3LMJL

Structure of human anti hiv 21c fab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGKNYVSWYQQLPGAAPKLLIFDDTQRPSGIPDRFSGSKSGTSATLAITGLQTGDEADYYCGTWDSSLSTGQLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTMAHAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of anti HIV Fab from human 21c antibody
publication title Structure of a clade C HIV-1 gp120 bound to CD4 and CD4-induced antibody reveals anti-CD4 polyreactivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lmjL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lmjL01
2UYLA 4HQQH 2CK2A 5GGUB 3SE8L 3WNPA 2R0WL 4ZO7A 4KH2A 5IIEA 1OCWH 1OTTC 5J6GB 3RWDB 5DQDL 1AO7B 3O4OC 3QUKA 1HOCA 1JTPA 2P5EE 2NTSP 1DLHB 4M93B 4G9FE 4XXDB 4APQC 3ARDD 3ZKXB 4DGIH 5C0JA 1BVLB 1XIWC 4KUZL 5LKNA 1BX2B 5DURD 1NGZB 1W72B 3DROA 2Q86B 3VG0L 2R9HD 4P5TD 5IESL 3D85A 3GMMA 5I1LB 4M1DL 4KZDL 1AQKL 5ECJE 1RUML 2LQRA 5HDLA 2ZSWA 5IVXF 4XNQA 4DCQB 4QLRA 1FAKT 3BUYB 3PABB 4BSWB 4WWKD 1DFBH 4RWYL 3RIAK 1WSST 5D7JA 3EOBB 3RWCA 3SDCC 1U58A 2ILLA 1P84J 4NO0D 4U1GB 1G9EA 4S10A 4O51A 4TVSa 2FATH 4I0CC 1YNKH 3T0EC 4NGHH 4YIQA 5ADOH 2E7MA 4KJYB 3VGAB 1WQVT 4G6FB 3GRWL 3MPCA 2XTLA 2A77H 4ORGB 5DD3H 4X7SH 1DQDL 2VL4A 4I48A 3O6FB 1YEJH 4W4NA 4K23L 4TSBH 3V4UH 3K7UA 3QIBC 5INCB 4UB0H 1MAKA 4XP1H 4D0BA 1E4XI 1OTSD 5BOPA 3UBXG 3C5JA 1T1ZB 4WTZG 3B5GA 2DQTH 1WJ3A 1EEUA 1OWRM 3UZVB 3BOVA 2PO6D 4JRYB 1BD2E 1IMHC 4JFYA 1OAXH 3MFGB 5GGVL 4HV8A 1CI5A 3IXAB 2NW3A 1ETZA 4ZD3H 4XPBL 5DZNA 1DR9A 4Z7WB 2NLJA 5J11C 4OT1H 3ULSB 2X1WL 2ARWA 1L7TH 5I75C 3VXSD 3BKJL 4IOFD 3MRIB 1CFSB 3GB7A 1NFDE 4ODUB 1GL4B 4GRLC 3QQ9D 4JFOA 3SKMA 4ODXA 5EU6E 3IDJB 4NKQB 5LBSL 4R3SA 3FB6B 1MQKH 5GISL 3JWOH 5T1KA 3TZVB 3B2VL 5E8NB 3D18A 4LCWD 3C2AL 3W82A 1CFVH 1G0XA 1EK3A 1JPTL 2G2RB 1Q0XL 4L4VE 2PW2B 5I0DA 3PXHA 1P2CA 1F6AB 1EDQA 1I3RA 3FCTB 2N7BA 3OKMB 4GFTB 4LIQL 4Y5YA 3GSVA 4Z7UA 1U8QB 3OAUL 3PWJA 3VXUE 1L7IH 5HHMB 4OZGB 2V9QA 1XGUA 3GMPB 4C57C 1DQML 3NFNB 2VDKH 4MLIA 1B0WA 4X7FC 3C6LA 4KHTH 1I7UA 3O11A 1T2XA 2H9GA 4LGPB 4BH8A 2BRQA 4L1DA 1OGTB 5FKAA 2MHAB 4YWGL 3I6LE 4PJXB 4XP9H 3IJHA 1YMMD 3OKKA 1JHTB 2CLZA 1J8HD 5IB3A 1BAFH 2IPTH 4XC1H 4PLNC 2GW5A 1KB9J 2C1PB 1IKNA 1TDQA 3KR3L 5BV7B 3UXFA 5HSFA 3IYLW 4MMXC 4R4FL 1BP3B 7CGTA 1ZA3A 3KLHC 1MFDH 2LVCA 1QBLL 1J12A 3NIFF 4F7MB 3ULVL 3UJJL 3SE8H 4BKLA 2R0WH 4B7IA 2BVTA 1I8MA 3GDBA 3WKNA 2VWEE 1OP3H 1A02N 4OLUL 2ZUQB 1HWHB 3PV6B 5DD6A 3RL2A 5EZIL 3D85D 3MRFB 4LEOA 1RFDL 3GZKA 5DR5L 4O5LL 4KKBD 3RJDA 2CLVB 4KUZH 2R1YA 1Z5LB 3QIUC 4S1RL 2IMMA 12E8L 1NANI 1LNUA 1ZAGA 3VG0H 1CICC 5IESH 5EC1B 1MCJA 1T5WA 1V8HA 4M1DH 2PXYA 2HVJA 3TJEH 2P46B 4F9PC 1AQKH 4OAWA 1PSKH 5TFSL 5FDWB 5D7JD 1R5VA 1E4XL 2J6EL 3QUYD 1SHMA 4PR5B 4IRJB 3C9NB 5EBLA 4LRIA 5GRYA 4U7SA 2GUOA 4ZUVA 4RWYH 5J57B 1RUKL 2JB5L 4E41D 3ARDC 1JBJA 4ZFFA 1I7ZA 4X5LA 1P9MC 1JWMA 5E99L 2R23A 1HQ4A 5HYEA 2R9HC 5MEOB 4P5TC 1MIEL 3BE1L 2DYPA 3NCEB 1BQLL 2BVYA 2Y7QB 1IILE 1DQDH 4IIQC 3BPNB 4LHUG 3KYMA 3VMOA 3ES6B 3PJSB 4AENB 3OKNA 1J0HA 4FZEH 3R1GL 4K23H 4WWKC 2DM3A 3C87A 3WUWB 5I2IB 4PJGA 3VI4E 3B83A 5KZCD 2QSVA 2NNAB 1EA9C 3UDWA 5KTEH 3QHTC 4J8RA 4HSQA 2F74A 2R1XA 3OMZA 2C3XA 4WNQA 4FS0A 5T3XD 2EEBA 4G6KL 5EIQA 2BY0A 1KIPA 1KXQE 2PTUA 2IQ9L 4BQCA 2DD8L 2NXZB 2VNCA 1B4JL 2V7HA 3BN9D 1KB5B 3QH3B 3GSOA 3P30L 3DUUA 3B43A 2J4WL 2Q6WA 4L8CB 3MRCB 1OSZA 4GXVL 5TE6L 1DBAH 2BFVL 1RHHB 5E1AB 5B8CA 3BKJH 5ACMA 2DQFA 1OY3B 5HHQB 2WP3O 3U36B 4KRLB 5T1KD 2PO6C 1NEZB 2EIEA 5LBSH 2CSPA 1YUHB 3ZDXF 3GK8L 1N26A 3ZE1F 5GISH 3GUTB 4GW5A 2YD1A 4HUUB 3B2VH 4XTRD 1EO7A 1VFUA 1CDYA 3O41B 5JTWA 1DTUA 2GY7B 3RIAF 2F9BT 1CGXA 3FT2A 1JPTH 2C7UB 3RGVB 1Q0XH 5EN2B 3BN3B 4DKFL 4IOFC 4HGWB 1AXSA 3REVB 4RMQA 1WAAA 4LIQH 3W0WD 4M5YL 3C6LD 3PHQB 3OAUH 3AXLA 5FV2A 2YXFA 1G84A 2ICWA 3DLQR 2R39A 3QXDB 3RVVD 5BVJA 4JFFB 4J3OC 5HHOA 3HI1A 2D4FA 4PD4K 3BIKA 5I8CB 4YWGH 1T7ZA 4J7RA 4C56A 3FB7A 2P5WB 4Y5XB 3X12B 1S5HB 4XP4L 5AUMA 3W9DA 2BNRE 4NN5C 1GGUA 4RCAA 5D7SH 5IUSA 4XWOD 3DHJA 4H20L 4QRRE 4LPWA 4OFIA 3W81A 3ZLQC 2IGFL 5F1IA 2F8VA 3CGTA 4XX1G 3TBWB 5FK9A 4PG2C 3AS2A 3MRNA 5GZND 2ITDB 5IHZB 2UVFA 2EE6A 1FFRA 5I73B 1OHQA 4X6DF 1CFQA 5IROC 4P4RB 2FL5B 1QBLH 4CN1A 4R0LB 3UJJH 3CVHL 3CFKB 5F96L 2LE9A 5DGRA 2HFEA 3O3UN 3O0RL 3ZE0F 1AKJB 2CDEA 3PWPA 1YEFL 1JGEA 3BVNA 3U30C 2R15A 3H7BA 1IBGL 5C92A 5F1KC 5ANMA 5IFHL 4GG6E 2ZOKB 4I18C 2PXYD 2R4SL 2VR9A 2JJVA 5J6HB 1OAKH 4KK9D 4YHNA 12E8H 3IFPB 2FH8A 3LVEA 5HGAA 3H9HA 4WV1B 7FABL 3O3AB 1CE6B 1X5GA 5SWSA 3F6LA 1CLYL 2GTZA 3P4OB 2GK0A 2G5RA 3MR9A 3O6LH 5TFSH 4KRMB 5KVMC 2HWZL 5D2NB 2XFXA 1HHIA 3HR6A 2J6EH 3KPRB 1ZT7A 2O61B 5CCKL 4JKWA 4YBLB 3OQ3B 5JUEL 1RJYA 2FRGP 3NCYS 1KULA 3HG1B 3TO2A 4MJIA 2ZCLL 4DUVA 1SVCP 1JF6A 2R29L 2AK1L 2DYPD 4KKAD 4KKBC 3MNZA 1S9YA 5DMGD 3SQOL 1YY8A 3IDGB 5E99H 1WFOA 4MSWB 2EDXA 3HPLB 3QCTL 4E0RA 1BQLH 1JNHB 3MV7D 1SJEA 1JZ3A 3U4BH 1GGYA 5FYLE 4Y4HD 5D7JC 2AP2A 3QUYC 1J1OH 3R1GH 4RISL 3HC4L 1JWSA 5JORA 2D9QB 2CDGB 3PIQB 4MDIA 1FYTA 4OF0A 4OZIA 4NQXB 5INDA 4N68A 3T3ME 4WO4A 4G6KH 2YK1H 4MJ5B 5IQ9A 2IQ9H 2O93L 4K9EC 2Z4QA 3S5LB 5CSZB 2F19L 3DMMD 3GSRB 4NO5B 3CSYA 5GS0H 1AP2B 1D3CA 1Q9KA 3SCMA 3T0DA 5CEZL 2J4WH 4YDVA 4NZUL 4C54A 3V5KA 3CDFA 2AV7B 4GXVH 4YDJA 5FIEA 2ZUSA 4K94L 4JFEE 3IS1X 3T4AA 4X4XA 4LL9A 2Y5TA 4RQQA 4OI9A 4L9LB 4F8TA 2A9NH 4M7LT 2ATPB 2DQHL 4YE4H 3OL2A 5DMYA 3GK8H 4XVTH 5D7IE 3QDGE 3REWB 3LQZA 3ZKND 5C0IB 4JANB 4PJFF 4P5MA 3AB0B 3R8BB 5EUOF 1UC6A 3L3IA 2XTJD 4WTXA 4DKFH 1HKFA 2FGZA 4NJAL 5L88L 1I9IH 2AJYH 5I74B 4M5YH 3MUGA 4X7EC 3ARSA 3B2UC 1QUNA 3G5YA 4XHJD 1LP9B 3EDKA 1IQDA 3WHXA 3PL6A 3RWEA 5DUPL 1AC0A 3QZWA 2VQUA 4WHTB 4G43B 1NLBL 3VFRB 3K8KA 5CEYA 4C56D 4PD4J 3B6SB 5MI0B 4Y16A 3V5DA 5C6TL 4FQXB 2Z8RA 5K9JL 4XTRC 3W39B 1YC7A 1YQVL 4Y5YC 4NO2A 1A7PL 5BZDA 2AXJA 4Z6AT 2VDQL 5E8OB 5ADPL 1DL7L 1KF9B 5HVHC 1HINL 4D94A 5F3BA 4H20H 1MWAH 3GSXA 5DD1L 5I16B 3C6LC 4JLRB 4P5KB 3SO3C 2BRRL 1S78D 5EOTA 1T3FA 3BDXA 3DV6B 3QEUB 3EOAB 2X4SA 1HK6A 5CMAB 3RVVC 4ZPTB 2PCPA 4RAUB 2ADJA 4Z76A 4X6BA 5GJTL 5E5MB 5A2LH 3MV9B 2J6EA 3CVHH 3PWPD 3FQXB 5TDPB 1DQQB 2YA2A 4YBHA 1HQRA 1IC4L 5IKCB 3O0RH 1UWEH 1CGUA 5F7LB 1ZLWK 1IKNC 3P0YL 1DUYB 1FZMB 1YEFH 4XWOC 5IVXA 3CPLA 5C09E 4JY4B 4TVPL 5J9PB 5SWSD 1G0DA 5GZNC 3HLAA 5JO5B 3HMWL 4HAFA 3UYRL 2C4FT 4TTDD 2BX5A 3D39B 1CLYH 1XT5A 2X1XR 2NTFB 4XNYL 1YNTA 2HWZH 2OCFD 4F37K 3KHQA 4MJID 4ZPVA 5DXWA 5CCKH 4NFDA 5JUEH 3TNMA 3WS3A 3RFZC 5C2BL 3UC0L 1D5XB 3LHPL 4HWBL 5D1ZC 2GY5A 3KXFE 3V6FB 2ZCLH 1K4CB 2PXYC 4IOIA 2AK1H 4OB5L 4M00A 4KK9C 1E4WL 2DDQH 1K5NB 5HHNB 4AEIL 5MP6L 4OJFL 2BOBA 4XZUA 1A9BB 2EIDA 1XF4B 1GGCL 3QPXL 4MXVE 1EXUA 5I1DA 5ID1A 3CFJB 5DJ6B 4PIRF 4LRIC 1ZHKA 1ZANL 4PRAA 2DN7A 1JPGA 1ZHBB 5FOBB 1PGRB 4Z0BL 5ISZA 1AQDB 2Q76B 1FYTD 4AG4L 4GKNA 4RISH 1I4FA 3VE0B 4P49A 3MLYL 1IC1A 4N1CA 5DS8A 4KKAC 5IM7B 3HN3A 1U42A 5DMGC 4OV5B 4AMKL 5KG9B 2AABL 2LAGB 5FM5O 3WE6A 1PYWA 2F19H 2AQ1A 4Y8AA 5DVKA 5CJOL 3ARBA 4Y4HC 1LK2B 1CXKA 2HLAA 3OR7B 3ZDYE 4OUOA 5CEZH 3UBXB 3WHE1 1QBML 4QGTA 3LY6A 4L8DB 4NZUH 1ND0B 3S35L 2C9AA 3KLSA 5I1IL 3NA9L 4K94H 1OGAE 2ESVE 3JWOC 1BZ7A 5BS0E 4BUHA 2NY4B 5SWZA 4LF3B 4UU9B 3EO1A 1XCQA 2P24B 4XCYA 3AM8A 4QCIB 4TUOA 4WI5A 2DQHH 4HUNB 5TGBA 1P7QB 4RAVB 3FO2A 4R97C 4XNZC 3R8QA 5ACZA 1HHHB 4M7ZB 1FN4A 4MA3B 3DMMC 3ROOB 4WHDA 5E4IA 1I1YB 2J3SA 3WIHL 4RMSA 4A2MA 4BQBA 1YEDA 4GRMB 4RAHA 1RVFH 2UV3A 4R4ND 5B8CC 3VWJB 1WZMA 2AEQL 5GRUL 1TQBB 4Z7OE 1MH5A 1T21B 1KGCE 1HH6A 3PL6D 3UTZB 2BSRB 5L88H 1WFTA 2VLLB 5KAQF 4MD4A 5A2IH 3ULVD 3EO9L 4GAJH 3ETBF 3EYVB 2VXSL 2E9IA 4Y16D 1C08B 5DUPH 4I3RL 4PJCF 5D96C 1D9KD 3DYMA 3MZGB 1FFNA 1RZJC 1VDGA 3CVHA 3FT3A 5HHPB 4NQTA 1JN6A 4LLMB 3ZKNC 1UACL 5K9JH 1T0MB 4JFHD 1GGIL 1YQVH 1JWUA 1A7PH 4MD5B 4YX2L 2XTJC 2VDQH 3HS0A 1DL7H 3ZHLA 4MZ3A 4IRZL 1HINH 1KPRA 4YDLC 5DD1H 1EO5A 2EDHA 1M7DB 3K4ZA 5KBNC 4XHJC 2BRRH 3QJFA 1YPZF 4B41A 1SYVA 4I9WE 4DVBA 3KPSA 2XN9A 1HNGA 5GS1A 2IANB 5H94B 1VADA 2JELL 4LSTL 4HHAB 4K3JL 3GMOB 1BFOA 1MPAL 2X4QB 4GS7B 3U9UB 5GJTH 2XG5A 4V1DB 4KI1A 1IC4H 1G7HA 3QI9A 3ULUF 5CHNB 2Z92B 3LS5L 3QO0A 3P0YH 5J6GA 1OQOA 1IT9H 4UBDD 1A3QA 4Y88A 1R5WB 5KVEL 4TVPH 1S78C 5C0CE 4NCC1 4NQEE 4RFNC 4JM4L 4L3EE 4L5FL 1W8NA 2IAMB 4I4WB 3UYRH 4QY8A 2YUWA 3LRHA 2DTSA 3BD3A 5D1XB 5ICXB 2WLZA 5JW5B 3IDYB 4J3XA 4EQ2A 3G6JE 3MNWB 4OLXL 3BFOA 5E2JA 1NLDL 3DX9A 1ZGLM 4LHQB 1JE6A 1J0KA 4DOHE 5EU5B 1NMCC 2CKBL 4WGWB 3U46B 5DJ8B 5C2BH 3UC0H 5JHLL 2B1AL 4HWBH 4UNUA 3IDNB 3IJYA 2GEEA 4OB5H 3T1FA 2FZ3A 1L4IA 4MQ7B 4OJFH 1SBSL 3QPXH 1GGCH 5ISZD 4TN9A 3EYFB 4TTDC 1H0DA 1D5BA 5T5FL 4Q9RH 4P2OA 1HHKB 1QSEB 1CF8L 1ZANH 5H37G 4GQPH 3BKMH 4YHLL 5IW6A 4Z0BH 4N0CD 3THML 4F57H 1MCWM 4AG4H 2NY6B 3U7YL 1DLFL 1TZHB 1WV7T 3MLYH 1M7IB 1W8OA 2CKNA 5L7XL 1A7OL 4NQSB 4U1NB 3SDXF 4F33B 2GSGB 5T3ZL 1CIDA 2P4AB 2X4PA 1HHJB 3VRLE 1KTKE 4AMKH 1G0YR 2AABH 2Z35A 3ARBD 3WFCL 2NXYB 3L3DB 4LHUB 3ZSTA 2BNUA 4WU7A 1S7WA 3FQNB 1A1OB 4JQVA 2EDFA 1PVHA 2XPGB 1YMME 3M1BB 4XP5L 1QBMH 2FWOA 3EYOA 5SWZD 3S35H 1J8KA 4NPYA 1K3IA 3BZ4A 2H2PC 5CP7B 4KWUA 1B0RA 3NA9H 1I75A 1JL8A 5K93A 1X5LA 5HPMA 3RX7A 4ISVB 4N1HB 4BQ6A 4P23A 1FE8L 1EHXA 1JF1A 2EDLA 5IFJB 5CEXA 2P7TB 3SGKC 5E94A 3NPSC 2COQA 3KYOA 2APXA 4F37F 1EHAA 4DKEL 3FTGA 2JK5A 1IGYB 2MMXA 5JHDA 3EO0B 4CVWA 4RZCA 4NUJA 4JAMA 2YPKB 2AEQH 4KGJA 1UM4L 5GRUH 2EDNA 3NA4A 3L3OB 4PJDF 3AVEA 3DVIA 4ODTL 3RP1A 5F9DC 2VO5A 1CBVL 2F8XC 5D6DA 2G2RA 4PG9B 2V2XB 3MRHA 4DN4L 3EO9H 4G9DA 2VXSH 5T1MA 3FONB 1RJLA 4HEPG 3RU8H 4PGBB 3WYRA 4I3RH 4Z95L 3DX8A 3O2VL 4M6AA 3ILPB 3NFNA 5IJVA 3FQTB 4NHUA 1AJ7L 2WINA 4K3GA 4R4NC 3T0BA 4MA7H 4X6DA 1H8OA 1TNNA 3DECA 4M6ML 4D8PB 3QDJE 4EQ3A 3V5HB 5BW7A 1HXYB 5JPMA 3BEWB 5T5NG 3PL6C 5C8JA 4HG4J 2A9ML 3KPSD 2XN9D 2R1WA 3QEHB 3ULVC 2WMPA 5F9WC 3VXNA 4MNHB 3B3IA 4Y16C 1UKTA 3UBXI 2APBA 3V0VA 1IAII 1D9KC 3VGHA 3TN0B 2F15A 4JQIH 4K3JH 4MJ6A 3QI9D 1L0YA 5I76B 2AGJL 1KELL 1NDMA 3O3DB 5KVDL 3BZEA 3RPIA 1ZXQA 4F7MA 3OJ2C 1P7HL 1PAMA 3G5VB 3M17A 5E2WH 5MERA 4HWBA 4WUUE 2IQAA 2R69H 3LS5H 5DJXB 1A6UL 1J10A 1MCNA 1G7IB 1CCZA 2IADB 1R5IA 2X4UB 4OLEA 5T3XE 4YDKL 1XGRA 3MCKB 3ZYZA 1FFQA 2JJSA 5HY9A 4JM2C 4UTAL 1PW3A 1G7JA 4L5FH 4YAQB 1XGTA 5J89A 4CW1A 4YK4B 1CL7L 4EIZC 4O00A 5KS9B 5SWQB 3ROLB 3NGBB 3O45B 3IGAA 4QT5B 4GLRH 2ZSVB 5J13C 3LRGA 2DBJA 4HUXA 5H2BB 2BNQB 4MWFB 1OW0A 5FDWA 3E3QC 2CKBH 1PZ5B 4GMSH 5JHLH 2B1AH 2K9UA 1MJ7L 4UBDC 4IRJA 4ESKA 1NC4A 4HS8L 5TPWL 5L8KB 5F7NC 1ZTXH 3G5XA 1RULL 4OUUA 4PRIB 2P1YA 3QJHA 1ZKAA 4P2OD 4G6FD 5CEZD 1EJOL 3C5ZA 1SBSH 2EDJA 2WWMC 2CDFA 1ZHLA 4M6OL 4FFYH 4OGXL 2HMID 2WUBH 3A6BL 3OX8B 1XH3A 1CE1H 1CF8H 4P2QB 4YHLH 3THMH 1GGBL 3V4VL 4F7CA 4O2CB 5JQHC 3KVQA 3U7YH 3FFDB 5F89A 4UNVA 1DLFH 1H3UA 4KHXL 1FNEB 2DL2A 4QHUA 5DJ0B 3MV8B 5D5MF 5L7XH 4XCNB 1A7OH 5T3ZH 3V6BR 3STZB 1MCSA 1HDMA 2H8PB 4HK3N 2UY6A 2Z31B 4LVOC 4X9FA 2HJLA 1S9XA 3CCHA 4I5BA 2QSQA 3T4YB 1Y18B 5JXAL 4N0CC 3KHOA 4CU7A 4XP5H 3LN5A 3TBYB 2WP3T 2WIMA 4N9GB 1YEIL 4IBLT 3EYQD 3G04A 4G9FB 4PJFA 5IW3A 5C0DA 2OI9C 4OCWH 2A0LD 5EUOA 1R6VA 1VHPA 4JHZA 1B2WL 1CFNB 2X70B 1RK0B 4ODVL 3MUY1 4AEHL 5JHDD 3ARVA 4LLVA 1CFTA 4DKEH 5D6CA 4AIXA 2A83B 3DURA 1U8KB 4NC2B 1YUHA 1HHGA 2VZSA 3VFPA 1ZOXA 2C26A 1TCRB 2PYEA 3MJGX 2CIIA 3V6ZA 1HSAA 1UM4H 4QHLB 2JJUA 3FOMB 1QFUH 5CJ5A 4ODTH 4YPJA 3AM8C 4H88L 2GSIB 4M43L 1NBYB 1CBVH 3AC0A 2XZQH 3MLWL 2VZUA 4DN4H 3AFLA 4AIZA 1IAIL 3S36L 4HGWA 2IFFL 1KSRA 3O2VH 4F3FB 4PGCB 4OIIH 4LLDB 1A14L 4PV8A 2VJXA 2BSSA 4TVPD 5C7XH 3STLB 2XACC 4ZS6D 3MXVL 5E5UB 1INQA 1UKQA 3PHOA 5DC9B 2VLRB 2A9MH 1BVKB 2RFXB 2ZG2A 4N8CL 3CFDA 5AG9A 5MEQB 3D3VA 1HILA 3WEXB 3RVXD 3KS0J 1BD2B 3MRKB 4XAKE 1B88A 3MNVB 1FRGL 3VXPB 4PJGE 3MJ6A 5DA0B 2X2YA 8CGTA 2AGJH 1R3LB 2YWZA 5FB8B 1C7SA 3F7PC 4H0GA 5KVDH 2CKBA 4JG1L 2XRAL 1MJJB 4EBQH 2FBOJ 1OAUL 1RUAH 2EDTA 4YDKH 4ONHA 2VQTA 2F53E 2D31A 2A1WH 1DE4B 3UROR 2AXGB 5EU6B 4UTAH 4HT1L 4TUJA 1KLGA 3ULUH 4O9HL 4U1KA 1CL7H 2YD2A 2FIRT 4HKBA 5D2LF 1RPQA 4I2XA 1RJCA 3QI9C 2NY5L 4FQ1H 2I25N 1ZEAL 2CR6A 3O3AA 4IRJD 4JFQB 2CJUL 3GSNH 5DLMH 4M93C 1WISA 1L9NA 4PLJD 3ZKXC 1MJ7H 3C5ZD 5HGGS 3VXUB 5GGSB 3HRPA 5JLZB 5CBAB 1RULH 1KJVA 4I3SL 3JUYA 3RTQB 1Q1JL 4WFGE 4M6OH 4OGXH 4QRSB 4L1HA 5J0BA 3BT2L 4NDMA 2ARJA 1WAAE 4FQ2L 4EXKA 2O26U 4HW6A 1AFVL 43CAA 3CSPA 4ZSOE 1GGBH 2VSDA 2YA1A 3TBVA 1RIHL 3WUZA 4KHXH 3QEQA 4YBQD 1W0WB 4MCYA 3MV01 4LVNB 5LAXB 4U0QB 4U1GC 3WJLA 5HHOE 1VPOL 2I9LB 1TTUA 3VGAC 1CDCA 1OP9A 1HH9A 3RKPA 2UZIL 5DMKB 1K4DB 2BCKB 4C56E 1WBZB 1WIOA 3E2HB 4K94C 2HMIC 3V0AC 5L2JA 5E8PB 5AYQA 4F2MB 4W6XB 5FYKL 1RV6X 4AH2B 5JXAH 4NQDA 2XQBH 1BJ1J 3Q3GA 3GSRA 4NO5A 5L9DL 5HYQB 1WT5A 5IW1B 2SEBB 4NZTL 4XC3L 3VWKB 4K7PH 4TPRL 3CDGA 1YEIH 1GOHA 3H9YA 2G75B 4HUWB 4YO0B 4ODWB 4L4JA 1KPVB 4ZQKB 1ZLWH 1EX0A 2JIXA 2B1HL 4NKOA 3FB5A 1WZ1L 1B2WH 4ODVH 3KPMA 3QQ4A 4MCZA 4AEHH 4JQVC 5I8EB 2PYED 4YHIA 1KT2B 4JO2L 3X14A 3PWPE 4AZ8A 1JYXA 1QLEH 1SYSA 1DCLA 2AJXL 1INDL 4AYFA 4U6YB 4PJCA 3BYTA 4ZFOB 4RIRA 1X9QA 4PJHF 1FNAA 5F1NB 3REWA 4WW2F 3CXHJ 3CC5B 5K59F 3AREB 3EYQC 4H88H 1YDPB 3OBAA 1JVKA 5SWSE 2A0LC 3MLWH 1BZQK 4PY7B 4F9LA 3DBXB 3S97C 3S36H 5DRWA 4IMLA 4DQOL 2ZOLA 2AKRB 3TZVC 3B9VA 2J5LB 1YPZA 1KCLA 1KTLB 1DVFB 3X13B 1A14H 3GGWB 4MJIE 3OWEA 5D6DC 1XFPA 1AD9B 3CU7A 5I66B 3DRQA 1WCQA 4OCRH 3D3VD 1Q9OB 1NCAL 1J1XL 3KPNB 1O5DT 3L7EA 4N8CH 4JG0L 1YEEH 2NX5A 4L29B 1EEQA 3VXTB 2YRPA 1M4KA 4RX4A 3EUUA 4QRUB 5CINL 1I7TA 2ZKHL 4EI6B 1FRGH 5IOPB 4CVXB 4HIHA 3I85A 4PJIF 1NGWB 3QHFL 5BW7C 1KIQB 1UWGL 3MRMB 5FCSH 5ERWB 2WM0A 2W9DL 3DJ9A 1PLGH 5DJAA 1BOGA 1QOKA 3O3EA 2OQJB 3MYJB 5DYOA 2E27L 1TVHB 3RWFA 5I71B 4PJ7B 1IAOA 2I5YL 1R3KA 5BJTB 1R24A 1UZ8B 1TJHL 3HB3D 4WDIB 3S3PA 1ZT4B 4ZUTB 3T08A 5GHWL 3LQMA 1LDSA 1T5XA 4LPXA 3RVXC 1IARB 1YC8A 4HT1H 5BV7C 3OB0K 3LH2H 4GRWF 4JY4A 4D0CA 4MAYA 4LIQE 3DI3B 2NY5H 1FL6B 1YZZA 3T2OA 4PJ9A 1UVQB 4FQQA 4POZD 4U0RB 1I1CA 2VLKB 2JJSC 2CJUH 1ORQA 1MLBB 1HXMB 4XP6L 2ZUQC 4WI9A 4NRXB 1NFDF 4AK1A 3P77A 4GXUM 1BQSA 5C07A 1Y0LA 3KDMA 2BVOB 2J8HA 4MA1C 1ITBB 3QAZC 1A5FL 4XBPB 4I3SH 5F88A 3SDXA 2P42B 4KRPB 1Q1JH 3RA7L 1OW0C 4X6FB 3SGDH 3QEQD 1XF4A 3K80A 4FQ2H 3QA3A 3TIEB 1AFVH 2UWEF 1NL0H 4IRJC 5EU4B 4A2LA 2DMCA 1GGTA 2BNRB 1JHLH 3MRBB 4PLJC 2MWCA 2OXHA 3RBGA 3C5ZC 1BIHA 2FX9L 3UTSB 5HI4D 2IFGA 2WWKT 1VPOH 4ZFZA 1T6WA 3C6SB 2UZIH 5IQ7H 1UB5B 4NQDD 3BP7B 3BZFA 4Z9KB 5FDYA 2EKSB 1MCHA 4KTYA 3PWVA 1H15A 1HEZB 4NSKA 1NCTA 2J7LA 4K55A 1X5AA 4X0KA 4XC3H 1T03H 1T1WA 2CXGA 3ARGA 4LSVH 4TPRH 1T83A 5I19L 5EBWA 4WTZA 2VRAA 4Y89A 1EHLL 3BQUA 5DWUL 3BPCA 1P1ZA 4GG6B 4PJDA 3DYPA 4LMQI 2Z8VC 2B0SL 3LV3B 2OSLA 4GT7A 3ILQD 4FMKA 3TIDA 4F7PB 3MRQA 2DM4A 2GTWB 1VGKB 3MJ8B 5IVXE 4ALAL 3TNNA 1INDH 5EWIL 1QFPA 1T7YA 3ZL4H 5CFHA 2PW1A 3H9SB 1FFPA 3ARWA 3E3QE 3RUGF 3VH8B 4PB0H 4XMLH 3OKEB 1FZKB 3FRUA 3U48A 4X6EA 3VWJA 4QHKJ 4HPOH 5JA9A 3MC0A 1KLUB 4YC2C 5DTFB 4NRZA 4QWWD 3QDAA 4DQOH 3VFSA 4NZDA 1KG0A 2VABA 4QOKE 3EFFB 5ID0B 3QR2A 3BD5A 2VZ1A 3I6KA 2RGSA 3UZQA 2WQ8A 1DBKL 1IM9A 2V5SA 2ATKA 4PJ5A 1R3IL 1ZGLP 1KPUA 1DUZB 2NX5D 3HI5H 3CJJA 4F7TB 4RX4D 5DEGA 2VXTH 1J1XH 1VENA 4R96B 5HGDB 4L4TA 3KYNA 4JG0H 2KL6A 1XAUA 5ISZE 4LAQL 5CINH 3RY6A 2R2BA 3GMNB 5KSAB 5ILTH 2ZKHH 5DHVB 4N5ED 1LEKB 1G1YA 5EDXA 2OS7A 5M94B 5JMRA 1E28B 2BK8A 3W9EB 3MRJB 1WLHA 1LE9B 4JCLA 2MQ3A 4W4OA 2B4CL 5IVZB 1ERNA 4U6XB 5FAAA 3WFDL 3TT3L 4APQB 3DRTB 4FOMA 1N7ML 4JFEB 4LPYA 2I5YH 3TCLB 5JOEA 2X7LA 1XIWB 1TJHH 2P43B 3BSZL 4MB5A 5J4MA 4MAYD 3ARUA 3L3HA 4HWNA 5GHWH 3OG6B 1IGJB 5I73C 1OB1A 4PJ9D 2BSED 4OZHF 3DVGB 5EU7E 3D0LB 5I30H 4R0LC 5D7IB 3CUPB 3QDGB 1K3ZA 1SM3L 1KV3A 2XKNB 1A3LL 5SWZE 3D25A 3LRSB 5AEAA 3FQRA 4LGSB 3LN9A 5C07D 5BMFH 3WD5H 4JB9L 3BP6A 1UXWB 5DI8B 3WIIH 4XP6H 1K85A 5C0EA 4YHOH 3HZKA 4R6UA 4FQLL 1Z3GL 3HB3C 5EBMB 2QQNH 1F58L 3QG7L 3D1MC 3LKNA 3O2DL 4WV1C 3P73B 1G6RB 5D5MA 4BH7B 2VR5A 2OX5A 2HRLA 5D8JH 2VDPH 3MJ7B 3MRDA 3TYGL 3RL1B 1J87A 9CGTA 5DJYB 3WBDA 5DD0L 3IKCB 4POZC 3QIBB 4LLYA 4NQCE 4BFIB 2E7LA 4ONOA 2FO1A 1FNHA 1CT8B 3QIWA 4KGLA 1CDBA 4DUXA 4CN6A 3BESR 1QBBA 4ZUUA 3QRFM 3VJ6B 4KJQD 2M26A 1FL3A 3NIFE 2EXYD 1PQZB 1HHJA 4O2FB 5F7DA 5GIRA 3ARGD 3KS0H 1HSBA 3JTTB 5J11B 3GSUA 1OT1A 4PRDB 4JGUA 5DC4B 3MLTB 4YQXL 2HFFB 3KPSE 5J1AB 4RDQF 5I19H 1NCWL 4JZJA 5HI4C 5C09B 1FDLL 1TVBA 5J12C 4P2RA 2OXGA 1JZ7A 4HS3A 3C08L 2JE8A 1WT5C 2R0KL 3QB7C 2X9XA 4ALAH 5EWIH 2QKIB 4QNPE 3LOWA 3VWJD 4KROD 2OZ4L 4UQ2B 3MCLH 3MOQA 4UT6L 2K7QA 5FKPA 3S88H 2YD7A 1I9JH 4JFXB 2YPKA 4YHPA 5JQ6H 2R0LL 3KXFB 4L9LC 3ISWA 1JFQL 3KNBA 5EC2B 4M03A 5SV3A 3AMKA 3CFBA 4QF1A 1IM9D 2BVQA 3OGOE 4PJ5D 2JB6A 3L7FB 3L3GA 4G8FB 4QTHA 1DBKH 4LNRB 3AB0C 2FECL 4FZ8H 5EPMB 2Q8AL 1R3IH 2H1PL 5IHUL 2IJ0C 4L4TD 4F9LC 3C5SB 5IMOB 3FQUB 4OQTL 1BGXL 4U6VL 5DQ9A 5I74C 1MAML 3WFHB 1KTRL 4JPVL 4MNQB 4QWWC 1CD9B 2JLLA 4LAQH 1NAML 3E6FB 4PJEE 3P4LA 2IH3B 5E6YA 1KYOK 4ZOCA 4FQXC 3JUZA 1C5BL 1PKOA 4HUVB 3NAAH 4HXBH 1C16A 5MHSE 1R3JB 4PRPB 1N6UA 5D2LA 1QLRA 5EZJA 1AGBB 5C0BA 5E2UL 4FFVD 3PDOB 1UKSA 1F11B 3WFDH 3TT3H 4R2GD 5GGRY 1N7MH 1OGAB 2ESVB 1X5JA 2EC9U 4B0MM 3ECBA 5BS0B 4P4KB 1BJ1H 3QIUB 2FJGA 3BSZH 5F1OB 3TC9A 5DVLA 3ZDXE 1X6NA 5KJRH 1CICB 3RRQA 4LDEB 2VXQH 3IFNL 4N5EC 4X9IA 2NY1D 4GMTH 3KPPB 2WIIA 3D69B 1KCRL 4KUCF 3LMJL 1X7QA 2FGWL 1T6VN 5IJKA 1MVUB 4OTXL 5B39A 4RSVA 1A7QL 5HHVL 3TP4A 4GRWH 1UCBL 4KPHL 4JB9H 4KI5D 4S11A 2Q3ZA 2VIRB 3GM8A 3W5NA 4FQLH 3ZT6A 1Z3GH 5SX4H 5DURB 4FQIL 1F58H 5JHDE 4QRQA 3QG7H 5FYKD 4LSUL 4G3YH 2C1OB 2FX7L 3UPCA 1Q9WA 4CJ0A 4PRIA 5EU3B 1GJIA 5A2FA 3TYGH 1QSED 3NCBB 4GW1A 4MLSA 1YNLL 5DD0H 5AYUL 5DT1L 2E9BA 5HBBA 4FQHA 3UZEA 4XT1C 3QXWA 3VRJA 1NDGB 4HD9A 4P3DA 2HTKD 3VW3L 5I15L 1EVTC 1U8OA 1S7SB 2VE6A 2X4OB 1IQWL 3UJIL 3SPVA 2DB8A 2XY1A 4H26B 4U1SA 4X6DE 2NXYD 4LHUD 2NY3B 3BH9A 1RUPL 1NFIA 3U7AA 4HMCA 4TVPE 2VERN 3RWJB 3C09C 4OFYA 3ZE0E 5E5RB 3F7YB 1KCSL 4YQXH 3VFTB 4XNMA 2A73A 5IT2L 4P2RD 2X1QA 1SJHB 3TBYA 2BMKB 2I9TB 1NCWH 4NKDA 4PJHA 4CBPA 1Q94A 2P5EA 4NBXB 4WW2A 1FDLH 5CAYB 5C0CB 4GKSB 2VN7A 4IJ3C 1MCCA 1IEAB 5ESQB 3AY4A 4KJQC 1LO4L 1YJDC 2EXYC 3C08H 4Y4KA 5F7HA 1UH3A 5IB1A 3G6JB 4WJ5A 2R0KH 2A74A 3VRIA 3JV4B 3U4EB 3ARGC 3I6GB 4JDVB 4QHNA 3VXSB 1I7RA 2GITA 4LCYA 5I8KL 4DOHB 5MEPA 1CR9L 1I85A 3EGSB 4AT6B 1JP5A 1ORSA 3K8LA 3U7WH 1X3DA 1OF2B 4QHLA 1JFQH 3QZWG 1T22B 4Y4FA 4JO1L 5E00B 4M62L 4JDZB 4JFPA 5GGQH 3SKOA 4M7ZC 5LVEA 2DQUL 4XNUH 2DQGL 1RSFA 2ENYA 1ADQH 5IWLA 4JO3H 3WN5A 1T4KB 4LCWB 2WQRA 1SEQL 5IB5A 5LQBH 3EYUL 4E5XB 3DYOA 3QBTB 3VWJC 4KROC 1TQBC 3DX7A 3TBSB 4PJIA 4WHCA 2H1PH 5IHUH 3HZMA 3C8DA 4NN5B 4LLDA 4FA8A 3EDFA 3LS4H 1ZWIA 1HIML 4PB9L 1H9VA 4OQTH 4U6VH 1MAMH 4WI8A 1VFBB 5F7EL 1JGLL 1KNOB 1NUGA 4JPVH 3KYKL 3TYFB 5DRXA 2ZUTA 3RY5A 1KYOJ 1NAMH 4AIOA 2VISA 1T04B 5D7KE 4YH6A 5C0BD 5E2VL 4QYOB 3FB8A 3LEVH 1A7NL 1JPSH 4JVUA 4JFZL 1YMMB 4I1NB 3LKRB 2Q87A 5L0QC 3GJFK 5M7QA 1J8HB 3DETD 5E2UH 5DQJA 3D9AL 5KSUB 3MRPA 4JHAL 3U30B 4XAWL 4PGEA 1ZVSB 2CUMA 5EIVA 3PGFL 1MJJA 3D0VA 2YEZA 2NY5C 2UYLB 2IPKA 3O2DA 1BFVL 3MRGA 5IIEB 5E70A 1F2QA 1RY7B 4UDTB 1NFDA 2UVEA 1DQJA 3BDBA 2GJJA 3UTQA 3QUKB 1HOCB 4YNYB 3V7MA 1F5WA 4JDTL 3LMJH 2FGWH 1FH5L 1O7SA 4LPUA 5C0JB 2BNQD 1A7QH 5HHVH 3BPLC 1VGEL 1UCBH 3HAEH 4KPHH 4ENED 3OJMB 3DROB 3S9DB 3D85B 2UWEA 1NGQL 4L4VA 4M5ZL 2E9JA 4PRID 4FQIH 4R26L 3SDYL 2ZSWB 2IAMC 2HYMA 2PYEE 4LSUH 4XNQB 4KV5F 3L5XH 1XGYL 2W65A 2FX7H 3EJZC 2NY1C 3S7GA 3OAZK 1IAMA 3KJ6L 3M07A 4ORZC 3UJTL 4LK4A 4EKXA 1YNLH 3RWCB 5AYUH 1CZ8L 1U58B 3K3QA 4U1LA 4UV7L 1KEML 3PGDA 4O51B 4UT7L 3QDJB 2E8ZA 4YIQB 5CJ8A 3DX6A 3BIAX 4KI5C 3NN8A 5I1JL 3BKYH 1N59A 5ALBL 4C55A 4WIQA 1EH9A 3O4LE 3TO4A 2OM5A 2K7PA 3F12A 3QWOA 2IBZX 2IG2L 2QEJA 1IQWH 4ACPA 4I48B 3DO7A 5FOJA 4G42A 2GKIA 5CZKA 4XWGL 4BFGA 1BZ9A 4J3UA 1UZ6F 1C5CL 4M48L 3GMRA 4D0BB 1IEBA 4OFYD 2E7LC 4P48A 1MRFL 1T89A 3C5JB 1RUPH 4LBEA 1FG2A 1MQ8A 1RUQL 1FO0L 3AU1A 4XI5D 2P5ED 2EO9A 1KCSH 2HTKC 2OMBA 4JFYB 5JIKA 1HZHL 5LGJA 5IT2H 1ZVHA 3H6JA 4HV8B 2NW3B 3RUGA 1ETZB 4HAGA 2A6JA 4QHMB 4W6WB 1E27A 1ZSDA 2NXYC 3L5HA 2NLJB 1LO4H 1MF2H 2UZYB 3OB0H 4B5EA 1RURH 4YGVA 3L3KA 5E08L 5I8EA 4PLKD 5ESAA 2F8OA 3GB7B 1KT2A 1KOAA 3BRGC 1A1NB 3W5MA 4JFOB 3SKMB 5J56B 4JZJC 4ODXB 5I8KH 4OQTA 5H37H 5SV4A 3QCUL 1CR9H 5E8EA 5I18H 4Y4FD 3WXVL 1UM6L 4R3SB 3BEVA 5FUOL 1FHGA 2OTWA 4I2XE 4Y5VA 5T1KB 3TPKA 3T77B 4OI8A 1MHHA 3D18B 1NAMA 4X80L 2YD6A 1UEMA 1N2RA 4M62H 2E8YA 1G7PA 1JHKH 2FO4A 1BBJA 2DQUH 2DQGH 4X83A 3GBLA 1RU9L 2AV1A 1P2CB 1SEQH 1I3RB 1Q9LA 1EAJA 4ETQA 3EYUH 5GGVY 5T3ZE 4Y5YB 1DDHA 3GSVB 4Z7UB 3UMTA 3PWJB 3DUSA 1ROWA 1F4YL 1XGUB 1VFMA 3MXWL 3MBEA 5HVHB 2V6HA 4CNIA 1O0VA 4RFOL 1HIMH 1A64A 2IH1A 1I7UB 3SO3B 4Y19A 4PB9H 3O11B 5I66A 2H9GB 5F7EH 4BH8B 3KYKH 1G7LA 5FKAB 4BSVA 3KJ4C 1E4JA 4ZS7L 3IJHB 4I3GA 4MD0A 3QEQE 3OKKB 4G8EB 3AAZA 1XR9A 2CLZB 5E2VH 4X4YA 1CS6A 5IB3B 1KIRA 1NQBA 4HXAL 5GJSH 3HAEA 4OZHA 1A7NH 4JFZH 3O8XA 3BISA 3GBNH 3TGXA 3D9AH 5CILL 1U8PA 3SGEI 2DRUA 1ZA3B 2NR6D 3PGFH 4U1JA 3WFZA 4BKLB 4NQDE 1I8MB 3TN0C 1LHZA 5LCVL 3VMNA 1S7TB 3FN3A 4JDTH 3RL2B 3IF1A 1FH5H 4LEOB 5DFWH 3CFCL 1V7NL 4L4VD 2UY7A 2R1YB 1VGEH 4P46A 5AWNH 5ITBL 2DQIL 4LP4A 1LNUB 1YQ2A 3H3BC 1T5WB 1AHWA 2PXYB 2HVJB 1NGQH 2X40A 4OF5A 3VXUD 4M5ZH 5TH2A 1WF5A 1JZ5A 4OAWB 4KDTA 1JGVH 1A21A 1H8NA 4R26H 4HCRL 2DL9A 4PJCE 3SDYH 1ZVYA 1R5VB 3RTQD 4ODHL 5IJKC 4Z8FL 5EBLB 1XZ0A 5IBLC 2GUOB 4ZUVB 5GZOD 4MJ2A 3FKUS 3SEPA 3TO4D 4ZFFB 3TV3L 1I7ZB 3I6LD 1KEMH 1MNUL 4IMKC 2VH5L 5LXGH 1H3XA 4PLOB 4ENEC 1JWMB 3J8F7 4YEEA 2R23B 1HQ4B 3WJJA 5ALBH 4Y0GA 5I1JH 2DYPB 1YPZE 3KYMB 4YFEA 4QRRA 2MTPA 1T1YA 3BO8A 4XWGH 3OAYK 5EG6C 1C5CH 3OKNB 3PGCA 3Q1SL 3W2DL 4F15B 4H5SA 4PJGB 1U8HA 4XCEA 3HR5A 3S3JA 1MRFH 1B6DA 3CLFL 4J8RB 2F74B 2R1XB 1X5KA 1Z9SA 1RUQH 1JGUL 1FO0H 3ULUE 2NX5E 1LO5A 4Z7NF 4ZYKA 1LEIA 2EDKA 1KIPB 1BHGA 2W91A 1HZHH 1LQSR 2V7HB 3IRPX 1S9VA 1PX3A 3H0TA 2AW2A 1LEGA 2DLFL 4OIAA 3GSOB 3MX0A 3CX5K 5C0AE 3DUUB 2O5XL 4HH9A 4YJZL 2Q6WB 4L3CA 1OSZB 1UEYA 4OCYL 1J0IA 4X8JA 4JRXA 3L3JA 1RZIA 5B8CB 5TDNA 2DQFB 5E08H 1EZVX 1AY1L 2YSSA 3BP5A 4N0YL 2CXKA 4XI5C 5CIPH 2DQJL 1VESA 4WW2C 3QCUH 4LCUA 4JKLA 1UM6H 2B20A 4JKMA 1RMFL 5FUOH 3K81A 1OWWA 3AY4C 5FXCH 4KFZC 5C0FB 4X80H 1K6QL 3FT2B 4P3WA 3DO3A 4HULB 3ZKQD 3QO1A 4G6JL 1DVFD 2AVGA 3HRZA 4WTWA 1F4XL 3MBED 5DJ2A 4WI4A 4BYHA 3RY4A 1I85C 1AXSB 2BDNL 4PLKC 2YKLL 5C07E 5TDOA 3QISA 1CG9A 5I6XB 4Y19D 2D03L 2Y25A 2XTJB 5ID0A 3AXLB 3MXWH 4DFHA 2Y06H 2YC1A 3DXAA 3OR6A 1DQLL 1CIUA 4Y4FC 5D93C 4JGJA 2ICWB 5EORH 5BVJB 3SDXE 1CD1A 5IWLC 3WN5C 3V6OA 5HHOB 3AUVA 3HI1B 4LDLB 5F7KC 2B4CC 3BIKB 5F9AC 5HGDA 3H7LA 4C56B 1WGOA 3FB7B 4ZS7H 1KEGL 2MCG1 3O8XD 4YR6A 5AUMB 1QPPA 3W9DB 1JNNH 5TQ0H 1UH2A 4MXWL 3BXNA 3FOLA 2VTFA 5F1IB 4OLZH 3LZFL 4U3CA 2CUHA 5FK9B 3MRNB 5CILH 1BQUA 1KXTB 1CFQB 4PJAF 2ADGA 5F7FA 4RFNB 4JCMA 1X5ZA 2ZCHL 5C0RH 1JUFA 2HFEB 3PQYA 1ZLVK 4Y2OA 5DUBA 4EJ1C 5FYJU 5LCVH 1CGSL 1T20A 1XCTA 2CDEB 2NY0D 3PWPB 1A6VH 1JGEB 4P46D 3BVNB 5C6WH 2ZJSL 3H7BB 5GRJL 3I9GL 5ANMB 2H41A 4OD3H 3CFCH 5I9QC 1V7NH 1JPFA 3MUZ1 3NCFB 4YHNB 2DS4A 5ITBH 4DGYL 5HGAB 2DQIH 3H3PL 3H9HB 2NR6C 5SWSB 2GTZB 2GK0B 3MR9B 5CWSA 4JY6A 1WBYA 4HCRH 2XFXB 1HHIB 3GMLA 1RIVL 4ODHH 1IKFL 3O6ML 4KRPD 4Z8FH 1ZT7B 1EFQA 3QQNA 4U6HA 1FVEB 1RJYB 3P4NA 1AGCA 1MCPL 1FO0A 2AEWA 5H35A 3TO2B 4MJIB 4PTTA 1J0ZA 3CXDL 3MGAA 3TV3H 1MNUH 1L0QA 3MNZB 1S9YB 2VH5H 5JW4M 1G9NL 3FFCE 2VC2L 4IDLA 4FABL 1BWMA 3MBXL 3MGTA 3CZFA 4QRRD 4GQ9L 4E0RB 1SJEB 5BOZG 1KFAL 2ADIA 5I1EL 3RTQC 3ARZA 3Q1SH 3W2DH 3JZ7A 1A4JA 1JWSB 5JORB 4LKXA 2E9WA 5GZOC 4OF6A 4P59L 4UMGA 2FIKA 1V3MA 4MDIB 4LVHB 4BFEA 5D9SA 1FYTB 5CIPA 4OZIB 4L4TE 3TO4C 5INDB 2ID5A 1JGUH 3G5ZA 4WO4B 1NBZA 4OKVA 1A22B 4U3HA 1D5MA 1XGPA 2CR3A 4LVNC 3G6DL 5IQ9B 2I07A 2Z4QB 4F58H 3CX5J 3VFWA 3BPOC 4HEME 3CSYB 2KUTA 1L0XA 2FB4L 2DLFH 1T89C 4JRXD 1RJZA 1Q9KB 2GIYA 3SCMB 2O5XH 5EZOL 4YDVB 4PV9B 3S37X 1QRKA 4Y2DA 1RI8A 3V5KB 3E2HC 4YDJB 2B5IB 4RBPK 4BK5A 3GFUA 3LDBC 3T4AB 4X4XB 2Y5TB 2FLRT 1AY1H 4RQQB 5EIIA 4J4PD 4N0YH 4IS6A 3OZ9L 4JR9L 5ENWA 2DQJH 1A9EA 1CLOH 1F90L 3O9WA 5BRZE 1RMFH 4KMTL 3RNQA 3LQZB 3PWNA 1NC2A 2CIKA 1K6QH 4P5MB 2YMXL 4ZTOL 3L3IB 3JV6A 2HT2D 1F3JB 2RB8A 3DXAD 1F4XH 1I1AA 1A3RL 2BDNH 2YKLH 4EOWL 3BIBX 1H3WM 1X5YA 5JMOC 4Y5VC 3G5YB 4ERSL 4OGZA 1D6EA 5IMMA 4J2XA 1IQDB 3SGEH 5IFAH 3WHXB 3PL6B 3RWEB 3AREC 5JPNA 3QFDA 2VSCA 3QZWB 5D5ME 2BERA 2KBGA 2R4RL 1BFTA 2D4DA 5F9WB 2G60L 5CEYB 1H5BA 1MHEA 2JCCF 5JOFA 3V5DB 4Y16B 5E03A 3KGRA 2H3NA 4PGJA 1A7RH 4NO2B 4NM4H 1QRNE 5BZDB 1KEGH 2D7QA 4WENB 1DVFC 2XWJA 4XPFL 3QUZA 3MBEC 2YPLA 1JNLL 4KUCD 5F3BB 3GSXB 4MXWH 2D2OA 1QFWM 1LD9A 3H9ZA 3LZFH 2W92A 5EOTB 1T3FB 32C2A 2HTLD 4NC1C 1UYWL 3CLEL 2HVKA 2BJMH 3RWIA 3PQYD 2PCPB 2ADJB 1VACA 2G5BA 4X6BB 4HCRA 1EMTL 2VMFA 5E6ZA 5K9QG 1HQRB 4HQQL 5ACLA 2IALA 1CGSH 1JRHL 5HYFA 2X9YA 2D0FA 5IB2A 3VXMA 5IVXB 1AGFA 2ZJSH 4HF5L 4U1IA 1WBXA 1AGEA 1ACZA 3I9GH 4MQSB 1KN2L 4AEFA 1JI1A 1LGVA 3L5WA 2XZCH 1TQCC 5DEFA 1FL5A 5I71C 4DGIL 2OL3L 1NGXA 4DGYH 2K3TA 3H3PH 4EVNA 5CJQL 5GQBA 1MFBL 4ZAKA 3VD7A 3ZYJA 4LSQH 1YNTB 3EDDA 1GZQA 1CGYA 2DKUA 3JXAA 3IFLL 1IKFH 1S9WA 4ZPVB 5AZ2L 2LABA 4QOKB 2ICWI 2NY0C 2XY2A 5I1KL 3TNMB 4P46C 3UPAA 1QKZL 2RCSL 3OG4B 1QQDA 1U3HA 5EU3A 1AHWC 1DFBL 1E0OB 4IOIB 3LKOA 3CXDH 1G9NH 2VC2H 1FGNH 4KDTC 2BOBB 3MBXH 2HG5A 4H0IA 5I1DB 2DWEA 1EXUB 5ID1B 1YNKL 4GQ9H 5ADOL 1WIUA 2F54A 4XXCC 2GAZA 1KFAH 1ZHKB 5KVGH 4PRAB 1BIIA 1JPGB 3HC0A 5ISZB 4HKZA 4M3JA 4KRPC 4GKNB 1E4KC 3QFJA 1I4FB 4EDWL 1YEJL 4YDIL 4P59H 4NZRH 4XCCL 1QFWH 1R3HA 4JHBA 4TSBL 3V4UL 3WJJC 4XP1L 1UQSA 5DS8B 4CKVX 1QVOA 4LPCA 1UG9A 4EUPH 3G6DH 2OI9B 5BZWA 3GJFH 5MENA 3WE6B 3QNXA 3S98A 3MLRL 4Y2DD 3MOBL 1T80A 3JTSA 2FB4H 4OCNC 5HVGB 3ARBB 5EZOH 4HUMB 5D4QA 4N8PA 5H8DA 3I75A 4ZD3L 3C60A 1JYVA 1KUMA 5C0CA 4NQEA 4GKSA 5EFIA 4L3EA 3IDUA 2XOTA 4X98B 1BZ7B 3O9WD 5HYJA 4OT1L 5SWZB 5IG7A 1PX4A 3EO1B 1XCQB 2QQLH 3TBTA 4LCCA 4XCYB 4XX1E 2FEEL 4TUOB 4JR9H 5TGBB 3DV4A 1B4RA 1NC2D 4IM8A 1AR2A 1F90H 3FO2B 4J1UA 5ACZB 1QYGH 3KXFD 1FN4B 1KCVL 1WFNA 4KMTH 1WUNT 1A1MA 5TE7L 3QULA 4M8QB 1YEDB 1I1AD 3U79A 2YMXH 1T22A 4ETYA 2HJKA 3PP3K 1MH5B 1MWAB 5FGBA 3VXRA 5E00A 1HH6B 5DGQA 1A3RH 4EOWH 4MD4B 3OAZH 3DHMA 1NCBL 1F4AA 4J4PC 4XVSH 4ERSH 4HC1H 4OF7A 5DEZA 2LU4A 4RWHA 1U3JA 1A6WH 3WS6C 1FFNB 3CVHB 3FT3B 4AY0A 2G60H 2DAVA 3RQ3A 4Q7DA 1JN6B 2VAAA 4HK3J 3IETA 3QUZD 4N8VA 2WV3A 2YPLD 1DQTA 1JWUB 1KNOA 4U2YA 2L4OA 1T0NA 2HT2C 5D7LA 5EO9A 3HS0B 4XPFH 4F7EA 3QQ3A 1MHPL 3NIGF 1ES0A 4ZUWA 5D71L 1KPRB 4KQ3H 2WUCL 4XP9L 5DHYA 1T04A 1I9EA 3QJFB 1SYVB 4WI6A 3LPGA 1YMHA 4DVBB 1BAFL 2OLDA 3KPSB 1UYWH 2XN9B 4JN1H 5GS1B 2ESVD 2HT4D 3CLEH 3HZVA 1VADB 1G6VK 1BFOB 1WTGT 2KQMA 2HKFL 4B50A 4XVUD 1DEDA 4GAGL 1MFDL 3VXMD 3VMPA 1EEZA 1C1EH 1G7HB 3QI9B 1HI6A 1JRHH 3QO0B 4UDTA 2VDOH 4GUPA 4Q9BA 4HF5H 4PJHE 5FF6A 1EUTA 4YNYA 1RHFA 1KN2H 4LQFH 4C58B 4H25A 5K59E 4CVZA 2HTLC 1GC1H 1KGCD 4GW4A 5JDJA 2DMKA 2OL3H 3NABH 4QY8B 3SDDA 1PJ9A 2L7UA 1F6LL 3OV6A 2WZPD 5LGHL 5CJQH 1MFBH 3HI6H 5EZLA 3DX9B 1MFCH 3TJEL 2MFNA 3IFLH 3MOAH 1U3HD 4P9MH 1PSKL 1MCLA 5B38A 5AZ2H 1UJ3A 5I1KH 2J1KA 4UAOB 2E5EA 4UOJA 4I8DA 5FHBH 1JMZA 1QKZH 2RCSH 5DD5L 3IJYB 1A6ZA 3EHBD 1CDUA 4EUPA 3TH4T 2VQ1A 1Y6MR 3GJFA 1SEBA 2F54D 3T1FB 2VDLH 2FZ3B 1I3GL 5I1HH 1LDPL 3QDJA 1H0DB 1D5BB 1KACB 1FZOA 1IGIL 4MHHG 4P2OB 4I9WD 5IW6B 4WI7A 2RBLA 4PJIE 4A6YL 2NY3D 5B4MD 4PJEB 5EA0L 2APFA 4EDWH 1SVZA 4YDIH 3L9RA 1IGCL 4XCCH 4FZEL 5MEND 4I0KA 5KTEL 2X4PB 2J8UF 2VZOA 2Z35B 2X4TA 4ZUSA 2BNUB 4WU7B 2L7JA 3C60D 3MLRH 1I8KA 1S7WB 3MOBH 3LKQA 4HPYH 4NQED 4WUUA 5C0CD 1VB9A 3LSOA 4L3ED 3MREA 4GRWE 2ERJC 3ZKSD 4U1HB 3LN4A 3NCCB 3BD4A 2OR7A 2FWOB 3EYOB 4NFBA 4NPYB 4QHMA 1IGTA 3BZ4B 1Y6NR 3F7QA 1B0RB 2Y4SA 3RKDC 3PF2A 4HC1A 1DBAL 5HPMB 4P23B 5FUCC 1JF1B 3HC3L 2DM2A 5CEXB 5E94B 1A1NA 5IVOA 1AD0A 1BMGA 3KYOB 5DSCA 2PF6A 1KCVH 2BOCA 4Y2DC 3FTGB 2JK5B 3EZ8A 2IEPA 5DZLA 1K8DA 3GO1H 5TE7H 5JHDB 3VXRD 1NMBL 2EDWA 4RZCB 5F6HJ 2HFGL 4JAMB 4NUJB 2EICA 5CGMA 3T77A 2YXMA 4UINL 3ZDZF 4LMQE 1PZUB 4P57A 3MRRA 4QEGA 2UWEE 3O9WC 3ZKMD 4QXTA 1NCBH 3MRHB 4G9DB 2XA3A 4LSSL 1XF3A 3KPLA 5T1MB 1RJLB 2FHCA 3GSQA 1MLCA 4JPIA 3DX8B 2KZWA 3GKZA 5IJVB 2R8SH 4NHUB 2WINB 1I1AC 1BQHG 4X6DB 4DZBA 2KH2B 4PJAA 5HHME 4OZGE 2CLRA 4LSRL 5FV1L 1IE5A 1QA9A 5JPMB 3OAYH 1MHPH 1CQYA 5C8JB 5D71H 5HPOA 2R1WB 2WUCH 3NZ8A 5E0QA 4DTGL 4Q9QL 4CAGA 4G8EA 4D3CL 5D7SL 3VXNB 1H5BC 1MRDL 2OL3A 3VGDA 3B3IB 1CDIA 4IRSA 3V0VB 3P40A 3P4MA 2LU3A 4MJ6B 3HHRB 1OQXA 2HKFH 3QUZC 5HDOA 4GAGH 1NDMB 4N0FA 3BZEB 3RPIB 5B22A 3M17B 5MERB 4X7CC 1IC5L 2IQAB 5DFTA 1P7KA 3WCYA 1LE5A 4KVCL 2Y6SD 4Q2ZA 3ARFB 3SOBL 1R5IB 3SDDD 5A43C 1XGRB 3CFEA 1S7TA 1ACYL 3K8MA 3RUGE 3FO9A 5HY9B 1G7JB 1DBML 1XGTB 1WWAX 2HT4C 4CW1B 3EFDL 1QFOA 4P4KC 3HTLX 1OAKL 4QXWA 3K74B 3MA7B 4H1LH 4MA1B 2QHLA 3BWUC 5LGHH 1GYAA 2WW8A 3IGAB 3QAZB 2IBGA 4JJ5A 4XVUC 2PTTA 3WFEL 1N0XH 4RA0C 4WI3A 2ZP0T 3O6LL 4HUXB 4U2ZA 4UOW1 4PS4L 3HMXH 1J11A 4QNPF 4LQ1A 4KKNA 1NC4B 5DD5H 4BQ8A 1RZ7L 3INUH 3G5XB 3QDJD 2VZVA 4OUUB 3VDCA 4JJHA 3QJHB 4HDIA 1F97A 4OFVA 4KC3B 1I3GH 3C5ZB 2APVA 2CDFB 1ZHLB 4V2BA 1LDPH 3SDAA 1NUNB 4OZFH 1MELA 3HZYA 2EYSA 1IGIH 1TVDA 1XH3B 1MIML 4U7MA 4F7CB 5C70A 4A6YH 4BZ2H 5EA0H 3U4BL 5F89B 5ABDE 1FNGA 5F7MC 4QHUB 2R2EA 1IGCH 4Q6IA 4Y19E 3WO3B 1J1OL 1X6LA 1IM3A 2ZUYA 3EHBC 4NC1E 5F6HI 3RIFK 1FIGL 1MCFA 4WUUD 3K1DA 2E7HA 1AXIB 1U91A 3BRFA 1HDMB 4H8WL 3Q5OA 3KPQA 3OKDA 3D2UA 2YK1L 3DTXA 2QADD 1VKXA 1RZ8A 1U36A 4OD1H 1H8SA 1S9XB 2HJLB 3CCHB 4I5BB 4ZO6A 4OZHE 2C4FU 4FP8L 4PJEF 5GS0L 3LN5B 2NY3C 4O02L 1QFHA 2F53A 3WDJA 5KSBE 1ZLVH 1F8TH 3HE7A 3G04B 4PJFB 5A3ID 5C0DB 5C08A 2HKHL 5EUOB 3MLUL 1OTSC 1ODAA 2I26N 3HC3H 4MGXA 1UWXK 4PRBA 4LLVB 1CK0H 4EN3A 2A9NL 1CFTB 2VUYA 5JNYA 5D6CB 3C60C 4E42A 4YE4L 1BECA 3DURB 4YC2B 1OM3H 5DVNA 1NMBH 1FC1A 1HHGB 3LKPA 4FXGA 3VFPB 3NACL 2X42A 1N4XL 1YEGL 2PYEB 2CIIB 2HFGH 4XVTL 3V6ZB 1HSAB 5C0FA 1B0GA 5I1CH 2JCCA 3DGGA 4YPGA 1LO0L 5CJBA 1MFNA 4UINH 1MCBA 4XH2A 1RAMA 2MPAH 1RQ5A 2D7PA 5DJDA 3WNLA 2P8MA 1TENA 5E95B 3FMGL 1QLFA 4LSSH 4AIZB 2EIZA 4DWHA 1I9IL 1DEEA 2AJYL 3QWQB 4LEXL 4UOW0 5EOCJ 4ZFGL 3QQ9C 4ZSOA 1S9KC 1KCKA 3O4LB 5FA3A 1OLZA 3P9MA 4KXZI 4PV8B 2BXZA 2BSSB 3VD5A 4CVUA 2BC4B 4OV6F 2XA8L 5E6IA 1INQB 2AXFA 4LSRH 3PHOB 2VAJA 5JW4N 4IRSD 1T2QH 5C0GA 1LVEA 4KJWD 3ZKMC 4KK8D 5FO9A 3MCG1 4DTGH 3CFDB 4Q9QH 3G08A 4D3CH 4NOFA 3U9PL 1MRDH 3D3VB 1HILB 2F5BL 2HLFD 1MWAL 4PRNB 3VGGA 4H1LA 1CGTA 4NKMA 3U2SA 3V4PH 3ZHDA 4FFZL 1ZK9A 1MI5A 2CKBB 4RGMC 3HMXA 1FVCA 4NUGH 2IPUK 1IC5H 5B39G 4DZ8A 1SY6L 2C3GA 5JXEA 1TLKA 4KVCH 1I1RA 2V5YA 3SOBH 4OI7A 4RBPH 4PBWD 5DC0A 1FNSL 1YY9D 4ONHB 3IJSA 1ACYH 1UWEL 1QR1A 3BAEH 2D31B 3C8KA 4TUJB 1KLGB 2YZ1A 1Z9MA 1DBMH 4ELKA 4U1KB 3EFDH 4HKBB 4EI5A 4I2XB 5ITFA 1CLZL 4POUB 1WTLA 4JRXE 3GEWB 1QSFE 2YS4A 3WFEH 4A6YA 6FABL 3NBNA 1G9NC 4JPWL 4RMUA 4PYGA 2OP4L 2Y6SC 4PS4H 5I0ZA 4DKAA 3SDDC 3SDAD 1FVEA 1RZ7H 2VDMH 5FO7B 1KJVB 5D2NE 3S4SG 1BWWA 3TF7C 3A67L 1T1XA 2DDQL 1IFHL 4NDMB 4NRYA 4K3DL 1UJ3C 2ARJB 1GSMA 3KLDA 4XAKD 43CAB 4M02A 1MIMH 3BGMA 4GH7B 3TBVB 4S2SA 3DXAE 1MEXH 5ICZA 3QEQB 2FBJL 4MCYB 1EV2E 2IC2A 3VXOB 4FQPA 2Y9RT 4X9BA 2C3WA 3V6OE 2ICCA 2WBWB 3D2UD 1FIGH 4NNXA 2DBLL 2QR0A 1HH9B 5C71A 1EBAA 4I0PA 3QDMA 4H8WH 1P4LA 3R0NA 4HFWA 4F8QA 2F53D 3HPJA 4UIKL 3P9LA 5J12B 5L2JB 2V17L 2Z93A 5TF1L 4NQDB 5C08D 3Q3GB 3WLBA 4FP8H 4HZLA 4K71C 4XVJL 2I60L 4O02H 3MUJA 3GNML 3CDGB 1WIPA 4MA8L 1A6AA 5FECA 4PV9A 4HKJA 1QBAA 2HKHH 3MLUH 4MDJA 2JIXB 4NKOB 1N3NA 2Q7YA 3FB5B 3KPMB 3QQ4B 4MCZB 3PQYE 4JVPA 1WEJL 5IMKA 4YHIB 4YGAB 1YN6A 5C6PB 3X14B 1CTOA 1FSKB 1SYSB 1D6VH 2QADC 1CU4H 1IAKA 4X5XA 1VA9A 4NO3A 1JF5A 4MYWB 4PJCB 1N6VA 3NACH 1N4XH 1YEGH 3BN9C 4RIRB 1FIEA 2LTQB 2DLGA 5EH1A 4WFGD 1LO0H 1F4WL 1RVFL 3QNZA 2GT9A 2X4RA 5A3IC 5C0ND 1GZPA 3B8YA 4UNTA 2I27N 3LAFA 2AEIT 2GQHA 1F3JA 3FMGH 5CP3H 3N1MC 5ALCL 5HVWA 4CMMA 5DRWB 5HDQL 4IMLB 4LEXH 4ZFGH 1CDGA 2ZOLB 3F65A 4GAJL 3RAJH 3PV7A 1YPZB 2ICEA 5HHOD 3N06B 2V7NA 4WFED 3QRGL 4JZNA 1FLRL 3EYSH 4ELMF 2XA8H 3DRQB 3NIDF 2OR9L 4NYLA 3IVKA 4TNWK 1JZ6A 1FC2D 1U8NB 5K33A 3OKLA 3L7EB 1DJSA 3MYZA 4PTUA 3RWHB 2NX5B 3U9PH 4LLWA 1A0QL 1G9ML 2YD4A 2F5BH 2DQEL 1I7TB 2IMNA 4IHOA 3BI9X 4MX7A 4P9HL 4HIHB 4JO4L 3QXVA 2AJZA 4FFZH 4ZNEE 1JZ8A 4YZFE 4TULH 2H26A 4YEFA 4GAYA 5C0AB 3B5TA 5JXED 4FXKA 3BW9A 2N4IA 1GPOL 3IFOA 5DJAB 1BOGB 3RWFB 3O3EB 5DYOB 5CBEA 1P6FA 3P0VL 4FG6D 1SY6H 3GBML 4IRSC 3N1QC 1IAOB 4KJWC 4X4ZA 1R3KB 1IEHA 1R24B 4KK8C 5KSVA 5FUCE 2MOVA 1FNSH 4R8WL 1OAYL 4EI5D 3S3SA 2NMSA 3E6HA 2XXMB 1T5XB 2HLFC 3MV9E 1IT9L 4HWUA 1F4HA 2XI9A 5DFVD 4N0UA 1YA5A 2BZDA 4NQVA 4D0CB 4F80A 3WSQL 2ED9A 4MAYB 3BJLA 1CLZH 3T0AA 2YD8A 1DANT 4PJ9B 3RZCA 1TPXB 4FQQB 6FABH 4NNYA 3R06A 4IDJH 4JPWH 1ORQB 1ZA6A 1NPUA 2OP4H 3LD8B 3NFPA 4D9QD 3P77B 3OF6A 3PP3H 5C07B 2QL1A 3VA2C 1Y0LB 1YY9C 3KDMB 2BVUA 4MXQD 4QOKA 1MHCA 3D39E 5F8RC 3V2AR 2ITCA 1J86A 2X89A 4M7KL 5F88B 3SDXB 3HUJF 4IOSD 3A67H 2W0KA 4MAUH 1IFHH 2J8UA 4K3DH 1MCWW 1N0LA 4BUGA 3QA3B 5EOCL 4Q9RL 2H45A 2CQVA 3F7RA 2E6JA 1U8JA 2FBJH 5EUKA 3BKML 4F57L 5GSVA 4GLRI 3UO1L 3C09B 5L2KA 2D0GA 3QUML 3SDAC 4WO4D 4Z78A 3AROA 4ZFZB 2DBLH 1CXFA 2WNGA 3K2UL 1J7VR 3BZFB 3MLXH 4LLQB 4LHJB 2YPLE 4IJ3B 4UIKH 2EYRA 1DN0A 5DK0A 2V17H 3SCMD 3PWVB 1H15B 5TF1H 5KOMC 4Q6IC 4NSKB 1S8DA 4F15C 2WWKO 4XVJH 2I60H 4X0KB 5J7CC 4Z77A 3GNMH 1T1WB 3ARGB 3UDWC 1MCQA 4MA8H 3GI9L 5EBWB 5CP3A 4UDUA 5K9QI 3BQUB 3BPCB 1P1ZB 3OKYA 4PJDB 5A2KH 4NN7C 4X98A 1HWGB 2OSLB 3CK0H 1WEJH 5HJ3A 4KK6D 5D1QA 3KYAA 3TIDB 3V52L 3MRQB 3HE6A 3VFGL 4KXZH 4G8GA 3VXME 3TNNB 4G80A 4KV5E 2KKQA 5IR1A 1PY4A 2PW1B 1FFPB 4GKZA 5I17A 4NIKB 1F4WH 3JV0A 4JN2A 3FRUB 3OPZL 4M8QA 1Z0NA 4X6EB 4KROB 2YUVA 4WU5A 3QXAA 1MWAA 5GRWA 5IV2A 3T0EA 5ALCH 1OL0A 3S6CA 3FFCB 5HDQH 4NRZB 1G7QA 3VFSB 1KG0B 4X8XA 4NQCA 5E24E 2VABB 4PUBL 3I6KB 3RU8L 3MLZH 3NPZB 1IM9B 1UZ6E 2ATKB 1G1CA 3QRGH 4PJ5B 3VGBA 1FLRH 1I1FB 1SY6A 2M2DA 1KPUB 2OR9H 3HAEG 2GJZA 4MA7L 3VFMA 5DEGB 5C0NC 1XMWA 3FRPG 5I6XC 1A2YA 4R7DA 5L0QB 1JTOA 4L4TB 4UQ3B 2F54E 3KYNB 3F7VA 3MRLB 1A0QH 1G9MH 3VFNA 2CK0L 5F9JA 2DQEH 2R2BB 4POYA 2R56L 4P9HH 2O5ZL 3QFJE 5HI5D 3RNKA 4JO4H 3B9KA 4OCXH 3QG6A 3BYYA 4G8IA 3EDJA 4MQTB 4XNXL 4JQIL 1X4YA 1U92A 2C3VB 1GPOH 4HIJA 3P0VH 3GBMH 5MENE 2BHYA 4GRLA 2X7LB 5E2WL 3BPLB 1ZLUK 4P3CH 1OAYH 4R8WH 3L1OH 3RHWK 2R69L 3KPOA 3S34H 5JW3L 3L3HB 2EDDA 4R2GB 2XG4A 4Y1AA 1OB1B 2QV2A 3RZCD 5IMLA 3WSQH 4U6TA 1NSNL 1MUJA 4OD2A 2Y23A 2BSTA 5HYJE 4PP2A 2ZUUA 3D25B 1YN7B 3OF6D 2NY1B 3FQRB 3BRDA 3BP6B 4QOKD 1FNLA 5C0EB 3PE9A 4FG6C 3HZKB 2QLVB 2X89D 1TCMA 3SE9H 1JI2A 4GMSL 3LKNB 1S7XA 1QPXA 5DFVC 3PWLA 5GS0D 5D5MB 1ZTXL 4M7KH 1ITCA 5B3NA 3MRDB 4RDQG 3VXRE 2D0HA 2PUQT 5EULV 3Q48A 2EYTB 1C12A 5EOCH 4TNWF 4LLYB 4FFYL 4TYUA 1CL7I 2D7OA 2WUBL 5L2KD 1A6TA 1CE1L 3Q6FA 3I50L 4L8BA 1MOEA 2V9RA 3A6CH 3QIWB 3UO1H 4PJEA 4D9LL 3QUMH 1OTUD 5DRZA 4ZUUB 1QD0A 3MFFA 3S37L 1FL3B 3K2UH 1BOYA 5D7LE 2OK0L 2ED8A 5F7DB 1UENA 5GIRB 1ULVA 1X5IA 4J3VA 1HSBB 3GSUB 5FGCE 2I24N 4U1HA 4LVHC 3GI9H 2LU7A 4JZJB 1NAKH 5D1QD 4WO4C 1KLFA 1TVBB 1XR8A 3HE6D 4JREC 1E6OL 4G8GD 3V95A 3CZJA 4P2RB 5EO0A 4D9RD 4OCWL 3GMQA 1UGNA 2QSTA 2V2WA 3R4DA 4FHBD 4HS3B 1DP0A 4LCIL 3V52H 5C1MB 3VFGH 3WO4C 4X4MA 1MVFA 1MAJA 2DQCL 3SCMC 1ZE3C 1A6PA 3UTPD 5FKPB 2B5IC 3FT4A 5SX5K 3OPZH 3TCXA 1JK8A 3ARDA 4L9DA 4YHPB 4NQCD 2E7BA 5GGSY 1QFUL 3KNBB 4XRCA 1P9MA 3WDHA 4QRTA 2PYFA 3CFBB 2GCYA 2XZQL 4QF1B 4P5TA 1BM3L 4KK6C 2BVQB 4ONFL 1IL1A 4HK0A 3WV0A 2JB6B 3F5WA 1EAPA 1KENL 1V7MH 2EECA 4PUBH 3L3GB 4IIQA 4QTHB 2EEDA 4UUJA 3IDXL 3GI8L 3KJ4B 4LASL 4JRWA 3BZDA 1NCCH 4WWKA 1XF5A 4MHHI 4OIIL 5CGYD 3F8UB 5C7XL 5DQ9B 1JCKA 4NO0A 4TUKL 4Z7NE 2EDRA 4DW2L 3B9KD 4U33A 1C5DA 1KJMA 2QTEA 1E6JH 2CK0H 1N6QL 2R56H 2O5ZH 3CNKA 1HYSD 3EOTL 4TNVK 2KZ1B 2VKXA 1KJ2L 4J12A 1C16B 3HA0A 4JPKL 4XNXH 2WANA 5D2LB 1QLRB 5EZJB 1WCBA 4OFDA 5C0BB 3EBAA 1H3VA 5K9KA 4Y1AD 3ECBB 1M6OA 4EBQL 2FJGB 2BVPA 3TH3T 3PDDA 5JW3H 2PO6A 1RUAL 3KLAA 5JIIA 3ARFA 3V79C 3BX7C 3DNKA 4FQCH 4OSUH 2X09A 2A1WL 5HI5C 1UWXH 3L6FA 2WIIB 3SQBA 4K9EH 3ULUL 4UI2A 1NSNH 1X7QB 4CMHC 5FFLA 2DI8A 5E1HB 5B39B 3CFIC 3MA7A 3VFUA 4FQ1L 2EEAA 3QUMA 1OARH 1QO3A 2PNDA 3IU3A 3GSNL 5DLML 5F6IB 1J88A 2DLIA 3LEYL 4M6NL 1OOAA 4QRQB 4XB8A 2V2TA 1IVLA 1Q9WB 3UPRA 1KC5L 2VB5A 3FZUD 4GO6B 5A16A 2HRPL 4GW1B 1RZKL 1A47A 1MCDA 1MJUH 2Q20A 4FQHB 2QBWA 3ZTJH 1UADC 3WNMA 3VRJB 4P3DB 2NPLX 2QSCH 1FCCA 3I50H 1CYGA 1AC6A 4GBXA 1U8OB 4H8WC 5MHSD 2VE6B 4D9LH 1U93A 3M8OH 3IU4L 2MSPA 4UZGA 5B21A 4PG2A 4WEMB 4D2NA 3SPVB 1Z9LA 4U1SB 4P2QE 5GS0C 4PJAE 3S37H 5L6YL 3O2WL 3BH9B 2OK0H 3BP4A 4PJ8A 1NFIB 1P4BL 2OJEA 4U3XA 1ZGLA 3ULVF 4YHYC 4BELD 1MCKA 3RHWF 4XNMB 1S5IH 2A73B 4KY1H 3SGDI 1KB9K 2XQBL 3LKSA 1C8PA 4NKDB 4PJHB 4K7PL 4I18A 4P23D 1Q94B 2P5EB 4WW2B 1ONQA 1OTUC 1E6OH 1URLA 5DMJB 3MJ9L 3Q6GL 3FHAA 4HGMA 4FNLH 4M7JL 1U2HA 4LCIH 4Y4KB 3T09A 4S1QL 5IB1B 4WJ5B 5FGSA 2A74B 3VRIB 4AL8H 2DQCH 3ARBC 2OTUA 4QHNB 4RNRA 5EU7C 1QLEL 5DDHA 1I7RB 2GITB 4JM2F 4LCYB 2WSKA 5MEPB 3MZTA 4PJBF 1ORSB 1U8LA 4ELMA 4Q58C 2D9CA 5D1QC 4QGYA 4FQJL 3T04D 2EE2A 3HE6C 4OCMC 3OXSA 4Y4FB 5D93B 8FABA 2YR3A 4JFPB 4M1GL 1F6FB 3SKOB 1BM3H 4ONFH 4LSPL 3WN5B 1KENH 5IB5B 2P49B 3K0WA 3DUHA 2PTVA 4OZ4A 3O4LA 3IDXH 3GI8H 3QUYA 4HIEA 4LASH 3CAFA 3DX7B 3I02A 4PJIB 2H6PA 3HZMB 1S7QA 2Q7NA 2DMBA 4LGRB 1ZWIB 2NW2A 2PR4L 4JEGB 2BC4A 4E41A 5J06A 3FJTA 4TUKH 4OCRL 3TA3A 4U1MA 4DW2H 4PGDA 1AI1L 3ZE2F 4WVRA 5DRXB 5C9JA 1N6QH 2HJFA 1YEEL 3WXWL 2VISB 3LPFA 3EOTH 3F62A 2W0FA 4PRNA 3FB8B 2VLRE 3VU2A 1CLCA 1KJ2H 3G6AA 4GRWB 3ZYOA 4JPKH 5E9DA 4UV4L 4Z7VF 3Q0HA 5CGYC 1YEKL 5DQJB 3MRPB 4BJLA 1YYLL 3ARFD 4M1CD 4PGEB 5I9QB 3DGCR 3D0VB 1PLGL 2YEZB 4FTVA 2IPKB 3B9KC 3AS0A 3MRGB 4KZEL 2AK4A 5GS1C 1NFDB 5GGRA 3N9GL 1DQJB 1JNJA 1G7MA 4LFHG 3UTQB 1HYSC 3LH2L 5FM5M 5C08E 2RHEA 1MY7A 3HUJA 1MCRA 3BUTA 5BQ7B 3K1KC 4RGNE 1EFXA 5DJZA 5EOQL 2UWEB 4JVWA 1NC4D 4KKLD 2NY7L 4L4VB 1U9KA 5DRNA 2FSEA 3LEYH 4M6NH 4O2EA 3RJQB 3WL9A 1UB6A 3CIQA 1DBBL 4GJTB 2W9LA 2W65B 3RWGA 2JCCE 5FO7A 4RMRA 1KC5H 2HRPH 4Z7QF 4RRPA 1RZKH 4GBXD 4WUKL 5HYSA 4U1LB 4ZDHA 4KRNA 3PGDB 2FDBP 5D7KD 5DUMH 3DX6B 4UAOC 3NN8B 1N59B 5GRVK 3MLSL 1NL0L 3TO4B 3W0WA 3QWOB 3F12B 2HAZA 4JHWH 3IU4H 1PDKA 1JHLL 3DO7B 4LPTA 4G42B 4TNVF 1QR4A 1ZV5A 4PJ8D 3VXOA 1IGFH 3GKWL 4CDHA 1BZ9B 3BPOB 3GMRB 5L6YH 1IEBB 1YYML 1UH4A 3O2WH 1AGDA 3OJVC 2DKSA 3FZUC 5AAWA 4P2OC 4WFEE 1RZJH 4LBEB 5IQ7L 1FG2B 2Q8BH 5J3HD 1P4BH 4U7KA 2N1KA 4R4BB 2FH6A 3AU1B 3LDBB 3MACH 5LGJB 3W11D 35C8L 1Q38A 1A7BA 1TXKA 1U8IA 3RUGB 1T03L 4LSVL 2A6JB 4M3KB 3MJ9H 1MI5E 1E27B 1ZSDB 3Q6GH 3PWUA 5IK3A 4M7JH 3X11A 3K2MC 5DQDH 4S1QH 4HX1A 4MJ4A 4YGVB 5CJXA 1FZJA 3L3KB 2G9HA 5ESAB 2FR4A 4QXUL 3BH8B 2W9EL 3CD4A 4G6AD 3CH1A 3DARA 5E8EB 4IEFB 3ZL4L 4XPGL 1Q0YL 3BEVB 5D1ZA 2OTWB 2R2HA 4Y5VB 4EIGB 4PB0L 4XMLL 4P23C 1MHHB 4KZDH 4FQJH 1NAMB 3B9AA 1RUMH 1N2RB 3O81A 4ZOEA 4HPOL 2X10A 4M1GH 1G7PB 1KXVC 3SO5A 2P8PA 2FO4B 1BBJB 4PRHA 3O4LD 4LSPH 4N8VG 2YUZA 2DICA 2AV1B 1KJ2A 1CVRA 3M45A 1NJ9A 1Q9LB 4ETQB 4EEEA 5K9OA 1ZT1A 1DDHB 1BLNA 1J0YA 1J5OL 2XICA 1WVZA 3DUSB 5E8DL 5HDBE 1EEYA 1G9MC 3SJVA 3TA3D 3MBEB 4HMEA 1FVDA 4CNIB 4D9QE 3VGFA 2PR4H 4P9HC 4O58L 2IH1B 3MTRA 2GFBA 2MKWA 4Y19B 3GRWH 1VFAA 2C3HA 4X5WB 3HI5L 1AI1H 4HFUL 5E2TL 1G7LB 2VXTL 2XWBA 1U8NA 4BSVB 3RWHA 5KN5A 3OJDA 4MD0B 5E9DD 3WXWH 5B3JE 2MCPL 3MV7A 3AAZB 1XR9B 4X4YB 5ILTL 4P2YA 4Y4HA 1KIRB 1T7XA 3HAEB 4OZHB 2DWDA 1F02I 4UV4H 3O8XB 4HJJL 1PKQA 2AJ3A 4FTVD 1RZGA 5C0AA 3RVTD 1YEKH 5KSBB 1U8PB 3IT8D 3IAQA 2AK4D 3GJEA 1YYLH 3GSNA 3QDME 5DK2A 3TLRA 4ZS6C 2EE3A 5GGVH 4U1JB 1EPFA 3GIVA 4HKXA 1TQCB 3S96A 4M61A 1RK1A 4KZEH 4XPBH 4LLUA 4XCFL 3N9GH 2H32H 3DMMA 4G6ML 1VEMA 1XEDA 4QRPE 1MFEL 3OGCA 3UTTA 3B9EA 1JIBA 4X9HA 5C86A 1SBBA 3SE4A 4PJ7E 1EFXD 3V9FA 5B38G 3IF1B 5I30L 4JFDA 2NY0B 3B2UD 4P46B 3TVMB 2CRYA 3ARFC 4M1CC 4EUPG 1NGPL 5BMFL 1EJ6A 5T3ZD 3WD5L 1AHWB 5EOQH 2NY7H 5TH2B 3WIIL 3O3BA 4YHOL 4Z7WF 2AQ2A 1DBBH 3C2AH 3RDTA 1AE6L 2QQNL 5IHLB 4HH8A 3DSFL 1XZ0B 4G7VL 5AZEL 2VLKE 1GRWA 1AH1A 3J7HA 4HIIA 3OXRA 1ED3A 3SY0A 5F71A 4WUKH 5D8JL 2VDPL 5IP4A 3TPUA 3EDEA 4HWZA 1D5ZA 1H3TA 3NIGE 3X3FL 1DQMH 4MNGA 1N5AB 3MLSH 4KKLC 2WK2A 4DK6A 1FJ1A 3MJ9A 2P47B 4KU1A 1QSVA 3EJYD 4QRRB 3QUXA 2X4NA 4AM0A 1T1YB 3BO8B 3GKWH 5ICYA 3PGCB 4H5SB 1YYMH 1U8HB 4XCEB 4XGZA 5SX4I 3HR5B 4G5ZL 4NQUA 5FO8A 3MGOA 4GBXC 1QHOA 3D6GA 4M8VA 5E56A 5F44A 1T7WA 2OTPA 1JGDA 2XQYK 3UTSE 4LLQA 4OZGF 1LO5B 1T0PB 4ZYKB 1LEIB 1QG3A 3MROA 5BXFA 3VDAA 2DJ4A 5A1AA 3KR3H 35C8H 4R4FH 2JIXD 1S9VB 4YBQC 3H0TB 2N56A 1LEGB 3ULVH 4PJ8C 4HH9B 1ZLUH 1CFBA 4L3CB 3MQIA 5JDSA 4PJXF 4XBGB 1S7UA 1U8MA 4X8JB 4JRXB 3L3JB 5IF0A 1RZIB 4WWID 3DIFA 5TDNB 1K2DA 1QSFB 1XGQA 2P8LA 4OLUH 5J3HC 4QXUH 5D1ZD 1Z0MA 1S7RA 2YSSB 3BP5B 5EZIH 3UCRA 1LK3L 1RFDH 2W9EH 5DR5H 4O5LH 2RJMA 3GRWA 4HJ0D 4S1RH 3RVUD 5FCUL 3DVNA 2JJTA 2W60A 1ZS8A 4LCUB 4N0UE 4N9OB 4XPGH 5ETUA 1Q0YH