2Y7LA

Structure of n-terminal domain of candida albicans als9-2 in complex with human fibrinogen gamma peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
312
Chain Sequence
RKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKNSEADSDGDVIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
publication title Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans.
pubmed doi rcsb
source organism Candida albicans
total genus 76
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA02
3V10A 2VR3A 2Z1PA 1R17A 3IRPX 4F24A 2RALA 2F6AA 2Y7NA 4F1ZA 4JE0A 4B60A 4F20A 4F27A 4JDZB 4LEEA 4B5ZA 2Y7LA 5CF3A 3IS1X 4LEBA 3AT0A 4MBRA 4JDZA 4LE8A 1R19A 1N67A 3IRZA 2F68X 3IS0X 2Y7MA 4MBOA 2Y7OA 3ASWA 5CFAA 2YLHA 5IHWA 3AU0A
chains in the Genus database with same CATH superfamily
3KPOB 5BVPH 4KGJA 1S3KH 2CDFA 2EIKB 1N0LA 2R1WB 3BP6A 5T5FL 4NDMA 1ZT1A 1C16A 3MRCA 3S36X 4DGUA 5LHDA 1N7ML 4X99B 4YDJA 4CN1A 5EF3A 2FUTA 2KT6A 1YYCA 1F41A 4A7GF 1LEIA 3L4YA 2EUXA 5DJXA 4KK5C 2Q2LA 2OYMA 4LCYB 4N3TA 3RVWC 4KGLA 4F33B 3FBQA 5AVQB 1DQDH 2JSFA 2XVGA 3BUQA 2GBTA 3IKCB 1RPQA 4J2QA 4Q89A 4AE0A 1VACB 5CFHA 4WI6A 3WAJA 2MNWA 3C60C 5FYJD 2OM5A 4GSRA 1D9KD 1JFHA 4MAUL 4AJWA 1ZVYA 5IMLB 3S36L 4DZBB 4GG6F 3EJTA 1D6EB 5E6UB 4GUPB 3KPRD 1PW3A 4D0BA 3SBWA 4Y2DD 1UB6B 2GBUA 2GK2A 3BUPA 3E6FA 3HMWH 3ZDXF 1D2OA 5FGBC 4PJXE 1FP5A 4TN9A 3LY6A 2EYRA 1UC6A 3GMOA 2RH0A 1MFNA 1JVKA 3KPMA 2YN5A 1BQKA 1CLOL 1TYRA 1U0QA 4GJTB 4M1CC 4P2OD 2PO6A 1BZOA 4F2FA 5DRZA 3FUDA 1JZFA 3B2DC 5BRPA 3ELAT 1S78D 2P52A 2QFPA 4AC2A 3QQ4B 2Y1AA 3TNNB 2OR9H 1DVSA 1XSJA 5GRVL 1PG7L 3WKNA 5GS0H 2HG5B 4NO3A 4IYKA 4A38A 1ZLWK 1A7QH 1IC4L 2H47C 4H8VA 3EO0A 2AJ3A 4YHNA 3FT0A 3D34A 4KHTL 5FLUA 4RSYA 5D7SL 2Y07L 1BXXA 1FNEA 3IPFA 1Z5HA 3ZR6A 4GQ9L 1QUNB 4EN3A 1JK9A 4LVEA 1MWAH 4GMTH 3K71B 1CL7L 5DFVD 1R4XA 3K72B 2O61B 2F0CA 3WEXB 4A2HA 1IARB 1CU4L 4BK5C 1F3JB 4IM8A 1PLCA 1QBLH 2NY6B 5C0BD 4M8UA 1FC1A 2CAKA 3LB6C 3SIKA 4XCCH 3GSUA 3O4LB 1RK0B 4IMLB 1QSEA 3CH8A 1ZE3C 1C5CL 1SVBA 4XMZA 4JQXC 4QRSA 4DUXA 2IOIA 4U49A 1S9WB 3MNWB 4OGXL 5I76B 5IM7A 1XD1A 1XCQA 3FB5B 1GXEA 2ZZUT 1LO4H 5EIIA 3VXPA 4IBSA 1BQ5A 1E5ZA 4ALAH 2AJSL 5BW7C 4I0PA 4NZRH 4NLHA 4E9WA 4LLQB 2B39A 3KXFB 4XCNA 1AY1L 2Q3ZA 4L05A 4HIEB 2BHUA 4LLMB 2BWDA 4MQXD 4QHUA 1T7XA 1T04A 1KBGH 1ZEAH 4I0KA 3SODB 2HFEA 4MCZA 4N2AA 2NUTA 3JWNG 1T1XB 4WI5A 1WTGT 3IXAB 4MHHG 1IO4C 1TCRB 4H88L 4IOSD 4RMBA 4O9HL 2UXTA 2Y36L 2OXHA 3CVHL 5CCJA 4BEIA 1CDBA 1AZNA 1KN4H 3I84A 4DSYA 4WK2B 2Y5QA 2H3KA 5DT1L 5DZ9A 5LXGL 3WFBH 3D39A 1P4IH 3UTSA 4ZO9A 3TH2T 3WIAA 4N0FB 1BVLB 4RRPG 2CM5A 3SDCD 3EYOA 4X4KA 5GGSA 2YAEA 1ICTA 4LHUD 4Y19B 2QVTA 1QFWM 4Z18A 1FVCB 4GW1B 1WAAE 4OAWA 1T5WB 1T83C 1UYWL 3LQZB 5F3HB 3K8KA 4GKZA 5ISZB 4JN2A 3KNBB 4L3AA 4P5TD 4R7XA 4GO6B 5HHXL 4M4RA 3G3LA 4AQ8C 1KIRB 4OZGA 1LO0H 4KK8C 4OI8A 3CFDA 3HG1D 2A74A 3IS1X 3VFVA 4W9ZA 5AYUL 6PAZA 2AEPH 5IQ9A 1T1YB 5KBMA 3UZEC 3VXTB 4ODVL 4ZTOH 5HSFA 1U3HD 1CJYA 4XNZC 3RZCB 1ZA3B 4TVPE 1AFVH 3FTGA 3GEWB 5J4MA 3KWVA 1H5BC 4K7PY 1DVFD 5CEXB 1FL5B 4HWBL 3D0LB 1ORSA 1QR4A 1BZ8A 3MNMA 4Y1AB 4AGQA 5C09B 4FXGA 1EXHA 5I16A 2PR9A 5IESL 4PCKA 1I53A 1BM3H 4OZIA 4JRXD 5GS0C 1WE5A 1P84K 1S7QB 3PQYE 3JWDL 2XA8H 1ADQL 4K9EL 4I13B 1NFDA 5TK2A 3CC5A 3VFUB 4AQEA 2I24N 4F1SA 1H8NA 1OAKL 4QTFA 4HJGB 4PGEA 3VDCA 1UCTA 2WQSA 2FWOA 1OGTB 1WZMA 3BPOC 5JQ6L 3T9WA 4YO0B 5DA4A 2A9BA 4XVUC 2B9BA 3OB8A 2EUZA 3BAXA 1JP5A 4Y0GA 3QJQB 4NZTL 3CLFL 4NHUB 3A3YB 4QGYA 3ETBJ 2DM7A 3WU1A 4WFED 1IAIL 3FFCD 4QI3A 3MOAL 2VMDA 4YGAB 3WN5C 5IFJB 4AH2B 3EKCA 3VFRB 2Q10A 4LEXH 5KSBE 4NPJA 1MEXL 5CJ8A 4G43B 3WJLA 3ZKXB 4KJWD 4PBVC 4UAOB 1NAMH 2WJ5A 3OKEB 3EH2A 1DBAH 1DJWA 4GO9A 1DZ0A 2CRMA 3B9KB 2ID5A 3IDYB 3MV9A 2L8AA 1I85A 1GMIA 3LNGA 4KRPB 2ZYRA 1JNJA 5EIVA 2ZJSL 1FJ1A 3MLWL 4HW6A 4J4PC 2Q5BA 3OR7B 3N5AA 2XTJB 1Z7JA 2NZ9D 4ALAC 3R0NA 3PWPA 3SQRA 4NO2A 3DV6A 5AUMB 1KJMA 3IJ7A 5EC2B 3MLXH 1WIUA 3IBOA 4N3UA 2BSDA 5GJTL 5D7LD 1YEFL 4P5SA 1CZ8H 5AOIA 1NL0L 3E80A 1F6FB 5H37H 2ZOKA 5T3XL 4LSUL 3K6SB 2VB5A 2UZYB 3TNMA 2ZXEB 3O41A 5GGVH 2VQTA 3QNZB 3FQTB 4X7DC 2ZUSA 2C9VA 3QIWB 4XWOD 5DUBA 5AW8B 1HAUA 4KAQL 4L1DA 4ZW7A 4Y2NA 2EDLA 5EB9A 5D7IE 4B60A 1BZ9B 1VLXA 1O6VA 3LXAA 4HT1L 4ODSL 1S9KC 1M7IB 4XC1H 3PWJA 3KBPA 3MREB 4W9IC 1EERB 1NGXB 2ZIDA 5JPNB 1GOGA 2YSSB 4N0CD 5FKPB 3NZHL 5KBPA 1A9BB 3A22A 1MAMH 3I85A 4PJEA 2XN9B 4IIQB 5MENB 4BDVA 2X87A 2JXMB 2EABA 2PWDA 1AI1L 1FC2D 4UQIM 1AJ7H 2PCYA 4JO4H 5A40E 5FHBL 1HL4A 2DBLL 2IFGA 3MKGA 3VGHA 2J72A 4JFXB 4KC3B 4MNQD 1NDGA 4Z7WE 4JPIA 4LSVL 4S1SL 3HHMA 1KJ2L 1NC4A 4C47A 4X5PA 5BVJA 3KBHE 2B3RA 1MZYA 2OMUA 4P23A 3ZZLA 2WLYA 1HEJC 3QDHA 3N0PB 5HJ3B 3SBQA 1G7IB 1U33A 1CFVH 4G9FA 3FT1A 5KVEL 3PE9A 4OM1L 1H0DA 5BS0A 5KUMA 5ESQB 1HKLL 2LFEA 1MLCA 1GPOH 4XAKD 3OVUB 4QHMB 4RFNB 2R0LH 2HB0A 3FQRB 1K85A 4TLSA 1NDMB 3I2CL 3CHXA 1SUHA 5IIEA 1J1XL 1Q9KA 3Q6GH 4IRJB 2OTUB 4JKNA 5GISH 3S35X 3BLPX 4PY8I 3HZVA 1NPJA 2JI2A 2KI6A 3HS0B 3EYFB 1MHHB 1FYTB 5DHDA 2YK1H 1INEL 3DOHA 1R3IH 1U8NB 3E1ZA 4PREB 2J88H 4LPWA 4AYDC 2R2BA 1T0NB 3ARBC 5AZ2H 4L4VE 2ZCLL 3QRFM 3UG4A 1JN6A 1HSAB 2A4EA 2NXZD 4IDLA 4JJOA 3M07A 4Q74A 2ZWNA 3GUTA 4R5TA 4F7EA 4Q0XH 4GT7A 1HH6A 1KCLA 3QORC 4NB7A 2HFGL 1OOAA 3C5ZD 4LCWE 1CD8A 2BY0A 3IJSB 3II1A 3ZR5A 3SDXF 4R9HA 5HGHB 1CTOA 5PCYA 5I1LB 2VW6A 5LAPA 3S35L 1XFPA 3SEPA 4Z8FL 4CW1A 3C6LB 3I75A 2XTLA 2H3NA 4KOBA 1V3KA 2Y7SA 3MJ7A 4EIGB 2CUMA 2GSMB 4LNRB 3BSZA 5E6ZA 3NJFA 3GMRA 2XDHA 3RDTA 3UAJA 2GW5A 2ZUVA 3AS1A 3LZLA 3QZWB 2P80D 5E0FA 4U1KB 3EH1A 5DRXA 2L7UA 5LBSH 4RQQB 2EDRA 1O7DC 2R56H 4FLRA 4P46B 4WVRA 1PZAA 1Q94A 2FSEB 3B43A 3U2IA 5MP6H 4S1RH 1CLVA 2AVFA 3GNML 5FM4A 3QS3A 5I6MA 3OV6A 5CD3A 5D1XA 2MOVA 4L4TA 3DECA 3UYOD 1GC1H 3IF1B 1YNTF 3D4ZA 4J27A 5ITBH 3I9PA 3JWOL 5E95B 2C9SA 3DA0A 4Y5YA 2X0WA 4R4NC 1KYUA 2HLEB 1ES0B 2EDKA 3VJ6A 1A47A 5FYKL 1X7SA 4FGMA 3OKLB 1BIIB 4U31A 1D3CA 1UWGH 3AREA 1P7KA 1W2KT 5F0MB 1ACZA 2O5YH 2LGNA 3L3OA 2OPCA 4EIBA 2ICCA 2X1OA 3ORJA 3ZMRA 5I6LA 1NBYB 1CK0L 1VFAB 2W88A 3WTYA 2DQIH 2VN7A 3N41B 3ZTCC 2YA0A 2BOCA 1SRDA 4ODXA 5BMFL 5T1JA 1QWHA 2IV8A 3D05A 4ZSOA 1TJHL 2OR7A 1NUNB 4LCVA 5EU7C 5AVYB 4ZPVA 3D4CA 5IGXH 2JJTA 1AGDB 2PWHA 4UANA 3C60B 1W72A 1TQUA 5E2VL 4HIHA 1MCQA 3PL6A 1DL7H 5T1DH 1F0LA 3VX0A 2MFNA 2IGLA 3D25A 4NQEB 2LW3A 1E43A 1RZPA 2R4SH 3NGBC 7FABH 4XP6L 2XWDA 4HF5H 3MMEB 2QQLH 3MLRH 1I1FA 4MAYC 4AGOA 5EOCJ 1OGSA 4AUUA 4LSSL 3MJGX 4AVHA 3SDYL 5DEFA 1E30A 4L37A 4WFHD 4Y5VA 4CVUA 3SKMB 4J3XA 3EO9H 4HMDA 4WUUE 4CBZA 3G6DL 1JZ4A 1XL4A 3UGUA 4J8RA 3OAZH 2B1HH 4YPGA 2D03L 4PJ7A 1BXAA 5KW9L 1INQB 1U58A 1S5IL 1WFUA 3IRCA 3U46A 5C9JA 2GJ6E 3QUZD 1BFOB 5DHVA 2BIPA 3UJTL 4U1NB 5GGVY 4ZXBC 2DWDA 2DPKA 4JCWA 5E23A 1XTMA 3TF4A 1DUYA 4LO9A 3BXNB 4JFPB 4A6YH 1FRGL 1BF2A 4JPVL 4QRPD 5SX5K 2VDPB 4DAGH 2QDVA 4PJXA 1I3RA 2HT2C 1ZTXL 3TFBA 4XMTA 2FBJL 2ROYA 3ESUF 4OQTL 3GINA 4NJ9L 3Q06A 1GZQB 1JHLH 1NCNA 1P2CA 2VERA 3GRWL 1Y0LA 4MLSA 2IOMA 2YAPA 4UIKH 4HWZA 1BD2E 1ACYH 5IJVA 1LEGA 1FZKB 1OT2A 2RGSA 4TUUA 2G5RA 4GS7C 4AVKA 1NPUA 4OZFB 5GXBB 1UZGA 5HYQA 2IO5A 3G04A 1OCWL 4X6CB 1F4XH 4WK4B 5C0RH 5I1GH 5J1TC 3PWVB 3SDAD 3T2PA 1ZHLB 2AJXH 4B9ZA 5B1JC 1N6QH 5J11C 1QEWB 4I4WB 3NIGE 1BLIA 4XPFH 1NCDH 2Q3AA 3FDWA 4EI5D 5FUCE 1UM4L 1U8CB 4XXDA 1AGCA 3BSGA 1OVZA 3HUJE 4AK2A 1FZMA 3BUTA 1IV8A 2C3HA 1AS7A 1XDTT 5AVUB 3IJYA 1GC1C 3GSNA 3HMXL 1BVKB 4NQSA 3LHPL 3MLZL 2F5BL 2OR8A 5E1IA 1Y18B 5IHHA 1OTUD 2CKBL 1QSVA 1PDKB 4JGMA 4ERSH 1AQDB 1LWJA 1QI4A 1TSHA 4UZSA 5CP3A 4N0UA 1N18A 1NGZA 4E9QA 4NT6A 4M6MH 1VESA 5F0PB 5TK4A 4JFDB 1TUPA 1TENA 3BT2H 3S37X 3MLVH 4K5MA 4MJID 4K23H 1KCVL 2HLAB 3VYNA 4FTVD 4EN2A 4NC0B 3WIHA 1A0QH 3AG1B 4LMQE 2EIBA 4PLJD 2K7PA 4M29A 3LEVH 1NCHA 2YWYA 3ZRSA 4NC1E 1URIA 1VB9A 1WEJH 2BNRB 4S2SA 5L4JA 3QA3B 1DJGA 2YXMA 5CZXD 1NC2B 3U0WL 2ORBH 5B3NA 1G84A 5I1CL 1WZ1H 5FGSA 1PYWA 1FDLL 4BUHA 3BH4A 3CVCA 3FUMA 2ARWA 3GJFA 5DJ6B 3EG9B 32C2A 5IQNA 3S37L 3O4OC 3GMQB 2CQVA 4XTRD 35C8L 4NAQA 4LSDA 4J3OH 4XPBL 5C0AA 1UVQB 3OMZA 5HGBB 1ECZA 5F9DC 4UV7H 4J6IA 4YFEA 4HS6B 5DWPA 5HDQL 2NW2B 1K6QH 1ZT7A 2QADD 1A4BA 2X1PA 4Z0XA 1QYGL 1U8MA 4X2UA 4XNZB 1HH9A 1N4XH 5KANI 1H5BB 2ZUWA 5AW0B 4U1MA 4K5PA 1ROWA 4KQ0A 2LU7A 3RYMA 3VA6A 2R23A 4K7FA 1Q72H 4EI6A 1X4YA 4XCEB 4NENA 5JHAA 4Z7VE 4MA7H 2CDGB 1T66D 4U6VL 1U9KA 3BZ4B 1Z6JT 2VXQL 1PGRB 2R15A 1K8IA 4ZMXA 3IPBA 1N3NB 2ZKHH 3RJQB 1CQYA 3KLAB 4PLKC 3F7RA 3F12A 3O3DB 4JFSA 4DKEL 2Z8SA 2P26A 4UZUA 5CN1A 1XF5A 2P5EE 2Y5TB 2YRBA 3L4CA 1F02I 2K4AA 4QOKE 1MWAB 4HXAL 4G6AC 3KL5A 2YGVA 5T1LD 4W6XB 3APFA 5E8EA 1P1ZB 3UTZB 3TF7C 2VDOH 2DD8H 1E3XA 2O30A 4KV5F 3ELQA 4PV8A 4XX1G 4ILDA 2EH7L 4XP4L 2CCLA 3GMLB 4DEPC 5TD4A 3WN5B 4E9XA 3BO8B 2YEVB 2IH8A 2XQBH 1YO4A 2YMOA 3F6LA 3PV6B 3AAZB 1KLGA 1SQ2N 5AB9A 1JXGA 1TTGA 5D2LB 4C4KO 4UDUB 2V7HB 3RILA 1HEZB 4LT7A 2R0WH 1CCZA 1E9OB 4FAAB 4PU2A 2ILLA 4TLTA 4YK4C 1RUMH 1YVLA 2WLIA 3S8FB 3TIEB 3SPHA 4OW6A 5DFWH 1SYVB 2IQAA 3HE6D 4PGJA 3KPPA 4PRPD 1ZGLP 5T3ZL 4JFEB 5IWLA 4H8UA 3D9AL 5FCUH 3BKCL 2ESVD 1MHCB 1SN0A 2X09A 4G7QB 4EUPA 1WLHA 2YBRB 2CE6A 4OUUB 4XVSH 3AITA 4JZJA 5I19H 5ADOH 2H2SD 4ZQKB 2PWEA 1G5AA 3VU2A 2HJLA 2XX1A 2VDNH 4TQEH 4ETQB 3VXNA 5D4QA 3IDMB 4ZK8A 4MYWB 5ALCL 2AXFA 4LCUB 4KOCA 1XGUA 3UBGA 3TL5A 2BNUA 3RI5F 2AQ3A 2IANB 5LCVL 1HHHB 3QPQC 4I3SH 4XVOA 2QL1A 3H8NA 3QIUA 1ED3B 3KPSA 4MD5A 1S7WA 4EN3C 5JO5B 1QSFE 5IB4B 2XVKA 5FYJU 3H42H 2J8UB 1RZIB 2QPEB 3T3ME 3K3QA 5F9JA 1G0XA 3SJVA 2CJ3A 2PYEA 1NMBL 4LVNC 5A2JH 5IW6A 2ODIA 5MEQA 4YSSA 5B1CA 2Z35A 3HC4H 4LARL 3LH2H 5D7IA 2OJEB 1IC1A 5DA0B 2BDNH 2IH1A 3WE1A 4K8RH 4J3OC 4YSOA 2R1YB 1JDCA 1OAYL 1PLBA 3N85L 4M9OA 1AYRA 3VFMB 4GY4A 5EU4B 3NIDF 3K6OA 4F57H 1RVFH 1G1OA 3ZHDA 3L3IA 3GUFA 4FMFA 1MCBA 5CLTA 4I0PC 2VSDA 4WJKB 5F9OH 3CFMA 2WLJA 4JLRA 3UC2A 5ID1A 5T1MB 1A6WH 5IVXF 2YXVA 3KWWA 2CDEB 1Z0MA 1MFBL 3WNLA 1WUZA 5EFIB 1R6VA 1LQBC 1P6AB 3KD4A 1XCXA 2YD9A 2OYLA 3ZHKA 3ARBB 4JRWA 4P4RB 4XNAA 1N2RB 3IB4A 1VZGA 4U1IA 3ZE2E 4QTHB 4X5QA 5E7FA 1OSYA 1MJUH 4K2UL 3AS0A 1M42A 4B0MM 3QORB 3KLQA 5T3ZD 3IKKA 2WZPA 2N56A 3AWGA 4OFIA 5IFAL 1YUHA 4JKWA 4YSUA 4BFBD 4P2RD 4YXHH 4PVBA 3AM8A 5CAYB 5CJBA 3TA3A 1U21A 5HYJA 1MLBB 3T6VA 4JCLA 1MF2H 2VE6B 2YGOA 1W9XA 1QWUA 2WN2A 5F72S 3Q8CA 2JCCB 5DDHB 1SXZA 4OCYL 4NRXB 1KENH 4HWNA 2EC9U 5E6SB 3RP1A 3UG3A 4RGOL 3RGVD 3BAJA 4WU5B 2A1WH 5FF6B 5F2FA 1VFBB 2YRPA 4YVNA 4BM7A 3G9VA 1NAMB 5FYJE 2AW2A 2DI7A 3CUPB 1MAJA 2EYSB 1DFBL 1M1XA 4JHUA 4LCWA 4P99A 2WV3A 4OCRL 1BOYA 1PBYA 4PRHD 2G3MA 3ARGA 3X14B 3OLIA 2Y7MA 1J05A 3O8XA 3GZOA 3PDDA 4ZS7L 3OJVC 2FX7L 2A74C 1W15A 3P0YH 5HVGB 3BIKB 2YD7A 5DJAB 5IQMA 1JYNA 2KH2B 3EF4A 4JRLA 2ISDA 3RKDD 2FIRT 1UD5A 4TTGA 4E0RB 4MNGA 4JR9H 3IT8D 4POZC 1SXCA 1E6JH 1IAKA 1NWPA 1IVTA 1OAQL 3FO9B 3HB3C 5K1JA 4P5MB 4PRBB 4DP0X 5CCKL 1XF4B 2EDHA 5IBTH 1NANH 1U30A 4ES8A 3R06A 5IMMA 3EJYD 4JG1H 4FXGC 3OR6B 5CXPA 5TE4L 3MRFA 4JFYA 2XKSA 3A6OA 2A0LD 3QAQA 4X4YB 4U1LA 3I02A 2I85A 3RTQD 4HUWB 1EHKB 1DQML 3C8KA 1HHGB 1B0WA 3FU3A 1U8IA 4MQ7A 1A3LL 3MOBH 1R5WB 3U4EB 2Z91A 2Q2EB 4FABL 5IMKB 1DBKH 4NBYB 2VDML 3D69A 4HPYL 4QRBA 1CD9B 1RZJH 2EEFA 1QW8A 1TDQA 2F7PA 4D0DB 4NNPL 4F7CA 1CFTB 3QQNA 1IKFH 4KTEH 2B08A 5TF0A 2F61A 3BAEL 4ODHL 5D6CA 3BSZH 1C12A 4WIQA 5GGSY 4Z7OB 2IAMA 2JQAA 5C0BE 5TGBA 1Z9SB 5DVLA 1ETB1 2QSCL 2WVUA 1M6OB 1IMHC 3NGBB 4K8RC 4KRLB 4BXSV 3PIQB 3DHUA 2FGZA 3WJLC 5I8CA 3QZWG 3MCKB 4JAMA 2C34A 3BKJL 2YEZB 5KOVC 3ABLB 3HIZA 1CB4A 4LGSB 4MAYB 5I1KL 2WY3B 1VSCA 5CGTA 3WFHA 2X0UA 4ZMOA 1I85C 1MVFA 3QJTB 2QPSA 2BRRL 3KEHA 5HGDA 3QUGA 2PLTA 5C0ND 3MNVB 2VN5A 2JFCA 3WENA 1BJMA 2BW4A 2BZ7A 1AQKL 3BW9A 4YHZH 5BUGA 1MFVA 3MBEA 2DV6A 4I3RL 1LTXA 1UOKA 2N1TE 3FB6A 4B7LA 3QJHA 5E5MA 1EA9C 3C12A 5HJBA 4F9LA 2QGBA 2EZ0D 1Z3GL 3PDGA 4ZXBB 3PHQA 1R34A 2I27N 3CSPA 3HJ0A 5CJQL 1U3HC 4KZCA 3GB7A 2FEEL 1X5FA 5D1ZI 5KBKA 3S98A 1HEHC 1WC7B 1GA2A 1IQDB 2NPLX 1SQMA 1P6FA 2AXJA 3DGGB 2ERJC 4WUUA 2ZUQC 4DKFL 3MX0A 3ROOA 1JV5A 4XZUA 1HOEA 5DMGC 5AOLA 3HN5A 1I4FA 1P6WA 4Q52A 3LRMA 2WZAA 4I1RA 4WZ9A 2GJ6A 2OMYA 4JRYB 3K2MC 1BAFH 2D7PA 3S5LA 4GS7B 4FI6A 4P2QD 3V4VA 4CJ0A 1F4WL 2QV4A 4WAFA 3ULUF 4GAJH 4OCWH 3DXAE 1HVXA 3O0RH 5J13C 4I2XB 3WFEL 4PLNC 1W72H 3LKQB 5BQDA 1DANT 4M7JH 3UJIH 4L9DA 3VE0A 4UM9B 2NNCA 5I1DB 3Q2WA 5AWNL 1BMZA 3W9EB 3T0DA 3GDCA 3VMPA 4JUSA 4AENB 2G5BB 3QQ9C 3B37A 5J11B 1UH4A 5F93C 4LLYA 3G6AA 4P23C 2R7EA 1PKQB 5EU5B 1UATA 4YHLH 4L8CA 4JKPH 1YEIH 4AQOA 2C4FU 3HG1E 2ADYA 4JGNA 2A6IB 1A6AA 3J7HA 1UACL 4PM1A 3OG4B 3EYUH 2ZXDA 3EOAA 4H0LC 1BFVL 4MZIA 5D6DA 1DVYA 1JFQH 4M03A 3P9MB 3N43F 5A3ID 3QCVL 4I3GA 2TSAA 3BP5A 5E70A 5FOBB 4OJAA 1E40A 4KZEL 1M7UA 2VZUA 3MCYA 4L29B 2P42B 4MKTA 1QFWL 2NZ9C 2X89D 3LQMA 3TA4D 3EO1B 5DHVH 5A6IA 4TULL 1MJ8H 5CBAA 1KGUA 4JRXE 2RAMA 5TQ0H 2R69L 1I8UA 3AG3B 2CA4A 1OV8A 3TIDB 2WHVA 5EU6D 2DB8A 4HWEL 3TYFA 4QY8A 1UZ6E 2GITB 1MRCH 4ZMLA 3FT4B 2ATPA 1RZJC 2BVPB 2F1BA 4M7KH 2IALA 1DZBA 1B4JH 2DQHL 4H1LA 5SWZB 4FQ1H 3U25A 3B7SA 5AL8A 3DRQA 1A2YA 3SE9H 1JYWA 2G2RA 5HHQB 4XODA 4ESKA 1FL3B 2BSED 3GIVB 5C7ZA 4DNLA 3II2A 3ROLA 5SWQB 4WFEE 3O4OB 1IKOP 3DYMA 5L6YH 3DTXA 1E8YA 4YAQA 4L2YA 1EH9A 1WA1X 1YEGH 4N0CC 3RDTC 3UAJC 3ZX1A 2PR4H 4EVNB 1FYHB 4PS8A 5E1HB 4OZFG 3L6FA 2YAFA 4OZ4B 2C9XA 2AABH 4Z7QF 6TAAA 3KGUA 3GXFA 4RWYH 4N2MA 1FGNH 2XG5B 2BIQA 1MY7A 1BQHB 3GS7A 8CGTA 1M1SA 5L4FA 5EO9A 5CGYC 3US1A 5IOKA 2V5SA 1MIML 5C0EB 1KXTA 1KB5H 1M7XA 1ND0A 3FU7A 1MNUL 5D1XC 5T1KD 5LJYH 3JYBA 4FFZL 5EO0A 5HPMA 2ZOWA 3GSNH 4B9CA 2NUPB 5D7LE 4CU8A 3O6MH 3T6ZA 5CJXC 3IWUA 4NPYB 3EGSA 4Y5YC 2EE2A 1HILB 2Y7QA 1IBDA 2V6HA 3DO4A 3DKHA 3HI1B 3TLRA 1QO3A 5EPMA 3U83A 3RX9A 2XV0A 4QYOA 1JPFA 2HLFC 4MCYB 2BJML 3MUJA 4XRCA 4A6YB 2Z4QA 2J2ZA 3L08A 4N85A 5CP3H 5ETUB 3CDZB 1OLZA 4GYBA 2ZD0A 5HI3D 3CFCH 1P5VA 4A39A 2X6MA 4GSDL 3AREC 1N0LB 3BP6B 3D12B 1CDCA 1RUQL 4NDMB 4ODWA 2ADFH 1ZT1B 1C16B 3BX7C 3D3VD 1B0RA 2LABA 3ECBA 3SPIA 3WIHH 4XO5A 3L3OC 5DD0H 3ZT5A 5IEHA 5JQIB 3RWJA 3EJSA 1TTAA 1LEIB 1NBQA 2JQMA 2P24B 3CDGB 3IFLL 4DEPB 5ANHA 1BBDL 3MCG1 4Z7VA 2UZXA 4FQJH 5HVHC 4L2LA 1LO2L 4A7SA 1GIGH 1QHQA 2E86A 3U1SL 2ITCA 5F7AA 4K7PL 2JJTC 1XGQA 5D4JA 4A67A 4HHAB 2F58L 3BE1H 1K5WA 2BP0A 3GJFH 1UXWA 4MNQE 1MOEA 2ZOUA 4RSVA 1B3IA 3PL6C 3CN0A 5CR8A 2BS8A 2P5EA 1GH7A 1UHVA 5AAWA 4ZFZA 2KHAA 3CZKA 3X13A 3NIFF 1AZBA 2WWOA 2OMNA 4GAFB 4D0BB 4QOKA 3BDBA 4Y2OA 1FAIH 2D7OA 2XFXA 5E51A 4YK4B 4AYMC 5IFHL 2NW3A 3PGCA 4PS7A 3RVTD 4NEHB 2X6UA 3E6FB 1XIWD 3QDMD 1SMAA 3H7BB 4OIIL 5ES4B 3M17B 1OGAD 2EYRB 3QR1A 2WNKA 1ZY9A 3EOTL 4M7LH 4Y5VC 3UTQA 1NQBA 2BY1A 5I1EH 4XAKE 3KPMB 2JK5A 4O2CA 5CCGE 1YY8A 2EDMA 2DIJA 3VI3F 5DRZB 5FB8A 1F4YL 4PWHA 4MB5A 2E3VA 4NM4L 5JOEA 3WUZA 2K7QA 2CUIA 3WAKA 4XN7A 1KDIA 2AEQH 4NO3B 1ZXKA 1XO8A 3QZBA 1XF1A 1QFUL 3EO0B 4YHNB 3HNVL 1MFDL 1W16A 2NY4C 2XU9A 4DK3A 4YEFA 3P73B 3ULSA 1FNEB 1JZGA 3QFJE 1A14H 1XZWA 4WF7A 3OPZL 4W68A 4U4IA 4WDIA 5TFSH 4EN3B 1JK9B 2COVD 3NACL 5T3XE 1AS8A 1QRND 3FHAA 4PRNA 2I60L 1SJEA 1MCPH 4QT5A 1FLTX 1KELL 4NZUL 5C92A 4LVNB 3N42B 4DFIA 4BZ1A 5F1NA 5DD5H 2HVKB 3HFML 4MRBA 5DR5H 5KS9F 2V37A 2JKXA 2RALA 5CILH 12E8L 4E41D 4ES9A 1SZNA 1X5IA 1IEAA 5B39A 3GSUB 5AVTB 5L4IA 3VWKA 4LU5H 4OGAC 1QSEB 4QKXB 2CM6A 4UT6A 1I7RA 1TO5A 4FHKA 5BUPA 3WTVA 4NQXA 4KO7A 1F56A 2XPZA 3EFOB 1J8HA 4N24A 5CM1A 4AQAA 3BH8A 5IM7B 1IBZA 1XCQB 1ORQB 3LJ3A 3IMRA 2IG2H 4NQCD 4S11A 3BVWA 3VXPB 1IGFH 4YGVA 5AOKA 4JFFA 1O5PA 1I9IL 1N5YL 2IDSA 4O02A 1R3LB 4FQCH 4I0PB 5EWIL 2J8OA 2E4TA 2CUHA 3KPRB 4XCNB 1T6WA 1DJYA 4XP1H 3CLEL 4RAHA 1H3PL 4L18A 1T89A 3ECVA 2OX5A 2BRQA 2YZ1A 4QHUB 1OM3H 5ICZA 2VDKH 2WLLA 4Q9QL 4EUPH 2PW1A 1UXLA 3JUZA 2UYLA 3BVNA 3Q43A 4V1DE 2HFEB 4MCZB 2NUTB 6FABL 3RX5A 5KVEE 3N1FC 3F64A 3L1OL 3NN8B 2FJGB 2WBXA 4WWID 3V6OA 3IJHA 3K2UH 3FB7A 4IIZA 1HTYA 2OXHB 2MQCA 1PZ2A 2ZXGA 4GAGH 3RIKA 3VVWA 3TWCH 3UOAB 2XN2A 1WSST 1X9UA 2FDBP 2Z1KA 1CIDA 1ETJA 1RIHH 1JXDA 2IBZY 4B41A 1C8PA 2VDOB 2IBGA 3BVUA 4K3JL 3UTSB 3DX1A 5CJOL 2CK0H 3UCQA 4GG6A 4OGZA 1THAA 2F74A 4IOIA 3MRHB 1WJ3A 3FHQA 3NH7L 4IJ3C 4ZUTB 4XPTH 2P3YA 4PLOB 1T22A 5F89A 2WSKA 3V0VB 4OAWB 4NFCA 4Z3FA 5C0CD 4TSBH 3LNDA 4GKZB 3MN8A 4JN2B 1ZMYA 4LOEA 1SLVA 4M4RB 2VRAA 5MERA 2YFOA 2DWTA 4OZGB 2MCG1 2IQ9H 3CFDB 3CDYA 1P9MC 4XMKH 2H8PA 2A74B 2EDQA 3VFVB 2OULB 3FB8A 2NX5D 1MQKL 1GGUA 1WZLA 5A2CA 4OGYH 2CHXA 2FX9L 5LVEA 3Q8BA 3FTGB 4JN1H 1NPNA 2YO3A 4XC3H 1N68A 1PU0A 1YEHH 1IC7L 4N86A 4G42A 3SDAC 1ZKAA 2MSPA 3HB3B 1BLNA 4U1SA 3ZOAA 5SV4A 1ORSB 1RZKH 3OHXA 1IBBA 2FD6L 4FXGB 4OB5H 3M46A 4EI5C 3CPLA 2XWTA 1I8MA 1E4WL 2MEJB 2VDNB 4HSAC 2D0HA 4BQBA 3MLPA 3ME0B 4AQEB 4XMXA 5E6RB 3TJEH 3NUKA 2DKMA 2J1YA 3CSTA 4Y4FA 3W81A 4GIOA 4PGEB 3B1UA 1JG9A 2J73A 1KFAL 3CH1A 2FWOB 4QRPE 2X9XA 4A68A 2Y6TE 3HZKA 1AO7D 1WUNT 3RAJL 1LDPL 3O45A 1MG2C 3INUH 5ANMB 2O93L 5C9KA 5IB3A 4IBZA 5BRZA 5FYKE 1R5VA 4F2ME 5CZVH 3OAUL 2RACA 3RA7H 4O51A 1WIPA 4Y8DC 3I74A 3SKJH 5I0XA 4NBXB 4PUBL 8FABA 1MELA 3O6FD 4X4ZA 4OM0H 3AT0A 3GXNA 4M3KB 5DVNA 3LDBC 4ZMTA 3E8VA 3I3BA 3EXJA 4OFYA 2LVCA 3MV9B 1X4XA 2YARA 2CALA 2CLRA 1L6ZA 5DD1H 5CZKA 1XB6A 3OKNB 3PWPB 2ODHA 4MASA 1KJMB 2RA1A 4HFWA 4MXWL 3O0LA 4Z7NB 4KNUA 1L0YA 2BP3A 3AQYA 3ZSSA 5IWLC 5T5FA 4XMLL 1ZLUK 5H37G 4NUJA 4G6KL 2JLLA 3TNMB 1U3HB 5A7EA 3P3RA 2XIDA 2OKMA 1QBBA 2BLFA 2ICWJ 4XMPL 4JREC 1CS6A 4JZJC 5DUBB 2ZOLA 5EF0A 1J0HA 1CGTA 5L7XH 4DO6A 2D8KA 5INDB 4LOUC 3I6GB 3T2NH 1K5NA 2SEBA 4JM4H 4QO1A 4HDIA 1NCIA 3D85A 2ERJB 3PWJB 3VXSA 4MJIE 2ZUQB 3V5DA 5I0VA 2N7SA 3OZ9H 4FTVE 3OC5A 1U8JA 4LESA 2I32A 3HC0A 1OOWA 3QIUC 4PJ5A 4PJEB 4ZTPH 2LQRA 4DQOL 4BDVB 1WA0X 2E9BA 5J13B 1I9EA 2XPYA 5HJGA 2BXZA 4DO5A 5ICYA 1XF2A 2WN3A 2DIEA 2OK0H 4ANKA 5IK3B 4JPIB 1I9JL 4F58H 3DUSA 5JNYA 3KL0A 2RBLA 3Q1SL 2ZNXA 1AC6A 1ZTXE 2J4WL 2QBWA 5A43C 5BVJB 1WPCA 3L7FA 4N0YL 3BKML 1UFGA 2OMUB 2P5PA 2ZP9A 3FFCB 4G8EA 4P23B 5ADPL 2DLHA 3NCEB 1CVSC 3TC9A 3VD7A 1KN2H 1QNZH 3BN3B 2HJFA 3G5YA 1H0DB 2F19H 3Q2CA 4AIXA 4DGIH 1MLCB 3UTTA 5JHLL 3HAEA 4OKVA 1I1AD 1MJ7L 3AXLA 3KLKA 4FI7A 4LLVA 2R0ZH 4TUKH 4PWJA 4QRTA 1LE9B 1NCOA 2AV7B 3EFDL 4LPTA 2GTWA 4OU3A 2Y24A 4M5YL 1T1ZB 3DXAA 1Q9KB 4JANA 1FH5L 1RZKC 4LSQL 3RY5A 3QEQD 3WHE0 4KMTH 4FFVC 5KSVB 4YDVA 1EVUA 4G3YL 3ZDYE 2Y25A 2R2BB 1DCEA 4JDVB 1ZRUA 1JN6B 2FEDD 1G7PA 3BAYA 2G30A 2WPGA 4E42A 3GUTB 5I28A 4F7EB 4FP8H 4KTYA 4WCYL 1B88A 4HGMA 2PNDA 1RZ7H 3FQ4A 3GGWA 4V33A 4LRIA 4DP1X 3MGAA 4AYID 3AM8C 2FSDA 3TA3C 4IKJA 1KTDA 2CPUA 4CW1B 4F15C 1GHFH 3I75B 2FQEA 2H3NB 2Y7NA 3QXWA 4LPYA 3VGBA 2HH0L 3VRIA 3MJ7B 5JUEL 3ZY7A 3UXFA 1AR1C 5AVWB 4UDTA 2CCVA 3OXSA 5EF2A 5I1IL 1KCSL 3RDTB 3V4VH 4DTGL 4DKTA 3KPNA 5CLYA 5IOPB 1YPZE 4Y4HA 5AYTA 3NT0A 4M1GL 4L5FL 3ZE1B 2NY2C 3BGMA 2G3ZA 5DRXB 2PF6A 2X4OA 1I3GH 2HSIA 4PHXA 3ARGC 3MFFA 4ELDA 2O5ZL 1Q94B 5E5RB 2YQBA 1J1PH 2F54D 1OHZA 1XZ0A 4OSUH 3PHOA 3SE8L 1OPGL 1J88A 3REWA 5CD3B 4YHPA 5D1XB 4L4TB 5F7EL 1NCCH 4X7SL 3OG6B 2DQCL 4UQ2B 4WI8A 2E5EA 2VDLH 3MJWA 4LMQI 2ZG1A 4PRPE 4QRAA 4DVRH 3CVHA 2R51A 1BGXL 2DQEH 3BEVA 4M43H 4NSKB 4Y5YB 5DEJA 2Z0UA 2ESVE 4IBTA 4LCIH 4HETA 4PJAF 3QIBD 1KCUH 3KL3A 3E3QC 2X2IA 3FYEB 3X3GL 5FUZL 3VJ6B 2Y06H 5JXAH 1W6WA 4KNQA 2JCCF 3C87A 1JGUL 3QJFA 5I23A 2P48B 3FSAA 5C0FB 4Q58C 3AREB 4RAVA 4DVBB 1KCRH 4J28A 2GBAA 3L3OB 2EDYA 5A2FA 5T8IA 1L9SA 2VR5A 4N87A 2BCMA 3L4VA 3E8UL 3OL2A 1TJMA 5TE6L 5IUCA 2BOCB 1RURL 3FN0H 4CMMB 1CLYH 1SBBA 2H4EA 4ZSOB 5HVHB 2L4OA 4TYUA 1QAWA 3VD1A 4JO3H 3NCJH 4ZPVB 5G2NA 3HLAA 3QEGL 3NABL 2VLKD 1H6UA 3M88A 4HIHB 3FCTA 4OR1A 3PL6B 1NKRA 2RMNA 2IAMC 2QMJA 1TYEB 3HPLA 3D25B 4Z78A 2ITDA 4PJHE 2OV0A 3KHQA 3ZO0A 4AZ8A 1M53A 4P9HH 1I1FB 2QT6A 5KSUA 3QDJD 5KVDL 1CICA 2Z31A 4A2DA 4PJGF 4WEUD 4M6OH 4L37B 4Y5VB 2JIXA 1HIML 4ACPA 1ZPLA 4JO2H 5FKAA 5KJ4A 1PF3A 4M62H 5BUAA 1BQHG 3JTSB 3OMAB 4GUCA 1T7VA 1KTRL 1IM3A 4J8RB 1HNFA 3UGEA 5I15L 4UNUA 4YPGB 4BHUA 1E4HA 1O9VA 2YXWA 4GMSH 1YQVL 4PJ7B 1RK1A 3MBEC 5E6IA 1U58B 3VG0L 2QKIC 2QQNL 5DMIH 3SDXA 3U46B 2EXYC 5I74C 5C9JB 2AQSA 3B8SA 3VFGH 5DHVB 4XN4A 4F9LC 3WTUA 4MDIA 1WFTA 2BFVH 2GCYA 3RFRA 2DWDB 1HC1A 2F18A 2UWEF 5KBDA 1DUYB 2NY4B 1X5YA 2AK4A 3BDYH 1RZ8B 5F6IB 3RFZA 1T0PB 2LOEA 2X9ZA 5T3ZE 2YPVH 1I3RB 3KJ4C 4LSTH 1EFXA 3VI4E 1J48A 1RULH 2R1XA 3TEYA 1OQOA 4NWTH 3IRPX 1EK3A 2CMRL 4P2RE 4LBAA 1CGWA 4BKSC 1JWMA 4U6YA 2QVIA 1P2CB 2AGJL 1SN2A 4A55A 4HWZB 3ZZQA 4RMTA 5F7FA 2KERA 1F8TH 1KBKA 1LEGB 2EDXA 3HS9A 3NA4A 2DKUA 2J12B 3DUUA 3IMTA 3QDGE 4JFUA 5HDBB 2OJZH 3HZYA 1KIPA 5FYLD 1I82A 4PGBA 1OSPH 1Q9OB 5HYQB 5BO1L 4BXVA 3G04B 3PNWA 4GIPD 4KHXL 1OCZB 1TJIL 1YNTA 2WYZA 2NY0D 3P11H 3PFUA 3QFJA 4ZUUB 3ILPA 1GJIA 3KW8A 1PY0A 5D7JA 1AC0A 1AXSA 2QELA 1RPUA 3QPXL 4NN7C 2W1NA 2R2HB 4PRHE 2IBBA 1AXIB 1P53A 3UMTA 3FO0H 4PY7A 4YLBA 2ED7A 1AGCB 4XXDB 1FZMB 5FV2A 1KB5B 5CGMA 1BCIA 2ZUUA 3IJYB 3GSNB 1CYWA 2W9DH 4NQSB 5CSZA 4Z5RA 5ESVA 3D2UD 1T0MA 3ARTA 3T1FA 4ETYA 3V0WH 5CD5D 4JL2A 1IQWL 4YE4L 3VW3L 5H35A 2X0VA 5FPIA 4HOXA 2HP4A 4C59B 4N0UB 1NGZB 5DRWA 2ENJA 1N8ZA 3MO1B 4NT6B 4Z9KB 4UOW0 3EUDA 2OTWA 2XN0A 4R3SA 4XB7A 4RIRA 4JQIL 3CN2A 5CEZL 1EJOL 3QFDA 3JV4A 5KVFE 3GM0A 1C5DA 3IDIA 2HX8A 3HZMA 1KJ2A 5LGHH 4HS3A 3U7WL 3V52L 4S2SB 5GRYA 3LIUA 2XZZA 4PB0L 1KEGH 2BSSA 1WFIA 4IJ3B 4OLVL 3ULVL 1IVLA 3GFUA 3RWCA 4A63A 3BVXA 4AIZA 4HLEA 4V1DA 4BZ1H 1YMMA 5HVWA 3GJFB 4FFYA 5FXCH 2RCSL 1MXDA 4ANWA 2NT1A 2ZF9A 1QI5A 4JMXA 1RV6X 1WGOA 1HHKA 1NGPH 3RVVD 4K3EH 5AZEL 3LVTA 3SQOH 3J27A 3N44F 3UYRL 1XGYL 4J3OG 5C0AB 4UT6H 5JR1H 5AW3B 5HYSA 2OSLA 1H15A 1JPTH 4P9HC 4L48A 1EO7A 3N9GH 4WHCA 4C56A 2QLVB 1ZT7B 5D8JH 4GRLD 5CMAA 1EDHA 3BMVA 3TVMD 4F7MA 4Z0XB 1U8MB 4XPHH 5JIKA 2Y1ZA 3CX2A 3EH5B 3SDAB 2ITFA 4XN5A 4O02H 4K7FB 2ZUXA 4JKKA 2OSXA 4EI6B 1RUAL 4J23A 4NENB 1IBFA 4EI5B 5DU7A 4BWTA 1WS7A 4D8PA 1UUSA 1E2VA 3HG5A 4CMHC 4HJJL 2ZICA 1HX0A 4KI5C 1JNLL 4NHCL 1K8IB 1R75A 2DL9A 1M9SA 2WUCL 3P9LA 5DEGA 4EBQL 2K1MA 3FCSB 4B3EA 3PP4L 4JFQA 5BJTA 2WO3B 3F12B 3IN2A 4APXA 4QRFA 1W8EA 4QHKJ 1XF5B 2X12A 3LXUX 4N8VA 3RWGA 4KVPA 2WXQA 3BHBA 4AC4A 2NY3C 3BCDA 3IFNH 1AG0A 5B21A 2OL3L 5K33A 1AKJA 1F1DA 2HMID 3T0EA 5E8EB 4HD5A 4PV8B 3SGDH 3DMMD 3N2JA 4XBPA 4XB3A 4JFZL 3THML 3WI9A 3N06B 4IRZL 3UERA 4DZ8A 2YRLA 5KYUA 4QHNA 3FL7A 2XZCL 5CEZD 1KC5H 4U1HA 5F7UA 5GS2D 1AQ8A 4ZW8A 1XX9C 1EAJA 1L7TL 1YJDH 1WZAA 2C8NA 1KLGB 3TM6A 1A7RH 4NUMA 5KANG 1A1NA 4CILA 1R9FA 1BVOA 4HXBL 5AAWC 1E4XI 2J20A 3AB0C 2FECI 3OKDA 3MJ9A 3WKML 1SM3H 2WLIB 5LDUA 1SNRA 3TO4D 3OHMB 1WT5A 2IQAB 3CFUA 43C9A 1U92A 3KPPB 1ZT4A 4WNSA 1G9EA 2X3CA 2QADB 1AE6L 4ONFH 4PRIA 1A7OH 3VB8A 1TITA 4EUPB 4LL4A 4JREB 1AS6A 5FIEA 4JZJB 3VFOA 2B1AL 4HEPA 1RU9H 2EC9T 4PP2B 4XAWH 5F1IB 3OF6D 4ZFGL 2HJLB 3NP3A 2QTVA 1GR7A 3H56A 2E7CA 2PETA 3VXNB 1FORH 4G1EA 3ZE0F 2GUYA 4PJ8D 2A9NL 4RFEA 5K9KA 2AXFB 3BT0A 4W93A 1XGUB 1KB9K 3LV3B 4W9DC 5AW9B 3TEWA 2BNUB 4L8BA 3W37A 4Q9RL 1A7PL 4OD1L 3Q8AA 3VD9A 3QIUB 4QRRA 2UUDH 1CUOA 1S7WB 1VFUA 1YYML 3IE9A 1U8QA 3KPSB 3BAIA 3LS4L 3QEHA 3M8OH 4MNHA 4A1RA 3DO7A 3Q7JA 3SDDA 4N8PA 4DCQA 4F9PA 5F9JB 2ZX9A 3SJVB 4K3HA 1Q0YL 2PYEB 2IGFL 4MKMA 1Z9PA 2WVTA 1RUPH 4LOFA 1F00I 4FFTA 5MEQB 4JPWH 3P02A 2BS9A 2V9RA 4BZ2H 5D7IB 5E4EC 3UGXA 5EORL 3RIFF 1LK2A 1ZGLA 3L81A 5IV2A 2IH1B 3U0TA 3VWKC 1OAZL 3S0PA 1G7MA 1CE6B 1HAWA 1JMXA 5DLML 4EF3A 1LO3H 2GABA 4OZHF 1BQUA 4HIXH 2NY5L 4JDTL 4QGTA 2EINB 2WO4A 1P4LA 4NKOA 3AXIA 3ESMA 1TKWA 3L3IB 2K70A 2N59A 1Z0NA 3QXVA 4BK4A 4JLRB 3BLKA 3IDNA 3CGTA 1CGSL 4H7VA 1TZ8A 5DRNA 3RUGB 9CGTA 1QVOA 5L9DH 3S3BB 1T89C 2NMSA 3L2NA 5T5FH 4X83A 2EDOA 2AMGA 1R1CA 4U1IB 5EV7A 1N7MH 4XB8A 3B7UX 3N42F 2NOYA 1G7LA 1M05A 4ICXA 3K74B 1EUUA 4OV6F 1ZV5A 2PTTA 4KX8A 2DYRB 2KPNA 4YHOL 1U6AL 3U2SB 3V6OC 1LEKA 1MHPL 2V3FA 3CFKA 3GLEA 4X4MA 3A6BL 1UZ8A 3OTTA 1JTOA 4HLJA 3P0GB 3TA3B 5HYJB 4F15B 1VERA 3D3VE 3KDMA 4ZD3L 3BI9X 4BWWA 1UB5A 5A2BA 4MAUH 3N3EA 2H32A 3IS0X 5DHMC 3E0GA 3S36H 3HN8A 1H3GA 1AR1B 2J5LC 2QSQA 4B9PA 2OMZA 2XY2A 2DQFA 2X41A 3V2AR 2H1LM 4HFUL 4L1HA 3IFPB 7CGTA 1AIFA 1YCSA 4LLUB 5D55A 4KK6C 1R24B 1YJDC 1V05A 4PJBE 2NY2B 1V7ML 1I75A 1E7UA 2MTPA 1M1XB 3HMXA 4LCWB 5E08L 4TSCH 3OPUA 5BXFA 1X4ZA 2NY6D 2K9UA 4NNXB 3ARGB 2B0SL 1J05B 1CLOH 2CKBA 4MBRA 1G9HA 4GRWE 1CT8B 2XACC 5GRXG 4LBEA 2BWQA 3O4LD 3V6FA 3BQVA 2XVLA 4QIRA 1Q9LA 1ULVA 3EGDB 3R7RA 3W5MA 1LLAA 3B9DA 1FNGA 3BEWA 3HAEH 4MNGB 1UG9A 3QDME 1TQWA 5AKRA 1PG7H 4HSQA 1OGAE 2QZ5A 1TPXC 3FQNA 5E8PA 3QUKA 1IAKB 2EKJA 3CXHJ 1YPZA 2Y07H 3OHXC 3V5KA 3R06B 5IMMB 1A1OB 4XP5L 4U3SA 5E4IA 4H2CA 3KCPA 5F7WC 4YDKH 3MRFB 2ZWYA 3KXFD 4JFYB 4GW5A 3DI3B 1TTUA 1I9RH 1CL7H 4U1LB 3I02B 5JLZA 4FZEL 2FT6A 5E1QA 1E5YA 3VMOA 3UPRA 4Y4FC 1U42A 3C8KB 3V4UL 1CU4H 1ET8A 1U8IB 4MQ7B 3HC3H 2Z91B 1NIBA 4EMZA 4KK9C 4P8QA 5I71C 3D69B 1MG3C 1GGBL 1URZA 2BINA 4OZGF 4MCMA 3CNKA 3BRGC 2FZ3A 2C4FT 4GOSA 3W38A 4F7CB 1GY1A 2DF3A 3RWHB 2WXFA 3BKYL 4XWGL 3ZDXE 4XN9A 4NUGL 3SQBA 1CR9L 2XWRA 4R0LC 3HNSL 4WTXA 1ZLSL 3FO2A 1VGEL 5D6CB 3FRPA 15C8H 1C12B 2VC2H 4OGXH 5EC1A 2IAMB 1T5XA 1HYSC 5D2NE 1RAMA 3WS3A 5FM8A 2Z9TA 3EYSL 5F71A 2L7EA 4XE0A 2X40A 4E41E 2QHRL 5DURB 5I8CB 2NNRA 1KYFA 1BFSA 2YHGA 3GRBA 3KAAA 3AU0A 3MXVL 3QZLA 4JAMB 4O5LH 2MCPL 4NNYA 3B2UD 4HU2A 4PQXA 4X4XA 5SX4I 3TBBA 4AYFA 4Y19D 3UFIA 3FU6A 5JQHC 1CWVA 3P4LA 3HNTL 3WFHB 5SX5H 3B3IB 2QJDA 4OZIF 5DS8A 3RPKA 2WP3T 5HD8C 1DBML 3OAZK 4YXLH 5ISZD 2VM3A 4A7QA 1SEQH 5HGDB 4NQCE 1E27A 1NFDF 2VN3A 2VXQA 3SOBL 3BW9B 1ACCA 2G0KA 2J57A 3LMJL 3MBEB 2J5WA 2QKIB 3G6JB 3IMBA 3GO1H 4L8SA 3FB6B 5I74B 4B27A 1S9YA 4H88H 4ZDHA 4O9HH 4X6DB 3QJHB 5E5MB 4PI2A 1IGJB 2R4RL 2ZYHA 3CVHH 4JM2A 4Q56A 3WUWA 1TZIA 4LASH 3D06A 1XMEB 3F85A 1JTTA 3FU0A 3PHQB 2X4UA 1S5HA 3TZVA 5LXGH 4UQAA 3GB7B 4NKDB 4C83A 5I6OA 2NY1C 2F6AA 4RESB 2A9CA 1LILA 1DQQA 2F8IA 4GT0A 3V8OA 3DBSA 4H5SA 3SGEI 2QLYA 4UINL 3KJ4B 4Y1AD 1BQLL 5C09D 1NGWA 1R5IA 2LAGB 4JFVA 4XI5C 2VCOA 1QWNA 1CPUA 5HHME 3JUYA 3ZYJA 2XJKA 4HAKA 5D1QA 5I6KA 1P5UA 3MX0B 5IB2B 3GHBL 1JV5B 4XZUB 5J1SC 3U0PA 1UYWH 4ONOA 1I4FB 4YDNA 5HHXH 5ITFA 4FYSA 4R26L 2AXHA 4HJEA 1IAII 3S5LB 3D33A 3VFNA 3V4VB 1A5FH 1O6SA 2HT4C 3AJ7A 2CHWA 3LD8C 5KVGE 2YPLE 4TLKA 2GKIA 5AYUH 5GRZA 1AP2B 4Z7NF 4CSZA 3VE0B 3HI5H 4UOQA 5C0CE 3MLSH 2YWZA 2LU3A 1ZHBA 4OTXL 3VXMA 1OO2A 1UA6H 2CD0A 4NN7B 4KDTA 5EUOB 5E7BA 2GJJA 4LLYB 3G6AB 3KLSA 3PV7A 3VI4A 2B2XH 2JLPA 2R7EB 4GKLA 2CKNA 2J1WA 4L8CB 5DC0A 2B4CL 1A6AB 2B77A 4A66A 3ZT6A 3Q8EA 3RIFK 3O6FC 5EUKA 3VYPA 5IESH 1MFAH 2NX5E 1NLBL 2VDLB 3N0AA 3QDGA 4PTUB 5IZ7A 3JWDH 2BVEA 3BP5B 3BGAA 4KRPD 3UO1L 4BA8A 5AKSA 1OAKH 4TV3A 1OEZW 2XTJD 3A24A 3ULUD 3TESA 5LCVA 2HKHL 5L0QC 4QWWC 4AUJA 5JQ6H 4NJAH 3ZZSA 5JHMA 2W9LA 2ICWI 1IB5A 4NYLA 5AZUA 5CBAB 1JAEA 4D8OA 4F8OA 3QXUA 1FNSL 4TM9A 1OWWA 1LP9E 4OJEH 5HDWA 1CVRA 2HTKD 2OS7A 3TYFB 4QY8B 1IAIH 2VLJE 1IGYA 1BECA 3EZJB 2IOOA 4E9SA 4ZZKA 1E9PB 5I0WA 4WSJA 3MOAH 1CGVA 4LRIC 3VU1A 2ATPB 4KXAA 2IALB 4FG4A 1XAKA 1FIEA 3LYRA 2YGQA 5E00A 1RFDL 2E7HA 1A2YB 1AO7E 2EKSB 2E76C 2I69A 2WXNA 2G2RB 1INDL 3HE7A 3VXUA 1V10A 3U4BH 2E6JA 4QYAA 2DLFH 3ROLB 3ZPDA 3D07A 4TNWK 3DTXB 3HN3A 4YAQB 3TTSA 3LIZL 3MLWH 3QJSB 2A4CA 4HG4K 1WAEA 4TVUA 4BGDA 2IFFH 5DTFA 1EV2E 3BISA 4K07A 3HRPA 5MEND 2XN9D 3L6FB 4OF0A 4Y4HC 5IROD 3VQ1C 4GRMA 4P2QB 4B9YA 4WEBL 4KX7A 1VAHA 4NP9A 1YEFH 5KN5A 1NL0H 3DETD 4KJPC 1LWRA 1CC3A 2GJRA 1EBAA 2ZXAA 4P2CG 4LSUH 5T3XH 4AGPA 3BESR 3L45A 2YUVA 1D5BA 2H0PA 2ZCZA 3ESVF 5EO9B 4JHZA 2HRPL 3MV8E 2NTFA 5ILTL 5IBLD 1KXTB 1ND0B 3FU7B 2YS4A 2VAJA 5EO0B 2Q87A 3VNYA 5HPMB 3UBXA 3ZVVA 2VXSL 4HBCL 4RZKA 5GGRA 1E9QB 4CMHB 2Y1YA 2YSTA 3IDXL 4NRZA 4O00A 5D7KD 2DQTL 2Y7QB 3AU1A 1BVNP 3QW9A 1QO3B 5EPMB 1WWAX 1JPFB 2WNXA 3A67H 3IEAA 4IDJL 2VXUL 4KDVA 2Z4QB 1LD9A 2J2ZB 1ID2A 3LKSA 4IRJD 5PAZA 1EDQA 2PP7A 1OKEA 3MSPA 4Z7IA 2NY3B 4ODWB 1FYTD 2E47A 2HRHA 3BUBA 1AI1H 2DJSA 4Z7UE 3ZDZB 4LP8A 4PBXA 5GPRA 1B0RB 1DQJA 2DBLH 3ECBB 3L7EA 3MRQA 2A5UA 1D7BA 1RK7A 4W4NA 2W91A 5IEHB 3RWJB 4LSVH 4F5CA 2W80C 3VFSA 3NG5A 1KJ2H 5EU6B 2E9GA 2C3VA 2GIYA 1FNFA 2UZXB 1HNYA 1GSKA 1S7RA 3GMMB 2XKNB 1BMWA 2DWYA 3RB7A 4BE6A 3LKOA 1TZGL 2F15A 3GTVA 3ZIMA 5JW4Q 5L8JB 5AAPA 2BP0B 3MV7E 1UXWB 2JKSA 4FG6C 4FFYH 3C6LD 1HKLH 2N7AA 2VDQL 4EDWH 1UOVA 4P04A 4PVNA 5AB2A 3AB0B 4HAGA 4ZFZB 2E46A 1HHJA 1DBBL 1C7TA 4TNGA 2FIKA 5INCA 5JHBA 3BZDA 3I2CH 4Y2OB 2XFXB 1J1XH 2BH0A 2G9KA 3PGCB 3BP7A 5F7LB 3EH4B 1CICC 2Z31C 1INEH 3CHQA 4TS6A 2AI0L 2IAAC 5TE7L 3UTQB 1JBJA 5DYOA 2YEQA 4GG8A 4ACTA 1RZGA 2JK5B 4O2CB 3JWDC 4YZFE 5J06A 1FI8C 4W70A 1K2DA 1YY8B 3LRLA 3F6IA 2XJLA 1NCWH 4P46D 2YD5A 4AW7A 5E6IC 1PJ9A 5FB8B 4TRPL 1BDYA 2FGWH 4GP4B 5CO1A 3QEQE 5T1KB 3WDHA 3SKNB 5E2UL 3S35H 2WQ8A 4Z8FH 5I82A 4ZMWA 4MB4A 3ULSB 4HLZH 3TN0A 4YE0A 3QCUL 1IILE 5F9AC 3RFZC 2IADA 4MMZA 1U8OA 1FZJA 3K1KC 3QIBC 4PJDA 4WDIB 4OCSL 5DSCA 5GZNA 2FYYA 3JWNE 5GGTL 4PRNB 4DN4L 2CLVB 3APDA 4QT5B 3T5WA 4Z77A 2JE8A 5BZZA 1J9CT 1MAKA 4OVVA 1HXMA 5F1NB 3RGBA 1NCAL 1JPSH 3HPJB 1BW8A 4TUJA 4BA0A 2KPWA 3W0WE 2F7IA 1VKXA 5E4EB 3Q05A 3AGWA 1IEAB 5B39B 3P0VH 3VWKB 3RVWD 3GNMH 3WKQA 1QKZL 4CKVX 3ZL4L 4CN4A 3QC6X 1I7RB 1XBRA 2XV6B 1A21A 4NQXB 5IQOA 1J8HB 1DQKA 3S2CA 1RJYA 1CBJA 3BH8B 4AQAB 2D73A 3NQIA 5D7JC 5T33L 4I5BB 2OQJA 3Q3GA 2F7QA 4JFFB 4MA3A 5KYNA 3MJ9H 5IBUB 4O02B 4NQED 3QUYA 2DTSA 4P49A 2F54E 2Y3AA 5B1BB 3DO3A 5F8QC 5FYKH 1FHNA 3KYNA 4PJXF 2WB7A 5IHUL 2OX5B 2OW7A 5ICZB 2WOBA 3APCA 3ISWA 2WLLB 1F97A 2PW1B 1S9VA 3D87B 4EUPG 1FWXA 1X5HA 1IKNA 3MZGB 4XMUA 3GMNA 3WJMB 1Q9WA 2VOTA 4WW2F 4R8WL 1CK0H 4KUZL 4FNTA 1IGTA 4M1CD 4X9GA 1CLZH 2KUTA 3IJHB 1XR8A 3FB7B 2FQFA 3CWGA 2WBJA 2R9HC 4DKAA 2DLEA 3L3JA 3WNJA 2P45B 5DXWA 1QTSA 4N9GA 5C08A 4ZMPA 4UCFA 1DQDL 1H19A 3CN1A 4KU1A 4LGPB 3WS6A 2D7MA 2ETWA 3SY6A 1JE6A 1YN6A 4WTZA 4GG6B 3ZYZA 2J5LB 2QV2A 4BKLA 4Z0BL 5L2KA 3BVTA 3RWEB 3VX1A 5JOPD 2F74B 1QPKA 4IOIB 5TF1H 1FV1A 1IM9A 4HMCA 4K94H 3CN3A 3QJZA 4XP6H 3ZE2B 1T22B 5DHEA 5F89B 2E7MA 1UWEH 1ZK5A 4JFOA 4D3CL 3MUY1 4E36A 3OSKA 4LSSH 3SDYH 2VLKE 1MI5A 2FCBA 1XH1A 5AALA 1R3JA 3NSJA 3DUHA 2H3XC 5MERB 4HQQL 4UWQB 5CP7A 2CWRA 1LM8V 1EEQA 3LB6D 2EE9A 1QR1A 3VI3A 2H8PB 2D03H 3EYQC 4UTCA 2KLSA 3FB8B 3OXRA 2FWLB 3PDOA 5HHPA 4MLIA 2F53A 2WTPA 5C3LD 1YG9A 4PJCE 2CR3A 1S7VA 4J12A 2VWEC 2EIDA 5F6HJ 2ZE0A 4G8FA 3UJTH 4DP2X 1TPXB 2FATH 2EXWC 5EOQH 2IDQA 4G42B 4N90D 4MSWA 4XMWA 2R69A 4QR7A 4AEIL 1BLNB 4U1SB 2H6UA 1T80A 3OHXB 4L5FE 2FO4A 2OR9L 1FRGH 4JPVH 1LO5A 4NM8L 3P3TA 1A7QL 3CPLB 2QPDB 1BA9A 2OMTA 3U30C 2EUVA 1ZTXH 3QARA 4YHKL 1XQ4A 4W9LC 5EH1A 2FBJH 2XWTB 2J7LA 3O3BA 4DQAA 1JZ5A 1I8MB 4ZS6C 2C4XA 3MRGA 3ARXA 1FO0L 2ZP8A 1HXYA 3Q6FA 4Y4FB 1MUJA 1IFGA 5EOCL 2WUBH 4GMTL 4HC1L 3CH1B 1B9KA 1FIGL 3GM8A 4JHWH 3NYKA 2AITA 4NIKB 4OBSA 5I71B 1T1WA 1J5HA 2BVUA 4Y4KA 2DM2A 2NRDA 1IAIM 2P8LA 4BYHA 3HZKB 4PWGA 1C9SA 3GD1C 3T0EC 4ENZA 1J9SA 3O45B 4R0LB 4NPKA 4CC1A 5IB3B 4XCCL 5BRZB 1QSZA 2H32H 2W81C 3ZK0A 1JZHA 1UASA 4QHLA 3FHEA 3B7RL 1TMQA 1HL5A 1T2XA 2MKWA 4N2KA 2PN5A 2BNRD 3L1GA 2BWIA 2X4TB 2CZNA 5FYLE 1T4KB 4X9YA 1NC2D 1WAAF 2G4GA 1F4AA 3L9RA 2J55A 2BSRB 2OAAA 1CO1A 4FFZA 4AVIA 3HMXH 5FGCB 3NCBB 4ALAL 2DEXX 4UOJA 3HRZB 1F1AA 1VGKA 3D0VA 2F5BH 3KHOA 2D9QB 3LHPH 3MLZH 4D9LL 4HKJA 2CKBH 3FTXA 3NCYS 4WY7L 3BUDA 2ARJQ 1DQTA 3RVVC 4KK8D 2DDQL 4DOHE 4HFWB 4WJ5A 4L3EA 4LSRL 2MQ3A 1WT5C 3MLYL 2FTAA 5C6TH 1KBGL 1ZEAL 5JIDA 1YQ2A 2FNBA 4NUJB 5GSVA 2UZIL 1KCVH 5IVZA 2EIEA 4JZOB 4U3XA 2FO1A 4IGBD 5TTRA 4IMKA 4RMSA 4LLWA 3WNKA 2ZOLB 5KVDE 1N59A 4PWEA 3SCMD 3O3UN 4L23A 3O3EA 2VQ4A 5LAXA 1OANA 1K5NB 3B2VL 2SEBB 4HDIB 3U0WH 3ZYOA 3D85B 1P4IL 2RD0A 2WXRA 3K6FA 4FF9A 5GRJH 3VXSB 3MQIA 1YAZA 5GS0D 5I1CH 4G5AA 4QHKI 3WNOA 3WDIA 2G4EA 4RFOH 1U8JB 2ZUYA 3HC0B 4OCLC 3GMPA 5HHOA 1SXAA 5DS1A 2A6KA 2K8QA 4PJ5B 5ID0A 2MHAA 4OVUA 1U8HA 3QYNA 4FCAA 4AW4A 3SDDC 3LD8B 2XFGB 4F9PC 3HZ3A 2C3XA 4K94C 5ICYB 4KKLC 1XF2B 3CFBB 4XVUD 3X1NA 5E9DA 5HDQH 2HMIC 1LO0L 5JNYB 5AVVB 3QS2A 3TBSA 1QYGH 3DX6A 3L7FB 5I8KH 2A9AA 2Q20A 4G8EB 5F7DA 2CG9X 5KSBF 4LLAA 5D5ME 3LPPA 3FSOA 4F1ZA 2HJFB 5SWSD 1AFVL 1WCBA 3G5YB 3AW5A 3O6FB 3U2JA 3UTTB 1FH2A 3HAEB 1EO8L 3JTTA 4IK7A 4QRTB 1DSWA 4ONGH 3HEIB 1B4LA 2VXQH 2GTWB 2J71A 5JHDD 3IU3A 1UM5L 3C6SA 1SDYA 4FQPA 4J4PD 4YMPA 5B38A 2YPLA 4JANB 1UT1A 5FA3A 2IH9A 3K1DA 5L0QB 2HFFB 4JO1H 2I9TB 2XA8L 4YDVB 5E2WL 4HXAH 4UYQA 4XO9A 2HT3D 1KTKE 4JFED 3AMLA 3TEZA 1G7PB 2VKXA 5KOMC 3RL2A 4E42B 4X6FA 4WI9A 4N0RA 2O5XH 3GXIA 4XMVA 4OCXH 4XP4H 2QVMA 5D7IF 3GGWB 2Z34A 1QMUA 5F7KC 4BQ8A 4FA8A 4AKPA 5KTEL 4P06A 1KTDB 2W0LA 4DESA 4ZPTA 1V7NH 1Y6MR 1T6VN 3VRIB 1EGJA 4OLXH 2VC2B 4C4UA 4UDTB 4HPOH 2E7LA 3OXSB 2YN3A 4ANUA 3S5LG 4ZI8A 2JVUA 1NAML 3KPNB 5CEZE 3QZMA 1EO5A 4IKLA 2WWMC 3P30H 4Y4HB 3O2DL 3VRJA 3HBPA 3P40A 4X9FA 5BZDA 3NCMA 3OJDA 4WWNA 2VLJA 3RPIA 1ML0A 1NMAL 2WXIA 3G7TA 4MCNA 1CXFA 1DTUA 2CRIA 2W9EH 2X4RA 3D9AH 2X4SA 2APVA 3MFFB 4HUUA 4LRNL 3MLXL 4DPRA 3ULVE 1KACB 1XZ0B 5JXEA 1NEUA 3REWB 3K7UA 4YHPB 2Z0BA 4G72B 4AK1A 3DLQR 4F20A 3BAKA 5JZ7C 1AGEA 2EEAA 1M3IA 3VG9C 3CVHB 2WWKT 4KV5E 4XE5B 3BEVB 4X7TA 4ELME 5AD0A 2M1KA 1E0OB 3MRKA 3QO1A 2DJ4A 1T4WA 3BLBA 1WD9A 3JYCA 1D6VH 5LCVH 3IM1A 1TTCA 3GSXA 3IPEA 3QJFB 4H2AA 2BHYA 4G9DB 4ZNEA 5FLVA 2YD6A 4WKZA 2AJZA 3DURA 2F8VA 1U3NA 3K6DA 4RAVB 3EUUA 3OAYH 4BINA 1S6NA 3ARBD 5K1NA 1SYSB 1MAML 2RHEA 3MV8A 2Q86A 4W9EC 3OM3B 5EZIL 4OLEA 3FS9A 4LARH 5L2JA 4ODTL 3QORD 4WSGA 3X2QB 4AZUA 1FFRA 3GJFK 1J5DA 5L8LB 1NCJA 2WTRB 1EHXA 1XB8A 3FUHA 3HLAB 4FZ8L 4ZX5A 2JKNA 3S2AA 1WYJA 2NNXA 4YSEA 1J9RA 3HPLB 2HTLC 2GJZA 4FNLL 4Z78B 3OLGA 4PHZA 1CFVL 2XBTA 4Z7UA 4URKA 3I3DA 2DJUA 2X05A 1XD0A 4X42A 2Q7AA 1ZGLM 4AZ8B 3T0XA 1UT9A 4E9VA 5JW4M 2PCPA 1JHTA 5KSUB 2R0LL 2V2TA 1KCKA 1J0IA 1CICB 2Z31B 4KRMB 1MFBH 1ZVHA 4GI6A 4MXQC 5I8OL 1EIBA 2FJFA 4J3TA 1JGLL 3RBGA 3UZVA 1SHMA 5FKAB 4YBLC 2UY6A 1IM3B 2YK1L 3TGXA 1RK1B 5E6IB 1SOQA 4Y8AA 5HDOA 2J88L 5C07A 3RWFA 1CF1A 5K59E 2J44A 3SDXB 3MV7A 4L8SC 2AKRA 3T0BA 4UBDC 5IVOA 2J6EL 4E2OA 4UQ3A 5IFAH 3LXBA 4MDIB 4JM2C 5CIPA 4H8PA 4LZKA 5GGUB 1JXJA 4UT7L 5B7MA 3F7YA 3NSFA 3TZVC 4K9JA 3QE5A 2AK4B 1EZVY 1E42A 3RFZB 4R4ND 1B6DA 1OSZA 3QIBB 4AYGA 2ICEA 1EFXB 1HZLA 4PW3A 3DVFA 1MKFA 2R1XB 4RH4A 1KPUB 4RGOH 3ZUCA 5DK3A 5D1QC 3C5SA 3TBVA 4HCRH 1P5UC 1ZWIA 3V7MA 1JWMB 4U6YB 4ZZFA 1WIOA 2UV3A 2MCAA 3SO3C 4WGKA 3GEFA 4IRSD 4FJZA 5AQ0A 2IPKB 1EANA 3DUUB 4RISH 4G83A 1TOXA 4QRUB 4K5LA 3HZYB 3UO8B 4ZS7H 1KIPB 3SYCA 2FX7H 3ZRFC 2K4WA 4EKXA 4UUJA 3PNWB 1XEUA 4HZLA 3QFJB 1YNTB 1ZHNA 5G55A 1DQVA 3ILPB 3LNEA 5FO9A 1N6UA 3PAYA 5MP6L 2GY7B 4KKCC 1AXSB 5D7JB 1K3ZA 2P49B 4QF1A 1I8AA 4KDTC 4PJAA 3VSQA 5CCKH 5JDJA 1CDJA 4PY7B 1M3JA 4HUNB 4PG2C 2QQKH 2DQGL 3IU4H 2QVKA 4JE0A 3O4LE 4GXUM 1GJUA 1CFBA 3W0WA 5CSZB 3VNZA 1OW0A 4EZMA 4U7SA 4KFZC 4UTAL 5ESVB 3S3SA 4KNSA 1J8RA 1ITCA 1T0MB 3GLDA 3MGTA 4ZW3A 3T1FB 1T21A 1A3LH 4PYHA 1IE5A 5H35B 4IKKA 4FABH 1E4KA 4PJFA 1P7QA 5DRWB 2VDMH 1N8ZB 4HPYH 1Z66A 2FEEI 1JRHI 2O5YL 2AK1L 1A9EA 2APWA 4CSSA 4CVZA 3GRGA 2A3TA 4OFPA 2OTWB 4R3SB 4W9FC 5FO7B 3UIYA 1WA2X 3AABA 3DOSB 2DQIL 2FK9A 4XR8C 4ZXBD 1RJLA 1RLWA 1YEDA 2R0KL 3JV4B 3MTXA 3QFDB 4AMXA 3BAEH 4LGRB 4ODHH 2GUOA 3QR2A 3HZMB 3WV0A 1KJ2B 3CE1A 3DSNA 5EF1A 2GK0A 4HS3B 5DQDH 1BV8A 1F6AA 2QSCH 3ISYA 2CXGA 4XHJC 2PABA 2PPDA 1UA7A 2BSSB 2HT2D 4DP4X 3RWCB 3QRGH 3HE7C 3CVIL 3CMOL 3ML9A 1KMGA 4PJGA 1YMMB 2JKRM 1JD9A 3MFGB 2DMKA 3RJOA 2R4SL 2C3WA 5JHLA 4HF5L 1JZJA 2QQLL 3QEUA 3B7YA 5ENWB 4GUOA 1E28A 5B39G 5FM5M 4G80A 3H3BC 1BXVA 2GTQA 4IU2A 5HYSB 5CGBA 1NFIA 3VSVA 1ZVNA 2OSLB 1OCRB 2V7NA 3TYGH 1H15B 3VCLA 1SOSA 4DGVL 1RCYA 4Q6YA 4C56B 5JYMA 5K9JH 4A7VA 4GW4A 3EO9L 3U36A 4IKIA 1AXTL 4Y19E 5CMAB 2ADIA 1JV2A 2UWEA 2X4PA 4UM9D 1Z3GH 3NIGF 1C7SA 1OP3H 3A6CL 5CJQH 4GLRH 3H4FA 5ISZE 3DARA 5IBUG 3HUJF 4PG9A 1PD0A 4NKIL 4OLWL 5H2BA 2WGXA 4TOYL 4KXZH 1KIUA 3U30B 4D8PB 4OT1H 2YA1A 4GKSA 3GSRA 3LZNA 3H9SE 4A6YL 2AVGA 4QXGL 3OJMB 4MD4A 2WZ6A 2CGZA 3P9LB 4JFQB 4KKRA 5F1OB 4HKBA 4N8VB 4A7UA 4CGTA 3RWGB 1PX4A 3BHBB 4S1QL 4Y1AE 1F4WH 5C09E 1AKJB 4UIKL 1FVEB 1JGEA 1AD9B 1I8IA 3T0EB 2AEOA 4OQ1A 4XHQA 1ACYL 3SHSA 4AL8L 4PJIE 2UVEA 2IIJA 1MCWW 1XH3A 4HKXA 4XBPB 3ES6A 1UTDA 5IB5A 2VXTH 3WTSA 3TT1L 4BCZA 1VJSA 5KYUB 1HOCA 1PX8A 4QHNB 2YKLH 3Q13A 4U1HB 4KTGA 3WG7B 3QQDA 4QAMB 1F4XL 2NSMA 5I1GL 1E6OL 1GW0A 1QLRA 3EFFA 1KPRB 2GQHA 5SWZD 4TSAL 1NICA 1N6QL 1UACH 4FNUA 2WYIA 1SGKA 2Y7OA 1A1NB 1BFVH 1RSYA 1NCDL 1GGYA 2EVIA 1NEPA 4KI5F 1JZ6A 4GNKB 4TQHA 2A6DA 3OKDB 1D5ZA 1PLGL 3NZUA 5DC2A 1G6RL 3ATBA 4R7LA 4YUEL 5IF0A 1PMYA 5JW3L 1QFWH 1T3FB 2EICA 2EDBA 1U92B 2AJYH 2VLRA 4JNXA 4TULH 1KB3A 1ZT4B 4ZYKA 3UBFA 5I0ZA 2L0DA 3EJZD 4PRIB 2R69H 5KG9A 4U6XB 4WFGD 3IXTA 3MLUH 5GGRY 1EMTH 3VFOB 4M6ML 3PABA 2XTJE 3MLVL 3ULUE 1A6ZA 1WS8A 4Z7VF 1ZS8A 5IBLC 3ABZA 2WQWA 1CXEA 4KKBC 3GBLA 2DQHH 2M2DA 5FW7A 3FC8A 2VABA 4UB0H 2XIBA 1W6LA 5CR1A 4PV1C 4RFEB 3LEVL 4TNVF 5DVKA 5K9KB 2P5WA 3M7OA 3X3FL 3TN0C 1WEJL 4K3DL 1TVBA 4L8BB 4UU9A 4MMZC 3V4LA 5F88B 4PLKD 4FQXA 4P3WA 4OKDA 3LQAH 4PV9A 1A4KA 4QRRB 3TV8A 5GZNC 1U8QB 4MNHB 1TQSA 5DI8A 3DO7B 3CZLA 1I1YB 1KPVA 1JD7A 3SDDB 1ZA6A 4YLCA 2FLMA 1KXHA 4G6AD 1HJCA 3QWRA 1R33A 3FQ2A 3HI6H 3O11A 5G5DB 1MWOA 2VZ3A 4OI9A 3T65A 3P3UA 3CZJA 1NGQL 2IPUG 4JG0L 4Y16A 4N2FA 4NXSA 1HHIB 2DIAA 1U8LA 1LK2B 1SFHA 3T2LA 1F13A 5IV2B 4UV7L 5H94A 1VEPA 3QHFH 3V5HB 3NFSL 1K6QL 1G7MB 5MENE 2XN9E 3FSZA 3T8XA 3FU9A 1MNUH 1N4XL 5K9QI 4FFZH 3W82A 2GTZA 5B3SB 1JUFA 1MCOH 1P4LB 2HUHA 2RQ8A 4IHOA 4NKOB 3PXJA 1TKWB 1TZHA 1HI6A 1A3ZA 4HIJA 1FLRL 4N8CH 4FE9A 2WNGA 1K3IA 3QUYC 4WSKA 3IDNB 4MA7L 3U6RA 1WBXA 1KUMA 1G7QA 2UXFA 4KTDH 5DRNB 1L9PA 1QVOB 4A2EA 3O6LL 3ZQWA 3ILEA 4GSDH 3CXDH 1OPOA 4LDLB 1BX2B 1DBJH 5EMYA 5EBMA 4O4YL 5LN4A 1E4XL 1CDYA 1BOGA 2AQPA 3GHPA 4LF3B 2FECL 3MI6A 5D7KE 1BAWA 1IKNC 1M7DA 2JKWA 1G7LB 1M05B 2YOCA 4IQHA 4ISVA 5G4MA 4NQQA 5BOJA 2PO6D 3NESA 1N12A 3CFKB 2Z93A 2CHDA 3K2KA 2WBJC 1LO2H 1UZ8B 2BHZA 5GSRA 3BFQG 1CTNA 1JPGB 2I7OA 4K7PH 1H9VA 2J3SA 2JJUA 2F58H 1Z9MA 3EJQA 3FU8A 3RL1A 3ZJAA 1JIBA 3WS6C 2H32B 1ZVSA 2CIIA 2XQBL 3B9AA 3JVGA 3ZMEA 2OMZB 2DQFB 3QPQD 3RVXD 2DQDL 3FQUA 4OLYH 4EN3D 3ESPA 5IFHH 1AIFB 2IMMA 1MDAA 2RFXA 1MHEA 1FF5A 1VHPA 4D3CH 2DKSA 4KX9A 2CGRL 1K8DB 1T2QL 1U8PA 3HCVA 5BXFB 1W80A 1BYOA 4ZFOL 1ZANL 1YUKB 2X4NB 4XNUL 4PGZA 5MEOA 2CKBB 2DL2A 2ZAGA 4GP8B 5EDXA 1G87A 3V6FB 4POYA 4J3OD 1QSED 1T7WA 1Q9LB 2AQTA 4FNSA 5FCUL 3W1ZA 1FNGB 3BEWB 3QH3B 1RMFL 3US9A 3HAEG 2FX8H 3JZYA 1WK0A 3VG9B 4KJQC 3FQNB 5E8PB 1WHPA 2VM4A 3QUKB 5I19L 1QFUH 4JQIA 3HNVH 1V3JA 4FEMA 4GPVA 3VD3A 3L8QA 2VJ8A 4DGYL 3OPZH 4U3SB 4I0PD 1BPVA 3KCPB 3I6KA 1D7FA 2PCFA 2YA2A 4J3WA 3FKUS 4GW5B 1SDAB 2I60H 3ZE2F 2CJTA 4BCYA 5JLZB 1OF2A 1KELH 3UPRB 4PGCA 4JM0A 3NJXA 4GFTB 3HFMH 1CLCA 2GSIA 3GHEL 4ZUSA 4Y7OC 3HC2A 12E8H 4O2FA 3LQAC 4Y4KC 2Q7NA 2XI9A 4WV1A 4XVTL 4XNQA 4OZHA 3SQBB 3NIDB 3HC4L 2BVQA 3PGDB 3FO2B 1EGJH 4M9PA 3FRPB 3MA9L 4W9JC 3BRDA 1T5XB 2KQMA 3D39D 4IS6B 3WS3B 5FCSH 4A04A 3UTSD 1KBVA 2Y69B 5I5JA 3ZUNC 1JSYA 3VD5A 1I9IH 2GSGA 1Q90A 5IVXB 1X5KA 2BC4A 4F57L 5LWYH 3IWVA 3HOGA 4AYFB 2KL6A 1H3PH 3B2MA 1JF1A 1HQ4B 5LGJA 2X28A 5L4MA 3S34L 5JA9A 4QRQA 1GSMA 4YBLB 1LNUB 4WHYH 1E27B 5DFTA 1A6WL 4Q9QH 1UKTA 3KPOA 4V11A 3UG5A 5F6HI 3RJDA 4KKPA 3IMSA 1OZTG 1X6LA 1FG9C 2ZXBA 4NQEE 5KSAA 4L8SB 3GPSA 5IB1B 1S9YB 4ZDHB 4PVLA 3D4GA 3U9PL 4JM2B 3WUWB 1TZIB 4BRVA 4JJHA 2OL3A 3WKPA 2X4UB 1S5HB 4POZD 4IMKC 4LCYA 4MS6A 4ORGA 1PZCA 3TZVB 1UH3A 3DX0A 4BH7B 3HB3D 2XC8A 1OF0A 3MVSA 4K3JH 5CJOH 3B9VA 1WGVA 4R84A 3UMNA 3IKCA 4IRZA 1NGWB 5D9SB 2Q1EA 4KWUA 1RJZA 5J3HC 5IMLA 5D1QB 4S10A 1P5UB 3T0AA 2VUOA 3CZUB 2OTPA 3UTPD 3U0PB 3SO3B 2I5YL 4GUPA 5AL0A 3UEQA 5ITFB 1Z1WA 1CF8H 3IMVA 4R4FL 4LKXA 5K1VA 4ZMZA 2A1WL 2X70A 4QDGA 4TNVK 2QEJA 2RIKA 3VFNB 1PLAA 3BJ91 1UA3A 1O6SB 1GL4B 4KPHL 3H0TA 5ALBL 2B8OT 2C5DC 2ZCHL 3L3HA 1MQKH 2K45A 3QI9A 3VXMB 4FQQA 5JDSA 1ZHBB 2I25N 2FX9H 1CE1H 3P0YL 4JVPA 3TURA 1BEXA 2LLGA 2C9RA 4TMPA 3H2PA 3MODL 3TNNA 3G5XA 4K8RD 4JR9L 4GXFA 3LKNB 2FD6H 4MGXA 4NZ8A 1HYRC 5EUKB 5DK2A 2VXVH 1E6JL 4BFNA 4XO3A 1I3VA 2TRHA 1CIUA 1EDYA 1E4WH 4X6CE 4OV5A 3MV9D 3MNDA 4AY0A 4N90E 4DPAX 1PTZA 1E2WA 4QTIH 3SGJA 3FO1A 2Y72A 3PWPD 4MHHI 1KFAH 3T0VA 2AZUA 1TVDA 3JV5A 1QW9A 2DWXA 3L4ZA 5CIPH 1OY3B 2OZNA 2AXGA 2YMXL 3WEXA 4NYLB 3RAJH 1GZHA 3B5HA 3RB5A 5DHYA 3ZKQD 2EE6A 4AM0A 1LDPH 1L9RA 2M83A 4WK0B 1EEZA 5D72H 4AITA 3NCFB 3BAWA 4F91B 1RZJL 1IGYB 3REVA 4IGBC 3OAUH 4IMLA 1N0XL 1IKFL 4KVNL 4DW2L 3MR9A 2BNQA 4KTEL 4L8DA 3D48R 1HE8A 4XBEH 3SCMC 2Q8BH 2A38A 4PUBH 3BSZL 5E00B 5AVZB 5F0JB 3F7KA 3QGVA 3FB5A 4JFDE 1Y1UA 3HE7B 1UEYA 2WXJA 3VXUB 3GZPA 3PGFL 4HH9A 3WE6A 2ADJA 2BW5A 2ZOOA 2DZEA 1CXKA 1DYZA 1CXHA 1ZLDA 3D18A 5DMGD 2E7LC 1DLFL 2H0JA 4KKQA 3VXRA 1EX0A 3DIDA 4AEFA 1QD0A 3WIIL 1IE4A 2MRYA 3CAFA 5DTFB 5LNGA 2NR6A 1CG9A 1JVLA 1U4FA 4HIEA 2BNRE 4H0GA 4LLMA 1TJGL 3NSCA 4MXWH 3GJEA 5E2TL 3V10A 4JG9A 5KN5B 1KWGA 2LT9A 5J56B 1AQHA 2O26U 4XMLH 4YBQC 4D7BA 3LX9A 4YHZL 1NC4D