4NJ9H

Crystal structure of fab 8b10 in complex with mpts
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
217
Chain Sequence
EVQLQQSGPELVKPGTSVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIGYIYPNNGGNGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARRGGYGSRGYFDVWGTGTTVTVSSAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 8B10 light chain
publication title Adaptive Mutations Alter Antibody Structure and Dynamics during Affinity Maturation.
pubmed doi rcsb
total genus 42
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nj9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nj9H02
3WD5H 1IM9D 5B38G 2WW8A 3MRLA 3T65A 4Q6YA 1WC7A 3IJHB 5I8KH 5DK2A 2AJSL 2HT2D 3O2DL 3RUGE 3CLFL 4Z7WB 4BQ8A 4M43L 3EO9L 1JHKH 4ENED 3RNQA 4IIQA 4MNGB 1MIML 1NMBL 5CJOL 5DA0B 4RFNC 3T4AB 3VI3E 5FCUL 5LGHL 3S35X 3DMMA 1SM3L 1BGXL 2GK0B 3WSQH 3O9WC 1KPRB 5EOQL 4WUUD 1WITA 2BY3A 5F1NA 4CVXA 3RTQB 2QV2A 4AY0A 3QIBC 2MQCA 3GMNA 5CJXC 4D9LL 5HHPA 1CFTA 1KB5B 8FABA 3U30B 1U9KA 2BNUB 1IGFL 1JWUA 1KN4L 4K23L 4DN4H 1Z0MA 4HKZB 4L5FL 1QNZH 1J8KA 1CLYL 1FYTA 1KB5H 3BZEB 2MHAB 1MLCB 5JIPA 4NQVB 1ERNA 3IDXL 3O3EA 4EZMA 1QRND 1U8QA 4V2CB 1GIGL 4ZUUA 2X9XA 3EOTH 4H25B 4HS6B 3LKPB 4LMQE 4NJAL 3S5LA 5KSVA 3MREA 2D31A 5HI5D 1HHIB 4Y4KC 1A6ZA 4ZPVA 1YEDA 5DJ0B 1ZGLP 3C6LB 2FJGB 2VDQH 1BX2B 2J8UE 4PTUB 1QPXA 1T5XB 2IH3B 2QQQA 4U1LA 4G6ML 1VEOA 5CEYB 4GBXC 1F3DH 3T2NH 4JFHD 4NQCE 2CIIB 3MV7A 3UYRH 4HK3J 2VYRE 4HIEB 4WUKL 4PJ7E 3WFDH 5I30L 2CLZB 5I0ZA 4D0DB 4CKVX 2PYED 4XB7A 5J13C 3GBNL 4HV8A 2NY3B 1SEQH 2R0KH 3P30L 5IB2A 1NBVL 2JCCF 4P4RA 1CDCA 5TPWL 1WIUA 1LK2B 3F62A 3O3AB 5KG9B 1J1PH 4JFQB 3TA3C 1K4CB 2HFGH 3VD5A 4JVWA 1DUZB 1NUFA 3NABL 1H3PH 3VXSE 3SE8L 4P2QB 3S96B 3MRFA 4ZQKB 3WFEL 4PJFB 1ED3A 2YEZB 1INDL 3H6JA 2HTKD 3EYOB 2YUZA 4I0PC 5C0RL 4Y2DC 1AGDB 5L2KE 1QVOB 4KI5D 4YBQD 4MGXA 5D7LD 5F88A 1BQUA 4P9ML 3VFGL 3GUTA 3G5XB 1UA6H 1D5ZA 4YBHA 3LQMA 5FB8B 5IVNA 1B4JL 1S7SB 3NIGE 4CMMA 4MJ6A 4MS8D 3U46A 2CRYA 4O9HH 4YZFE 1P4LA 4PJ8B 2GKIA 3OTTA 2YA0A 2VC2L 5J8OA 1F11A 4JN2A 1FVDB 2DLTA 4Q0XH 4Y16B 3HCVB 3TN0B 5HHOB 5HGGS 1CLOH 1FC1A 1F4XL 4KAQH 1WV7T 5EA0H 4R9HA 3RA7H 4OAWA 3QNXA 3MLRH 4K7FA 1SY6H 1B88A 3QDGA 4HCRA 1I1FB 2LU7A 3SOBH 1NCDH 4PGBB 5LGKA 2L4OA 2VKXA 2AQ3A 1XF5A 1KIQA 2ZCLH 3WNLA 4I5BA 3K7UA 4UT7H 4OFPA 3RVTC 5EZLB 2IPTL 4LBEB 2VZTA 3O0RL 1HCVA 3D6GA 4F57H 4PJHE 5FGBA 4F33A 1ZLVH 4M7JL 1HEZB 1NBZB 5KVEH 3NN8B 5CUSL 1C5BL 2R2BA 3EO0B 4QNPE 1YEHH 3MLUH 4X9BA 1CFQA 3E3QC 1NL0H 2NY5H 4LQFH 5E03A 5EU6B 2CPCA 2YZ8A 4YC2B 5CLWA 3TYGH 2JJSC 5ESVA 3ULUC 1NEZG 1X4ZA 1DQJA 5D6DA 4OLEA 4R4BB 4YPJA 5CZXD 1ZHBA 1P5UA 1MRDH 1KXTB 4N0FB 4IRSB 5JPNA 1A6WH 4ONGH 5ICZB 4UNTA 1CDUA 2KKQA 5TQ2L 4GG6B 3SO3B 3BP5A 5E6ZA 3LDBB 1DBJL 2FSEA 5F9OL 5EZOL 4P5TA 2AJSH 1MWAA 3O2DH 4F9PA 4PIRF 3CLFH 4NKOB 3SDAD 2P44B 1INQA 3VFMA 3WJLA 4J4PC 4M43H 3EO9H 3L3OB 4KUCD 3M1BB 1QLFB 4LLQB 1G9MC 1MIMH 1NMBH 5CJOH 5LGHH 5FCUH 3QDAA 1SM3H 1BGXH 3BESR 1KEGL 1L7TL 3BMVA 5EOQH 3QHZL 5JHDB 3O4LE 1CFVL 5JDJA 1C12B 1MJ8L 2H9GA 5FA3A 4TVPE 4D9LH 5IM7B 1IGCL 3MUHL 1UJ3A 5F7NC 3D3VE 1IGFH 1KN4H 4M00A 3WLBB 4K23H 4L5FH 2VLKA 2Y25A 3M45A 1CLYH 3KJ6L 2DKUA 3QEGL 5DFVD 3IDXH 4NZTL 3QPXL 1EX0A 2GJ6D 2JJVA 5HVHC 3G6AB 1NKRA 1GIGH 4LKXA 4X8XA 3E6FB 4X98B 4LEOA 4NJAH 1RJLA 5D71L 2QKIB 1MELA 4KDTA 4OCMC 4LLVB 1HH6A 5DJAA 3PWVA 4CN4A 2EE3A 4UAOC 4JM2F 1BVZA 2R1XA 4OD1L 4N8VA 4HUWB 4L8DB 3CSPA 3BE1L 4G6MH 2A0LD 2VSCA 5AG9A 3RZCA 4UB0L 3B8YA 1OW0C 4G9FD 1HNFA 5IQ7L 4WUKH 4Z7UB 4MCZB 5I30H 5FYJE 4LSSL 5CIPB 3LKQA 2V2XB 2UWEB 3GBNH 4HJJL 3HG1D 5DVNA 1ZT4B 3P30H 4WTZG 4LQ1A 4TNVK 3RWHB 1NBVH 3T08A 4HFWB 5TPWH 3T1WA 5IFJB 5CIPH 5GSRB 1RULL 4RAHA 5D1ZD 5GS2H 3C09B 4AQOA 3NABH 3PWNB 5KZCB 1DEEA 5EH1A 3SE8H 1T1YA 1DSFL 3ULUL 3WFEH 3UTZA 2B2XL 1INDH 4XWGL 5C0RH 4N0UA 5KSBB 4F7CB 5DGQA 4NFDA 1KULA 1KJ2A 4P9MH 4XT1C 3VFGH 1B4JH 4LDEB 1XGPB 4JRXD 2W59A 4L9LA 2VC2H 4G3YL 5C9JA 1R5IB 2C3VA 2IEPA 1FZOA 1F4XH 1IAOA 1WTGT 1F58L 1S8DB 4ODBD 3QXVA 1D5MA 2G75B 3QZWA 2NW2A 4OV5B 2NTSP 1XF1A 3DYMA 4RQQB 5E2UL 1T7YA 5DXWA 5DUBA 4PYHA 5DJ6B 3AU1A 1OARL 1YY8B 4U1SA 2ADGA 3AS1A 3BYYA 1KIRA 1M6OA 2F8OA 2IPTH 5CMAB 3UTPE 4ORGA 1NFIA 3V9FA 4HZLB 1MCRA 4Y1AE 3DUSA 4OLUL 4M7JH 5E1AB 5CUSH 1C5BH 2FEDD 2CDEA 3VA2C 3IXTA 3BH9B 4E0RA 5F7UA 4OZHF 1ZSDA 4XAWL 4LPVA 4KKLC 3ZE1F 1G7MA 1U8KA 4PJEE 5GGRY 5GRWA 4K94C 5E8PB 5I1HL 4OM0L 5DR5L 3IT8D 4ZFOB 3VXTB 4UOW0 4RIRA 5HHQB 3MA7A 2FX9L 2GTZA 4PRPD 1NC2D 2UY7A 3X12A 5GSVA 3WE6A 4DUVA 3U6RB 5TQ2H 5FKPB 5EULV 1BZ9B 4RRPG 3DRQB 5AZ2L 1DBJH 5F9OH 1AKJB 5EZOH 2OR7A 3CDGA 4TSCL 4D0CA 5IEKB 4LCYB 1G9NC 1VGKA 3S36L 1YY9C 3X14B 2DQEL 1IEAA 3VFOA 5J7CC 5A2JH 2DLEA 2Z35A 1EHNA 5KN5B 3G5VB 2X4QA 3R06A 4UIKL 4L4TD 3ARSA 3WKNA 3MR9A 3QUMA 1KTDB 3BPNB 3DIFB 2AGJL 3T4YA 1KEGH 5I0DA 5DTFB 1L7TH 3EJZD 3KLDA 3QHZH 1RHHB 2GJJA 1CFVH 2E6QA 4HHAB 1MJ8H 3VXUB 3CX2A 4OGXL 4OCLC 2CDGA 1IGCH 3INUL 3WL9B 4PYGA 1GC1C 3QI9A 2X7LA 5GRVL 5MENA 2AEPL 2OR9L 4NKIL 2FHBA 4U1KA 1I9RL 3OMZA 4I18C 4LNRB 32C2A 2Z31D 4FQHB 3KJ6H 5FIEA 4X4MA 4HIJA 1NFDB 5FOBA 3QEGH 1XR9B 1G7JB 3LAFA 4HAFA 5HXMA 3GSQB 5IJVA 4NZTH 1N6QL 4OZFA 3QPXH 1SJEA 3OV6A 4P5MA 4PJIF 1VKXB 1GL4B 5D71H 4FFVD 3BQUC 4YH6A 1XCTB 2BNRB 4OD1H 2DKSA 3RIAF 5E56A 4FQXD 5GGTL 3STBA 4YO0A 4P2RA 3BE1H 3FB7B 3IJYB 4M6OL 5DI8A 4P5KA 2VISA 1OP3H 2NR6D 1V3KA 4JY4A 4UB0H 4ZSOE 3BJLA 4NNXB 1XZ0A 5IQ7H 3FTGA 4KK9D 4LSSH 1WAAE 1FC2D 1UQSA 5BVJA 5IW1A 2IANA 4HJJH 1FZMB 2IAMA 5HYSA 1JRHI 4LCWD 4PRHA 4W4OC 3VI4E 2AI0L 1AGEA 1KPVB 1R3IL 1BVKA 1D5XA 3CD4A 1RULH 2R56L 1YDPB 3AS0A 4LVOC 4OKDA 1CGWA 3IDNA 3AXLA 2EYRB 4EEEA 4KRLB 2ZZUT 3C5ZA 2J88L 2F9BT 4Y4FC 2E27L 2CMRL 4XNXL 3ULUH 1WFTA 3NA9H 4EUPB 4PJFF 4HFUL 5I19L 4XWGH 2FJHA 1QFUL 2CUIA 4MD4B 4NQTA 1E4XL 3MGTB 3WS3A 3KR3L 2G9HA 4ONFL 5IMMA 5DZOA 2H8PA 2I60L 5C0AE 1R0AL 1I1RA 4EUPH 1YC7A 3QIWA 3HR5A 1JFQL 2DQIL 1RURL 1J0HA 1J12A 2EEBA 2HJFA 4G3YH 4M93B 5HYJD 4YHIA 1XGQB 4X99B 1G9NL 1IL1A 4C56B 1F58H 4HCRL 2ERJC 4HJ0C 5GZOC 3VFSB 2JELL 1MI5B 5F44A 4EUPG 3HE7A 1S7RB 5E2UH 2OTUA 3K80A 1IKNC 3RWGA 3CFJA 3P3YA 2AKRB 2F54E 4YK4C 5DJXA 3F7YB 3U36A 1OARH 4X8JB 4Z7VB 1YEIH 2N7AA 1JYVA 2FZ3B 2FYYA 4EI5D 1FAKT 4LVNB 2H41A 4OLUH 2ATKA 4JFED 5EBWA 4JFDE 3JWOC 2MWCA 1EO7A 4YFLI 5C0NC 3QRFM 3BP6A 4XAWH 4LK4A 3I6GB 3W39B 5I1LA 3VXME 5FUCE 3MRLB 3BWUC 3T65B 5J3HD 3LN5A 2MSPA 1WC7B 5I1HH 4OM0H 3CFIC 5DR5H 4JY6A 3V7AE 1OT2A 3QUZC 4NO3A 4OUOA 5DK2B 3QFJD 2FX9H 3FZUC 4K8RL 3QIUD 1NGQL 2VJXA 5T1LA 2C4XA 4MAYA 1CDBA 3GSUA 3RNQB 4APQA 1NGPL 3NCFB 1EGJL 4IIQB 3EIFA 5AZ2H 3DMMB 1MWAL 5JW5A 1KB9K 1EXUA 4TSCH 3O3DA 4URTB 5F1NB 2DMBA 1LO3L 1NMAL 4FZEL 1OLLA 3S36H 2DQEH 3GMNB 4OZ4A 4JKLA 5HHPB 1EEQA 1N8ZA 4UIKH 8FABB 1QPPA 3ZYOA 4LHQB 2A6DA 4ELKA 1YEFL 2AGJH 1V7NL 1N59B 4QHKJ 3TO4D 5EPMA 5F96H 1FYTB 3CXDL 3FFCA 4OGXH 3V6OA 1V3MA 3INUH 3O3EB 4K7PY 5LGJA 2XV6B 5D1XB 2ESVA 2VUYA 1Z5LA 1U8QB 2AEPH 2OR9H 4NKIH 4G7VL 1AHWA 1I9RH 2D0HA 2BVPA 2O5XL 3S5LB 5KSVB 3MREB 2D31B 1F4YL 5FM5M 3NCMA 1A6ZB 4ZPVB 1U91A 1A21A 1NDGA 4PJXE 3MLZL 1YJDC 5TJWK 1N6QH 4R2GB 4U1LB 1JI2A 3WNMA 4KROB 5T5FL 3MV7B 4OCXL 5IVZA 2E3VA 3RDTC 3ARUA 4LHJB 4JFFD 1XF4A 4ZXBB 4L29A 5CILL 3PL6C 2OSLA 4M7LL 5GGTH 3G6JF 5D7JC 5SWZD 1OCWL 4M6OH 3MJGX 5IB2B 4P4RB 3S5LG 1WT5C 3OKLA 3SDXB 4PJAA 3VXRD 3LEVL 4F9LC 4N9OB 3QNYA 2V5TA 5I15L 3HFML 1OB1B 1G7HA 2AJVL 3SCMC 2AI0H 1R3IH 3MRFB 1ED3B 4O51A 3OHXA 5GZNC 5ID0B 3DVGA 1XFPA 2R56H 1CDIA 4B41A 1KTRL 3VCLA 3KPOA 2NMSA 5F88B 3GUTB 1D5ZB 4HGMA 4I4WA 4J3XA 4BZYA 3BRGC 4CMMB 2BC4A 3FOLA 2J88H 4MJ6B 3VJ6A 2E27H 2CMRH 4XNXH 3WUWB 3FQWA 4HW6A 2P42B 4HFUH 5I19H 1F11B 1QFUH 4JN2B 1E4XH 4X9IA 1KJ2L 4K2UL 3KR3H 1II4E 4MX7A 4ONFH 3PQYA 4AM0B 5KBNC 4OAWB 2Q7NA 4XTRC 2I60H 1H3UA 4K7FB 1R0AH 3QDGB 4I3SH 1JFQH 4ACPA 2DQIH 1RURH 1XF5B 1KIQB 2A74A 4Z7QF 5EU4A 4P49A 4JO4L 2EDNA 4I5BB 4JPVL 5D1QD 1G9NH 2FR4A 4KTYA 3QJHB 5DRWA 4S0TD 3UBXI 4HCRH 3BP7B 4LU5H 2JELH 1GGCL 2W1NA 4OFKA 4I2XB 3G6JA 4F33B 1CD9B 2CDFA 2R2BB 4MD5A 4PUBH 3FN0L 2BXZA 4H1LA 2C4FU 4HLZG 3ZYZA 1CFQB 2VERN 5FO7A 4HF5L 1CT8A 5JXAL 3IAQA 5ESVB 4O2CA 5I1CL 1DQJB 3KHOA 3L3HB 1ZHBB 2CKBL 3SDDC 5IHZA 3IS0X 3CH1A 2VQTA 5JPNB 4J3TA 1FL5A 1ZLWK 4WI5A 4JKMA 1OTTC 1WWWX 3CFBA 1U92A 3BP5B 3DROA 4WFEE 3TVMD 4ZOBA 3TZVA 1MWAB 2VLJD 4K8RH 3Q2CA 1Z3GL 1INQB 1NGQH 2BRRL 3VFMB 3RY6C 3QWQB 3BYTA 4W6YB 4Z76A 2YC1B 1U3HD 3PWPA 4CNIA 4JPIA 1NGPH 3TLRA 1EGJH 3PG2A 1MWAH 5F6HJ 1EO5A 3IU4L 4ZAKA 3GJFH 3TP4A 1LO3H 1NMAH 4FZEH 4I77L 1SMAA 2H9GB 1GGBL 5FA3B 2C3GA 1MHCA 3BKCL 3RGVA 1X6LA 1RFDL 3M17A 1UJ3B 5BZWA 5DQJA 4OI8A 1YEFH 1V7NH 4NN5C 2VLKB 4O00A 1ZS8A 1N7ML 4DTGL 2EC9U 3GSNL 2ZUSA 1E4KC 3CXDH 5ESQB 1W72A 2ZUQB 5F72S 3EFFA 3MRRA 3WNKA 5D7IF 4LKXB 1CFSA 1MCWW 4LEOB 1FG2A 1RJLB 3MJ7A 4G7VH 2O5XH 4OZGE 5IR1A 5ICXB 1HH6B 1F4YH 3PWVB 2ZUVA 5I2IB 2R1XB 4XBEL 4M7LT 3MLZH 4N8VB 5JOFA 3WCYA 4XZUA 2AERT 1H9VA 5KOVC 3RZCB 5T5FH 3RTQD 4OCXH 4MXVE 5GRZA 2DDQL 2WWMC 1F42A 2P5WA 5BS0A 3LKQB 1F4HA 4M7LH 4YK4B 1OCWH 1GYAA 1SMOA 2YK1L 3ETBF 3PGFL 1K2DA 4ZDHA 1PD6A 3WFCL 4MMZC 4LHUA 5I9QC 4RA0C 4LLUA 4N8VG 3O8XA 4G8IA 1NGYB 2KPNA 3MXVL 1A1NA 4MWFA 3HFMH 5I15H 4BZ1L 1DEEB 2AJVH 1T1YB 2Q76A 3UTZB 3CGTA 1RIVL 2Q1EA 4LIQL 2N1KA 3ULUF 1U8NB 3N0PB 3C6LD 4N0UB 1QOKA 4N8CL 5C0CA 1KJ2B 4PBWD 2P5EA 5DVLA 4QHUA 1ZK9A 5F97E 4WW1A 1WZ1L 5E4EB 5BOZG 1T22B 1VSCA 3BPCA 5C71A 1NBYA 5C9JB 1EERB 4R26L 2X4PB 3HC3L 1KJ2H 4QRSA 5ADPL 4JDZA 4K2UH 1FZOB 2XRAL 1IAOB 3G08B 2OR8A 2NY3D 3WO3B 4X7FC 1XAUA 1D5MB 1MVFA 3QZWB 1J8HE 3QG7L 3GSVA 2YRPA 4OBSA 1FVCA 1JTPA 2ZG1A 1ZVSA 5DUBB 2AK4A 4JO4H 5T1KA 4FQ2L 1JE6A 4JPVH 5AEAA 5C6WH 3AU1B 4OBRA 4NM8L 4U1SB 2ADGB 5DURD 2Y6SC 4U1GC 1M6OB 5KAQF 2CK0L 4ORGB 1NFIB 4P2QD 3RBGA 1GGCH 2NY1C 4M3JA 4KRPB 2QQNL 3DUSB 4PRIE 4L8SC 1FZKA 1OGAA 3DXAB 2OL3L 4GQPH 3FN0H 4OCSL 4KI5E 1Q94A 2CDEB 2WNGA 4L4VA 2DWEA 1CVRA 2CKBB 5D7LE 4E0RB 4QGTA 3NBNA 4HF5H 3HUJA 4NHUA 5JXAH 4MXQC 4P46C 3QZWG 1DVFC 1G7MB 3VG0L 1U8KB 4PJ8D 3T0XA 3QULA 4AT6A 5I1CH 5GHWL 3MA7B 2CKBH 4Y16D 4W6XB 5HHOD 3TN0D 1SJXA 3KPQA 1ND0B 4DEPC 3WN5A 5ICYA 1U3ZA 2JJSA 3X12B 5GSVB 3WE6B 2AXFA 4UOW1 5F7EL 1JYWA 4YBLB 4BQCA 3CDGB 3RIFK 4D0CB 2CGRL 1Z3GH 1VGKB 2BRRH 2F53E 3EYQD 1IEAB 3VFOB 2Z35B 4ZMAT 2Q3ZA 2D9CA 2PKDA 5JUEL 5CFHA 2EDKA 3R06B 5LG1A 5EUOB 3IDMA 3MR9B 3QUMB 4GFTB 4G8GA 3SE3A 3T4YB 2B20A 3IU4H 1B2WL 4U31A 4LOUD 5FYKL 2XQYK 1G7IA 2WV3A 2NNAA 1S9WA 1F5WA 2L7UA 5EU6D 1GGBH 2BVYA 2CDGB 2X10A 2AJYL 3BKCH 3VFRA 3ZHDA 3K4AA 3DSFL 1RFDH 1UXWA 3QI9B 1S7VA 5MENB 2Q20A 5F1OB 2EDYA 1U58A 4GXUM 4O4YL 4FXGB 4U1KB 4WCYL 3ULVH 4IRSD 3SGKA 1N7MH 4DTGH 3GSNH 3V0WL 5FOBB 2MNUA 1UWGL 1DE4A 5CEZE 3TO2A 5IJVB 3CC5B 5INCA 4OZFB 1SJEB 3B9EA 2DJ4A 2WMPA 4YDVA 3W0WA 3BDYL 4P5MB 3ZHKA 2XTLA 3QUYC 4N9GA 3QPQC 3MZGB 3MFGB 2WINA 3U9PL 2EDFA 4XBEH 4OZFH 5D2NC 2FEEL 1WFUA 1WZLA 4LRNL 4JB9L 4YO0B 4P2RB 4CUCA 4P5KB 4HKXA 2IQAA 1EBAA 1WJ3A 5JHDD 2M26A 4JY4B 2DDQH 1XZ0B 2NLJA 3FTGB 5BVJB 1UQSB 2IGFL 5IW1B 2IANB 3QNZA 5DK0A 3V5DA 1JGLL 2IAMB 4L9DA 3GJEA 5HYSB 1HHGB 4LSVL 4PRHB 1I3UA 2DTML 1AGEB 2YK1H 3SKNB 1BFOB 3RWEA 1BVKB 1D5XB 5ADOL 3PGFH 1OQXA 3WFCH 1MQ8A 1UKQA 4U3CA 2GJ6E 3AXLB 3IDNB 3MXVH 3FO0L 3C5ZB 4BZ1H 4NZDA 4OGAD 1RIVH 4LIQH 2FJHB 3ZKQD 3SEPA 4TRPL 4P23A 3VFPA 1TTUA 1X5KA 3WS3B 4BM7A 4N8CH 2G9HB 5IMMB 5HYSG 5GGVY 1LE9A 1WZ1H 4HK0A 3SN6N 5F7DA 3QIWB 3HR5B 4YGVA 1JPST 4G9FE 2YD9A 4EI6A 1WGOA 3DI2B 2HP4A 4R26H 4YHIB 1MCEA 2J8HA 4LPCA 3HC3H 2IH1A 1GGYA 4PJ5E 3VFTA 5ADPH 4E5XA 4OQ1A 4FXLA 1WFOA 5ANMA 1IL1B 2XRAH 3HG1E 5GS2D 3SKMA 3QG7H 4ZUWA 3LD8B 4UQ2A 1OTUD 3HE7B 2OTUB 3RWGB 3CFJB 3KG5A 1BAFL 3BZ4A 4NN5B 4FQ2H 5DJXB 3U36B 2OL3B 4HUMB 4NM8H 1KCSL 3QWOB 4U6HA 2BSTA 3VG9C 5L0QC 5KZCD 2CK0H 4M1CD 2FYYB 3O41A 1F6LL 3P0YL 2QQNH 4NCC2 2ATKB 3QXAA 2OL3H 4OCSH 4U1MA 1M7IA 2X1QA 2IBZY 1GGUA 1EV2E 3KPPA 3BP6B 2RR3A 4JRXE 5IROA 4PJ9A 5I1LB 2BX5A 3VG0H 4IOSD 3NCEB 1MJ7L 3LN5B 2JIXA 5F21B 5DDHA 5B8CC 4JY6B 4JRWA 4NO3B 5GHWH 5FYJU 2EDOA 3ZMRA 2HT4D 4QOKB 3VD7A 4MMXC 3UXFA 5T1LB 3E2HC 3QIBD 4MAYB 4PJBE 3GSUB 4RISL 3ZT5A 5F7EH 4APQB 1BFSA 2NZIA 4X9GA 1RUKL 1CYGA 4Q97A 3D0LA 4UV7L 3W82A 2VAJA 2WBWB 1JZ8A 3O3DB 1FNHA 2CGRH 3HR6A 1LO2H 2ZUWA 5FECA 3LHPL 2YRLA 1Z9OA 3BO8A 4E9LA 9CGTA 4OZ4B 35C8L 5JUEH 1N8ZB 4NZRH 2FX8L 3BJ91 3OAYK 2A6DB 4ELKB 3VGAC 1JZ6A 4IEFB 5FYKH 5LBSL 3ILQC 5EPMB 4MQSB 2AJZA 5HYIA 3FFCB 2AJYH 1GCFA 3X11A 3DSFH 5LGJB 2ESVB 5DD3L 5MERA 4UIMA 1Z5LB 1L9NA 4IRZL 4GAGL 3E6HA 1QSZA 4O4YH 4WCYH 4PRPE 1AHWB 5D6CA 2EXYD 3QHTC 5JIKA 1W72L 3V0WH 4NBZB 4LAJH 1NDGB 1UWGH 3S37X 2IPUG 2NW3A 3WUZA 2WLZA 1AKJD 2XNAA 5JOPE 3BDYH 4G5ZL 5DC4B 1MLBA 3K81A 3QBTB 5IVZB 2MMXA 5E6IA 4L29B 1Z9MA 5IBUB 1P4BL 3U9PH 1H3VA 2OSLB 4L4TE 2DQGL 4KJWC 4LRNH 4JB9H 3OGCA 4Q9CA 1T7XA 4WI3A 5HGAA 3AUVA 2G5BA 3VXUD 4PJAB 5IHUL 1BOYA 5FHBL 1ETZA 2FD6L 2YUWA 2IGFH 3RVUD 3P73A 3QNYB 5C0DA 3REWA 1JGLH 1G7HB 2X1PA 1K3ZA 4LSVH 4R0LA 2DTMH 3O2WL 5ADOH 3SKUD 1DBML 1IGTA 1AIFA 5IBUG 4PGCB 3D2UA 1CI5A 2P1YA 3TBSA 2DQUL 2EH7L 4I4WB 1TJGL 3FO0H 1KXVC 2BC4B 3FOLB 5IVXF 1NANH 3VJ6B 4WW2C 5JW4R 5E5UB 2A6IA 5FUCC 3FQWB 4WU5B 3MRMA 4KXZH 2R2EA 4MVBC 2BNRD 4G6AC 4TRPH 1QTYT 5EO0B 3K1KC 3G04A 3RVTD 4NNYA 3GIZL 1VEPA 1ITBB 4BYHA 3B4NA 1D9KC 3BVNA 4X7TA 4HC1A 4ZO7A 4NHCL 1KELL 4S1RL 5EU7C 5EU4B 3HI1A 1OTSD 1S7QA 1YPZA 2V7HA 3CMOL 4NO0A 1A6VL 5IBLD 2FR4B 5DRWB 1XF2A 3VXQB 4M61A 3BDBA 4QHMA 5C07A 4NKQB 1TITA 2CDFB 4MD5B 1BAFH 4H1LB 2LE9A 5J06A 3E8UL 5KS9E 3BH8B 1KCSH 1AO7E 5FO7B 1AE6L 4LCCA 1CT8B 1GAFL 3HE6A 4M1DL 2DQDL 1SVZA 1IKNA 3V52L 3X3FL 1BQSA 4WHTA 3P0YH 3TBTA 4O2CB 3NCYP 3KPSA 4QRTA 4H1LH 3ZE0F 3NGBB 4Z6AT 5IHZB 4Y19A 3CFKA 3CH1B 4WHYH 4P2OC 1FL5B 2JCCE 1HQ4A 3MUY1 4KI1A 2WQRA 4P99A 2Q86A 1UM4L 4WI6A 3OX8B 3CAFA 1MJ7H 5I8CA 3CFBB 1U92B 5HYJE 3DROB 4RGMC 3MRCB 3X17A 3WLWD 3TZVB 3L5JA 3QUKA 1PGRB 4H1LG 2J4WL 4C56D 2ZUUA 4Z76B 12E8L 3N9GH 4RISH 5IB3A 3OJDA 5ERWA 1MI5D 3PWPB 4CNIB 4JPIB 4J7RA 4DGYL 4QYOA 1OVZA 1RUKH 5D96C 5B39A 4LSTL 4WNQA 4UV7H 4LDOB 2L7JA 3QQ9C 5H37G 3V2AR 3LHPH 1N0XL 2W92A 1MHCB 35C8H 3RGVB 2KZ1B 3AM8A 2FX8H 3M17B 1D3CA 5BZWB 5DQJB 1IC5L 4JFEE 3WV0A 4ONOA 1DLHA 3BGMA 5GS0D 5FO9A 4UU9A 3QEQE 2GJZB 1ZS8B 3VGEA 5LBSH 4HWEL 1EEUA 1W72B 1KB9J 1KCUL 4LLYA 3EFFB 3O2VL 3MRRB 1QFHA 5DD3H 3QFJE 4IRZH 4GAGH 3U4BL 1CFSB 3ZE2E 2VRAA 1NUGA 3MJ7B 4MAUL 3RHWK 1RSFA 1K4DA 5IR1B 1IILE 3C2AL 1KSRA 5D7KD 1EHAA 1W72H 2O93L 4IOFD 1IGYA 4GAFB 3T0DA 1MQKL 3DMMD 3NFPA 4XZUB 2HTLD 1G1CA 2BXYA 4G5ZH 5BOPA 5HGDA 5IJKC 2P49B 4XXCA 3QCVL 2P5WB 3TNNA 4HWUA 5BS0B 3VI3F 1P4BH 3HNSL 4X6DF 1OP5K 2DQGH 3UDWA 1V7ML 1U8JA 4Q6IC 2FGWL 4LP5A 3TBYA 3ARVA 4XNMA 4KK8D 4O2EB 2AAVA 4NKMA 1K2DB 2V5YA 4ZDHB 5C0BA 4LHUB 1FYTD 5IHUH 1IZJA 5FHBH 5D7JA 3O8XB 3MRBA 4G8IB 4FABL 2FD6H 5D1XD 4MWFB 3U82B 3H9SA 1KT2B 3L5IA 2DM4A 4ELMA 2Q76B 2PTTB 4OFYD 5MI0B 1TXKA 1DBMH 3BISA 3D87B 4HUVA 2XTJC 5C0CB 4N5EC 4R2GD 3VRIA 2DQUH 1K85A 2EH7H 1TJGH 4KROD 5CGTA 3BHBA 3MV7D 3BPCB 4M6AA 1NBYB 1KLFA 1X5JA 4JFFE 4ZXBD 4LHUG 3J8F7 2XPGA 4QRSB 3EYFA 4JDZB 4KKBD 4J3UA 3STZA 5SWZE 1KJVA 3GIZH 5F7WC 2P4AB 1IMHC 3GSVB 3FQNA 4NHCH 1FVCB 4PJ7F 3S6CA 1KELH 4S1RH 4L1HA 4EN3A 1E0OB 1ZVSB 4G9DA 1JWMA 2AK4B 3RUGA 3F12A 4X4ZA 5T1KB 2DIAA 3FT2B 3CMOH 3OXSA 2VABA 4EIZC 1A6VH 1QFPA 4DFHA 4MD0A 1TJHL 4LPTA 1L7IL 1JTOA 3G9VA 4V2BA 5GGRB 3O6FC 1FZKB 3OKYA 3QWRD 1KIPA 1Q94B 4L4VB 2DWEB 4IS6A 3E8UH 3ZKMD 1AE6H 3HUJB 1GAFH 2AXGA 4NHUB 4M1DH 1GZPA 2DQDH 3V52H 4LNVA 3QULB 4X7DC 3X3FH 1B3JA 1HDMB 3TC9A 4AT6B 1SBBA 4QEGA 4F7TA 3KPQB 5JMOC 2HT2C 3WN5B 5GS1C 1B4RA 3N1MC 3V4UL 3PGDA 1NFKA 3NIGF 4U6YA 4YZFF 2AXFB 3QDGD 3SDCC 4S1DD 5DGRA 5A1AA 1UM4H 4ENEC 4FOMA 3SDDA 1FFNA 1LGVA 4XX1G 1OHQA 1LEGA 2J4WH 1VADA 12E8H 2HJKA 2J8UA 4DGYH 4Y4HA 5D2LE 2YHGA 3IDMB 4LSTH 1D7FA 4G8GB 1QO3A 2B4CC 2YZ1A 4NQCA 1F02I 2BMKB 4PY8J 4XCYA 4EVNA 2VL5A 5KSAA 1G7IB 2NNAB 1S9WB 1N0XH 2CR3A 2Z8VC 5AAMA 4BH8A 3VFRB 4FTVE 5I8OL 3H7LA 4K7PL 1TTGA 3L9RA 1UXWB 3AVEA 5IFHL 1IC5H 4RGNB 1S7VB 3B2VL 1V8HA 5I66A 3O81A 3IFOA 1AGBA 3BDXA 2P8MA 4OJFL 4K8RD 3PNWA 1F4AA 1ULVA 3RNKA 5HI5C 3DVIA 4IMLA 1DE4B 3TO2B 1KCUH 3LIZL 5INCB 3O2VH 3VXSA 4YDVB 3U4BH 3RVWC 1RJYA 1YNTA 2FO1A 1PFCA 4MAUH 5ELIA 4U05A 2MQ3A 2O5ZL 3C2AH 4N9GB 4X6CF 1HINL 4XNZC 1Q9KA 2ORBL 1BBJA 2WINB 4QLRA 4ZNEE 5L2KA 4Q9RL 3L7EA 4LGSB 1MQKH 3IFNL 3D0VA 1TQCB 3NPZB 1QSFE 5KAQG 4WEBL 2H1PL 4HKXB 2IQAB 4OZHE 3C9NA 3DRTA 4YHZL 1QR1A 2NLJB 3QCVH 3BKJL 3HNSH 3W81A 3BT2L 1V7MH 3QNZB 5DK0B 2FGWH 3V5DB 2HG5A 1BJ1H 3GJEB 1G84A 3LCYA 2VLKD 2QSQA 2VXQL 3AROA 3RWEB 4YHPA 1XCQA 4IHOA 5GJTL 3VGDA 3ALXA 4F15B 2HTKC 1B0GA 4FABH 4PGDA 5ALBL 1R5WA 1HI6A 3QQ4B 4KI5C 4YBQC 4P2OB 3OXRA 4WFHD 2HKHL 1L0QA 1MF2L 4MS8C 2FH8A 4JZJC 4PJHA 1UZ6E 4OCWL 4OFIA 3ZYJA 1IC7L 4MHHG 4P23B 3U7YL 3EGSB 3IRPX 1LE9B 4HK0B 5F7DB 5SWSA 3RZCD 2FCBA 1MIEL 3MUJA 4YGVB 2ADIA 4EI6B 3JWNC 5D5MF 1BD2A 3V5HA 2AXHA 1MFCL 3C60A 2X4OA 5IOPA 2IH1B 3OF6A 1OM3L 3KJ4B 4E5XB 2VAAA 5ANMB 1X5IA 4NT6A 4P57A 3SKMB 3QB7C 4JRYA 4UQ2B 2B4CL 4IMKC 3BOVA 4PLKD 3BZ4B 5HYFA 1WZKA 1MH5A 1W2KT 3QSKB 1J1XL 1G7PA 1MCLA 4U6HB 2APXA 2BSTB 3T0AA 3ARZA 2PO6A 3LKSA 1TJHH 1L7IH 1FNGA 3O41B 4QF1A 2CO6B 3HZYA 4BFIB 3QUZD 3QXAB 4U1MB 1M7IB 3O4LA 4K55A 5CZXC 2D7OA 4PREA 4X9FA 3KPPB 4C59B 2VO5A 5EC1A 3MV11 4PJ9B 1HH9A 2P47B 3RY4A 4LKCA 1C5DA 2JIXB 4F37F 5DDHB 3D3VA 2BJML 5D7SL 4U7KA 2K7PA 2OMBA 3T3PF 1UENA 3NCCB 3V4UH 1IQWL 1R3HA 3MNZA 3V6ZA 3SDAC 3SGDH 1A5FL 5EIVA 3I84A 4XNUL 1GPOL 3DO3A 1JNNL 1UKSA 4Q6IB 3D0LB 4YX2L 4BUGA 1X7QA 1DZBA 5FECB 2AVGA 4UNUA 3BO8B 3HZMA 4P2QE 1I8IA 4PJFE 4CN1A 4KRPD 4ESKA 2BOCA 5CINL 3DXAD 1WWCA 1O5DT 1A4JA 1RY7B 3NPSB 4PFEA 1TQBB 1AGFA 2AJZB 4DQOL 5I8OH 3X11B 4K7PH 1FG9C 5DFVC 5MERB 4OCRL 4UIMB 5IFHH 3W11D 3B2VH 4MLSA 3E6HB 4AMKL 4OJFH 1UYWL 2X40A 2HFEA 5D6CB 2W91A 3RDTD 3ROLA 1JGEA 2R9HD 4PJEF 2YD6A 1R3LA 3LIZH 3MRNB 4ZFGL 3B83A 2XNAB 1U8LA 5B22A 1KTLA 4HWNA 1MLBB 2A0LC 2XKSA 2O5ZH 1HINH 3GKZA 2BP3A 2ORBH 5E6IB 3WFHA 2ICES 4Q9RH 1FFOA 3MRKA 1QHOA 3WFZA 4JGMA 3IFNH 4LLWA 3OGCB 5E9DB 2XA8L 4BSWA 4XP5L 4WEBH 2H1PH 1QP1A 5GJSL 5HGAB 4YHZH 3ULVD 2G5BB 1HHKA 4XHJD 4OF8A 2VB5A 3BKJH 1ETZB 3BT2H 4OTXL 3P73B 3QI9D 3L5HA 5D1ZC 5FKAA 5C0DB 2HMIC 2BSRA 2OJEA 3REWB 4NC2B 3ZKXC 5MEND 3QQNA 3KHQA 2VXQH 4I8DA 3V0AC 1JUFB 2CXKA 5GJTH 1IGTB 1AIFB 5EBMA 2K7QA 5IW6A 1YNKL 3AS2A 3D2UB 5ALBH 3P4NA 3NIFE 3QAZB 3TBSB 5MP6L 2EZ0D 2HKHH 2VDLL 4QCIA 1RVFL 2J1KA 1MF2H 4Y1AA 3DARA 1TETL 2ITDA 4OCWH 5E8EA 3MRMB 2R2EB 3F7QA 2LU3A 4U1HA 1IC7H 4C58B 3EJYC 3G04B 3U7YH 4A6YA 4EXKA 4P2RD 2HLFD 5BMFL 1RV6X 3BVNB 3FAWA 4X7TB 1MIEH 1P53A 1IE5A 2GITA 1MFCH 2V7HB 1YPZB 3HI1B 2MFNA 1OM3H 4NO0B 2IAND 1FFPA 2IAMD 1SEBA 5CJBA 4LEXL 3T0EE 3JBG7 5A2FA 5C2UB 1XF2B 4PRHD 4M61B 4OV6F 4MNHB 3FMGL 3GIVA 4EJ1C 2QL1A 4QHMB 5C07B 2B4CH 1WAAF 1N26A 4LLAA 2FEDC 1K8DA 2KZWA 1J1XH 3KYMB 4Y5YA 3C5ZD 4LCCB 4LRIC 4RZCA 4UI2A 3VI4F 1XGRA 4N0YL 4YEEA 3BIAX 3MFFA 4WHTB 3TBTB 1MCPL 3T2OA 3KPSB 4N1HB 1U2HA 4Y19B 1T0MA 3CFKB 2H2SD 3CFDA 3P0VL 4KDVA 1S7UA 2HKFL 1HQ4B 2Q86B 3QIWD 4B7IA 1PY9A 3IU3A 2VZUA 4Z7UE 2ZKHL 1F2XK 1A3QA 2BJMH 5D7SH 3OAZK 5FFLA 1VESA 3QUKB 1DQQA 2HH0L 3ZT6A 2M1KA 1IQWH 5FDYA 2C4FT 5IB3B 1A5FH 1XGUB 3OJDB 5ERWB 4XNUH 3W9EB 1GPOH 4QYOB 4F7PA 2FGZA 3HE7D 4ZPTA 5B39B 1JNNH 4PG9A 4WNQB 2R1YA 4YX2H 3X3GL 1JNHA 2RB8A 3DURA 1ONQA 4JZNA 4CW1A 4JE4B 1G6RA 4IDJL 4I9WD 5CINH 5I71B 1DLHB 3BGMB 2WBKA 4U0RC 4GRWB 4UU9B 1GJIA 4ZSOA 1SJHA 3SBWA 1T7ZA 4ODHL 5HVGB 3VH8B 3PWLA 2Z31C 4DQOH 4U6TA 4G6JL 3GKWL 5B39G 1A6TA 4OCRH 2D2OA 2X4RA 4GRWH 3OR7A 2FJFA 4AMKH 4QOKD 4DGIL 1WTLA 1K4DB 4WW2F 5T1LD 1UYWH 3ZKSD 1YQ2A 2PW1A 4MAYD 2WWMD 2BY1A 4FFVC 4APQD 4U2YA 1IGYB 5HSFA 4YDIL 1AR2A 1ZGLM 3DX9A 3NFPB 4FQXC 5FGSA 4QXTB 4WGWB 5F6IC 5HGDB 5I1DA 4R97C 2IC2A 3CU7A 4X6EA 5IV2A 4DGVL 4YHLL 5FYKD 2NR6C 3VWKA 3TNNB 4QTHA 2VDNL 4KK9C 2D7PA 3RFZC 1U8JB 1QZ1A 4OZIA 2OTPA 3TBYB 2VLLA 5C0AA 2VXSL 4UDUA 2XA8H 4XNMB 2J5LC 4XP5H 2IALA 5GJSH 3MBEA 4F7MB 5LKNA 4NKMB 5C0BB 1HWHB 1ZV5A 4KMQA 1N5AB 3FFCD 1E6JL 4L8CA 3MRBB 3LSOA 2ESVD 1GVIA 2YSSA 4OTXH 2XKNA 4Z0XA 3H9SB 3OPZL 3F65A 4PLOB 4ELMB 4LSUL 1INEL 3AREA 2D9QB 3BPLC 1WUNT 3MC0A 2F54A 1YNKH 4HUVB 5AG8A 1NC4A 1ZKAA 1VFMA 4ODVH 4J3SA 4L4JA 2ITCA 2B1HL 5GGVL 3VRIB 5MP6H 3N1PC 1CWVA 3BHBB 4MA1B 2VDLH 1RVFH 2HVKA 2JKXA 3SGEI 1B0RB 5I1AA 3U7WL 1TETH 5C1MB 5EBLB 3WMSA 4JVPA 5GRJL 2XPGB 4JFDA 1UM6L 3EYFB 3STZB 2BVTA 3OKDA 4BUHA 4XCFL 1KJVB 3JZ7A 1Y6MR 5BMFH 4CDHA 4NZJA 5J57B 1P9MC 3RY5A 3FQNB 4EN3B 1YEGL 4G9DB 1JWMB 3RUGB 1QRKA 3F12B 3QDMA 5TFSL 3OXSB 5CP3A 2VABB 5D7IE 1KXQE 5IB1A 5IKCB 1QG3A 4LEXH 4Z5RA 3K8MA 2E9IA 3FMGH 4O58L 5GGUA 4EI5C 2FX7L 4XP1H 4JZOA 1KIPB 3H3KA 1EFXA 3QQ3A 4NYLA 1ES0A 4IS6B 2Q8BL 3C87A 1VFBA 2AXGB 5IP4A 3CPLA 3OKEA 4N0YH 1GZPB 5J3HC 1MCPH 5DEFA 3DECA 4N5UA 2G2RA 2QADB 2FNBA 3SE4C 2NY4B 4RA3A 3P0VH 2XWTB 3PGDB 5INDA 5HGHA 3QIUC 2DKMA 2HKFH 3FONB 2O5YL 2F5AL 3KYNA 4MZ3A 1YMME 1FFNB 2V5MA 3TH4T 2ZKHH 1LEGB 2HH0H 4JFXA 1ZLWH 3Q6FA 4KGLA 4XP9L 2AEIT 3E3QE 5KVDL 1CS6A 2VQ1B 1CGSL 4PJXA 2HJKB 2EICA 4HDIA 1JRHL 2J8UB 1G7QA 2ZUTA 3ULUE 4Y4HB 4WI7A 1PYWA 4V1DE 4C4KT 2B5IB 1LQSR 1QO3B 3DGCR 4JCLA 5DC9B 4NQCB 4YXHL 4XCYB 3X3GH 1SQ2N 4EVNB 3S7GA 5KSAB 4F3FA 2XY2A 3RKDD 3TO4C 4BH8B 4FQIL 2ZNXA 5F8QC 5JNYA 1TDQA 1XIWC 4BSVB 3L9RB 4IDJH 2WP3O 2NY6B 5I66B 4PJDA 2Q6WA 3IFOB 1AGBB 3FO9B 3DTXA 2P8MB 3P9WB 4GW1A 4Y0GA 3RVVD 4YFEA 4JDVA 4KTEL 5E5MA 4Y5XC 3PNWB 1HXMA 4ODHH 4FQJL 3UJTL 4Y8DC 3EJJX 3RNKB 1GH7A 2X6MA 4G6JH 4IMLB 3ZZ1A 3H9HA 1MHHA 3GKWH 5CSZA 5F6HI 2Q87A 3ZTNL 3HAEA 5E0QA 2A6KA 3TZVD 1YNTB 4DGIH 3MRIA 4YXKL 2DI8A 1FSKB 2RBLA 2UVEA 2NTFA 1UADC 3ECBA 1BBJB 3PWPD 2XN9E 5L2KB 3L7EB 4YDIH 1RJZA 4I3GA 2GY5A 2QQKL 3ARFB 3D0VB 4PJCF 4Z77A 3SGJA 2I07A 1YMHA 2YPLE 3C9NB 3QXUA 3DRTB 2ZG2A 1QR1B 3TIDB 4DGVH 4YHLH 2DF3A 3OKNA 3RGVD 1BJ8A 2VDNH 4BQ6A 2HG5B 2OI9C 2VXSH 1T7VA 2GEEA 4ZFZA 4YHPB 1XCQB 4IHOB 3NOIA 4BFEA 1CE1L 1E6JH 5DMKA 1B0GB 4PGDB 1R5WB 5I73B 1HI6B 3DUHA 4CJ1A 3FN9A 4HUUA 2VTFA 3OPZH 3OXRB 4KK6D 1BEYL 5C70A 5I1GH 1INEH 5D9SB 4PJHB 1P5VA 5D7KE 3V4PL 4UBDD 1NEZA 1VFAA 4LASL 3BN9D 2YD7A 1VERA 5SX4I 3G5YA 5DWUL 2B1HH 5GGVH 3F7RA 1HYRC 1CGXA 3GFUA 5HBBA 1FL3A 5SWSB 4OZGF 2ADIB 3U7WH 5EOCJ 1X5XA 2AV1A 1BD2B 3V5HB 3C60B 5IOPB 5BS0D 5GRJH 3KAAA 1UM6H 3VGBA 5D1QC 4NT6B 4XCFH 4P57B 4QHLA 3GGWA 1UXSA 3CZFA 2A77L 4JRYB 1LEKA 4B53A 3NFNB 4LHUD 1KGCD 1YEGH 4WO4A 4R90H 5TFSH 4BJLA 2AJUL 5C0EA 1MH5B 3DVFA 1G7PB 2PO6B 3LKSB 5BJTA 1A8JH 2HAZA 4O58H 2APTA 3QUXA 3HZYB 2FX7H 4TSBL 1RAMA 3MV01 1PBYA 3WNPA 5D70L 4OD3L 3O4LB 1NAKL 4PREB 3MODL 4F7EB 2Q8BH 3UJJL 4GRLA 4F2MB 4JJ5A 4JCMA 5EC1B 3FOMA 4JFYB 1OWRM 1HH9B 4LKCB 3O6FA 5TE7L 1C5DB 4NM4L 5HYQA 5F7HA 4M9PA 2EDEA 3D3VB 2R8SL 4PG2A 2HT3D 3ARGA 3TVMC 1MCDA 2O61A 3FO2B 4PJGF 1R3HB 4N90D 3MNZB 1MCNA 3V79C 4G8EA 1TPXB 3UPCA 4XAKD 3U79A 3OB8A 4NWTL 2O5YH 1U3HC 2F5AH 3LPFA 4KTDL 1ZLSL 3SDXE 1QEWA 1T5WA 4XI5D 5ALCL 4MSWA 2AK4D 4D3CL 5T1KD 4CL7A 2FECI 2KBGA 4OZGA 3KYOA 4X5XA 4GG8A 4XP9H 5KVDH 1X7QB 2A38A 5FAAA 3ILQD 5J0BA 3HZMB 1CGSH 1QFWM 1A3RL 1I8IB 1JRHH 3IGAB 2DOCA 1OAQL 2OM5A 3LKRA 1DFBL 3PXHA 2BOCB 4OIBA 3DNKA 5E8DL 5EU3A 4P3DA 2X2YA 2L0DA 4L4VD 4JQXC 4POYA 4GXUN 4LSRL 3EO1A 1WCQA 4G43A 4YGAB 4U4BA 4FQIH 3LKNA 5C08D 5A3ID 1BHGA 2H32A 4Q2ZA 5J1AA 5LCVL 4KI5F 2C9AA 5HHVL 3FN3A 5EG6C 2P8LA 3QR2A 4KTEH 2HFEB 2P45B 4FQJH 3ROLB 3UJTH 3QDGE 1JGEB 3DUUA 1X3DA 1R3LB 5IF0A 5CHNA 4KJQD 5DFWH 1TIUA 5H35A 1NCUA 3ZTNH 2WZPD 3KPNA 4BELD 1U8LB 1KTLB 4YDLB 4YXKH 2XQYG 5FOJA 2DQJL 3RTQC 4KQ4L 3WFHB 3JV0A 3WEXA 4I2XE 3TCXA 1G1YA 1FFOB 3MRKB 4G8GD 2F8VA 4YFDB 3U30C 2QQKH 4LLWB 4HWBA 3AY4C 4E41E 5CBAB 3CNKA 4BSWB 1EIBA 1S3KL 5FGRA 1PG7X 1QSEE 3KGRA 3GM0A 2W0FB 4P0DA 1JV5A 5FKAB 2BSRB 2OJEB 4RGND 1J8HA 3RPKA 1T1WA 3I6KA 5IMKA 1FFRA 3OZ9L 1WIPA 1B0WA 2C1PA 5IW6B 3F5WA 1RZGA 1CE1H 2GFBA 3C6LC 4IJ3B 4GAYA 4J6RL 3ARDC 1JWSA 3P4NB 2N56A 4XC1L 2EIZA 4PP2A 4Z18A 1BEYH 4QCIB 5IHLB 5BCAA 4Y1AB 2ITDB 3B3IA 4PRIA 5E8EB 2NYYD 5HDLA 3V4PH 3Q3GB 2BHYA 3RIAK 4U1HB 4LASH 1CGUA 3CSYA 3NZHL 5DWUH 4A6YB 2XI9A 1T89C 4P3CL 3BP4A 1U8MA 2LFGA 4NCC1 4R8WH 3U2SA 4LARL 2XKUA 4KUCF 3I3BA 2GITB 4MJ2A 1ZLUK 2H6PA 2ZCHL 1JF1A 3R8BB 1KCLA 1H0DA 5E2WL 1FFPB 1SEBB 4MHHI 2VLKE 3MRDB 2ED7A 1JYNA 2A77H 4WJ5A 3TGXA 3GEWB 4X7EC 1XIWB 1HK6A 2W0PA 3PUCA 3RI5F 2AJUH 2F53A 3IDJA 3A67L 4Y5YB 4P2OD 4RZCB 5E2JA 4NQDE 1XGRB 4NPYA 4WWKA 3MFFB 4KK5D 4PJ8C 1VPOL 5K9QI 2BSED 4P23D 4TSBH 5D70H 4OD3H 1NAKH 1T0MB 3CFDB 1EBPA 3MODH 1D5BA 4Y16C 3UJJH 3TFKC 3BD4A 3K74B 1S7UB 1VEMA 1PX4A 4HUKB 5DJ2A 3RPIA 5TE7H 1ZXQA 3RL1A 4NM4H 3IU3B 4DOHE 2IMMA 5GS3A 2R8SH 3K2MC 2IPUK 3CDCA 4Y2OA 1T66D 1DQQB 3KPLA 2V2TA 5FUOL 4KZDL 3WJJA 4EDXA 2Y7QB 3EYQC 3WHE0 4C83B 4F7PB 4OQTA 2NY5C 3FHAA 4KTDH 1ZLSH 3OKOA 2I26N 3FHQA 4ZPTB 4PG9B 5ALCH 1FGVL 4ZS7L 3VE0A 4D3CH 1KLGA 4XXDA 4JQVA 1JNHB 3DURB 5IVXE 3L1OL 4LOUC 2VXTL 4JZNB 1A3RH 4CW1B 3HZKA 1OAQH 1MHEA 4YC2C 1DFBH 3G5ZA 4HKJA 4N0UE 3MUGA 5E8DH 3UO1L 3OR6A 1SJHB 5A2IH 5CCKL 1KACB 3PWLB 4Y5VA 4PJ9D 4M7ZB 1TMCB 3VXOA 3OAYH 2JIXD 2VN4A 1P6FA 1CDHA 1XMWA 2X4RB 3SO3C 1ZHKA 3BIKA 3LDBC 2FJFB 5HHVH 2PNDA 1U3JA 1DUYA 1NKOA 1I3GL 4NDMA 5KJRL 2PW1B 3QA3A 25C8L 3PHQA 1C08B 2EYSA 1L4IA 3DX9B 5HPMA 2GUOA 3DYOA 5SX5K 4CADA 4WDIB 3FFDB 5I1DB 4X6EB 2DQJH 4P4KA 3VWKB 1CXKA 1I9JL 4KQ4H 3T77A 4QTHB 4NUJA 2QHLA 1IC1A 2IWGA 1NLDL 5HGBA 4OZIB 2UV3A 3DXAE 2VLLB 1U8PA 5C0AB 1QFWI 4UDUB 1QLRA 4CVWA 1GZQA 3MV8A 2C3XA 2IALB 3MBEB 4G9FA 1C16A 2R29L 3EBAA 4NSKA 1S3KH 5BW7C 5M94B 5C92A 3MRGA 3EDKA 4PJ5A 3RL2A 3ARRA 4L8CB 3LSOB 1S9VA 4DVBA 2YSSB 4QRRA 3AS3A 2XKNB 3FCTB 5CZKA 1H3TA 2K1MA 4GRMA 4Z0XB 3UMTA 2EE6A 3D48R 4KVNL 2D0FA 3CSGA 1I1AB 2DQFA 1KIUA 4MLIA 3OZ9H 4OGAC 1P2CB 2F54B 3H3PL 3S3SA 1EEYB 4U7MA 1NC4B 1U95A 4J6RH 3WS6C 5FDWA 5BO1L 2ITCB 4D9RE 4OCNC 4XC1H 2ICEA 5B38B 2HVKB 3CDYA 5C09E 5I1AB 1HXYA 5E6ID 4JFDB 5EUOE 1LILA 1XT5A 2B7DT 3OKDB 3NZHH 1UWXK 4JDTL 2R2HA 3MLUL 4JRXA 3UEZA 2MKWA 4P3CH 5E9DD 1K5NA 2NY5L 2WWKO 3KXFE 2I9TB 4LARH 1OTUC 2I25N 2ZCHH 1UH2A 3QDMB 2VWEE 3RAJL 1HYSD 3K4DA 3FJTA 5IB1B 1EK3A 5E2WH 3MRHB 3C09C 4PJBA 5BXFA 5MHSD 4X4ME 2PXYA 3LV3A 4M1CC 4MJIB 5GGUB 5CP3H 1EFXB 1K9TA 3D2UD 3QQ3B 4NYLB 1ES0B 2BY0A 3PJSA 3I6LE 3A67H 1VFBB 2WBJA 3ARPA 3SDCD 4J3OC 3CPLB 2CD0A 4FXKA 3O6KL 1VPOH 5DEFB 2PCPB 4X6DE 1ZAGA 2G2RB 4LRIA 1PQZA 2R0LL 4P2RE 3KPTA 4JGUA 4AEIL 3VDBA 2HT4C 5INDB 5HGHB 3GNML 2PF6A 2M2DA 3GB7A 4NFBA 4NO0D 1NC2A 2IANE 2QQLL 4OIAA 3Q6FB 4PB0L 4DAGL 3SE9L 5FUOH 5IK3A 4KZDH 4KJPD 4PJXB 1G7QB 1PVHA 3JVGC 4KQ3L 1CICA 5C07D 1PYWB 3NZ8A 5DD1L 1FGVH 4U7SA 4ZS7H 4YHML 2KDGA 1NUDA 2VITB 3OKMA 4P2CG 1QQDA 4F3FB 3L1OH 2VXTH 4HS3A 4JY5L 5HJ3A 1FIEA 4GSDL 3KPRA 5JNYB 3ARDB 3KPSD 4OF0A 4PJDB 2Q6WB 3MO1A 4Y19D 3DTXB 3RVWD 3UO1H 5KS9F 1Q9LA 4GW1B 4NNPL 4JDVB 5E5MB 5CCKH 3VU2A 1HXMB 3TBWA 2EXYC 1CD8A 5F89A 2CRMA 1RZJL 2UVFA 1FGNL 4XMPL 5CSZB 1MHHB 4AL8L 2XOTA 3QO1A 3HAEB 2YUVA 2A6KB 3MRIB 5JQHC 5F7KC 1VA9A 5JZ7D 1I3GH 1CIDA 1GOHA 5KJRH 4C55A 3ECBB 3VRJA 1NAMA 25C8H 1GXEA 4K3GA 5GRXG 3HAEH 3D39E 1J86A 1RJZB 5DS8A 2ZCKL 4Z77B 2Q8AL 4LLDA 3BPNC 4S1QL 1EVTC 5HI3D 3QFDA 2HVJA 1JF6A 2HN7A 1J18A 1I9JH 3N1GC 3OKNB 3H3BC 4MNQB 5DEGA 2C26A 4I9WE 2R0ZL 1NLDH 3HAEG 3K3QA 2A6JB 3RVUC 4NC0B 1LEIA 1RZFL 1AI1L 4LGRB 5KVGH 1RZKC 4ZFZB 4D8PA 2R29H 1OP5H 2GTWA 4GS7B 4KMLB 3CVHA 1JN6A 3DHMA 5DMKB 3NCJL 3V4VL 1VENA 2ADFL 3R0MA 4HUUB 4QOKE 4KVNH 2COQA 3CFCL 3BFOA 4TSAL 1NEZB 1VFAB 1FORL 5GQBA 3H3PH 1GSMA 3M07A 5IEHA 1RMFL 2V5RA 2V5SA 3G5YB 5KS9A 2LVEA 1AO7A 2C5DC 3UYPA 5BO1H 3VWJB 3ZE2F 5JORA 2IBGA 1NCNA 1J0JA 4KVCL 5TDOA 5FYKE 2AV1B 1LMKA 5B3NA 1OTSC 1FNEA 4JDTH 5IBLC 2JCCA 1CQKA 2NY2C 2P43B 4QHLB 1UXSB 4NRZA 5FYLL 4AIOA 1I8LC 5C0GA 4OIIL 3EDJA 2CR6A 4WO4B 3RAJH 1UACL 5C0EB 2E7LC 1H3GA 2F19L 3H9SD 4WV1A 3VD4A 1N3NB 5ID1A 4X6CE 3QUXB 4R7DA 2D0GA 4GW4A 4D9QE 1E6OL 4ZFOL 1MCIA 3OAUL 3DHJA 1UEMA 5DO2D 1J05B 1TCRB 3I75A 4JJ5B 2H26A 3FOMB 4W6WB 4PRNB 3S35L 3MLPA 4R4FL 3GMPA 4OLXL 3O6KH 3SJVE 3DX6A 3KLAB 4M93C 4XWOD 3ARGB 3QEQA 2O61B 4OGZA 2ZWLT 3EHBD 3WLWC 1X5HA 2R0LH 4GXVL 2APBA 5M95B 4AEIH 3PV6A 2ZUXA 4G8EB 3GNMH 4GT7A 4UTBL 1QEWB 1T5WB 1PZ5A 4EN3D 4MSWB 2XG4A 3MGOA 3MUZ1 4X4XA 4PR5A 1OQOA 2QQLH 2A73A 4PB0H 4DAGH 4X5XB 1IKFL 4GG8B 2BFVL 3SE9H 2SEBA 3P4LA 3LS5L 4OQTL 4KQ3H 2Z0BA 3AGVA 6FABL 1CDGA 1PEZA 3MCKA 4LVNC 2OLDA 5DD1H 1F8TL 1RZKL 1U0QA 4P3DB 2C3WA 5EU3B 5I16A 1CN4A 4YHMH 2QR0A 5GS0C 1M05A 4JHZA 3SPVA 4JY5H 4G43B 4GSDH 5D5ME 3LKNB 1DANU 2H32B 4Q2ZB 4JO3L 5TH2A 5J1AB 1KG0A 2QADD 1CLCA 3U48A 2NY4D 1KEML 4NNPH 2P8LB 4ZUTA 3BX7C 3PDOA 4KRMB 5A40E 2F5BL 2PETA 3DUUB 3LRSA 1RZJH 2ADJB 5IF0B 5CHNB 1MFAL 1FGNH 4XMPH 4AL8H 4IOFC 5H35B 1UB5A 4IIQC 3D18A 4CMHB 3KPNB 4PY8I 5F3BA 3ZYIA 4J2XA 3DMMC 2HTLC 1R6VA 4NP4L 3DO7A 1I75A 5I8EA 4QRPE 3IDIA 4LMQI 3QYCA 2HYMA 1ZVHA 2VIRA 4U3HA 4Y4HD 4KKCD 4HMCA 5L8LB 2HMID 2DIJA 2ZCKH 5F9AC 4NQCD 2Q8AH 5ECJE 1A02N 3RWIB 4S1QH 4KK8C 4JFFA 5DUML 5MEQB 5KSAD 1IEBA 5T1MB 3NA9L 1M1SA 3NMEA 3RZWA 5D2LF 4WGVB 4UQ3A 5SWZA 1JV5B 1C5CL 2NY6D 2R0ZH 3MRQA 1CR9L 4PB9L 5D1XC 3T3PE 5GRVK 1J8HB 5I18L 1RZFH 1T1WB 2DMCA 1AI1H 3I6KB 4RAUA 4ZTOL 5IMKB 1JI1A 3ZSSA 1AD0A 4JEGB 2C1PB 1LP9F 3D25A 1RZGB 3EJYD 3F5WB 2GFBB 5D2NE 1V5JA 3NCJH 3V4VH 3QDJE 1GGTA 1JWSB 1NCCL 2ADFH 3LN4A 5ISZB 4ERSL 2EIZB 4PP2B 4R2GC 3CFCH 4KROC 3OSKA 2XZAL 4JM2A 4TSAH 3B3IB 1A9BA 3MJ9A 4PRIB 4HH9A 1FORH 4ZXBC 5L2KD 4IRJA 1RMFH 1XR8A 3WDHA 3ARFD 4KKBC 1JPFA 1MRFL 4I13B 3BP4B 1U8MB 3P9MA 3UAJD 1YEIL 4HIIA 3U2SB 4I0KA 4KVCH 4LPWA 3HI5L 2XXCB 2F15A 2CRZA 4BSJA 2H6PB 1P1ZA 2LVCA 2R4SL 3I9GL 1H0DB 3IYLW 5ITFA 4AH2A 1EDQA 5L2JA 3R0NA 2AV7A 4ZODA 4X6FA 2MQ0A 1TZIA 5FYLH 4WJ5B 3IVKA 4NN6B 8CGTA 2C7UA 3BW9A 4OIIH 5TDPA 2K9UA 5FV2A 1NMCB 1S9KC 5GS0L 3LB6D 2A1WL 1UACH 4PLJD 2F53B 3IDJB 2X4SA 2F19H 1Q8MA 3ZKMC 4NPYB 4WWKB 5D2LA 3DPBA 4JKWA 4LFHG 4MCYA 1E6OH 3OAUH 1N6UA 1D5BB 1DBKL 2XFXA 5DJ2B 3S35H 4Z7WF 2J6EA 4FTVA 5SWSD 3ME0A 1UZ6F 4R4FH 3RL1B 1UG9A 4S1DC 1MCBA 3T2PA 3BUTA 4Z78B 3UTQA 4OLXH 1BD2D 3C60D 2OTWA 3UTSA 3SDYL 3IFPA 4GXVH 2V2TB 1Y0LA 4ZD3H 1T2QL 4EDXB 4JRYD 4X5WA 5F96L 5F71A 4OM1L 3OKOB 4UTBH 1KGCE 3PF2A 1R3JB 4XP4L 5EN2A 5FGBC 3VE0B 4POUB 4BQBA 1IAKA 5L8JB 3BPOB 1KLGB 4I48A 3UZVB 3DYPA 4DCQA 2PYFA 3WHE1 5I74B 4XXDB 1IKFH 2BFVH 2PO6D 4M48L 3LS5H 4OQTH 1RIHL 1VHPA 3HZKB 1MHEB 3IXAA 3G5ZB 6FABH 1DL7L 3BSZL 4HKJB 4X9HA 1QSFA 2GY7B 3BZDA 3PE9A 1F8TH 1RZKH 5D6DC 3O4LD 3KS0H 4OZHA 2KUTA 3OR6B 1G0DA 3ESVF 1WLHA 4K8RC 1CQYA 4Y5VB 2R15A 3LEXA 3VXOB 1NGXA 1BZ7B 5EB9A 1A0QL 3D3VD 1MREL 1JHTA 1T83A 4JO3H 43CAA 3HPLA 3WBDA 1ZHKB 5L8KB 3BIKB 1UKTA 5LVEA 1KEMH 5AAWA 4FFZL 4F9PC 3SKJL 1DUYB 3WIHA 4NDMB 1O0VA 5IMOB 2F5BH 3VGGA 3B9KB 4XAKE 1HKLL 3G9AB 3QA3B 3WJLC 1HSAA 1MFAH 3PHQB 2EYSB 2Z8WC 4QRQA 3LQAC 4NQEB 2AK4E 2GUOB 1D6EA 1UM5L 1CGYA 2NY2B 1I1YA 4NP4H 5F1KC 3GJFK 3U0PB 3WIIL 3CU1A 4P4KB 3T77B 2CH8A 5HGBB 4O02L 1U8PB 1UJ3C 1QLRB 3ARBA 1GZQB 3MV8B 3RTQA 3WO4B 4GW5A 4WI4A 5HVWA 1IEHA 1C16B 1P7KA 3NIDE 3QT2A 4PV8B 5DUMH 4NSKB 3TJHC 3HUJE 4JHAL 3QH3A 3MRGB 2DB8A 4PJ5B 3RL2B 4ODXA 5C08E 1QR4A 2ZUQC 2XYCA 4DVBB 1C5CH 4QRRB 4HKZA 1CR9H 4PB9H 4GRMB 4AK1A 4CBPA 5C6TL 1LK3L 5I18H 2DQFB 4EQ2A 1MPAL 4ZTOH 2YWZA 1RHFA 1G0YR 4I3SL 4YXLL 3CVHL 4B50A 1FZJB 4KDTC 1MLCA 2OCFD 5DZLA 3TPKA 5J12B 4N68A 3TPUA 4OB5L 5JLZA 1U95B 1EAJA 1XH3A 1ZT1A 5FDWB 1NCCH 1QBML 4H25A 4PJIA 4ERSH 2ICEB 3EFDL 4LU5L 1JPTL 2XZAH 2NX5B 3RZCC 3W5MA 5ACMA 1HXYB 5DRXA 1W0YT 4XCNB 4PUBL 4XB8A 1OF2A 3HRZA 2R2HB 4JRXB 2D03H 1MRFH 1K5NB 5CSBA 1NH6A 4HULB 4H20L 3VRLF 1EEZB 3HI5H 3V0VA 2G5RA 3DBXA 3PIQA 2R4SH 3I9GH 4ZFFA 4GKSA 4PLKC 3GO1L 1NJ9A 4RGNE 3RWJA 2X1XR 3AB0B 4PJBB 1HQRA 5BXFB 1LK2A 3O3AA 3TIEA 5KG9A 2PXYB 3N1QC 1K4CA 3IKCA 1T80A 5CD5C 4Q58C 3U4EA 5GS0H 5ACLA 1YECL 1DUZA 1R3KA 2IQ9H 1EMTL 2A1WH 2VQUA 3PJSB 3JV5A 3O3UN 2WBJB 4P2QA 2XACC 4PJFA 2YEZA 3DX8A 5CBEA 5E4EC 3EYOA 4Y1AD 1IZKA 4FXKB 2HFFA 4GG6F 5EU7E 3GBML 3G5XA 3NIFF 5DHXB 5FB8A 2JF1A 1DBKH 5J4MA 1P84K 3MYJA 4CVXB 4NKDA 1DQML 1NPUA 3HB3D 3LQAL 3CLEL 1XEDA 4LSPL 1CFTB 3TN0A 3GB7B 1JWUB 3SDYH 2XIDA 4WENB 1T2QH 2JJTA 3EZ8A 5IK3B 5CKAA 1X5YA 4PGBA 5JXEA 2CUMA 3HRPA 2E7HA 1CICB 3OAZH 3I3DA 4OM1H 1XIWD 5F8RC 3NZ8B 4KRPC 4ZTPL 4XP4H 3DJ9A 4UZGA 2WM0A 4ZUUB 3IB4A 4RFOL 4B0MM 3OKMB 4LBEA 1QQDB 4GLRI 3HS0A 2VXUL 4UTAL 4M48H 1RIHH 3UTOA 1YEDB 3KPRB 3AMLA 1DL7H 3BSZH 2X05A 2QLVB 2YA2A 3W11C 3MO1B 3PABA 1H5BA 1Q9LB 3S3JA 4P48A 3CIQA 3TBWB 5F89B 2YKLL 1F13A 1YN6A 5CSGA 5HHXL 3ELAT 2R9HC 1I85A 1A0QH 3QO1B 1KC5L 1MREH 3FQTA 4B7LA 4OLZL 1HCFX 4YBLC 3O2DA 4N0FA 4HV8B 4IRSA 2EEDA 5ANME 2I27N 4FFZH 3SKJH 5E00A 5TGBA 5K9OA 1HKLH 3H7BA 3VRJB 1NAMB 4Z7UF 3HI6L 4MA7L 4TUJA 2UWEF 1TZHA 1UM5H 4LLDB 1JZ2A 4DKAA 2VUOA 3L3OA 2HN7B 3RWFA 3BD5A 1DTUA 3WIIH 4KV5E 3BWAA 3ULVC 4M1GL 3X13A 1UH4A 3DWTA 5DMJB 1PSKL 4XHJC 2NXYB 2VWEC 4O02H 4J1UA 2CRIA 3QI9C 4BFGA 1LEIB 3RRQA 4ORZC 5IESL 4D8PB 1MUJA 3U46B 1P4LB 3OJ2C 4FQPA 4JHAH 2GTWB 3CVHB 2JLLA 4QWWD 5KSBF 1FLRL 3T0EA 5C6TH 1LK3H 2XZZA 2Y07L 1X5FA 4LCIL 5DMGC 3QHFL 5BRZE 3T8XA 1MPAH 2EZ0C 3QNXB 5J11B 3B8SA 4ZO8A 4YXLH 3CVHH 5J6GA 4QRUA 1FQ9C 5E5RB 4F58L 4OB5H 5IEHB 1W0VA 3G6AA 4HLZH 1AO7B 1QBMH 3CUPA 3G6DL 4G42A 5JORB 4N0RA 1UCTA 1QHPA 2DLGA 2HLFC 1KYOK 2QKIA 4LLVA 3MJ9L 3EFDH 5F9JA 5TDOB 1JPTH 3GMMA 3WS6A 3VWKD 1KCRL 3MTRA 5ESAA 4M8VA 1RUQL 3FKUS 1T03L 1Q0YL 1MFDL 1FNEB 5C0AD 4UDTA 4X6BA 2IAMC 4NRZB 2FLBT 3GSXA 2BNQA 3MBED 4H20H 1EA9C 5C0GB 5CIPA 5FEBA 5IWLA 2LQRA 2XTJE 3GO1H 5E08L 1NBQA 1SYVA 1I1AD 4ZOAA 3C5ZC 5ID1B 3VFVA 3I02A 3O3BA 4GW4B 2H45A 2VH5L 2F54D 1CG9A 4TYUA 1NC4D 1YECH 2FSEB 2MKLC 1EMTH 4P5TB 5CWSA 4PJCE 3I75B 2H26B 2H2SC 1X5AA 4HAGA 4Z7OE 2QEJA 1EZVY 1RZIA 3GMPB 3QIWC 1REIA 3NAAL 3DX6B 4F7CA 4OI9A 2VLRD 1N64L 4JFDD 3U9UA 3QEQB 4HQQL 3GBMH 4OUUA 2J6EL 5E9DE 1C7TA 3MV9E 1KF9B 1DQMH 3LQAH 1YUHA 1R5IA 3CLEH 3LD8C 3QUML 4LSPH 3O9WA 3MGOB 3HE7C 5DC0A 4X4XB 3QDMD 5T3XL 4PR5B 1TVBA 2A73B 3QIBA 1M7DA 5CJXA 3ULVL 2SEBB 3JXAA 4OV5A 5MHSE 4RQQA 4OF6A 4Q9BA 5BVPL 4MJID 1SVCP 4L3EA 3MCKB 4ZTPH 1OP9A 3A0OA 2M8XA 2VR9A 4HUXA 5I16B 1EFXD 3O45A 1M05B 4RFOH 5CMAA 3B6SA 4L3AA 5F70A 4UTAH 2VXUH 3SPVB 5DJAB 4NBXB 1NFDF 2PR4L 1CXEA 5TH2B 1KG0B 4EOWL 5M7QA 4A2LA 1ZGLA 4B5EA 5EO1A 4WUUE 4Y4KA 3ARYA 3PDOB 3RX8A 5BQ7A 3HC0A 2YKLH 3LRSB 4MAYC 5HHXH 1WVZA 2AP2A 4XGZA 4APQC 1PKQE 2NXZB 1UB5B 1D6VL 1Q0XL 1KC5H 5HHQA 1OAZL 4J3WA 4GBXA 1IGIL 5F9WB 5F3BB 4OLZH 4FMKA 4UILL 2GQHA 3WIHL 2VDRL 3MCG1 4MXWL 3DO7B 2UUDK 1BREA 1X4XA 5I8EB 1UH3A 3IDIB 1ZMYA 2DMKA 2VIRB 3HI6H 2E7MA 4BA8A 4MA7H 1QRNE 3MNWA 4LCYA 3SKOA 2ARWA 1QUNA 5KN5A 4AIXA 1KJMA 1IEBB 3TA3A 3FQRA 4M1GH 5FXCH 3OQ3B 3V6OC 4UQ3B 1VFOA 2AQ1A 1IRAY 3ARDD 1PSKH 3KPSE 4OF5A 3MRQB 5MEOA 5DTFA 4AYFA 1ZEAL 4X4YA 4XVTL 1CXIA 4R96A 5IESH 4PJGE 4RAUB 2PUQT 4JFHE 1AHWC 4I0PA 1AD0B 1I7RA 4L9LB 3VMPA 4Y2DA 3D25B 2JB5L 3ZDXE 5D7IA 1QACA 2C3VB 2NY7L 1FLRH 2PYEE 3LN4B 2QSCL 2X70A 4U3XA 4A2MA 2Y07H 4LCIH 2KQNA 3QHFH 1OWWA 3IRZA 4KY1L 2NW2B 4JM2B 1A9BB 3GRWA 1G7JA 2J2ZA 5D4QA 4NRXA 1JPSL 4F58H 4IRJB 5CLTA 3G6DH 1JPFB 1F6AA 3P9MB 1KIRB 3MJ9H 2EKJA 4HIIB 3WFBL 2I24N 3GZKA 3IJSA 4RMSA 1KCRH 1P1ZB 1RUQH 4MNQD 1T03H 1Q0YH 1MFDH 4AH2B 2FIKA 5TE4L 3N06B 3IXTB 5L2JB 1HOCA 1ODAA 5ENWA 2AV7B 1LE5A 1ZSDB 4Z7VF 4ZS6D 2EE2A 2P46B 3BMWA 3R4DA 4X6FB 1TZIB 3IVKB 1YMMA 3BW9B 1Z9SA 5TDPB 3DI3B 3ZDZE 4RIRB 4JREB 2J3SA 5E08H 3TFKD 2GTZB 3AFLA 3KVQA 5I6XC 1KPVA 1I8LA 3LPGA 5HI4D 1DEDA 4MZ2A 4XP6L 4V1DA 4MCYB 2VH5H 3VFWA 1N5YL 3MA9L 1B6UA 2XFXB 3VWJD 1LO2L 1ZA3A 1A7NL 4FTVB 1S9YA 5KOMC 2VSDA 3MLTA 4MD4A 5JW4Q 2X4QB 4S10A 3UTQB 3MGTA 3MLXL 1JGVL 3NAAH 4NZRL 2OTWB 3UTSB 2EDDA 4OLYL 1N64H 3RWDA 3ZSTA 4HQQH 3OG4B 3IFPB 3VDCA 1Y0LB 4J4PA 1LO4L 2J6EH 4ISVA 4KUZL 2DM2A 4X5WB 4X83A 1NUNB 1X5LA 2EDBA 4WFED 4PP1C 3QUMH 3REVA 4WO4D 2X7LB 1J0ZA 5BV7B 1IAKB 5HVFB 5T3XH 4I48B 4DCQB 2PYFB 3L3GA 1T3FA 5E8NA 32C2B 2XN9A 1YYLL 4NBYB 4HIJB 1S7RA 3IXAB 3RKDC 5CAYB 5BVPH 3GM8A 2CLRA 2AKRA 5BV7H 1QSFB 4OGYL 2YPLA 1YEKL 1LWRA 4OZHB 15C8L 3NGBC 1AXIB 1TNNA 4KKAD 3RVVC 2FZ3A 4UV4L 4ZNCD 3KLHD 4YPGA 3EZJB 5T1DL 1NGXB 4F37K 4FA8A 4JO2L 2PR4H 5FYKU 1JHTB 4R6UA 43CAB 4EOWH 3ARGD 3T3MF 1JZ3A 3TZVC 5DI8B 4MA3A 3IDGA 2VISB 2A83A 1B6DA 1HSAB 3VXNA 1YNLL 4QRQB 1D6VH 1Q0XH 1OAZH 2DL9A 3Q5TA 1IGIH 1D6EB 4JR9L 4UILH 4HIXL 4YAQA 3WIHH 2VDRH 1I1YB 4K3EL 4MXWH 1OW0A 4PS4L 1BQHA 4ZAKC 2WIMA 1G0XA 2H2PD 3SDXF 1CIUA 3HKFA 3RGVC 2DLHA 2Y5EA 5FGCB 1QLEL 2W60A 3VFNA 3ARBB 4FG6D 4TN9A 4GW5B 5T3ZL 2VOTA 3OB0K 1P7KB 2B8OT 1G7LA 3FL7A 2XWBA 3QH3B 3QG6A 3TT3L 4ODXB 1OY3B 4XMLL 1N59A 1J0YA 1ZEAH 4KHXL 4XVTH 5E99L 2EH8L 5FM5O 2H8PB 4KK6C 4NQSA 1MRCL 1V05A 2FWOA 4NN7C 4UBDC 3TPUB 2HJFB 1CK0L 2JB5H 5D1XA 5GGSA 4NO2A 4MYWB 5JLZB 3BN9C 1A3LL 2NY7H 1XH3B 1ZT1B 1ZT7A 1URLA 3EOAA 4P59L 4PJIB 1JMXA 2QSCH 4WTXA 1PEWA 4RDQF 4OFYA 3W5NA 1S9XA 4KY1H 4O2FA 2R0WL 4LDLB 5DRXB 1JPSH 1QBAA 5HD8C 5E7BA 5GGTA 5F1IA 1OF2B 3HRZB 4EKXA 3O6ML 2EDHA 3WFBH 4ZXBA 3DSNA 2VDPL 2FB4L 3V0VB 1OGTA 3DBXB 3PIQB 5LJYH 4U1IA 4DUWA 4ZFFB 4GKSB 5EBWB 1NJ9B 3O8XC 5TE4H 2YRZA 4JKKA 3UTTA 2Q3AA 1SHMA 4NC1C 3RWJB 1J8HD 1HQRB 3SQBA 3SDXA 3TIEB 1ZLUH 3IKCB 5MI0C 1AR1D 1RK1A 3U4EB 3I85A 1R3KB 1OB1A 3BAEL 5DURB 3PDGA 5ISZD 4YDKL 1WFNA 3SHSA 3PHOA 3ABZA 5B4MD 3DX8B 5CBEB 3N9GL 4XP6H 3EYVA 4PRID 3QWRA 4XRCA 5ID0A 3QP3A 2HFFB 1IAMA 4LLMA 1N5YH 3MA9H 5JW5B 3Q5OA 2HT3C 4XPTL 1EXUB 2YD8A 3BGFC 1HZHL 1ORQA 4JHWL 3AMKA 3MYJB 4RMRA 1C1EL 1A7NH 3IDYC 3WUWA 4LFHD 4NKDB 5FYLD 2CK2A 3MLXH 1JGVH 2BRQA 2XZQL 4OLYH 4XI5C 1NQBA 2P24A 4AM0A 3UPAA 1OAUL 2MCG1 1LO4H 1BF8A 3QXWA 1MJJA 1XGTA 1JJUA 4KUZH 4HBQA 3M8OL 4OSUL 1KTKE 5HPOA 3QJHA 3JV4A 1JCKA 3TH2T 1PJ9A 2F53D 3BP7A 4HMEA 3B5HA 4HG4K 2BVPB 3HS0B 2EXWD 2LTQB 1YYLH 4I2XA 5HDQL 4WWKD 1U91B 2AEWA 3JWDC 2RIKA 4UT6L 3VGFA 3H2WA 5A3IC 4E41A 4OGYH 3L3DA 1YEKH 4I18A 15C8H 3PABB 1H5BB 1MNUL 2JJWA 1ZA6A 3WN5C 1QSEA 5MEPA 5SWSE 4UV4H 4FQQA 3C8KA 1MCHA 1YN6B 2WUBL 1XF4B 5T1DH 3L3HA 4JO2H 4KJQC 1BD2E 1I7UA 3SGEH 3FQTB 1MCSA 2OYPA 5J56B 4BFBD 4YHYB 5AZEL 4HXAL 3VXPA 3BQUA 5E00B 2Y5TA 5TGBB 3OKLB 5K9OB 4JRYE 1CD0A 3H7BB 4EDWL 2RJMA 5CEZD 3MNVA 1EGJA 1YNLH 1F3JA 1TCMA 4TUJB 3SE3C 4JR9H 1TZHB 4HIXH 5DFTA 4K3EH 2Z8SA 3GJFA 2FO4A 2YC1A 4PS4H 1CDJA 1FH5L 3RWFB 1HILA 3BWAB 4MQXD 5CGYD 3LS4L 4O51B 3X13B 3OHXB 3S36X 1I9IL 1A1OA 3DVGB 5SX5H 1V3LA 1QLEH 3S88L 4J1UB 3VCLB 5I6XB 3KPOB 4W4OA 4RGNC 1M4KA 3PHSA 1CXHA 5D93B 5T3ZH 4UUJA 1MUJB 1SBSL 3GSRA 3U0TA 3MGAA 3SGKC 2DAVA 1AFVL 3TT3H 3PXJA 2UZYB 4WVRA 4HZAA 5CJ8A 4XMLH 3T0EB 4MX7B 4Y4FA 3PQYB 2UY6A 4KHXH 5E99H 2EH8H 3T8XB 4PBVC 1MRCH 4YEFA 5C0JA 5F93C 5ESQA 3B9KD 7CGTA 5J6GB 1FBIL 4QRUB 3NCYS 2ARJA 2NYYC 1CK0H 4HBCL 4GKZA 2A74B 2CJUL 1W0VB 1A3LH 3PP3H 4NQED 2YA1A 3CUPB 4G42B 4P59H 2FDBP 4NQDA 2NY2D 1TQCC 5ICXA 4LCWE 3GRWL 5F9JB 2FECL 5I2IA 3GMMB 5DQ9A 4U49A 2R0WH 4R4ND 4P4KD 4GUPA 5ESAB 3G6JB 2NY0B 1T20A 5H2BA 1ZTXL 2DRUA 4UDTB 2PN5A 1PAMA 3O6MH 4X6BB 3MV8D 4DK3A 3GSXB 2ENYA 2R2CA 2BNQB 2VDPH 2FB4H 4POZD 3NFSL 4PJ5D 1HE7A 3QISA 5DK3A 4F15C 2D7NA 1UWXH 4QRRD 3C8HA 1U8HA 5JA9A 1AXTL 1SYVB 3L6FA 1ACZA 3CDFA 1MFBL 3JWDL 3VFVB 3I02B 3O3BB 2YPKA 4KK5C 1CU4L 4J12A 2JB6A 4BH7A 1CG9B 1NGYA 2ENSA 1YA5A 4P23C 1MCCA 1JZ7A 3RP1A 2V9QA 3BAEH 4N1CA 3OGOE 4XMKL 5CWSB 1GOGA 2W38A 5H37H 5IVXA 4YDKH 5JA8B 2YD4A 1U8NA 1GGIL 2NX5D 1LVEA 1RZIB 3QUZA 1UGNA 1OPGL 3DETD 3U9UB 4RGOL 2IFGA 4OUUB 1KBGL 1T66C 3KJ4C 4XPTH 4JHWH 1HZHH 5E7FA 1UZ8A 4ZAKB 1C1EH 3PGCA 4NQUA 1T22A 3TJEL 1Q38A 4RFNB 5CJQL 1T6VN 1YUHB 2EIDA 4WHDA 2X4PA 4DZBA 4AZ8A 3O9WB 5EUOF 2XZQH 2DL2A 3G08A 1L0YA 1TVBB 1OAUH 4BQ9A 2YMXL 3QIBB 1M7DB 4KGJA 1G9ML 2ARJQ 4IM8A 3A6CL 2DLFL 3ULVF 1WWAX 4YUEL 1CZ8L 2PXYD 3M8OH 4OSUH 2DBJA 4L3EB 3B9VA 2YR3A 2WAHA 3S98A 1P84J 4HUXB 2VXVL 3O45B 5JO5A 1O7VA 4H26A 3B6SB 3S37L 4ODUA 1FG2B 2WBJD 3TWCL 3O0RH 3KYAA 1BWMA 4NN7B 2BSSA 5IROC 4PJ9C 5FK9A 5HDQH 7FABL 4JO1L 3ARWA 3DXAA 5JOFB 4UT6H 1CLZL 3F6LA 2CKBA 3EOYG 1ZGLB 1U6AL 1MNUH 5EO1B 1IGML 5DRNA 4Y4KB 5SX4H 2VN7A 1J0KA 5BQ7B 3HC0B 2ICWI 5DT1L 2IADA 2WUBH 4XGZB 4M3KB 4GBXB 1A6PA 1ND0A 1IAIM 5AZEH 3RDTA 4HXAH 2R69L 2WUCL 3PL6A 2GCYA 4EDWH 5CKGA 5J13B 2BHUA 2ZJSL 1CICD 1S7XA 4LLUB 5JOPD 3MNWB 1DANT 1A1NB 3SKOB 4AIZA 2PTUA 1WT5A 4MDJA 4XVUD 1QD0A 4GQ9L 5EFIA 5C09A 5DVMA 3K8KA 2UYLA 1KJMB 4XNYL 1FH5H 3TA3B 3NPSC 1TQBC 3CX5K 3FQRB 4F9LA 5EUOA 3LS4H 4R3SA 5CGMA 3KPRD 1I9IH 1QBBA 4S1SL 5MEOB 5J6HA 3S88H 4E42A 2P5EB 1BMGA 4QHUB 3SCMA 4X4YB 4R96B 3DLQR 2R1WA 3KXFA 4WW1B 1RU9L 3A6BL 1SBSH 3GSNA 1U41A 1I7RB 4I0PB 5CD3A 5B3JE 4HD9A 4Y2DB 3WDJA 1AFVH 1CGVA 5D7IB 3MPCA 1DLFL 2VZ3A 3BGFB 2ZSWA 3HN3A 4FXGA 2X70B 2VZOA 1RD6A 2FRGP 2J12B 3IDYB 1JNLL 5CZVL 1VDGA 1RUPL 1FBIH 4NRXB 3CC5A 3VXRE 4GMTL 5E6IC 5GISL 4HBCH 3VD3A 1BECA 2CJUH 1FN4A 1T21A 1F6AB 1CDYA 3GRWH 5F3HA 1ORSA 4X6DA 5ACZA 3IJSB 1A7QL 3VW3L 1PKOA 1OGAB 2YS4A 3EW3B 3NCBB 2NXYD 2FIKB 3TESA </