 4NZRL 2FL5A 3DVGB 3RZCD 3KS0H 5HI5C 4Q6IA 4LIQH 2EIZB 5DC9B 5E4EC 3FB5A 4NO0D 4QHNB 1SJXA 3O11A 5HYSB 3IETB 4O51A 5CEXA 1EBAA 5IB5B 2VDOH 5E8PA 3QUMH 2C1PB 4XBPA 4JFED 4XMPH 3IJSB 4LPXA 4JFZL 1HIML 4OBSA 4XTRC 3QEHB 4NO3B 1ZA3B 1JGVH 5F44A 5E2UH 5ABDE 2HJFB 3UYOD 2F5AL 1BBDH 4MAYD 4PLKC 3RUGB 3ARFC 2VQUA 1LILA 4B41A 1UXSA 1VPOH 3CZJA 5BS0D 4U1LA 4M9OA 4FQJL 2BHZA 2HLFC 1JWSB 1CFSB 3PWPD 4OF6A 3M8OL 5LGJA 5DJAB 3VWJC 3VXPA 3BEWB 4UT7H 2O5YH 4S0TD 1QZ1A 3TNNA 1MAKA 1JGLL 2CLVA 2NY6B 5KS9E 5L9DH 3O9WB 3BP6B 4PJCF 2Q1EA 3ARFA 3UBXI 3V5DB 1WZKA 2YD7A 4QTHA 2VNCA 3TBTB 5HDBE 3N06B 3RWCB 1S5IH 2DLFL 2JCCF 3QUZB 1QPPA 1A02N 1G0YR 2O26U 3QDJB 9CGTA 4LEOB 4PJDA 5LCVH 3VWJA 3HB3C 5ACZA 4KUCF 5IVXA 1I1AC 3K4AA 2DYPD 4S11A 2V2WB 2HVKA 5TPWL 1CD9B 1W8OA 4HK0B 5FYKH 3TO4D 4JM2F 2P46B 3CC5B 4KJQD 1YMME 4LARL 3BP4A 4UI2A 5BV7H 1NMCC 4YHML 4JFYA 3BZDA 3T77A 2X7LA 4OLEA 3PV6B 2CIIB 4LSTH 2VLJB 2B0SL 3EFDL 4AL8L 1T22A 3KPRD 1M7DA 3U0WL 3GO1H 3ULSA 1SEBB 1HZHH 3KLDA 1DUZA 1EVUA 4PLJD 4XNQA 1YEIH 4K94C 3ESVF 5TE6L 3AREC 1AKJD 2YPLE 2H32A 5TQ2H 1DLHA 2R1YB 3CFJA 4C56E 1UQSB 4YHKH 1BX2A 3T2PA 4FABH 4J4PC 4M61A 4YDIH 2DKSA 1A1MB 2IANB 4HKXB 2I27N 2YD6A 2GJZA 3O2DH 5FB8A 3QEUB 3I3BA 4NJ9H 3DRQA 4BFIA 4C54A 4U7SA 5D1QC 4OFIA 1KB5L 4G42B 3VGGA 1G7IB 5DD6A 3AROA 2JB5H 1T20B 3T4YA 3F12B 2B1HH 5KTEH 2H3NA 3D9AH 1LK2A 4IRSA 3O3DA 4KHTL 3VRJA 2ITCB 2HVJB 5GSVB 1MRFL 5E8EB 4RGMB 3LSOB 5C0RL 1CWVA 4MNQB 5D7LE 1E27A 2DOCA 1U8MB 4X5WB 5FM4A 3KAAA 4QT5B 4CDHA 4R97C 3P9MA 5DJ6A 3D2UD 2Z8VC 1KCSL 1I4FA 2W9DL 5L8KB 4M5ZH 5F6HI 1KB9J 4FQ1L 3D0LB 2EDLA 5J1SC 5D93C 4NUJA 5D2NA 3TVMA 2J12B 4BFEA 4Y5XB 4X0KA 2FWOB 4CVZB 2QHRH 4L9DA 5KS9F 3I2CH 5E24E 5L6YH 5GGSA 1KF9B 4L4JA 1LO0H 2DS4A 1I8LA 1EHXA 1DUYB 3N0PB 1HEZB 2H6PB 1RVFH 4ENED 5HDBF 1Y0LB 4OCRH 1EA9C 5D70L 5E6ID 4JKMA 3RAJL 4MJ5A 4NM8H 3I50H 1EXUA 2JELL 3QEQE 3SE8L 2MMXA 3MV8E 4GS7B 4OAWA 4BQ9A 1B6DA 1IC4L 4OZ4A 4M3KB 2DQIL 1I8IA 4JKPH 3U4EB 5F70A 1RFDL 5IOPA 3C87A 3DTXA 3BZEB 3GMLB 1C5BH 4B7LA 4OCXL 1FCCA 2NTSP 3CFBA 2VSCA 1QLRB 5DRXB 4L1DA 3KS0J 5I6XC 5DMKB 2OQJA 4MXQC 3VD9A 3SE9H 5D7SH 3UBXA 1K9TA 4HIIB 4DTGH 4AYFA 3MUZ1 5ADPL 3O8XA 5FYLL 1P4LA 1NGZA 1WEJL 1OTUD 3PGFH 4JRXA 1XF5A 4UT6H 4HC1H 4U6XA 4QWWD 4CU8A 4P2OC 1DBAH 2FBOJ 2W9EH 3KYOB 1I3GH 3SGEH 1RUMH 2GW5A 5GIRB 2Q8BL 3IDIB 1ZLWK 1HINL 4C56D 3RGHA 4JAMA 1P1ZA 3DETC 2EDKA 1D5IH 6FABH 4ZO9A 1INDH 1PAMA 4NQSB 4FQQA 3QDGA 5C0AE 3TJEL 4N0FA 2GK2A 4YHLL 3G6JA 2CSPA 2YPKA 3HFMH 2VISB 1AJ7L 1MHHB 3MRNA 4JQVA 4Y2DB 2AW2A 3UTSB 4NKMA 5IMLA 4U3XA 1A6WH 5BJTA 3QDAA 4OGZA 2YRPA 4HEPG 4HZAA 5FECB 3QIUA 2XTJC 3BPNC 3QWRA 4OFVA 3QIBA 4WI5A 4HF5L 1B3JA 5FUOH 2H45A 5GS2D 4ZOEA 3U7WL 5FHBH 1DBKH 2E7MA 2M2DA 1R5WA 2DMBA 3D3VD 2P45B 4QOKD 1LQSR 5GISH 3QFJE 1JL8A 4OKDA 1NBYA 5EIQA 5EZOL 1XZ0B 2R2BB 4M9PA 4NQUA 1NAKL 4Z7UB 2IADA 4UIMB 3X12A 1R3KA 3MGTB 3BJLA 3SDCC 4OQTA 4WI3A 3AFLA 2VDLH 3WS3B 2C3HA 1KLUA 4GW5B 4K8RH 1K4DA 2AEPL 3QEQD 3UTPE 2ADFL 2GSGB 3D87B 5TGBA 1BAFL 5JZ7D 1ROWA 2VXQL 4PD4J 4PP1D 2ZOLA 3FT4A 1IAII 4HWNA 3E8UH 4U6TA 3IGAA 4BSVA 3HI6L 3SOBH 4X7TB 5DHVA 1JPSH 2BDNL 4W4NA 1KPRB 2VDMH 5DFVD 4WIQA 4HAGA 4OZFB 4W70A 4PJAA 4X98B 2R1WA 3MRMA 3KLAB 1EX0A 3BQUB 3FO2A 2UZIH 4KJPD 1X7QA 3BN3B 4KZEH 1G6RL 3IT8D 5E08L 5ESAA 3A6CL 2NZ9D 3LKNB 3QDMB 1S5HA 4PJXA 3TWCL 2DQCL 2P4AB 5I1DA 1E4KC 2R8SL 3GNML 2O5ZL 3OKEA 1JHTA 1Z9MA 2QQKH 4D0CA 5DHXB 1JHKL 2UWEE 4M6ML 4U7MA 5JR1H 3WFDL 3VXUA 4NGHL 1U93A 4TNWF 5LWYL 4G6JH 1DANT 1FORH 4TVPE 4W6XB 3L5HA 4NRYA 1E4XI 4LASL 1FLRL 4ZOCA 1KIUA 1QR1A 1UENA 4N0YL 2EXYC 3G08A 3RTQC 1E4KA 1NAML 1ZVYA 1Q1JH 1RJYB 4X5XB 1W72L 5IB4A 4OLWH 4ORZC 5I71C 3ARBD 4XCFL 3VFOA 2QQLL 2ARJB 3VXME 4CW1B 2FSEB 3C5SA 3LH2L 1QSED 1XF3B 2I9TB 3VGAC 2EDXA 4P4RA 3QFJD 4ZFFB 1KIPA 1IEBA 3BKYH 1N7ML 2Q86A 5JHDD 3BD4A 4EVNB 3P0YH 1QNZL 1MCNA 3WL9B 3HAEG 3ULUC 1QFWI 1MCWW 4XNZC 3RTQA 3N1PC 3WJLC 4ORGA 3CFIC 2ZUVA 4PG9B 3W11D 2NR6C 4POZC 5K9KA 3UTPD 4I0KA 3L7EB 3ETBF 4I0PC 5HVHC 3QJHA 1MLCA 1M7IB 2NZIA 5MEQB 4JFDA 3T0EC 1E6JL 4J12A 1JFQH 1KEGH 2DQUH 5EC2A 2LAAA 5I1EL 1RHHB 3BPOC 1FC1A 2WIIB 2GAZB 3L5XL 1JNJA 2VN4A 2Y07L 4K07A 2EEBA 1A7OH 4V2CB 5JUEH 2XIDA 4Z7VE 4HWBA 5L88L 4AT6A 3MOBL 4KGLA 2A6KB 2WUBH 3VXSD 3MYJB 2ZUWA 3HI5L 1G7HB 1QACA 4F7PA 3MROA 1MCOH 1RIVH 4M3JA 3H9SA 3QUYB 1VADA 1BQHB 4MDIB 1KTKE 3K2MC 4X6EB 4X6FA 1ZEAH 4XVSH 5T1LD 5AZ2H 3E6HA 5C09E 1NCUA 1NGWB 2BVOB 5H94A 4UQ3B 1KCVL 5DZNA 3MNVA 1J05B 1XGRA 1AGDB 2ZCHL 1JGEA 2UWEF 4PR5A 1OSZA 4F57H 5C8JA 5C7XL 5DWUL 2DI8A 5C07E 5C0FB 4PG2C 3MRJA 1B90A 1U41A 4XPTL 5JQHC 4TVPD 1MFCL 1RZFL 1I9JH 2UUDH 1IGTB 3FJTA 3NCMA 4QRRE 4XP1H 4P3WA 4LAQH 4HCRL 5F9JA 4ZTPL 3RI5F 4CNIA 4M7JH 4QY8A 4C55A 4GLRH 3UYRH 4LLVA 3VFWB 4DN4L 3WE6A 3UMTA 3N50A 5TQ0L 3CH8A 3NPSC 5E7FA 5IK3B 3U0PB 5FM5O 2WMPA 4BSWB 3UZQA 1ORQA 4TOYL 5F3BB 1UKSA 1WICA 3BVNB 4X5LA 2HFGH 1OVZA 3LEXB 4U1JB 5T1KB 1D6EA 3PABB 3HAEA 2BMKB 3CFCH 1BHGA 2E27H 2QR0B 2X4NB 2Z31A 3WHE1 2FR4B 1JZ8A 1KJMA 3B9VA 4O02H 4G7YL 1EV2E 2EEDA 3HZVA 4QO1A 1I9IH 2AGJL 3MLZL 4HJJH 1QFOA 5CEYB 3JWNC 3HZYA 2VC2L 1MFEL 2G5BA 2ZCLL 2ATKB 1MHEA 3PE9A 5EU4A 4RGNE 3FO1B 1CFQB 2XZAL 3ALWA 5LAXB 3F5WA 5IGXH 5IW3A 3MRQA 1BREA 4LMQI 1Q8MA 4R4BA 2EC9T 1AGFA 4MQSB 5M95B 3EKCA 4J6RL 1OGTB 1HHIB 3T2OA 1D9KB 4XP4H 3NZ8B 1KSRA 3GSOB 1WTGT 4Z7VF 4PRNA 4PB9L 1G9MC 3CFDA 3ZE0F 2FX8H 3TIDB 2B39A 1NCAH 3RVTC 1KBGL 4WW2F 4IRZL 1Z3GL 2NQCA 1TQBB 2E6PA 3T08A 1X4XA 5FYLD 2IGFL 1GHFH 1YJDL 3EYQD 4U1IA 3QXWA 4I48B 2QSCH 4KMQA 3TN0B 1CIDA 4BQ6A 5FM5M 4RMUA 3L1OH 4B5EA 1LVEA 1SY6A 3BE1L 3CPLA 3C60A 2DQTH 5EORH 4U1NA 4ETQB 5E99H 2NX5E 5IB1B 1W72B 1ORSA 1XCTA 3DUSA 3B9EA 2W91A 3FQWB 1CXIA 2DQEH 3RWEA 3S5LB 3V0VA 4XPAL 5EO0A 3ULVE 1A6VH 1JNLL 5F89B 4R2GC 4ZUVB 2C9AA 2CD0A 4KGJA 3IFPA 4FQXC 3L7FB 3IKKA 3UJIH 5DR5L 4HGWA 5AD0B 5IG7A 5LQBL 1PW3A 5CJQL 3RL1B 1S7XA 1F4AA 4HSQA 3NCYP 2C3VB 1FL5A 2UVFA 3DGGA 4R0LA 5D9SB 1OAKL 3QUXD 4LSQH 4HPYL 1KC5L 3UROR 1N59B 1EUTA 1UJ3B 4GG6A 3C9NB 3TNMB 4H25A 4QRUB 3RPIA 4YHOL 2JB6B 2ZUQC 1MFAL 4DW2H 3L3OB 1JE6A 1MI5A 3LEYL 1LP9B 4FQXA 2X09A 1RUPL 1QBLL 1T21A 4FTVA 3O6KL 2DICA 3B9DA 1A0QL 3U30B 3ULVH 2ENYA 1HHHB 1FYTE 4WEMB 5CHNB 1MAMH 1AD9A 1WBYB 3DURB 3U4BH 3ZKND 3L3JA 1HXMA 4DCQA 4LQFL 5GGVH 1BVLB 5T3XL 4U1SB 5FAAA 2GEEA 1L7TH 4KFZC 4N0UA 4G6KL 4RGND 5ICYA 3C8HA 1ED3A 4MJ6A 3F65A 1B2WH 3OG6B 4GAJH 2RGSA 3T8XB 4G9FE 5J12B 1A1OA 3OTTA 3BUTA 4KY1H 5EU3A 3VXNB 4JRYB 3WNMA 5D71H 4NHCH 5BRZD 4F9LC 2D7MA 3GUTB 2C5DC 1E6OH 2XWJA 3NZHH 1BD2E 4YBQC 1DQJA 4AENA 3LRGA 3I9GH 2P8PB 3GZKA 1JK8A 3SBWC 1T5WA 5DDHB 2FATH 3GSRA 1U8NA 4NNXB 3MLVL 2FX7L 2Z92A 5C6TH 1JF5A 2GIYA 1CK0L 4TUJA 3BUYA 4BSJA 3L3HB 3VFUA 3RVWC 2P47B 5E6YA 2BJMH 4MD5A 1AO7E 5EOQL 2P5WD 1IM9B 4GQPH 3LAFA 5I19H 5EDXA 4ZQKA 3ARRA 4XB7A 3FB8A 3DECA 5EU6B 2X42A 4PJBE 3MXVH 4JGMA 3ULVF 3U36B 4CJ1A 2KBGA 3DVFA 2Y1VA 3D85D 1PG7L 4E41B 5KAQG 1N3NB 1Q38A 1D5ZB 4L4VE 1IZJA 3GMMB 2SEBB 2R0KH 4IM8A 1KULA 3RBGA 1QQDB 4JQIH 1MLBA 5TE7L 4MJ2A 4PJHA 1X44A 1FVCB 2ILLA 3F7RA 3BZ4B 4KH2A 4MX7A 3T1FA 1KUMA 2NY1D 3E3QE 1PVHA 3EOTH 3TT1L 4MXVE 4OSUL 5IVZB 2A74B 3TPUB 3PWVA 1LDPH 3V4VL 5J06A 3C08L 3EFFA 3I6GB 3DUUB 3LEVL 4JGUA 2AV7A 3BP5B 3B5GA 1LGVA 4HH9B 4OBRA 4K3GA 1XIWC 4ZODA 4M7KH 2DWEA 5CJXC 4R3SB 1NUFA 2ICES 3UJJL 2EDEA 1QOKA 4KRLB 1J10A 1KG0B 2GJ6B 3U46B 4JDZB 1FN4A 1NKOA 5I1CL 4NRZA 4RNRA 2MWCA 3V5KB 5I15L 4LSUH 3SDAB 4QXUL 1NBVL 3BYTA 4OD1H 5HI3C 4HBCL 4OCYH 4HIHA 4MNGB 5KSVB 1X5KA 3GM8A 4NFCA 5DJ0A 5DJZA 4Y4KB 3PP3K 2F74B 4QXGL 4G9FD 3VG0L 2C3GA 1XF4A 3KXFA 3NIFE 2B8OT 4I9WD 4MD4B 1BLNA 4W4OA 4LIQL 3WFHB 3MRDA 3WUZA 3MO1B 1OAZL 4WUUB 2VDOL 4YGVA 4UAOB 3QUML 5CP7B 2Y06H 4XMPL 2MTPA 2VABA 1E28B 3EYOA 3MR9B 5ICXB 1JGVL 5E2UL 3KPPA 3O0RH 1Q72L 5D2LE 1BBDL 1RK1B 1MPAH 1DDHA 5HYSG 4WFED 3A0OA 3HZKB 4S1DD 1ZT7A 4CBPA 4Z6AT 3VH8B 5DSCB 5HGDA 1VPOL 5KSAC 3REVA 5INDA 1XGYH 2K7PA 3LRSB 4PJBF 4LCYA 2IQAB 3REWB 3RGVA 3S36X 1ZWIA 5SV4A 3EJYC 1AHWB 4JHZA 1X4YA 4UT7L 5GRZA 2O5YL 3WIFB 3OB0H 3CX5K 3DVNB 1KLFA 1F4HA 1VESA 5JW3H 1L9NA 5L9DL 4L4VD 4HEME 3S37H 5EZJB 1VKXA 4P4KB 4LSDA 2F54B 1OGAB 4M43H 1WITA 5KSAA 2E7LA 4QYOB 1S5IL 5EZLA 4K3JL 2EYRB 5DRNA 1H0DB 5C0CD 4MXVF 5HGHB 5LCVL 2V5MA 3G5YB 3BRGC 1FPTH 3QNXB 2BVQB 4KRMB 3IDGA 4WWKA 3O41A 4YHIA 5IHLB 5DUPL 5HHPA 5E2WH 4LPVA 5FYKL 2H26B 1QFPA 1CFBA 3NCCB 3IF1A 1OSPH 4DKFH 4ELMB 5BV7L 4JZNA 3QI9B 2ESVB 3PNWA 2VZ1A 2OTUA 1UH2A 1PD6A 4LSTL 1CT8B 1FP5A 4GW4B 1DVFB 3GEWB 2DAVA 1U8JB 2AJSH 4YZFE 5E1AB 3GO1L 5D1XD 1YQ2A 3AM8A 2A9NH 1HZHL 2VLMD 5KVGH 4CVXA 4MD0B 2AJXH 2XG4A 3EOAA 3MFFB 4FQ2H 3VG9C 5AYQA 2NNAA 1CD0A 3NIFF 3HE6A 3HS0B 3MGAA 4D9RE 4YHKL 1VFBA 4FABL 4HS6B 3RWFA 4YDIL 2H32H 5A16B 1T89A 3C5ZA 5JLZB 3S35H 3O2DL 4L1HA 4QHKJ 4LPUA 4NJ9L 2Q87A 1P7QD 2JB5L 1IGML 1PKQE 2B1HL 1ACZA 5KTEL 3DVGA 1XGUB 4M02A 3D9AL 4D9QE 2EIZA 3UZEA 15C8H 1XGQB 4QHNA 5D2LF 5HYSA 5I66B 3IETA 4H88L 1PYWB 1OQOA 3QIWC 5IB5A 1MJ8H 1LHZA 2C1PA 1NFKA 2EIBA 3T0DA 3Q3GB 2WANA 1EAPB 5L8JB 1T6WA 3IJSA 4P59H 1NC4B 3QEHA 4NO3A 1K4CB 1ZA3A 3SGDI 4L3ED 3EAKA 4JHWH 2HJFA 2D4DA 4L8SB 4M5ZL 4WU5B 4QXTB 3RUGA 1J7VR 1W8NA 2DM7A 5EPMB 2RBLA 3W0WE 5F1NB 5CLWA 4KTDH 4QHUB 1BOYA 2AI0H 3E6FB 4JFPB 1JWSA 1CFSA 2QHRL 4UTBH 1KACB 3QIWA 4R4FH 5L6YL 3DYOA 1AY1H 4AEIH 3BEWA 1RVFL 4MMXC 4RWHA 4DZ8B 1IGCH 4OCRL 2R0WL 1T7YA 3DSFH 1UXWB 4NM8L 1LD9B 4P3DB 5IESL 3I50L 2WINB 1VA9A 2RJMA 2K1MA 3U6RB 3O9WA 3BP6A 4B7IA 3V5DA 4PJCB 5MHSE 1TNNA 3SO5A 1WZ1H 4JKPL 2C7UB 2YD3A 1UH3A 3TBTA 1JMZA 2ICWJ 3RWCA 3QUZA 2NY3D 1VEOA 4Y8DC 2E5EA 2JCCB 3QDJA 1B6UA 1C5BL 4LEOA 1UYWH 3RWDB 1S9YB 1IAOB 4NQDE 3VWKD 3CNKA 1NH6A 4IS6A 3J7HA 4DGVH 3HNVL 4OQ1A 4BFBD 5KN5A 1BOGB 5E00B 2FECI 1OT2A 3SE9L 5D7SL 3U1SH 1CGVA 4YZFF 4DTGL 4P9HL 2RQ8A 4FFWD 2P43B 3CC5A 3IU4H 1BVZA 4JM2B 3PGFL 5D7KD 3BO8A 1KCLA 2DLTA 4HC1L 1X5AA 4NHUA 3PV6A 1DBAL 2CIIA 2W9EL 3ARED 1I3GL 2VLJA 3U9PH 4XCCH 1RUML 2IH1B 5KG9B 5IHBA 3FT3B 1D5IL 3D1MC 5AZEH 6FABL 3MJGX 4RGMC 2P49B 3BN9D 3ELAT 2WK2A 5D1QD 2R1YA 1UQSA 4OD3H 2ICEB 5GJTH 3HFML 1A1MA 2IANA 4HKXA 4CRPA 2D03L 5HGBB 1URLA 3D39A 1RZKL 3LKPA 3TZVD 4LKXB 2RR3A 1VACB 4G42A 1A6WL 4S0SD 1G7IA 5D5ME 1T20A 2OR9H 4OFYA 3F12A 4UV4L 2XTJE 5I30H 1WZLA 4LCUB 2JJTC 5GGTH 5T1DH 4Z77B 2ITCA 2HVJA 3O3EB 4R7DB 5GSVA 5E8EA 3LSOA 3RX5A 3OQ3B 4MNQA 4G5ZH 2NW2A 4CADB 4D8PB 4X5WA 5FHBL 3BI9X 4QT5A 1DBKL 3C2AH 2GTWB 3W0WD 4JZOB 2ZOKB 1A4KB 2JJUA 1NJ9B 2Y5EA 4LLYB 2VZVA 5GISL 4KVCH 1CTOA 5T3ZH 1YEKH 3D0LA 1V7NH 2K3TA 5TH2B 3OMZA 3KDMB 4Y5XA 2QADB 4WHDA 2FWOA 3V8OA 4U0RC 4CVZA 5BV7B 4OD2B 1VSCA 4F9PA 1B9ZA 1Q9OB 4NKDB 4K8RL 5KS9B 1BZ9B 2OMNA 3S34H 4ZFZB 4H1LA 3QQ4B 1DUYA 4OQTH 1HEZA 2H6PA 5EUKB 1Y0LA 1EEZB 2BFVH 3VFGH 2BSRB 5MHSD 3CDFA 2Z35B 4P23D 4NQXB 2IAMB 3E8UL 4DUVA 4Q9QH 4LLQB 3G6AB 3BH9B 2ITDB 5IW6B 1JPSL 4OLZL 4NQDD 4O00A 4IBLT 2VDML 4WHTB 3BZEA 1YYLH 5IVOA 5DHVH 4ZS7H 2GT9A 3TP4A 3GMLA 1KGCD 1JIBA 3W39B 1YMMB 3GMPB 2XA8L 1QLRA 5DRXA 4IMKA 1JHLH 3B5HA 2UZIL 4BYHA 1PG7W 5HPOA 3WYRA 5DMKA 4KZEL 4JFOB 1BJ1J 1QBMH 3JV6A 4X6DE 4HIIA 5JW5A 4OZFG 3UX9B 3HUJE 1I7TB 3NMEA 4UT9L 5HDQH 3M17A 4Y2DC 5JA8B 1WFOA 3LKQB 3DETD 4XC3L 5GGRA 4RGOH 4OGAC 1F11B 5I9QC 1KPVB 2BOBB 2YPLB 3KYOA 4LOUD 1UM5H 5HGAB 5T5NF 1Z2KA 5F21B 3IDIA 5GIRA 1RV6X 3TLRA 1Y6KR 2QQKL 4XI5C 3MLPA 1AI1H 4MQXC 5JR1L 2VERN 3O45B 1ITCA 5C2UB 4G6JL 1FORL 5D5MF 4NQSA 4YPJA 1BVKB 5DJXB 1FYHB 5JXEA 1YC7A 4EDXB 2EE9A 4JN2B 4NN5C 4X80H 2VISA 1MHHA 2XTJD 2X4OB 4Y2DA 2NY2C 4MDJB 3UTSA 2X1WL 2DKMA 4UILH 1Q1JL 5D7LB 1KEMH 1JP5A 5FECA 4OLWL 3GMQB 2H2SC 3UPCA 4GW1A 1UZ6E 3E0GA 4GRWH 3VFRB 4DAGH 4ZMAT 4ZO8A 1HN1A 1YDPB 3LS4H 3BKYL 4EI6B 2P8MB 4HJ0C 3CK0H 1CVSC 3Q6FB 3ULUE 1OAYH 3LMJH 3OF6D 4NKOB 3QUKA 4NPYB 3KLHC 3NIDE 5C70A 1QSFE 2R39A 5DQDH 1XZ0A 2R2BA 3FHQA 4Z7UA 1T1YB 2FEEI 4UIMA 1A6ZB 3D6GA 4JG0H 4Z95L 2ATPB 4C59B 5DTFB 1BJ8A 2P1YA 4YHPB 3WS3A 1T1ZB 1ZT1B 5DURD 3T0EE 4GW5A 1ERNA 3MRKB 3QEQB 4N0CD 1ZT4B 2BRRH 1HKLH 3MV8B 1JFQL 1CLOH 2DQUL 3BQUC 1KEGL 1ZLWH 2GSGA 2BNUB 4RFEB 5D1ZC 1HCVA 3OR7A 3PQYD 4ZNCD 5FYKD 1A7OL 5JUEL 3NGBB 4Q9RH 4EN3D 5IQ9A 1AR1D 3EO0B 2V2XB 4X7TA 2WUBL 2OL3B 1KPRA 4HWBH 4OI9A 4OZFA 4X6DF 4FQHB 1MCOL 5CD3B 1ONQB 1RIVL 4X98A 3HUJF 3ZKMC 1BQSA 3MV9E 5K93A 1N6VA 5JOFB 2AK1H 2XZQH 3KLAA 2EDHA 3MOAL 3BQUA 4LHUD 5I8KH 4XVSL 1I7ZA 5AZ2L 4GRWF 4DVRH 1HQRB 5TF1H 4EBQH 2GUOB 1JTPA 4QRSB 2PO6D 3MBXL 3EGSB 3LKNA 4TULH 3QDMA 4TQEH 4F57L 3ALPA 2FBJH 1YN7B 1HDMB 5K59E 1BQHG 2GKIA 4XZUB 1MF2H 4C57C 5CBAB 1OTSD 5C0AB 1I9JL 2W0LA 4KK6C 3B4NA 3CIQA 4XP1L 1X9QA 4L4TD 1R3IH 2GY5A 2J5LC 1SYSA 3PG2A 3NFPB 4M7JL 2EYTB 4YUEH 3QCVH 4W81A 2VSDA 3UYRL 2WNGA 5LXGH 1JZ7A 1UZ6F 4P5TC 1YEHL 4W6WB 4XHJD 1EHNA 4F7CB 2HFGL 4MGXA 4HX1B 2XRAL 4GBXB 4X5XA 1SJHB 2VDRH 2E27L 3CFCL 3ULUF 2F8VA 4Q97A 2R23B 2ARJA 1R24B 3TJHC 4WFHE 3NIDF 4O02L 3HAEH 3ULUD 2EXWC 2HTKC 2FSEA 4MWFB 3VCLB 1XF3A 1I9IL 3QFJB 4QF1B 2I9TA 4HJJL 1QSFD 4ZFFA 2CDGB 3DXAE 2R0ZH 1E4XH 3E2HC 1FGVH 2Y25A 4EVNA 4GKSB 2EO9A 5GS0C 3WL9A 3NBNA 3ROLB 2VLRD 5IGXL 3JXAA 3GBLA 3ILQC 3H7BB 5GRWA 3FZUC 2G2RB 2PXYD 4PG9A 1SYVB 1DR9A 3L7EA 1Z6JT 2ZSWB 2RB8A 3LZFH 1M7IA 4N8PA 4WUKH 4X4YB 2VZUA 5MEQA 3PP4H 5L2KD 5DO2D 4APQB 5H35A 2FX8L 1RHHA 2HN7A 2WIIA 2GAZA 1I75A 5T5FH 3MXWH 4URTB 1QFWH 1OM3H 5EFIB 4XP5H 4K23H 1GHFL 5CGYC 3MV9D 2QSCL 5I73B 2A6KA 2KPNA 2NYYC 3L1OL 2KQNA 4FNLH 1EAJA 5SV3A 1VHPA 3H8NA 3VD3A 2AJZB 5C0GA 3DI3B 2DQTL 2EE3A 3QUYA 5EORL 2J6EA 1BQHA 1SY6H 4MDIA 5K59F 3HMXA 1Z9OA 4M7ZB 4MA3B 4X6EA 1OPGL 4IRJC 3F6LA 1G9MH 2DQEL 4ODBD 1NGWA 3V6FB 1U0QA 1A6VL 4UQ3A 3V4UH 2B2XL 1U36A 1J05A 1AGDA 3UJIL 2UWEB 5IT2H 3DMMC 5C0FA 3EYFB 5JO5B 1OF2B 1U8OB 5DZOA 3S5LG 2X44D 4JPVL 1IGTA 4OM0H 1GZQB 4M4RA 3BIKB 2IFGA 3ME0A 3VFMB 3H9YA 3EBAA 1WAAA 3SJVE 1EVTC 4DW2L 2WBJD 3BZFB 4EXKA 3ZYIA 1HQ4B 2C3XA 1J5OH 2D0GA 5IK3A 3U0PA 4BSWA 1KELH 3MYZA 1NFIB 1T66D 4M7LH 3RIFF 3VXMB 1MAML 3JWDC 5F3BA 3U4BL 3BVNA 4WFHD 4LDEB 5IJKC 3LEXA 3AY4C 4U1JA 5T1KA 5GGVL 3CVIL 4D0BB 2QQQA 2BMKA 2QR0A 2X4NA 3DXAD 3CSYB 1L7TL 3IS0X 4LLWB 1B2WL 4GAJL 5CEYA 2CXKA 4KY1L 4WU7A 2PYEE 2ATKA 5FV1L 5D71L 4NHCL 3FO1A 1CFQA 3TBYB 2BOCA 2OYPA 1FFRA 5EOCJ 2WWKT 1F4WH 2FEDD 3NZHL 2YD9A 4KRNA 4GAGH 1HHIA 1EEQA 5HI4C 1D9KA 2FATL 3NZ8A 4GKNB 4LRIC 3S9DB 3GSOA 4YAQB 5DQ9A 3V7AE 3TC9A 5C6TL 4Z7VB 3TIDA 2AERT 4AEHH 1G7PB 1U8HB 1IGJB 5GHWH 2IMMA 5HDOA 4OT1H 4PJEA 4WW2B 3TV3H 5I19L 1A5FH 3O4LE 35C8H 4YFEA 5SWSB 4IOSD 2CIKA 3MXVL 3TN0A 4F15C 1WJ3A 1OAUH 3OKOB 5C09B 5E2JA 4WTZA 4R2GD 5FGRA 4CVWA 4HMDA 2QV2A 4F37F 5IB1A 3HA0A 4J3UA 5IHZB 3ZSTA 2R0KL 4MHHI 4KROB 5C07B 3PWUB 4R4NC 3FQWA 3S5LA 4NBXB 2FGZA 4JQIL 3SCMD 1CF8H 5JW4R 5FK9B 4LVHC 5F89A 3ABZA 5IV2B 4ZNEE 4FZ8H 3L7FA 4BH8B 4QRRB 2BNQE 3MLRH 1TVDA 2XN9E 4RX4A 5AD0A 2A38A 4DEPB 3EOTL 5J11B 2W59A 1F4YH 3RL1A 3SDDD 2V6HA 1LDPL 4Y7MA 3AS1A 5DHYB 2C3VA 3GFUA 4P2RA 2RFXB 5HY9B 5D9SA 2C4FU 3AB0B 4C58B 1ZHNB 3PHQB 1N59A 4ZFGH 3C9NA 4M7KL 3S97C 4QRUA 3TNMA 4WDIB 2JB6A 1JYNA 4P49A 1M6OA 3L3OA 2FGWH 2VLLA 1A7RH 4YK4C 4WV1B 4PB0H 1LP9A 2IG2H 2Y7QB 2VQTA 1CGXA 1HHHA 2HWZH 4NYLB 2WSKA 2BY0A 1WBYA 3DURA 4LSUL 5CHNA 3MJ7B 1EEUA 3ZHDA 4OCYL 1PG7X 5DUBB 1BVLA 4MJIB 4U1SA 4I18C 4Y19E 4LLDA 1IC1A 3ECBB 3GSUB 4Z76B 5D7JD 3ZT7A 4RGNB 2PYED 2IH3B 3VFNB 4JJHA 3HTLX 5FGSA 1B4JH 1CICD 5J13B 3O4OB 4TSBH 3T8XA 2Q3ZA 1MCPH 4WGWB 3VXNA 4JRYA 4QKXB 1M1SA 5FDWB 5ISZD 1P6AB 5IMOB 1DLFH 3RHWK 1X3DA 3GUTA 5BZWA 1DTUA 3O81A 5B3NA 3Q48A 2I07B 1MPAL 2P8PA 1HYSC 3IDMA 4I18A 1D5BB 5DDHA 4U6HA 4NNXA 5LJYH 3DROB 1XGYL 4UNUA 4HLZG 3SKJH 3O4LD 1FZJB 3L3HA 4GXUM 5KOVC 5SWQB 3UTZB 4BK4A 1PGRB 4O58H 2LQRA 4GMTL 5ITFB 1IM9A 1ODAA 4PRHE 3N1QC 2W65A 3VH8G 4G8GE 4ODWB 1TPXC 1IC7L 5EU6A 2Q3AA 5JW3L 1QYGL 2NX5B 4RIRB 1LE9B 3S37L 3G5ZA 3ZDZE 3U36A 3PL6C 2ENSA 5DEGB 1A7QH 4XH2B 4M43L 5J6HA 2E9BA 4E41A 3PWNB 4C83B 1N3NA 1D5ZA 4I3SL 3GMMA 2SEBA 2BNQD 1I85A 5FUCC 5F9WB 1QQDA 1FPTL 2PW2B 1FVCA 2FX9L 1EHAA 5L0QB 3BZ4A 3X13B 5HGGS 1C12B 4OI7A 2WWMD 3SGKA 1UCBH 1OSPL 5IVZA 4DKFL 2A74A 3WXWH 3TPUA 3LD8B 2ZG1A 3I6GA 5CWSB 3JTTB 3VFSA 2V9QA 4Y4HD 3ZTNH 4RZCB 4HH9A 2OM5A 1DBML 2AJSL 4AEFA 1FYTB 2A9NL 4JB9H 4QRPA 2R0LL 1JPGB 3VXRE 4R3SA 4NBYB 5KVGL 4Q2ZB 3KPQB 2AJXL 4FQ2L 4HK3N 1CFVH 1KG0A 2GJ6A 2VLKD 4HFWB 2P8LB 3U46A 3CVHA 4JDZA 2WM0A 1OTTC 3V5KA 3SDAA 5DK0A 2ZG2A 4NFBA 1QLFB 2OI9B 5FXCH 5KANI 5E2TH 1NC2D 4MNGA 5F9OH 3P4OB 5KSVA 5DMJB 4Y4KA 2F74A 3ARDC 4G9FB 1K85A 1X6NA 3Q5YA 2KL6A 5H37H 3EOBB 5FUZH 1MY7A 1GGTA 4R96B 4U33A 4MVBC 4WFGE 3FOLB 4J3SA 2DWDB 3WFHA 15C8L 4MZ3A 4HUNB 1UVQB 3MO1A 4M62H 1BD2B 3MRBB 4S1QH 4WUUA 4MAUH 3X3GH 5CP7A 3UTQB 4AIZA 2RAMA 5HYIA 5A3IC 5ALCH 4P59L 1E28A 3MR9A 5ICXA 3V6ZB 1X5IA 4XNUH 4JHWL 4H26B 4CGTA 4ZDHB 3RY4A 2WLYA 1RK1A 2R29H 1TQCB 3LCYA 3HZKA 3PXHA 2B5IB 3EYUH 4CU6A 1AO7B 3VH8A 5DMIH 4KTDL 3NCJH 3I75A 2A1WH 3MRRB 4X4ZA 2AI0L 3AU1B 4PRHD 5FA3A 3LRSA 5DVMA 1CTNA 5HXMA 3REWA 4G8GD 4PJBB 4OCSH 4R4FL 5FOBB 1AHWA 5D8JL 3ZDZF 3FFDB 3KGRA 1AY1L 1P69B 1KJVB 2K9UA 4AEIL 1DQLH 5HJ3B 2COQA 3WIFA 1Q9KB 1IGCL 3RY6A 4KKLC 3DVNA 4Y4FD 3DSFL 1TNMA 1VFAB 4JLRB 4L4VB 3UPRB 4LPWA 5EZJA 3K81A 4ISVB 3W9EB 2F54A 1OGAA 4JE4B 1PJ9A 1WZ1L 4OUUB 4QYOA 4ESKA 1HHJB 2D0FA 3MLSH 4JREC 5JMRA 3PP3H 1GGBH 2EYRA 1H0DA 4PUBH 1F3JB 4PJ9B 1UYWL 4MA8H 3G5YA 3QNXA 2BVQA 3GMNB 5ANME 4DGVL 4PJ8C 1CVRA 4KK9C 4TTDD 5F97E 2FL5B 1U8LB 2H26A 1EFXB 3PDOB 4WTWA 4KMTH 4ELMA 3G04A 2HT2D 5B3JE 1S7TB 5F7NC 3QI9A 2ESVA 3VXRD 4JPWL 1T83A 1CT8A 3RZCC 3U9PL 4GW4A 1DVFA 4JZJB 5CZKA 3NACH 1U8JA 5E1AA 2EH8H 3QHTC 5CKGA 3O6FB 5TFSH 3QO1B 1YECL 3CAFA 4NCDA 5AZEL 4MD0A 3S6CA 2JJVA 5KSBE 2HFEB 4HQQH 3HS0A 5DA4A 4HS6A 4OD3L 2NXYD 3KJ4C 1ZK9A 5A16A 1U92A 4JFFE 2YA1A 4JDVB 4MAYC 4P2YA 4X7CC 5E4EB 3WNOA 5JLZA 5F1SA 1P7QB 1RZ8A 2DQFB 1KYOK 4YH6A 4HXAH 1MY5A 3B9KD 4NUGH 2OR9L 4WTXA 3RZCA 2IFFH 4N90E 3U0TB 1Q9WA 1XGUA 1MCCA 1RAMA 3QQ3B 4NO0A 4PRIE 5I30L 1EGJH 2L7UA 1IBGH 3RNQB 5T1DL 1XGQA 1GGCH 5I66A 1PYWA 5D2LB 4G5ZL 3ARFB 4X8JA 1F8TH 1EAPA 3MV11 1WT5C 1NC4A 3C2AL 1V8HA 5BW7C 1ZXQA 1K4CA 2E6QA 2N1KA 3ZYJA 4OTXH 5IFAH 2YSSB 5HHVL 3DJ9A 4L8SA 3DO7A 1AXTH 4WU5A 4KVCL 5T3ZL 1YEKL 3VWJB 1V7NL 4M1DL 4OCMC 5EPMA 2BY2A 4U6VH 4V1DE 5F1NA 3O3BB 5BS0A 3KPSE 1A1NB 3OKMB 4OLVH 3E6FA 5IR1B 4XAKE 3GJFK 3O3UN 3GSXB 3S34L 2NY4D 4OQTL 1MCJA 1MQKH 1N0XH 1KLGB 3T77B 4H1LH 4DZ8A 3QNYB 1B0GA 1JYVA 1KT2A 4LPYA 2BFVL 3SGDH 3VFGL 3TO4C 1UXWA 2HTLD 1LD9A 1LO3H 2W92A 4P3DA 3ZO0A 4Y16D 5SWZE 2WINA 5HBBA 4Q9QL 4PJ5D 3TA3D 3U6RA 5GS1C 1S78D 1A3LH 4PJCA 1QBBA 1I1AB 4HG4K 3PJSB 2C7UA 3ZHLA 3WKNA 4NZUH 3C09B 4OV6F 1YYLL 4ZS7L 4DJMA 2JCCA 3GIVB 3ZYOA 3CMGA 1F02I 3MODH 3PDDA 3RWDA 1QRNE 1S9YA 4PLJC 1IAOA 1NMCB 1IT9H 5B3JF 5JPNB 2GJZB 1DN0B 1JHLL 3RWGB 5F9DC 1WFTA 2DYPA 4HS3B 1BOGA 5CFHA 5DD6B 5E00A 4CUCA 1QBML 4RAUB 3TO4A 3D48R 1YUHB 2UZXB 1I1FB 2CPCA 4J23A 1LK2B 4M93C 4OZGE 1JMXA 2FJHB 4JM2A 1X5XA 5I1LB 4OLYH 5KSBF 4RGOL 3K74B 2R56H 4P46D 3AREB 3P3YA 1RK0A 3KPRA 2E7HA 1UM5L 2IH1A 3MV7E 2GHWB 4AG4H 5BXFB 5KG9A 4K3EH 5I18L 4QHMB 5GRYA 4FFZL 3FT3A 5CEZE 4PJGE 5D1QB 3OKYA 3VMPA 4NQCE 1S7SB 4N90D 4X80L 4CU7A 3TZVB 5HGBA 4PRID 3QHZL 2A6IA 5LG1A 5ACLA 4LKXA 1VACA 4UILL 1G6VK 1NEZB 1LO2H 1HH6B 4XAWH 1KEML 5LGKA 5D96C 3VW3H 1BM3H 1FAIH 4HKZA 2D9QB 4R97B 4NBZB 3RNKB 4LCUA 4Z77A 4DAGL 4MJ5B 3O3EA 4R7DA 3RQ3A 1F6LL 4CADA 3BDXA 2GK0B 3T0AA 2MQ3A 3LS4L 4ENEC 5L2JB 1N6QH 3W0WB 4ONOA 4OZ4B 3D2UA 2GTWA 4P3CH 5E6IC 1SVCP 3CK0L 4V1DD 4HD9A 4JZOA 2ZOKA 4YX2H 5IOPB 1OAYL 3LMJL 1NJ9A 3CXHJ 3KPSD 4LLYA 4O9HL 5TH2A 4LU5H 2LFGA 2ERJC 4RBPK 3TBWB 3KDMA 4UINL 4OD2A 4P9MH 4TUKH 1XF1A 1Q9OA 5KS9A 1BZ9A 3CDGB 3DUHA 3QQ4A 2BRRL 3AVEA 4TNWK 1HKLL 2D7TH 1CLOL 5E8OB 5EUKA 4KJYB 4PY7B 4LEXL 1JPST 2BSRA 2Z35A 4NQXA 1S9VA 5DS8B 4Q9RL 3P30H 1RUKH 1OTUC 1XR9B 4LLQA 5F7EH 2ITDA 1RZJC 4NQDB 5IW6A 4QWWC 1QRND 5I74C 5I6XB 2X4PB 4PJ7E 6CGTA 4HWBL 4JY4A 4WHTA 1FJ1B 4OZGF 4OZFH 3W39A 2XZQL 1YMMA 3GMPA 5I8KL 1TETH 1Q0XH 5BJTB 4G8IB 4FP8H 3QWQB 4DVRL 4P2OB 1JYXA 4EBQL 3LV3B 1M7XA 1DQMH 3IJYB 1HOCB 1I7TA 4TULL 1HE7A 3QWOB 2FBJL 4D2NA 4MQXD 4PJGF 3B3IB 1F11A 2ZG3A 2ED7A 1T5XB 3RVUD 1MF2L 1JGDB 2BOBA 2YPLA 5DVKA 4JY5H 1TIUA 5HGAA 5LVEA 4C56A 1T0MA 4KHXH 4LF3B 2CMRH 1R3IL 3HPJB 4NQCD 5C71A 3S4SB 3O45A 4IRSD 1K6QH 4YUEL 3QCVL 5K9QI 5ENWB 1CDBA 1P4IH 1TZGH 1BVKA 3FAXA 5D5MB 5DJXA 5LXGL 2E8ZA 4JN2A 2DIAA 2XTJB 3BPNB 1CBVH 1RI8A 2X4OA 5I1IH 4LBEA 4MDJA 1IAIM 4GO6B 1RURH 5D7LA 1OWWA 1FNSL 3GMQA 3UDWA 5E94B 2VDRL 3TVMD 3VFRA 1MH5B 3BPCA 3FQTB 4LFHG 3KLHD 2YD2A 4OZIE 1D5MB 1YDPA 4IOFC 1IFHH 2A83B 2R0ZL 1K3IA 1E4XL 2P8MA 1IKNA 1FGVL 4PP1C 4WO4D 3OHXB 3Q6FA 1KIQB 1E4WH 3SDCB 3HG1E 2UV3A 1GC1C 4NPYA 2HRPH 1AGCB 1EMTH 4ALAH 5IVNA 4R7NB 3PXJA 1T1YA 1IGFH 3RFZC 5DFVC 3R8QA 2ATPA 2FLBT 5DTFA 5D1ZD 5DURB 3KR3H 4YHPA 3RI5K 1T1ZA 1ZT1A 5GRVK 3LZFL 4XVJH 1HWHB 3MRKA 3PP4L 3QEQA 1MSPA 1MCDA 3K3QA 4KU1A 1ZT4A 5TE4H 3T0XA 3U2SB 4KJPC 3MV8A 1PX4A 3TESA 5MP6H 4PJ7F 2BNUA 4RFEA 1GVIA 5I17A 1G9EA 5T5FL 1MJJB 1JVKA 2NZ9C 3MXWL 1QFWL 2VZOA 4GKOA 4P99A 5GGVY 4XP5L 1WC7B 5GS0H 2X4RB 3HC3H 4K23L 4EDWH 1I3RB 4I8DA 3ARGD 1IQWH 4NQEE 3EO0A 1MIEH 2V2XA 5I8OH 2HH0L 3O8XD 2OL3A 2MCG1 1WWAX 3K80A 4JRXD 4FNLL 4U3HA 4ZO6A 4FQHA 1ZGLP 2EO1A 5CD3A 1FZMA 1ONQA 3HE7D 4X6DB 2PF6A 5FHAH 5JOFA 3HUJB 4QHLB 2EIDA 1SY6L 4LHUB 4X4ME 3G08B 1FC2D 5DC0A 1G9ML 1P53A 2J6EH 1B4RA 1HQRA 3KPOA 3QRFM 3HMXH 1OWRM 4GRWB 3V4UL 2GUOA 3PWJB 4QRSA 3MV01 1D6VH 3BDYH 3EGSA 3QDGD 3MQIA 1YN7A 1HDMA 4LLUB 1RUQH 2Y36H 5CBAA 5FGCE 4P4RB 1XMWA 3CJJA 3ARBC 5C0AA 4BUHA 1UT9A 4OM0L 4UIKH 1R5IB 4ZS6D 1KJ2B 3NFPA 4P5TD 2PTUA 3QIUD 3ZKXC 4LK4A 3RTQB 2EYTA 3QIBD 1BFVH 2VAJA 4ORGB 4XB8A 4MNHB 3KJ6H 1I7UB 4KK5D 4AIXA 1RZ7H 5I71B 3K7UA 2VR5A 2XQBL 1J5OL 1KELL 4N9OB 4PREB 1QVOA 4M7LL 4OZIF 4F7CA 3VGAB 1CU4H 4HX1A 3W11C 4GBXA 3DGCR 4KI1A 1EJOH 1SJHA 3ARBA 3SKMB 1C7SA 1OP5K 3KLSA 3T2QA 1J0JA 4NOFA 2R23A 4YXHH 1R24A 3ILPB 1ZS8B 4OM1H 4OFDA 4XNZB 2H2PD 3VCLA 4MWFA 3QFJA 4QF1A 1QSFB 4LLAA 4YFLF 5CINH 4S1SH 1EFQA 2CDGA 2NY0D 3RWHB 1LEIB 4GKSA 3VD4A 3WSQH 4I0PB 5HVHB 1QFHA 3ALXA 2PXYB 5EO9A 3H7BA 3UEZA 3VJ6B 4P48A 2G2RA 3T0EB 5GRJL 2FIRT 4R8WH 1F4WL 1IL1B 3ZTJH 1SYVA 3BPOB 4GAGL 3E6HB 3FONB 5F7FA 2R2EB 4X4YA 2BNRE 2V5SA 5K9OA 1JGEB 4APQA 5C8JB 1GJIA 1MCIA 4U6YB 4M7ZC 4H8WC 4AEHL 2Q6WB 4MS8D 1ETZA 3QXVA 4X6CE 3QZWB 3RVVD 5GHWL 4OT1L 1CZ8H 3TV3L 1P84J 1A5FL 5EFIA 35C8L 2AQ2A 3CH1B 4XP9H 1P7KA 2KH2B 2Q8AL 3WS6C 2R4SH 1OAUL 4KJWD 3T2NH 1MUJA 2AJZA 1RD6A 3B2VH 1Z0NA 2BCKB 5F7UA 2VKXA 2AEQH 5EBLB 5T1LA 3SO3C 2XG5A 1N5AB 1ORQB 4MA3A 2V17H 5BVPH 1JWMB 3MMEB 3VXUD 1D6EB 1A6PA 3V6FA 1NCCH 1CF8L 5J6GA 5MENE 1FBIH 2R4RH 4G6MH 5BQ7B 5IJVB 2UWEA 4IIQC 4PRPE 2YD5A 4EXPX 3WS6A 2Z4QB 1EEYB 3EYFA 1F4YL 3HR6A 5JO5A 1U8OA 1ITBB 5DQJB 3RWIB 4ZYKB 3DRTB 2XKUA 1GZQA 5EOTB 3NPSB 4WCYH 3BIKA 1NL0H 4YEFA 1MAJA 3WNPA 4ZFGL 3ZDXE 4HZLB 4UUJA 5CKAA 4MB5A 2B4CH 3FQNB 2WBJB 2W0PA 3MCG1 2FGWL 1A7RL 3BZFA 4PB0L 2IG2L 4Q9CA 1HQ4A 3QB7C 5ETUB 4I4WB 1NFIA 1FIEA 2HWZL 1BBJB 3VXMA 1UEMA 4OF0A 4K9EH 3FTGB 4D0BA 3DXAB 4PIRF 4EIGB 4OF3A 3CSYA 1RJLB 5I1GH 1J12A 1CDJA 4Z7WE 1B4JL 4LLWA 4ETYA 5DMYA 4JHAH 4TSBL 5MEPB 1MCPL 3BKMH 5IBUB 3MGOB 4JFDD 4RA3A 4HS8H 5C6WH 2H1PH 1V7MH 1FAKT 3TBYA 2BERA 3EYQC 2ZPKL 4U1NB 1X5YA 2BNRD 4X6CF 3GIZH 3HI1A 3RWEB 3V0VB 3FRUB 2C4XA 5FYJD 5A2LH 4GKNA 4YE4L 4YAQA 3R06A 2JIXB 4Z7VA 4CMHC 3H9SD 4KKAC 4ODUB 4N5UA 4QCIB 1U8HA 1IGJA 4XRCB 3IJHB 4O58L 4EI5D 4S2SB 1ZHBB 4PBWD 3T4AB 4WW2A 1T6VN 4DQOH 4RMTA 4Y8AA 1Q0YL 1LO4H 1Z9LA 2BSTB 5KZCD 4FS0A 2APFA 3RL2B 4DEPC 2X4SB 1FNLA 2PYFB 5KSUB 3OKOA 5C09A 1A7QL 3EO1B 4R2GB 3QUXC 5MEND 1F3RB 1UKQA 1I1CA 5IHZA 1OD9A 3MPCA 5FUCE 1JUFB 5C07A 3PWUA 2YUXA 3SCMB 2HAZA 2DMKA 2HJLB 3T65B 1KXTB 5CIPH 5FK9A 3WEXB 2E8YA 2RIKA 5IV2A 1C08B 1OY3B 1DANU 4P57B 2YD4A 4BH8A 4QRRA 2P24B 4N0UB 2J4WH 4X9GA 3ZKNC 3MRLB 4MJ4A 1ED3B 1P2CB 3ZDXF 1UCBL 2CKBH 4FMFA 3WXWL 4XWOD 5IFJB 2ZUQB 4NN6C 5DHYA 3SJVB 2QQNH 2RFXA 3NAAL 4KXZI 5HY9A 3TH4T 4KTEH 4PBVC 1TDQA 4RGNC 4ZD3H 2B1AH 3LKSB 4WI8A 2Z31D 2D7QA 3PHQA 4PRAB 3MFGB 3L5JA 4JB9L 4OB5H 5D7IE 4J3OC 4JANB 5GGSY 4K7PH 5F3HB 1CFVL 4WV1A 2Y7QA 1J8KA 3GSRB 3S37X 3WXVH 2Z0BA 4LCWE 4Z7WF 1BECA 5HSFA 3MJ7A 3CSPA 5E2TL 5F9OL 3CVHH 3VGDA 5TF0A 3QISA 1PQZB 5DUBA 4U1KA 1H5BB 1SJEB 3ECBA 3GSUA 3LN4A 5FUZL 1G1CA 3IU3B 4ZAKD 2IH3A 3VFNA 1UG9A 3R0MA 1CG9B 4XPGH 4RMWA 3RJDA 1FV1B 4U1HB 3PIQB 4M62L 5DC4B 2JE8A 3CCHA 5J56B 4S1QL 1CE6B 5FDWA 3LKOB 2PETA 5FEBA 3VDBA 1RSFA 3KNBB 4WVRA 5ALCL 5IMOA 2I60H 1CR9H 1K2DB 1WBZB 4HGKC 4XNUL 1U2CA 3WO3B 5IB2B 5F6IC 5KVEH 2JJSA 3QO0B 1JZ5A 4HLZH 2R29L 1P9MA 2I07A 2RHEA 4X7FC 1D5BA 4ODXB 3UTTE 3NCJL 3SE3C 2ADIB 1WCBB 2A1WL 1QA9B 1QFUL 2C1OB 3O4LB 1EO8H 1FZJA 5SWQA 1MCFA 3UTZA 4HHAA 4OCSL 3B83A 3INUL 3LQAL 5ITFA 1DQLL 3S35X 2KQMA 2QL1A 1T2XA 4ODWA 2NY1C 3STLA 5T33L 3W82A 1NDMB 2NX5A 4RIRA 5DJYB 1UCTA 3K4ZA 1LE9A 3QXAB 5DEGA 4XH2A 4DFHA 2XKNB 3FAWA 4C83A 3MLSL 2BNQB 4O4YH 4NRZB 2XN9B 2VOTA 3DSNA 4JQXC 4PUBL 3FN0H 4NN7C 4JN1H 1DFBH 2OBGA 3X13A 1KIRB 1MI5D 1VDGA 1C12A 1XIWB 2ED9A 4ZPVB 5D7IF 5DRWB 4KMTL 3T04D 4BFGA 2VXVH 4ODSH 4YDVB 2VUOA 2LABA 2EE6A 3JTTA 2CGRL 3NIGE 4UNTA 5DD1H 5J89A 1NBQA 1EIBA 3MJ9A 3PGDB 2EH8L 3EYOB 4Y88A 1FYTA 1LK3H 5EIVA 4DKEH 5TFSL 4M8VA 3A67L 4Q2ZA 3KPQA 4JFEE 1MVFA 1L0XA 3ARDD 4HQQL 1G9NH 4HFWA 4Y19B 2P8LA 3TFKD 2OSLB 1ZHLB 1QLFA 1TJGH 3F58H 2FJGB 4S1DC 4G9FA 1ZWIB 4GAYB 3EOBA 2EC9U 4HXAL 1MFNA 2P48B 4NUGL 4R96A 2IFFL 2KZWA 3MRIB 2I25N 1U8QB 1RZGB 3PWPE 2VL5B 3FOLA 2BX5A 3I3DA 3N85H 1IBGL 1GGCL 1NLDH 1UVQA 4YHNB 1BD2A 3MRBA 5E2VH 1FH5H 3UTQA 1GGUA 1RULH 4XPFL 1GXEA 4JJ5B 1MCBA 4QGTA 3L3DA 5IEHB 4FFYH 3K46A 1I9EA 4OTXL 5IFAL 4H26A 4ZDHA 3UXFA 4WY7H 2PR4H 2GY7B 3MBEC 1AO7A 1QSVA 1FL6B 3MJ6A 5FDYA 2DL2A 2X2YA 3MRRA 4PRHB 3AU1A 3MUHL 3NFSH 4RFOH 4LL9A 2F53E 4R26H 4PJBA 5FOBA 3FFDA 1KJVA 1MQKL 4G3YH 2NXZD 3FQRB 3V6OC 4Z7NF 1U8IB 3PNWB 1Q9KA 4H0HB 1PKOA 2MPAH 4JM4H 4RISH 5E70A 1J8HE 3GBMH 4OIAA 4L4VA 1LO3L 1VFAA 3UPRA 1X5FA 2XWTB 4G6FD 3W9EA 2OR7A 4CVUA 1A3LL 1HI6B 1RIHL 1CE1H 1RPQA 4OUUA 1HHJA 4NZUL 5D1XC 2QSTA 3OWEA 2OMBA 5E0QA 1F3JA 3MODL 4U1MB 1IT9L 3GMNA 2PTVA 3N1GC 3NIGF 4HFUH 4Q7DA 2UVEA 3LQZB 3FOMB 1GCFA 3WIIL 1U8LA 1EFXA 2K7QA 3PDOA 5J9PB 2NW3B 3VXRB 4OLYL 1S7TA 25C8H 3VG9B 2OXHA 2R56L 5HHOE 5EUOE 4JPIB 4CDGC 4JZJA 2X6MA 4AG4L 4K3EL 3O6FA 5MI0C 3KXFD 12E8H 4PV8B 3QO1A 4B53A 4KI5E 3ARTA 1KB9K 3MA7B 1YPZE 2HFEA 3LN5A 4K55A 1J88A 4NDMB 2FECL 2NY5H 4KVNH 1K5NB 4JDVA 1YEGH 4Y5YC 2DIBA 3QIWB 5JDJA 1P7QA 3GI9H 3GSQB 5C2BL 2DQFA 4JDTH 1LO2L 1QP1A 2QHLA 1MFDH 2BVPB 4HUUB 1QHOA 2M26A 3HCVB 3U0TA 1WQVT 1BM3L 3VW3L 1FAIL 3QQ3A 2Y6SC 3RNQA 1IARB 5LGHH 5D2LA 3TO2B 4RMSA 5HHMB 1KN4H 3BHBB 1LEGB 2LAGB 1SQ2N 1N6QL 1NEZG 4P3CL 4Y5VB 3TYFB 4YX2L 3RIAF 5ADOH 2YSSA 4G6AD 4XWGH 2R2HB 1DQDH 3U48A 5DT1H 2F53D 2HKFH 4LU5L 4F33A 5DGQA 5I16B 3M45A 3DHJA 3O3BA 4IS6B 4Q0XH 1A47A 4U31A 1A1NA 3OKMA 1S7QB 3VI3E 5KN5B 2NY3C 3BP7B 5IR1A 3C09C 1YQVH 3P4LA 4P9ML 1F97A 4TUKL 5JW4M 3GSXA 4DK3A 5TDOB 3VWKC 1J8HD 2J8UE 2D7TL 1KLGA 5D72H 3BO8B 1DEEA 3VE0B 2OTWB 2N7AA 2NCMA 3QNYA 4NHUB 5JIIA 1RJCA 4TN9A 4Y16B 4FFWC 5ESVB 3WFEH 1JGUH 3P30L 1RUKL 3UBXG 5F7EL 1LMKA 3VFPB 4X9IA 1I1AA 2OJEA 3PJSA 4WENB 5ANMB 3HC4H 5JIHA 4AZ8A 2IQ9H 1SJVA 3GIVA 3W81A 3QYCA 5JPNA 3D39B 1DN0A 3BN9C 3RWGA 3LKPB 1P7HL 4HS3A 1TETL 5TJWK 5EUOF 1Q0XL 2HP4A 4FP8L 3ES6B 2Q20A 2FO4B 1DQML 4RAUA 5HHOD 1YUHA 8CGTA 1I1FA 3P0GB 3HE6D 1IQDB 4P2QE 4HV8A 2FJHA 3Q2CA 3TZVC 4KI5F 5INCB 5I1LA 1YPZF 3K8KA 3RA7H 4XVUD 3C5ZD 2OS7A 3AREA 2NW2B 5KSBB 4KI5D 5F7WC 2APBA 4JY5L 5BXFA 4KHXL 3NCFB 4J4PA 2CMRL 4QHMA 3IXTB 1INQB 3B43A 1SMAA 5JOEA 4JFFB 1D5XB 3V8CA 1MWAB 1K6QL 5D1QA 1U95B 1P4IL 1TENA 1TZGL 3JV4B 3D3VE 3GJFH 4OF5A 1UACH 4QOKE 1PKQA 1S7SA 5CCKH 2DRUA 4PRIB 2EZ0D 3TZVA 5I1IL 5T5NG 5SX4H 4H1LB 1M71B 1NEZA 3S4SG 4BQCA 1RURL 1HH6A 1ZMYA 3GK8H 4GXVL 1A7PH 4PD4K 1UB5B 4GQ9H 3RNKA 3OPZH 2V9RA 4H0IA 1HHGB 1ZSDB 2D4FA 4AIOA 2GK0A 1IFHL 5L2JA 5GS2H 1CQKA 4RCAA 4V1DB 3W0WA 3VI3F 5C0BE 5KBNC 1E4WL 4P23C 5FCSH 4ERSH 4W6YB 4U0RB 3MLWH 3FB7B 2F5BH 1DP0A 2GT9B 4N9GB 2PW1A 2J8UF 3VFTB 2NY6D 1EMTL 4WI4A 4ALAL 1PX3A 2QTEA 1B88A 1KCUH 3EHBD 1IGFL 1BZ7B 3D0VB 3NABH 3O9WD 4X9FA 3TBWA 2Q7YB 3JV6B 3KR3L 5JW5B 4XVJL 2JK5B 4JR9H 3QUZD 5SWZB 3CDGA 2CRMA 5TE4L 1TJHH 3M17B 1A4JB 3QDJD 4HMEA 2F58H 5E8OA 1MVUB 1CLCA 5GGRB 4KJYA 4PY7A 4P23A 4I0CC 3HRPA 4A2LA 5DS8A 1XR9A 5GS0L 3HC3L 4EDWL 4PTUB 1QRNB 3GHEH 1IQWL 4NQDA 1MIEL 4KQ3H 5I8OL 4PGBB 2X4PA 3RVXD 2ZP0T 5ID0B 4LOUC 4OLXH 3CZFB 3QQ9D 2VR4A 1J1XH 5JPMB 3QAZC 1KN2H 1FL3B 3LS5H 2OL3H 3IDYB 1FJ1A 4KRPC 4MMZC 5FHAL 3W5MA 2VLJD 1HHKB 4U1GC 1BGXH 4P2QD 4ZUUB 3VFVA 4DGYH 1GL4B 2J6EL 4G8IA 1TZHA 4P2OA 1K3ZA 5I9QB 3LV3A 3HMXL 5GGTA 5CD5D 1JN6B 1KTDB 2YKLH 3MV7B 3P9WB 3C8KB 1AXSB 3IJYA 1D6VL 3BDYL 4GW1B 3P4MB 2WUCH 1HOCA 2DLHA 4FMKA 3QWOA 5C0DB 3LB6D 4GFTB 5F71A 2L7JA 3B3IA 1AGEB 3LRHA 2OK0H 1RUQL 1T5XA 4PJGB 1JGDA 4BK5A 4TNVK 2W0FB 4LF3A 4NN5B 2D31B 3HPJA 4UIKL 1FZKA 3QUKB 3QPQD 1QSEE 3KHOA 3JTSB 2NY2B 3S4SA 4DN3L 4AJ0A 1HSAB 1F58L 5ENWA 1BFVL 5JHDE 3QP3A 5D5MA 4PGCB 3ROOB 1RZ7L 1HIMH 4G7VH 1CD8A 3GDBA 4I77H 3O6LH 4LSPH 2YZ8A 1CU4L 1KTLB 1EZVY 5B8CC 3OXRB 2Y9RT 4IOFD 5E94A 5F7KC 3OR7B 5F1KC 4YXHL 4F7MB 1MH5A 5C0BD 4N0CC 1CIUA 3FQTA 1YEJH 3MNWB 5F72S 2X89A 1D5MA 5CINL 4S1SL 5IQ9B 3JV5A 2A83A 4OZHE 1BF8A 2YOCA 3OHXA 1KIQA 3WSQL 3SDCA 4OCLC 2FNBA 4XXDB 1K8IA 4EN3C 2VWEC 2W0KA 5GZND 1AGCA 2HT3D 4LPCA 1AR1C 3VXSE 4R8WL 2CH8A 5JDSB 1ZHKB 4R7NA 1A7NH 1WIPA 3F7QA 1I7ZB 1C8PA 5D1ZB 2JJWA 3SGEI 1F6FB 3EUUA 5ITBH 2R2CA 1Y18B 3U2SA 4YDJB 4LLMA 3KG5A 5AWNH 4NC1C 3RRQA 2LU4A 4PJ7B 2VIRA 3U9UB 1CZ8L 2PO6C 1EBPA 1MJJA 1CL7I 2DKUA 2VDPH 5JORB 3RIFK 1WC7A 3ARGB 5E6ZA 2X4RA 4XP9L 4XMKH 1I3RA 1SYSB 1Y6NR 2HLAB 5E95B 4CMMB 1OTSC 3F7VA 2ZNXA 3T2NL 3QZWG 4LDOB 4X6DA 3EFDH 1Q94B 3B2VL 4M48H 3HUJA 4QHLA 2AEQL 4LHUA 5GXBB 2CDEB 1JRHI 2V17L 1UEYA 2HFTA 3KYNB 5BVPL 3TYGH 1OT1A 1NCCL 4H8WH 3PWJA 1WWBX 1G7JB 2VE6B 1JNNH 1FBIL 3EIFA 3JWOH 5JXED 4G6ML 2J5LB 4XHJC 4L5FH 3H3BC 4LLUA 2W60B 1FLTX 3UTSD 3QT2A 5A2KH 4TVPH 4P5TB 4WCYL 1R5IA 1KJ2A 1NL0L 1DL7L 4M7LT 1YA5A 2B4CL 1NCWH 4MNHA 1I7UA 4WW1B 1ZVSB 2XFXA 5F93C 4HDIB 4PREA 2PXYC 2FB4L 4F7TA 3G5XB 3ZL4H 4JFHE 5H35B 1EZVX 4OZIB 4K9EL 3EDDA 4JO1H 4OZHF 3VA2C 2HN7B 1TMCB 2Z8WC 3E2HB 3SKMA 3UAJD 5EN2B 3BJ91 3ILPA 1ZS8A 2GTZB 3HG1B 5DO2C 3X11B 4J8RB 4F37K 1VFMA 4JHAL 1A2YB 1WTLA 1QSFA 3WJLA 2CUHA 3BKML 3H42H 4LGRB 4ZTOH 3P4NB 3A6OA 3RWHA 3HMWH 1A22B 1LEIA 4HS8L 4P9HC 2HMID 2H1PL 1V7ML 4F8TA 2DBJA 5FYLE 4NRXB 1NBZB 4I0PA 1JV5B 1BEYH 2PXYA 4I3RL 3VJ6A 5C0GB 3T0EA 5CZXC 1IL1A 3NPZB 3GIZL 5IBUG 1TITA 3EJZC 4ZXBD 4KWUA 3FONA 3QBTB 1NGYB 3F7PC 4CN4A 2R2EA 1N64H 4HKJB 4U6YA 2Y4SA 4NQEB 4EZMA 2Q6WA 4NNYB 4V2BA 3WFBH 3QZWA 4DUWA 3MRHB 1U8PB 2AJYH 3I6KB 4HPOL 4UBDD 4DQOL 2FRGP 1RZKC 4KV5E 5B22A 3CH1A 1LO4L 3MV9A 4RAHA 5ADPH 3GGWB 4UV7H 2F15A 4IRJB 3FFCE 3BSZH 1IZKA 4L3AA 1DBJH 2X4UB 3OL2A 2BSSB 1GYAA 4XGZB 2PKDA 3UC0H 2BCKA 4O2FB 5EBLA 2E9IA 1N5AA 3DMMB 2CO7B 4PG2A 1OP5H 1PZ5B 3H2WA 1JWMA 3LKRB 3MMEA 1U2HA 2WBJC 3QSKB 5CP3A 1Q9LB 4BZ2H 3C2SA 1T66C 5BQ7A 5IJVA 1WSST 1FHGA 2J4WL 3KHQA 2Z4QA 1EEYA 5IROC 1FQ9C 4X99B 3QG6B 4HUXB 2CKBL 5JMOC 5DQJA 3RWIA 2AABH 4ZYKA 4WU7B 3DRTA 3AS0A 2QQNL 2AJUH 3CMOH 4KTEL 5EOTA 3WN5C 5KW9H 1WFNA 3GSNB 2IJ0C 2B1AL 4ZD3L 5LBSH 2BOCB 1C16B 5F7HA 3N9GH 4HZLA 1KTRL 3K4DA 3FQNA 2WBJA 1GRWA 4K7PL 5BRZE 3QXUA 3CXDH 4JFHD 4GG8B 5F8RC 4LSRH 1MJ7H 3WXVL 2HA1A 5ETUA 4I4WA 1G7LB 1BBJA 3CUPB 2FIKB 2FEDC 5DQ9B 2UUDK 3CVHL 1JTOA 3IFNH 1S7VB 5E7BA 4JKKA 3I02B 3BOVA 3FTGA 3DXAA 2HYMA 5DVLA 4PRBA 4JG1H 1RJLA 4PJEB 3SE4C 3I6LE 1LE5A 1CGUA 4XPGL 3PUCA 1D3CA 5MEPA 1CDCA 3K0WA 1VENA 3WIHA 3MGOA 2P5WE 2CIKB 4PJFE 1BAFH 1XR8B 3K1KC 2I60L 3Q5TA 2YMXH 1PEWA 2EDNA 1GGIH 1KPUB 1YEDB 5KVEL 4KKAD 4QLRA 2HT4D 1IC5H 3FRUA 2BDNH 4X6CB 4LCCC 2GCYB 1TCRB 4KV5F 1HWGB 3L3IB 1TTFA 1BWMA 4LGSB 1S9XB 1EO8L 1WBXB 2JIXA 3L95B 5I1AB 4ODUA 4AEEA 2IWGA 1O7VA 1I3VA 3QUYD 4QCIA 4EI5B 3V7AG 4F15B 4XRCA 2YZ1A 4BJLA 3IJHA 3DVIA 3AAZA 3H6JA 3SCMC 4S2SA