2Y7LA

Structure of n-terminal domain of candida albicans als9-2 in complex with human fibrinogen gamma peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
312
Chain Sequence
RKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKNSEADSDGDVIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
publication title Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
total genus 76
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA02
2Y7MA 2F6AA 3IRPX 4JDZA 2Y7NA 5IHWA 2YLHA 4B5ZA 4B60A 4JE0A 1N67A 2Y7LA 1R19A 4MBRA 2VR3A 3ASWA 3IRZA 3V10A 5CFAA 3IS0X 4F24A 4LEBA 4LE8A 2Y7OA 2Z1PA 4LEEA 4F20A 2RALA 5CF3A 2F68X 1R17A 4F1ZA 4JDZB 3AT0A 4F27A 3AU0A 3IS1X 4MBOA
chains in the Genus database with same CATH superfamily
1ULVA 2OL3H 4ORGA 1AZNA 3HJ0A 1I3VA 4YEFA 1MFNA 3OQRA 5E4IA 4FA7B 1M57B 4PG2C 4M1GL 5FYLL 5TH2A 3O8XB 4TUOA 5J7CC 2OL3A 3NT0A 1SDYA 3C5JA 4L2LA 4G43B 1KJ3H 3T0VA 1FNAA 1QRND 2XXCB 2OJEB 1IJ9A 1ESOA 2HVJB 3ZYZA 2CO3A 5DRNA 5DJ6A 1HHJA 5FW7A 1UEYA 4AEIH 1UB5B 2J21A 3V4PL 4HXAL 2VR8A 4K94L 4YR6B 5ALCL 2CK0H 4G7YL 1ZSHA 4A7VA 3B34A 3VWJD 3P9LA 1ZT7A 5C08A 4NOBA 1ZLUH 3KPNA 3MTXA 2CHXA 4NKIH 2MKLC 3DXAB 4PJEB 1YEKL 2TRYA 4XPAL 2O5YH 2EUWA 4P2RE 5ADOL 1G1KA 1RVFL 2YD5A 2XBDA 3L17A 1TDQA 5LXVA 2WIMA 5DFVD 4CVXA 1GS8A 2OJZH 1C5BH 2R27A 1CL7L 1CICD 3LRHA 3WD5L 5IKCB 2ZX5A 1P2CA 4XN7A 4F7EA 1VESA 5T5NG 5FGSA 1LO4H 3DVGA 1MAMH 3HBZA 5E6RB 4EXPX 1T0NB 3O3EB 3NCWA 3BWZA 2OTUB 2DDQL 2BSTA 5I30L 2AAAA 5GZNA 4JJOA 1F4WH 4FQCH 4XZ4A 2DY2A 3AREB 5DURD 2AEOA 4TVPD 3IEAA 1J1PL 5KSAB 3U79A 4WO4B 4LCIL 1W80A 3MROB 1ML0A 1P7QD 3Q48A 2AANA 4ADJA 4OZIA 4S11A 2F5BL 5I15H 2VSDA 4RDQF 1G6RL 4PTUA 1E5BA 1NPNA 2BSBA 3FN0H 4FABL 1MCPH 2UY6A 4N6RA 4Y19E 2YO3A 1NCOA 2E56A 3V4LA 4LCWE 3ZYOA 3PL6D 4PJAF 4G7VH 3CN0A 1UM6H 1KWGA 2O6PA 2R83A 5SWSE 3Q5YA 1FIEA 4YXKL 3HR6A 5FYKH 4JFFB 3VFMA 1C08A 3PABA 1F1DA 1QLRA 3GHPA 1CXIA 4I0PC 1NGPH 2Z34A 2PYEA 2WSKA 3SO3B 1KJ2B 1IU1A 3TN0B 2KT6A 3BP5B 1J5CA 3EJCA 4AUUA 5K9QG 5BNXD 2Q1EA 2F7OA 3MRFA 2BIQA 4BFGA 2B20A 4WCYL 3TFBA 1RKRA 4LMQI 2I25N 2QV4A 4PS4H 4MA1C 2J25A 3MRNA 4BK5C 4O58L 1CE6A 4QJ3B 4Y16A 4WI9A 4IIQB 3H9SE 3VYPA 1RLWA 4ONGH 3TEUA 3MV9D 4M7ZC 4C83B 2WN3A 3T0WA 5IGXL 5D2LF 1KCVH 3IFLL 2HLEB 4HUNB 1KB5B 2JI1A 5GGUB 1VADB 1BBDL 2M8XA 1XR9A 4NPYB 4QYOB 5E70A 3S36X 1FFNB 4I3RH 2F53D 4U6TA 4AL8L 3FO0L 3OB0H 4ZX6A 3S88L 4FFVC 3UBXB 3QZBA 1ZVSA 2UXFA 2IFFL 2E86A 2DQUH 5GSRA 4J3OD 1SFDA 2X42A 3DIDA 4GBXB 5IB5B 4D9RE 4FAAB 4WHYH 5DD6B 4FE9A 1CQKA 3CLWA 5KYYB 5L8LB 5G4OA 2AEPL 3MUZ1 3T6WA 1JJUA 3RQ3A 3MCG1 4FTVA 3BVVA 3LYRA 1F02I 2YAQA 3NJJA 4M7KH 5AKRA 3MNWA 3QUXD 2F54D 4X0KB 1R5IB 2H32B 2IBZX 3SDXE 5E2VH 1WAPA 3M46A 5HHPA 1KJVB 3WS3A 1IFRA 2V2WB 3C09B 2HXAA 3KWWA 1A7QH 5LXGH 4JG1L 1ADQA 2DH3A 1BM3H 4OAWB 4TS6A 2R2HA 1GW6A 3DGGB 3L7FA 3QQ9D 4JDVB 2C4FU 2BNUA 2MEJB 3T0ED 2C9UA 1QG3A 2Y25A 1OAUH 1X6NA 5ESVA 1EA9C 2L7UA 1UKQA 5KSBB 5C6WH 3GLDA 1AE6L 2UUDH 3KYKL 3QDHA 2XWEA 2N1TE 4YX2H 5K33A 1CFTA 1OHQA 4UB0L 2GCYA 2DQJL 5B39G 1MDTA 4A2LA 3G5YA 1L9OA 2DD8L 3KXFD 1R46A 2GIMA 2E5EA 5EBGA 2P5WD 4OJFL 3SDAA 1T66D 2X0VA 1QR1A 4DPRA 3NA9H 4IGBB 4TQPA 4KDVA 4PJXB 3RDTA 2WANA 2D3NA 4U0RC 2E4TA 4QXGL 1OAQL 4RZKA 4N2NA 2X6UA 3LDBC 3DX8A 2HRPL 3PHQB 5EZJA 2B1AL 1WFMA 3EGDA 1ZHKA 4L3AA 4Z95H 3SBWC 5D7LD 1MWOA 3G04B 4XMLH 1EANA 2APXA 4ZMZA 4CMHB 2RQ8A 4GSDL 3QDMA 4TN9A 1T1ZB 3MV8B 1U8OB 5FYLH 4GI8A 3DHPA 4HV8A 4ZOAA 3LKQA 5MENA 4AE1A 1E6JH 1FO0H 4RAVA 3TO4C 3IJYA 4ESKA 4X99A 4KMQA 1JZ4A 2IV8A 5C08D 4P07A 4QOKB 3AM8C 1QFWL 3FB5A 4HXAH 1YAIA 5I1CL 2NDFA 2RD0A 3IAPA 1TITA 1EAOA 1HSBB 3CDGA 2OXHA 1QFWM 4XP1L 3O45B 4M43L 3PIQB 4AV0A 2TAAA 3MR9A 4GAGH 2VM4A 1R19A 2OZ4H 3U0PA 1IGJB 4Z7VE 1WFNA 3TBSB 1T2QL 4U4BA 4F33A 3QEQB 4L29B 4XX1E 5E9DB 5ISZD 1YEKH 1IGIH 2XJLA 1NMAH 4LF3B 4X4KA 4ODXB 5MI0C 2EDDA 3E2HB 1U3HC 3QXUA 4D0CB 5AOIA 5IQMA 3H1ZA 4IBZA 1YYCA 2D2OA 4PW9A 4UQIM 2GJJA 5AL8A 3WD5H 3X13A 5T1JA 2LOEA 4LKCB 3LRSA 3EH5B 3QCUL 4S1DD 1RMFH 5EZOH 1J11A 2GUYA 1EUTA 4JR9H 4WI3A 3I9GH 2YAHA 4G8GA 3ZDYE 5E1GA 1P69B 3B1UA 1CD8A 3DTDA 4G5ZL 4G8IB 5I1IL 3RZCA 5DMIL 3QG6A 2QQKL 1KYAA 3CFJA 5I66B 2R4RH 1LP9A 5AOLA 5FYKU 4UOJA 4MSWA 1PG7L 4KK5D 2EXWC 3TPUB 4BUHA 2R7EB 1SJHA 5DZ9A 4ZUSA 4RCAA 2KZ1B 2YN3A 4S0TD 3S96A 2BXYA 4XCFL 3ZX1A 2B7DT 5EF3A 1YG9A 2ZJSL 3NCMA 4RGOL 3VG9B 1H5BB 4POYA 4LPWA 5DJZA 1K4CB 4X5LA 5SX4I 1A7OH 1EVTC 1OT1A 1I8IB 4WKZB 3IDGA 3MBWA 2DTSA 3N55A 3VFGH 2R0KH 4N6QA 3GSXA 4E9SA 3QO0B 1TZOA 2PYED 3TIEB 3AWFA 3APCA 5FYKD 4G82A 1ETA1 5L4JA 4P23D 4K8RH 1J9QA 1IC5L 5DC4B 1MW1A 5DVLA 3GHBH 4YWGL 4BYHA 1AOZA 4OGZA 2YR3A 5C0FB 4YLBA 4KX8A 3RUGA 1PX8A 2ADIB 1N0XH 1EHAA 4Y9GA 4XXCC 1QSEB 5E7BA 1X9LA 5IQLA 1J0HA 2FBJH 1VZIA 1QACA 4RA3A 4Y16D 4LLYA 3Q2WA 4HJJL 5JYMA 4KMLB 1OP9A 3QUZA 3NCYS 3T8XB 3BVDB 5DT1L 1A1NA 3PQYA 4IM8A 2X4QA 3PPEA 4V1DA 2N7AA 3MV01 1ET8A 2PTTA 4MGXA 5BVPH 2B77A 4JQXC 5J56B 2QGBA 4U1HB 1BYOA 3S35H 3MREA 4NZRH 4Z5RB 3H3PL 5EPMA 2VWEC 2X4SB 3O2WL 4LSDA 4EXKA 2ZX8A 3JYCA 1R24B 5KVGE 3PDOA 4FG2A 4HK0B 4LL1A 5K39B 3WTWA 3VQ2C 5CCKL 4HKXA 2I5YH 25C8H 4UNIA 5AW6B 4QRSB 1FZMA 3G5ZB 1VF5C 2Y69B 3L3GB 5A6LA 2ZPKL 4CMMA 4IMKA 4AL8H 3DJ9A 4GUPA 5AYUL 4IRJA 1E4XH 5I73C 2PXYC 5J11C 3GS7A 1KJ2L 2IFFH 4FTVD 3FB8A 1XF4A 5D2NA 3SE9L 3BFQG 1RZ7L 3AXLA 1KG0B 5C0RL 3CFBB 5BS0D 1HOEA 3ZKXB 3WE6B 5JOPD 2OMUB 2BVQB 2DRUA 4Z7NB 3LZFH 1REIA 3TJEH 4NQCA 5IV2A 5IVXF 1J9RA 2XCMC 4F8NA 4OF8A 1NPJA 3BKYL 1MUJB 4X80H 1OWRM 5C6PB 3VRLF 2OYKA 4F8OA 2VDOB 2C1PB 3ISWA 1PZCA 1AGEB 3WIHL 3S37L 1KB5L 3CDZA 3F7VB 4M62L 4PLKD 1OE3A 3EYVA 1FP5A 3CZLA 4N90D 4U6YB 4XWGL 2CJUL 2E6QA 1OM9A 2W94A 3UAFA 4AJWA 4A1RA 3NACL 4Z3HA 4LSQH 5L2KE 2EVJA 1I1AC 3VXSD 3B2UD 1DSFL 5L88H 3LS4L 1CDGA 3F6IA 3UOAB 2HG5B 1KXHA 1S8DB 3ULUH 4KUCD 3MOBH 2JCWA 4PJFA 3SDAD 4BHUI 2AXFB 2N7BA 5KVFL 2Y2YA 3JT2A 1EDYA 4UTAH 5FEBA 5D1ZA 2A77H 3DC0A 4N26A 4NYLB 2PCFA 2ZUQC 4XC3H 1FNEB 1A8JH 3L13A 4BKTC 3BKML 2RQEA 3NG5A 3KHQA 4FQ1L 1T04A 1QWUA 4UTAA 3RX5A 4Y5XA 1PMYA 3D34A 4FMKA 4NO2B 3HG0A 4YHOL 5BZWA 4HDIB 1UWEH 3FZUC 4QXGH 4HS3B 5ADPL 3K7UA 5E4OA 3V0AC 1XDTT 1QI3A 4AGNA 3IN0A 1Q9KB 3ILPA 2HX8A 4LDCA 4ORZC 4PJ7E 1QHQA 2NT1A 1UZ8B 2IADB 1CFQB 4ZFFA 4G1EB 2FIRT 5MEND 2R23B 4P5RA 1KGCE 1KXTA 2QGCA 3LQZB 3ERXA 1DL7L 2HRLA 5FYLD 4NO5B 1M2VA 2QFPA 1FI8C 3KL5A 3NESA 1XGQA 2ZKYA 2P5ED 4P46C 3GZOA 2VDNH 1RURH 2KZKA 4EN3A 4J3OG 4ZAKB 1FG2A 3TYFA 3MNVA 5EUOF 1A3RH 2OM5A 4HPYL 4BKSC 5I1CH 3FK3A 3PF2A 4F7MB 3GSRB 4KVNL 3THMH 1EXUB 4XP1H 2E9GA 3ZHNA 1GGCL 3WDJA 4XBPB 4ELMB 5KEZA 1KBWA 4QTFA 4HGMA 3KPRE 2ZG2A 2AQTA 4R5XA 4X83A 4OFIA 3L45A 3I75B 4FEMA 1NEPA 5LQBL 3EH1A 2XN0A 3UAJA 4AUYA 4CN4A 2NSQA 3QIBA 3V0VB 4YDIH 1XCQB 1XGPB 4MCMA 5AVWB 4ODBD 4JPKH 4R0LC 3T2OA 2XVLA 3QAQA 3KMDA 4X4XA 4N68A 3U0WL 3Q6FB 2R2BA 2WD0A 3RZCD 5KOVC 4ENED 1QLFA 2CRYA 4XOCA 4HFWB 3RB7A 4XZUB 5AVUB 3KDPB 4DZBA 3MJ9L 5CGBA 2NY2C 1ONQB 2VMFA 2HLFC 3TA3A 3EGSA 5AAMC 3V10A 4X2UA 4L0YA 4JVUA 5INDB 2Q2LA 5FDWB 4B5EA 2CZNA 4HWEH 5T33L 5IQ9B 2AQPA 3QEGL 3CLFH 1YJDL 1S7UB 2P52A 2P80A 4WUUD 1MCLA 5IVZA 3DHUA 3G9AB 3B8SA 2GJZA 5D7IA 2WLZA 3UJIL 4C56A 1D6EB 2R39A 3HZVA 3S8FB 2D31B 4F7TA 3J27A 4PHZA 3QSKB 3P0VL 3EFDL 4KJWD 4NQDE 2ZXEB 5CD5D 2DQCL 3OF6D 3HI1B 4QT5A 1OGAA 4P2RB 2AVFA 3F8UB 1HCZA 3U1SL 3LMJL 3TBYB 2WQUA 1AGCB 2VISB 1OARH 3BGMA 5AVQB 3QIUC 3NJGA 5F7KC 1FVCA 3EJZC 4DTGL 5HHQA 1JN6B 2BWQA 4FQXA 5I9QB 1P6WA 4PJ5D 4K8RD 4ZK8A 2HT2D 2DI8A 5IEHA 5JPMC 3GSQB 4PJEF 4MMXA 1FZKA 1XX9C 5GS0H 5LGYA 3FO9B 4M7ZB 3Q13A 3APDA 4JFEE 4PR5A 5F8RC 4LMQE 4OGYH 2OSWA 2GJPA 2VN3A 2LU3A 3ROLB 3H42L 1JK8A 1FLTX 2WLIA 4NXSA 3SE6A 3BAIA 3EJQA 4B9YA 2VJXA 4L3ED 1SN2A 3II1A 3Q3GB 4ZMTA 4P5SA 3UG3A 3RGVA 2V7NA 1MCJA 2YFOA 1SYVA 1S3KL 4ZFOB 4NO3B 4WK2B 4PJBA 3Q1SH 2UY7A 5HP5A 1DANU 4FQLL 4H0LC 1L0PA 4Y19B 1I3UA 4OF5A 2NTSP 4YNYA 3O2WH 2PWHA 2C9RA 1OZUA 2J8HA 1U3JA 4MBOA 1UYWL 4LCWB 1E8YA 4EMZA 32C2A 4IRJD 4LLDB 4F9PA 4QNPE 5JIMA 4OIIH 5CCKH 2GEEA 4JDTH 2HFFA 3NZHL 3V7AG 2AV1A 5SWSB 2W95A 2CUAA 5HDWA 3FB6A 3FHEA 4EDWL 5HYIA 3B83A 3SJVA 1MCDA 5EA0L 5IR1B 3J07A 1MXGA 3ZMNA 1CDHA 1JDDA 1KJ2H 2H3NB 1YNLL 1E50A 2P45B 1TFHA 3KCPB 3PJSA 4MCYB 5EO0A 1F56A 2CXGA 5F93C 4OKDA 3WDHA 1MHCA 4NQQA 1BQLH 3QA3A 1BZ7B 2X10A 1RU9H 2WQSA 1XF5B 4XAWL 5SV3A 4J12A 4P2QE 5DUPH 4Z7WA 3BE1H 4NCDA 1M3JA 5I1EH 5AW2B 1QEWA 3FHQA 1CZ8H 1D5XA 1M71B 4J8QA 2ITDB 1TZ8A 3CFCL 3V4VB 4G59C 3AXIA 3RWDB 3ILQD 4HIEA 3H9SB 1MFBH 3MRHB 2WBJA 3OLDA 3SYCA 1RL1A 2G3MA 4XBGA 1NIAA 2ADFH 4XWGH 5FAAA 1X9UA 2X4UA 1T2XA 1OSYA 5D7HA 4PJCE 3LRLA 4MLSA 2A9NL 2HKHH 1E8XA 4HUWB 4LU5H 4MNQD 4OCNC 2C9AA 4XBEL 2W65B 2Z4TA 1S9XA 1EAQA 1HK6A 2BC4A 4YDVA 4S0HA 4U0RB 4Y1AE 1TNMA 3BDXA 4GKSB 3ULUD 1OE2A 3V5DB 2CO6A 1NFDE 4WSJA 4OLYL 3QIWC 4CC1A 1R3LA 3VDCA 1MCOL 4HISA 2AJSL 3SODB 1WWAX 1UWXK 3EGXA 4NLAA 3H9HA 4N8VB 1P4BL 3C8KB 4JREB 4EI5C 4B9FA 1OQXA 1HH6A 4HEME 3CFDB 4RQQB 4AK2A 5I1KL 1T1XA 2AV7A 1T0PB 2H32H 2W0KA 2IVFC 3II3A 1EEYB 1F45A 1JGIA 3KPPA 2ZD0A 4QRPA 5A2JH 4JN2A 2VDOL 1L9PA 3MKGA 4GQ9L 4JFUA 4JHVA 3CFNA 5C0GA 1U9KA 1B0WA 3SDXB 4Y2LA 4EVNA 4NN7B 1NBCA 4E68A 3Q6GH 2FJFB 3RFZC 3QUMB 2E9WA 1JGEA 5B3NA 5DMJB 3MSPA 3FTSA 4QO1B 2FECL 3BO8B 1HH9A 4KV5E 5FDYA 3FQWB 3HG4A 4J4PA 3TBTB 4I48A 2IDUA 1YNTB 4G8FB 3N40F 1OOAA 1T22A 4UU9B 3NAAL 2YD4A 3F7YA 1DN0A 4WU7A 5MI0B 4FNQA 5E95B 1UACL 1WUNT 4OIBA 3KYOB 5MEQB 2KQNA 4HPYH 4BZ1H 1OPOA 2MJWA 3GTNA 3BWAA 4HLJA 2EDFA 3ASOB 4RGND 5F1NB 3UAJD 4QXTA 1L9QA 3MJ7A 3RVTD 4ELKA 1X3DA 1Y0LB 3QIBD 3OLIA 5D71L 5DDHA 5KSBF 4KGJA 3HMXL 1OM3H 5D5ME 1SJEA 4L8CB 4HP5A 4BZ1A 5CEYA 3VFWB 2G2PA 4L2YA 4AMWA 3B2MA 3QORA 5LQBH 1B2WH 2OMVA 1FORH 2CHNA 2VE6A 4M1DL 3OTTA 2GKIA 1KY7A 1QMUA 5DJCB 1S5HA 4FQJL 4H5SA 1JFQL 2DYPB 3HKFA 3TA3D 3X17A 3F05A 1BZEA 3IDXH 3HZYB 2QADD 2G4EA 4PJXF 3O8XD 4ADIA 5IB2A 1M3IA 1AQ8A 5A7BA 5CLXA 1R6VA 1F3DJ 3A6CH 3K72B 3MFGB 4JBSA 2GVYA 5KW9H 1KNOA 1O9WA 4MAYC 5EEWA 3MODL 3NFPB 4LGPB 4TTGA 5DC2A 1T6BX 2VXTL 1M4KA 2O72A 3GSOA 3EDKA 4C56D 3KLKA 3EDFA 2GK0A 1FPTL 2LT9A 2YGQA 2BHYA 1B2YA 2RH0A 4X9YA 2YPLE 5TE7L 1VGKA 5KANI 4ONOA 3QXAB 4L8BA 1W6WA 3DJZA 4DKFL 4YHML 5JQ6L 1A3LL 3DXAD 4H88H 3EG9A 3G3LA 5EEZA 1JPGB 3P0VH 2JCCE 2WLLA 3EFDH 3EYOB 3KBEA 3N1PC 1NEZB 4NN5B 4Z7VB 3BP6B 2IAMC 2XKNB 3GMLB 3T2LA 1Q1JL 3U1SH 3V6FB 4PB9H 1GZQA 2MKWA 3LMJH 5E0QA 3LB6C 1RP9A 3RWFB 1QWNA 2ZKHL 3IDNB 3VYOA 5BOJA 3RNKB 1JNNL 4B6ZA 3PNWA 4JPIA 3TPKA 3DRTB 3VXQB 4PI0A 3PUUA 3RX7A 5D7JC 3PGCB 3A3YB 3F7RA 4OM1L 4HJ0D 2XTLA 5GS0D 5L8KB 3N6YA 4AI7A 3RGVD 1R1CA 1NJ9A 3H42H 4G9DB 3ZDYB 3UDWC 1AXTH 4YDNA 3DO4A 2YD9A 2VLRD 2ICWA 4WO4D 5CR8A 4WWNA 4YFLF 4HHWA 4Q56A 1AH1A 5FFOA 2YAOA 3RJQB 1LL1A 1OF2B 2CG9X 1DBMH 2WIIB 3GXTA 3FFDA 5JO5A 4I2XE 1F6AB 1UOKA 1ZEAH 2PXYB 1VPOH 1U4FA 4MKMA 5J11B 1HIML 2ZOKA 4LHUA 4XE5B 2VM9A 2NNXA 3AU0A 3OX8B 4Y4FC 1BEXA 5IQ7H 2Y7MA 3SJVD 3ZRFC 5AZEL 4LVHB 4PP1D 2NUTA 4R96B 2OMYA 4LT7A 4O4YL 5LAXA 3NZHH 3H3KA 2IBBA 3JTTB 1ZAGA 2W81C 4L3CA 1AS6A 4D9QE 2A99A 5E8OA 4Q4IA 5F89B 2ZUVA 1PF3A 2W0FA 5EA0H 3RAJH 4ZUUB 3KDMA 1R47A 1U8HA 1BD2E 4KGLA 4R8WH 4RFEB 2XQYK 2F7QA 4GAYA 1U8PB 3V6OE 4N2LA 5G5DA 1KIQA 1PIFA 3BN3B 1WRFA 2MCMA 2X7LB 1DUZB 1NLBL 1JYXA 5ICYB 3MC0A 3MLPA 2WBJD 4ZFOL 2DB8A 1IBFA 5IJBC 1G9NC 1XEDA 1TJMA 2W1NA 1INQA 4MJHA 4E41E 3SKOB 5IHHA 1A64A 1JGDB 1JCKA 4LPCA 5ANMA 1QFHA 2LLLA 3SE8L 3MRDA 3FYEB 4K23H 4K5OA 1UM5L 3U6RA 1ZMYA 1SF3A 1ZHLA 3OAYH 4K3EH 4TULL 2BRRL 3QUGA 5HY9B 4Q9RL 3BH8A 3J7HA 4HWZA 4E9VA 3OJMB 3QUYC 4GKLA 4C47A 4CL7A 3L3IA 3GBNH 5TF1L 5DS8B 5HHMD 1YC8A 1M7IA 2CHZA 4D9LH 2FX7L 2WVVB 2E7CA 4AMKH 2D03L 2VN6A 5GS3A 1FC2D 1YA5A 2KDYA 3C6SA 4NBXB 4ZPVB 3RBSA 4ZODA 2VLKE 4YDZA 4E0RA 3OHXC 3JVGA 4RMWA 4F7PB 43C9A 1TZIB 1J8SA 1IL1A 2JB5H 1UVQA 3KHOA 1G84A 4GBXD 4YJZL 4OF3A 3N40P 3OD3A 2R4SH 4QRPD 4UAHA 3ULAB 2NR6D 4LLQB 2AQ1A 3T3ME 4HC1H 43CAA 2FJHB 3P9MB 3MRCB 4WHTB 1AFVH 2DEXX 3AVEA 4AG4H 4WRLA 4ZX5A 1BZ9A 5JOFA 2QTEA 1XGUB 4Y9CA 3V4VL 1HZKA 2Y06L 4J8RB 3CUPA 3H9ZA 3V9EA 3I3EA 3NBNA 4MMZC 5IG7A 3C9NA 3CFIC 4GQ9H 4ZZKA 1A6ZB 3QARA 4LVNC 1HHIA 1F3RB 3L3HA 4K3HA 4ANUA 4Z7NF 5A2IH 1S78D 3O3DB 4GT7A 5KTEL 1ID5I 1AGFB 1GCYA 1MLBB 1J9TA 2BINA 3QJXA 5L2KB 1AO7A 3D2UA 5C0AE 2JKWA 1OB0A 1R3IL 5C0BD 1WZKA 3CSYA 3GMNA 3EO1B 4JO4L 4LRNL 3T0BA 1KCRH 3Q05A 1FZOB 3NAAH 1E2VA 4J6RL 1GL4B 2V2XA 1GGBL 3TNNA 1UACH 5DUBB 1D5IL 3LRGA 3NJVA 2WYZA 4UQAA 2MOGA 2ZCHH 4DO4A 3A4AA 4IGBD 1MQKH 3RY6C 1HU8A 3NK4A 2J1XA 4LSUL 4X9IA 2XPGB 1ZK9A 1WP6A 4L05A 1I85A 3NJFA 4QY8B 2CKBL 4WW2B 2OSLB 4JO5A 5DK0A 4XN2A 4CJ1A 4PLJC 1CK0L 1G7JB 3QUML 4PJ7B 1KUMA 5BV7B 2G9HB 4X6BA 4XNZC 3AACA 3W81A 2ENQA 4UT6A 3VRJA 3K8MA 2E4FA 4CW1A 1JZHA 2G0KA 5CD3A 3GPSA 4OT1L 2GTQA 3G6JE 3SGJA 4Q4EA 4WI4A 1FDLL 3HZMA 4QOKD 1JK9A 5C86A 5H37A 5C09A 2ZOLB 4UMSA 3RHWK 2VH5L 4KMTH 3GJEB 1BLNB 4PJHA 2VR7A 3QFJA 1RZKC 5MEPB 4DKFH 4WWID 2A6JA 4RSYA 5JPMB 2IDFA 2DWSA 4KXCA 4JY6A 2AZAA 1DVFC 2VDRH 3ECBA 3KPRB 1NMBL 1TYEB 2EAEA 5MP6L 5KBLA 3UTZB 3U2SB 3ML9A 3GO1H 5GJTH 4NZTH 3D3VA 4QHUA 4DUVA 5D1QE 3L7EA 3OGOE 1JAEA 4PD4K 1H8NA 2WKOA 2H5UA 4XVSL 5EO1B 3A21A 4ELMF 4M9PA 4I1RA 4LSPL 1BIIB 3DV6A 2CDEB 5C0DB 2FZ3A 5JPNA 5A3IC 4WTWA 7PAZA 1JNNH 3ARDB 4PRBA 4L37A 2A0LD 2GTZB 3QPXH 4HWBH 2EIDA 3RPIA 4M3HA 1FFOA 3LEVH 4DAGH 2E46A 4YMPA 3KR3H 2AEIT 4P5TB 4LOVA 5BW7C 1XIWA 2NYYD 4G42B 2QSCL 2QKIB 2BP8B 2OCJA 3HFML 4PGCB 4BE5A 1A6PA 2E59A 1U8JB 2YGNA 3AROA 3CN2A 3QDJE 1P84K 2XKUA 4JAMB 1WPCA 4RMVA 2Z35B 3B3IB 5L2JB 1P4IL 3E38A 1ES0A 5SWZE 4FQIL 4KY1H 2MQGA 4OZGB 3HN8A 3EH4B 2MPAL 4WV1C 5A7EA 2FEEI 4Y5YC 3VXRA 4OLWL 2JV6A 3IFOB 1OW0C 1TZGH 3WIFB 4NQDB 1HJCA 5EOQL 4FFYA 4I9WD 1ILUA 1S7XA 2HYMA 2NSXA 2IMNA 1SXCA 1IEAA 2ZWZA 1R4XA 4NIKB 2XVKA 3CC5A 2J43A 3T2NL 4N8CL 3SDDA 5HY9A 2PF6A 2X3AA 2DBJA 4PBVC 1KTBA 5FOBA 1RZ8B 2DWEB 3L4VA 4TUJA 1HXMA 4JFEB 5ESQB 5ILTL 4QHLA 4PRHE 4M1CD 3BH9A 5EF2A 3B9EA 1BPLB 5C0EB 1BFOA 1NLBH 2AEQL 2YN5A 3PWJB 1G5GA 4XVUD 2NZ9C 4PJGA 3AB0C 4HW6A 4BA0A 4OLEA 1EH9A 1NGQL 1A6VH 3LN4B 4GXVL 3VGDA 4JRWA 5I18L 1SPDA 3VFVB 4LHQB 4W4OC 5C70A 1NAMA 3NJHA 5FPIA 3SGDI 1IQWL 5DLLA 2AQ3A 1UB6A 3QO1A 5BVJA 5J9PB 1CGXA 4A2FA 4V2BA 5I8KH 2APBA 2XG5A 4L5FH 1X5KA 3RWEA 2ZAHA 5KYUA 2HFTA 1KIUB 2RTTA 3MYJA 3OGCB 4JFPB 4RX4A 4YHLH 3WSQL 4KTYA 2P24A 4XPHH 2WLYA 4W68A 4YH6A 4JANA 1RD6A 1GOGA 2VXUH 4FFWC 4Z3IA 2OFQA 2R1XA 2Y0SA 5CINL 1TQBC 4M6OH 4X4YA 3BW9A 5DMKB 2E3VA 4P2OC 4NSKA 4Y5VC 5TQ0L 2J6EL 3HLKA 1NANH 4P2QB 4P4KB 5IFHL 5JTWA 3W9DA 2J1ZA 4M56A 4WQOA 3U2JA 2WPGA 5E08L 1TSHA 1IBZA 2Y72A 3SIKA 4DP0X 3L4UA 1H8SA 1AO7D 3D2UD 3UO1H 4EAEA 2L7QA 1LEKB 3P30L 4JG0H 2GY5A 4AEHL 1FN4B 3IAGC 3WXVH 1A7RL 5C7ZA 3IPFA 1LMKA 1PEWA 4KTGA 4POUB 4PJCB 4MCZA 1E40A 1QFPA 3D1MC 3LSOA 3BUBA 3UZEC 1JWMA 5CUSH 3DX1A 4Y1AB 5AQ0A 3GGWB 3JVFC 1O9ZA 1I4FA 1X6LA 4KAQH 4NUJB 3VCLA 1DFXA 1NFDB 4APQA 4U6XB 2BVEA 4JFHD 5E6YA 1Z7JA 2YA0A 2P46B 3FU7A 5GRJL 4R4BB 1CF8L 3QXDA 3S6CA 1MCQA 2H45A 2CMRH 1BVNT 4OCWL 2ICEA 4LSUH 4Y2OA 4XP5H 1T5XA 1DBAL 1IC4H 1GC1C 3BT2L 3U7YL 5L0QC 4CN1A 5DFWH 2R1YA 4XC1H 4JNXA 2E76C 4L1HA 1WBZA 2FWLB 4FZEL 3C6EA 1GR7A 4YGVB 2CR6A 2XFXA 1IV8A 1NCDH 3QUMH 1KFGA 4BSVB 2Y7NA 2VL5B 2GSGA 5EU7E 4CGTA 5C09D 2VDQB 1I1YB 3GRBA 1WZ1L 2AW2A 1DQMH 2CCVA 5I28A 2X4NA 1OV8A 1NUGA 5IFAL 4L8SA 2BS71 4LIQH 4MJ6B 3K1KC 1AR1C 5IIEB 3TOPA 4EZLA 1BQHB 1A25A 2AABH 4RSVA 1GHFH 4O9HH 5IJCC 3NTCH 4W6WB 4ZDHB 4ZUVB 1F4AA 1F2XK 1RZJC 2CGRL 2NY3B 1XMEB 2X05A 4YPGB 1YNTF 2F61A 4QRQB 1FIGH 2WNXA 1VDGA 5GRUH 5MP6H 3RIAK 4XOBA 3F64A 2DI9A 3MRPA 3DX9A 4OIFA 3HG1A 4B41A 3VW3L 5KBMA 4GT0A 3DETD 1CBJA 1VGEH 2EC8A 2APVA 3C8DA 1TEYA 4WFEE 4KRPB 5EZLA 1YY9D 3D06A 4NJ9H 5BV7L 3RJOA 3VA6A 1PKQE 1X5AA 4F37K 2Q76B 3K6SA 3UAAA 4ZS7H 4KZDL 5FC9A 15C8H 3C87A 1KLGA 3OKDA 1ZLWK 1BXUA 3AWGA 3FOLB 1JE6A 2P49B 1RZIB 2NY6D 4JJ5A 4Y4FB 3DX4A 2QSCH 4X5WA 3GI8H 4HIJA 3VE0A 4JG5A 3HC0A 5K9KB 5A2KH 4H44C 4ODUA 4X5XA 4AT6B 3LV3B 2QPDB 1T1WB 5GGSA 4DP8X 2YPLB 5IHZB 3H85A 1QD0A 2D73A 4FLQA 4WSGA 4WU5B 1XXDC 4XPTH 2CBOA 5EU7C 5D7KE 5E1IA 1IJNA 1XEUA 4M6MH 4HZLA 3OR7A 2MPAH 3SN6N 1EBPA 1KEMH 2UYLB 4OLWH 2ZUWA 1SF5A 1OOWA 4P2RD 1M1XB 2NUPB 4F2ME 1WSST 1N2RA 2OMTB 3CFEB 4NZFA 1E8WA 1MG2C 1KIRB 2XZAL 3C60A 3KJ4B 4KK6C 1Z5LB 1JF1B 5ETUB 1A4CA 4LDOB 3N1MC 5EU5A 5I71C 1KF9B 1PG7X 2ROYA 3BH4A 2QHLA 2VGLM 3ULVE 3I6LE 1PFOA 3FT0A 4Z7VF 1FH2A 1AD9B 3IWVA 3K46A 3WY2A 3WTTA 1S7VA 3BCDA 1KT2B 3R19A 1AQDA 4ZTPH 1MIML 2ZG1A 3UYRL 3PXLA 4AY0A 4DP9X 5ILTH 3KLQA 3UJJH 1R75A 1R9FA 3VNZA 3GIZL 1SFHA 2AJVL 2CPCA 1SXSA 2YK1H 1MY5A 3FMGL 3QUYB 4N86A 4D0BB 5FA4A 3IJSA 4RETB 5HJ3A 1CLYL 2VR4A 3RTLA 4BQ8A 4A7GF 1VACA 4QRTA 2VERA 4KUZL 3WIIL 4XRCB 4MMYB 4I2XB 4Y19D 3ZDYF 1MRCH 1X5GA 2JMRA 3K2UL 2GBTA 2W60A 4N3TA 4N1EA 3KL0A 3P73B 4LCWD 4QRRA 3CFMA 2GT9B 2KLSA 1SVZA 4OSUL 5KG9B 3JSSA 5DJAB 1RZGB 4U6VL 1MY7A 3KWXA 5GRZA 5EWIH 5F7WC 4X6DA 5T1LA 4DVRH 4WI0B 5CJOL 4JGNA 3OHMB 2IPUK 1SVCP 1AQKH 4UOQA 3VXUE 5E56A 2YUZA 4JKPL 1S5IL 4AC4A 1D2PA 4LVNB 3NRQA 1RHFA 2GHWB 3C6LC 3Q8BA 4BA8A 4LHUG 1BD2B 1D9KC 2Z9TA 1HSAB 2NW2A 4M5SA 1DVQA 2Y07H 3SQRA 4UNTA 3BEWB 1UFGA 2VERN 5AKSA 5GGQL 3IMSA 3BYYA 5I8CB 1JZ8A 4QHNA 1F11B 1T0MB 2EH7L 3VFRB 3H9SD 2A6IB 3ULVC 2W92A 4E41B 1TG8A 4LNRB 3FT4B 3WJJC 4RNRA 1ZE3H 2V33A 3B9AA 1AZBA 5KVGH 3W5MA 4NQSB 4KHXL 2ZUSA 1OP5K 5C9JA 5IROC 3GHEH 2JIXA 2JELH 2XRAH 4DPAX 3QS3A 3ECVA 3CXFA 4UIMA 4APQD 3DO3A 3FBQA 4M6NH 1RERA 1BAGA 1OLLA 2BVPB 3TVMC 3HHSA 4H7VA 3HE6C 3WJLC 5ICXA 3GSNA 3OJDA 2VLKB 3DIFB 3IXTB 1NICA 2LGNA 3DMMC 4I18A 4WTQA 2IOMA 4BGLA 4KXDA 5KVEL 1E2WA 2IIJA 4XNZB 3WGUB 3SCMB 1JWSB 1CF8H 3AS2A 3X1FA 1S7RA 2BERA 3S37X 4A7QA 4XMTA 2HSIA 4PW4A 2EDKA 5HYFA 1A6AA 3NA4A 3T3MB 2M2DA 3QCTL 2H6OA 3T77A 4QF1B 3QNXB 4NM8H 5HHVH 3MBEC 2Q5BA 5IEKB 1EDHA 4KKCD 4JKNA 4Q6IC 2A83B 2IPKB 1QI4A 3T4AB 4GUOA 2H1PL 1KGYE 1M6UA 4UTBL 1U91B 4HLEA 2FEDC 5JHBA 5HHOE 4DCQB 5B8CC 1FH5L 3WHE0 3WEXA 4WFGD 3PWNA 4J3UA 1T20A 3WS6A 1XSIA 2PW2B 4HX1A 2K4AA 3ARXA 4QXUH 1KTDA 1T7XA 4RBPK 2XV0A 3QDAA 4LCYB 5F7DA 1RZQA 2BSRA 5I1DB 5LBSH 2AP2A 4LQ1A 3X14A 5C0AB 4FZ8L 4KO7A 2CO2A 1DVSA 3VMPA 3VXME 3Q8FA 2X4PA 4YHKL 4NZJA 4PEEA 4DGWC 4JM0A 4NIYE 1RPQA 5LBSA 1FJ1B 3ZVVA 3HZKB 5DQ9B 3K6NA 3UXFA 2WCPA 4JM4H 4YDJA 3JWNE 2JJVA 3V0WL 4BFEA 1KTRL 2DICA 1I9JH 4U6HA 4JY5H 1CGTA 1KN2H 4QTIH 4HLZH 4ZW7A 3ULSA 2WM0A 1DQLH 1G7QB 3IFPA 3V4PA 4LLMB 1Q94B 2W8CA 4Z18A 3S4SG 4TOYL 1WS8A 4UWQB 5FWRA 4S1SL 3VU1A 3PCYA 3KS0H 3ZKMD 2DYSB 3QWOA 2DYPD 1W72H 1ASOA 3CAFA 2ARJQ 4MASA 5DO2C 5GISH 4AGMA 4DEUA 5BV7H 2H9GB 1AI1L 4OLXL 4LLUA 3FCSA 3UH8A 4HCGA 3ES6A 2VDQL 4IBYA 4D7PA 3MLSH 4KZDH 2QLVB 1RSFA 4XAKE 4FDWA 5INCB 5AUMA 1ADWA 5EFIB 4WW2F 4Y5YB 5A40E 1SNRA 1XV8A 3GBDA 3G6JB 3T4YB 4EE2A 5I2IA 4NLHA 1S7QB 3MO1B 1AD0B 2B1OA 4PJ7F 1LMIA 4LDEB 4PRIE 4PV9A 1E65A 2YOCA 2DV6A 2LFGA 3UEZA 1GSKA 1IAII 3MA7A 2V17H 4GSRA 2BY3A 2C3WA 1VA9A 3AFLA 3GTTA 3K1DA 4R7VA 4NWUL 1LWJA 1JGVH 3RWJB 4NUPA 3EJSA 2PTVA 4IEFA 4Y4HB 3SKUD 2WXGA 4NC2B 3P4OA 5DMGC 4X0NA 1LO0L 3HNSH 3COOA 2XWTA 4JZJC 3VM7A 3NFSL 3LHAA 3ARGC 3VX1A 4X9HA 1U8LA 5D1QB 3G5VB 4JW3A 3WKPA 3QCVH 5H37G 5LO7A 4PRAA 5H4YA 1U8MB 4OI9A 2LVEA 2BXZA 2WZPD 4X6EB 3LEYH 1AIFB 5IK3A 3OAWA 2F5AL 1IM9B 3JWNC 3GSUB 2EINB 3F84A 1OSEA 4NHCL 3NGBB 4N0UB 3UX9B 2R0LL 4GRWE 3VMOA 3L2LA 4H8UA 5PCYA 5AB9A 3IFNH 1N10A 1E3ZA 2DQTH 2ZF9A 1JPSL 2V9UA 3LZLA 4QKXB 4TKWA 5FUCE 2J2ZA 4NKMB 4GMSL 1I3RA 5IBLD 1LHZA 1QZNA 3LKPB 3QDJB 4JS7A 4QCIA 4NXKA 5CSZA 1MCKA 5SWZB 5JW5B 4FKEA 3WMPA 1NGXA 2LV4A 2WUCH 2Y4SA 5E0FA 5I6OA 2DM3A 1S9VA 2VXSH 4MWFB 1CD1B 35C8L 6FABL 1RJYA 2LAAA 1G9NL 3DSNA 4JB9H 5DMYA 5LN8A 1HYSD 3KYMB 1YLBB 1UC6A 2NMSA 3EXJA 1BA9A 3KPMB 5CEZH 4OZGF 5IF0A 2MFNA 3FF8A 1VEOA 3RNQA 4LEXL 1X9RA 2OR8A 1ZLSH 1TJIH 4I85A 1E90A 5C7XH 3IJEA 2IANA 1OLZA 5DTFA 4LSTL 2AK4A 2A73A 3LTVA 2YUXA 1IAMA 2WMPB 1G5AA 3QR1A 4GW1B 4PRHB 3BEVA 5FO7A 2COQA 2NY1D 2IBGA 4U0QB 3SDCC 4Z23A 1NKGA 1K5WA 4PREB 3ZIYA 1ZIAA 3BVWA 1F3JA 3BN9D 4FN0A 1AHWA 3ZL2A 1L9MA 4PBDA 5FA3A 3D0VB 2DH2A 2FK9A 3CHOA 5F3FA 2UWEE 5KVDE 3O4LE 1MF2H 1RUPH 4DHLA 5BCAA 2VAAA 2YMXH 2YJQA 4LE8A 2AC0A 3GLZA 1F13A 5J06A 2LABA 3LKRA 4XCNB 1GXEA 1ZT1A 3HE7A 3O6LL 4KKNA 5DLML 5B3JE 4N25A 5E51A 3G5XA 4GXUN 1OSPH 4NP4H 3VA2C 4IIZA 3GMMB 5L0QB 1KYDA 1TVHA 2OXGA 3ABLB 5K9OA 2PCPB 1ASQA 3MRLA 1N5AB 4M5ZH 5H94B 4W93A 2MNWA 4M4RA 1S7TB 1J8HE 1OL0A 1U36A 3BPCB 4BCYA 2DTML 3BKJL 2EDNA 1NBZA 1WZMA 4JE4B 4W1TA 3Q2LA 4YZWA 4YHPA 4ES9A 2NY7L 3B9KC 3Q2CA 4QNPF 1FC1A 4U3SA 3SGKA 2O30A 5D93C 3P4LA 4MS8C 5E4EC 2KUTA 3VFUA 3IDIB 1KLFB 3ZDZE 1F58H 3SQOL 1T1YA 1YDPA 3FTGB 5JXED 3C5ZC 4N1CA 3EBHA 4KRNA 2CO4A 3IDJB 5F21B 2OW7A 3DHJA 4CNIB 3PPSA 4K9EH 4UTBH 4YXHH 5EO9B 3OC8A 4PHXA 2GITA 1F1GA 4YSDA 2PWFA 3RURA 4APXA 4GH7B 4I8DA 3VU2A 2VXQL 4JQIH 5L2KD 5MERA 1M1SA 4U1KB 5D8JH 3BGFC 1DDTA 2WTPA 5LWYH 2BJMH 2EC9U 2VMDA 3L9RA 1Z0MA 3VDAA 2FIKA 3FKUS 4HCIA 1FYTA 1GYWA 1NAKL 4JQIA 2IPTL 5DHXB 1JNLL 3SBQA 4GW4B 5DZNA 3LN5B 3QPKA 2VC2B 3I3BA 2VL4A 3DVNB 2H6UA 4PJCF 2FO4B 4HPHA 2XT1B 4PRDA 5F9AC 2AK1L 2A74C 5AW9B 4NENA 4YSSA 2IWFA 3R1GL 5GS1C 2RHEA 2GI7A 1E9OA 3WO4B 4ZXBA 1NFDF 1RK7A 4XWOC 2G75B 5GGVY 1ORQA 1NGZA 4OJCA 2XX1A 2XWXA 1P6AB 2H0EA 3PXJA 2FQEA 4OKVB 1RZKL 4LP5A 3PWVB 1XO8A 3B56A 2EE0A 1KGCD 3QT2A 3S3SA 4Z9KB 5I1JH 2QV2A 3S97C 3QEUA 5D1XA 3OKMB 3LKSB 2KC0A 2IWEA 3D6GA 2KDGA 2TRHA 2NXYC 3CVIL 3K74B 4UM9B 4M5YH 3TT3L 3AS3A 4OJYA 4EZKA 4K2UH 1DJSA 3PWPE 4OGXH 4P5KA 2NCEA 3BESR 2IGFL 1H8LA 3DPBB 4FQ2H 1MFEL 1AR2A 4G43A 5HGHB 1KBGL 1VKXB 4ECNA 3EOAB 3MMEA 5JHDA 2MQ3A 4KV5F 1OZTG 4WNQB 3OQ3B 3OVUB 4GO8A 4YR6A 3HPLA 1AQHA 4KH9A 1BVLB 4AW7A 1IO4C 4B60A 9CGTA 1NKOA 4U1GC 1H15B 1QKZL 4CC4A 4N9GB 1BX2B 4HF5L 3LEXB 4F91B 1B4RA 3ARDD 4OB5H 2KHAA 1N3NB 5EDSA 1PKQB 4JCLA 1M2OA 1WHOA 3CHSA 4WTXA 4K7PY 5IMKB 1NIEA 2Q7NA 4P5TD 1SVBA 3WELA 5B4MD 4OZHA 5KSUB 2R0WL 1ETJA 3TCLB 4UDUB 3OMZA 4TPRH 1IC0A 2YAEA 4F7CB 4NERA 1DR9A 2VJ8A 3DJTA 4P3CH 4ZTOL 3ZQXA 1IGML 4OCRL 12E8H 4N3UA 4XNAA 3O6KH 4NRYB 5C3IA 5B7FA 3Q0HA 5DZJA 5IJKA 4U7KA 3BLBA 3UTTA 3VI4E 1DQQB 5SX4H 3FAXA 4ANXA 4GMSH 4UQ9A 3CZFB 3B7TA 3WXWL 4F80A 2X38A 2E7MA 1TJGH 1R5WA 1K4DB 2H2SC 3QHZH 4AJVA 3ZHLA 2MHAB 3MROA 4B9CA 3D33A 2VRQA 4GQZA 4NQDD 2LU4A 3ZTJH 4GSQA 5E5UB 4CADA 1D9KB 1CT8B 3O2DH 4F2MB 4W9JC 3MGTA 3FS9A 4LFHD 2FJUB 35C8H 4JRXB 2BOBB 3GS4A 4OGQC 1MEXL 2MPVA 4HIHA 4NQXA 5IMLB 2PWGA 3TZVA 2AK4D 5GGVL 5CEZD 2VZSA 3O2DA 5TK4A 3EO9L 5AOKA 1HCVA 2FL5B 4HKBB 4XP9H 5HVHB 1BFVL 3BAEH 3NZ8B 1S7SA 4JFED 1OAYL 1PAMA 4KPHH 3RGBA 1KXVC 1KPUA 4YIQB 2R2CA 3GIVA 3FCTB 4MZ2A 5TDOA 1QRNE 4KZEL 4XPFH 3NH7L 2BCKA 1PLAA 1KEGL 2X9YA 4HMEA 1S9YB 4PP2B 5F6HJ 3O3AB 4RIRA 3UAEA 2HX9A 3VI3E 1CUOA 4KQ3L 1N5YL 4PJ9C 2QR0A 3WGVB 5EH1A 3OLEA 3TVMB 5IMOB 1GAFH 1HHGB 2Y6SC 1DJXA 3HE6B 3NCEB 1HNGA 4HJGB 2BNQE 2E27L 3HE7D 2X89D 4LEOA 4OUOA 1KIPA 3VGGA 5C2UB 2F8VA 3DMMB 4LSVL 1ZV9A 2EDTA 3SKMB 1AY1L 4LPVA 5LGHH 3LIZH 1M05A 2J8UE 2YQ2A 3PREA 1X5JA 5LNGA 4QXWA 1UTDA 1UT1A 3QK0A 4C83A 1KTLA 1X9QA 4G8EB 1MDAA 1K3IA 1EQWA 3ARFC 3CV5A 2F1AA 3MBEB 4DEPB 5I76B 2VMEA 3D08A 4Q6IB 1T0OA 4P0DA 2AVGA 4HMCA 1VERA 3KYNA 4OLUH 5E2JA 1OWWA 2QSTA 2H8PA 3NCJL 2VR3A 3VXUB 5FM5M 4S2SB 5E5LA 3MBXL 1WC7B 3Q8AA 4UV7L 4ZPTB 1DDHA 2MNJB 3GM8A 3LCYA 4K7PL 1NCWH 5JQIB 4L4TB 4W9IC 3SQBB 4R4FH 4TVPE 4P4KD 4UUJA 4MHHI 2WXLA 4W4NA 5E99L 1C8PA 4YDMA 1W9XA 3HAEB 5GJSL 5A2BA 2AJYH 2K7PA 2ZXWB 5D4IA 5DYOA 1N4XL 3WKYA 3IJ7A 2UUDK 3CZEA 4KJYA 5EIIB 4DK5A 4K71C 1IX2A 2ATKA 1DLFL 1ODUA 3BAWA 3ZW3A 3KPQB 3B6SB 1X44A 4ZO6A 1X5ZA 4YAQA 3UFIA 1YEJH 1MRDL 1KYUA 5TK2A 1KJVA 2X9XA 4Y4KB 5D4QA 4CDHA 5FF6B 2WB1A 4Y1AD 2X6AA 2A4ZA 2CIKA 2P7TA 4G6FB 4BHUA 4OAWA 3NPSC 5F7EL 3RVUD 2G60L 4R7NA 3T2QA 3DI3B 4WWKC 4Y7MA 3BJLA 5EF0A 3VWJC 3DIVA 3OZ9H 5CBEB 2D7OA 2QQLL 3LZOA 1YPZA 1Y6MR 5BOPA 2ZXDA 1EZLA 4PLNC 5E2UH 4QRFA 3LZNA 3VXTA 2MOVA 2HCZX 1I7TA 1QX1A 1Z9LA 3RWHB 4A6YB 1B0IA 3JV4B 4OJAA 1R5VA 1CICC 2VKXA 3ZE1E 3S98A 7FABH 2NNAA 2PMZA 1LO2L 1JP5A 3SB3A 1RZJL 3T0XA 4DN4L 1IGTB 4WEBL 5HHOB 4WI7A 1G9EA 1HINL 1E6OL 2Y5TB 4GKNA 2OX5A 4JM2A 3T3MF 5LDSA 3ARWA 2NY5C 3JT0A 3MLZH 5CILL 2HG0A 1PQZB 3N42B 1BGXL 3BPLC 4FFZL 4GRMB 4HQQH 4NUGH 5DD1L 4IBQA 4GG8A 2OR7A 2F53E 4JZJB 5E6IB 4KJQD 4HGKC 3ARGB 5AAWC 3VXMB 4FA8A 2VC2L 2I69A 2IGFH 2XN9D 3K4DA 4KWUA 4HD9A 4XPGL 2NY3D 2BP0B 2OA9A 3ETSA 4X4MA 3IBOA 4JUSA 4FCHA 2HJLA 2W0PA 1AKPA 1ICTA 3WOVA 4F58L 1IC1A 2A9BA 2WZAA 1P4LA 3BQUA 3GEFA 3D18B 2OYLA 4N2AA 4KKRA 3G6AB 5DJ0B 4YEEA 3GMRB 3PL6C 3ECUA 4LOFA 3CCHB 3FRPA 3HRZC 4NQVA 4MNGE 4Z3JA 2GAZA 2Y7LA 4Z0BH 3N44B 5C6TL 3O45A 2C7FA 5B21A 1UOVA 4KRPD 3PIQA 5E1HB 3PDGA 2OULB 1QKZH 2XICA 3O6ML 4OF7A 4PWEA 4AQAB 5B38A 4OGAD 1WA0X 2BHFA 2F54E 4O2CB 4R84A 8CGTA 5IW6B 4X7SL 3W0WA 3FT9A 2Z7ZA 4D3CH 4H20L 2H6PA 2HTLC 3D4GA 1B6UA 4PMFA 1IEBA 2B2XH 1IM3A 2IFGA 3LKOA 5DEFA 1J8KA 2DYRB 3SKNA 1JHLL 1M9WA 4N4YB 2AKRB 4D0CA 1BMZA 4HT1L 3AW5A 1CFSA 4XBMA 3T0EE 1P4UA 3UTTD 5DS1A 4LPUA 2Y1YA 1DE4A 5F9WB 3WFBL 2BX5A 3QQDA 1EK3A 2HFEA 3KH3A 5KJRL 3DX3A 4ABQA 2X1PA 2HJKA 2YPLD 4PRIB 1I1FB 1JYVA 5D1ZI 3TX4A 4HLZG 2GTWA 2P5WE 3H0TA 1WBXB 1Y07A 3G6JF 1KGUA 5CP7B 5A2AA 1HC1A 3QULB 4P9MH 1F4HA 1O6SA 4TUKL 4URTB 1LQBC 4D7BA 5FECB 3LH2L 4A04A 4YPJA 3ZZLA 3TZVD 1IARB 5JW4R 2BWIA 3BVUA 4XNXL 5F9DC 4YHYC 3RP1A 2HVKA 2WCSA 1PX3A 3LVEA 3QFGA 5FR3A 5L4FA 2F58L 2KS0A 3OKEB 4JQVA 5AEAA 5FKPA 5JORB 1K4CA 1INEH 1UWGH 5FK9A 5GGVH 1SMAA 3QDGB 4HH9B 4EBQL 4J3OC 3FH8A 5GZOA 3TL5A 2W59A 1BFVH 3NJXA 3UBGA 1OAYH 3MLYH 5KSVB 1HILA 1YUHB 3EADA 1KELL 1XCWA 1XCXA 4JZNB 1FLRL 5FO8B 4KZEH 1NOLA 4GRWB 4I13B 4X8JA 4DEWA 2UZIH 3QUXC 3MRGA 5C08E 4FADA 1P7KB 3FO2B 5HPMA 2R69L 3NCFB 3QNYB 4BFJA 3L5XL 1TEGA 1AOHA 3BFOA 2OMXB 4DK3A 1D7CA 3BPOC 4XH2B 3BMWA 3FT2A 1P5UC 1ZKAA 2BDNL 4M8QA 3I9PA 3B7RL 4NS0A 3HG3A 3IE4A 3P4NB 5BUAA 4ZMLA 3LPPA 1D5MA 3QQ9C 3T0EC 3EOTH 3GI9L 2X4TB 3IETB 3SKJH 1T83C 1RQ5A 3ATFA 4XP4L 1A4BA 5DJYA 3AZUA 1VFMA 5E4EB 3T1FB 3V0JA 1LK3H 5DQJB 3C5ZB 2I26N 2UX6A 4J2XA 5J1AA 4D9QD 4HK0A 5JHAA 3ULVL 3TO2A 4FJ6A 1UD3A 4M29A 3PP3K 2EYSB 1WIPA 2W91A 1I7ZA 5EBLB 3V7AE 3NCJH 4H26B 4QRSA 2IXQA 2NLJA 3APFA 2F9BT 4O51B 5CMAA 1RHHB 2HT4D 4OZIE 4PS7A 4BWUA 5M94B 4Q7DA 4MAZA 5DWUH 1Q0YL 5E9NA 1HKLH 4LPXA 4N0FB 1NDGB 2GUOB 2RR3A 2LR4A 2XYBA 5ABDE 4N2HA 5EG6C 1MNUH 5K59E 1PZSA 3FUDA 4MD0B 3DUHA 4NGHL 4YE0A 1GOHA 2BIHA 4FLRA 2GG1A 1EHXA 2FGZA 5DHDA 4OQTA 1KG0A 3G08A 4E41D 4HA1A 4YVUA 5KYWA 3U4KA 4JZOA 5E8NB 3WE6A 2CDGB 2BVQA 4LFHG 2UWEB 3S2AA 1DLFH 2IH3A 1XQ4A 2P8LA 3GJFK 3WFCH 3HNTL 1YYLH 3T6QC 4MXQD 1BEYL 1NCCH 1VFOA 2HA1A 2A74B 2ROXA 3MRQA 2ZICA 1C5DB 1Z9NA 3DX7B 2X53A 4GRLA 2PYEE 1GCFA 2K7QA 3L3OA 5LLIC 2WCGA 3QQ3B 5F9JB 2JKSA 1WO2A 4C4BA 3QE5A 1A1OA 1XWVA 3IRPX 2PW1B 3N06B 1YAZA 1J8HB 4MYPA 2DPKA 1A6TA 1SYSA 4MQ7B 3MLTB 4MBRA 4AQOA 3IGKA 4EUPH 2QQLH 3CMOH 1TYRA 3MLRL 2YRPA 4Z8FH 2AXFA 4Q9BA 5DJDB 4O02B 5CCJA 5I6PA 3WKMH 3KWUA 3QZMA 1NCAL 4I1NB 1R0AL 1JZDC 3X1EA 1MJUL 2H4EA 2NXYB 4GINA 4MZIA 3FW6A 3ZDZB 3AS1A 4Z1PA 3O4OC 3O6FA 1NWOA 4JM2D 4KFMA 4EUPA 1A9BB 2GJ6B 4PG2A 4PV1C 5TGBB 4UT9L 4FXGB 1JPFB 1LO2H 4A7UA 3W39B 3GQFA 1XBDA 4YO0B 3S3PA 4UQ3A 4PV8A 2OYMA 1QA9B 3CSPA 1TTUA 3CDFA 4AMXA 2SEBB 4FFZH 5D72L 3SBPA 4AYDC 1QW9A 2AJUL 3B2DC 2DQ6A 2XBZA 2DQIL 2L4OA 4U1GB 3ISYA 1U4EA 2OMNA 3FU0A 3Q06A 2ZCKL 2BFVL 2VC2H 3DSFL 1U8QB 3TNMA 1WV7T 4R6UA 5FKAA 1HTYA 5FGBC 4IJTA 1PU0A 4CRPA 4AENB 2YUVA 4FTVE 1NIDA 2EYRA 4OD1L 3R7RA 3DO7B 3FQRA 4PW3A 3VWKB 1F4YL 2D2CC 3BRGC 3LHPL 1RIUH 3BUDA 5C2BL 4UQCA 5DVNA 1CI3M 1KCUL 5DUJA 4A6YL 3FTXA 4E9LA 5B39B 5JOPE 3N1FC 1KENL 4IMLB 3HR5A 4X9GA 1G7LB 1YN7A 1EXUA 3E8UL 4ETYA 1ACCA 4U2YA 5FCUL 3U36A 1IM3D 3ZR6A 2AQSA 4GSXA 5ITFA 3O2VH 4NDMA 1HYRC 3LNDA 5T5FA 4P23C 3HCVB 3I75A 1ZJBA 3GK8L 4H20H 1PEZA 4DH2A 3CQQA 2ZP8A 3L16A 5CXPA 1WITA 4F1ZA 4BSWB 3IMUA 1UXMA 4N90E 4WDIB 1IRAY 1C8QA 4UILL 5KUMA 4YSQA 2J71A 4Y16C 4HT1H 3GRWH 3LPGA 3Q6FA 1KPVB 4Q52A 4J1UA 4D0DB 5JXAL 1XGZA 5DSCB 4JRYB 2HT3C 3PWPB 3EYQD 1FHNA 1NC4A 1ONQA 1F8TL 3MFFA 1BXXA 4HIQA 2FHFA 5CCHE 1QVOB 3GRWA 5CN2A 4FLOA 5INDA 5FDWA 3N5AA 3RU8L 4Y4HD 1VZGA 2CALA 2CA3A 1YC7A 1CLZL 2YC1B 4U1NB 5ERWA 3FC8A 1S7UA 3EDJA 2YRLA 3L5WA 3EUUA 5DRWA 4OFYA 4YLQT 1SHXA 2PO6B 1SLUA 2KLTA 3BUYA 5D1QD 1IMHC 1EMTH 3D0LA 3LXUX 3QDME 4I0PA 3D85A 4RWHA 1A4KB 4U1IA 1LDPL 4PJ9B 3RVVC 1YEDB 3HI1A 5MENE 2MSPA 1LEGB 3P40A 1IGYB 4K7FB 3CIAA 1FGVH 1G7HA 3US9A 3LJ3A 3KW7A 4K5NA 1FGNH 5E9AA 2HWZH 2IALA 1PYWA 2ATPA 2V4LA 3S7GA 4LLWB 4B9PA 3QQNA 5L4MA 4PWHA 3ETTA 3V52L 3UYPA 1AMXA 3WHXA 4TSBH 1AG0A 1GY1A 4YBQD 3ARFB 1MREL 2H47C 1HE7A 4FNUA 3VI4B 2YRBA 3DLQR 4BE6A 1MIEH 2OMWB 2WWKT 5SWZD 3UTSA 1CXEA 4PLKC 1AZUA 4XVJH 1AXIB 1ROCA 2NY4D 4DZ8B 1BXVA 1KBVA 3SOBL 3VD2A 5GHWL 4YUEH 1GGTA 1Z9MA 3B2UC 2JQAA 5EOTA 1UATA 4XP4H 2WO2B 1ZANL 3VFSB 5FOJA 1UJ3C 3WLBA 3SDAC 4IOSD 2G5BB 5IM7A 1CPUA 3F7PC 1G9MH 4LPYA 3TFKD 4Z0XB 2X6CA 2WWKO 4G8GE 5CS7A 2VITA 4ONFH 1WDAA 1VFBB 2MCG1 4LLDA 2AQRA 2VUYA 1X7QA 2Y7QB 4NQEA 5J12C 4DKEH 1THCA 1LP9E 1KFAH 4EEEA 4N2DA 5DD0H 2GJRA 2DM4A 3RTQD 3WNLA 1SQMA 2FYVA 4I77L 3S3CB 2G30A 4E9QA 1QRNB 5A1AA 2ZP9A 4HPOH 3BSZH 1NBQA 4OCMC 4MCYA 1I8KA 4WUUE 3ULVF 1ZIBA 3U0TA 3VI3B 3QFDA 3NPSB 1QBAA 1MJ7H 4GLRI 2O5ZL 2IDQA 4LCUB 1RXLA 3QI9B 2BNQB 1FNSL 3MNDA 3ZRCC 3AT8A 1VFAA 3GKWL 3VNYA 3FUFA 3VWJB 4PVLA 5HVGB 1RUKL 3IPEA 1ITBB 2OP4H 3VRIB 3K71A 1M71A 1JPEA 2Y22A 3TYGH 1MWAB 3N41B 3BP4A 4C8XA 2NW3A 3CU7A 2J8UB 2QQNL 1SMOA 3TEZA 3MRHA 4JHWL 2QTVA 3RUGE 2RCSH 3SY6A 5DHYB 1R3KB 3KE0A 4TNFA 4UDTB 3FUEA 1USZA 5EBMB 2J88L 2AXGA 1JVOA 1CGSH 4PJ5E 4WFFE 4ALAH 2QVTA 1B9KA 1JHKH 4OUUA 2W65A 3NSJA 4S1QH 5GIRB 1LWHA 5JIQA 2Q6WA 4I3GA 1T21A 1M53A 4XPBH 3O6FD 3RHWF 4IJ3C 4V1DE 1G0XA 2ICWI 2EDJA 3DOHA 5EUKA 2JLLA 4D94A 1JGUH 2PPAA 3B9VA 3BPLB 3N2JA 3QG7H 2XTSA 3H7BA 5IFJB 5LBGA 2VQ1B 3I9IA 1P7QB 4L9LC 5KVDL 3TU6A 3RZCC 3WO3B 1LE9B 1CVSC 4ENEC 2ITCB 4PRNB 2FWOA 4Z76A 5I1AB 4IDLA 1O7SA 3QJFA 4PWFA 5KBNC 3TO4A 2HPTA 2CLZB 4BQBA 1EEYA 2V7HA 6CGTA 3MJ8A 2MTAA 3AM8A 5CZRA 2CKBA 5SWQB 1CDIA 1E4WH 3PL6B 2CRIA 4LQFH 3TV3H 1FZJB 2QDWA 4N0YH 1AKJA 3V6ZA 1FQ9C 2VDPB 2X09A 4WWOA 3JWDH 1K8DA 4FP8H 5GRYA 4LVOB 3QWNA 5A43C 2V5SA 4G8FA 4XN5A 3UTQB 2Y36H 1ZHNB 1KN4L 2A6KA 2ARJA 4O02L 2X12A 4NQCE 3UG5A 4P57B 4UCFA 3LHPH 4KJWC 5CD5C 1J8RA 4HIIB 1LD9B 1U3HA 3DTXB 5E5MB 2QSQA 1UKTA 5LBVA 2MQ0A 1U58A 4P59H 3CSFA 1GKOA 5DR5L 2RB8A 3CHRA 1RJLB 2GSIA 5I1GH 1U8IA 4K8RC 3FSZA 2HT2C 3ZE1B 1YMMA 3GK8H 1Y18B 1K5NA 5EU6A 1C5CH 2NXZD 4UAOC 2BMKB 3FRUA 4ABWA 4BFNA 4ODSL 1JRHL 5DJ8A 5DJCA 4PJFE 3OKOB 3HUJA 5D7SH 4GFTB 2X0WA 4UM9D 1L5GB 1NC4D 3S5ZA 2FX9H 2YPKA 5CBAB 4ZYKB 5TJWK 2AHIA 2V2TB 4LAJH 3MX0B 5JXAH 4YHYB 1QFUL 3IF1B 2B1HH 5ACZA 1NBVL 4W9FC 3ULUE 3DOSB 1A8ZA 2F53B 5D6CB 1D5RA 3N04A 1BAFL 1MKFA 3KNBB 1VCBC 2B16A 2R2EA 3NFPA 2EVFA 1J1OL 1FV1B 3L5HA 3N42F 3QVAA 1MPAL 3RU8H 1J1XL 3ZPDA 3K5SA 1MFCH 1JD7A 1H6UA 1TENA 3GNML 1QQDB 3QNFA 4IMKC 4CVWA 2B4CH 4AQ1C 1JHTB 1TETL 3H4FA 3N43B 3D85D 3MRRB 4IRJC 4HXBH 2VUOA 2X2UA 3W9EB 2EIMB 1ZA3B 3DOIA 4XVTH 3MRBB 2WINB 4MNGB 5EB9A 1Q90A 3V0FA 3VD1A 2W80C 1OIOA 1CG9A 1UA6H 3PAYA 5IB4B 4AL8C 1TCRB 3QUXB 2F54B 3MV7A 3QHTC 3KM1A 3FUNA 4HU2A 1ZHBA 3WTUA 5F72S 4HBCL 3BP6A 1QTPA 3NFNB 2CO1A 3IDYB 1A9EB 2Q10A 1ED3B 1DSWA 3DPDA 3BPOB 3EXLA 1J10A 2ENYA 2EYTB 2VABB 1HEZA 4DN3H 2FO1A 2C7UB 2VXVL 4IK7A 3BAKA 5SX5H 3FRPG 2ENSA 2Y3AA 3T0EB 1N59B 1XD0A 1BIHA 2X4OB 4NO0B 1B0RB 3ZDXE 5FXCH 3OMAB 1D5ZB 4QWWD 5BMFL 5B38G 2ZSWB 1WJ3A 4BUGA 2AERT 1WFOA 3ZHDA 1CR9H 1CIUA 1DLHA 3RWGB 3L1OH 2P5WB 2F8IA 4PAZA 5D7KD 3EHBB 2HUHA 2DN7A 3ELAT 5IHUL 4KDTC 1JPTL 5B22A 3PV6B 5GHWH 2MCAA 4ORGB 4JG9A 3MLVH 2QPEB 4ODHH 2BP3A 1TF4A 4XCEA 1DEEA 3QHFL 4NJAH 5J57B 1SXAA 3OMIB 3TBVB 4TUOB 5C97A 3QYMA 1G9HA 2OL3B 2NX5A 4AH2B 3C5JB 3I6LD 1URIA 4GAAA 4HZ1A 4J27A 3F65A 4R26L 3LRMA 1ECZA 2XHNA 5I75C 3VH8A 5DRNB 5DJ6B 1HHJB 1QEXA 3OAYK 4X7TA 4IQHA 5EU4A 3UMNA 3MOAH 5D7IE 4RGMC 3L81A 4FG6D 4C56E 2BSSA 4WY7L 3U4BL 4HCRH 2IEPA 1FSKB 3P9LB 3QP3A 1ZT7B 5C08B 2HVBA 3KPNB 2YPVH 1U8PA 3SGDH 1B4JH 4RLDA 4BM7A 3ZE2E 4WK4B 1OGAE 4BK4A 4JX0A 2YQBA 2VMCA 5ICYA 1I1AA 4OD2B 5T5NF 4UT7L 3QR2A 4GRWF 5LGJA 3L4CA 1IKNC 4CVXB 4JRLA 2YD6A 4H25B 4F7EB 4F5CA 1RH8A 3CSGA 2DKMA 3HS0C 4KKLD 2FUTA 3DVGB 5E6UB 4XMZA 2EKJA 3SE4A 3VTMA 1QHOA 2BSTB 3O4OB 4LAQH 3VJ6A 4HULB 2VW6A 4PLOB 5I19H 4A63A 4JHZA 2BRQA 3A22A 4RGNC 5JHLA 3ARQA 3QNZA 5EU3A 1S9WA 3RVTC 3KW8A 1UH2A 5E8PA 2WVVA 3X12A 5J3HD 1KB3A 1UOWA 1FAIH 3V4UH 2Q7YA 4OZIB 1L7IH 2DLGA 4DP2X 3TEWA 2X9ZA 1QYGH 2VJ0A 3KPLA 4F8QA 3O3UN 5CN1A 4PJBE 4PTUB 1OCWH 5ICUA 1XSOA 2I60L 4Y1SA 1G7IA 2LLGA 2XA3A 2UY6B 3IK2A 3W3BA 3FT3A 1A5FL 1KC5L 3TA3C 5HGDA 1IGCH 1CTNA 2X3CA 1JV5B 4ZFZA 3O8XC 1AG6A 2J8OA 2JXMA 4P46A 3UEQA 3WNOA 1MWAL 3H2WA 1AKJD 2O4EA 3D4ZA 3MU3A 1RUQH 4DKTA 1XAUA 1UD6A 3SJVE 3VFMB 1C08B 1QO3B 2C9QA 5CZVL 3PABB 3TF4A 1NA8A 2EZ0D 4UQEA 3I6GB 1QLRB 4IKIA 4PJIA 3SHSA 1TTBA 5J4MA 4I4WB 2PYEB 2UWEF 3W82A 1I8LC 2YD1A 4Y8DC 5AVSB 4P23B 4HOMA 3DA0A 2WSDA 1A6UL 1O0VA 1WWCA 4MA8L 3MRFB 3HG2A 4Z7WE 2C9VA 3ZTEA 5B3JF 1Y7VA 3N85L 1P7BA 1AANA 5K9JL 3MRNB 4TVPL 3D25A 5DVPA 4R0LA 1AC6A 5HD8D 1DZ0A 3DUSA 4Y16B 2BSDA 1YMMD 1Z5YD 2UX7A 2WNWA 1CDUA 4PCYA 4AZ8A 4MMXC 2EEBA 1FNHA 1MCWW 5L9DL 3CH8A 4G3YL 1E27A 5DR5H 3U48A 4ZS6D 8FABA 5HHOD 1KDIA 4E2OA 2Q8BH 5AAMA 2CBQA 2EXWD 4HJ0C 5GS0C 5L8JB 1XR9B 3MXWH 4XNYH 4XNBA 5TQ2L 3RGVC 1V7NH 2OSLA 3ZDZF 1MFMA 5KSAC 1MCCA 4M48H 3N0PB 1SEQH 4WO4C 2ZKWA 2VDPL 4NRZA 3DX6A 3IB4A 1Z2KA 1ZVSB 2G9HA 1OGTA 5E6ID 2VR9A 4XMVA 1QFUH 1A7BA 2BOCA 5GSRB 2Z8RA 1RUAL 3WLWD 4EUPG 5FB8A 3EF4A 1F42A 2J55A 2O6EA 4JKMA 4AITA 2OR9H 4B53A 3C2AL 2Q2EB 3H4HA 1I7UA 1FF5A 4Q0XL 4FTVB 5AW7B 4QRPE 4AV4A 2EDRA 4OY9A 3RA7H 1QLEB 1WTLA 3MNWB 2Z31A 2MIZA 4UQDA 3MV7D 4PP1C 4V11A 3QIUA 1BLNA 1RUMH 3MACH 5HHPB 4HUXA 3WS3B 2XIBA 1UD5A 3KWWB 5AWNL 3MLXL 2ITFA 5ICZA 3M8OL 2PYFA 3MNMA 5DEJA 4R97B 4HJEA 1Q9OA 3QRGL 4YHIA 4QUOA 3Q5TA 1PLGH 4EI6A 2R2HB 3V55A 1TXKA 3L7FB 2AQNA 4LESA 2CCLA 4P3DA 3BIBX 3SO3C 4B7IA 4AKOA 4AJ0A 1PZ5A 4XXWC 2APSA 1J7VR 1WWWX 2F7PA 4PI2A 4XAKD 4XR8C 5CJ8A 4LLVA 5E1AB 5HSFA 3BUIA 4UANA 5CZKA 2XV3A 1MVFA 3DJRA 1F97A 1CFTB 1KGJA 2GCYB 4NWTH 3VXSB 1UXLA 5C0BE 2WBJC 3G5YB 2XY2A 1ACYL 4PRID 3B2XA 3FYIB 5I6XC 3F58H 4B0MB 1UJ3B 4XP6L 1QBML 3SDAB 1A2YB 3QYNA 1ZGLM 1QR1B 2V8MA 1RFDH 2OTWA 5MEOA 3FU3A 4DW2H 1L3WA 1DQDL 1EBAA 5DA4A 3RDTB 4PY7A 5J12B 3GXUB 1GVIA 2WXQA 4E9YA 4GG6A 1EFXD 3NDZE 5DD5L 4BH7A 3OXRA 4JAMA 4P49A 3DX8B 2Z35A 2VZ3A 2NX5D 4JO8A 1U95A 1IB5A 3EGDB 1ZHKB 3M1BA 2WQRA 1DQJA 1XGRA 2EACA 2YEZA 5AW0B 4OZGA 1WE5A 3AQXA 3P9WB 3QDMB 3ZXAC 4YLCA 1A4JA 3NEXA 3VAEA 2XWJA 3GPEA 5ID1A 1UFUA 1OSZB 4DGIH 4HV8B 2AXWA 4NBZB 3LKQB 4BKLA 4GBXC 1JZEA 5MENB 2DQGH 3I50L 4RAVB 3IJYB 2PCYA 4ZMYA 4R26H 1A6WH 3NJIA 2NR6C 1MRFH 5BO1L 1EUUA 2FATL 3IAQA 3FB5B 1HXYA 4RZCB 2JKLA 5FX3A 2FT8A 4G2AA 4Y9BA 3CDGB 4NAMA 1OP3K 5F7YC 3U4BH 4AM0Q 3BYTA 3MR9B 4TNEA 3C09C 5ESQA 4W9GC 3U0PB 1LDSA 3NSDA 2ZUUA 2Z65C 3VACA 2R56L 3ARZA 2GBUA 4F33B 4CBPA 3RFRA 3GZPA 1QNZL 1X5YA 1S78C 3OZLA 4KY2A 1I3GH 3TEYA 3DECA 2JQMA 4GSUA 4Y9FA 3WV0A 2ZWYA 3O81A 2UVFA 3MQIA 2GBVA 1Q9WA 3ZLQC 3GMPA 3TESA 4IJ3B 5F70A 1UKSA 3QIWA 2EE9A 2P1YA 4M61A 5GGTH 3VI4F 1PPIA 1ASPA 1RIVH 3X13B 1XGYH 3LRSB 4OR1A 1QTYT 4Q97A 2OL3L 3BFWA 4MD4A 4QHKI 4EI5A 4OLZH 4UZGA 5DRXB 2ZSVA 2D3LA 4L9LB 1ZVHA 4FQQA 3RZCB 1MAJA 4MJIA 4IGBC 2EO1A 3QG6B 5FHAL 3CFJB 1LP9B 1KJ3L 4MSWB 2YXVA 4NCC1 3FU8A 4LKXA 1SM3L 3RKPA 6PCYA 3KVQA 2IG2H 3UPCA 2CDFA 3KEHA 3S8WA 4EOWH 2JJTA 1SJHB 4ZSOA 4ZUSB 4AEIL 4XCYA 2O6DA 4KX7A 1XR8A 3S96B 2XXGA 3E8VA 4G8AC 3QC5X 4M7LT 5GRWA 3RFZA 1J5DA 1T89C 2VLMD 4ZOBA 3U7WH 2CK0L 4WUUB 5IMMA 1HDMA 5DJZB 1HVXA 4X6FA 5AVVB 3VXOA 3IDGB 3O4LD 4X6CA 2MMXA 3MBWB 3EKCA 1PIGA 4GW5A 4IRZH 4NKIL 1CXKA 2FQFA 1MWAH 3GSXB 4ZFGL 2CO7A 2O5YL 2BNRD 2HMID 3STLA 4HFUH 3VI3F 3UC0L 1OK8A 4K7PX 3MLWH 3M1CA 2OJZL 1C5BL 1LEKA 2GHZA 3I02A 4GMTH 5K1NA 3RDJA 2X41A 1LO4L 1UWFA 1MAML 4PJ5B 3OBAA 4E42A 3N41F 1A6UH 3QZWA 1EO7A 5CJQL 1CIDA 4FQCL 2J8UF 3NCBB 2ALAA 3M07A 4FG4A 3QUZB 2XTJE 2CUHA 2G9KA 5C0ND 4DUWA 1MJJA 1A1NB 5HDBB 4L4VA 2DQEH 2X4QB 4JO1H 4R83A 4U6XA 4V1DB 3ZK0A 4ELDA 5TDPA 3E2HC 2PTTB 4QRUA 1BQRA 3BVNB 5ANME 3T1WA 3I6KB 3NOIA 3MREB 3NIFE 5I15L 5HVFB 2VM3A 3FN0L 1MCPL 1CVRA 1E9PA 1B3IA 3PDOB 4MAYA 3ZU8A 1M56B 4HEMA 2A0LC 3PJNA 5HYJA 4M7LH 2EJ1A 5F88A 3MUGA 2OW6A 4NAJA 3BGAA 4HKXB 1UXWA 3KGSA 3WEAA 3FONA 3F7QA 4MXVE 1FZMB 2F74A 2NYYC 1V55B 3OKLA 4CMMB 4G7VL 1JGLH 3ZQWA 1UM6L 2O6CA 1JD9A 4GUPB 4ZOCA 4BSVA 2VDPH 4IRJB 4XO3A 4FJYA 4RMBA 1M7XA 3F83A 4BIKA 3AU1B 3FB8B 2GIXA 2UZYA 1EWHA 3V0HA 2H2PD 1I1YA 1YEHH 1NGPL 2VDLH 1I7RA 2WXPA 2Z31D 3AXLB 5A2LH 1EEUA 3VWKD 3E6FA 2IAMA 1B3JA 4NQCB 5IV2B 2YS4A 3BUTA 1U2HA 4N0CD 1TU2A 4QGTA 5DEGA 4ZUVA 4PS4L 3EW3B 3WEBA 1VLXA 4KFZC 3F7LA 4QRQA 2LHAA 4KZ0A 5D7JA 5JZ7D 3CDZB 3BDYL 1C9SA 3EYVB 2HKAA 2JWYA 3R4DA 4ONGL 2F0CA 1TMQA 4X98B 1QBBA 1AO7E 1MH5A 2C4XA 3FL7A 2VUKA 5ES4B 5F1IA 3D50A 2Y7SA 2VLJD 4YSEA 1IAIH 1Q9LA 1QFOA 1PW3A 1ZVYA 4PJFB 5I8EB 3ZT5A 3BZ4B 3LPOA 3UBHA 2Q76A 4MNQB 5D1ZB 4P8QA 5B3SB 2ZNXA 3ZE1F 4XVUC 2PCFB 3FQUA 3U1QA 3V5HB 1Z9OA 3FBKA 4I0CC 4NC1C 3TASA 1HHKA 4FG0A 1T04B 2HAZA 4Y4FA 2DQUL 1B88A 4JPWH 1DQDH 1WWBX 4J3BA 1TJHH 5BZWB 1Q4NX 4UNVA 5H2BA 2B8OT 3GXIA 4AT6A 2CPUA 3MXVH 2XPZA 3B2PA 3JVGC 4OJDH 5ABAA 3FO1A 4U7SA 4IK6A 3ILPB 3D51A 2RA1A 4U1JA 4M7KL 3U4EA 1ADQL 4ZFFB 1ORSA 4RGMB 1ZRUA 5E2VL 1KXTB 1F90L 1JG9A 4J3OF 1HOCA 1QSVA 5KJ7E 1M2VB 1A7QL 4M8UA 3N43F 5IBUG 5LXGL 1BW8A 1XGQB 1XF2A 4IKJA 1E3XA 1BM3L 2OMTA 5FYJH 3WFEH 1KIRA 2BZDA 2QJDA 4EN3B 3ZKXC 5C09E 3WAKA 1FG2B 5DXWA 3TYFB 5ETUA 4R7DA 1SJMA 3MNVB 1NMCB 3WCYA 2VN7A 4X5QA 3QFJE 5BQDA 3ZDXB 3V7MA 4IU3A 4YX2L 4B0MM 3MLUH 3GDCA 1FL5B 1OCCB 4P3WA 1TTAA 1U2CA 1DN2A 3D3VE 4D0BA 3NVQA 4XO9A 4XX1G 1S6NA 1GJIA 1BBJA 2CUIA 3CJJA 3QIBB 1FCCA 2CRZA 1LQSR 1OKEA 1S7WA 3LD8B 2QZ5A 4E36A 3FQ4A 3OHXA 4I2XA 4X4XB 2AQQA 2R2BB 4MJID 3HN5A 1L0XA 1WFTA 1QLFB 1PZ2A 1H6EA 4DZBB 3FQTA 4W6XB 4Z95L 4L23A 4XMLL 4A2EA 1Z9SB 4HVBA 3QJOA 3TA3B 1C1EH 3EGSB 4KO5A 3X1GA 2QADB 4KTEL 1EJOH 1NZRA 5GPRA 3EFOA 1FNFA 4WI0A 5FHAH 5FLVA 2X2JA 4FNPA 5DHVA 2ZUTA 2HRHA 1E6JL 1FO0L 1SM3H 2FBOJ 3HHRB 3FFCA 4LZKA 5IVZB 3VGBA 3H56A 2CHWA 1CL7I 3D52A 4MMZA 2GJZB 3SY0A 2ORBH 5D7IB 3WN5A 3ZYJA 4C56B 2Q8AH 3HZVB 3SE3A 2FJGA 4F7TB 5JLZB 1QW8A 1XB8A 3VXRE 5J13B 4JY4A 4KJPC 3QI9D 2BNQD 3Q2NA 4GAGL 2OZ4L 3ZE2B 4IBVA 1OGAB 4L1TA 2BFGA 1A47A 4ODWA 4ZFGH 1CO1A 3VH8G 4R9HA 2EDLA 1IGIL 1ZLVK 3BGMB 1NMAL 4RFOH 5BZDB 4ZAKC 1FVCB 4AYGA 5HHQB 1TLKA 4NZUH 3FT4A 3UC0H 1J48A 5IEHB 2Z3FA 2WAHA 4PRPA 1P1ZB 4MMXB 2QL1A 1HEJC 4PR5B 1I9EA 4YSUA 1RULH 1NGYA 2EEXA 4I5BB 1RMFL 4L4VD 4XGZA 1JK8B 5EZOL 2WLIB 5IB3A 3LPFA 3ARVA 4JR9L 1BSIA 1HZHH 3I9GL 1W15A 5CJQH 3MRMA 2GFBA 4WTZA 4PJGE 3RGVB 2EH8H 2V7NB 3A67H 3EFFA 3DIFA 5IVOA 2R4RL 3DETC 1SYVB 4FQHA 5E2WH 4DETA 4MAYD 2VLRB 4TNWF 2A3TA 1RLBA 4PJBB 2UY7B 3DYPA 5HYJD 3B5GA 1YY9C 3R8QA 3GBEA 4YNYB 4XN8A 3HA0A 3ROOA 3KLAA 2E7LC 4OZIF 3Q9PA 1AP2A 5I1HH 32C2B 3KVPA 3ZTDC 1T3FA 4WZ9A 1A7OL 1VZHA 4KITB 2NY6C 5K59F 5KBKA 3BQVA 5IESH 3VFGL 1ODAA 2R0KL 2PABA 3FB6B 1CLOH 4G83A 3SJVB 5T1MA 3AGVA 5IW1A 3EJYD 1AMYA 1Z6JT 4FNTA 4L5FE 4B7LA 4XOEA 2J20A 4JFDD 4AZUA 5EO0B 3MJGX 3PJSB 4K8RL 2Z1KA 1IBBA 3GHBL 4Z3FA 3IXAA 1MHCB 1DVFA 3VTTA 3QA3B 5T1KA 4EI0A 4OD3H 2XNAA 1N0XL 2ZOTA 5I1DA 3HI5H 1MHPH 3IT8D 4Z7UA 4CSZA 2A9DA 4FQPA 4Z7WB 2FBJL 2VZTA 5D7JD 1QEWB 3ZMRA 3ZZSA 3CFQA 1D5XB 1NEUA 3CN1A 5KS9A 3WNJA 5G2NA 2BVTA 2ICES 5AAPA 4D8OA 4HIEB 5I9QC 2WBJB 5I6XB 5BVPL 4GB9A 4XBGB 3BDYH 3R18A 3S35L 5JYLA 3ZGIA 2X4UB 3EH3B 2NYZA 3MCKA 4NZRL 3SPVA 5BW7A 1U21A 4R3SA 3ZZ1A 5L6YH 1FL3A 5IT2H 2KKQA 4NM4H 4AGOA 1S9XB 2BC4B 1ZGLP 1EZVX 3FB7A 4OFVA 4YDVB 5AVZB 1JTPA 2CO6B 3GWJA 2I5YL 1W0VA 25C8L 3CXDH 4H8WL 3MUHL 1R3LB 2E6JA 1ZY9A 5HHMB 1A65A 4IHOA 3EGXB 2EKSA 4X8XA 2Y6TE 4H0GA 3RLSA 1E4XL 2XWBA 3H9HB 1T6WA 2FUQA 3ZQ9A 5INCA 1TCMA 2ZKXA 4WV1A 1CJYA 5EFIA 3ZUCA 2FYYA 4HGWA 2GBAA 1L7TH 1HH6B 1URZA 4K3GA 1S7QA 2Q7AA 3VFPB 1GZHA 1T1XB 1QLEH 4OCYH 4AKPA 2AV7B 4N2IA 4QRPB 3A0OA 1ERNA 3BD4A 3BWSA 3X3FH 3IVKA 3GSWA 3LZFL 1HAWA 2VIRA 3TJEL 4Q8BA 5C0GB 4ZD3H 5DZOA 4OCLC 4WAFA 4EVNB 5BQ7A 1ADQH 1B0GA 4OFKA 4X80L 2QPSA 2OTPA 2F19L 1H3XA 1T5WB 3NIDE 1F90H 4MDJA 4FOMA 1HH9B 3BUPA 1UWXH 2ZAGA 4I48B 4G7SB 2E8ZA 4WI2A 2X0UA 1T22B 2P28B 5FYJD 4WFGE 4XN4A 4WSKA 3G5VA 4LSQL 2HFGH 3M45A 3F7YB 1U8MA 1DN0B 4F3FA 4NO0D 3PXHA 4CU7A 5L88L 1UCTA 1MZZA 3ZBMA 3ULUL 3DGDA 3MOBL 4MYWB 4Z3EA 1XMWA 3BWAB 2ZG3A 5C0BB 2WOYA 4QXTB 3K6DA 4LIQE 3MJ7B 4UTAL 4ELKB 2A77L 2H3XC 1E5UI 4W4OA 2X4RA 1JZ2A 4XC3L 4N0UA 1SJEB 5EULV 4ACTA 3HG1E 3C08L 3EHBD 5CEYB 1JFHA 4MVBD 4JFSA