4NJ9H

Crystal structure of fab 8b10 in complex with mpts
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
217
Chain Sequence
EVQLQQSGPELVKPGTSVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIGYIYPNNGGNGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARRGGYGSRGYFDVWGTGTTVTVSSAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8B10 light chain
publication title Adaptive Mutations Alter Antibody Structure and Dynamics during Affinity Maturation.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nj9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nj9H02
1P4LB 2BDNH 3KLAA 5D93B 1DQQA 3BDYH 5DEGB 4F57H 3UAJD 4XBEH 5F88A 1BOGB 2Z4QB 3U36A 2P45B 3RPIB 4YQXH 4NZRH 3L95A 5H94A 5I1GH 1ZHNA 1PD6A 3RWEA 4POYA 3UO1L 4OZIE 4GOSA 3BVNA 4WUUD 3NPZB 1SEQH 3F6IA 4PLKD 4MAYA 4TUJA 2R1YB 4FZEL 4S1RH 4XTRC 3QG7L 2OM5A 4K8RL 1LEGB 5J57B 5FFLA 1YMHA 3MRJB 1X9QA 2AXGB 1GPOH 3LQAL 4M1GH 2WW8A 1E6JH 3DURB 1UYWH 1V7NL 4JZNA 4G7YH 5D1QB 5HI5C 5I16B 2AEPL 3I6LE 2CO7B 4LSDA 2FYYA 5IM7A 3K80A 1T7WA 3W0WA 1EUTA 2YZ8A 4N1EA 1EHXA 5L0QC 4JGJA 1TQBB 4XBGB 3CVHH 5TPWH 1CXFA 1DE4B 1T83C 5C0RL 4JFPA 8FABB 1JNHB 1YMME 1RZ8A 2AJUL 4Y2DB 1KXVC 5LWYH 4P23D 5I2IA 5I74C 5DFVC 4KDVA 3C60C 2UWEF 4JRYE 3PGFH 4P3DA 4QXGH 3RL1A 3SKJL 4OCNC 1JTTA 2VH5H 4U1KB 1JHLH 4WUUE 4NC1C 1MRCL 1WZMA 2FR4A 4HIJA 5SX5H 3OKDA 4TULL 4JO4H 2CDGB 3UCRA 4U4BA 4OLVH 4X7TB 5E1AA 1DBAL 2Y1VA 4F58L 4LIQL 1OSZA 3H6JA 2DJ4A 1ERNA 3IFLH 5I75C 1UB6B 5FGCB 3ARFC 1FFPA 4P2QB 5HHPB 1JZ3A 4XP9L 3IYLW 1FBIH 3WL9A 1KTDA 5CGTA 5E99H 3BT2L 4FFZH 3DXAB 1KJMB 1Z0MA 4LCWD 4XB8A 2AJSH 5CP7B 2WANA 2NR6C 4XNMB 2NY2B 2KPNA 4DKFH 4IRJC 1CFSB 3OB8A 5DK2A 1UZ8A 5DK3A 4FMFA 3BZEA 1T03L 4JB9L 2BVQA 4MA3A 4PJEB 4PRIA 4PLJD 5TDPB 2OR9H 3NZ8B 1S5HB 3E2HB 5F89B 3VFMB 1B2WL 5D7KD 4EBQL 1QQDA 1NAMA 4PJDA 5F9JB 3WEXA 2IPTH 4K3HA 1E28B 4G6ML 1ACYL 1G7HA 3X11A 1A1OA 1F8TH 1U8KA 1NGYA 1WQVT 1H8OA 2CSPA 2LAAA 2QHRL 4NQDE 3W2DH 2VDOL 3OKEB 3O2DH 1JVKA 1PG7L 1QLRA 2FEEL 5J12C 3QIBC 5A16A 3O8XA 5EC1A 3MA9L 4DVRH 4MJIA 3GMNA 1LMKA 5SWQA 1AD0B 1E4JA 3WNKA 3L9RB 1RJLA 3DIFB 1FNLA 5KN5A 4JY6A 4LDLB 2CGRL 4NKMB 4LCWE 1HXYA 4HWNA 3E3QC 1FCGA 5CILL 3QCVH 3PDOB 4TVSa 4N1HB 1J5OL 4DFIA 2Z31D 4PJ5B 3B9KD 3P4MB 2DB8A 2OL3B 1ZTXL 4PG2C 1M7DB 2GQHA 1MY7A 1ZT4A 4NGHH 5IHUL 3X3FL 5JLZB 3VWJB 2RJMA 2X7LB 4PRPE 3TP4A 5IW6A 4U6VH 2DIAA 3GSVA 4U05A 1UWXK 3FT2B 4X6DE 3STLB 1GOGA 3C5SB 4N0UA 5DJXB 1E0OB 4ZTPH 5DQDL 2XI9A 1A6ZB 4Z5RB 3TIDB 5JHLH 2BNRA 1E27A 4XP5L 1TJGL 4H20H 5GRVL 3GMMB 3IKCB 4P59L 4OAWB 2XWTA 3SDDB 1VHPA 3QEUB 4NO0D 3VXOA 5AZEL 3S34L 1A6AA 1SYVA 4OQTA 1XF4B 2E8ZA 2X4UA 5HY9B 1IGIL 4FZ8L 3FOLA 1ND0A 1NUDA 2PCPA 3QFJB 5IB2B 5IFJA 1F4XH 2R4RL 2EXYD 2NY0D 3PNWB 4YHYB 1I1AD 1XIWB 3QIUB 1UJ3A 4MXVE 2ZOKB 3ZKND 4EZMA 4UILH 3W11C 3B8SA 4Y8AA 1G9NL 4ZAKB 3NCYP 4HGMA 2PTTA 3NABH 4LVHC 5L9DH 2X44D 1IE5A 3BP5B 4LSQH 1MFDL 4ZXBC 1OAZL 4LLDA 3PABB 4HIHA 1SQ2N 2IGFL 4ZOBA 3R1GL 5IT2L 1FFOB 1T1YA 3O9WB 4GRWB 4UDUB 5GGVH 3WIFA 3WFHA 5FYJL 3BWAA 2XYCA 4NKDB 2D3VA 4X0KB 2OTPA 4FRWA 4MJ5B 4Z7WE 1AD9B 5CEZD 1BJ1H 3OB0H 5HDBE 3S4SG 4P2OC 4Z7VF 5F44A 5HYFA 3LMJL 2IH1A 2CJUL 3ZL4L 4WU7B 4L8CA 3KLHD 3ULVC 3DBXB 4I3GA 3MV9E 5MENB 1C1EL 1AO7E 4DOHB 4M61A 3KYKL 3WLWD 5I1LA 2V2XB 4LSSL 3VGAB 5DUBA 2CR6A 5JMOC 5DQJA 4I2XA 3UYRH 3VXQB 4P5TB 1BBDH 3SKMB 1G6RA 1NMCB 2F54A 4UAOC 5I1CL 1MI5B 2JLLA 5I8OH 3TT1L 5GJSH 3VFPB 5GRVK 4I1NB 4HWBA 5DK0A 5JUEH 4P5KA 4RISH 2F53B 4BSWA 1XF5B 1YNKH 4NRYA 2DQGL 2QJDA 1OGAA 3BP7B 5C2BL 3JVGA 2JIXA 3QHZH 4WEUD 1BVLB 2ZSWB 4ZPTB 2K1MA 3LQMA 3NH7L 2MCPH 5CEZE 2UYLA 5C08B 3F7VA 4GSDL 1JV5B 3B83A 1MFAL 4ORZC 3MLYL 4I0PD 1OAKL 2IQ9L 3WKML 4PJGF 2CK0H 1YNLH 4YC2B 3IFNH 5DJAB 5A2KH 4R0LA 3SDYL 1S7VB 2AI0L 1MFBL 5C0NC 1X5AA 2C3VA 4HLJA 3KWWA 2C3XA 4NRXB 4G6KH 4XHJD 4LRIC 3ALXA 3G5XA 2DWDA 5KJRH 1MNUL 1UVQA 4U1MA 2HKFH 1F4WL 3UBXG 4F37K 1I8LA 3HRPA 2EE9A 1OTSD 4M1CC 4U33A 3O4LB 4MD0A 5ICZA 5F1KC 5EORL 4ZUUB 1T20A 1EMTL 4AQ1B 3HS0B 2PYFB 5FYJU 4X9FA 3M07A 1NBZB 2VTFA 2O26U 3UTOA 1P6FA 2IBBA 4NQXA 4OD2B 3MV01 2LVEA 1WFNA 2B2XH 4IJ3C 1MCWW 4M1DL 4E41D 2K7QA 1CFQB 3PWPD 3MCLL 3IXAA 5EULV 5BXFB 1TIUA 5FGBA 2VLKD 1WLHA 4N0YL 3ABZA 4J12A 4ACPA 4I4WA 5HHME 1BFOB 4OFDA 5D7JC 1INDL 1OARH 1I7ZB 5DTFB 3SDXA 2NY6D 5C0CA 3QDGB 5HHNA 3QQ3B 5EOQL 1EFXB 4X4XB 2BOBA 4WW2F 2FH8A 2OJEB 1KLUA 1WTLA 4ODUB 3TYFA 4OB5L 1PAMA 1A4KA 1T6WA 1T80A 3BSZH 3GMRB 1NUGA 2ZCLH 1CDBA 2A83A 3MNVA 1MFEH 1DFBL 3RWIA 1EIBA 3AFLA 1PW3A 1FZOB 6FABH 1JZ2A 5GRJL 4KRLB 3QDJA 3F7QA 1Q9OA 1J0ZA 5SWSB 3MUGA 3CH1B 4YR6B 2EKSB 3C6LA 5HJ3B 4KTEL 3UYPA 1NFIB 2OL3L 3PXJA 3I3DA 1T66D 5KVEH 2DICA 1A7BA 1AGFB 1N59B 3LCYA 5CJQL 4F9LC 3FB8B 3CVHA 2VIRA 1HXMB 4EN3D 1I3GL 2I5YL 5IESH 4X5WA 3HE6C 2W59A 4ONHB 2EH8L 5GHWL 5SV4A 4POZD 3VA6A 3VD4A 1BQLL 1KF9B 4IEFB 4TUOB 4K3EH 1KIPA 1XGRB 1WT5C 5D71L 4U0RB 3ZKMD 5B8CC 2EEDA 1DJSA 1TTFA 3WFEL 2AV7A 4X98B 4YHIA 1IC7L 3JTSA 4JFXA 2PO6A 1P6AB 4X7DC 3SKOA 1E4XI 3LH2H 3L1OH 5DMGC 3S36H 3KGRA 3QQ9C 1MAJA 5A3ID 2LABA 4JKPL 5A2JH 3S5LA 1IGCL 4JN2A 1G7MB 4XPBL 5HI3D 5C9JA 2YSSB 5D96B 5HBBA 4IHOA 1BFVL 4OUOA 4XWOD 3W81A 1S78C 1JUFB 3P0YH 1RURH 2DL2A 2WSKA 3IU3B 3GSXB 1JPFA 2V9QA 3MTRA 3EFDL 1OAXH 5I8KL 4J3TA 5T1LB 4JKLA 3IDJA 4HJ0D 3MR9B 4DKEH 1NCWL 5JW4N 2OI9B 4LVNB 1TVDA 5EO0A 3DARA 3IDNA 5BRZA 4YFLF 4YXHH 1FC1A 4YO0B 3UO1H 4Y4HD 3FT4A 2HA1A 1EAPA 2BSTB 4PUBL 5IK3A 2BMKB 1DDHB 4N0FA 4QYOA 4R7NA 1ZT7A 3L3OB 2NMSA 4FXGA 4G3YH 2ZUYA 4G5ZL 2QR0A 3VRLF 4HUMB 3O2DA 4BZ1H 5F9DC 3VH8B 2VLJA 3GSUA 4JPWH 4NJ9L 3LQAH 4MDIB 2P42B 1U8OB 4KU1A 2O5YL 3I50H 3MLZL 4JVUA 1SBSH 5JNYB 4OT1L 1ZVSA 3CFCH 4JFFA 4UU9B 3VFNA 4L8BA 5FKPA 1T3FB 3TCLB 4H8WL 3MRHB 3O6KL 5CIPB 3VXPA 1YY9C 3G6JF 3DV4B 1JGDB 2P5WE 4NQCE 4YK4B 3UTSB 3D9AL 3D85B 4DCQB 1IKNA 3EFFB 4Q97A 3EOYG 4UQ3A 4G80A 4JGUA 4HAFA 2RIKA 4I3RH 1A5FH 4HFUL 3FRPA 4YHPB 3SKJH 4D3CH 1K85A 3ME0A 3BN9D 1NC2D 1K5NA 3GZKA 4PGEA 4NPYB 4PJIE 4TULH 3KPMA 1RK0B 4Z9KB 4DEPB 5EA0L 3EJZC 3EHBC 4LQFH 4PV8B 2P49B 4NBXB 3FO9B 1WF5A 4NBZB 4K3GA 4KZEH 2XACC 5L88L 3PWLA 4XP9H 4PLOB 4RBPK 1MAKA 4HX1A 1WIOA 4LGPB 3KXFE 1HQ4A 4RGOL 1QP1A 4RNRB 1ZVYA 1CD1A 3I84A 5MI0C 3F58H 3ZE1F 5D2NC 2XZQL 4ONFL 3BQUC 5CZXC 5B38A 5CJOL 1RUPH 4ZO7A 4OFPA 5F8RC 3RVTC 5JOEA 4XTRD 3PL6B 5D7SL 1B2WH 4EBQH 1QBAA 3TZVB 4FXKB 3QH3A 4OF5A 2I27N 1ES0A 4OKVA 4DGYH 2WBJA 2BVPA 2DQDL 1EK3A 4X6FB 1FC2D 1Q38A 3WIIL 3QUZC 1ACYH 1S5IL 3EOTL 5FK9B 2GEEA 1CGVA 2NNAB 3EJJX 3ZE0F 1N6QH 2R2BA 5HI5D 4WFGE 4WVRA 1QLFB 1A9EB 2D03H 2ZUVA 4YPGB 3C9NB 1V5JA 4F7CB 4FXLA 2BZDA 4TVPE 4ZSOA 2BOCA 2YPLD 4LU5L 4ODVH 5MP6L 3MYJB 4XVSH 1KIUA 5JO5B 5T1KB 3GI8H 2BRRL 3VXRD 5TFSL 4KTDL 1AC0A 5MHSD 5JORA 5HHQA 2CGRH 5C0AB 1QBML 4AK1A 4PRBA 4XXDB 1J5OH 1UEMA 1WFOA 3QNXA 2V5MA 2VLMD 3MRBB 5DFVD 4L9DA 3C60D 3FT3B 1A3RL 5TF0A 5D70L 5IROA 2OTWA 3X3FH 1UM4L 1WK0A 4S1QL 5C0GA 2WAHA 3GBMH 4PGBA 1KTLA 1PSKL 2BERA 5J6GB 5DJ6A 2YA1A 4NNYA 5T5NG 4TSAL 2X4RA 1WBXA 3ARFD 3AY4A 2CDFB 4RIRA 4WEMB 4XP5H 1V7ML 1TJGH 2PKDA 3I02A 5IR1A 1Z3GL 4Q0XL 5DMIL 2QV2A 2UZIL 2GSIB 4DGIL 5AZEH 5BVPL 2GJZB 3BPLC 2BNQA 2NR6D 5L2JA 4FTVD 4IRJD 5CAYB 2VQ1A 1R24A 3RNKA 4F7TB 1QUNA 3VDCA 3D48R 1IGIH 4BUHA 1FFQA 4YHZH 5JQHC 3MV8D 2DBLL 1PKQB 2R4RH 1A8JH 1H5BC 3HE7B 3LS5L 1T1ZB 3O4OB 3SDCB 4PRAB 5ID0B 1J9CT 3WSQH 3UTZB 2EEBA 3QWRD 4HUWA 4YDVB 4HG4J 3WE6B 3ZDZF 4OSUL 1NL0L 1T5XA 2X09A 4JO2H 2XICA 4LCIL 2XZAL 3ZTJH 2UWEA 3IS0X 1MFDH 2XNAB 3DV6A 3HUJE 4GW5A 3GDBA 2X1WL 4WV1B 1F00I 2ATKA 2FIKA 2VUOA 3GSOB 1IKFL 2IGFH 4MWFA 5E0QA 1I8IA 1EO8L 3U0PA 4RRPG 3RRQA 3U0TB 3K74B 4GRWF 4MD4A 5LG1A 3BHBA 1P84J 1ZHLA 4FFVC 4XAWL 1GYAA 4PJ9C 4LRNH 2CUIA 5FYKE 2Y23A 3QSKB 3KLDA 5ADOL 3LS4H 3MLUL 1ZAGA 4Q9RH 2XA3A 4TSCH 3NFSL 2DDQH 4FTVE 2APWA 3LMJH 3EYOA 3MBEA 3OGOE 1N8ZA 2CJUH 1MHCB 4M6OH 1YEHL 4PJFB 4ERSL 2NZ9C 3T77B 3V79C 3KPSE 4LLMA 4FQCL 2B7DT 4ZQKB 4CVWA 4HBCH 4GLRI 4XWGH 3MLTA 2Z31B 2A9ML 3OGCB 1AY1H 3MUY1 3QHFL 3H7LA 3O0RH 5H35A 5EU6E 3GRWH 3WXWL 4CU8A 4LCYA 3VFOA 3GGWB 4OLYL 5B39A 5F70A 2NX5B 2X1QA 3D18A 4APQB 4H0HB 2OXGA 4KI1A 2YC1A 1KOAA 2DS4A 5DD1L 1WFUA 2QLVB 2XZZA 4M7LH 1QLEH 1F02I 1ETZA 4JRXD 2DQGH 5EFIB 5C2BH 1NC4D 2VDNL 4G8EB 3MCKA 4LLYB 1T1WB 1UCBH 3NGBC 1J8HD 5CHNB 5CJ5A 3LSOA 4OM0L 4LF3B 1JJUA 1UB5A 1J0IA 4PP1C 3P4OA 3MC0A 3W11D 5SWZE 4BH8A 3QWOA 2JJSA 1IAOA 1CD8A 3QEQB 2JJWA 3LPWA 2ARJA 4MNQD 4ZXBD 4Z18A 1CR9H 3RA7H 2V5SA 2YD3A 3PQYE 1IM3A 3HI1B 2BY2A 3VFVB 4Z6AT 2FZ3B 4P2YA 4R2GB 3LVEA 1PBYA 3C5JB 4Z76A 1IQDA 1S7TA 1F4WH 1JPGA 5IQ7L 1I9IL 4LCCB 1IAIL 2VXQL 4J3OC 1MPAH 3N85L 4JFZH 5GGVY 4UQ2A 4WHTA 32C2A 1EVUA 4P2OD 1M71A 2X89A 2VN4A 2VDQL 3PIQA 5ADPL 1KCSL 1YEKH 5EIVA 2IBGA 3ULVD 2DJSA 2EZ0C 3QDMD 2M1KA 2EC9T 3DX7A 4G6JL 1UKQA 2MMXA 2FD6L 4TTDC 3MLXL 4JKKA 2NY5C 1J8HE 4CKVX 5C86A 4UUJA 3U46A 4EI5C 4H25A 4OTXL 4EOWL 3LB6C 3V4UH 2C3HA 2VZTA 1WZ1L 5E2TH 4JPIA 4YBQC 1I3UA 2VR4A 3WNOA 1KPRB 2EDKA 4M9PA 1AHWA 5LGHH 3CFKB 4XMPH 2IALB 2YPVL 1MHHA 1QVOA 4DUVA 4YHOL 3LZFL 3DSNA 5EOQH 4P4KC 4LPYA 3HG1E 3R06A 1X4YA 1HQRA 4PY8J 5ANMA 4FQIL 4I5BB 2BX5A 5D6DA 3QRGH 1PG7X 4N9GA 4OB5H 3E6HB 4PJCF 4ETQA 4NQEB 4K94L 4PRHA 2DL9A 4P3CH 1ZT1B 3MLVH 1XGPA 2GCYA 4AMKL 3EYVA 3UPAA 1DFBH 1ZLUK 4XX1G 3ULVE 4ZFZA 3HNTH 3MLSH 3VE0A 5C0JA 1ZWIB 4KWUA 1H9VA 1KPVA 4C56A 4I0PB 1OWWA 4I3SH 3BUYA 1BF8A 5C0ND 4S1SH 4PB9L 5GGRB 4PV9A 1RZIA 3GIVA 1IGMH 3THML 3LEVH 4KTEH 3W5MA 4NRZA 2BCKB 2VR5A 3P9MB 4M1CD 1WBYA 1JNJA 1X3DA 3SCMB 1LO0H 4G8IB 5CJQH 3TN0C 1GZPB 1GIGH 4X5XA 2P24A 1I1FB 4DZ8B 1IZJA 1L0XA 1J0HA 1J0KA 2CIKB 1MIEL 5KSAB 1TZIB 4PRNB 1QSED 1I7UB 1PEWA 4BSVB 1FNSL 2OQJA 2Q7YA 2X4OA 1BZ7B 5D7IB 3DLQR 4LKCA 4QRPA 3PWPB 1FYTE 3MRDB 4JDVB 3F8UB 1FVCA 5IMOA 5C71A 1DBMH 2R8SL 3G08A 5D7JD 1NDGB 1T7YA 5I0ZA 5IB4B 4PJGA 2YD6A 3H7BB 1AR1C 1HEZB 2W0FA 1HE7A 3LN5A 1A1MB 2VL5A 3SJVB 1BFVH 1U8IA 4HULB 5FDWA 3H9SD 2NY6B 3ARBA 1DSFL 5ISZA 4JFDA 2HP4A 3EFDH 1OB1A 4QTIH 5F1NB 3RP1A 3EGSA 3HR5A 1NCWH 3LEYL 2OZ4L 3ARZA 3INUL 4P46A 3MZGB 4K23L 1KCUH 1OVZA 4KKAC 3DRTA 4CMMB 4PJAB 1QSEE 4L8SB 4L4VA 4Z7UB 3DOSA 3CCHA 4M8QA 2DQJH 4S10A 5D6CB 1DUZB 3L3KA 4DW2H 3TA3A 4G5ZH 4PGCB 3FQXB 3DSFL 1MF2H 4H88L 4AT6B 4NUGL 4NJ9H 2AERT 3MJ9H 2FX9H 3S98A 2W0PA 4KKCC 2VERN 3FKUS 5C0EA 1KBGH 5HYQB 1GGBL 3QPQC 5AAMA 3DYMA 4X5LA 3V0AC 1YPZB 3T0EC 3WUZA 5I1EH 5KZCB 2BC4A 5HDLA 1MHEA 1HSBB 2I60H 3VXMD 1DL7H 2D0FA 2ORBL 3GJFH 4XVJH 3V6FB 4XGZB 3HE6D 2CUMA 1HILB 1XR8A 4ZFOA 3NCBB 3O6KH 4PJBB 4K3JH 4JFEE 2YKLL 5BOZG 1Q94A 2XFXB 4WW2A 1QBLL 4NQVB 3HMWL 4PG9B 4L3EA 1C16B 1KUMA 5IV2A 3AB0B 3ULSA 4CMHC 4P9MH 3ZDXE 4U2YA 2FEEI 3QFDB 3CUPB 4YHMH 4O51B 4HQQH 1S7WA 5DMGD 4OLWL 3QQ9D 2YUZA 5E2JA 2OK0L 3S88L 1DQLL 1FPTL 3FOMB 1J7VR 3HI6L 1RIVL 5K9QI 2SEBB 2PYEA 1G7QA 1G9MC 3KJ6L 3BPCB 4FG6C 4K9EL 1S78D 2GJ6D 4JDTL 3HMXH 3L3HA 2X4QB 3TNMA 3FQUA 1KC5H 4RGOH 3WFBL 5IJKC 5C6WH 4LLQB 1M05B 5KVDL 4NN5B 4PD4K 3RVXC 2VDPL 3ROLA 1HZHL 1T5WA 4EVNB 5IROC 5GGTH 4RAUB 3EO1A 2X4SB 3VG9C 1PLGL 4PS4L 5D7SH 3VFSA 1OSPH 4MA7L 1G7PA 2Q6WA 3MODH 1D5MB 4D94A 4U1HB 4OGYL 5I9QC 4E42B 1JIBA 2RCSH 4UNVA 5CFHA 1UA6H 3PWVA 4WJ5B 1QFWI 2C1PB 4G7VH 1A7RL 2X4TA 5FKAB 3WNLA 3KPRD 4KJYA 3WXVH 1OF2A 1BWWA 1T0PB 4UI2A 2P46B 2V17L 3MV11 4E9LA 1R3JA 1HCVA 1WV7T 5IJVA 1A7QH 1KT2B 4LU5H 5LGJB 5I15H 5T3ZL 5LJYH 1EEZA 1JWUB 3H3PL 4W6WB 3W0WE 4HZAA 5CCKL 1VPOL 2R0LH 1NBVH 3NPSC 4RMSA 4GRLC 2BRRH 4ELKA 5TFSH 1YY9D 2Q8BH 3NACH 1GC1C 5GJTL 3MRGB 1INEH 3UZQA 3QEGH 1A14H 1UG9A 5DEGA 2CD0A 1JRHL 1BOGA 2Z4QA 2J12B 1A3RH 2AEWA 3GRWA 3RPIA 5D70H 1LE9B 4GXUN 1ZLVH 2IMMA 4B7LA 5TDOB 5E6IA 2XWBB 4M6NL 3WHE0 4QGTA 4X83A 3FB5A 2O5ZH 5DC9B 1E4WH 2Y9RT 5IHLB 3TNNA 4U1LB 3O3BB 3EO9L 1VKXB 4DTGH 1G0XA 4JE4B 1I8KB 3EHBD 3DX9A 3QDHA 4HGWB 4GKOA 1T4KB 5HHVH 4HS8H 3O41B 2QQLH 3MNWA 3W9DB 1DQJB 2HJKB 1V7MH 4KRPC 1LEGA 4UT9L 3MRJA 4P99A 1YJDC 1BEYL 1PKOA 3L5WB 1B4RA 4QRTA 2AJVH 2QADC 3DURA 1N4XH 3S5LG 4QRQA 5D1QA 3EOAB 5I16A 2G2RA 1JZ8A 3BQUD 5CZXD 1IL1A 4M5ZH 4D9QD 4GKNA 1KXQE 3RVTD 4AENB 4PRIE 3LS5H 2XQYK 1KG0A 3BGAA 1WVZA 5GSRB 3G6JA 2E6JA 1DE4A 4DN3H 2Y07L 1VB9A 4PJDE 3QUZD 1JNHA 5CGMA 4U31A 2PETA 5FYLE 1NL0H 4U49A 2XZAH 5FM5O 5H37H 5T1MB 4Y5YB 1QD0A 1IKFH 4PJ8B 2P8MB 2YN3A 2V5YA 5FXCH 5KS9A 3PP4L 2QQNL 1GL4B 2WQRA 2X41A 2CDGA 5FF6A 4X4ME 1KXTB 4XAWH 1CZ8L 4MJIE 5KANG 5BV7H 1DBJL 3BGFC 4XRCB 1UB6A 2X5PA 5JHDB 4MA1C 4P2QA 4XC1L 3VRIA 2ZOLB 3VXRB 4H5SA 3EYFA 2FBJH 1OGTA 4EIZC 1CICC 1IGTB 4CVXA 4ERSH 5CSBA 4PJFF 3NCCB 1RZKL 1XGTB 1KELH 4FQCH 5CP7A 4MXQC 3F5WA 5AZ2H 1ZSDB 3P4NA 4Z0XB 2HWZH 5IWLA 1QPPA 3BH8A 5HYSA 4HIIA 4MQ7B 3WXWH 1SJHB 1W0WB 5IVXF 4JG1L 5TDPA 1PGRB 4KC3B 4CDGC 3NZ8A 4N0UE 2COQA 2KL6A 3TO2A 5FAAA 4OJFL 3VFMA 5T3XL 3HI5H 4HDIA 3V6ZB 1JWMB 1URLA 4O2EA 2BNRE 2Z91B 1YDPB 5IP4A 1C7TA 4M62H 4J3XA 3WNMA 1YEIL 4OFYA 5D72L 3DO3A 3V5KB 4HZLB 5DXWA 1FVEB 1FDLL 1VESA 4Q9BA 1NANI 2D4DA 5FM5M 1DN2A 3WLBB 3UPRA 4WWID 4MCZA 2XN9A 3P9WB 1AD0A 4NP4L 3ZLQC 3SE3A 3DIFA 1YEDB 5I19H 3KYMB 5IIEB 4L8DB 3CK0H 3TPKA 2LV4A 2Z35B 3A67L 1N2RB 3VCLB 4PJ5A 2F54D 3SE4A 5CIPH 1TCRB 3QCTH 1M7DA 2RFXB 1U42A 5E94B 4OLZL 5JLZA 3VWJA 2X7LA 2ZUTA 3MMEA 5DJ2A 3ULUL 4PR5A 3DMMC 3FT2A 1HH6B 2VISA 4HK0A 3RWGB 2D31A 4ZOEA 2JIXD 3QIBB 4PJ9D 2VXQH 5D6DC 2V2TB 4HC1L 4OFKA 1A6ZA 3A6BL 4D0BA 3TIDA 4HPYH 1I75A 4U3XA 2VDQH 3RZWA 5ADPH 3GMMA 5DRWB 2NZ9D 4QHMA 2KZ1B 3DO7B 1MCOH 3FO2A 3L6FB 4G6JH 3KPQB 4K8RC 1EVTC 2ZNXA 3A0OA 3MLXH 3SGJA 4OF3A 4OTXH 4EOWH 4MX7A 4JANA 2J8UB 2AK1L 5DEZA 3HAEG 3PNWA 1XIWA 1U3HC 1R3KA 4R7DA 1BWMA 4JLRA 3NIFE 2ZOKA 3D2UD 4I2XE 1QO3A 2H8PB 4WCYH 2AABH 2NQCA 2F54E 4QCIB 4TNWF 4X80L 2YPVH 3O45B 4PTTB 2V7HB 1NSNL 1RIHH 4OCWL 5FHBL 3BP5A 3U48A 3X14B 2R0KH 1QSFA 5DQ9B 1J05B 1V8HA 2EECA 4WFEE 1OGAE 3T2PA 4P2RE 4J2XA 2J4WL 5ACLA 1T2XA 4K94H 3O9WA 2N56A 5C09B 5HVWA 2W60B 1OT2A 1S9XB 4ODSH 4CJ1A 4PP1D 5B3JE 3GO1L 1RJCA 5AYUL 3UZEA 2EDJA 4ZDHA 3KHOA 2CXGA 4NCDA 3VFGH 4UOW1 3MJ9A 1UEYA 2OTUB 1D9KA 3QO0B 1Z9MA 4WU7A 5D8JL 5EO1A 3SKNB 3U4EB 4IS6B 1ORQB 3HLAA 1JN6B 4IM8A 1C5CH 5D7LA 4LVHB 3THMH 4J8RB 3K0WA 1F3JA 3QZWB 3GJFA 1VENA 4Z7NE 1MFCH 4JZOB 4L4TA 1XMWA 3VXQA 4OM1H 1VADB 4P5TA 5HYJB 1AFVH 5C6TL 5T33L 4NWTL 2J2ZA 3QA3B 1AKJD 4HPOL 3VFPA 5EUOF 1R3IH 4LSRH 2EZ0D 4RFNC 4M93C 4ZFGL 1BGXH 5DF0A 1XFPA 2OJZH 3MNZB 1FFRA 1AJ7H 1OAUH 3MGTA 1RAMA 4F7PB 1XF5A 3ZT7A 3SE9H 3QDMB 3LB6D 2ESVB 3E8UH 3QDJD 1BVLA 2ZSWA 1D5IH 3QXVA 2BY3A 1F90L 2BVYA 4ZPTA 3NZHL 4G6AC 4YBQD 5D7IF 1YN7B 2EDRA 2JJTC 5F9WC 1BD2D 2PXYC 4MQTB 2XTJC 3MRLB 1QFWM 5J06A 5DD0H 4LLAA 1I7RB 2IADB 4R90L 3HMXA 1HWGB 1X4XA 3C6SB 3SDXE 3TCXA 5J6HB 4L9LA 4P4KD 5C0CE 2ILLA 4HLZH 1C12B 4GKZB 1XF2B 3GB7B 1DSFH 1VGEL 4D8PB 5HPMB 5B39G 1F13A 3JSSA 1OCWH 2EE6A 1IGYA 3LEYH 5GGTA 3P30L 1U91A 4WGWB 4JFHE 2Z8SA 3O4LA 3QUYC 1NQBA 3PHQB 1UXWA 4RFOH 5DI8A 4ZUUA 3TBSB 4X9HA 1K4CB 4PJAF 1ADQH 4Z7UF 4ZUTB 3SOBH 3L3IA 4OD2A 2FWOA 5IB5B 5TE6L 3QDJE 3MJ8A 1D5ZB 1GHFH 1P4BL 4H88H 1E6OH 4R8WL 4QHKJ 2BSSB 5EH1A 1A7OL 1CFQA 5CMAB 1F3RB 2C3WA 2R69L 3V0WL 3ETBF 5E03A 1J86A 5BXFA 2ZJSH 3TN0D 3BGMB 1NMBL 1XGQA 4NWUL 1MJ8L 2HT3C 5L7XH 5E5MA 5MERB 3N1MC 4KUCF 12E8H 1YPZF 5DURB 4C83B 4I18C 4AM0A 1UH4A 4F33A 5I1AB 1I7ZA 5DTFA 1RUKL 5EBMB 3BH9B 2CR3A 4AEHH 1AP2B 3MX0A 5TGBA 3WO3B 2MQ3A 3TO4A 2NLJB 5E9DB 2DBJA 4RGNC 1G9NC 2OJEA 1KEGL 4XPHH 3P4LA 4PJCA 3ULUF 5IB3B 1H3VA 4WY7H 4RDQG 4TYUA 5TQ2L 1M7IA 2OK0H 1BECA 3S88H 1AR1D 1FPTH 1KJ3L 2VZOA 3HI6H 1FZOA 1CT8A 1F11B 2WNGA 4KFZC 3KJ6H 4CRPA 1IC4L 4K9EH 2XRAL 5SWSA 2F5AH 4QRSA 5DRXB 4JHAL 4YR6A 2EKSA 4MNHB 3QUMH 1NFIA 4DVBB 2AV1B 4QNPE 2RR3A 2MQ0A 3HZYB 1HHKB 5D93C 5C3TA 1AGFA 3WYRA 4KKAD 5BRZE 1NMAL 3EYUL 4HT1H 2J7LA 4QGYA 1U93A 3IRPX 1LE5B 3BP4B 2J1KA 3PJSB 4G8GB 4XP1L 4PS4H 2UUDH 2I9LA 4MA7H 4ETYA 5C0FB 4TSBH 1PEZA 4YGAB 5K33A 3V0VB 3BOVA 4OLEA 5MEOB 2ID5A 1J1PL 4LBEA 1QRNB 4KQ3H 2VLJE 1A7RH 3VXSD 2YUXA 4KKCD 5ILTL 1YUHB 1YY8B 3F7YB 1LVEA 3QPQD 5ID1B 3T0ED 2GK2A 2AKRA 4Z7OF 2DTMH 4G8FB 5ABDE 1S7QA 3O11A 4NKOB 4JFFE 4QXTA 1QFUH 5CCKH 1GGYA 2Q87A 1ZHKB 3X13A 2YSSA 1BVZA 4RA3A 4WO4B 5DD6B 5KSUB 1M7XA 3HFML 3HE6B 2VDKH 3P40A 1JUFA 3IU3A 1VFBB 2AXFA 3MA7A 5JIKA 3ZO0A 1TQBC 2VXVL 2WBJD 5T1LA 2OMNA 3P73A 2NTSP 4QHUB 3ZSTA 4AG4L 5K59F 4OZIB 2XV6B 2PF6A 1QR1B 3OKOA 3VMOA 2PTUA 3V8OA 1JNLH 1BJMA 1MIMH 5E1HB 2NTFB 3AREB 4YO0A 4ZPVA 4Y2DC 3MJ7B 3RQ3A 3MXVH 3EO9H 5J9PA 2YK1H 3CSBA 2C5DC 2BMKA 3B2UC 1ZHBA 1DVFB 1DDHA 2DLFL 5HDQL 2APVA 3L3OA 4FG6D 5D2LE 2D9QB 4Y19B 1Y6NR 2YD9A 3TT3H 3ARGA 4JGMA 1P2CB 3VH8A 4RFEB 3KPNB 3Q6GL 1C5BL 3OJMB 3DVNA 1RFDH 3RVXD 1KJVA 2MSPA 4OIIH 3ARDB 4WTZG 5DJZB 1S7UA 2I9TB 1FNGB 2E7CA 5BS0A 1P7QD 2VXUH 2E9JA 1IM9A 3T3PE 2NY2C 4PREB 4XHQA 4CBPA 5FO9B 3TCLA 2IPUK 1YMMB 3MRHA 4ISVB 5CIPA 2J6EL 4LPCA 3DV4A 3B9DA 1LNUB 1JGDA 4KJQC 4HKJB 3UTSA 5I18H 3L5XH 2GT9B 3D85A 1KEMH 3E2HC 2DLTA 3EFFA 4JRYB 5I76A 2EDDA 5KG9A 3SKUD 3M8OL 2XTLA 5INCB 4NPYA 4HUUB 2CLRB 2QQNH 4ZSOE 3GBNL 15C8L 1RK0A 2HH0L 3GMPA 1V05A 2Y06L 2VJXA 1K8IA 4QRUB 4GRLD 1CZ8H 1U8LB 2GAZB 1DBJH 3KR3L 5INDA 5AYQA 4DK3A 4KHTL 3QUXB 4OIBA 4XNYL 1D3CA 4XPTH 2RB8A 1G7JB 2YWYA 1QEWB 4MJ6B 4K3DH 5IEHA 4YXLH 2YD7A 1IBGL 4XCYB 4DFHA 3SN6N 4RNRA 4BSJA 1L7IH 3SY0A 3B3IA 4RAHA 1IAII 4PJHA 4BKLB 2R1WB 3LKNB 3MOAH 1XH3A 5BCAA 1A21A 1NCNA 2F8VA 1CIUA 3LKQB 3PL6A 1IQWH 5T3XH 1INQA 4FXKA 4KRPD 1Q1JL 3NA4A 4WNQA 4ONOA 4X6FA 5TE4H 4XXCA 2DI8A 2XA8H 3CFBA 3DRQB 4XPGL 2QADD 4JQIH 5CINH 5E08H 2BNQE 2OS7A 1A9EA 2J88H 4KI5F 1BQUA 1NGPL 5DJDB 1DR9A 3SDDC 3MV7D 3K1KC 1YEFL 2YD5A 3G5ZB 3O3DB 5T1KA 3BPOC 3SGJC 4P49A 1BQHG 4M00A 4MD5B 4YHYC 5BQ7A 4YAQB 3T8XA 3IETB 2Z92B 3QIUC 3A67H 4NYLB 5D1XB 1OLLA 3UTTD 4PRPB 3FT3A 1CK0L 2ICEA 4HF5L 1X5LA 1RJYB 1ZA6B 2VE6B 2UWEE 5KW9L 1HKLL 3RVWD 4LEXL 4X8JA 5I30L 4HWEL 3PWJA 4N9OB 4ZAKC 5F8QC 4P23A 4OD3L 4JZJB 1BIHA 3T4AA 3D69B 1EGJL 1ZVHA 4R3SB 1EZVY 4O58H 3OR6A 4F80A 1CXKA 4Y1AD 1CE6B 3E1F1 2BSED 1U9KA 2CDFA 1I4FA 25C8H 1GZQB 1ROWA 4JR9L 1CICD 5IMLB 3ISWA 2B20A 2ZSVB 1EBAA 4MXQD 4GUPA 1F4AA 5KBNC 4WWKC 4F7TA 2VKWA 3ILPA 2XQBL 1RMFH 3GMOB 1U58A 1A6WL 2J8UF 3PUCA 2FSEA 1I1CA 1NDMA 5T5FH 2A1WL 4UTBH 2IH3B 2NY3B 2HTKC 2X1OA 3SDCA 1MWAL 4PRAA 1CDUA 2ZKHL 3QG6B 4FMKA 5ID0A 5JA8B 5H8DA 2ATPB 3VGAC 4YDVA 3EBAA 4XPAL 5DJ0B 3WE6A 2ZP0T 1NSNH 4GBXB 1JPSL 5IW1A 5JIPA 1N64H 4H8WC 4JM2B 2DYPD 3C2AL 1RV6X 1NMCC 2X89D 3DGCR 2ADJB 4JFOB 4WV1A 2VLLA 1A6TA 1QKZH 4OCYL 1ADQA 4AH2A 3U0TA 2I07B 4W6YB 3LDBB 4LPUA 5ALBL 5AYUH 4YDIL 1TTUA 4NDMB 4M43L 1NCCH 2NYYC 1KENH 1DN0B 4WFFE 1R3HB 1IAKB 5EPMA 1MHCA 1AO7B 1MELA 3T77A 3ECBB 1T7VA 4YC2C 5JMRA 2Z31A 3B9KA 3OGCA 3TESA 3DMMD 4FOMA 3C8DA 1JCKA 5IVXA 3QJHA 1IJ9A 4GXVL 2IPKB 1IC5H 5F7NC 4MA8L 3IJHA 4UINH 4X7SL 1U92B 5T33H 3FONA 3MACL 3QIWC 3FN9A 4HGKC 3F7RA 1KIRB 1PYWB 5JPNA 4IRSB 4ZFGH 1XGUB 5GPRA 4U1NB 4V1DB 2WINA 2J3SA 4K8RD 3JV0A 5FUZL 3FB7A 4N8VA 4OZFB 3MFFA 5EFIA 5CS7A 2VSCA 4NSKB 5JXAL 2W9EL 5ACMA 1V3LA 4G8EA 4LLYA 3LKOB 3SQOH 3QEHB 4M02A 1G84A 4FQ2H 3O6FC 5GSVA 4GAJH 4ODBD 1U3HD 1QSZA 2R0WL 2E7BA 2WBKA 4GS7B 1N0XL 3RY6C 1HN1A 1X5KA 4U1SA 4QRRD 2VAJA 4XH2A 4NOBA 5E8DL 4DN4L 1I7TB 1Z9LA 1K6QH 1OLZA 3QEQA 3QUMA 4Q2ZB 4UIMB 1HDMA 2DKUA 3LKRA 4R96B 4LNRA 4OGXL 5HI4D 1AGDA 2YOCA 5CSGA 5ANME 2IBZY 3HI1A 1FRGL 2ZUXA 4RZCA 2GTWB 3T1FB 3VFVA 4HUXB 2FZ3A 3P0GB 4R4BB 3ARWA 4ZUVA 4U6XA 1XCQB 3C5JA 4PRHE 1NEZA 3BO8A 3MUHL 3OJDB 4HWZA 2YRZA 1QA9A 2IFFH 4YNYB 1SVZA 3AS0A 3GHBL 4M48L 1FNHA 4C4KT 3MO1B 3NFPB 5TE6H 4C56E 3DJ9A 1HH9A 3FO0L 1P4BH 3DX6A 2OXHA 1T2QL 3LKSB 5KTEH 2NY7L 3T65A 4NUJA 2KZWA 4H1LB 5HHMB 5KOMC 2E3VA 3HZKB 4NWUH 2FLRT 4FABH 4M7KL 5F3HA 1KPRA 4HUVB 4K7FB 4F9PC 4O2FB 1U8PA 1OAYL 3MRPB 2CUHA 2FO1A 1CGSH 4Z0BH 3U7YL 5J1AB 3QI9B 5CEXB 4ELMA 4MYWB 1OM3L 5C6PB 4OGZA 4G6AD 1UKSA 3E6HA 5E2WL 5DZNA 2WWKT 3G6AB 2WZPD 2B1AL 2Q76A 4EI5B 1ZT1A 5TQ2H 4QRPE 2Q8AH 2PXYD 4O5LL 2A9NL 2XTJD 3HZMB 1WC7B 1Y0LB 1MJJB 3QP3A 4Z8FL 2ZPKH 5GGQH 3ZKSD 4U0RC 1YYMH 5FUCE 3HKFA 1U8QA 1HINH 4PJGE 5ENWA 4MS8C 1ZWIA 2PW1B 1FYHB 4I0PA 2OYPA 1SM3L 5DJCB 5DHVH 1IC4H 2VRAA 3X12B 2FB4H 2HJLB 2P1YA 5DEFB 1JYXA 5CJXC 1OQOA 5ISZE 3MXWH 4JFDE 3O2WH 1F5WA 3V7AG 3WKNA 5D96C 5AG9A 3MCG1 1I9RL 4RMTA 4YUEH 4JY4A 4WHYH 4BUGA 3HPLB 2E6QA 2YN5A 5DYOB 4L3ED 4C4KO 3QUYD 1RUMH 4G8IA 1FZMA 3BISA 1ZLWK 2RHEA 1I1FA 4DZ8A 4L4VE 5EUOA 5T5NF 4XP1H 3MBXH 2OI9C 4LVNC 5EZIH 1VACB 4NKQB 4XC3L 3VXNB 3RU8L 1KN2H 1M6OB 3MOQA 3QB7C 4W4OA 1IAIM 1R5VB 2PYED 4N90D 5DA4A 4BSVA 5J11B 2XTJE 3RWDB 3V4VL 4K2UL 1BZ7A 5JW5B 4E41A 5EDXA 1KB5B 4U6YB 2HT3D 2O5XL 3PWPA 2XPGA 4L3AA 4NZDA 4XCEB 3MRDA 4JDVA 4UDTB 5IVOA 4MXWL 4ODXB 5IB4A 1O7VA 3H7BA 1HEZA 4WDIA 2VLKA 5J8OA 5BO1L 1SJEB 1A1MA 3OF6A 3QXWA 4BZ2L 1ORSB 2WWKO 3L3DA 4U6TA 4D9LL 5EUKB 4OCXH 4RGND 2VDML 3V6BR 3LQZA 1J88A 1WBZB 5ICXB 2VLRD 2VXVH 3MGOA 3PWNB 3WJLC 1PFCA 1JF5A 1F58L 1UM6L 3GSWB 4XPFH 5HHOD 1LD9B 5FHAL 4OZIF 4YK4C 1UACL 1QTYT 4Y4KB 1RZ7H 4JO1L 5FYJD 2IAND 1C08A 4CMMA 4PJAA 3BMVA 3OKNB 4Z7UA 2AS5M 2AK4E 3L5JA 3TVMB 3QQ4B 5JTWA 2PYEE 3IJSB 1NGQH 3QXDB 2ICWI 1J10A 2ADGA 2H9GA 5IFAH 2C1OA 3C8KA 5F7KC 5TF1L 4HH8A 3CJJA 1T21B 4DEPC 2BHYA 4X6EB 5BVJA 2RAMA 4M7JH 4NNXB 1KGCD 4Z7QF 1QBBA 4HIXH 1ONQB 4RSVA 3DUSB 1U95A 2FCBA 4QF1B 4RGNE 3V6FA 4XGZA 2DQFB 4LVOB 3AUVA 2P5WB 4NQCB 2FX8L 5EIQA 4EN3A 5HVGB 5F93C 2ENYA 5DD3H 4M3JA 2XFXA 4M9OA 4YHNB 2R56H 4UT6L 4NQVA 2NY1B 4G6FD 3PL6C 1C8PA 1NUFA 4J4PA 3TZVC 3K2UH 3S8WA 3I2CH 4PJIB 4LPXA 1L6XA 3QFDA 4O51A 5GRZA 3U4AA 4Y89A 3VXSB 4XXCC 1EEQA 5I71B 5D9SB 5ITFB 2BP3A 3IJYB 5EWIH 2HFEA 4K94C 3RL2B 1JGUL 2MHAB 3FOMA 4ODTL 3T0EB 5C9KA 1MLBB 2MTPA 4Q74A 3CSPA 4KHTH 2DM4A 2IWGA 4XNYH 3EDJA 2ERJC 3KXFB 2A73B 4B7IA 4WW1A 3FO1B 5EOTB 4S2SB 5F7DB 2OCFD 4KUZL 5ETUB 2A0LC 4CMHB 4J7RA 4Y2DD 4GH7B 3AXLB 4MCYB 5JPMB 3KPOB 1SMOA 4K71B 1A22B 2L7UA 3B2UD 3OX8B 4HW6A 3OKMB 1UH2A 1LEKA 3VRJB 4Y4HA 1BBJA 5DT1L 3HHRB 3OKYA 4JM4H 2P48B 3VRLE 1LEIB 5DVOA 2K7PA 4WJ5A 2CLZA 3NA9H 4LEOA 4PTUA 1TDQA 4XPGH 1VFAA 4P2QD 3P11L 4IMLB 1PY9A 4LKXB 1NGPH 3DXAD 1ZANH 1CFVL 1KT2A 4L3CB 5LGJA 2FECI 4GAGL 1JWUA 5CUSL 2NY2D 4HHAB 1MRDL 5EBWB 1KLFA 2B4CL 3G6JE 5DVMA 4KJQD 5EZLA 1L7TL 3MRGA 5I1DB 3HE7C 4GG8B 1N3NA 5ERWB 2FO4B 3O4OC 1L0QA 3SDCC 8CGTA 4ORGB 3DGGB 5HHXL 4K7PL 5EOCL 5I30H 5LQBH 5TDOA 2XWBA 3GKWH 1LO5A 1YECL 3U0WL 3NTCH 4N68A 1XCTA 5KS9E 1TQCB 1B0GB 5C0IB 1FLRL 1LO2H 4U1LA 1RHHA 1YEEL 3O3BA 4ZTOL 1VKXA 5HGGS 5GRUH 1NC2A 3UTPE 3CDGA 1HK6A 3TJEL 3ORJA 4HGWA 2VDRL 2IQAA 3O41A 1ZLSL 1VFMA 3WNNA 3U9UB 1PZ5B 4URTB 3W9DA 5AEAA 4JRWA 5HYIA 2QQKH 4P2QE 4KXZI 1S9YB 4JR9H 3HRZB 5EN2A 4GG6B 3IFPB 2GK0A 1CU4L 1E4XL 1OP5K 4FFWC 1QFPA 5DVKA 3OAYK 4PJ5D 2F58L 3C09C 3ES6B 2X70A 5L2KD 1I1RA 1B4JL 4GW1B 4I77H 1RUAH 2X9XA 4KAQL 3JTTB 3WFDH 2QSCL 1BHGA 1Q0XL 1UM5H 3BEVA 3MRCA 4Q6IB 2OLDA 2FL5B 3RDTB 3ZSSA 3HUJB 2EC8A 4OCRH 4JM2F 3HB3C 3ZE0E 4APQC 3MOBL 1WTGT 1JK8A 1RVFH 3SDDD 2P8MA 2AJYH 5TH2B 5DS8A 2AGJL 1WIUA 2XN9E 3VH8G 1AR2A 1KB5L 1YN6B 3MSPA 3QFJD 4KMQA 2YPLA 5JHDA 1N7ML 3ARQA 1Y18B 3QIUD 3OPZH 1RJZB 5ALCL 3VXRA 1NFDA 2DD8L 1KJ2L 2BJML 1NCBH 4PJ5E 1EJ6A 4K9EC 2MPAL 1FGVL 4ZAKD 1JNNH 5EU6B 5GS3A 5JXEC 1FL6A 3LRSB 1IAMA 1FAKT 3CFIC 4CADB 4Z0XA 1P69B 3C60A 4PRDA 4MGXA 1MEXL 2WUCL 2HVJA 5DUML 1SJHA 3UBXA 5ESAA 4GXVH 3X17A 3MROB 4MA8H 1BOYA 3V6ZA 3AVEA 4R2GC 3QULA 2Z91A 1YDPA 2JK5B 4XNZB 3TFKC 1S7RB 4LCCC 3S37L 1IFHH 4HZLA 4KY1L 1FVEA 2Y7QA 3V5KA 4X6CA 4JFYB 4NIKB 2J8OA 4WWKD 1CFNA 1CICB 4Y4FB 1RIUL 2NW3B 3RUGF 3CC5B 3DROA 3OHXB 4IRJA 2R0WH 5MEND 4XI5C 4XP4L 1GAFL 5SWZB 5HGHB 3IXTA 2HTKD 3MV8A 4Y7MA 5I1JL 3U9PL 4UIKL 5DHVA 1F2QA 1W8NA 3V7AE 1YEDA 3KYMA 5IIEA 4L8DA 1VSCA 4P57B 3ZDZE 2HFFB 3PQYB 1TCMA 3F7PC 4LMQE 3QWRA 1MI5D 1TCRA 5EU7C 1XAUA 1QSFE 1T0MB 5E94A 2X4NA 2JJVA 4YDJB 4JHWL 3JZ7A 1VCAA 2BNUB 2F53D 1HH6A 3VD7A 3RWGA 2Q3ZA 3QIBA 43C9B 2NY4B 2V2TA 1S7XB 1JZ5A 4KK9C 1I1YB 2NYYD 3R0NA 4G9DB 5C08D 3GHBH 1A6VH 1IGFL 2DQCL 4LASL 5IMMA 4KH2A 5DRWA 4MVBC 3AS1A 4M8VA 5GGSB 5D7LE 2ZNWA 4XP6H 4PG2A 5EZJB 4LSVL 2DIBA 1FCCA 3EO0A 4LARL 3KHQA 4HUKB 3B4NA 3FFDB 1BJ1J 2YMXL 5IG7B 1AI1H 5BZDB 3TYGH 4L4TE 2H8PA 4Y16B 3VU2A 2ICES 3QIWD 2C9AA 4D0CA 3HG1B 1ZGLB 3O4LD 1KYOJ 3PWUA 2NW2B 2Y36H 5EU4A 1P7KB 2DLEA 3SCMC 1YQVL 2R23B 2L0DA 3BKYH 3HTLX 4M6MH 4KPHH 2EH7L 5CD5C 5ECJE 1J05A 4JG0H 1EEYB 1Q72H 5KSAC 5C0DB 1VGKB 1YA5A 5E2WH 3O6FD 3T1WA 4JRXA 4KDWA 1GGCH 2BXYA 5C09A 3WS3B 1NC4A 4TVPL 2W60A 4O5LH 2A9NH 3GHEH 1R0AH 1MRFH 2UY6A 4Z8FH 1NLDH 3IRZA 1AH1A 1T0NB 2ITCA 1IARB 3CMGA 3PG2A 1LWRA 2OTUA 3D1MC 3MRFA 5GGUA 4IS6A 3SKNA 1JN6A 5FCSH 1QNZH 4CAGA 4E5XA 1BP3B 5CKAA 4XMKL 3BW9B 3N1GC 3W39A 3QDGD 4FP8H 4HLZG 4KMTL 5K9KA 4MNQA 4ZXBA 1EFXD 1RZKC 2WIIB 1KB9J 2FATL 1KFAH 2GSGB 1KN4H 2A6JA 5L8JB 2E7LC 5HYJA 4KQ4H 4IIQB 2BFVH 3QA3A 5KSVB 3B43A 3H9HB 5F1IB 1KTRL 1AQKL 1J1XH 1MCSA 1CLYH 3PV6B 3SPVB 4P2OA 1MCKA 2VITA 4F7PA 4DQOH 5TQ0L 4L8SC 3OXRA 4LAQL 5ICYB 4XCNB 5T1DH 2W65B 3QDMA 3S97C 1Q9LB 3NCYS 5FA4A 1FYTB 1T89C 3CAFA 4HKBA 2B1HL 1YN7A 3GUTB 1K2DB 1DTUA 3BXNB 4JDZB 2IADA 2XKNA 3B9AA 1JF6A 5F7MC 1HHJA 1A0QL 3AMKA 4GKZA 1MJ7L 5BJTB 1XF2A 3U4BL 4JCMA 5DWUL 3I85A 3RFZC 3W9EB 4HWUA 3LN4A 3HC3L 1HSAB 5FA3A 1DBKH 1YEGL 4D8PA 5F3BB 5HPMA 3IVKA 4TUKH 5TJWK 4PJCE 5J1TC 2FGWH 5FECB 1F58H 1RZGA 2YRPA 1BM3H 5FHAH 4PJXF 4QXWA 4WIQA 1OPGL 5GS1B 3QJFB 3WFCH 1JF1A 3DUUB 3ULUC 3AB0C 3PHQA 4HJGA 1P4IL 4MS8D 1JWSB 2DWEA 5FYKL 2PXYB 1QFHA 2ADIB 5IB1A 2IJ0C 5IB5A 1U8MB 2HTLC 2QL1A 1D5ZA 4NN6B 5SWSE 4ALAL 3IB4A 3U79A 1FNEB 2D0HA 4UV7L 2FBOJ 3IT8D 1T7XA 4HH9B 3U2SA 2PNDA 2R2EB 4LRIA 2P43B 2HVKB 2HLFC 1W0VB 3BP6B 1JHKL 1HHGB 1YZZA 3G6DH 3KPPB 1WCBA 3B8YA 3H42L 5C07D 4U1IB 4C83A 5J13B 5JW3H 4JFEB 2VAAB 4IDJH 2OMBA 5I1AA 2ZUWA 4NN5C 4HIEB 2FX8H 3BH9A 1AP2A 3IDGB 4M7ZB 2QKIB 5E9DA 5DR5H 1RULH 3UJTH 3FN0L 4WENB 1TETH 5IB3A 1R6VA 4IOIB 2HLAB 4OZFH 5DA0B 3QCUH 2JB5L 4FFYH 3B6SB 2EYRB 2KDGA 1QRKA 4HKXB 3WIHL 4AIXA 3PF2A 2VZ3A 3KLAB 1DQQB 3GSNH 1F11A 5D7JA 4NJAH 1DLFL 4XAKE 5F88B 2WUBH 1BIIB 3O3EB 1I3VA 3FRUA 3L95B 4G9FB 5H94B 3KYNA 3T2NL 2AV1A 5KVFL 3H9SA 5DUPH 1ZHNB 2CRMA 4DGVL 3RWEB 1HHKA 2YUWA 3OAYH 2DQIL 3BKML 2OSLA 4ODHL 3PHOB 5JW4M 2W1NA 1WSST 4MAYB 3O6LL 4NKIL 4TUJB 5FDYA 3PJSA 4G8GA 1KNOA 5E00B 1MCBA 5JZ7C 3V4PL 3V6OC 4WUKH 5I1HH 2DQEH 5FB8A 3IF1B 4NQSA 1YUHA 5LBSL 3W82A 5CLTA 2P44B 3F7YA 3TBYA 5A2IH 2FYYB 4GMTH 1NJ9A 1FORH 2HKHL 3PE9A 4OI9A 5IBTH 4G8FA 3LV3B 4NZTL 4MSWB 4JREB 5BS0E 3S35L 3VGFA 4F9LA 4H1LH 5C2UB 3IFOA 1ZHKA 1CLZL 2XWJA 4JFPB 3VXMA 1L7TH 4O02L 4WO4A 5DD6A 5EC2A 5KSUA 3B2VL 5JOPD 3HE6A 5BMFH 4GAYA 4I48B 5I2IB 5AG8A 4Y2OA 4OLXH 4JJHA 3PL6D 3UTSE 4ZUSA 2A6DA 3TZVD 4P3DB 3RL1B 1TJHL 4QXUH 4Q9CA 2KQNA 2EYSA 4QHUA 5E2UH 5HHXH 3VWKB 3HCVA 1WT5A 5BZWA 1CFTA 3OKDB 4G6FB 3VI4F 5B8CA 1YECH 4Y8DC 2NTFA 5E1AB 3RAJH 4RRPA 1FLRH 4JPVL 3QNYB 4UNTA 1OSZB 4RMWA 2NY5H 3E6FA 5IGXL 4Y5YC 1DVFA 1FFPB 3TJEH 5GZNC 2VDRH 4BZYA 4PJ8C 3D0VA 2PN5A 1KTDB 4Y19A 1N5YL 3FTGA 3STZA 4FNLH 5T1KD 3UJIL 1JTOA 1FH5H 1P2CA 3RNQA 2D7MA 4GG6F 3FQRB 2WIMA 2VR9A 3KPNA 5GIRB 5K9JH 2GJ6A 5C0AD 1XZ0A 2A0LD 5DK2B 1UZ8B 2P7TA 2HT2C 5F1SA 3BZEB 3I9GH 3ARDA 1CXEA 3C8HA 4PRIB 1I85C 4YE4H 3LD8B 5DJZA 2I9TA 1FNGA 4PJHE 3N0PB 5IEKA 3OAUH 4KAQH 3IDYC 2QSCH 5JOPE 4X9IA 5CD3A 3ZTNL 4PJDB 1AE6H 5FO9A 5E2VH 3GSRB 2A2QT 2R2HB 1LNUA 1G7HB 4HKJA 1PDKA 2NXYB 3Q3GA 1NGYB 2AJZB 5CGYC 1Z9SA 5HGAB 4K07A 4I9WD 4NC2B 1QLRB 4BH7B 3O8XB 5EC1B 3RVUC 1UADC 1X5HA 5ESVA 4UB0H 4PIRF 4MJIB 2CLRA 5D4QA 3KPRA 3UC0L 3RX5A 5SWQB 4YH6A 1TVHA 4OZ4A 5E5UB 3M1BB 4KI5C 3DTXB 5KN5B 2GAZA 4Y5VC 1RU9L 2D9CA 3VDBA 3QUXA 3TGXA 1HXYB 3HE7D 4XVTH 1G7JA 1NGZB 2OX5A 5LAXB 5DSCA 2DD8H 4MJ6A 3SDCD 1ZT4B 1KSRA 1UWEH 2GJJA 4XCYA 4LSPH 3EYSH 4J6RL 1UQSB 4IRZL 5DRNA 4N0CC 4F15B 1MEXH 4TRPL 5DUMH 1OW0C 4C54A 3LKNA 1LK2A 3HZVA 3CXHK 4XT1C 1YNTB 2BNRB 1F45A 2E7MA 4FS0A 1MQ8A 2A77L 3REVB 5I8EA 2XWTB 3IDUA 4OKDA 3VXOB 5KSBA 1CE1H 5E8NB 1SYVB 2KH2B 3DRQA 3G5YA 1IEHA 4H0GA 1RZJL 3TH3T 2X4UB 4PY8I 4R4NC 4L29B 5IFJB 1RIUH 3JWOL 3K3QA 3OAZK 5DJDA 2YBRA 1UJ3B 4DZBA 5F7FA 1LP9B 1NCAH 5D2NA 5IFHL 3O3DA 3BQUA 5I1JH 3TBVA 1TVBB 1Z5LB 4UIKH 2MKWA 5L2KB 4MD5A 1CF8L 4EDWL 5ACZA 1ULVA 4YAQA 1BAFL 2CPCA 3CLEH 2FLBT 3C5ZB 5D1XA 1HYRC 5D7KE 2NX5D 3HB3D 4PRPA 4APQD 3QUZA 1B0RA 1RJYA 1ZA6A 1CTNA 2EDNA 3WIFB 3WFHB 4YHLH 1I9JL 1AGEB 3MJGX 4NHUB 4JZJA 3NCJH 3ROOA 1CXIA 4RDQF 2W07A 4R3SA 3VW3H 3CDCA 4GMSL 2DQHH 2JB6B 4BFIB 1JPST 1QFWL 1ITCA 2C4XA 2LTQB 1CE6A 4OF8A 3BPOB 4YDKL 1H3XA 4L8CB 1GZQA 3K2MC 2DI9A 3ESVF 5IMLA 2F5BH 3G9VA 2W0LA 5JXED 5B21A 4QY8A 4JO3H 1UWGL 3BWUC 4M61B 3QEQD 1MCHA 3RWFB 5L8KB 5IVXE 4I2XB 3SGKC 2IH3A 3GM0A 4R2GD 3LRHA 5JR1H 4JPKL 3QG6A 1DLHA 5CZKA 3L7FB 3TFKD 4WI6A 2AEQH 4P5KB 3HNSH 4BSWB 4GKSA 4NRYB 1OGAB 1NBQA 4P2RB 4XNXH 1XGYL 2EH7H 2ADJA 4RMUA 1G9MH 5D5MA 1F4YL 3QQNA 3OWEA 1JYVA 3BAEL 4WWKB 1T1XB 4XI5D 4WI7A 2CKNA 4FQLH 4LDEB 2I07A 1HHHA 1H5BA 5T3ZD 2IC2A 1FIGL 4LAJH 3HAEH 2GITB 1A64A 1MCDA 3GI9H 4R0LB 3ZYJA 1A7NH 1DN0A 2N7BA 1HYSC 3QEQE 4PBVC 3ZMRA 3Q1SL 5C7XH 2EDWA 4K7PX 3VI3E 3G5XB 2DWDB 4YZFF 4KMTH 2VXSH 1A4JA 5DHYA 4WI8A 4CN4A 4MD0B 4KK9D 2IPKA 1UKTA 5TE7H 1MJUL 4NQED 9CGTA 3MYZA 3WJJC 2YZ1A 3RWJA 3LIZH 4PJ9A 4M5YH 2QEJA 1KIRA 4GAFB 1JFQH 2EDYA 1AQKH 1XGUA 1OD7A 4HKZB 4MVBD 2F74A 4U1NA 4V1DA 1CQYA 5FCUL 2AJXL 2V5TA 4NNPH 4OZFA 4LAQH 3CH8A 3IXAB 3RX7A 3RUGA 1JGVL 3PGDB 4O9HH 5I17A 4NSKA 1GC1H 3R0MA 5DRZA 4ZNEA 2WP3T 4L5FL 5BW7C 4I4WB 4NBYB 1FIEA 3CVIL 4CL7A 5HSFA 1LO4L 3GSNA 4YXKL 5DJ8B 1CBVL 3SDXB 3FL7A 5EU7E 3CFDB 1EHLL 4ZS6C 1I7TA 1A7PL 3I6KB 3D2UA 3KDMB 1P1ZA 3SCMD 4GLRH 2R0ZL 3QIWB 4GQ9H 3HA0A 1NAML 1MJ7H 5CD5D 1RK1B 3T3MF 1KLUB 1S7SB 5FYLL 4ELME 1A4KB 4H0IA 5KSAD 4OLUL 3CFEB 5DO2C 4KGJA 1MQKH 1DUYA 3MNVB 3A6CH 2ZUSA 5KVGL 1YJDH 4X4YA 1C5DA 2F8XC 3OJDA 3RTQB 2D7TL 5FUOL 2P5EB 3O6FB 1X4ZA 3I6GA 3DETC 4R4FL 1NGWA 2OR7A 1FG2A 4FQ1L 1TZGH 1LDPL 1Q9OB 3MUGB 3SE8H 3MO1A 3NFPA 4Q9QH 3V9FA 4BA8A 3C6LB 2DJUA 5F7EL 3OF6D 2YA2A 1KLGA 2FX7H 1OAQL 3LKSA 2FDBP 3SJVD 5F7WC 4OZGF 2XY1A 4H1LA 3IGAA 4WU5A 4KROB 1QPXA 3WHXA 3JUYA 3H42H 2WV3A 4HEPG 4WHYG 1F3DJ 1U6AL 4NHCH 5EUOE 2LE9A 3CSYA 5T3XD 3S37X 2WP3O 2H3NA 5J1AA 3CNKA 4W70A 3RIAK 1KIPB 3QI9A 5E24E 5CEXA 3MRMA 1AKJA 1DQML 3MRRB 4NQUA 4D2NA 1YEJL 2AV7B 4YHIB 2PO6B 3G6AA 4OQTL 4TQEH 3SKOB 2X9WA 4EI5A 4E41E 4HCRH 1NCDL 1MHPH 3PWPE 3T0DA 1Y0LA 3JWNC 5IKCA 1H3TA 5C9JB 3UTQB 1BLNA 3LEXB 2VLKE 2PW1A 1BD2A 3GMLB 4KUCD 5KZCD 5CBEA 3P0VL 2PR4L 3BIKA 3X12A 1NBYB 3MRQB 2OBGA 2HJLA 3IDJB 4P4KA 4S0TD 5JQ6L 2CH8A 4A6YH 5EO0B 4UBDC 3IDNB 3D25A 4ONGH 5BRZB 4WO4C 1X5YA 4QHLB 5DYOA 4LSUL 2DQIH 3LRGA 3LPGA 3U82B 3ULUD 5IK3B 4UV4L 4ODHH 5T3XE 1WEJL 4J4PD 4N0FB 3QBTB 4R7NB 1ZT7B 5DD5H 3DVGB 5CLWA 4XCCH 4Z7UE 2VC2H 1VEOA 4EDXA 1VACA 2HTLD 3AREC 3BZFA 4F37F 1MCPL 5CBAA 2VLJB 3GSUB 3V4PH 1DVFC 5F9OL 3X3GL 4NM8L 3B5GA 4LL9A 3BD3A 5JW5A 4IOFC 2HLFD 1ZVSB 3U1SL 4U6YA 4FQXC 4JFFB 2ZCKL 3RWHB 3VFNB 1HOCB 2HKHH 3PDDA 4L8BB 4XCEA 4YBLB 1CLOL 4QKXB 4NZTH 4UDTA 5FKPB 3SDAC 4CW1A 5CJ8A 3TN0A 1U8JB 3VXPB 1CL7L 1K3IA 3M17A 1ZV5A 1CLZH 3VGBA 5C07B 1ORSA 3ARDC 3QZWG 3MRKB 5AUMA 5EUKA 4UQ3B 1RD6A 1TJIL 5JOFA 5MEPA 4PP2A 3IAPA 2H41A 4HWBL 2XY2A 1TJHH 2KQMA 3T0BA 1K5NB 3ALPA 4PGEB 4PJXA 2UY7A 4FZEH 2M2DA 3CGTA 1FL3B 3QG7H 3EKCA 2DM2A 2VZSA 4K8RH 3ELAT 3AU1A 4JPVH 5HGBA 1W0YT 5EIIA 3OKNA 1YYLL 4TNVK 1DQDL 4PLKC 5D2LB 3GSQB 3CX5K 1V7NH 3RIAF 3PWLB 1R5IA 3QXDA 1T6VN 2AEPH 2HAZA 1HQ4B 4FQJL 1T21A 3QUXC 2JELL 5HYEA 4NNXA 1WJ3A 4D9RD 1FL5B 6CGTA 5B38B 1X5GA 1ONQA 2JTDA 5C0RH 1A6UL 4LLVB 1GGIL 4NM4L 3DUSA 4QF1A 2AJUH 5B22A 3UJJL 4B53A 1ES0B 2DQFA 2BVPB 2B0SL 3QXAA 4PJDF 4UZGA 5JZ7D 2FHCA 2ADFL 2R4SL 5F1OB 1TZHB 1MRCH 4WI5A 1UWXH 4N8CL 4ODWB 2R2BB 2ARWA 3D39D 3KPLB 1DBAH 4DAGL 2G75B 4F58H 4AQOA 4LIQH 4KHXL 4ZSOB 5F6IB 1F6FB 3BDBA 3CMOL 2BOCB 3VXSA 3VFUA 5K9OB 3KNBB 1L4IA 2L7JA 5ITFA 4H26B 2QTEA 3U6RB 1G0YR 3T0EA 3CXDL 3BT2H 3D0LA 4R26L 4E0RB 1MLBA 2C7UB 2BDNL 3BDYL 3QXTA 4F57L 4PRBB 4XBEL 1HHIB 3QNXB 2A73A 4YHKL 3K7UA 4NZRL 1T03H 4JB9H 1G7LB 4PJEF 5F7DA 2XIDA 1VFUA 1KTLB 5I1GL 1S3KL 5K59E 3OKKB 2V2WA 5CSZB 5D1XC 5DJ6B 5TDNB 4MCYA 3KPOA 4NNYB 2X1XR 2X4RB 1SEQL 3EDFA 1WBXB 3OKMA 1WZKA 5GZND 3VG0L 4G6MH 2Y6SC 4RIRB 4PJ8D 1CIDA 3FQWA 1O0VA 2QHRH 2VDOH 4JZJC 2NCMA 3KVQA 3HR6A 1LGVA 1GPOL 1XF3A 3ALWA 2ARJQ 1LEIA 1PG7H 2FHBA 4WFHD 3TBWA 5CZVL 2BNQB 5L2JB 2ERJB 4MNGA 3MA9H 1UYWL 4G7YL 2D7OA 3RNKB 5JHDD 1II4E 2HT2D 4BQ9A 4B50A 3S3PA 3JWOH 3M45A 5IJKA 3HAEA 1DCLA 5CILH 1TLKA 1U0QA 1LP9F 3CVHL 5TPWL 1ZTXH 4HUWB 5DGRA 4ZUWA 3SBWA 5IHUH 3O3UN 1P7QA 1YC8A 4EDWH 1JGEB 1BAFH 1T5XB 4GG8A 3WCYA 4NO3A 2O61A 1SEBA 5CGYD 5ERWA 2FO4A 3PGFL 4QXGL 2NY3C 43CAA 3G5VB 2FJGA 4QOKB 5DQDH 2FIKB 3O2VL 1JHLL 2G9HA 4ORGA 4MWFB 4F2MA 3RVUD 1I8IB 3CFJA 1RY7B 4GBXC 4MD4B 4OLVL 2PUQT 4JM2C 3WS6C 1ZHLB 1B0GA 3G04B 5C0IA 3PP3K 4P0DA 4KI5D 1FGNL 4P59H 5I73B 3ZE2F 3IFLL 3OXSB 1G1CA 3S34H 1MY5A 1QFWH 2AQ2A 2YPLE 1CVSC 3MBEB 4AEEA 3EYOB 1FBIL 4GRLA 5JHDE 4FZ8H 5E99L 4FFZL 1S9YA 3HRZA 3VXRE 1NFDE 4MJ2A 3WUWB 4LLMB 2AJSL 3LDBC 4GG6A 5MHSE 3MLTB 4YPJA 1Z0NA 4DKFL 1UWGH 1WISA 4N0CD 1NKRA 5H35B 1FO0B 4OFIA 2VLME 4LCYB 2NY0C 3ES6A 1MCLA 2OR9L 4RX4A 1OTUC 3VFOB 5IOPB 1G9NH 4GW1A 1CXLA 4NC1E 5I6XC 5JW4R 4U1JB 1QACA 3JTTA 1OAZH 4JPKH 2YC1B 4TTGA 5M7QA 3QIBD 3LN9A 1A1NA 2AXJA 1VFOA 3R1GH 1ETZB 5IT2H 4ZNCD 5FYJH 2F19L 4R4ND 4X6CE 1NH6A 2DLGA 4UOW0 1DP0A 5AD0A 3UX9B 1F4YH 2MOVA 2HJFB 3BX7C 3GMQA 3VFTA 2YS4A 4IRSC 2EDXA 4DVRL 2C4FU 3LSOB 1QG3A 5C0BD 3S35X 4G42A 3C09B 3ZL4H 2FIRT 1YN6A 1X6LA 4BH8B 3MV8E 3QWOB 3ZHKA 3MV7A 5J4MA 3OSKA 1C1EH 3IDIA 3I75B 2ARJB 4KVNL 2J5LB 3KYKH 1F4HA 4M03A 4LSSH 4GS7C 2P8LB 5GISL 4U6VL 1H3PL 5K93A 5IF0A 4CADA 3UTTA 4Z76B 1S7TB 2L4OA 5I1CH 1JPGB 4ZTPL 3TT1H 1F2XK 5EG6C 4UQ2B 4WHTB 32C2B 5JHLL 1M71B 3MROA 3OKLB 4LLWA 5C09D 4H20L 3Q48A 5H2BA 4F3FA 1S7RA 3DX7B 3NH7H 4Y1AA 2XOTA 3V5DB 5FCUH 4DWHA 4UUJB 4GSDH 3E3QE 4H25B 1WAAF 1CICA 1MFAH 4HCRA 3MLYH 4RQQB 1F4XL 1OAKH 1X5ZA 1AXSB 2IQ9H 1JI1A 4OFVA 2NW3A 4WTXA 3WKMH 1KCKA 1H8SA 4ZODA 5IBUB 3OHXA 4QT5B 1PZUB 1LO4H 3SDYH 1AHWB 2AI0H 4YXKH 1MFBH 3MJ6A 3WBDA 4OV5B 3SDXF 3GEWB 4CGTA 3T0XA 5L9DL 3R06B 1J12A 4LSQL 5FO8B 1H0DB 1HQRB 4A6YA 2HFFA 5ANMB 1MNUH 5HYJD 2B4CC 4KK6C 1VA9A 1Z2KA 1AQDB 4N9GB 1T0MA 2LU3A 2A6IB 4GJTB 3TIEA 2MJWA 5EORH 4ETQB 3FQNA 1EMTH 4PRHB 4Z95L 2BNUA 2DYPA 2NZIA 5GGVL 4LQ1A 5KAQF 3PGCA 3FFCD 3QI9C 4JRXE 1XGPB 2GCYB 2R2CA 3EDEA 4BQ6A 5KVGH 5C09E 3EYVB 4ZFZB 1P5VA 3N9GL 2ESVD 1MH5A 5C0JB 1I1YA 4M1DH 2GTZA 5E56A 4C56B 3T09A 4GQPH 3MCLH 4G9DA 1HYSD 5FO7B 2P8PB 1FVDA 1LDPH 1X5JA 1NANH 1U8HA 4PV9B 1RZIB 3GIVB 4N0YH 5HPOA 2JCCE 1INDH 4MNQE 5IHZB 4HAGA 1WBYB 4G43A 3FFDA 5IG7A 2W9DL 4J1UB 3R8BB 3DMMA 2BVOA 2P24B 3BKJL 4S11A 5I8OL 4JVWA 2B8OT 2YWZA 1FZJA 1OD9A 1U6AH 5E8EA 2BY1A 5JUEL 2NW2A 3PXHA 4RISL 2R23A 4KVCL 3N1PC 3T2QA 2DTSA 3QHZL 2OQJB 1EEYA 5DHXB 5CEYB 4LKCB 3QDME 2MCPL 3S96B 1MAML 4QRPB 1UJTA 4Z7VA 5IMOB 5GRJH 4PJGB 4HK3J 1F3DH 1YNLL 2VL5B 5J11C 1U3HA 1H15A 3IFNL 4ZS6D 2ZUUA 1WIPA 1T0NA 3ARXA 1U8IB 2OL3H 5FDWB 4QRRA 5DURD 4G6KL 4LHUB 4Q58C 5DO2D 3BW9A 5I1KL 5KJRL 1I3GH 2I5YH 4L1DA 4P46B 1OTTC 1Q9WB 5E9DD 1EJOL 4LSUH 2EH8H 3DRTB 4LHQB 5GHWH 4UV4H 4L4VB 4KJWC 3OB0K 1BQLH 4KZDL 5IUSA 4IIQA 3PDGA 3L3KB 1X7QB 5D71H 3H9HA 5F1IA 1XF1A 2B2XL 4Y4KC 2WK2A 3GFUA 3PV6A 3WFEH 1IC7H 1PQZB 4PD4J 2X1PA 5ICYA 1CFBA 4XCNA 2W65A 3X3GH 4Z77B 4MDJB 2E9WA 3TVMC 4JKPH 2I26N 1IGCH 2ICWB 5GZOC 4XPBH 5A2FA 3F12A 2BC4B 1A9BB 1MHEB 3MREB 5FGSA 3L3GA 4WTZA 2LU7A 3NAAL 1FO0L 1OQXA 5I66B 5F7LB 4RBPH 5I8KH 1AGBB 1Q94B 1ZA3B 1JZ7A 4WW2B 3UP1A 3KAAA 2Y72A 3W9EA 4G8GD 4OBSA 3ULSB 1P9MC 1HSAA 5F3BA 2CDEA 4LVOC 4PUBH 3VFRB 4QHNB 4DUXA 1ED3B 3QAZC 3QUKB 1S7WB 2ZCLL 4GRWH 5FECA 1MFEL 4BFGA 1QRND 3QJFA 4HBQA 2H26B 2NY1C 2AK4B 6FABL 4OZFG 2JJTA 1RZFL 2PXYA 1G7QB 4LP5A 1ZK9A 1W72B 3P9LA 5D2LF 1QYGL 5I71C 2ADIA 1W8OA 2ZG2A 2O5YH 3CZFA 3MLZH 1K8DA 4OBRA 4F7EB 3BRFA 3TNMB 4XB7A 4OI7A 4OT1H 4CNIB 4HS3A 3O3AA 3JWDL 3UDWA 4UBDD 4WO4D 2JELH 5KVEL 1NLBL 4P4RA 4OZGA 5F71A 4DKAA 3H9SE 1L9NA 1IMHC 3ROLB 4H8WH 2HVKA 1T5WB 1HHGA 4HD9A 3NMEA 3KPPA 4U1IA 5IESL 3D9AH 3VFSB 5D1ZB 2FJHA 1G7PB 2VAAA 1N6VA 3QUYA 4G8GE 5E4EB 3ARED 2B0SH 1FJ1A 5ESQA 4HFUH 4K3EL 2ADFH 4K71C 2X4TB 1DVFD 1I3RB 4HK3N 5JDSB 3ZDYE 4KJYB 4N8CH 1HIML 5F21B 4KRMB 4IOFD 4Y19D 1R3JB 4O4YL 5SX4I 4KHXH 2GKIA 2HLAA 3LH2L 3L1OL 5EA0H 5IJVB 1FFNA 3S36L 5JW4Q 1EEZB 3QRFM 3SDAD 5L88H 3ARPA 3I6LD 3P77B 2VN7A 4HKXA 4ELKB 4Y5XC 3ARDD 1BQHA 4OQ1A 4S1DC 3TEUA 4I18A 2BVUA 3VXME 3RBGA 2GIYA 3FMGL 3P0YL 4H1LG 1RURL 2Z8WC 4PY7A 1BIIA 3O3EA 4YHKH 1OAXL 2XZQH 4ONFH 5LKNA 5F97E 2YPKB 4G9FA 1YMMD 4DKEL 5CJOH 2X6MA 5E6IB 3LOWA 3BZ4B 1CG9A 2WWMC 3D3VB 2YEZA 3SBWC 1A2YA 3FB5B 1FG9C 1S3KH 4YXHL 2G5BA 3TNNB 4JRYD 5EZOL 4QO1A 2VLRA 2DQDH 3FQTA 3L7EB 3PHOA 1YC7A 2FHFA 3DX9B 3WIIH 5HHOA 4X6BA 3VG0H 1S5IH 3SO5A 3EOTH 4G3YL 3MNWB 1JGLL 5E00A 3N1FC 2IANA 1P7HL 3L5IA 1TQCC 4BZ1L 4JPWL 4Y19E 2XG5A 3ARRA 4QRTB 1CTOA 5CZVH 3QUXD 1FAIL 3IF1A 5MP6H 4ZMAT 3I50L 4QRQB 5I8CA 2G2RB 5IQ9B 2GJ6E 3CU1A 1IL1B 1SBSL 4Z7QE 4KTDH 5MEQB 3CFCL 4GKNB 1R5WA 1P4LA 1QBMH 1KG0B 3D6GA 3LPFA 3LV3A 4MSWA 3PHSA 2E5EA 4QTHB 3G6JB 4D0DB 3OTTA 4HFWB 1UM4H 4S1QH 3MPCA 1N5AB 1PSKH 4XCFL 4I48A 2VQTA 4I3RL 1A5FL 4JHBA 4D3CL 3O2VH 3EJZD 4TSAH 2X4PB 3VWKA 3VGEA 2YD2A 3SHSA 5KS9B 1PX3A 4Q6IC 2R1YA 4NQDD 2Y5TB 3RDTC 5FF6B 3D39B 3KPRE 4JQVA 3QNYA 1Z3GH 1FGNH 4Q0XH 3U30B 5DMIH 2AXGA 4LQFL 2UZIH 4DGIH 5BVPH 4KZEL 3VRIB 4H5SB 3EYFB 1OGTB 4CVXB 1J87A 2DBLH 3EJYC 1EAJA 3FQRA 3F5WB 2DQTL 3P4NB 5GIRA 3F58L 3O81A 3BH8B 5HYSB 4HIIB 4XBGA 3C2SA 5D1XD 4PRPD 2DKMA 1RUPL 4XVUC 8FABA 3TO2B 1KTKE 4OSUH 3RGVB 2Y6SD 2CLVB 4HDIB 2ICWJ 2LFGA 4Y2DA 2R39A 4LCIH 3ZHLA 1UENA 4O2EB 4DGYL 4OF7A 3BMWA 5HD8C 3GSRA 2R2HA 4U1KA 3S7GA 4EIGB 1QZ1A 1ZS8B 5KSBE 2AAVA 1EO8H 2GY7B 2AJZA 2F19H 1N6QL 5DMYA 5HGAA 2P47B 2D03L 4X7TA 5LGKA 3UPRB 4BH7A 4TOYL 4XNZC 4Z78B 5ADOH 4ODVL 4MCZB 4X4MA 3MLUH 2XN9B 5JA9A 4XVSL 3I3BA 1DANU 3NFSH 5HHPA 3VJ6B 3GI8L 4EI6B 3M1BA 4Y4FC 1YEHH 3DTXA 5D2NE 3DXAA 1KJMA 4D9QE 1EHAA 3IDYB 4XNMA 2A9MH 1NGZA 1CFSA 3QHFH 4KVNH 5LAXA 4ZFOL 4XMLL 2NY3D 4PJEA 1OOAA 5GISH 4Q6YA 1S5HA 3GBML 1H3PH 4OLYH 3MMEB 3RZCB 5DJ2B 2ZUQB 5F89A 4PR5B 4GBXD 4HSQA 1UQSA 4JM2D 2VISB 4HK0B 4EXPX 2D31B 5F9JA 1HI6B 4D0BB 5DD1H 1YNTA 1ZGLM 1E28A 3OR7B 4XX1E 4ZYKB 4ENEC 3REVA 1IEBB 2EKJA 4Y5VB 4M3KB 3OKEA 2VDNH 4QHMB 3ARVA 3EDDA 3FO2B 3K8MA 2EDQA 1W72L 2NY4C 5E8NA 2FRGP 1EH9A 4OM0H 4KV5F 4MX7B 4JANB 4YHZL 4L29A 1ZLUH 3L9RA 3MV9D 2CXKA 1OTUD 3NIGF 1JE6A 4NKMA 3ARTA 1R3KB 1AO7D 4R7DB 2OP4L 4JLRB 1OHQA 1X5XA 5DC4B 2VL4A 1QO3B 1T04B 3PDOA 1LP9A 3P4MA 2OL3A 3WSQL 1TVBA 1Z5LA 5L2KA 3T0WA 1TPXB 5IMKB 2K3TA 2AQ1A 4HXBL 4JO2L 1QSFB 3C5ZA 1M4KA 4OGAC 4U1GB 3STLA 3C5SA 4FFVD 4Y16C 5DJXA 5IQ7H 1I9IH 1XR9B 1IAIH 3BFOA 2IAMB 3N85H 4IRSD 2WLZA 4Z95H 1E4KC 4Z5RA 5D5ME 4V1DD 2HFGL 5FV1L 1AGEA 4NHUA 1JL8A 1KCSH 3F65A 4LRNL 3IKCA 4WGVB 4OAWA 3SDDA 2CRZA 3N9GH 3QEUA 3LS4L 3VGDA 2JB6A 3N06B 4BFIA 4Q9RL 4TSCL 4ZDHB 4OZHB 5C0BB 2FD6H 2DDQL 1XF4A 1K4DB 1D9KB 2G5RA 5HY9A 5EO1B 2GUOB 4M6OL 3HLAB 3QFJA 5IB2A 1EEUA 2E8YA 3HC0B 1WZ1H 5D7LB 2QSVA 3CU7A 1WITA 4HBCL 4XWGL 3MLWL 3STBA 1D5BB 3QIUA 3OG4B 4WI3A 1AY1L 2FECL 1F3JB 3O0RL 5F96L 3GJFB 4HEME 3GRWL 5IVZB 4L4TB 3RWFA 4ZAKA 5GRXG 1BVKB 2W9DH 4GW4B 4YHOH 3LZFH 3BKJH 4FQIH 2XT1B 2VO5A 2ICCA 3PABA 3L7FA 4PYHA 3H3BC 5EB9A 4FA8A 4IBLT 4M7LL 1QLEL 3MGTB 1CDIA 1FFOA 4NZJA 3QNZB 4UDUA 4KVCH 4V1DE 4NKDA 4P2RA 3IDMB 4IIQC 4X0KA 4MJ5A 4AMKH 3WFZA 3RUGE 1AD9A 1UCBL 3U7WL 1FNFA 1MAMH 5DMKB 4ZNEE 4WWKA 1T1XA 4PJ7B 4N5UA 3LHPL 4PB9H 3DBXA 2EYTB 1CL7I 2GITA 4ZD3L 5MENA 4L9LB 5HHMD 2V2XA 4KK6D 1CR9L 3RA7L 2EDLA 5EU3B 5I1KH 4MMXC 1IGYB 2R29L 1QHPA 3SKMA 1H3GA 3QI9D 2C3GA 1MI5A 1U91B 2GI7A 4RWHA 1EJOH 1U3YA 5KOVC 1MIEH 4BK5A 1MPAL 4W81A 1UXWB 4JFZL 5DI8B 4JJ5B 2NXZB 3FFCB 2F53A 4TTDD 4KZDH 2DLHA 1MREL 3BP7A 3UXFA 5M94B 4EI5D 1YEKL 2EXWC 3L3IB 2FWOB 3DI2B 4M6AA 1FNSH 3MQIA 5GS1C 3EZJB 3MJ8B 4BQBA 2DRUA 3IDXL 4HKZA 1KV3A 2F8OA 5C08A 1WAAA 3VXUB 1JV5A 2R8SH 4JQXC 3PGDA 3V4UL 5E2TL 1RZJC 1XGQB 1ZXQA 5E5MB 5DJAA 4NN6C 3JWOC 1U36A 1S7VA 4YLQT 3NAAH 5LGHL 1FO0H 5DJ8A 4XMPL 3UDWC 4YX2L 4AM0B 4F33B 7CGTA 4NRXA 4R97B 3CFDA 3R4DA 4JKMA 3I6KA 5TGBB 1KCVL 3VDAA 4I0KA 3KDMA 3TO4B 5B4MC 3OZ9L 3QIWA 2EIZB 4OI8A 1BFTA 1RK1A 2OZ4H 3INUH 5A2LH 1S7SA 3QRGL 3UZVB 2Y5EA 4K23H 4PJCB 5J13C 4UTAL 3CFEA 5EU5B 3ZZ1A 3HS0A 2PYFA 4P3CL 4F7MB 2QBWA 1NBZA 4M7ZC 3MLVL 1M7IB 3RTQA 3DSFH 2DIJA 2P5EA 3HNTL 3O6FA 3MLSL 1CT8B 3RY6A 4NUGH 1RZFH 4X9GA 4P48A 4I3SL 4AYFA 1G7IB 3HN3A 4S1SL 2VXTL 1BD2E 1QYGH 3L5HA 4QRSB 5DJYB 1RHFA 1L6ZA 1IGML 1GGBH 3QWQB 1S9VB 1CD9B 3LEVL 1I8MB 3JWDH 1BFOA 1OTTD 2EDFA 2ORBH 1NLBH 4PFEA 1LO0L 1Q8MA 3QDGA 3RX8A 2YKLH 4KJWD 1GIGL 4PJBF 1X6NA 1U93B 3QQ3A 1EFXA 4YDLC 4X4XA 1QBLH 1OY3B 1QSVA 2I9LB 3HMWH 4ODUA 2DQUL 4LCUB 4Y4KD 3JV6B 4KDTA 4WTWA 3GMRA 4LBEB 4OLWH 3MRRA 4MAYC