1AMXA

Collagen-binding domain from a staphylococcus aureus adhesin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
TSSVFYYKTGDMLPEDTTHVRWFLNINNEKSYVSKDITIKDQIQGGQQLDLSTLNINVTGTHSNYYSGQSAITDFEKAFPGSKITVDNTKNTIDVTIPQGYGSYNSFSINYKTKITNEQQKEFVNNSQAWYQEHGKEEVNGKSFNHTVHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Bacterial adhesin
molecule keywords COLLAGEN ADHESIN
publication title Structure of the collagen-binding domain from a Staphylococcus aureus adhesin.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 34
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 1997-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1amxA00
2F6AA 4Z23A 4HSQA 4IGBB 4IGBC 4UZGA 2F68X 3UXFA 2X9ZA 2WOYA 3PG2A 2XTLA 2Y1VA 5DZAA 4P0DA 3KPTA 2WQSA 3HR6A 4IGBA 3V10A 3RPKA 4IGBD 2OKMA 2X9XA 2X9YA 4OFQA 3RKPA 2WZAA 4Z1PA 3HTLX 3QE5A 5DZ9A 2X9WA 3QDHA 3PF2A 2Z1PA 1AMXA 3OPUA
chains in the Genus database with same CATH superfamily
1QLEH 1RJZB 3H42L 4IEFA 3LKSB 1OGPA 2Q3ZA 3EIFA 5KBKA 4APQB 3BFWA 3GMQA 3EYVA 3NN8A 5GGQL 1NFIA 3OHXA 3B1TA 4KHTH 1LMIA 3FT4B 3NCXA 4GKSA 2PWDA 5I2IA 2XZCL 2ZUUA 1HDMB 4L3AA 1EO7A 4KXBA 4PJDA 4AEFA 4A6YB 1U3ZA 5CP3H 3O3DB 4WY7H 2EH7L 4B7IA 2ZOTA 3NJXA 4N2GA 4N0FA 1XSJA 1CLCA 1BXVA 3ZK0A 3ZU8A 1OARH 2EUXA 5ID1A 5DD0L 5JW3L 4NRYB 4GIOA 3NZHL 3HMXH 2BOBB 4GXVH 1AP2A 5T5FA 2WAQA 2W94A 4FMKA 4M61A 1O6VA 1ZT7B 1ZLUH 4ALAL 4PLKC 3M17A 3HE6B 4WO0A 1W0WB 1E28A 4H8WH 4OW6A 1ROCA 5CD5D 3T71A 1QLRA 4OB5H 1FPTH 3KBFA 3ZZLA 3AG4B 2QPUA 4NPJA 4HAGA 2EILB 1SFDA 4LBEA 1LO0L 5KSAD 1NCBH 1MFMA 3DMMA 3DUSA 3TBTB 3GSQA 3D6GA 4OQTH 3QEHB 43CAB 2YD7A 3H0TA 3BSZA 3LIZA 4M9OA 4Z7AA 1TG8A 1AR1B 4O02A 1X5FA 4AG4L 1SVCP 2XTLA 4NUPA 2R8SL 4IKLA 3KLAA 5LO7A 5B3JE 3M7OA 4QEGA 5AVSB 3K6FA 3SGDH 2OR7A 3F01A 5I76A 3EOAA 5F3BA 3TV3H 4JM2C 5D2NC 3RVWD 4YH6A 1S9WB 3OF6D 4C56E 5DZ9A 3G9VA 3GIVA 1AACA 5IQLA 3QUZD 3W11C 5IKCB 2AXFA 2DYRB 5FB8A 3K81A 4UQBA 3B7RL 3D12B 4CVXA 4TNWK 4RRPM 1FG2B 4R8WH 3LDBB 5LCVL 2EH8L 4FXLA 4I1RA 2O26U 1B9ZA 5LGJA 5KW9L 4W81A 1MOEA 4M7LT 5J1TC 2GTZA 2NY4B 3HHRB 2O1AA 4TTDC 2O61A 1BW8A 3TVMB 3GMRA 4PJ5D 4HEPG 1R33A 5KUMA 3VQLA 5FCSH 1MCNA 4BFIA 2DH2A 3GXPA 3FFCB 5KOMC 3K2UH 4IBUA 1QEWB 5IEHB 4PUBL 2PF6A 1MLCB 4IHBA 3VGBA 3BAJA 3GUTB 1JCKA 3TURA 4LCCB 5L88L 1D5BB 2ZXEB 3F3HA 3WE6B 2YFNA 1U0QA 4FHKA 5CEZE 3P77B 3QRGL 4P4KC 5IQ7H 2C1OA 4L8DA 4IRZL 2AQ2A 2DWDA 4ZQKA 3SO3C 1KTDB 2FO4A 3RWCB 4RIRA 3DETD 2FJFA 4F7EB 1NQBA 1K85A 4OM0H 1W15A 2BXZA 3U4BH 2BO0A 4AT6A 1S9XA 5DMYA 2YA0A 4RGOL 3LV3B 2VDKL 5DUPH 4GW1B 1FDLL 2NSXA 1FYTA 3E1ZA 1F86A 1QP1A 3P9LB 4RFOH 4E41E 4NQDD 1CWVA 4Z7VF 1CGTA 3CVBA 4R96A 1R0AH 2EO7A 1M57B 5ACZA 3KPLA 1G7QB 2VR3A 2XLLA 2XG5B 3VXQA 3O4OB 1BM3H 2WLZA 4FYRA 4MDJA 5T1LA 4K2UH 5TDPA 2OMWB 3VFWA 3ZYOA 5B1JA 4MQ7B 3SDXF 4Y5XB 4JFOB 1EMTH 1J9TA 3MRLB 2BWIA 2IAMA 4GW5B 4G70B 4QT5B 5IFAH 5BS0B 4ZUTA 2EIBA 4LLWA 4N20A 3AG2B 4LLUB 1AKJB 4JFFD 4DKEL 1A7PH 2LU4A 2KI6A 3VXRE 3O3EA 4GUPB 4CSSA 1OK8A 3VXUB 3AS0A 1YMHA 25C8H 1I7ZA 4OKVA 3OC8A 1IGYA 1SBSL 2EYRA 1J8HE 4IS6B 5KAQG 2GJZA 3KPRD 4X9BA 1G6RL 1JCVA 5A2AA 3B34A 5F96H 5EU5A 3UG5A 1QSFA 2R4RH 3FU5A 3M88A 3QXAA 4UM9D 3W38A 3J07A 1ONQA 4M4PA 2ZUQB 3L3IA 1RQ5A 4NN6B 2JE8A 2GK0B 4IHOA 5F1SA 5KYUA 1F11B 3ZDZE 2XTJB 3FTUA 3ZT7A 2KZ1B 2JXMB 2XBTA 1P4IH 3CFCH 2H7WA 1E8XA 2V5SA 2MHAA 5I18L 4HJ0D 1DCEA 4YBHA 4HUVA 2WN2A 3CD4A 3DX8A 2CBTA 3ZY7A 4WV1C 1OIOA 4ZS6C 3AQXA 1DBJL 2X0VA 4KRNA 1Y7VA 4BWTA 3PGFH 3V6BR 5DTFB 2ADIB 5KVGE 1B2YA 4EUPG 1NOLA 1QR4A 2J6EH 2E9WA 4IIQB 3QWOB 2NX5A 2J73A 3IXTB 3RX9A 1KPRA 3EGXA 2JI1A 3O6LL 3Q01A 3O4LE 2XQYG 1IFHH 4ZMYA 5B4MC 4LPUA 2CGRH 3JWOL 1EANA 2Z31B 1A4BA 5KVEE 4FTVA 1ML0A 1M1SA 3BSHA 3GMOB 3MFGB 1F90L 1UWGL 1VZGA 4GG8B 5T1DL 4XRCB 3PQYA 2N0MA 2R0WH 2XN1A 5C6TH 1B4TA 1JGDA 1PDKB 1T89C 2XT1B 5ABZA 5DJ2B 4D9RD 1KB5A 3VDBA 2VZTA 4C47A 3FBQA 4WW2F 4N22A 2A99A 4WTQA 2GJPA 3IF1B 5BRZE 1YC7A 5FO9B 5LLIC 2VQ1A 4LL1A 3JWNE 2I9TB 1QI4A 1ZGLP 1UHVA 3CX2A 5HXMA 2EUZA 3D4YA 3VFUB 1KJMB 4EDWL 4GRWB 3UZVB 4OY9A 3IN2A 2XFXB 2Y22A 4HKZA 4DPBX 1CQKA 1E27B 5JQHC 1E6OL 4PJIA 4NGHL 3L9EA 3W9DA 2IFGA 3PV7A 4I18A 3KJ4B 4ZSOE 1N67A 4KNSA 5CN2A 5AOZA 1WA0X 3N0PB 5I74B 1JMXA 5JZ7C 2N7BA 2X3BA 4G8AC 1JL8A 4QJ5B 3FQWB 1NEZA 1ZIAA 1IO4C 2Y24A 4DW2H 3QZBA 3KPNA 1F56A 4UOQA 4J1UB 4MAUL 3T4AB 1BIIB 1CCZA 2F7QA 12E8L 2IAMD 4GJTB 1AIFB 1N0XL 5HTSA 1RUQL 1E90A 1TZAA 4YHKH 3OWEA 3ZE2E 3PWPD 5I1CL 3CFDB 2YAPA 5LXGH 1FBIL 4B9JA 3BT2H 2IWEA 3QQNA 2O5YH 1T3FB 3S9DB 4XPHH 2FGZA 2ZOLA 1QVOA 2CMRH 3SJVE 4N0RA 3T65A 3GBEA 3FT0A 1RXLA 1Z0NA 5TF1L 2ZJSL 4U0RB 5JW4R 4J39A 4H26B 1PG7W 3O8XC 2BSTB 4H1LB 4JRXE 4QYOB 1HCYA 5F89B 3HI6L 3TN0B 2X1XR 5JPMB 1QSFD 3O9WB 1OHZA 2JJTA 4LIQE 4K3JL 2TSAA 3MZGB 4QTIH 4AKOA 1T2QH 1W6LA 2LGNA 3T0ED 4JAMA 4ZAKB 2K1MA 5AW6B 1UENA 1CD8A 2IH3A 3ARBD 4JFDB 4MA1B 4IBZA 1M7DA 3RX5A 3RZWA 4Y1TA 3ZXAC 4F57H 3EUDA 1QNZH 3M45A 1LEGA 5DZVA 4WI2A 2VLJE 4RMWA 2Q20A 2F19L 4U6VH 3O6FC 2X42A 1FFOA 2PCFB 4NZ8A 1GGBH 4XNZB 3VD1A 1MIMH 2CA4A 4PJCB 1PX8A 4QOKB 4YWGH 3UDWA 5EEYA 4ODSH 4LSDA 2CHXA 3KYKL 2NX5D 1GCYA 5E2VL 4Y2DC 4OCYL 1P2CB 4LVEA 1T21A 4NOBA 1K4DB 3FU8A 2M1KA 2XQYA 4PV8B 5E2JA 5MENE 3MNVB 4FTVD 4IK7A 5AW5B 1IC7L 5KAQF 4WGWB 4U1MA 1JF6A 4HLZH 4ENED 3DJ9A 5PCYA 5C0BE 3ECBB 2ZOKB 3ZRCC 2C8NA 3HLAA 3NCYS 2PPAA 3GSRA 4GQ9L 4NIKB 3O3AA 4H44C 4ZO6A 5DZJA 1LM8V 4J7RA 5K9KA 1Z2KA 4K7PL 1P5UC 3KYOA 4S1RL 3NAAL 5IB4B 3MLYH 5JLZB 4HHAB 3B9KD 5FW6A 2XHNA 5I1GH 5CJXA 4L8CB 1KXTB 4MCZA 2CRIA 1EA9C 3MOAL 4KK6C 3CDFA 5LKNA 2AJXH 3AGVA 4WWKB 3V6OE 2VNCA 2AJZA 2F8VA 1ZLVK 4A6YH 3Q1SH 2BNUA 5HY9A 4JPIB 4I89A 5E99H 1KBKA 2PCPA 3ZE0E 1HAUA 5DEGA 2QPDB 4AQ8C 2X4PA 3IJHB 2A0LC 2OBGA 5L9DH 1HTYA 3QA3B 4GIAA 3TCLA 3VACA 5HYSA 3A6CL 3GS7A 3SE8L 4WKZB 5TE4H 3IRZA 5TPWH 2AAAA 3F8UB 4XP5H 5I8KH 3CC5A 3MUZ1 1MG2C 4P23D 1ZS8A 1B4JL 2ICEB 2PUQT 4OZGB 4XX1E 1VFOA 4W4OC 1TZ8A 4OJEH 5D7KD 1GPOH 5E1GA 5EZIH 5HDRA 4O4YH 3D39E 3KXFE 5HHPB 1ADQH 3IFPB 1C12A 5FF6B 4KX8A 5CZVL 4Q6IB 3DX4A 3QE5A 4BINA 4NBZB 1H3UA 3TC9A 4KJYA 3IVKA 3WNKA 5I6KA 3ARGA 1YUHA 2J8UF 4F58L 4WI5A 1T0MB 4UWQB 4MHHI 5T1KD 2YSSB 3PP3K 4YOKA 1DE4A 3CXDH 4X5WB 3FO9A 1NWPA 1UJ3C 3ULVL 5BO1H 1XF4B 4ZNCD 2VT0A 4BZ1L 4DQOH 2MNWA 3BP6A 4K7FB 4L1HA 4J3OC 4LLQA 1V8HA 2NUTA 1NCAH 1R46A 4G7QB 1DLHB 1G7MB 3MODL 3B2XA 4XVOA 1KJ2A 3FQ4A 3G5WA 3K74B 4Q6YA 2NNRA 1PIFA 4ZMLA 1NGZA 4Z76B 2APTA 3C75A 2BS71 2PW2B 2ZCKL 3MV8E 4HIEB 1AR2A 4X99A 1NBZA 1X9QA 1IBGL 2J88L 3IMVA 3IFOB 4KXAA 4X0KB 3WLWD 1G7HB 4TSAL 5I1IL 1A5FH 4UDUB 4P4RB 3QIWD 1N5AA 3ARVA 3KPMB 1T6VN 4XZUB 4AUJA 3P11H 4YXKH 4XVUD 3LKOA 5J89A 2BS9A 3C9NB 4QJ3B 3UIZA 3ZGIA 5HYQB 4NQCD 2XN9A 4KTYA 4KMQA 4PMFA 1EO8L 3QNYB 5D4QA 3QG7H 2PTTA 4B9CA 4B3EA 4MJ6A 3C8DA 3K6DA 5DLML 1CXFA 3VI4E 2JK5A 3GS0A 3HC0A 1DL7H 2RQ8A 2PMZA 3ZZQA 3A24A 3TA3B 4ZMVA 6PAZA 5SWZE 1UH2A 2YZ1A 3FTYA 1PD6A 4XI5C 1HL9A 5KYXB 4QGYA 3VMOA 4L4VA 2NY5C 5HYIA 1W72B 3DV4A 4WSJA 5EO0B 3TEXA 2UZYB 4NI6A 3EGSB 4BFBD 2W88A 4WI0B 3D3VA 3V4VL 2QSTA 4MS8D 4NC2B 2H26A 3NIDB 3LMJH 1Q0XH 3IXAB 5BJTA 1L7IH 3T1FB 4OT1L 4Y8AA 3I74A 1LP9A 2Z8VC 4CVZB 3VJ6B 4G43B 5DWUH 3QNZB 3CAFA 1GGUA 4AEEA 1QFOA 2IOMA 3DRTA 1CGVA 5L0QB 2ENYA 3FQTB 1JHTA 3HPLB 2X6UA 3VUAA 4NQQA 3O2VL 4X4XB 3S5YA 1DBAL 4AQAB 1JNLL 2PWGA 1SJEA 2XWEA 3HC3H 5C92A 3BKJL 3UBXI 3X13A 4UQ3B 3TBBA 3MBEA 4P04A 1SM3H 4PBVC 1YO4A 2KZKA 4HD9A 2H3NA 1QHOA 2K0RA 5I6OA 5IFJA 1YG9A 4L8SA 2X4NB 4R6UA 3GINA 4XMVA 4P46B 4PW9A 5E7BA 3WMSA 1RZPA 3ARGD 4QRBA 3DX9B 1J5CA 1DN2A 1KG0A 2DLIA 3SDAA 2V2TA 2EXWC 5CSGA 3NIGE 3BUBA 3FONA 2MQGA 2CO1A 4OSUL 5K1JA 4WHCA 4D9LH 2GBTA 4UT9L 4MMZC 3RA7L 2XETA 1EAPB 3MBWB 3NP3A 2CIKB 4OJFH 2MNJB 4F37F 1S78D 2E7MA 4PJHE 4E0RB 1I7TA 1PX3A 2KDYA 5FYKD 3DIFB 5F3FA 2Q7AA 1R5VB 4OKDA 2YRBA 1HHKB 4QXVA 1V54B 5FKAB 5INCB 3LS4L 2H8PB 4PRPD 4ZOAA 1NJ9B 4OZFG 1ZGLA 2FT7A 3KWTA 5L6YH 4IBWA 1KNOB 3T6XA 3SCMC 3MXVH 3QJHA 4YC2C 4J3XA 5D1QC 1OCRB 3F12B 4HCGA 4LOVA 2ZF8A 3S35H 3KAAA 3O3UN 5T3XH 2HJKB 4OGAD 4XCCH 2O5NA 2J56A 1O5DT 1QLFA 4WI6A 4KKPA 3WFEL 2XN9D 1TOXA 1JK9B 3IDGB 4V33A 1PEWA 1MUJB 1A7RH 1M1XB 4EDXB 5ILTH 1IM9D 1HSAB 4I2XE 1DJSA 3WKML 2EEBA 1AD9A 1PVHA 2GBAA 3GMPA 5HGAA 5BO0D 1NZRA 1PJWA 3GMMB 1WBZA 3LEXB 2ZPKH 4RA3A 4L4VD 1CLYL 1M2VA 3PGDA 4C56B 3KGRA 2ZCLL 1PZUB 4EMZA 1J1PH 4KI5D 3FFDA 3DTUB 3U1SH 3ECUA 2EXYD 3MRHB 2E3VA 4M62H 4Y4KC 2FEEL 2N3JA 4JGMA 4Y4FD 3DOIA 1SEBA 4H88H 3RURA 2X4RA 4XTRC 4PREA 1FGVL 4ZXBD 1XZ0A 5IMMB 4XPFL 1OAJA 1DO5A 2P80D 4H2AA 4JRFA 5IM7B 3ZDZF 4PRAA 4RDQF 4Y19A 2ZXBA 3P30H 1DQLH 2P5WB 1XF5A 3WNNA 4XMLL 2CD0A 4TOYH 2VIRB 1CT8B 4QHUA 3FB6B 5HHOD 4DGVH 1J9QA 2R1XA 5JHDA 2C1PB 1HKLH 3BVDB 2R23B 2GHWB 1G9EA 1NDGB 3ZUNC 4IJTA 1OF2A 5EF2A 3BZ4B 4FULA 4L3EE 1RZQA 2JCCB 2Y6SD 3NZ8A 1R9FA 4PLJD 3ZUCA 5TJWK 2G30A 4AMKL 1UM4L 4RA0C 5HGDB 1QSEA 2XZZA 4UT6L 5FCUH 1CTMA 1GKOA 1SJMA 4I48A 4JHWL 5C09B 1OKEA 4E41B 5ABDE 4A2GA 2BCMA 4XGZA 2E7HA 3FB7B 4YDVB 1NKOA 5DI8B 1H8SA 1YEGH 3WTWA 5FA3A 4YSRA 5I9QC 4QD2E 1FFNB 2A9NH 5D72H 4TQEH 3HRZB 5A2IH 3F65A 3FQ2A 4KVCH 3PWUB 4UUJB 4JNXA 1YEEL 3U9PH 3FC8A 1FSKB 4WUUE 3US0A 2NXYD 1YN6B 1DJGA 3NGBC 1MVYA 4BQ8A 1UWFA 4OCXL 4JFHE 2MNUA 5KSAC 3VXRB 4PRBA 2YARA 4G9FE 1ZS2A 2WSKA 2A73A 3MOBH 5AENA 5GIRB 3AB0B 1SMDA 4N1EA 5D71L 4MA3A 2LU3A 3NRFA 4GSDL 4KK9C 4BKSC 4DTGH 4F20A 4FFVC 1R17A 1LVEA 4OD1L 4Z0BH 3US9A 3W1ZA 5B8CB 1C8PA 2LLGA 1OK0A 4X9FA 3TYGL 4G5ZL 1T03H 4GAYA 1IC0A 3EYSH 1L5GA 2VXTL 3ZL4L 3N6YA 1TZGH 1ETA1 1U8PB 3BP5B 1C5CL 2OI9C 3AREC 3DDFA 4PJGA 1WCBA 1CZ8H 2GUYA 4AV0A 4XCNA 1C5BH 1OAUH 1YNTB 4PJAE 2QVTA 5D9SB 4KZ0A 2WV3A 2WQVA 3DPBA 5FA4B 4OF6A 4PM1A 4EZKA 3QS2A 2B59B 2VJXA 3LH2L 4Y7OC 1KTJA 1NGQH 1UC6A 3WFZA 1O7DC 4N0CC 2VOTA 5DYOA 4UMGA 2DWEB 1UFGA 3F6LA 4XX5A 3V52H 2CAKA 4OCNC 4X6FB 1ERNA 1PZ2A 2HKAA 2FO8A 2AMGA 2GEEA 4FJ6A 5DZLA 1G87A 1CK0L 2RFXB 4YLBA 5D1ZI 1WZKA 3O4LB 4XP6L 4OIIH 1BQSA 2D31B 2ZCZA 3ETTA 3PFUA 1FL6A 3LN4A 1ETB1 3OR7A 3S5LA 4WWID 3QFDB 1RUAH 1N19A 1Q0EA 5GQBA 5AL8A 2JVUA 4OUUA 1UWEH 1YYML 4K8RL 2OK0L 1AQDA 1FHGA 3H7BA 5EORH 4E5XA 2YN3A 1A6WH 1CD9B 4EIUA 4KQ4H 5KEZA 1IM3A 4MXVE 3P0VH 4OAWB 4J3WA 4PJEB 1YJDL 4X98B 2HZHA 4N8CL 4RCAA 1S5HB 3TCXA 3JVGA 3FB5A 5AVRB 4R7DB 1OXYA 1SY6A 4OU3A 5BW7A 4I0PB 1VADB 2A9DA 2E9BA 1MHCA 3G6AB 5EOQL 1QSED 1XIWA 2HUEA 1OHQA 4HIXH 1YN7A 3IMTA 4LAQL 1T66D 4JBSA 4ZMNA 3HZVB 1C16A 2AK4E 2GB2A 5KJ7E 2QT6A 3GJFK 4IKNA 3EJYD 3UZQA 1OAZH 4KPHH 4PPTA 1MCCA 2K8QA 4MNGA 4ZSOB 1JFQL 2YPKA 2PO6D 2CBOA 1WZAA 2XVGA 1J1XH 4ZFOA 1INDL 2PYED 1ACZA 1XBDA 3PHOA 2QTEA 4L4TE 5CBEB 4HDIB 1EHAA 4TNEA 3LN9A 3NZUA 1DLFL 3TT1H 4DKFH 1HOCB 4TL5A 2ZSWA 3WL9B 2P5EA 3P4LA 1XDTT 3C08L 2VDOB 4A2EA 1IQDA 2F58H 4D9QE 3VXPB 1EDHA 3RWEB 1U91B 1GJWA 2WW8A 2WBJB 4ALAC 2CDFA 1CC3A 3VD2A 4PGDB 4PY7A 4R2GC 3FDWA 4BE5A 5AZ2L 5C1MB 3C6SA 5IQ9B 2OTUB 2GY5A 4JRWA 1SUHA 4BEIA 5IB5A 3D06A 3MRJA 3RWFA 2F53E 4NBYB 3RY4A 4TUJA 3VE0B 4PSPA 1J8KA 2GAZB 4HJ1A 1N2RA 5E4EC 3MO1B 3MVSA 2ITCA 5IF0B 5TE6L 2TSBA 1XFPA 1CXIA 4KUZL 1KBWA 2JJSA 1QUNB 2XXFA 3TEUA 5D2NE 4J3OH 1W72H 1RZGB 2FR4A 2E74C 2VLJB 3LIUA 5CBAB 3T6WA 5GGSY 2JH2A 1ECYA 2IGLA 3F58L 1X7SA 3S3SA 1FHNA 3HKZA 3EO1B 3MC0A 5L7XL 3HZMB 5ANMB 3QEGL 1AI1L 1LYQA 3I84A 5DJCB 2D0GA 2Z65C 3VFNB 4BDVA 4NUGL 5KVDE 2K6ZA 3AW5A 1ZHBA 4LCYB 4ZFZB 3MLSL 1HEHC 3QHZL 4U3SA 5MENB 4X6BA 2CKNA 1THAA 1KFGA 2NTSP 1MHHB 1RFDH 1PCSA 2ADJA 3ALWA 5DEZA 4F27A 1I1AA 3WEXB 1N10A 5C0BB 4XPGH 2TRYA 3LRHA 1QQDB 1N0LA 3NG5A 1Q4NX 1R5WB 2EE2A 3TJEL 4CC1A 1IKFL 4WW1A 3KHOA 4DCQA 1YHPA 4FXKC 5C0EB 4R7XA 3MUGB 3WFBH 3EXJA 2OJZL 4BSWB 4UNVA 1M05A 3NH7L 3QUMH 4XPAL 4KRPD 2KT6A 1A6UL 3G6JA 1W2KT 2YOAA 1T22B 1U3JA 4YHOH 2H3KA 3SE4C 2EQDA 1VFAB 3LS5H 3MOQA 1HZKA 4Q4EA 1KN4H 4KKNA 4JO2L 4JPQA 3QQ9D 1NKRA 3APCA 3MV7D 5DJXB 3ZE0B 4DN3H 1NC4D 4YSEA 3KPSD 3H9SD 2FYYB 1I1RA 3KW7A 2OZ4H 1A9BB 1JHLH 1XH3A 2CCLA 3RVXD 1YQVH 4PJ9B 5T3ZH 3UTSA 4WEBL 1Z1WA 3CE1A 3BQUB 2EDTA 1MCHA 3KR3L 1VFMA 1BEXA 4X2UA 4HJJH 4BELD 5IB2A 1I8IA 1L9SA 2CQVA 3RQ3A 3U2IA 5D7JD 4Z7NB 1HS6A 4Y1AE 1QO3A 1U8OB 1OSZA 1YNLL 2OJ1A 2WTOA 3N43B 1ZV2A 3I75B 3JUZA 3RAJH 2VISA 1OP4A 3ULAB 2C3VA 3OPZH 1N4XL 3LHPL 4DVRL 5IB3B 1I8KA 2VH5H 3T0EC 5ESQA 3VXNA 1S6NA 2HT2D 3OBAA 1I3GL 2Q3AA 5IW6A 5E8EB 1NIEA 3B5HA 1IC4L 1J88A 3BN9D 3N44B 4FNRA 5I8EA 2X70A 4JO5A 1MJJA 5H35B 2AI0L 2ERJB 3ZDYE 4B7LA 2PCYA 1HCVA 2D7OA 5DEFB 1KGUA 2VJ8A 2DQIL 2DM2A 4M8QA 1Q1JH 4ZUVA 4FCHA 1ASPA 1AO7B 3JTSB 2V3FA 1U8QB 3P4NB 2VLLA 4R0LC 5CCJA 3EYOB 5SX4I 3WFDL 2ZXAA 4BKTC 3MJ8A 4HLZG 4MQSB 3GB7A 3MV8B 2ZYRA 1JTOA 2HJLA 4HISA 1EJ6A 2LVEA 1CICD 2FX7H 2J4WL 4KY1H 5F88A 3UGEA 4BH7A 1IGIL 1II4E 3CBJB 5D2LF 4ENEC 4WI3A 3D1MC 4QRRE 2DIBA 5T1MA 2L7EA 4DUVA 1CF8H 1T04A 2XQYK 3L4CA 3NJKA 5I8OL 4HKBA 5F6IB 2JF1A 2MSPA 1I1AD 5J6HA 3C5ZC 1HHIA 4G82A 3NT0A 1ZWIA 2R1WB 5EZLB 2X4SA 3DX2A 2AEQH 1JVOA 3G7TA 5LDUA 2IWGA 1F4XL 4NCDA 1MI5A 1KIQA 1KYUA 5MP6L 3JWOC 5SWZB 3VD4A 1KXHA 3OKDB 4XN2A 5E1HB 5C07A 3K6OA 4Y0GA 5E9DE 1MCKA 2GEQA 2L04A 4OCWL 4P5TD 1JD9A 2XVLA 1TQVA 2G5BA 4GAJH 2JV6A 4XAWL 1UM6L 3Q6GL 3QI9B 1EVUA 4RGND 5FHBL 4H8PA 4Y5YC 3LPGA 2RCSH 2I26N 4TMPA 1Z5LA 1DFXA 4JZJB 4KTEH 2LTQB 2QHLA 4JRYD 4K3EL 1FJ1B 4P23C 1SN5A 2CBQA 4DZ8A 1OD9A 4MJ5B 4PYGA 1R24B 3TNMB 1LWJA 2HFEB 2P43B 4WFED 5FDYA 3OAWA 4LO9A 4WK0B 4BK5C 3OX8B 4MNQE 5HYJE 2VSDA 4OZHE 4X6DB 4G2AA 3ZHKA 4DK3A 3CPUA 1JPTL 5D70H 4RZCB 5MERA 5I6NA 3CFTA 4BQBA 1KLUA 4UNIA 4F1SA 3CFIC 3OMAB 1C8QA 3L3GB 4P2CG 4AYGA 4DGYH 3BVNA 4YSSA 1GH7A 1J0ZA 3ML9A 4M6OH 3EDJA 4UOW1 1MFBL 3S36X 4GEIA 3C8KB 5AW3B 3GSWA 4UINH 2XZAH 3NIGB 2W91A 3CXHJ 4PP1D 3QJFB 1J11A 5J6GB 1KCVL 2YKLH 3VYPA 1MCEA 1R3KB 1FI8C 2HVJB 3OR6A 1CGSL 1LNUB 4TPRH 3BH9B 1VB9A 1NGWB 4XOAA 3RIFF 3WN5B 1Q0YL 2YPVH 3QAQA 3MR9B 4PJHB 1MXGA 1ZCRA 2XA3A 3K6IA 3C2SA 3QZNA 1K8DB 1KLFB 4HH8A 4XN1A 1BMWA 2OYPA 1IJ9A 2OZNA 2DBLH 4AL8H 2ROXA 3O45B 1KGCE 2VO8A 3L9RB 4LSUH 4GRMA 3FSZA 3ZIYA 3V4UL 4AH2B 3VFMA 3WLWC 3L95B 2YD5A 4KKLD 4C4UA 3GGWA 3GSNA 3LZFL 2K45A 1ZANH 2GSMB 1TQBC 5ADOL 4FQJL 5B1AB 2EDQA 2YA1A 3A23A 1PG7L 1YYLH 4M5ZL 3HG1B 2A7BA 4UV4L 4DN4H 3MYJB 1HIML 3DXAD 5D7IA 1NM4A 1ZDSA 3O3BB 3QNXA 3LKSA 3MLXH 1Y0LB 1NDTA 1IAOB 4APQA 3MBXH 3QEQE 4JVWA 3SZ6A 1DVZA 1AE6L 3Q2WA 3FT4A 4NZUH 3EGDB 1NSNL 3VG9C 4JPVL 3OMNB 2Y36H 5CILH 4I2XB 3D0VB 5F8QC 1MI5D 2CCVA 2ZX7A 5IVXE 3SE9H 4H0GA 2KPNA 5L2JB 3SSGA 1IARB 2F1AA 4HSAC 5C07D 1H0DB 4X9HA 3VM7A 4MS8C 1DVQA 3WY2A 4U6TA 4YUEL 3RU8H 2HAZA 1ZE3C 1WA2X 4KHXL 3V0DA 2XXGA 4DHLA 1A0QH 3H7LA 3AT9A 1LE9A 4PB9L 5L8JB 3OM3B 3OKEB 4ZBJA 4CKVX 4AWJC 4B95C 1SQMA 2AJYL 4U31A 5HDLA 3SGJC 1QACA 1E6JL 5CZKA 1W0WA 3I2CL 3D50A 1BMGA 4JJHA 4WFHE 4E9XA 4V2BA 4LZKA 1EH9A 3MMEB 3IETB 5D55A 3RGVC 2ID5A 4RGMB 3TBTA 1RSFA 1LO4L 3QEHA 4YHZH 1ULVA 43CAA 2BJMH 2C9UA 3CZEA 3D69B 5C0IB 5GS1B 3Q44A 2DLFL 4L5FE 5L4MA 4XMPH 1QRKA 3N41B 5KS9F 4L3EB 4WU7B 1JZ7A 4WQOA 4Y2NA 1N6QH 3X3FH 3ARYA 4JR9L 4K71C 3VWKB 5ES4B 2DM7A 4JQXC 1RUKL 1DUZA 4HMEA 1ZPLA 3BI9X 4Y88A 1SGKA 2H32H 2OW6A 3F7RA 2OM5A 3QIUA 4B6ZA 1NM9A 2ZNWA 4NYLB 1Q94B 4UILL 2IH9A 4GFTB 2N1TE 2OYKA 2DTML 5J7CC 1PTZA 1SUJA 3TIDB 3FO0L 2OSYA 5GGQH 3BPOC 1SVBA 2OYMA 3E6FB 5IK3B 2XZCH 4KBPA 3OKMA 3A6OA 3ULVC 4UIMB 4JM4L 4F93B 2R27A 4I4WB 3TJHD 1FF5A 3QIBB 1JNNL 2YRZA 5BV7L 4S1DC 3FFCA 2R2EA 1XAKA 1BJ1H 1CIDA 1QEWA 5I6LA 3L4ZA 3EHBB 5IEHA 1MLCA 2XACC 3GUTA 4RSYA 1IBHA 4LCCA 4NQVB 2F5AH 2PW1B 4QHPA 3ECVA 1AOHA 5DD0H 5JXEA 3O11B 3B56A 4PJBB 3BCFA 1DP0A 1ZPUA 4TQIA 4W68A 3IDYC 4Q58C 4YHLL 2BVYA 4CW1B 3QZOA 4A7GA 3WD5H 1W80A 1G94A 2WYHA 2EEFA 1LO3L 4MAZA 1OZUA 2YKKA 1PAZA 1A7QL 2W9DL 4ALAH 1OCWL 4L05A 1DJHA 4KZCA 1JDAA 4OTXH 3OWRA 4PG9B 4U1GC 3TESA 4QRAA 2R0ZL 3EZJB 4GW1A 1TEYA 1V7ML 4PEEA 4ZDHB 3E1F1 3QORD 1E30A 4CNIA 2EXYC 2VXQA 3PJNA 1G7QA 4Y4FC 5E4IA 4NAMA 1TU2B 2XG5A 3C12A 1AXTL 1T2JA 3QHFL 4PJAB 4S1SL 5FM5M 4IOIB 4ZXBC 1BVNT 2ZE0A 1LO0H 2BS8A 4A2HA 2OMWA 5KSBE 4MJID 1D7BA 4MQ7A 3QDJE 4Y5XA 4JFOA 2H0EA 4XXWA 4BFJA 3UJIL 3MRLA 4QT5A 4JFYB 3U0WH 3REWB 4DEPC 5BS0A 4GUCA 3HAEB 3Q8FA 1AKJA 1FYHB 3VH8B 5JW5B 1FZMB 1HHJB 5HHNB 4JM0A 1NCCH 5JQ6H 1EHLL 1ZK9A 2H1PL 3LIZL 4GUPA 2DYPD 2P46B 4YBLC 1HZHH 4IRJD 4H1LG 1NL0L 3CFEB 3F62A 3IN0A 3T0AA 4IS6A 5ICYA 4NP4L 4U1IB 3NCWA 4BZ2H 2XWTB 3QHTC 4X6CA 1P4LB 3RGHA 5JHLL 4YSOA 1V10A 2DJMA 4HOWA 3GO1L 5LCVH 2EH8H 2AEIT 4JO3L 3NBNA 2GK0A 5KW9H 1MNNA 1A3LH 1F11A 3D85D 2V5RA 2JXMA 2NT1A 5ISZA 4RISL 3CFUA 3VAEA 2BSRB 3QUKB 5B7EA 3B1UA 4M93B 5A3ID 1KYOK 4WGVB 3GHBL 1I31A 1S5IH 2WD0A 3CXHK 3QIUD 4FLHA 1MCPL 3DX6A 5DK3A 4FDWA 1B2WH 4N25A 5DTFA 2ADIA 3DURA 5BOJA 1FN4B 4WAFA 5I1LA 3HFMH 3ZL2A 3D4CA 3QRGH 4RRPG 3ZKXB 1G9NL 3QWOA 3S3JA 3IXTA 3DBSA 1MDTA 1JJUA 3G5XA 3CZKA 1TNNA 4JPKL 5GGRB 5C3IA 5IHHA 2Z31A 5DQ9A 4QXTB 4U7SA 3WNPA 4O58L 2EADA 4OLUL 3WEBA 2FE0A 1T7VA 1ZLEA 3CQQA 3GMOA 4PG2A 4F9PC 4JN2B 2VDKH 2DQUH 3HNTL 1FDLH 3MHZA 4LSSL 4XRCA 2GJ6B 2IXQA 5DDHB 1PDKA 3OXSB 4GKNB 5G4OA 5D1QE 1JZJA 4FC3E 2WHVA 5HI4D 5JXED 2C4FT 3NEEA 2VDRB 3CN1A 3IF1A 3T2LA 3BLBA 4HK3J 4ELME 3E8UL 2I9TA 3L4VA 2WXQA 4IJ3B 3VFUA 1KJMA 1GIGL 2HX7A 3QS3A 3UZVA 4HIIA 2XFXA 4OCSL 3IDMB 1E27A 2AJUL 4DKEH 4U3HA 1XR9B 4ZX4A 2IG2H 1YC8A 4GP8B 3A6BL 2FUTA 1R34A 4AE1A 3UTPE 1W0VA 3FL7A 1ZSDB 1SBSH 3NTCL 2YS4A 2BVPB 1F3DJ 2WO4A 3FQWA 2VMEA 2Y06H 4N86A 3T4AA 4LSVL 3BWUC 1BIIA 3E9UA 2DBJA 4GQPH 2GUOB 4NUQA 3SD5A 2Q2EB 4DOHB 2H9GB 1JERA 4APXB 2X10A 2Q8BH 4L2LA 1FORH 2E7DA 3QFJE 4YDLC 4MZ2A 1RK0B 5DJYB 2VN7A 4N0UE 1RP9A 1RVFH 5TQ2L 3MV9D 5I18H 5CEYB 4H26A 2UY6B 4GXUN 5DUMH 4H1LA 2QADD 4N5UA 1JI2A 5DFAA 1DBJH 1MEXL 3GFUA 5JPMA 3MA7B 1BF5A 4M7JH 3GLZA 3PWJB 4KY2A 1XGYL 3SO5A 5CSBA 4X8JB 3POCA 2JCWA 4ZAKA 3ZTDC 2ZG1A 5JNYB 1FVDB 4JFDA 5SWSE 3DO7B 2X6BA 3QYCA 3DGGB 4HZAA 2BP3A 1RZIA 2IQ9L 5EBLB 2EAEA 4JRLA 4LHUG 1E8ZA 3O6LH 1VEMA 4Q52A 5EULV 4AV4A 1MCFA 2ESVD 4M6ML 3R7QA 3EJYC 4J3VA 3TJPA 4KROD 4XP1H 1J0JA 5DURD 5I15L 5T1DH 1F90H 1UWGH 4N5ED 1SF5A 3QZMA 3CQFA 2YRLA 4HEME 2NY7L 2PCFA 2PO6C 2OXHB 2VKWA 4G6AC 4JO4L 3WLBB 5DJ8B 5HHQA 4PJCA 3EZ8A 1CL7L 4MAYD 4QOKA 5E5RB 4G72B 4HKJA 3B5GA 3QDGD 3SPVB 2Q76B 3IAQA 1T83A 2HLAA 1QW8A 3EFFB 3P9MB 1P2CA 1FLRL 4N6QA 2WP3O 1K4DA 1FGNL 1N12A 4QGTA 4PV8A 3MNVA 2BERA 4EDWH 3EOBA 4ELKA 1KB5L 2YJLA 3ZGHA 3L54A 3IDUA 4KXZI 1E6OH 3RWDB 4NGHH 2DF3A 4PWIA 1U8MB 1FRGL 2Z9TA 3DVNA 3FUKA 1ETZB 5FAAA 3BDBA 1D5IL 4JFPB 4H8HA 5LJYH 4TUKL 1QAWA 5JIQA 2D4FA 4EN3A 3NMEA 1EZVX 4HVBA 2V5YA 3U83A 2B5IB 4FNSA 4HHAA 4NPKA 4M48L 4L8CA 3RGBA 1KXTA 3HW7A 3UZEC 1QI5A 4Y16D 2IH1A 4A2FA 3GEFA 4QNPF 12E8H 2ARWA 4NQUA 2EVJA 4WWKA 1S3KH 3GBLA 3C6EA 5JW4N 1X5IA 2VXSL 4PN6A 1TKWA 3SPHA 3G04A 3N55A 1BX2A 4JPIA 1KXQE 4FNUA 1TO4A 5EU4A 1DDTA 1GOGA 3NJIA 3FO2B 4JQIA 4ZJ9A 4DH2A 3EJCA 5J06A 5TF1H 2ZJSH 4L37B 4K9EL 1HYSD 3QA3A 1F4YH 1WV7T 5I17B 1CGWA 1IGCL 1V3JA 2P48B 1BXAA 4WKZA 5BVPL 3MJ7B 1A4JA 4E2OA 3R8QA 4Z7QB 2ICEA 4HKXA 4OZGA 3TZVC 3V7AE 4KV5E 3TH3T 5HHPA 2Z8RA 3IFPA 3DPDA 5EUOE 5I75B 5FF6A 1O7DE 4H5SA 3N9GH 2EEAA 5DRWA 3QZPA 4BA0A 5GISL 2XWRA 2DWTA 2YR3A 4H13C 3RDTB 1TQUA 4NFDA 3TA4D 4G9DB 1T0MA 1VERA 3WDJA 4ETYA 2YSSA 5JORB 1WAAF 3QFGA 2O4EA 4LPCA 4G8GE 4X5WA 1YA5A 1AXSB 4KRPC 1NCDH 5CUSH 1XF4A 1JGUL 3KYKH 4D8OA 3SDCA 1JK8B 3LJ3A 3SDDA 5TK4A 4PMEA 4OM1H 3QQ9C 5CP7B 2XFGB 4PV9B 1P9MA 1WEJL 4F7TA 4LOEA 4ONGL 2UUDK 4NQDE 4IK6A 2VDQL 3MNWA 4FJZA 2KQMA 3DHJA 1YJDC 4M1GL 2GT9A 1FNEA 4XWGH 3K0YA 4J5VA 3IFOA 3PL6D 2ENSA 4X0KA 1G7HA 4MWFB 5CCKL 3CVDA 2N01B 4K7PH 4MB3A 4S1RH 4FG0A 4BHUI 1JMZA 1KOAA 3NAAH 4L1DA 3MUUA 3KPMA 3NCCB 4JDZA 5GJSL 2XX1A 4HSQA 1KCBA 1A6TB 2CLRB 3QYMA 3QR0A 3MOAH 3C9NA 2XWJB 3NA4A 1L6XA 1F58L 4MNQB 1FV1A 3LRSB 3UYRH 4OZHB 4JFFE 3U6XS 4FQXD 3QNYA 1WRFA 4YHNB 3D2TA 2WLKA 2MTAA 3ARUA 4JFZL 3VG0L 2IDCA 3VO0A 3EDEA 1FZKB 1HL5A 1QFWL 5C7XH 3N06B 4EN3D 1NGXB 4GT0A 3TA3A 5KYWB 2C9XA 1NBVL 1Z9OA 2CNZA 3A6CH 1BF2A 3SE8H 5ICZA 1KN2L 1LLAA 3NSDA 4D2NA 1OZTG 1NA8A 3O8XB 2QSCH 5EO0A 3H9HB 1K4CB 4W70A 4HD5A 4LARL 4KXZH 4KJQD 1AQ8A 4HA1A 4WI0A 4ZS7H 3S48A 2VDLB 3WENA 1U8IB 5AVTB 1HI6A 1HNGA 1ZVNA 3GXDA 1KWKA 1ZJBA 3R06B 3T1FA 1XR8B 5J13C 1XF3A 4CVZA 1BZ7B 3VJ6A 1PS3A 4G43A 1GYAA 3MDJA 3QNZA 1IBZA 4XC1L 2MFNA 1TLKA 1XXFC 3CHOA 3FQTA 1CICC 3HPLA 3GZPA 1WP6A 2WSPA 4X4XA 3H9YA 4AQAA 1QRND 4NCC1 3ZKND 4YR6B 2WMPB 4JKMA 2HFGL 5LAXB 3ULVH 3L5XL 3U9UB 1XGZA 4JHAL 2XIBA 4KNQA 1X6NA 3ZRFC 1M3IA 3PCYA 1E4KA 5DD6B 3HKFA 1BZ8A 4JQVA 4AW4A 1EGJA 1QI3A 3AVEA 5CEXB 1REIA 4AQ1C 2X4NA 4IOSD 4JVUA 4AYID 2VAAA 2PTUA 3QEQB 2JWYA 3DX9A 3WY1A 2FX8L 2E56A 2E27L 5LN8A 3VGGA 4P2OB 4TLTA 1BMZA 1JGVL 3HHMA 4J3OF 4WKXA 3FU9A 3D18B 3BP7B 2R9HC 4PGCB 4QHKJ 5I0VA 2J88H 1IBGH 1JOIA 4P5TC 1HU8A 2CDGA 1EAPA 1RUPL 2VLMD 3MBWA 3QWRA 5I1IH 4XB3A 3KM1A 2DV6A 4NFCA 4KUCF 4CUCA 4E0RA 2FJSA 3SDDD 2WCGA 2A9CA 3H2PA 4RGNC 3UJJH 3B2DC 4LSTL 1R5VA 4B9YA 2NYYD 1UFUA 3NCBB 5GSVB 1XV8A 2Y23A 4PP2B 5FKAA 3WKPA 2E75C 2WXFA 2H8PA 1I7RB 1IEAB 1NJ9A 3H56A 4N2AA 2FZ3B 4DK5A 2AKRB 1PY9A 1RIHH 4IBTA 3TF7C 4R26H 3RIFK 1ZKAA 2CO3A 4FA7B 3CXFA 4U6HB 3T3ME 1XX9C 5H94B 5A2JH 5ADPH 4JJ5A 4HCFA 2HJKA 3ZIMA 2XXMB 5G5DA 3GDBA 4JY5L 3ATDA 3HE7A 5IVOA 5F7HA 1N6UA 3PPEA 1JK9A 4TQHA 3MLRH 2VRKA 4JCMA 1L0XA 1MUJA 3B3IA 3MNMA 1M1XA 4EDXA 3HUJE 1U58B 4OT1H 1RULH 5I73C 3RWGA 3F85A 2E8ZA 4PP1C 5DHYA 2X05A 4MLIA 4W9CC 1BAFL 2Z6FA 3VA6A 4M29A 4MBRA 1BP3B 2DKUA 3AFLA 4MA8L 4CVWA 3BZDA 3GMMA 3LEXA 4ODBD 4CMMB 2JLPA 3T0EE 2K4AA 4C56A 3QQ3B 1BQ5A 2YPLB 4B9ZA 4R7LA 1FNHA 3BKJH 5HPOA 1R1CA 1FCCA 3MJ9L 3DTDA 5DC4B 2WZ0A 5FW7A 2GKIA 3MRHA 4TVPD 3FSWA 1A3ZA 5EEVA 2ORBL 1NH6A 2AZUA 1J18A 1NGYB 3NPSB 4WHTB 5FYJH 4EIZC 3THML 4LCWB 4HIPA 5E6IC 3OZKA 5I71C 2Y69B 1I1YA 3IBEA 1PZ5B 4ZO9A 1G4MA 1MIEL 3RILA 2ODIA 4NQED 2YGOA 2BNRD 1JGLH 3RY6A 1FAIL 3SE3A 5HGHB 3L7EB 3RA7H 2VIRA 1CT8A 4X7DC 3FB6A 2Y25A 1TENA 4NUJB 4KX9A 3SOTA 2WQUA 2OS7A 2C1PA 4U49A 3CZGA 5CM1A 4YZFE 1R3LB 3CVHA 4AC4A 1YEJL 3L4YA 3Q2CA 1E2VA 5E1AB 3OKKB 3LS4H 5TGBB 4JDEB 2D9QB 2JCCA 1KEML 1S8DB 3W5NA 1MWAB 4Y2OB 4Y89A 1L9RA 3EJTA 3IRPX 4YSDA 3EYFB 1ZT1A 4FQ1L 5HGDA 1L9PA 4XP9H 3FH8A 3CVIL 4X5XB 3W82A 3FZUD 3HR5B 1KCKA 5D1ZB 5ANHA 1OAQH 4Q0XL 4E41A 2XV6B 4YDVA 1T5XB 1U95A 5DI8A 4JDTH 3QC5X 1JXJA 4LE8A 1DJYA 1UEYA 1HXMA 5JPNB 3WFEH 2CKBB 5I1EH 5D5MB 4Z7UE 4G8FB 1TITA 1EEUA 4NCC2 1L7TL 3HRZA 4UQ2B 3QDJB 4O2EB 2EEDA 5EF1A 3PWUA 4UUJA 3WKMH 2A5UA 3FO1A 3NCEB 5DC2A 4YGVA 3O2DH 4KKRA 4NHUB 5A2CA 1GJIA 2QR0B 3WO4C 3MRMB 2H45A 2QQKL 1UATA 3VXRA 4LSQL 1X5HA 1E3XA 4MRCA 2Q2LA 2X1PA 3HE7D 3TPUA 4LVHC 5GIRA 5CINH 1QWNA 2CGZA 5B8CA 4DWHA 2W59A 4W9HC 3ARRA 1CS6A 2P9RA 1I4FB 4TKWA 4U1HB 5GRZA 3U7AA 4UB0L 4ZODA 4M1CC 4JKKA 1FO0B 1RZ8B 3U30C 2IBZY 1G0YR 2ICCA 4HFWB 4W93A 1X9RA 4NLAA 1O6SB 1U8PA 3BP5A 4ZMPA 4TVSa 2AVGA 4BFRA 1LO5B 2KMWA 4HMDA 2MJWA 3D33A 1IIKA 4EI6A 1QYGL 5D9SA 3B2PA 4B3VA 2DQEL 4XMLH 2BWDA 4TLSA 5CR1A 1IAMA 1NEPA 1OD7A 2ZP0T 2B59A 4PR5B 4R83A 1X44A 5JOFA 3KH3A 5IBTH 2VR5A 1TMQA 3TJHC 4BUGA 5LG1A 2RFXA 4NQXB 3LNHA 5LBSA 3O4LA 1NBCA 3MRRB 2D31A 3PDOB 4ISVB 2R69H 3B4NA 4F7PB 2OMUB 3QFDA 1FZOB 3EJUA 2CUAA 3PP4L 3TO2B 4UT6H 2ED6A 5JIHA 1I3VA 4JANB 5IQNA 1FWXA 2EDKA 9PCYA 4JHWH 1VGEL 2YBRB 1D5ZA 1OGAB 1UM5L 5D1QB 3MNZB 2FT8A 4FQLL 3HS8A 4NQCE 2VDML 2WO3B 2XX0A 4X98A 4A1RA 1E9PA 3X11B 3JV4B 5BRZA 1S5HA 2GI7A 1E4HA 1NUFA 4XMKL 5GS2D 3RFRA 3NPZB 1YNTF 4DK6A 4I0PA 4P5RA 3K46A 3G6AA 2ENQA 3BPNC 1YEEH 1O7VA 2CO6B 2XQBH 4DJMA 4PVBA 3ROLB 5EIIG 4N9GB 4PI0A 5EDXA 4ZMZA 1ZEAH 5D1XC 4G83A 6PCYA 3HZVA 2DTSA 2JKNA 4OCXH 4HOXA 1AZVA 4Y4HC 2ENPA 4FQCH 4ZSOA 6CGTA 2ITDA 2YSTA 3R19A 1BWWA 4DVBB 4GSDH 5BCAA 1F6FB 2G3XA 3FT2B 3PXHA 4OD1H 5H2BB 1BFOB 4FLQA 1PZ3A 3K5SA 2X87A 3TYGH 4G5ZH 5CBEA 4HDIA 4UQEA 3JYBA 1DVFD 3P4OB 3TASA 1MCLA 3ZL4H 2CWRA 5AYQA 1AHKA 1QSZA 3CZFB 3FN0L 5DF0A 1HOCA 3RHWF 4BCXA 5C8JB 4GG6E 3WL9A 3WO3B 2ZOUA 2CXKA 1DSFH 1SJVA 2FB4L 1UVQB 4PJEF 3KWUA 3SJVA 2YXWA 1JRHL 1MW3A 4N0UB 4A7UA 4BQ9A 3KYMA 2UVFA 1ZV9A 2O72A 3EJSA 4NXKA 4NC0B 1J8HD 5IESL 4I3SL 1U91A 5ESAB 1NMCC 4QIRA 2NSQA 2FX9L 5H37H 5AFAA 1TZHB 3LH2H 5IQ9A 5HHXL 5D8JL 4MNHB 4HUWB 3U4EB 5ACMA 2VDPL 2ZSVB 3X1EA 3QG6B 5B3NA 3VE0A 1R5IB 2FQGA 4OH2A 3MO1A 5IF0A 4DUXA 4HPYL 4WIQA 3FPXA 3QZWG 1RZJL 1QOKA 1QUNA 1WZ1H 2CGYA 1UXLA 4QRPE 1XF2B 1RZGA 2B77A 2VLJA 4P2AA 4IDLA 5KSVA 1F13A 3S88L 1QLEL 4K8RH 2OK0H 4HT1L 4XB7A 3EO1A 1UASA 3BGAA 3HZMA 1KJ3H 5DJCA 2NY2C 2P24A 4KHTL 3VFNA 3FCBA 1YJDH 3IYLW 4PRPE 3WEAA 5ELIA 5E8DL 4N8CH 1WISA 4LCYA 3Q05A 4K5MA 4ZFZA 1VZHA 1HWHB 3KGSA 3MCYA 4D0BA 2YAFA 1SHWA 5MENA 1IIIA 5EOQH 3ARDD 5HVWA 3GKWL 1NLBH 3ZYZA 3ULVE 1VCAA 1Q9LB 2ZAHA 5C0BA 3WEXA 2CE6A 2WP3T 3WIAA 1QQDA 1NPNA 2JI2A 2LHAA 3NGBB 5JOEA 1JFQH 1R5WA 3HMXL 5C0EA 4M5SA 5BRZD 2DQTH 3MUGA 2AHIA 1X4YA 3AQYA 4HK0B 4OD2B 4BSWA 2EDXA 4LKCB 4R9HA 1XTMA 5EC2B 5BV7C 2YA2A 3OC5A 3FU3A 3V6OA 5C0CD 2YHGA 3J7HA 2DS4A 2EE6A 3V4PB 1DLFH 3ATFA 1QPPA 3EH4B 2L3BA 4OB5L 4Z7WE 1PBYA 2WKGA 4KKBD 2KS0A 3L3JB 3WOVA 1F3JB 3C08H 5K93A 5C0AE 3HG3A 3QUZB 2FYYA 1PKQE 1NCBL 4GW4B 4Z7OF 3FTVA 2VN4A 1A9BA 4PJ9A 3CHPA 3BQUA 4N85A 3WJLC 4CJ1A 2WZPA 5AZ2H 4NJAH 5MI0C 4LU5H 1AJ7H 5BQ7B 2E76C 1AS8A 2XICA 4D94A 1HHGB 2NR6A 3MRDB 3K4DA 3QCUH 1U8OA 3D39A 3KXFA 3RPBA 3TV3L 5EUOB 3KVPA 1WCQA 3EG9B 3I75A 2ATKB 3U48A 4JJOA 5TE6H 5CN3A 4PJ5B 3SJVD 5IB3A 3HB3C 2Z91B 3CLEH 4NKQB 3Q2VA 2I9LB 4D0DB 3OZ9L 4C8XA 3VXSE 4JRXD 4R8WL 4IEFB 1GHFL 2P5PA 3F58H 1FL3B 4KH9A 4ZUUB 1KZQA 5L7XH 1UQSB 1XTLA 3CLWA 3GMQB 3QEGH 3DMMC 1AI1H 2H2PD 3HNSH 3Q2LA 4LRNL 4WI4A 1IGJA 4PHZA 2BDNL 3VNYA 4A63A 4OI7A 4X9IA 5K9JL 4N5EC 4OGQC 4PJDB 3HI1B 3MLSH 3DTXB 4Z23A 4UAOC 3QHZH 3EO0A 3RKDD 3P4NA 3K2UL 4MAYC 1M7IB 4OLXL 1IE5A 1QBLH 4HK3N 4PJ8D 3EYOA 4Z7NF 3RP1A 3V0VA 4KFZC 3SEPA 5ID1B 2QLYA 5IQ7L 3MV8A 4ADGA 5DHDA 3TJEH 1IKFH 4DP9X 3TO4D 2V8LA 4BSJA 2R83A 4OF8A 5FXCH 4XPAH 2LFEA 3NH7H 4L1SA 3GHEH 1A6UH 3U4BL 3QP3A 4BA8A 3M17B 5FS5A 4DQAA 2DEXX 1HCFX 5HSFA 1FVCA 3JT0A 5BUPA 1O9WA 2HX8A 3FCGA 1SMAA 5EZLA 3W0WD 1G9NC 3VI4A 1G1OA 5EA0H 2K8MA 2YN5A 2X40A 1BM3L 4JK0D 4LBEB 4WLCA 3FW6A 4R97B 1AZZC 1TF4A 3DUSB 3KPRB 4Z18A 5I30H 5SWZA 2DQFB 3IGAB 2V3DA 1EMTL 4WEBH 4O02B 4UM9B 5IHBA 3KR3H 1XH2A 5IFAL 1JI1A 2NMSA 1KTRL 1JYVA 4EI5C 4LVNC 5LWYH 1IB5A 1A7PL 1NOAA 1OT1A 2IAND 2KDGA 1YNLH 3EOAB 4JZOB 4LHQB 4AQZA 2WXNA 5F3BB 3HVNA 1HYSC 5CHNB 2V7HB 25C8L 4JZJA 4N2FA 4UQ9A 2ARJA 1N4XH 5AW9B 1FJ1A 1YYCA 4KJPD 4M9PA 1ZLVH 2IPTL 4ZUWA 2F7OA 1R24A 3FT1A 3TNMA 5IMOB 3G6DL 3V0EA 2HFEA 2R4RL 4Z3HA 4CVXB 3LRKA 2WZPD 3RZCD 5HP5A 1CR9H 1NFKA 1IC4H 3OX8A 1P6WA 5LGJB 3FQ1A 4HGKC 1TQCC 2QBWA 1SOKA 3L4WA 4X6DA 4BH8B 2DMKA 4BGDA 3D39D 3KXFD 3AWEA 3CFCL 4RZCA 1KIUB 2W95A 2X2YA 3ASOB 2VXVH 3GMRB 4S0HA 2MOGA 3SD2A 1NGPH 4X6EB 1Z0MA 2B15A 3QCVL 3C8KA 4ZNEE 2FCBA 1BFVL 4N2DA 3WFDH 4WENB 3HI5L 3QJFA 5J6GA 5KWYC 1R3KA 3VTAA 2DM3A 2J6EL 2C1OB 3K7UA 4HCRA 2EZ0C 3BD3A 4PWKA 1LNUA 2DLHA 4ZQKB 3BH9A 2ZAIA 2C9PA 4PJHA 2NRDA 2CGRL 2FJFB 2Q8AL 4FXKB 3IRCA 2K6WA 3L9RA 1S7TB 1PY0A 3KLSA 4HZLB 3ILDA 1RHHB 3MCLL 4OCRH 2ZUTA 2WC7A 1N26A 1XCXA 3PL6C 4LBAA 4AH2A 5I8OH 3TBYB 1D9KD 3L95A 3IJ8A 1BDYA 5EOTB 4QRSB 1T6WA 4PY8I 3F5WA 1L9OA 4BK8A 5JOPD 3WKQA 4MDJB 3T3MB 4ANWA 3HG1A 3VFWB 5MP6H 2VC2B 3MYJA 4NENB 5FFGA 4HW6A 1J0IA 1S2EA 4UTAA 2XYCA 3O3BA 1DZBA 2IAMB 2BP5M 5I1JH 4YX2L 2MOVA 1DO6A 1XEDA 1Y0LA 1IAOA 3PWPB 4LLWB 5FV1L 2YWYA 5BZDA 4CJ0A 2VAJA 4XAWH 3BUTA 1CO1A 4ZW8A 3HCVB 1VJSA 1ZHNB 4S2SB 3RYMA 1ADWA 5I19H 4GRLC 2GCYB 2IGFL 5EPMB 4I2XA 4IKJA 5B22A 1YMHB 1X5YA 3HUJB 3VGAC 3WS3B 4K3EH 1IGYB 1MJUL 2GJZB 5L2JA 4R90L 4PAZA 5CIPB 4P2RE 1B3IA 4DW2L 1F4WH 3FOMB 1QSFB 2C9QA 2WXPA 5F3HB 1KEGL 5CAYB 3KZ8A 1ONQB 2Q87A 4C57C 2MEJB 2FHFA 3ARBB 4AYFB 5C2BH 1WD9A 4WU5B 4WVRA 4A7SA 5KYUB 5LXGL 1JPTH 3F83A 1YPZE 3NDYE 4XPHL 2CMRL 2ZUYA 5AVXB 1T4KA 5LB1A 3OKEA 3DKHA 4AGOA 1OW0A 3HAEG 3VH8G 3DX8B 3LEVH 4MS6A 5BOZG 4F9LC 2B39A 3FT9A 4UTBL 4JL2A 4I18C 3CN0A 4EO5A 1AHWA 1G6RB 1TTAA 1P7BA 2UXTA 1QZ1A 1T2QL 4QTIL 3MMEA 1A3RH 3IETA 2HJFA 1DN0A 3LD8C 4OQ1A 4R0LB 3SQBB 3AQZA 4LRIC 3ARFA 2NX5B 4AEIH 4HFUL 1KPRB 1SF3A 3K72B 4B0MM 5L2KD 3TNNA 4F57L 3NJFA 2CSPA 2I7OA 5ALCL 2V9UA 4K9EC 5GS1A 4QHLA 4XH2B 4FTVB 3DJTA 4ZPTA 2XZQL 3V4UH 4L3EA 1BXUA 2R29H 3FTZA 5KANG 2A6KB 1JGDB 5CMAB 4WU7A 3TLRA 4RAVA 4RWHA 1CIUA 5D96C 1MIML 3LZFH 1KACB 1PGRB 3VWKA 1BOGA 1U9KA 1B6DA 1NCGA 2DQGL 4ZFFA 4OZIE 3PLYA 1PG7H 4POUB 3I9GH 4M5ZH 4NRXB 4UV4H 4JVPA 3B9KB 2FHBA 3PRZA 1JYXA 1JIBA 1HIMH 1D5XB 1HAWA 2A3TA 2VLRD 5HI5C 3ZTNL 4F2EA 5E4OA 1LWRA 4EN2A 3GSNL 3TIDA 1X7TA 4AXWB 1I8UA 4Z7UB 2VXUL 3E6FA 2J2ZB 1TJXA 5IK3A 1NSNH 1WD8A 1EERB 4FFYH 4UIMA 4ADJA 1ECZA 4NWTL 4I4WA 2F1BA 1FH5H 1ZAGA 2WWMC 3H9SE 4WUUA 3QIBA 4YFDB 1NEZB 1TJMA 4DFIA 4G6JL 4G9FA 4NQVA 1T7XA 2PW1A 3G08B 3N41F 4PJ6A 3BKYL 3O11A 4A6YL 2YJQA 4YUEH 2X0UA 2WWKO 3Q1SL 2MQCA 5KBMA 4JHVA 3MI6A 4CW1A 3D0LB 5E99L 4LHJB 3VNZA 4MCMA 3RVTD 1DFBL 2JKJA 1I1CA 1J5DA 1FC1A 1TVHA 2FGWH 2FVNA 1HE7A 2AJYH 3NJVA 1WWWX 4PG9A 3PABB 2B0SL 3WBDA 2WZAA 5TE4L 5TPWL 5I8KL 5T1KB 4K5LA 4FABL 2WPGA 5FYLL 2Y2TA 5EZIL 3T6QC 3B37A 1TU2A 4PJAA 1M53A 1QFUL 2IH3B 4X7SL 4IOIA 4OCMC 1M7DB 4UF7C 2KBGA 3LKRB 2WQAA 1LO4H 3MLPA 4OIAA 4WWOA 4K4KA 2JJUA 2ADGB 2P8PA 4PJXE 4JFYA 2DLFH 3REWA 4UQCA 1VPOH 3VH8A 2NNAA 1FZMA 2D0FA 4PJBF 2H4EA 3CXDL 5DJZB 3KEDA 1EFQA 3KL3A 4JR9H 1AQKH 3CFEA 3QIWB 2XWTA 1IGML 4HZ1A 3BLPX 4XVSH 3TS8A 2DIJA 3EDDA 3IMRA 1DQKA 1HKFA 1T21B 3CHXA 2W8CA 3PE9A 4KQ3H 4UILH 2D7MA 1S9YB 4F2ME 2WOBA 4P06A 3KWWB 2DTMH 3MLTA 4ERSL 2FJUB 4NQCB 1K3IA 4GP4B 4NZFA 5DHMC 4U1MB 4P3DB 1IKNC 2RH0A 3I9AA 4RMTA 2DKSA 3V10A 3RIAF 5HPMA 3HLAB 3K91A 3GTNA 4KXCA 4JFUA 2J1KA 4JM4H 1FG9C 1A5FL 5HD8C 2ZZUT 3WFHA 1JNNH 3KYOB 4MGXA 3L4XA 2R2BB 4PJFF 3B9VA 2OTWB 2WBWB 2AK4A 1DQTA 4YXKL 3VTMA 1VZIA 5DD3L 4MRBA 4Z95H 1FN4A 4LF3A 4CVUA 1VACB 3RBGA 1QPKA 2X9ZA 2AJZB 2ZIDA 2CLZA 5DMKB 3QG7L 4RGNE 3TIEB 1J8SA 3I9PA 3PS6A 4NQTA 4TLKA 2CNYA 4YHLH 2YGVA 2PCPB 2OMVB 3LH8A 2Y7MA 2ZXDA 4JRYE 1G7PB 5C3TA 3INOA 1Z9MA 2XBDA 1A7QH 4FEMA 4L4TA 4QXTA 1OCWH 4WUUD 2HN7B 1XZWA 1TQSA 3QBTB 5HYSB 5DYFA 1V7MH 2AXHA 4NZRH 5JR1H 4WFEE 5T5FH 5DDHA 3OXSA 4GG6B 3CC5B 4G9FD 5SX5H 4Z7WF 2BPBA 5FX3A 2J3SA 2D2OA 2JJWA 5K9JH 1G7JA 2DL9A 1DEDA 3QHFH 1ACCA 4S1SH 1C12B 4GAGH 1KXVC 4O2FB 1Q0XL 4KXDA 3DO4A 3ZMEA 1O75A 4RFNC 4Y1SA 3ZDXB 4KJYB 3IVKB 5DWUL 2F7IA 1ZDQA 2VM3A 1T7YA 2VXQL 3ARGB 2F53A 4IDJH 4XN4A 4WK4B 1EQWA 3QK0A 1A6VH 2B1OA 3QXWA 1XR9A 1OAYL 2CLVB 1M6OB 3HC3L 2H1PH 3BSZH 3LIZH 1IMHC 1PZAA 3FO9B 4O02H 4HULB 5EBMB 3VI3F 2P1YA 1TO5A 1ZSDA 4JM2A 1SM3L 2FEDC 5D2NA 1UWXH 1LDPL 4XO4A 1NANI 3K8LA 4OLEA 3BP6B 3RB7A 2IFFH 4ZW6A 5JHLH 1ZVSB 4LT7A 3W56A 1NPUA 3ZYJA 3GO1H 2GUOA 3RUGE 1TTCA 1KZYA 1X5GA 2EE3A 4JO3H 4APXA 1OLZA 1AS7A 4PRPB 1ZT4B 3ETSA 1CL7I 1KENH 1QFPA 1U8KA 4RISH 5L4FA 4D9LL 1RK0A 5DJYA 1SOSA 4OLWL 1OVZA 1YEHL 4X99B 2D3NA 2B3IA 5C08E 2KZWA 3UOAB 1J05B 1YLBB 3GSOB 3IDXL 8PAZA 3DXAE 3U2JA 1HVXA 3A5VA 3MA7A 3NYKA 5JIPA 3EJJX 3LKOB 3PWJA 2AF2A 4X8JA 2CUIA 2XN9B 4B0MB 5JNYA 2K6YA 2O30A 4HUNB 2Y7SA 1A9VA 5KSUB 3HG5A 5EBLA 5L6YL 1AXIB 3QB7C 2DWXA 1Q38A 4DPAX 1IM9B 2JK5B 3HC0B 3KWXA 3GI8H 3MXVL 4H7VA 4QXUL 5DD1L 5J11B 3IDYB 3VSVA 3GMLB 3S35L 1S46A 3L17A 4O58H 5GGVL 5IOKA 3CMGA 5T3XL 2KC0A 2NY1C 3HNTH 2AITA 4LSSH 4AI7A 2VCOA 4U1GB 1BBDL 4L4VB 1CXHA 3VD7A 3DV4B 1ROWA 2D9CA 3B2VL 2QMJA 3NOIA 4EZMA 3SPVA 1WFJA 4FXGC 4P2QD 1PKQB 5C0JB 2Q76A 5EDSA 4GP5B 1A7RL 3P9MA 3EFFA 3E8UH 3GJFH 4GIPD 5ILTL 1G1CA 4CDHA 4ZXBB 4L4TD 1GIGH 5LNEA 3BGMA 2O6PA 1F2XK 1BJ8A 2XWCA 4OCSH 2NDFA 2AJUH 5EU7C 3QR1A 4PLKD 1JHTB 1U8MA 5JMOC 1ETZA 3HC4H 3A6BH 1H8NA 2UWEE 3AWFA 2X88A 1YAZA 3IAPA 2NZ9C 2Y72A 3U1SL 1IAIM 3IBOA 3MBEB 4WRLA 3TVMD 3NTCH 2LLLA 3WSQH 3IJYA 4M62L 5D4HA 4D9QD 5HHOB 5ERWB 4QJ4B 4HS6B 4KDVA 1Z9NA 2H3NB 4NN7B 1F42A 5IFJB 3VFSB 4L8SB 3EH3B 1G1KA 3I6SA 3ESUF 3SYPA 2G2NA 3CWGA 2F53D 2B16A 5KJRL 4UTCA 1I9IL 1KTCA 2ZAGA 3GDCA 1ZLSL 2BZCA 1NFDE 3T2QA 3P30L 3QQ4B 3AWGA 4DP0X 4Y5VC 1KCUH 3UADA 3FO2A 3FTSA 2FD6H 5EZOL 5AAPA 3OPUA 4Z77B 5TQ2H 4JM2D 1GC1L 4K23L 4L37A 3U36A 3LNIA 3TM6A 3V0GA 5I17A 4N2EA 3FU6A 3LX9A 2AANA 1OPOA 1MEXH 3MJ7A 4G7SB 3W2DL 1BA9A 3ELQA 3W11D 2D3LA 5AVWB 1VRSA 1XGYH 4N1CA 4WV1A 2G4EA 2HT4D 3VFOA 2R4SL 4V1DE 2QELA 3UROR 5D7LD 4HWBA 2WSDA 2DH3A 3DRQB 4P5KB 2IQ9H 4FHJA 4M7ZC 1H5BB 3PNWB 2IBBA 4M6MH 2NXYB 1UD8A 3RDTA 2YOCA 2ZD0A 3IAGC 1BZDA 2H1LM 4G9DA 3NFSL 2I69A 1WSST 3LKNB 2OV0A 4JO4H 1EK3A 4UU9A 1AXSA 4Q14A 1C1EH 4YMPA 5D72L 1EEQA 2A9NL 1PAMA 1QFWI 5AOJA 1T89A 2VYRE 1JK8A 2NW2A 3FF7A 4KVCL 4P4KD 1Z3GL 5E9DA 1FLRH 1OTUC 1MCOH 4FGMA 1FGNH 3REVB 2NY6B 1AD9B 4XPTL 3KWVA 2R56L 4PV9A 1SJXA 3GBNL 1KB5H 3V6FB 1F4HA 3C5XA 5DXWA 1WBZB 4Z7QF 2CH8A 2CHDA 1FRGH 3MOBL 3RX7A 5BRPA 1WTGT 5D1XE 5JA8B 4TUKH 5CZXC 1JDCA 3U4AA 1E42A 2NCMA 4MWFA 4MJIE 4K73A 2AQSA 2SODB 5ICXA 1UT1A 5D4JA 1TMCB 5HHME 4A38A 2EEXA 1A6TA 4PREB 1VSCA 1KV3A 2IALA 1T5WB 3H1ZA 4MNQA 3LRSA 4OZHA 3MGTB 1TZGL 4Y1AD 1BQKA 5M94B 4YHNA 3N1MC 2VXSH 3UIYA 5HBBA 1CZ8L 1TJGL 4AVJA 5D7HA 5GGTA 4AQEA 4Y19B 1T2XA 1C5BL 2WINB 1NGXA 3HRPA 4OLYH 4E42B 3DSFH 1IGCH 2J6WA 3UTTE 3BWAB 5BVPH 3BO8A 4W9LC 3O8XA 5JMRA 1X5MA 2G75B 5B1BB 3H9HA 1K4CA 3V52L 1LL1A 4ZUSA 1OF2B 2F8IA 1ET5A 5KTEL 3RKDC 1U8IA 1DDHB 2DJUA 4HG4J 3R06A 2ZQKA 4PJ7E 2DQJH 3RRQA 1IZJA 2YQ2A 1CGUA 2NLJA 1RUAL 2L8AA 1QSEB 2D0HA 3VXOA 3AAZA 3SN6N 1KCWA 3AXLB 2V5MA 4I48B 4XGZB 1OWWA 3FOLB 3CSYA 1HL8A 2WLNA 4KQ4L 4ZS6D 4YR6A 1HT6A 2WMPA 2N59A 3P0VL 5FA3B 5LAXA 2D7TH 2GQHA 3O6FA 3U9UA 4YEFA 1JGUH 2PYEB 3T3PB 3ASNB 4OZIF 1RZJC 4NEHB 5KZCD 1DANT 4QRRD 5IW3A 5DUBB 4HIXL 3CIAA 2L7JA 3QEQA 4BWWA 1WEJH 3Q06A 1JXDA 4ONGH 3BOVA 3S36H 5B39G 2VDQH 2XSKA 4KPHL 4FQ2H 3D18A 4I3RL 2WOYA 4AW7A 1KYFA 4M1GH 2LOEA 4NDMB 4MA3B 4M3JA 2JKIS 3P1VA 5IVXA 3UAJD 5IVZA 3C09C 3CV5A 2Z4QA 5KYYB 5E9DD 1AGDB 5E9AA 1P5UA 5D6DA 1MPAH 1IVLA 5E1IA 3E6HB 4Z0XB 4PP2A 2HKFH 4U2YA 4DKFL 4KJPC 1I7RA 1H3TA 1IEAA 1F45A 3GNMH 2X4UA 4H4NA 3QJSB 2AKRA 1M9WA 2J1YA 1XIWC 4X5PA 2B4CH 3NEXA 1A6ZA 3RZCC 4U6HA 3DUUA 5H94A 5MEQB 3C2AL 4WJKB 1NBVH 3PHSA 5IT2L 1SNRA 1MQ8A 5JZ7D 2Y2WA 3UPRB 1H6TA 4GQZA 4IMLA 3NCMA 5DYOB 1H6UA 2CHNA 5HYJD 4LFHG 4U3XA 2PCXA 3CBKB 3V79C 5B3SB 1IU1A 5JIMA 1JUFB 4NKOA 1OY3B 1TNMA 3MV9E 2VLKE 1DQDL 1W72L 5JA9A 1TYRA 4PJXF 4ODTH 1FAKT 1DJZA 4M8VA 4G80A 5TH2B 3QEUB 4BWUA 4E5XB 3MACH 3S37L 2OMYB 1IM3B 2APWA 4JN1L 3NA9L 2HFGH 1C08B 4XE5B 1U8LB 3WEMA 3CH8A 3OXRB 3FB5B 4BIKA 4B5ZA 4IRSD 1TCMA 1UJ3A 4GLRH 4KRPB 2BMKA 4MDIB 3T4YA 2ESVE 2AXWA 1D9KC 1TT6A 2EDWA 3H6AA 1KGCD 1RFDL 1NGYA 1EZLA 5PAZA 1F00I 1F8TH 3ILPB 2FX8H 2GIYA 5DVNA 4LCWA 4CN1A 2NY0C 1JGVH 4JG9A 1JE6A 3UZQB 1YMME 1E9OB 3MV7B 4MNGB 1A1NB 3U1QA 4FLSA 5FYKH 3QDGE 3KPSB 3H9SB 1WT5C 3L7EA 1UCBH 4LOFA 1KJ2H 3BJLA 1R3LA 4YHOL 2G3MA 3RFZC 4LSTH 1KBPA 1TZIB 3QRLA 5D7JB 4Y2DD 4F8QA 4Z7VE 5E03A 3OKKA 5AVVB 1KN4L 2J71A 5TGBA 4JDEA 3TL5A 3PREA 3WG7B 1EAQA 1F41A 1MWAA 2IADA 3NJLA 5K9QI 4OV6F 2AVFA 4DN3L 3EYFA 2NXZC 3EDKA 4LP4A 1S9VA 1IQDB 2ZWLT 3RTQC 4YSAA 1BYPA 2OZ4L 4X5XA 1YQVL 5T3ZL 2ADFL 2WXKA 5D1ZA 5B7MA 1ZTXH 5DJ6B 3WN6A 4PGBB 1F3RB 4HJJL 5CCHE 3OG4B 4JY5H 1EHNA 4HALA 5C0FA 3NJJA 3ISRA 5JPNA 1GZPB 2CKBA 3OJ2C 5D5MA 4G8FA 4OBRA 1URZA 5FM4A 5KSBA 5J0BA 4A2MA 5BNXD 4L1TA 1H19A 3QDJA 2CU9A 3ZT5A 1QKZH 1LK2B 1W6WA 3OPZL 4O2EA 3VX0A 1HC1A 4MMXB 4WO4D 4XN9A 1QBBA 3MROA 3OKNB 1J0KA 4LHUD 4NHUA 2QR0A 2CCWA 5FPIA 4MA8H 3MRMA 2Q10A 4PU2A 4MJHA 5M7QA 3QJZA 4WFHD 3SDYL 1XGQA 3TH2T 2Y5EA 1DQJA 3MJ9H 1CICB 3IWUA 2Q6WA 1G4RA 1JZDC 1NAMA 2WIIB 1EJFA 1X9UA 1I4FA 4Z3JA 2VW4A 3QCTL 5E5LA 4F2MB 5EEZA 1FO0A 4X6BB 3OGOE 3CHRA 3FQRB 4HFWA 4G1EB 2WJ7A 3Q9PA 1P53A 1O6SA 1I1AB 2JI3A 5IBLC 3THMH 4Q7DA 2NCEA 2BY1A 3SKMB 4Z3IA 4X4YB 4YEEA 1G7LA 2HWZL 3HG0A 4KY1L 1ORQB 2GI0A 5BQDA 2XIDA 3M1CA 1IC1A 1M05B 4PR5A 1J86A 4P5TB 4ATWA 3BPCB 3G6JB 1E4XI 4CMHC 5AB2A 1TQTA 3ZRSA 5IJKC 3V5KB 3KS0J 4J3OD 4RGNB 4OIFA 3VDCA 3FNKA 3L5IA 4NQXA 1KEMH 2AEQL 2NY3C 2VUYA 1UXSB 2EIKB 2XRAH 3PDOA 4IBVA 4M43L 4ISVA 1T80A 3IPFA 4F7PA 2OMUA 2QDVA 4KUCD 2ZX8A 3TO2A 3UG4A 2PN5A 3B9AA 2VL4A 2DDQH 1I8AA 2HVKB 4M4RA 1OM9A 1XEUA 2FJGA 5DQJB 4AIZB 5B38B 4Q0XH 2YBRA 2QGEA 1OGAA 4PLOB 5D1QA 3MNZA 5IB2B 1MREH 4GAJL 1QSVA 2HH0L 5FM5O 4Q97A 1QO3B 3HS0C 1GYCA 1HN1A 3JV4A 3Q9QA 3HG2A 5CGTA 3ZTCC 5AW0B 4ELMA 1L7TH 4GO8A 5FGRA 4HC1A 2A4CA 3K8KA 3NIFB 1NOFA 3IK2A 5DJDB 2UZXA 4FZEH 2Z35A 3ROLA 5CS7A 1P6FA 4WWPA 5CJ8A 3VXNB 2KL6A 1T7ZA 5I73B 3QUXD 4OFYD 1W8OA 2OP4H 3PQYE 1BHGA 1H15B 1YCSA 4KU1A 3IFLH 5D70L 2K78A 3RIAK 1MJJB 4DVBA 1OOAA 2CHZA 3FT2A 5H2BA 1OSYA 4DGYL 5AAWC 5FHAL 2HTKC 4OF3A 5EEXA 1VGKB 1GRWA 4Y9EA 3P4OA 3SGEH 2P47B 3RUGB 4PCSA 2VLLB 3EADA 1DVSA 1WG3A 2IWFA 2EC9T 4UINL 2XZAL 1FCGA 5BZZA 4ZG1A 2YKLL 4RNRB 1QRNE 1ID2A 1WZMA 4N0UA 5IG7B 4TPRL 1IILE 2W0LA 2DQEH 4BH7B 5D93C 4M56A 5ESAA 2OYLA 3TBVB 1IKOP 3DXAB 4YSCA 3B9DA 3OAZK 3BDYL 1TZHA 3FQXB 4AL8L 4LSUL 4MNHA 4W6WB 4AV5A 4HUWA 4JZNB 3U4EA 1BPVA 4Q74A 1HHIB 3APDA 1R5IA 3Q8AA 4G11A 2X4SB 1G6VK 4TQPA 4K9JA 5KG9B 1VDGA 3FPYA 3ALXA 3APFA 1MI5B 1ET8A 2VLME 2F7PA 4MKMA 3B8SA 2XV0A 5CSZB 5C07B 4HEMA 1JXGA 3MLXL 1VGEH 4MSWA 3WJMB 1UM5H 3LQZB 5LBSL 4FQLH 2CBMA 1U36A 4M3KB 4B9GA 2VDMH 3L5HA 3BD4A 4WTWA 4LQ1A 1QR1A 1Z5LB 3WNOA 4JUSA 1NKGA 3LNDA 3DARA 4I88A 5A40E 1YVLA 4DZ8B 1ASOA 1SYVA 2ITEA 2GIMA 3HA0A 4I1NB 1Q9LA 3SCMD 3SGDI 3N85L 2EIEA 1TETH 1CD1B 3CFBB 2UWEB 3RU8L 5IROC 3S3DB 4NNPH 1UT9A 3FSVA 5KSAA 3KCPA 3BZEA 1A0QL 1A4AA 1F02I 4IBSA 5MERB 1QNIA 4OD2A 1KLUB 1FZJB 4LVHB 4K7PY 4LKCA 4APQC 3HHSB 2WKOF 5EC2A 4WUKL 2KHAA 4EKXA 1WDAA 3V4PA 1N59B 3FN0H 2EDMA 5FOJA 2JIXD 3Q3GB 2F54E 5HDBF 1E40A 2G0KA 3OF6A 5HJGA 5F72S 2WQWA 3L3JA 3ESNA 4YLQT 1MZZA 3UTPD 1JRHH 2BC4A 2ARJQ 1B0IA 1QG3A 2X6AA 1C5DA 3ARPA 1S7XB 3FUNA 3OR6B 4MXQC 4PS4L 4E9QA 4YHZL 1MCQA 4JL1A 2BJML 4I3SH 5IESH 5A6IA 4OR1A 1KWGA 5CNHA 3SODB 2Y7NA 4EBQH 4I85A 3BHBB 5BQ7A 2J8UE 5HHXH 5D8JH 1HHGA 3MRDA 5GHWL 4Y4KD 2VDPH 1IBBA 2VDOL 2P8LA 1VEOA 2WWNA 3VFMB 5EUOA 2RIKA 3A67L 3EG9A 5EC1B 4XTRD 2DPKA 2ATKA 3CSPA 3AU0A 4PS8A 2ZUSA 4MYWB 2YXMA 3GGWB 3QFJD 2BK8A 1IGFL 3HE6C 3PPSA 4JFTA 4NQEE 3X3FL 4Z3EA 2BNRE 1YY9D 3BIKB 2Z91A 4LIQL 4PJ7F 3OZLA 1HINH 4MKTA 3H3BC 2I9LA 4D0DA 4POYA 2AQ3A 4IBLT 2DOCA 4BK4A 1O7SA 5D7IB 4XO3A 3QNXB 4HT1H 1FL3A 4ZUUA 2OW7A 2WLMA 1UQSA 4A37A 5J9PA 3UMTA 4RETB 1D2OA 5F7AA 5SWSD 2HTLC 5E2TH 5E8DH 4PHXA 4JGNA 5AZEH 3HI1A 1I75A 3DTXA 1OAKH 4XNXL 2G2RA 1T0NA 4TVUA 4W6YB 1PNDA 1IAIH 3GKWH 4NP9A 4MJJA 2J1XA 3WHXB 1M7IA 4NQDA 3QORB 3MLZH 2F5AL 3CCHB 4QMEA 4ZOEA 5FUCE 4NZDA 1DEEB 1SY6H 3KPOB 4QRUB 3FBKA 4KNTA 5DRZB 3OVUB 1BVNP 5GS0H 5AW2B 2BP0B 4MB4A 3RL1B 3WD5L 3LDBC 1LE9B 2OMTB 1GS8A 3MLWL 3FCTB 4OTXL 1CTOA 3HJ0A 2HPOA 1WBYA 5IUCA 4N8VB 1BVLA 4JFFA 2Q3XA 4F3FB 1CDJA 2BCKA 5LNGA 3BRDA 2H0FA 4OVUA 1N64L 2M2DA 4XC3L 3TVMC 1KBBA 2FATH 2KPWA 2V37A 5DHVB 2DYPB 5I1KL 4IRJB 3T8XA 3HFFA 4Q4IA 1R47A 3KPRA 5DGQA 5DT1L 5C9KA 3TPKA 1JPGA 2DQFA 3BN3B 2M83A 2PR4L 3HNVL 1UUNA 2JLLA 3IGAA 4LCCC 4PJDF 5EU6E 3UXFA 1DBKL 4UM9A 3EYQC 1WS7A 3U0WL 2A6DA 4KK9D 2DQDH 4FFVD 3V8CA 4PRHD 2E86A 3D85B 2NZ1A 2C9SA 4JZOA 4MA7H 5JQ6L 1NCCL 2V2WB 1WGVA 5CHNA 2ED7A 1NIBA 4LDEB 3UPCA 3C60D 1NWOA 2V7HA 4OJCA 1HZHL 1THCA 5I0ZA 1EWHA 4KOCA 1F18A 3ARED 1DUZB 4BZ2L 3FUHA 2HT4C 2HUHA 3QIUB 5IMOA 4ZW5A 1I9JH 2BSED 1G9HA 2H41A 3OZ9H 4X4KA 5LAPA 4EIBA 1GHFH 1RKRA 4YFEA 3C5JA 3O4OC 2X3CA 3VVWA 2Y1AA 5EOCJ 1QFHA 1UZGA 2PYFB 1A3LL 4P05A 4BH8A 4LRNH 4Y5XC 1MRDL 2BDNH 3M1OA 4AUYA 1KIUA 3OKMB 1FFPB 4N0CD 3I3BA 1BZOA 3D4GA 1QTSA 4ICWA 2IC2A 4LOUC 1S5IL 2Q7NA 1P7QD 3D2UA 2DRUA 2PNDA 2O6CA 4X6EA 5F9AC 2R2EB 4OLXH 4K07A 1AQHA 2FLBT 1B2WL 3VD3A 4JFEE 2FBRA 2QQQA 3HFML 5F44A 4G8GD 3WNLA 1JS4A 4QRQB 2B2XH 4A66A 1UD6A 1JTPA 2ZUQC 1CU4L 3HBPA 4FXKA 4NN6C 3HVDA 2BHZA 4NT6B 1S7TA 4HZLA 2B9AA 1BAGA 1RHHA 2CR3A 1PLCA 1WUZA 2DQUL 4WFGD 2E0PA 3JTTB 3QDHA 3TBYA 1JFHA 5EOTA 5C6PB 1KCRL 4QRSA 4CNIB 1UOVA 5DA4A 3SE4A 3TTYA 4PRIE 3DJRA 2WTPA 1NEZG 4YSTA 2P7TA 3VGFA 2G9HB 2Z7YA 2UUDH 4IRZA 4NENA 4ZTOH 4AE0A 4H20L 2YZ8A 1EFXD 2PPFA 3BEVB 1FC2D 2V3EA 3FTGB 1HNFA 4IIQC 4A04A 2YMXL 3PWPA 3ECQA 3FRUA 2W0FA 1AD0B 5IJCC 1F6LL 2W60A 2IG2L 1UG9A 3HCVA 1ZHNA 4S2SA 3S4SB 5E5MB 2GCYA 1O9ZA 3E3QC 5EPMA 2D03H 3HUJA 3WS3A 3B7TA 1WE5A 3GXMA 4HJIA 4HS3B 5EU7E 1KLGB 1OB1B 4TV3A 5C70A 3COOA 4PIBA 5ICYB 2IPTH 3CUPB 3OSKA 2QADB 5TDOA 3QZLA 5CIPA 1GL4B 1HJCA 4X6CB 2I24N 3G6DH 2Y06L 3FOMA 3CN3A 4JW3A 5F3HA 3WTSA 5L8KB 3G5VA 4ESKA 3T0EA 1AFVL 5AYUH 2NTFA 2PKDA 1L3WA 1DQIA 4R2GD 2NYZA 1D7FA 3ARBA 5GGSB 4WU5A 4AYFA 2L7QA 1D5MA 4Z9KB 4GS7B 4XBPB 2Q8BL 5ISZB 1FORL 2B20A 2XWDA 1PW3A 1RZFL 3CDYA 2ESVB 2E5EA 1MVFA 1RH8A 1RVFL 3L3DB 4UBDD 3C87A 2YC1B 4KROB 4TL4A 5DUML 4AC2A 3EAKA 1CDYA 3DX6B 2EXSA 3QCVH 3KJ4C 4M7JL 1MDAA 1BFVH 1SXZA 1G6RA 2ZXWB 4QRTB 2V0AA 3HI5H 2YD1A 3DURB 4LEBA 4EE2A 5I1LB 4MAYB 2MIZA 4R0LA 3HBGA 4FOMA 3QDGB 3SQBA 1D7CA 3K72A 5JXAH 3L2MA 1L0YA 3R4DA 4F7CB 3G5XB 5FUOH 5EO1B 3MRPB 2FNBA 1GC1C 1BD2D 5DQ9B 2Q8AH 1F3DH 3GM8A 2RGSA 4XH2A 2XJLA 4X7CC 3L4UA 4XP1L 4ZK8A 3RTLA 1N9PA 3VU2A 3P4MB 3D2UD 3MCLH 4HCRL 4Z7VB 2TAAA 4F80A 1RY7B 2A6KA 2IXQB