3HR5B

M1prime peptide from ige bound by humanized antibody 47h4 fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGIAWVRQAPGKGLEWVAFISDLAYTIYYADTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDNWDAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab h47H4 light chain
publication title Antibodies specific for a segment of human membrane IgE deplete IgE-producing B cells in humanized mice.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
chains with identical sequence H, I, J
ec nomenclature
pdb deposition date 2009-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr5B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hr5B01
5D7JD 4UQ2B 3NA9L 1HK6A 3NA9H 5BZDB 1I8IB 2OZ4A 3W11C 4M1GL 2X4NB 3CZFA 4APQD 2XZCL 4M1GH 3F5WB 1E4KA 3M45A 5C07B 4UT6L 1RMFL 1B0RA 1OP5H 2XZCH 4UT6H 1VEPA 1JPFB 3K81A 3CH1A 2Z35B 4P4RA 5GJTL 2DWDB 2IPUG 1ZT4B 1A4KB 1LMKA 1KTDA 4F2MB 1KIQB 1SJHB 2E6PA 4NBYB 3QDJD 3ZDYF 2QLVB 1YJDC 2HYMA 3J7HA 3W0WA 5A43C 5IB1B 1I8MB 5IQ9B 5D6DA 2XA3A 4CDGC 3Q6GH 2MJWA 5DURD 1CFQB 1R24A 1TIUA 1KB9J 2GT9B 2PO6B 1K3IA 4RAHA 4YAQB 4NKOA 3WO3B 1MAJA 1U58A 3MPCA 1H8OA 5E4IA 2DMCA 2ZWLT 1WUNT 3FO9B 3MRHB 4QHKI 1CFTA 1T5WB 1EVTC 5IFAL 3IFPA 1FRGH 3FAWA 3P9MB 1J05B 1I7ZA 4JFYA 3KYKH 3C2SA 1F97A 3VI4F 3TP4A 1H3PL 1RVFH 4WWID 1Z0MA 3VWJC 5I75C 1H3PH 4G8GA 3LKOA 4U2ZA 4X5XA 4Y16D 3U0PA 3TBSA 1BF2A 1HIML 3LEYL 1OF2A 1HIMH 2DMKA 3LEYH 1F3JA 2K7QA 4NJAL 4J7RA 4YQXL 2DQGH 5JPMB 1JN6A 4U3XA 1YNKL 4WCYL 4NJAH 4YQXH 1YNKH 1G7HA 4DWHA 1RSFA 5C07E 2Q8BH 4PGDA 1XIWA 2H41A 1M4KA 3EYUH 1JRHH 4I1NB 2ZUSA 2VLMD 3CFEB 1JL8A 4C59B 1FZMA 3HPLB 5CMAA 4XMPL 4I48A 5CJ8A 1P7KB 4XMPH 3NCEB 1UKQA 1XGRB 5JW5B 3LPGA 3TO4C 3DVNA 4WGWB 2VISB 1KN2L 2EDJA 1DQJB 3BE1H 1KN2H 4LVEA 5CAYB 4ORGB 4OCMC 2VABA 4KVNL 4KVNH 3VDBA 4JPWL 2R1YB 3UTOA 2ATPA 2Y23A 4P9HC 4JPWH 3LQAL 3C87A 5IOPA 1WIPA 5H2BB 3Q0HA 5F3BA 1S5HA 1HOCA 3QA3A 5CCKH 4YIQA 3ULUL 4XWGH 5EOCJ 1WICA 3ULSB 1Q1JL 1ZLWK 1OW0C 1G7QA 3ME0A 1PYWA 1NC4A 4ELMA 1UWGH 2G5BB 5AZEL 2ZPKL 5I75B 5AZEH 4PJBB 4QRPA 1JE6A 3RVVD 4NHUB 1OAXL 3HR5A 2QR0B 3QFDA 4MS8D 1YEKL 2P5WA 3LQZB 1W72B 4Z7WB 4BH7A 1CR9L 1V7ML 2FJFA 1IGML 5FB8B 4H0HB 3B2UD 3QH3A 5T5NF 1IJ9A 1V7MH 5MENA 1IGMH 1U8KA 3FZUC 1SVCP 3OL2A 4HDIB 3GHEL 5CEYA 4DK6A 1I3GL 3IJYA 5MP6H 3U9PL 1FNEA 3I2CH 3U9PH 3QIBA 4XBEH 1P4LA 3KS0H 4U1MB 1QRNA 4Y0GA 4LGRB 4N68A 5IB4A 2YC1A 2A0LC 3QUZD 3TO4B 3QUYC 3L3OB 4X6DB 4Q6YA 2HT2C 4EI5D 5LCVL 3G04A 2NW3B 4JM2C 3TF7C 2C4FT 4U1JA 3K46A 4GO6B 2EEAA 4XBPA 4J2XA 3N1PC 2DI7A 1U8OB 3BDYL 3HB3D 3BIAX 3ZKXC 5BVPL 1KPVA 4I4WB 1YC8A 5BVPH 4EUPA 1OGAB 1WCBA 4OIIL 5LGHH 1X6LA 3F8UB 4KK5D 2OJZH 1CU4L 1G7LA 4LSRL 1CU4H 3DIFA 4LSRH 1ZLVH 2V2WA 4JO1L 1FJ1B 5EU7C 1FQ9C 2IWGA 3KYMB 4X80L 1Q94A 2QQQA 3G9VA 4U7SA 2ERJC 5BV7L 4Z7WE 5EO9B 4NHCH 5BV7H 3IFLL 3T4AA 1CLZH 2J88H 4JDZB 3IFLH 4M8QA 3EYFA 4Y2DD 2FLBT 4WIQA 4L3CB 4ALAL 3OKKB 4ALAH 1JMZA 2I60L 4G9FD 1P9MC 1FE8L 4XPFL 4DKAA 3U1SH 2I60H 4FABH 1FE8H 2Y36L 3KPLA 4XCEA 2JE8A 4OAWA 1I1YB 1J7VR 2Y36H 1XGYH 2E9JA 4HIIA 4X6DE 5L2KA 2EO9A 1X5FA 1FBIL 4OLUH 1KC5L 2YWYA 3ZMRA 1KC5H 4GXUM 1T89C 4JM2B 5K93A 4BZYA 1UZ8A 3B9EA 4IMLB 2DQUL 3OXRB 4HS3A 3SEPA 3L5HA 2DQUH 3MYZA 1DLHA 4D9QD 3VFSA 4PRPE 1ZANL 2CK2A 1JWUA 5CP7A 3ZKXB 2OCFD 1OGAE 1ZANH 5I1KL 2YWZA 3C5JB 5CSZA 3R06A 1DLFH 4U1SB 3UDWA 3O6LH 4OJFH 1HSBB 3MJ7A 3U0TA 5KJRH 2R15A 4DOHB 3OG6B 3CSYA 4K9EC 3T4YA 1F4AA 3TT1H 1PSKH 3HE6D 3TN0D 5EU6D 5GXBB 3QP3A 4YGVB 2CRZA 3WDJA 3QXVA 4TPRL 5JLZB 4H20H 2NLJB 4Y5VC 2ZZUT 4TPRH 1FO0B 1MCJA 2UYLB 4HW6A 3QEUB 2VWEE 1R3JA 2ERJB 4LHUA 5CBAB 3VXQA 1EXUB 2F8XC 1D6VL 3QUKB 4WHYH 1II4E 5F9JA 3EO0A 1KXTB 3RGVA 2GSIB 4Y89A 4HUUA 4GLRH 4OZFB 4PLKC 3MUGA 5KTEH 1D9KC 3DO7B 4PTUB 5FYJD 3R0MA 3SE4C 3TBTB 4H88L 4NN5C 3VFUA 3E1F1 4O5LH 3UO1H 1M7IA 3MRGB 2NY1B 3EDDA 4DVBA 4Z7WF 4BK5A 2GTZB 1FG2A 1CK0H 2GUOB 3AGVA 1T2JA 1YC7A 3AAZB 2YSSB 3QIUC 5T1LB 3UC0H 3MX0A 3W5NA 4HX1A 3QDGE 4X6FA 1JYNA 1TJIL 3BD3A 1VDGA 2AKRB 1TJIH 1BOYA 1JHKH 4KRMB 1HHHA 3G5VB 5EZLA 3VRJA 4ZFOA 4ZFFB 4H26A 1CG9A 5KANG 4X6DF 5I66A 4RGNC 1RUPL 3D3VB 3I3BA 4DOHE 3A6CH 1RIVL 3V4VH 3EOBA 1RIVH 5J1AA 3K2MC 2H9GB 5EU7E 5LQBH 1MLBB 4LIQE 1AR2A 2UWEB 2CIKA 3OKMB 3PWNB 4YBQD 3WLBB 4KVCL 5DFTA 5F89A 4MCYA 5KSBA 1DSFL 1KJMB 1LE5B 3FQNB 3ALPA 1IAII 5H37G 4A6YB 4NNYB 5IHLB 1J1OH 2CGRL 4WFHE 3IDMA 3MO1B 4MQSB 2XN9D 2CGRH 3WNPA 4U1HA 3DHMA 5I8KL 1IKFL 2IMNA 2L7UA 5I8KH 3MV01 2NY4B 3HRPA 1QQDB 1E4WH 1D9KB 3RWEB 4ZUSB 3U9UA 5IQ7H 2A38A 4BH8A 3OR6A 5I8EB 3HI1A 4RMQA 1C7SA 3IAQA 3MCKA 4HLZH 4ZOEA 4DCQA 1JVKA 1KEGH 1G7JB 2G9HB 1HH9B 1AO7A 5DJZA 3WHE1 32C2A 3SE3C 4AJ0A 2DIAA 4X5WB 4K3JL 5IT2L 4MDJA 1MJ8L 3RTQA 5IT2H 1MJ8H 1EX0A 1A9BB 3GDBA 4MNHA 2X4RA 5E99L 1S9VB 3GSWB 2ITDA 3BUTA 1RZKC 3VCLA 5CIPB 4F8QA 4XP4H 5D1XD 3UTTB 5IR1A 3GJFB 4TTDC 2ZJSL 4UUJA 2PYEB 3V95A 2UVFA 4S0TD 1WWCA 2B4CL 2ZJSH 1WBXA 1G0YR 2B4CH 3HMXA 4P5TC 1NSNH 4JM2F 5MEQA 1W8NA 5C0FA 5JHLH 1OT2A 3FN0L 3FB5B 1K8DA 2UWEE 2NPLX 3DSNA 2J1KA 5TQ0L 1K4CB 3FN0H 1BHGA 1T0MB 2EXWD 3RBSA 4Z5RA 4GRMA 4GRLD 3MRLA 1MRDL 1G7MA 3CPLA 3TZVC 2BXZA 1UVQB 1IGJA 3QG7H 2X1WL 4GKZA 3LRGA 3ZL4L 3T8XA 1XGQB 3ZL4H 5L2JA 1NUDA 2BVQA 4ODWA 3TVMC 5F71A 3BQUC 3VRIA 2GJZB 4X4MA 1Z9LA 3MCLL 2IBZX 1HHGB 2Q6WB 3X13B 1DR9A 4JZOB 1F13A 3C08H 3I50H 3HZYA 5GS1A 5I0ZA 5ECJE 3QBTB 1UG9A 4PTTB 4KMTL 4KMTH 3SKMB 2C7UB 5L9DH 3GMMB 1XCTB 5FYLH 4L8SC 1PKOA 5C9JB 4HKJA 5T3ZH 5HHOE 1QSVA 3IETA 4LOUC 4X99B 1CVRA 5TDOA 3VFPB 1IAOA 5SV4A 2ADGB 1KOAA 1FL3A 1R5VB 2PYEE 2YK1H 4HKXB 1S7VB 3ARGA 4GJTB 1YDPB 4EQ3A 4XH2A 4J8RB 4P5TB 2J6EL 3KXFD 2X7LB 2CJUL 3CLEH 1D5IL 3VFWB 3P40A 2MHAB 3RIAK 2B39A 1AR1C 1MI5B 4P2QD 2R0WL 3KPOA 2R0WH 3BZ4B 2ZOKB 2B0SL 3TZVB 2AJVH 4Q9QL 2B0SH 3SGKA 4Q9QH 4FQ1L 3BFOA 4KGLA 4JQIH 3G5YA 2UWEF 4FQ1H 3VGHA 2CK0L 4F7MB 2CK0H 2LE9A 1KB5B 3RDTB 2B1AL 5DRWB 3RWHA 5FV1L 2DBLL 2B1AH 4RMWA 3ZTJH 3FQUB 5ADPL 2HT3D 4X7SH 1ORQA 4XNXL 5D2LA 5ADPH 4KI5E 3GI9H 4RISH 3B6SA 4XNXH 4TNVF 5CJXA 3ET9F 1MCWM 4MA3B 3U36B 4NO0B 3KYAA 3MCG1 3MTRA 3B9DA 3L7EB 4TN9A 4L8SB 1C5CL 3U46A 1IM9B 1ES0B 3MMEA 1C5CH 3DTXB 5JW4R 3V8CA 2DQEL 1MHEA 5CSGA 4XCCH 1JPST 1HNFA 3P0GB 1HCVA 4OM1L 1TMCB 2CO7B 4MNQD 1C5DA 3P73B 2UV3A 1OSZA 5HYSA 3TBYA 3BP6B 1DN0A 2W0FA 5F9AC 3IXTB 3L1OH 3ARDD 4NQDA 5GZNC 5IMLB 5E9DD 4XNQB 3DETC 3ZTNH 3MXVL 4LRIC 2FEEL 5D7LB 1DBBH 3MXVH 3OTTA 2V7HA 2X4SB 3WS6C 3QXTA 1QR1B 3KPQB 2AEIT 4OLVH 5T3XD 2YEZB 1FLRH 2HFFA 1JWMB 3F12B 1QSFA 4KDTA 1ZLWH 1ADQL 3X11A 3KYOA 3TBVA 1WZ1H 5HGHB 1RK1B 1ADQH 2ZUUA 3JV5A 5D5MA 2OTWB 1TTFA 4FTVA 4IRJD 2DTSA 5FKAB 5H94B 3FB6B 2PNDA 3OPZL 4MAUL 5TQ2L 4O2EB 3KLSA 3OPZH 4MAUH 5TQ2H 1W72L 1KIUA 4DKDC 1S3KL 3DMMD 4P59L 2I5YL 4MX7B 4WI8A 4FMKA 1BJ8A 3VXSA 4P59H 3OGCB 4Y4FD 5C0CB 3IKKA 1RZJL 4CVXB 2EC9T 2ZCKL 1RZJH 5HGDB 2EDDA 4Q9RL 1HNGA 4Q9RH 3T77A 3VXUD 4KI5F 4NKIL 2YUWA 3B5GA 4PJCA 1J8HA 4NKIH 3BKJL 3U4EB 1TFHA 2VDLL 3BKJH 3HS0B 3GSOA 4TNWK 3JTTB 2HKFL 3PHOA 3QG6B 2VDLH 4HKBB 1FFQA 4I8DA 1CTNA 2HKFH 3EFDL 3WKNA 3QULA 5GQBA 2VZUA 3EFDH 3LN5A 5FYKU 4U6YA 1NCAL 3N9GH 1Q9OB 3OKEA 5DJAB 5HHVL 1TVBB 5D7LE 3V5HA 4P9HL 5HHVH 1EEZB 3O2VL 3L9RA 12E8L 2H3NB 3O2VH 4IMKC 3VWKD 1YEEL 5GGRB 3T0BA 5I1AB 1G1YA 1YEEH 1WF5A 2F53B 4HC1L 1WBYB 5C0AD 2ED8A 3BT2L 2ID5A 3T0EE 1DQML 3VXPA 3BT2H 4JHZA 4Z0XA 1DQMH 1A4JB 5C08B 3WFDL 4N5ED 1P2CA 1XGUB 3GMLA 3X3GL 2XPGA 3WFDH 2DQHL 2YN5A 1RUAL 7FABL 5IMOB 2A6JB 1RUAH 3BXNA 2ICCA 7FABH 1CD1B 4I2XB 2LTQC 4JFZL 4FZ8L 1JGUL 3KHQA 4JFZH 4FZ8H 4HZLB 2Y5TB 3IB4A 2PXYA 1JPSL 3D39D 5JORB 2YBRA 2H26B 43CAB 4HPOL 4WHTB 4CMHC 5CBEA 4YPGB 4HPOH 4LCWD 3O8XA 3BWAA 5F3HA 1I1AA 3ZSTA 4HWNA 4D9LH 1U3HD 5HDLA 2NX5A 2RFXB 4R6UA 5C0JA 1BF8A 3MLVL 1N5AA 3MLVH 4IS6B 4CDHA 5B38A 2D0FA 2IADA 3ARYA 1KN4H 1UCBL 3MNWB 4Y16C 1B4JL 1QA9B 4DN4H 4GRWE 1UCBH 1GL4B 2IPUK 3FT2A 4UOW0 1B4JH 2GK0B 1JGLL 2DLHA 4ZO6A 3TFKD 1JGLH 3KPMB 3T0WA 3LZFH 3U7YH 5CEZL 4W70A 5BMFL 5CEZH 4RDQG 5IG7A 3P4MB 2N56A 4XGZA 3S36H 3TA3D 1EBPA 2F53E 4HG4J 1FC1A 1LP9B 1BLNA 2CO6B 3KR3L 3MRIB 1F00I 1S8DB 3KR3H 4KMLB 3M1BB 1A7RL 5C08E 4E5XB 3O4LA 1A7RH 1VFUA 5F1OB 1JHTB 2ZG1A 4HK0B 1H15B 1BBJB 4L4VB 1MIMH 2X42A 5DT1L 4J3OC 3MA7A 1OT1A 4I2XE 5DT1H 4K3DL 2OSLB 5IMMA 1BM3H 5IVXB 4K3DH 5FUCC 1L6XA 2LTQB 3LHPL 1EHLH 4AM0A 1P7QA 3LHPH 5F7MC 3MQIA 3LCYA 4B7IA 4M7KL 2WZPD 4J3UA 4ODUA 5MI0C 4N1HB 1XH3A 4CMHB 4PRHD 4MSWA 1F02I 2FBOJ 2VO5A 2OS7A 5CWSA 3TIDA 3OKLA 4PJGA 2E3VA 4G80A 5DS8B 1UT9A 5JW4M 5IV2B 4JHWH 3NCMA 4LCYA 4HIEA 5C6WH 4Y16B 4Q0XL 1DQQB 5E4EB 2F19L 4Q0XH 3HLAA 4N0FA 2FBJL 1VKXB 4MS8C 3PJSA 2H1PL 4KTDH 4ZUUA 5BRZD 2R0LH 1H3UA 2BVPB 4G9DB 3W39B 4RMUA 1ZHBA 3MFFA 3B2UC 1CT8B 1HWGB 5IFHH 4HH9A 4X8JA 2AK4A 2Q7YA 4GRWF 4ODTL 3GSXB 4ODTH 3HUJF 1T22B 4YDVB 4F7PA 1QKZL 3RY6A 4R26H 4K9EL 5FO8A 1QKZH 1MOEA 3ROOA 2QJDA 4X4XA 1SHMA 4L4VE 1UACL 3B9KA 3KLHD 4ZPTA 3QUZC 4JZNB 1S7RB 3LY6A 4K94L 3RWDA 2CLRB 4ELKA 4K94H 3CX5K 4MLSA 5EN2A 4EI5C 4A6YL 2KL6A 2UZIL 4MGXA 5FYKD 1BOGA 2UZIH 4XX1G 1WJ3A 2VITB 1PVHA 5MI0B 4K55A 3HB3C 3RL1B 3HC0A 3W0WD 2A73B 3BD5A 3PL6A 3F6IA 4KK5C 4WY7L 4X6BA 3GFUA 5C0EA 3R4DA 4BFBD 4BKLA 3MA9L 3PWLB 3MBXL 5TE6H 3MRKA 2F54B 3MBXH 1OAZL 2W60A 4XCYB 1JRHI 5B4MD 1OAZH 2BDNL 1S5IL 1EEQA 1T83C 2C3VB 2W65B 1HI6B 3MOQA 1E4XL 1S5IH 1QR4A 2R1XB 4M7ZC 1JNJA 4U4BA 2CDFA 4MNGB 1UXSB 1A5FL 2VLME 3VG0L 2FGWL 3C6SA 1A5FH 2DMBA 4Y2DC 2FGWH 1YY8A 3Q5TA 3C6LA 4IRZL 3BKCL 4J4PA 1T7ZA 5CLTA 4IRZH 4HWUA 4OCSH 4DZBA 2AJ3A 2R1WB 5F9DC 5KVGH 3IDIA 1F8TH 5IWLC 1X5HA 1IBGL 4YHKH 3QUZB 4GW4B 1IBGH 4F33A 3UTZA 4UTBL 1XIWD 1KTRL 1K5NB 3RUGB 4UTBH 5FUCE 3V0AC 3AM8C 4V1DA 5ICYB 1T3FB 4HCRH 4RZCA 3FL7A 4R7NB 2CKBB 5SWZA 4XNYL 4JZJB 1BD2E 4EZMA 3OKNA 2Q8AL 1ZHLA 2Q8AH 1AJ7L 4WTZG 3I6KB 5GGQH 5DYOA 2EDOA 4JFDA 1INQB 5TE4H 6FABH 1AJ7H 4PV9A 4HXAL 1FZOA 3UPRB 3HE6C 3TN0C 3RWIB 3MRJA 2OM5A 5I15L 2F54E 3CLFL 1U8NA 1FL6B 1EO5A 5DD0L 3CLFH 4GKSA 2AW2A 5DHVB 5DRNB 5F88A 5T1MB 1A9EB 4MA7L 2VXSL 2AJZA 2BNRE 4MA7H 4MNGE 2VXSH 3C2AL 1M7DA 4M7ZB 4WNQA 5DK0B 5MEPA 1U8QA 4L3EB 2NTFB 5F6IC 4NNXB 4RFEB 4DAGH 1RZKL 4GXUN 4KHTH 4PG2C 1V8HA 4FN0A 1NC4D 4Y2DB 1HEZA 2YUZA 1MAMH 5ERWB 2PCPB 4QRPD 4PJHA 2EDXA 3O3EB 1NBVL 2BK8A 1U8PB 3LH2H 4G9FB 1LD9B 1NBVH 3OQ3B 5I19H 3WL9A 1MCLA 3OX8B 4JGUA 1IGFL 3RUGE 5I1CH 5D72L 1IGFH 4OZIB 5D72H 3NZHL 2I9TA 4ODSL 4W4OA 5MEND 1T20B 4ODSH 4O51B 2FRGP 1HH6A 4P46A 5IESH 4ZDHA 3QIBD 3ARBA 3SDXB 1DQDL 3T2NH 1BMGA 4OKVB 4MHHI 1QRND 1DQDH 1EK3A 3DYMA 3P9WB 4OZ4A 1K8IB 5GSVA 1KB5L 4LU5L 1IEBB 1BJ1H 1S7TA 2WBWB 4JJ5A 4LU5H 1X4XA 1CI5A 5KSVA 1EZVX 1VENA 3GIVA 3PWVB 5EIQA 5HPMB 4U1IA 3HE6B 3TN0B 5EU6B 5I1HL 3KPSE 4YBQC 4NSKB 4UMGA 4JPIB 1FAIL 5I1HH 2FEDD 4R7DA 3WFHB 1FAIH 2JJSC 4U05A 4NKDB 3MODL 4I9WE 4YR6B 1NAML 4LDLB 5C6TL 5IBUG 4XPHL 5DD6A 1LEKA 1NAMH 3WUWG 4JAMB 1CQYA 4L3EE 4XPHH 5DJXA 5E7BA 2PYFA 4C83B 5F6IB 3VA2C 2DQTL 2OP4H 4X5LA 2YKLL 2P7TA 4WWKA 3UYRL 2YKLH 2D9CA 5ITBL 1NCBL 3BP4A 3UYRH 1S9YB 4G9FE 4F58L 5ITBH 5CHNA 5JZ7D 3RVWD 4DUWA 2VZTA 5HDBE 3RU8L 1IFHL 3LV3B 4EUPG 3RNQB 5HYJB 3QHZL 3RU8H 1IFHH 5ICZB 4X83A 2V7NA 4Y4KA 4MD5B 3BISA 3V4UH 1IRAY 4OZIE 4FXKB 2NW2B 5C0ND 4TVPD 3BGMB 1CGVA 3GBNH 3CDFA 5JR1H 4LCUB 3SDXE 1YEIH 4PLNC 4WUUA 3WE6A 3BH9B 4ONHB 4HBCL 4HKZB 4S1SL 5IJKC 1X7QA 5FA3A 1CXHA 5D1XC 3RUGF 5IIEB 2A6IB 5DRZA 4PV8A 5L2KD 1OLZA 1U91B 4L9LC 5D7SL 5EU6E 3P77B 1ZKAA 1CFVL 1S7SA 3V7AE 5D7SH 3GSVA 1AH1A 3VGEA 1CFVH 2EXWC 4LP5A 1NJ9A 3C8KA 3FO1B 4YNYB 3LRSB 3RX7A 3RWJA 4HD9A 1YZZA 4RQQB 3ZKND 4GLRI 1O5DT 2HN7B 3SDDA 3BGAA 1L0XA 2NY6D 2XN9B 4CW1B 5DFWH 3SKUD 4B7LA 5DTFA 2QQLL 4MJIA 4PYGA 5FYJE 4HV8A 3NAAL 4WI3A 4M6ML 3BX7C 4KQ4H 4M6MH 5HYJE 5FXCH 4UI2A 3M8OL 1JMXA 2QSQA 1HSAA 4LLQB 5SX4H 3OHXB 1WEJL 3RGVD 4RRPG 3BJLA 4UAOC 1ZA6B 1MUJB 1MFBL 1JNHB 4QRRE 4HT1L 3ULVH 3S7GA 4HT1H 2OTPA 5F72S 1A6AA 3S96A 4Z18A 2VDML 1UXWB 1ZEAL 1OQXA 1UEYA 2N7BA 1HYRC 2VDMH 3T08A 3ROLA 1ZEAH 5D1XB 3LVEA 4OZIF 1XF3B 1SYSA 1GC1C 3UTPD 3HE7A 1KCSL 4UV4L 1TXKA 4HLJA 1KCSH 4UV4H 3RL2B 5KW9L 4L9LB 3AFLA 3UPAA 4BFIA 5K9KB 2EEBA 1BIIB 1H3TA 2GTWB 1PGRB 3MSPA 4TVSa 1XF4B 5ETUB 4BZ1H 2IANA 2MFNA 2JJWA 1BWWA 5I73C 2J2ZA 3KG5A 2XN9E 4WO4A 4TSCL 4IHOB 4PGEB 2W0PA 4PJ8B 1W8OA 5CJQH 5C09B 4KTEL 5JW3L 1ROWA 4CADA 2HWZL 1HCFX 5JA8B 2BSSB 3EZ8A 4HFWB 4KTEH 1MQ8A 5ANMB 3EO9L 5JW3H 2HWZH 4OGAD 1PKQB 1FIGL 2Z91B 3EO9H 5FA4B 3LEXA 2ADJA 1ZSDA 2RQ8A 4G5ZH 1FIGH 4LLVB 4XZUB 2HT3C 3BH8B 3NIGE 1GJIA 4E42A 1X4YA 2EIZB 1ADQA 1BAFL 3TNNA 1VSCA 3VD7A 1BAFH 4KK8D 2HJLB 2YD5A 3C8DA 1LO3L 3LQMA 2EYRB 2OI9C 1VEMA 1F42A 4UAOB 5IJVA 5MERB 4NZUH 4PGZA 2VC2H 4ZOBA 4CVZB 3TNMA 4I5BA 5TF0A 2EDKA 3EYOA 1WTLA 4YHNA 4ZTPH 2DWEA 1AGFA 4AY0A 3S5LB 2FL5A 4HS8L 3EYVA 4HS8H 3LDBC 1AO7D 3LN9A 3ARDC 4JKWA 4X7TA 1IKNC 4KKBD 3KXFB 1F58L 4NKMA 3RTQD 3DYOA 5I16B 4C56D 2FJHB 1EH9A 1D5MB 3MRMA 1D5ZB 1MWAB 5DI8B 3SQOL 5I73B 2XACC 2ICWB 5DJDA 3T65B 4PJFB 3SQOH 1CE1H 3FCTA 5GRVK 1LO2L 3LIZH 4Z7VA 4OFYA 5C09E 1LO2H 2R29L 4P0DA 4U1NB 5ANME 4NT6B 1U8JB 2R29H 2BFVH 4FQLH 1PKQE 4EN3A 1RUMH 2VQ1A 2DQIL 1G9MC 1EIBA 4IRJC 4JR9H 2DQIH 2DJUA 4QRTB 3R8BB 4Z6AT 4KZDL 4X7DC 2Y1VA 3DMMC 4QYOA 5EBWA 2Q86B 4KZDH 2IH3A 5J06A 1QFUH 3U30C 4Y4FC 2VL5B 4H25A 2BY0A 4JFEE 3WSQL 2XZZA 2OI9B 5F1NA 4Y5XB 3WSQH 1WISA 3L5WA 3MGOB 3L3DB 3NIGF 1JV5A 4ETYA 1AGEA 2XWBA 4MNQB 4MDIA 4UILL 5BW7C 2WWMD 3K2UL 5C0GA 4AH2B 4UILH 3A67L 1DVFA 3LDBB 1KPUB 3K2UH 2Z93A 2LU3A 5GGSB 3B5TA 2V17L 3ARDB 2JJTA 1N8ZA 2P8MB 5E9DB 3QZWB 3QO1B 5GSRA 5J6HB 2YPLB 3P30H 5TJWK 4ZNEA 4AEEA 4U6HA 3VWKC 1MELA 4ONOA 1W0VA 1MVFA 1TCRB 5IHZA 2BMKB 1XF5A 4R2GD 2AJYH 5KS9B 1WWBX 1NBQA 3ARGD 5C8JA 3ILPA 2E7LC 3PV7A 3MJ9A 1QBLL 4N5EC 3D5OF 1J1XL 2BCKA 4QOKA 1NC2A 5IBTH 3V2AR 1J1XH 2WBJB 3VFNB 1L7IH 2ITCB 3UZQA 1EUUA 4IRJB 2FLRT 1T0NB 3PDOB 3IT8D 1P5UA 3HA0A 4Y19B 1TQBC 4P48A 1KTKE 4JG0L 3F7YB 5AAWA 1DL7H 1A22B 3DMMB 1XZ0B 5KSAA 2E7CA 4Y4FB 3CFKB 5D2NE 5L7XL 4WU7B 2EH7H 4R4BB 5DWUL 1U3HC 3RVUD 1GRWA 2HT4D 4JKPL 5ID1B 4JKPH 4Z7QE 4MJ4A 1RZIA 3VXUB 1U3JA 4F15B 1GXEA 1UKSA 1F4XH 3PV6B 4MNQE 1CDGA 1OB1B 1BVZA 4ZPVA 4CRPA 1JF5A 4U6VL 2L0DA 3MRCB 2X9WA 1TENA 1EFXA 5KZCB 4U6VH 4ZFZB 1ZVHA 3TFKC 2COQA 1P9MA 5E9DE 1XGPA 3TJHC 2FEEI 5D93C 1TZIB 5A3ID 5DUBA 2VR9A 3MXWL 2YPLE 4AEIL 1G9NC 3MXWH 5E2JA 2CR6A 4NQCB 4RMSA 2AEWA 5FDYA 2G5RA 1CYGA 2NY7L 1AD0A 3VFVB 1NCWL 2NY7H 1K4DA 2A83A 1NCWH 4JN2A 1GGUA 2FH8A 3RY4A 2WLZA 1AFVL 5GISH 4NQDD 2AXJA 3O3UN 3FHQA 1AFVH 1R3KA 3FO2B 5CILL 1OAQL 3IFOA 3G6DH 4YHPA 1BVLB 3OZ9H 3V6OA 4Y19E 1I7UA 1FVCA 2WANA 3CCHB 5HYSG 2MKLC 4IRSC 2D7TL 2MQCA 5CD3A 4QHUA 4U7MA 3ARQA 4JREC 2D7TH 3D39B 3PNWA 4H8WC 1MQKL 3FQRB 3SQBA 4Y5VA 3RWCB 5ID0A 4M6OL 3BIKA 1QSFD 3FQXB 4MJ2A 4PS4H 4M6OH 4I18C 1IT9H 3T3PE 4FTVD 3IGAB 1FC2D 5E8DL 3VXUE 3QIWB 2DQCH 4J12A 1A6ZB 3GMQB 5E8DH 3QNZA 2D03L 3RGHA 2I07B 3H7BA 1T80A 4JQVA 2WNGA 4GUPA 1Z3GL 3FFCA 4CL7A 1VGKB 3VXSD 4OGXL 2HH0H 1Z3GH 1RURL 3SJVB 4ONGL 4OGXH 3CFBB 4M62H 1RHHA 1RURH 4ONGH 3HAEG 2F5BL 5D93B 3MLUL 5INCA 5IB3A 4NQCE 4Z7QF 2GJJA 3IFNL 3ARVA 3UXFA 1HILA 4YE4H 3QIUA 2VERN 3MLZL 1LEIA 1BZ7B 2BNUA 4G7VL 5FGRA 1N0LA 4LPVA 5A40E 5BVJB 5A2JH 3MRFA 4G7VH 1YPZA 2D4FA 2NZ9D 1IEAA 2QHRL 5CINL 1GPOL 4LLUB 1I8LA 2QHRH 3OSKA 4X7EC 1GPOH 4LNVA 4WW2A 3KLHC 1RUQH 2VJXA 5IB5A 2KH2B 1E4KC 5JW4N 3OKOA 3B83A 1JTPA 1ZLSL 3UYOD 3D69A 1TCMA 3D39E 1ZLSH 4IRSB 4WFEE 1KEML 4L5FH 4WW1A 3JWOC 5H8DA 1KEMH 1SJXA 2ZSWA 1ETZA 3BWUC 5M94B 4UIMB 2P8PA 4PJAB 3OGOE 5E5MA 5H35B 5D6DC 3JUYA 2HFEB 2WIIB 4HCRA 4RA0C 5F7DA 3FOLA 4XB8A 3GMOB 2R69L 2YMXH 3FTGA 4CU8A 1YUHA 2X1OA 1QNZL 1DBJL 2R69H 1IC5L 1QNZH 1DBJH 1I1RA 2PXYD 5HHNB 3SJVE 1A7PL 5EWIL 5B4MC 1A7PH 2E5EA 2R2HA 3H0TB 3O8XD 5EWIH 3T3PF 1I1AD 2E27L 1CLOL 5CJ5A 3QI9B 2NX5D 2E27H 3PWUB 5KSUB 1CLOH 5BRZB 4JM4L 3KJ6L 4JM4H 3KJ6H 4HXBL 1KUMA 2LVCA 3LMJH 5D1ZA 4QTIH 4MA8H 3RIFK 3MROA 3K4DA 3V4PL 3BP7A 2BVTA 1UQSB 3RWGB 4UT9L 3V4PH 3K74B 4UT9H 3PWJB 3NFPA 5F70A 3WXVL 4HFUL 2VLJA 4CVWA 3WXVH 2KDGA 1XIWC 3CZFB 1JGDA 2AEPH 1HQ4A 1B0RB 1I3VA 2HG5A 4IOFD 1JTTA 3FONA 3CH1B 4P4RB 1OPGL 3CDYA 1KG0A 1KTDB 4O58L 4PJAE 1DCLA 3O4LD 4OFIA 1KCRL 3W0WB 3PQYE 5AEAA 1KCRH 4LVHB 2VSCA 3ZSSA 3BKMH 4KRNA 5D9SA 4HUXA 4GMTL 3O9WA 1TVHA 3ARUA 5GS2H 1M71A 4GMTH 1R24B 3TVMA 2B2XH 4TUKL 1P7QD 3K4ZA 3BQUA 4NKOB 4TUKH 2QADB 1FCCA 1U8HA 1GSMA 1U58B 4F80A 3IDNB 1NGWA 1Q72L 4I3RL 3IFPB 1Q72H 4QRQB 5BRZE 1JBJA 4I3RH 1I7ZB 2BERA 3W9EB 1AIFA 3NTCH 1H3VA 3FT3A 4I77L 4FNLH 4Q58C 2V9TA 3VXOA 3WUZA 5B3NA 4NPYA 3SOBH 4NN7C 1NAMA 4OCRL 4G8GB 3LKOB 3U0PB 3ZZ1A 3TBSB 4MD0A 4OQTA 3V0WL 4OCRH 4Y8DC 2EICA 1OF2B 3RPIA 2H32B 3H9SD 4HH8A 1G7HB 4LL9A 3HNTH 1XIWB 4JRYA 3JVGA 5B3JE 2N4IA 1HZHH 3GMPA 2DIBA 2AK4D 3OF6D 4MHHG 1AY1L 3P4NA 4U31A 1CICA 5J13C 3QIBC 5CMAB 1AY1H 4HIJB 1S7WA 4I48B 5GIRA 3TWCL 3W9DA 3W0WE 1RK0A 1V3MA 3TWCH 3DVNB 5TE7H 5KN5A 3G6AA 4RSVA 4PJ9B 2C1OA 2VABB 4ZUTA 4ZD3H 4PJAF 3ECBA 2FEDC 1A6TA 3FB7B 3PE9A 5IOPB 2C3WA 1A47A 1CXEA 2XIDA 1A14H 5F3BB 1S5HB 5FM4A 1HOCB 2XA8H 5E0QA 3QA3B 4YIQB 4HS6A 3PL6D 1KNOA 2GK2A 5E08L 5E6ID 4ZAKB 2JCCA 5E08H 5LBSL 1G7QB 1T7VA 4NUJA 2FJGA 1NC4B 2FATH 2A6KA 4G8GE 3HMWH 1GC1L 4NN7B 5I2IA 1RJLB 4L8DA 3TBWB 1G0DA 3GI8L 4PRDA 4G6FB 5JZ7C 3RVWC 4XT1C 1E0OB 3G08A 3W2DL 5HGBA 4QGYA 3HR5B 2PF6A 3RRQA 3QFDB 3W2DH 5DGQA 2P5WB 5DQ9B 4BH7B 3AXLA 5D71L 5C0NC 3ES6B 4YDLC 2R2BB 3B2VL 3QH3B 4S2SA 5D71H 5MENB 1HXYB 1U8KB 3MOAL 4ACPA 3VW3L 3B2VH 3C6LD 4A2LA 1GZQA 4EDWL 5CEYB 3MOAH 1NCDL 3IJYB 4J4PD 1UM4H 1FNEB 2XI9A 4B50A 4EDWH 5EUOA 1NCDH 4MJ6A 5J13B 3QIBB 1P4LB 5I1EL 5GRVL 1QRNB 4GG8A 5BXFA 5JMRA 3HZMB 8FABA 3GBMH 3M07A 5IB4B 5KG9A 2YC1B 5B3JF 2EZ0D 3QEQA 5F97E 5B8CB 1RY7B 4V1DD 3G04B 4CU7A 4JRWA 1SM3L 4U1JB 3O41A 2R2EA 4XBPB 1SM3H 4HF5L 2JK5A 3LD8C 5SWSA 2ENYA 3ZE1E 2APFA 4HF5H 4FRWA 5DEGA 5SWZD 3ZKNC 3BN9D 1G1CA 1KLGA 1KPVB 2I9LA 1BQSA 3UDWC 4EUPB 2NY6C 3B9AA 1WCBB 2CQVA 1G7LB 2A1WH 3VXRA 1UWXK 3X3FL 3DIFB 1OCWH 5AZ2L 2V2WB 2BNQA 3X3FH 3C5ZA 4LLMA 1RZGB 5AZ2H 2A6DA 3GBLA 4L1HA 4NBXB 4MQ7B 5DVKA 3W81A 4UOW1 3GNML 2DDQL 4I3SH 2BOBA 1Q94B 2DDQH 2P43B 2Y7QA 4NC1C 1R6VA 3PF2A 3VE0A 2P5WE 5C0DB 2W38A 3CVIH 1TJGL 5HDQL 1QBBA 3N1QC 3RGVC 1TJGH 1EAPA 4TYUA 4YLQT 5HDQH 4LIQH 3T4AB 5FFLA 4ZUWA 5MENE 4M8QB 3EYFB 5D7JA 4YDLB 1TQCC 3SKNA 4F9PA 5T3XL 1MCKA 3JBG7 4OD3L 1M05A 1QRNE 5GGVL 4APQA 4OD3H 5GGVH 3ZT7A 2F8OA 3QEGL 4YWGL 2NY2D 3BPCA 3AB0C 4GSDL 4OAWB 3B9VA 4YWGH 1H5BA 2IALB 1G9ML 3SO5A 1PY9A 2PKDA 4GSDH 4HIIB 5L2KB 3S98A 2FWOA 4WI4A 3THML 4M5YH 3QDJA 3S35X 3D87B 1S9WA 3E8UH 4GG6E 3IAGC 1RJZA 1UZ8B 3QRGL 2WUBL 1JHLH 4HS3B 4YDJB 1ZS8A 3ARBD 2EH8L 2ZUXA 2WUBH 3LD8B 5E56A 1DLHB 2EH8H 3VFSB 1FDLH 2XXMB 3BKYL 1JWUB 5CP7B 1TJHL 2VDNH 2BJML 1UCTA 3BKYH 5CSZB 5FCSH 3LKPA 2BJMH 2NY6B 3VXMA 3MJ7B 4ZOCA 3U0TB 5CKAA 3CSYB 3T4YB 5ADOL 4L29A 5TDPA 5ADOH 5IB2A 4OGAC 3ZE1F 4NIKB 2FCBA 3NIDE 3VD5A 1D6EA 4JDTL 4UBDD 1INEL 3EBAA 5MEOA 1C1EL 2D7MA 4JDTH 1UJ3B 1R3JB 1INEH 2FX8L 3KLAA 4LHUB 3TO2A 3VXQB 2FX8H 3EOAA 3RI5F 4BQBA 3BRGC 4KK8C 4TVPE 3SKJL 3U4BL 1VADB 5F9JB 3EO0B 3RGVB 1X5XA 2X4TA 1BBDH 3U4BH 4HUUB 5F7WC 3RQ3A 4WWKD 3MUGB 5DQJB 1GGYA 2FR4A 3VFUB 1CS6A 1M7IB 4Q6IC 1P84K 4DVBB 1ACYH 1T21A 1TPXB 4UQ3A 4YPJA 1FG2B 1FZKA 4Y4KD 2MOVA 3AB0B 2GFBA 2YXFA 5EB9A 4IDJL 4KKBC 4PB0H 3OJDA 1GOGA 3RTQC 4YC2B 2R4SL 4TTGA 2Z8VC 4HX1B 1I9IL 4WUUD 2R4SH 4X6FB 1HWHB 1NUFA 5FYLD 1MREL 3BEWA 5CZVL 1XCQA 1GVIA 1MREH 4QXTA 4ZFOB 3TYFA 5EZLB 4OCWL 4YHMH 4NKQB 3VRJB 5T3ZD 4QXWA 3NVQA 2GIYA 4MQTB 4OCWH 5DUMH 5I66B 3VFGL 3QXWA 4BELD 3VFGH 3RZCA 5EU4A 3IJHA 5EUKB 4NWUL 2H6PA 3EOBB 3I75A 3K0WA 4FHBD 1Q38A 4NWUH 5J1AB 5JQHC 4GG6F 3K8LA 2CIKB 1HQRA 1LNUA 5SX4I 5F89B 4QHNA 5KSBB 3MRDB 4QXUH 5M95B 1G9NL 3SDDD 1VEOA 3JSSA 3IDMB 3CMOH 3RVTD 4FP8L 1OM3L 2OR9L 4FP8H 1OM3H 5EU3B 4MJID 5DGRA 2OR9H 2LFGA 3FMGL 3PWPE 1OARL 3U9UB 3NIDF 4L1DA 4BH8B 1FFOA 3OR6B 3HI1B 3MCKB 3IU3A 5GS1C 4DCQB 1FHGA 3MV9B 2X9YA 2WWMC 5J11C 1N5YL 4LBEA 1AO7B 5DJZB 4M61B 2YZ1A 32C2B 3DGCR 2APWA 2MWCA 4MDJB 4KKLC 3STLA 3QUXA 1WC7A 2DQDH 3DRTA 4S1DD 4C58B 2CLZA 4H8WL 2HRPL 2XG5A 2XZQH 4MNHB 2HRPH 2ITDB 3VCLB 4FQCL 4R2GC 5DVLA 4UUJB 3HE7D 5HTSA 3ARGC 1TZGH 1WBXB 5TF1L 1F3DJ 3F7RA 1URLA 5TF1H 5MEQB 5C0FB 4WI5A 1K8DB 4KGJA 5HBBA 3N50A 3CXHJ 4LPYA 2BOCA 1J5OH 1EEYA 5KSBE 4Z5RB 3CMGA 1I8KA 1RULL 4GRMB 3G5XB 2IAND 3MRLB 1RULH 1G7MB 2FX9L 3CPLB 1T1YB 2FX9H 3SGKC 4S1RL 4WO4D 1NBZA 5EPMA 2GCYA 4C55A 1F4YL 1PG7X 3T8XB 4J3TA 4S1RH 4TUOA 1Z5LB 1Z6JT 1F4YH 5L2JB 2JKXA 3WFBH 5E2TL 2BVQB 3MRQA 4ODWB 4CJ0A 1ZHNB 5E2TH 4UU9A 3L3KA 3O6FA 3VRIB 4AEHL 3RVUC 2YPKA 5FAAA 2HT4C 2QSCH 3EJYD 4AEHH 1CWVA 2E6QA 1UB6A 4OIBA 4CN6A 3MV9E 3LKSA 1U8LA 3HZYB 1CL7L 4HIHA 2OZ4L 5GS1B 3L3GA 1CL7H 4PJ5E 2OZ4H 4P4KB 1MRCH 5J11B 4DTGL 4AQ1B 4DTGH 2IPKA 2Y25A 1V3JA 2ZNXA 5A3IC 2ZCLH 3DX6A 4N90D 5FYKL 4AENA 1E28A 1YYLH 4HKJB 1IE5A 3MUHL 1B6DA 2Z92B 3IETB 5FKPA 5FYKH 2P8LA 4HPYL 2X6MA 4HPYH 1FL3B 3RZWA 5I1DA 1JCKA 4P5KA 4JFPA 1RUKL 5EC2A 5J9PA 3D0VA 4OT1L 3VMNA 3ARGB 1MNUL 2VDOH 4XH2B 1MNUH 1U92B 4YFEA 1YEFL 3DXAD 4EOWL 4N0RA 1DBMH 4M7JH 4ZMAT 2JIXD 3NFNA 4OFKA 2XWTA 3DUSB 3TCLA 1S9XA 2APVA 3CFJB 4DEPC 2CH8A 3OWEA 4XVSL 5CUSL 4LFHG 2HJKA 3WIHH 1H0DA 2PTTA 4OFYD 3G5YB 4PJ7E 4OV6F 3QJFA 4KDTC 3OR7A 3VG9C 5KSBF 3RWHB 4EN3D 1J0HA 4JO3L 3ZE2E 3KPPA 3AY4A 3ZYJA 1JWSA 5F7EL 4JO3H 1QFWM 2FYYA 4F7CA 5F7EH 1K2DB 1ORQB 5I30H 2ZSVA 5D2LB 4GKOA 3B6SB 1G7IA 4Q74A 4FZEL 1JPFA 1BPVA 1NBYA 4N1CA 1HXMA 4LLDA 4NC0B 5I1IL 4K3HA 5BS0E 1ZT4A 3AUVA 3U46B 5JXAH 5ALBL 4F2MA 4G7YL 1MHPL 3MMEB 4WUKL 4F7EA 4JKMA 3T3ME 4G7YH 1MHPH 2AVGA 2Z0BA 1MHEB 5IB1A 5DK3A 2B7DT 4LSSH 4IJ3C 4XVJL 4D0BA 4XVJH 1X9QA 1OSZB 5HYSB 1DVFD 2NZ9C 3TBYB 1DN0B 2W0FB 1RZ7L 3LKNA 3AC0A 1QSED 4KUCD 1J86A 5B21A 3L6FA 4CUCA 2ZUWA 2VLKE 3H3KA 2ZUQC 4UDUB 4JGMA 5F7YC 4DEPB 3A6OA 2V7HB 4F37F 1EV2E 3J8F7 1PDKA 4GRWH 1DBKH 2CUIA 1IAKB 1OP5K 3AMLA 3FN9A 2DBJA 1VERA 3NCCB 1QSFB 3X11B 3KYOB 3VG9B 3TBVB 5HHMB 1T5XB 5D5MB 3O3DB 4FTVB 4M1CD 3V0VA 1RFDL 3MRPB 4PJXF 5D2LE 1RFDH 3QWRA 3L3IA 5ACZA 5T1KB 3CC5B 4DZ8A 2PXYC 2ARWA 4PJ7F 3D25A 3VXSB 5I8CA 2BY1A 5KSAD 3FT4A 4KUZL 4HMDA 3GHBL 5E24E 3O8XC 3BZEA 2JJVA 4KUZH 1I1AC 3GHBH 3ZE2F 1P7KA 3PGFL 1MFCL 3PGFH 1QFWI 1I1FA 3T04D 1AGCB 4AT6B 2SEBA 3T77B 1IAIL 1MFCH 5EORH 5JW5A 2ICWJ 2VISA 3LN4B 1J8HB 4XWOD 4PJEA 4YHLL 3NCBB 2I27N 4ORGA 4YHLH 3GSOB 3PHOB 2AI0L 4UB0L 5HGGS 3QULB 5JPNA 5GGVY 3G6JB 3LN5B 4U6YB 4AL8L 3IYLW 3T3MF 3OKEB 4AL8H 4AG4L 4R4FL 3Q3GA 4AG4H 1RJYA 2ZUQB 1N0XH 3L9RB 4D9RE 4KFZC 4EI6A 1SEBA 2X40A 3VXPB 25C8H 4GRLA 4RFOL 3H9YA 2OTUA 5E1HB 5F7LB 1P2CB 3GMLB 1S78D 2J3SA 4RFOH 1U95A 5HHME 2FHCA 2XPGB 1UWXH 5D5ME 4WFGD 4FTVE 5HYEA 3WBDA 5IFJA 4LQFL 1FIEA 3BXNB 4LQFH 2QR0A 1KCVL 5HY9B 2OJEA 1T1WA 4Z7WA 1KCVH 2XFXA 4H1LH 5J12C 1N2RA 3NACL 2OL3L 2AQ1A 4GAYA 3SY0A 3NACH 4JRXE 5E2WH 2PXYB 2OL3H 3Q1SL 4KQ3L 1JNLL 2R23A 4P9MH 5CBEB 4KQ3H 1JNLH 3O8XB 5F3HB 1I1AB 2ADFL 1KYOJ 1KIRA 2XXCB 2NX5B 2ADFH 1N5AB 1YEGL 5SWQA 1PX3A 4Z0BL 5SX5H 2X4OA 4U33A 1J8HE 2VIRA 5B38B 2IADB 4U0QB 4X6DA 4P57B 2HJFA 1CGSL 3FT2B 2W9DH 1CGSH 5IK3A 3G6JE 3ARFB 3BO8A 3BHBA 4JY5L 1J11A 4NRZA 2R2CA 4J3VA 3M17A 3EOYG 3GUTA 2APXA 3GRWA 1NGZA 1BECA 5AD0A 1K85A 4PRPA 4GQ9L 5IG7B 4MAYA 4D0CA 1OGAA 2VB5A 1ZE3C 4G6KH 1MJ7H 2BP3A 1BLNB 5BV7C 1CBVH 3RY6C 3ARSA 1FJ1A 1J0ZA 4JPVH 3O4LB 1UYWL 3QXAB 3KYMA 4MXWH 1NLBL 1UYWH 3B9KC 3T1FA 5K33A 4KRPD 2YRLA 3E6HA 3JWNC 2XY1A 3NGBB 3MA7B 5F7KC 5KANI 5EO9A 2O5ZH 1B9ZA 3VGFA 4AM0B 5J12B 1P7QB 5EIVA 4P2OA 2VXQL 4GAGL 1WBZA 4NQSB 3BMVA 3WLWD 1A1OB 4HMCA 2VXQH 2KQNA 4ODUB 3OKKA 5D5MF 4MSWB 2P49B 4JANA 4WHDA 3SE8L 3PL6C 4PBVC 5CWSB 5E6IC 3TIDB 3OKLB 4PJGB 5DMIL 3N1FC 1A7OH 3O2DL 2O5YL 4G80B 4OTXH 4X4YB 3MJ6A 3O2DH 2O5YH 4YXKL 4XHQA 1N26A 1NGXA 1NLDL 4YXKH 1OTUD 3C9NA 4HIEB 3ULUE 3GSUA 5GRXG 1PY4A 4PD4K 4QHKJ 2VDKL 4YEFA 3HLAB 3OXRA 2VDKH 3V79C 1NGPL 3QDGA 4N0FB 4P3DB 3U6RB 3O0RL 3OBAA 2V2XA 4PLOB 2VN4A 1NGPH 2XRAL 3O0RH 3PJSB 1AXTL 4ZUUB 2XRAH 5JOPE 1YN6A 4LVOC 4LSPL 1MJJA 1ZHBB 1JFQL 4LSPH 1HSBA 5D1ZD 5JUEL 1JFQH 4I13B 4HH9B 4X8JB 3C6LC 2AK4B 3WNMA 5JW4Q 4N5UA 2EDWA 4J4PC 5JUEH 3JV4A 3G6JF 4H0GA 5BV7B 4JY4A 3MREB 4PRBA 4F7PB 4LARL 3O4LE 4LLYB 5FO8B 4LARH 3ROOB 4X4XB 2VLJD 1CGYA 1FO0A 3B9KB 2OR7A 4ZPTB 3N0PB 3EYSL 4I0PA 3RWDB 1C5BH 2EZ0C 4ELKB 5CBAA 3EYSH 5EN2B 1EXUA 1EGJH 2D31A 5INDA 1D7FA 2IQAA 2L4OA 3QUKA 5D1QA 4ZXBB 7CGTA 2GSIA 1BOGB 4FQJL 3CU7A 2KQMA 2VLRA 4FQJH 1T04A 1X5ZA 3BN9C 1G6VK 1KXVC 1S7QB 3BJ91 3MUY1 2D7PA 3MBED 1KTLA 3PL6B 3S8WA 2W1NA 2N1KA 5ILTL 3EHBD 4JJHA 4K7PL 1IEHA 1QFOA 4GXVL 4X6BB 5ILTH 4K7PH 5C0EB 3LRHA 4GXVH 3CK0L 3DURB 4BKLB 5FOBB 1CDJA 2YSSA 2VLLA 3CK0H 3Q6FB 5T1LA 3TH3T 1PFCA 2NQCA 4Y2OA 3MRKB 2W60B 3PP4L 5DLML 1TETH 3T1WA 3TCXA 3PP4H 1VB9A 5DLMH 3ZO0A 1HE7A 1WK0A 4G6AD 4QT5A 2ADIA 2LV4A 2X4PA 3QQ9D 3UJJL 5B39A 1NCTA 3ZKQD 5KAQF 3UJJH 2DLEA 2EECA 4U1LA 5GRZA 4YFLF 3S88H 3ULUF 1YY8B 3C6LB 4QGTA 2H9GA 1NL0L 3HMXL 1EBAA 2FB4H 4IOIB 4DZBB 1NL0H 2FH6A 3IDIB 1CD8A 1VCAA 2NY2C 3K3QA 4W81A 3T09A 5ESAB 3MZGB 4LAQL 2ICES 4F33B 1C12A 4JRYD 4LAQH 4LKCA 1JZ6A 4W4OC 4LP4A 3SDAD 3WIIL 5E6YA 4ZG1A 4V1DB 3SDCD 4P46C 3IDJA 2YD9A 4YBLC 1QPPA 1CICD 1VFOA 3ARBC 4RZCB 5E03A 4MCZA 4FQ2H 4OF5A 4L8CB 1MFAL 5SWZB 4XPGL 2NYYD 3OKNB 2BHYA 1LDPH 3OKYA 2P5EA 5DYOB 1PEZA 4JFDB 2H45A 2Z8RA 3MRJB 1FGNL 1U8NB 3BP5A 1U3HA 4Y5YA 3F58H 4X5WA 1FGNH 4JO2L 2WV3A 4XP5L 2B4CC 4JO2H 4M6NH 4PJDE 5F88B 4NQUA 4UBDC 2AXFB 5HHOA 1A9BA 2AJZB 1XEDA 3GSWA 1M7DB 3ZDZE 1EA9C 1WZKA 4WNQB 5CIPA 4JFHD 5MEPB 1U8QB 5DJ2A 5DEFA 3GJFA 4M9PA 5J3HD 2PYEA 2CDGA 2ZOLA 4WWKC 1VFMA 2V9RA 1HEZB 4PJHB 1FH5H 1Q9KA 2VZ1A 4KJYA 4D3CL 5JA9A 2OK0L 4D3CH 3TA3A 3DO3A 2WP3T 2OK0H 4KHXH 1I9RH 4Y4KC 2NY2B 5ENWB 4NQVA 3WL9B 5E8PA 1MPAL 3GSNL 3QFJA 5C0RL 2W59A 1HHKA 3GSNH 5C0RH 2I9TB 3GSQA 4N0YH 1GH7A 2WWKT 1OGTA 1F4HA 1XGQA 5I1LA 1EHAA 1HH6B 4P46B 4YBLB 3P2TA 3ARBB 2VZVA 1LQSR 4EQ2A 5SWZE 1QSZA 1RIHH 2VR5A 4OZ4B 3ZT6A 1HINH 5GSVB 1JZ3A 4U49A 1S7TB 4JJ5B 4JZOA 3ULVD 2XV6B 4JFDE 2B5IC 3GIVB 4NN6C 5KSVB 2DTMH 4DKEL 2CLVA 4M48H 3QEQD 5GJSL 2MSPA 2KZ1B 1MCCA 5GJSH 3SKMA 2C7UA 2XY2A 1EEUA 4KJWD 4NWTL 3MLTA 5J89A 1MHCB 5JQ6L 4NWTH 5ESQA 4R7DB 5SWSD 1RZFL 1KXQE 4WFFD 4AIZA 3SDDC 5MHSE 2C4FU 1LEKB 3EKCA 5IMKB 1JF1A 2Y07L 3RVTC 3IXAA 4G8IA 5DJXB 2PYFB 3B3IA 1JZ2A 2Y07H 5GS0H 1CZ8L 3VXRD 1F2QA 1PG7L 1Z9OA 3HZKA 1CZ8H 3C5ZD 2P7TB 3TV3L 4QWWD 2AEQL 1PLGL 3AS2A 4PJDF 3SGEH 2XQYG 3TV3H 2X4UA 2AEQH 1PLGH 1MVUA 5BOPA 1V3LA 1BGXH 4OD1H 3ZDZF 1JI2A 2ILLA 2V7NB 3ESVF 4Y4KB 5K9OA 3S97C 3FB8B 1JYXA 3QNYA 3N06B 1RAMA 2PR4H 3NIFE 5E8EA 4WUUB 3BSZL 2XKSA 3BSZH 5DRWA 1X7QB 1KELL 2GAZA 4QHMA 1Z0NA 3I85A 1KELH 2WINA 1B3JA 2NY5H 3HE7C 4OZGA 4NP4L 3HAEH 5DRZB 3TYGL 3VFMA 4PV8B 3VXTA 4EKXA 2B5IB 4NN6B 4NP4H 3MV8A 3TYGH 3IS0X 43C9A 1DEDA 4B5EA 5L0QC 1S7SB 5F7FA 3QQ4B 2VR4A 3GSVB 5TDNA 5E5UB 3UTQA 1NJ9B 2D7QA 5A16A 3C8KB 2NY0D 1EO7A 4ODVL 3Q6GL 3I6LE 4ODVH 3FFDB 5DR5L 1UZ6E 5DR5H 4OKDA 3SDDB 4WO4C 4KPHH 3NCJH 4XAWL 2ESVD 1JYVA 4HHAA 3VXMD 1T7XA 1CVSC 1IAMA 3MNVA 4XAWH 2WM0A 1UADC 3CU1A 1FRGL 2ARJB 2DJ4A 5DTFB 4MJIB 1BQHG 3QHTC 3DBXA 4HV8B 3WIHA 3GJEA 2BSRA 4WV1C 3KYKL 3D9AH 3HHRB 1RVFL 3BVNA 4JDVA 1XFPA 4NYLA 1HSAB 1KPRA 2FSEA 2X4SA 3H3BC 4M1DL 5D96C 5E2UL 2DQGL 5FHBL 4M1DH 1XR8A 4DW2H 1QR1A 4AMKH 5E2UH 5FHBH 2B8OT 4N0UB 3PIQB 4WUUE 3T0EA 5DFVC 5HJ3B 2Q8BL 2KPNA 3EYUL 1JRHL 4NQXA 5FYLE 1OSPH 4FFYH 1A6AB 2R0ZH 4WTZA 2CRYA 3S96B 1IZKA 1RZJC 1N7MH 3ROLB 2GW5A 1OVZA 1SYSB 2O26U 2VMFA 3DRQA 1N59A 1S7XA 2X4QA 3NIFF 5L0QB 3OGCA 4BFIB 1XR9B 3B8SA 3BE1L 4MYWB 3OJ2C 4XMLH 1F6LL 4YK4C 5HGDA 3RHWF 3VDCA 2HA1A 2O93L 1G6RL 4M3KB 4YHIB 1G6RH 4TUJB 1KULA 5FO7B 4XPAH 3D85D 3U82B 3QXDB 1KB9K 4WO4B 4NDMA 4OI9A 3RZCD 1CXLA 3SGJA 3OB0H 4MJIE 3QUML 5CCKL 4XNUL 5DHXB 2CD0A 4CADB 3QUMH 4XWGL 2VE6A 4XNUH 1EJOH 4EN3C 3HUJA 3LEXB 2ADJB 1ZSDB 5HI3D 3LPFA 1UZ6F 5DJAA 1UWGL 1MF2H 4N8VG 3VWJB 1FYTD 3Q5OA 3WN5A 3TNNB 4R96A 3I3EA 2F53A 5D96B 1CLYL 1WBYA 3BEVA 4XBGA 1CLYH 4N0UE 1ACZA 3NA4A 1OTSD 4UZGA 5C08A 3VGDA 3S36X 1S7UB 3P11L 5D4QA 1BVKA 4I5BB 4URTB 3P11H 1CDCA 3EYOB 5IMOA 3MRNA 5MP6L 2M26A 2DWEB 1AGFB 4UDTA 2VN7A 3I2CL 4I2XA 4XBEL 1NEZB 3EYVB 2W92A 1DVFC 3MFGB 1FVEA 2JJTC 3EYQD 3BAEL 2HLAA 3VA6A 2Q7NA 5ISZA 3BAEH 43CAA 4WHTA 3QUXD 5BZWA 3I9GL 3MGAA 1MCFA 4E41D 1XF2A 2VH5L 2ICEA 1H3GA 3I9GH 4RAUA 3WUWA 4F8TA 3MRMB 2VH5H 1DBAH 1GGBL 1YY9D 3OKDA 1GGBH 1JP5A 5DJDB 2XT1B 5CJOH 1IC1A 4AZ8A 4Z7VB 4LNRA 3DVFA 4WU5A 3GGWB 1N3NB 4G8EA 4HUNB 4KKNA 4OFVA 4X9GA 5LGHL 1I9EA 2OJZL 3KPMA 1CL7I 2VQ1B 4M1CC 1YEDB 1YA5A 1F6AB 5EBLA 4K7PY 5FUOL 4PJBE 4XCFL 1X4ZA 2C5DC 5C2BL 5JHDD 5FUOH 4QYOB 4XCFH 2IH3B 1XF1A 4WTWA 5C2BH 5KSAC 3VH8B 3VFOA 4H25B 4H1LA 3HPJA 5E00B 3O6FD 5F1NB 4E5XA 4NHCL 2KZWA 3DX8B 5E1AA 5IF0A 3L5WB 1AHWA 1GZPA 2OL3A 1CLZL 1JZ4A 2J88L 1H15A 4PY7B 4XPTL 4Z78A 4X9FA 4XPTH 4XWOC 1KLUA 2XWBB 1LEGB 3FKUS 2BZDA 3PXHA 3V5KB 4MDIB 5DK2B 5HHXL 3RKPA 5C3LD 3UYPA 1DVFB 5HHXH 3O81A 3U1SL 2Z93B 4LSDA 4FABL 1N8ZB 5HYIA 3UBXB 2MQ3A 4P99A 1XGYL 1Y6MR 4JFFA 5GSRB 5ICXA 4OLUL 4KI1A 3QUYB 1ZTXL 4XMKH 4XNMA 4U6HB 1ZTXH 1W0VB 4NZTL 2ZNWA 5C86A 5DS8A 1XF5B 4NZTH 3MJ8B 2XZAH 1NCUA 5C8JB 2G2RB 1ZWIA 3ILPB 4HGKC 4LK4A 1S78C 2F74A 4KROD 2LAAA 4IBLT 1JYWA 1DLFL 2BCKB 4QOKB 3O6LL 3I6GA 3MRBA 1NC2B 2NTSP 4OJFL 5EIIB 2C3GA 3MV7A 3V6OC 5KJRL 3TT1L 1PSKL 4KKAD 1FSKC 1ZT1A 1QVOA 1G84A 4HJGA 4RRPA 1NGQL 4NRYA 5K9JL 1CT8A 4H20L 1U93A 1NGQH 5K9JH 4K94C 5EZJA 1ZHKB 2BVEA 5JIKA 5KSAB 15C8H 1T22A 5FO9B 1BEYL 1AKJB 5E94A 1BEYH 2V2TA 1F6FB 4NZRH 2ATKA 1P69B 5EU5B 4PJBF 5KTEL 5IROC 4XP9L 5C07D 5KVDL 4K3GA 4ZPVB 4JQVC 3U4AA 5IW6A 4XP9H 5KVDH 4O5LL 3UO1L 1EFXB 3GIZH 5T5NG 1Z9MA 4LKXA 3U7WL 3IS1X 3UPCA 3O2DA 1QUNA 1CK0L 1XGPB 3U7WH 5DUBB 3G9AB 5HYQA 1WWWX 4BK4A 1WWAX 3V5DA 4L4JA 1NCCH 1BD2A 3S3SA 3UC0L 4MVBD 3S37L 1AD0B 2YD3A 5CEZE 3S37H 4O2FA 4NM8L 1K4DB 2A83B 3FAXA 4JN2B 4FQXA 4NM8H 1JHKL 1I8LC 4NZJA 2F54A 4QOKE 2VQUA 1R3KB 4WW2C 3BI9X 4LSUL 4OCXL 2E9IA 4YDKH 4KRPC 3A6CL 3IFOB 4LSUH 3HG1A 4OCXH 3V4VL 2CDEA 3D6GA 2BNRA 4MNGA 5LQBL 5DUPL 1I7UB 1FSKB 3GB7A 2ZCHH 1WIOA 1FVCB 2BRQA 5J8OA 5DUPH 1AXSA 1KENL 4G3YL 4LSVL 3EDFA 1KENH 3MNZA 5CD3B 4QHUB 4G3YH 4LSVH 5J6GB 3WLWC 3PNWB 5C92A 4Y5VB 4NOFA 1EGJA 5ID0B 5IGXL 3BIKB 1J1OL 5IGXH 1WTGT 5IHUL 5F96L 3KVQA 3CVHL 5IHUH 5F96H 3CVHH 2DKSA 3FRPA 3D1MC 3V52H 1U8MA 4GW4A 3QWRD 1E4WL 5IQ7L 1OTUC 3H7BB 3P0YH 1UM6H 4GUPB 2AJXL 3FFCB 4NN5B 2AJXH 4Q6IA 5GS2D 1KEGL 1CGTA 4OZHA 1RHHB 4RGMC 5JNYB 1UH2A 4R7NA 2EDTA 5INCB 5IB3B 3HI5H 3MLRL 1T6WA 1ZA3A 1HILB 1R0AL 1GIGH 3MLRH 3QIUB 5D1ZC 1R0AH 1LO0L 1LEIB 2BNUB 1CLCA 2CSPA 2EC9U 1LO0H 4HWZA 3X12A 5FDWA 4C56A 3UPRA 1YPZB 3REWA 4MXQD 4KUCF 1IEAB 3FO0H 5BJTA 4OI8A 4XP4L 3KPSA 2BSED 3MYJA 4BFEA 1QLRB 3MRRA 3D3VE 4B53A 3V6OE 2A74A 4KRPB 1NSNL 4RGNB 5JHLL 5I18L 4TQEL 3HC4H 4IIQA 2CIIA 5I18H 3VJ6A 4TQEH 4RFEA 4XC1L 3D69B 4XC1H 4QRSB 4WW1B 5I71C 2ZSWB 3TPKA 1ETZB 2P8PB 3QG7L 4PBXA 2E7MA 5D7IA 5E5MB 5A2LH 3MBEC 1YN7A 1QEWA 5DD5L 3WD5L 1LD9A 1SEQH 5DD5H 3WD5H 3EHBC 1LK3L 5F7DB 1T03L 3FOLB 3O9WC 1LK3H 4N8PA 1T03H 3FTGB 3IDXL 1YUHB 2C9AA 5FM5O 3IDXH 3FFCE 1T20A 4ZTOH 3C08L 3I50L 2R2HB 4RGMB 5HSFA 4G6AC 4S10A 1OP9A 4QCIA 1K8IA 1B0GA 3QQ9C 5L9DL 5FYLL 1GHFL 4PGCA 1H9VA 1GHFH 4HJJL 3K8KA 1V05A 4GKNA 5T3ZL 4HJJH 3UROR 3QDHA 1YECH 1YPZE 1ULVA 3MROB 5D7KE 1QLFA 4BQ8A 1LK2A 2WUCL 4I0CC 3SHSA 4A2MA 2DL2A 3UTTE 2DQJH 1F11A 3NFPB 2WUCH 2YK1L 2FO4A 5A1AA 4RGNE 4YR6A 4PRPD 3GMRB 3HCVA 3JVGC 4MAYD 2AV1A 3CLEL 1JGDB 1AGBB 1OGAD 3E0GA 1HQ4B 3SDAC 2V5MA 2EYSA 2HG5B 3BGFC 1E4JA 3SDCC 3F7PC 3FONB 1CICC 2IBBA 4LASL 1C7TA 1KG0B 4WEBL 4LASH 5GRYA 3DROA 3GSNA 5I71B 4WEBH 2YRZA 3DX7A 2AJVL 4KY1H 1S9YA 2IPTL 2NYYC 3OV6A 2IPTH 1OAKL 2VDPH 1X5LA 4JQIL 1OAKH 2E7HA 5ICZA 3EGSA 4LPWA 5D9SB 3O9WB 1TVHB 4MA1C 4JFOB 1M71B 5DZNA 3WJLA 4M5ZH 3TVMB 3KPRA 5FGCB 3BQUB 3BGMA 4P2OD 1VFAB 3GEWB 3OJVC 1U8HB 1OLLA 4X7SL 3GI9L 4ONHA 4RISL 4QRRA 2HVJA 4JLRA 5C2UB 2AQ3A 3FT3B 4QNPE 1ED3A 3VXOB 4NPYB 2AGJH 1MY7A 1DN2A 3KDMB 4FQQB 1NAMB 2E9WA 1ZOXA 4XCCL 2DS4A 4DVRH 3QCUL 3RPIB 3QDGD 1CGXA 4IEFB 4PRNA 1IQDB 3QCUH 4RQQA 3N1MC 3IRPX 3L1OL 4NCC2 2EDHA 4JRYB 4UTAL 1T1ZA 1YPZF 3NH7L 5ESVA 4UTAH 3GMPB 3BGFB 3ESUF 3NH7H 3ZTNL 2QQNL 5E2VH 3S6CA 1DDHA 1MI5E 1QTYT 3P4NB 3ZYOA 3L7FA 2R0KH 2QQNH 4C54A 1DBBL 4PY8J 5DJYB 4AIXA 2FO1A 1S7WB 2ZUVA 5GIRB 3W9DB 3QCTL 3ULVC 4OLVL 3QCTH 3ISWA 5KN5B 4I0PD 1OD7A 1FLRL 3G6AB 3IVKA 4K23L 4PREA 4WFHD 2C1OB 1SMOA 1WZ1L 1YNLL 4K23H 4MA1B 5D1QD 1U0QA 4ZUTB 1YNLH 1Q9LA 3HAEA 3U7AA 3ECBB 1ZA6A 1A6TB 2VLRD 1FL5A 1CXIA 4ETQA 1JZ7A 2NY1D 1NFIA 4DUVA 4HS6B 3ZT5A 1KNOB 4KZEL 2JCCB 3LKQB 4YHOH 4NUGH 4O9HL 2XYCA 4NUJB 2FJGB 4O9HH 3C5ZC 1OQOA 2A6KB 3KNBA 4OZFG 4QWWC 5T1LD 4G6JL 5I2IB 4L8DB 3X17A 4G6JH 4HZAA 4PRDB 2CXKA 2VXTH 1P7HL 3LOWA 3BW9A 1BIIA 5TH2A 3G08B 5HGBB 1E6OL 4QNPF 3KS0J 4KH2A 1E6OH 2CMRL 4JRYE 2Z31A 4F7TA 5CS7A 2CMRH 1HKLL 3AXLB 5D7JC 5DRXB 1HKLH 3N9GL 4IHOA 4S2SB 4PGEA 1ZGLP 5DVMA 4PJ8A 1GZQB 4PJIA 1HDMB 4F9PC 1X5AA 5C09A 3I02B 5EUOB 1CF8L 4APQC 1NANH 4MJ6B 4HFWA 4XVUD 1CF8H 4GG8B 4L4TA 1PKQA 4HUWA 1CE6A 5BXFB 2DQFB 5B39G 3WS3B 4FFVD 1MEXL 2D0GA 5K9QG 2JB5L 1H5BC 5KG9B 2Y4SA 2J8UA 1MEXH 2JB5H 3CFCH 4GW1A 2IC2A 3QEQB 4MB3A 5EOCL 2DM3A 3RIAF 5EOCH 4ZFGL 2NY0C 2R2EB 2XQYK 4LPCA 4ZFGH 2JK5B 2NY4D 4JFEA 2PETA 4Z7OE 2PW1A 4Z7UA 1M1SA 5DEGB 1EMTL 5IEHA 1N6VA 1EMTH 2I9LB 4POYA 2JCCE 2P5ED 3S5LA 5C0CE 3VXRB 1N64L 3T2PA 1J87A 4WI2A 1G6RA 2I24N 2BNQB 4D9LL 1N64H 1AQKL 3MJGX 1MCDA 4LLMB 2A6DB 3JWDC 2D4DA 3NPZB 2BSTA 1AQKH 3R8QA 3V6ZA 1SJEA 3TESA 2X89A 1KN4L 5HHOD 2Y7QB 1A64A 3QUMA 4DN4L 1FZJA 2YZ8A 3VE0B 1D5ZA 5DJCA 1VGEL 1MWAA 4PG9A 5DI8A 5GGUA 4BSJA 2OX5A 1VGEH 3IF1A 2PYED 4LCIH 4ZUWB 3LZFL 3U7YL 2Y06H 5HHPA 5D7JB 3REVA 4DQOL 3STZA 1WT5A 5EUOE 3LSOA 1I3RA 5F1KC 4DQOH 3S4SA 2RAMA 1M05B 4DN3H 4APQB 3S36L 3MJ9L 4HIXL 3MJ9H 4P23A 4HIXH 3ULVE 4UNUA 4K8RD 4Y4HA 2J7LA 5GRWA 3BPCB 2OXHA 3DPBA 1H5BB 3QFJD 2ZG3A 1JI1A 3QEQE 4WVRA 1T1XA 2UUDH 4BUGA 1J88A 2FWOB 4RNRA 1J18A 2Q86A 2R9HD 3QDJB 1MIML 5EA0L 4K71C 4LLWA 1S9WB 1U3YA 3K4AA 5EA0H 2VL5A 1RJZB 3CXDH 2NY0B 4NJ9L 1BM3L 5LVEA 5D2NA 1PQZB 4NJ9H 1EHLL 5DURB 3SCMA 4GW5B 2BY3A 1JZ8A 3LKPB 3LPWA 3SGEI 3X14A 3VXRE 3RZCC 5I76A 3VXMB 4KI5D 5JMOC 1JJUA 2BNQE 1DANT 1IGIH 3WFEL 4L29B 4AEFA 4K3EH 1A7QH 3WFEH 2JTDA 5IB2B 3W82A 4ODBD 4Z7OF 3ORJA 3P4LA 2W07A 5HI3C 4JHWL 5FM5M 1D6EB 2FIKA 4WI9A 5MEOB 5EULV 2JCCF 3EOTH 4JKLA 5HI4D 4BQCA 1A2YA 3TO2B 3E6FA 5E8OA 2E6JA 2BMKA 1W0WA 3RVVC 3F62A 4KK6D 1CD9B 4RWYH 1OTSC 4KTDL 2R0LL 4BSVA 3H9SA 2CXGA 2FR4B 3ARPA 2P42B 2WBJA 5IFHL 4CMMA 1YNTA 2ITCA 1LP9E 1RD6A 1FVDB 3CAFA 2AP2A 1FG9C 1T0NA 1T21B 4UQ3B 3PDOA 3VMOA 3OF6A 2AERT 4TNWF 4R26L 1Q0YL 4FA8A 4HG4K 1FFPA 2GFBB 2FGZA 4QHLB 1Q0YH 2AS5M 4OLWL 3QDJE 3EYQC 4RX4A 1J1PL 4OLWH 4HJ0D 1CQKA 5EUOF 1XZ0A 1J1PH 3QUXC 4K71B 1IL1A 3CFKA 2GEEA 2LU4A 3RDTD 5GS3A 5IVXE 3BEWB 1LWRA 2VAAA 4JEGB 1XCQB 1YY9C 4QXTB 4ZODA 3MV11 3TYFB 4ZYKA 1BFTA 1QFHA 4Z8FL 3JZ7A 3VXME 4DFIA 4Z8FH 1ZGLA 1R3IH 3MV8D 3RZCB 5EU4B 3MRCA 3I75B 2EDLA 3FQWA 1AXIB 1HQRB 3SO3C 2G60L 1LNUB 5E6IA 4ONFL 1D5XB 3DUUA 2G60H 4ONFH 1NGYA 4ZOAA 4XC3H 1MFEH 4E0RA 4NQCA 5TE6L 3AU1B 3L95B 1XMWA 1NUNB 5I1JH 1EO8L 1EO8H 4GBXA 1C16A 3O6FC 5DJ8A 1WLHA 2HLFD 4U7KA 3RJDA 5HHQA 2DM2A 1FFOB 1FV1A 1PD6A 5HI5D 5FEBA 4C4KT 1AI1L 3NFSH 1BVLA 3OXSA 1AI1H 3IU3B 3DVIA 4OCSL 1GOHA 4P5MA 1XGTA 5HXMA 5KVGL 5C9KA 4UNVA 1OAYH 3QO0A 2VXUH 1F8TL 3CJJA 4YHKL 1P4BL 3STLB 3T0ED 3QUXB 1WC7B 3DRTB 1P4BH 1R5WA 2Q76B 1I3UA 2CLZB 4PRAB 1FLTX 1LP9F 1A6VL 1FN4A 3IGAA 1A6VH 4EI5B 4HCRL 3QIWA 3I84A 2M1KA 5AYUL 5EG6C 5HVHC 5AYUH 3V6FA 5A2FA 3L3JA 2ZKHL 4LCCC 2XTJD 4KROC 2ZKHH 1NMBL 5GGQL 3CFBA 1NMBH 4YEEA 5TE4L 5IVXF 6FABL 2BOCB 1EEYB 4KKAC 2QQKL 1ZT7A 2XKNA 1JGEA 2QQKH 1MHHB 4WEUD 4NO5A 3PHQB 5EPMB 1NBZB 5ACLA 2GCYB 4TUOB 5J56B 3ARZA 4IDLA 1ZGLM 3MRQB 1GAFH 4GT7A 4M7LL 2ZUTA 4MWFA 4POZD 5C6PB 4UU9B 1G7PB 3L3KB 4M7LH 2FDBP 2YPKB 4KC3B 3AY4C 5F7HA 4DAGL 4JGJA 5I1GH 1JUFA 4KHTL 3BRFA 1UB6B 1A0QL 4DKFH 2X1PA 2BVOB 1A0QH 3LKSB 1U8LB 1MAML 4HIHB 4HWBH 1Y18A 3QSKB 1RU9L 3L3GB 2A77H 1RU9H 3CVHA 3LH2L 1FNAA 2F53D 4J3WA 4D8PB 4G42B 3H42H 5I19L 2IPKB 5D8JL 4EXKA 5D8JH 3DX6B 1E28B 5I1CL 5C08D 5FKPB 2P8LB 2D3VA 4MVBC 1T4KA 3PQYA 1UWEH 2DD8H 4YHZH 5IESL 3GMOA 4JFPB 4P5KB 4D2NA 3T2NL 4NGHL 5EC2B 5J9PB 3D0VB 3VI4E 4D0DA 5HVHB 4NGHH 3IJSA 1BFVH 5HHNA 3UJIL 4OGZA 5ISZD 5CZKA 1WAAE 4KROB 1AC0A 4PBWD 1EHNA 3TIEB 3UJIH 1X44A 3B5HA 3H0TA 3NFNB 3TCLB 2H2SD 4TRPL 1S9XB 3QI9A 4TRPH 4RAVA 5F93C 3C60A 5C1MB 1F4WL 5FECA 4CNIA 1FFRA 5AUMA 1F4WH 2HJKB 1H0DB 2O5XH 2PTTB 1AD9B 5DD1L 3PGDA 2RBLA 3QJFB 4HAFA 3OR7B 1MCNA 5DD1H 4OQTL 4OQTH 3KPPB 2DLFH 1JWSB 1M6OA 2OP4L 1IM3A 2FYYB 4JQXA 4F7CB 1REIA 1ND0A 4K7FA 2VZ3A 2ZSVB 2O61A 4FQHA 1G7IB 2NCMA 1UH3A 3WDHA 1RMFH 1NBYB 1L6ZA 1HXMB 4LLDB 3DX9A 4JHAL 3DV4A 5GJTH 4JHAH 3EO1A 3VDAA 3FQTB 4L9DA 3V4UL 4X0KA 4F7EB 4MD4A 3GK8L 4PFEA 5JDSA 2AXGB 1QPXA 4L4VD 3GK8H 2EKSA 2OMBA 3GBNL 1KV3A 4NCC1 2P46B 4OV5A 3O45B 5DMKB 5JR1L 3K80A 4D0BB 1YEIL 3ZKMD 4MXQC 3HNVL 4D9QE 4H1LG 1D5BA 3HNVH 2JF1A 2RIKA 3LKNB 1ODAA 3L6FB 4QEGA 4JFFD 3IDNA 1EAJA 4QTHA 3UX9B 1GYAA 4QRQA 5IFAH 3W9EA 2DIJA 1VHPA 3QYCA 3H8NA 1JGVL 2W91A 2BHUA 1HKFA 1JGVH 2L7JA 4G43A 4GRLC 1WAAF 4OLEA 3SN6N 4WJ5A 4ESKA 2P4AB 2E8ZA 1WZLA 2C1PA 2H32A 2VZSA 3MV7D 3V0VB 4WCYH 5J4MA 1V5JA 1NCNA 1NDMB 1MJUL 3MGTB 4UV7L 5EBMA 1KJ2L 3L3IB 5ACZB 3O3BA 1MJUH 4DZ8B 4U1KA 4UV7H 1KJ2H 4KQ4L 5EOTA 4DGYL 3D25B 5I8CB 3VGAC 3FT4B 3MOBL 4DGYH 2PUQT 3PGCA 4HIJA 4LMQI 3BZEB 3MOBH 1I1FB 3QDMA 2SEBB 4HUVA 8CGTA 4KDVA 4PJEB 1A6UL 3ULVL 4PJ9A 1KJVA 2YD8A 1A6UH 1UM5L 5CLWA 1KSRA 3NCFB 1UM5H 5HDBF 4QRUB 5JPNB 1CFSB 2CUMA 3JTSA 3FB7A 4OQ1A 4DJMA 2Y9RT 3PABA 3BYYA 2ZUYA 5FYJU 3LQAH 1E27A 1EUTA 4GOSA 3Q3GB 1C08A 4MAYC 1BD2D 1RJYB 2QV2A 3JV6A 5BQ7A 35C8L 1ZAGA 5JIPA 3W5MA 4ZAKA 3SDXF 3ULUH 35C8H 4R3SA 4EI6B 4S11A 5DA4A 1Q1JH 1SEBB 4FQXD 4BZ1L 1CTOA 1I7RB 1PZ5B 1AP2A 1MCHA 2GSGA 1RJLA 1KF9B 3EDEA 5DJ0A 4GRLB 3TBWA 2F54D 4EIGB 3DV6B 2OTUB 5DQDL 2ZPKH 5J7CC 3WDIA 1U95B 5DQDH 3UZVB 4KXZH 4PUBL 5IFJB 3HG1D 4HEPG 1J0YA 3GSRA 2VWEC 4PUBH 2BNRD 1OAXH 5CJQL 3DSFL 3QJHA 1MLCA 2OJEB 1T1WB 3DSFH 2XFXB 5DQ9A 1N2RB 2EE9A 1YEKH 1HHJA 3ES6A 2DJSA 2R2BA 4GAYB 5IEKA 4P2OC 1CR9H 2ENSA 3SY0B 4G5ZL 1HXYA 4WV1A 4X7CC 3SGDH 3RNKA 2PN5A 2R23B 3VGAB 3GHEH 4HK3J 1I3GH 3OAUL 4G8FA 3OAUH 4CU6A 1L4IA 1KIRB 3HZMA 4QY8A 3BDXA 3SKOA 5SWQB 1FAKT 1MSPA 2WMPA 2X4OB 3GMNB 4PJEE 2VIRB 2ARJQ 4NZUL 2VC2L 5B8CA 5TFSL 2HJFB 5TFSH 5IK3B 4ZTPL 3BO8B 5LCVH 4GG6A 3BHBB 4NRZB 1A1MA 3M17B 2EIBA 3GUTB 1BP3B 2GQHA 1NGZB 3FRPG 5AD0B 3MR9A 4PRPB 3BDYH 4MAYB 3H6JA 4D0CB 1U2HA 4OIIH 3DXAA 2XOTA 4JKKA 2RR3A 3RPKA 5EOQL 5HVWA 2JIXA 4PIRF 1CXKA 4KJQD 1FNHA 3KAAA 4P2QB 5EOQH 1RZGA 1X5GA 4MQ7A 1RIUL 3KWWA 4JO1H 3FJTA 1ZVYA 3KPSD 1RIUH 3T1FB 3JWDL 1CE1L 3LIZL 3E6HB 4I0PC 3JWDH 4EJ1C 2FZ3A 5ABDE 4X80H 4I9WD 5C0DA 2BFVL 5ITFB 4L3ED 4FQLL 5D1QC 1RUML 4L8BA 4XTRD 5TGBA 1CD0A 1P1ZA 4JR9L 4P2OB 4PGBA 2K3TA 1RQ5A 4QO1A 1WBZB 3HR6A 3KPNA 2D2OA 2NY1C 4X9HA 2PW2A 4JANB 1QFUL 4F3FA 1XT5A 5FK9A 4XPFH 2XWJA 2XNAA 4N9GA 1EFQA 2IALA 3R0NA 5GZOD 1NGXB 3C9NB 4FFWD 2YN3A 5HGAB 3GSUB 4YXLL 1QBAA 1FBIH 4LDEB 1U36A 4YXLH 2A9NL 2AJSL 4YDJA 3LKRA 1CFNA 1TTGA 4UINL 2FHBA 3QDGB 2A9NH 2AJSH 4MLIA 2V2XB 4UINH 4ZUVA 1TVDA 4RMVA 4PJEF 1YN6B 1IAIM 1IC4L 1MJJB 3KXFE 1U2CA 1IC4H 5I1KH 2D0HA 1CGUA 1QSEA 3P30L 3JV4B 4KAQL 4P2QE 5I8OL 4JY4B 1RV6X 4PRBB 4KAQH 4XVUC 3G5ZA 4JVUA 5I8OH 4U3CA 3TEUA 2JLLA 2RB8A 4PJFE 4BUHA 2AJYL 4FFVC 3R1GL 4XXDA 3R1GH 1UJ3A 4I0PB 4MMZC 5FF6A 3F7VB 2NXZD 1T2QL 5INDB 2D31B 5IBTL 2IQAB 1D3CA 5D1QB 5LAXA 1L7IL 1T2QH 2H2PD 4N1EA 1FNSL 1VADA 1D6VH 1DE4B 3V7AG 1FNSH 4W68A 2HVKA 2NY4C 4R4ND 5F8QC 2VLRB 3Q2CA 5DQJA 1T04B 4Q9CA 3ZKSD 2DI9A 4DGVL 1DL7L 1U8IA 1WIUA 3PWPA 4H88H 4F9LA 4AIOA 4DGVH 5DJ6A 1TNMA 1KTLB 5HYJD 3P4OA 2DB8A 3TPUA 5JO5A 3U30B 4WDIA 2EH7L 4U6XA 4FXGA 3QWOA 3KPRD 2VLLB 1V7NL 4Y5YC 2GITB 1V7NH 1JZ5A 1F4XL 4ISVB 3GM8A 4QRRD 3F65A 1HHIA 1A6PA 1ORSA 4GS7C 4QT5B 2ADIB 1BZ9A 2X4PB 5B39B 4XXCA 3QEHB 3BPNC 1Y0LA 4U1LB 1F45A 1RUPH 5EUKA 3EJZD 5E95B 1PW3A 2Y72A 5GS0D 1H3WM 3TA3C 3VWKB 3VFTB 5KS9E 4K8RC 1QFWL 4KVCH 3MRDA 1BREA 1DUYA 5C0AB 2GY7B 5T3XE 1QFWH 1DSFH 5GISL 1C12B 4PB9L 2EYTA 4LKCB 4TNVK 3C09C 4PB9H 2R9HC 4P2RA 5B22A 3G6DL 5DMYA 3OZ9L 3IDJB 5EU3A 1IKFH 5DDHA 2VLRE 2QKIA 4MCZB 3OB8A 2GY5A 4PJFF 3WHXA 1TQBB 1SYVA 1OL0A 3DJ9A 3EFFA 3VXNA 3LB6D 2P5EB 1NFDA 4KI5C 3MV9A 3HNSL 4XRCA 4PS4L 4KMQA 3DOSA 1IT9L 3HNSH 4LCWB 2C4XA 4PJ5A 4M61A 3BP5B 1U3HB 3EJJX 2DQCL 4Y5YB 1PEWA 5JTWA 3QQ3A 2M8XA 4K3JH 3BYTA 5HHOB 1YMMA 2WP3O 5IROA 5HI4C 1OP3K 3GJFK 1VPOL 2E8YA 4GS7B 2HH0L 3DGGB 5E99H 4WRLA 1VPOH 5DJ2B 1NANI 5DEFB 4M62L 4CN1A 3BPNB 2YS4A 2CDGB 4KK6C 2ZOLB 2WWKO 3CFDA 1FNGA 1JNNL 5TPWL 1KJ3L 4YE4L 1JNNH 5TPWH 1KJ3H 1Q9KB 4KJYB 5TQ0H 1AGDA 1Q9WA 3ABZA 1WZMA 2EKJA 3ZE0E 4OGYL 5KVFL 3TA3B 5F6HJ 3G5XA <