2Y7LA

Structure of n-terminal domain of candida albicans als9-2 in complex with human fibrinogen gamma peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
312
Chain Sequence
RKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKNSEADSDGDVIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
publication title Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
total genus 76
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA02
4JDZB 5CFAA 2Z1PA 2YLHA 3IS1X 4JDZA 3AU0A 4JE0A 1N67A 4B5ZA 3IS0X 2Y7OA 2F68X 2Y7MA 2Y7NA 1R17A 3AT0A 4LEEA 5CF3A 4LE8A 3ASWA 2Y7LA 4F24A 4F27A 4LEBA 3IRZA 4MBOA 4F1ZA 2F6AA 3V10A 5IHWA 4MBRA 4F20A 1R19A 2VR3A 2RALA 4B60A 3IRPX
chains in the Genus database with same CATH superfamily
4HBCL 1U8NA 4U3CA 4AMKH 5C2BH 4L0YA 1I1YB 5JQIB 2QDWA 2P4AB 3OC5A 1UZ8A 3EJSA 3HTLX 3QNZA 1OANA 5JHLA 1GJWA 4NXKA 4OUUB 2V4LA 3TNNB 4I48A 3W82A 1MCEA 5GGSB 4HJ1A 4AV4A 5FKAB 3TM6A 2Y7SA 4PJEA 2CUIA 2W65A 3SIKA 3VXRE 2CIIA 4N2AA 2DQJH 1WCBA 3L3IB 2A99A 1RQ5A 2GY7B 3JV0A 3LX9A 4IKIA 4WY7H 3WNJA 4OZGE 4NN6B 1HKLH 3S3DB 1AGCA 4F7EA 2I25N 4G1EB 4DO4A 5F1IB 1TO4A 2AEPL 4O2FB 1F56A 4Z3GA 4P5MB 5DUMH 4HS3A 1R5IB 5C0BE 5GIRA 1KEMH 3RPKA 3ETSA 3Q8AA 2R2EA 1GS6X 2B77A 1Y18A 3RGBA 4OZIB 1M7IA 4JFVA 4JRYE 2RA1A 2ROYA 4AUJA 4DW2L 3HG1D 4YHKL 1M7UA 3CFBB 5IHZA 2AEIT 2PYEA 5IHUH 4ANUA 3C5ZA 1AIFB 4M7KH 4CVUA 2I24N 3VI4E 3D39E 3MLVH 4NENB 3UZVB 2XV3A 4H88L 1GC1L 2XFXA 4PG2C 1JV5A 3B5TA 4G5ZL 2WZ0A 5KVMC 5TD4A 1NLBH 3D87B 4YDKL 5A16B 1DVSA 2G60L 2XIDA 4NHUB 2JJUA 2FLRT 1AZZC 2BOCA 3MOAH 1BXXA 4P2CG 5EBGA 4W9IC 1UQSB 4Y5XC 2KHAA 2C1PA 3V52H 2E9BA 3ZDXF 2ZP9A 2XTJD 4HPYL 3BPOB 1KBWA 1AKJD 2W38A 4G6KH 3OD3A 4OGYH 4AIXA 1JYWA 3MOQA 3WD5H 3ZT5A 2AXGB 3DIFA 2V8LA 1PG7H 4K3JH 4NDMB 1IM3D 3RAJL 1BVLB 3MNDA 4FF9A 3HC0B 4ABUA 1NCDH 2DMKA 2Q3AA 3G08B 4IOIB 3P4MB 4R4ND 3EYVB 2X9WA 3ARXA 4IBVA 1MHHB 1PQZA 2QMKA 2K9FB 4DGYH 3FUIA 4LQFL 3BRDA 1A7OH 5FPIA 1QBML 3VXUE 2PP9A 2CCLA 1QI3A 2CO6B 5E8NB 5HVFB 1BIIA 4RGOL 3WFCL 2CPCA 4LPXA 4TNGA 3ULVH 4CKQA 3N44B 4RH4A 3L7EB 2K4WA 1IC7L 1P84J 3ECBB 3F6LA 2QEJA 4M3JA 4DKFL 1YEJH 1JF1B 4L8BB 2JB5L 2RH0A 4BWUA 2ZYRA 3EAKA 4KXCA 3TVMB 1ML0A 5D7LD 3WSQH 4Z7QB 1HSBB 1G94A 4G42A 4MNGA 2A3TA 5FM5M 5BRQA 4HAFA 3QUZC 1A1NA 4R3SA 2W9LA 1NMAL 2QPDB 4KJWC 4GBXC 4DK5A 1XGYL 2GJZA 3ATAA 4MX7B 5KJ4A 2CO7B 1TKWA 4GKLA 2GTZA 2IOOA 4QKXB 3CAFA 5E8EA 2FX8L 2YD9A 1RZKL 1T3FB 1VGEH 2V9UA 1HWWA 1I7TA 4MGXA 4ENED 1AS6A 3BZ4B 3PP4H 4LFHG 5FHBL 5E9AA 2FYYA 4ZMPA 4UTBA 3ZYJA 4BFKA 1AANA 2TAAA 5C0JB 2DQHH 1HL8A 3D51A 5CLTA 3O41A 5DWUL 4ALAC 3HPLA 2ERJB 3BD3A 1HDMB 3KPMA 5HPMB 1KZQA 3O8XC 4YAQB 5EORH 3ZN6A 5C0DB 1SMOA 1PX3A 3N9GH 1J87A 2ADFL 4NUJB 3MRDB 2UV3A 1BXVA 2B20A 3MUGA 5DLML 1SYSB 4X9FA 3OX8B 3SCMA 2LLNA 1AR1D 2UXFA 3KGUA 4X6BA 1TJHL 1RP8A 1IL1B 1MQKH 2IAMA 4P0DA 2E0PA 5DMIL 5IVXA 3MLYL 4IDJH 1I3GL 3GIVB 3FPXA 4NPYA 1ZOXA 3GSOA 2DIAA 2FE0A 2HTLC 3BVTA 3KG5A 3MRBB 1GCFA 3CDGA 3VDCA 4JO2L 2R1YB 4D0BA 2VXUH 4P23D 4PJCF 3JWDL 2D8KA 4H1LG 4DGIL 3VXSB 2H26B 3QIUB 3U0TA 3HI1B 3LEXB 3VSTA 2AGJH 4LDOB 4DP7X 2AXFA 1KG0A 3EH2A 1YMMD 2RTTA 1ZS2A 4KI5C 5EF1A 2A7BA 1ZTXL 3CU7A 4D8PB 4F80A 3LZOA 5KEZA 5A6IA 5HSFA 4HCIA 2VITB 3ZTEA 3MU3A 5C0BA 3D07A 4GG6F 2VLLA 5HY9B 4ABVA 4JO4L 4HKZB 4UT9H 1B0GA 3N06B 1MCPH 5AKSA 1LDPH 2FUTA 3D9AL 2F7OA 1WTLA 4KJQC 1C1EL 1MF2H 3T0VA 4YUEH 3EH5B 3EYFB 4OI9A 1ETB1 3D39A 4L3CA 3MLZL 4BQ8A 1GJIA 3FFOA 1U92B 2O6PA 3QP3A 2PCXA 2WIMA 4IU3B 3VH8G 3QR1A 2XV2A 1CVSC 4PJBF 3RZCA 4QOKD 2O6CA 5I6XB 3QFJE 4A6YA 5BXFA 4P5TB 1O6SB 3MA7B 2DL9A 4YDZA 2Q76B 3FQXA 3PWVB 4MDIA 3JWNG 1KCVH 2J2ZB 5MENA 5D96B 1B4RA 2PTTA 3WKQA 4DUWA 4Q9CA 3QWOA 4ZMNA 5INDB 1IAMA 2AMUA 4N2CA 3IDYC 4KUZL 4QRAA 4KTEL 3PABA 1UKSA 2BY1A 2I9TB 1U95B 3HZYA 4J12A 4K71C 1BOYA 4RMTA 1C08B 1MI5D 3ISRA 4LGRB 1UWEH 3ARSA 4QXUH 1XBDA 4ZS7H 4AEHL 1F11A 5CN3A 1E4XH 1L9SA 4S0HA 3W2DH 1M9SA 1JI2A 4FGMA 3MACH 4WFHE 1AR2A 1CBVH 5LDSA 3ME0A 5D70L 1LP9B 5EBLB 1QYGH 1YN7B 2ED6A 4KNTA 1AD9A 2EIKB 3TFKD 4GSUA 1B0IA 4X6CF 1UB6B 3VXMD 2NLJB 4S1QL 3HMXH 3P2BA 4QXWA 5EO1A 3CE1A 3DX6B 5I8KL 4YNYA 1F90L 1O9WA 4GAJL 4Z7UB 5DEFB 1IAIM 3V6BR 3ZY7A 3KBHE 1AJ7L 3BWAA 3DPDA 2YA2A 4HLJA 4ZW8A 4FA6A 1E9PB 3V0VA 5KSAA 3KJ6H 1P7QD 1IZJA 1T7YA 1S7RB 4EN3A 4CJ1A 5HYSB 1H6TA 1FZKB 4JY6B 3GEWB 2DQIL 5KS9B 1U8PB 1EO5A 3HI6H 4MDJB 4OCLC 5IZ7A 5KBNC 4OZFB 3RWFB 5FCSH 4YHPB 2B4CL 4JPVH 3QC5X 4A1RA 1SJXA 2PXYD 3B2UD 5DHEA 4NIYE 5K39B 5TDPA 1EH9A 2LFGA 1J8HB 1SM3H 2D3VA 5D9SA 4XR8C 1UA3A 4ZX5A 1P4BL 3UTSD 2O61A 4P4RB 3PQYE 1FO0H 1BCIA 2OMNA 4P9MH 1OSPH 2EDTA 1N10A 1RJYA 1GZQA 2V3FA 4KV5F 4X9GA 3ROOA 3TPUA 3ZE1E 3EKCA 1DL7L 5C0RH 1OLLA 3GPSA 4JQIL 4JB9H 4QJ3B 5CD3B 4JGUA 1I9RL 3BW9A 3IDMA 1I4FB 2D3NA 5DJAB 1NGPH 3IGLA 4RFNC 2AEWA 1L3NA 4XH2A 5LXGH 3SYQA 1OM3L 4G8GA 3WJJA 1JGUL 1P7KA 2EEXA 4M1DH 4KOCA 1GC1C 4QRSB 4A67A 4GFXA 4OGQC 3TBWA 1LJMA 4POZC 5GQBA 1MDTA 1WTGT 1H9VA 2EH7H 4QCIA 3QXAB 5BV7B 3PHOA 4YLBA 5MEOB 4Z7NF 5FO8B 3ET9F 5DJYB 1IVTA 4B9JA 1B2YA 4MXVF 5F9DC 1JN6B 3JBG7 43CAA 4JZNB 2EYRB 5JUEL 2XZAL 4N8PA 2WWKT 1SEQH 2AJVL 4RNRB 1TJGL 1KT2B 4DTGL 3GI9L 1T7XA 2LE9A 4HFWB 3U0WH 1IKFL 2FGWL 4G82A 4K3EH 4CADB 1EPFA 1K85A 1PGRB 1V10A 3KWXA 4JE0A 4ZTOH 1ROCA 3MUY1 2FJUB 1LO5A 4PJFA 1TO5A 4PLKD 4A68A 3AXIA 4JFDB 3N0AA 5AAMA 3PWLB 3GHPA 3DI3B 4ZOAA 4JANB 2YUXA 1SXNA 1IAII 2H1PL 2WSKA 3H85A 5CEXB 5EF0A 4DZ8B 1S5HB 1D9KD 2CPUA 4ODVL 4Z7VB 2EDNA 1NEZG 5H2BB 1MAJA 3PXJA 3T2NL 4AIEA 4NQED 1EIBA 2FL5A 4HKBB 5HYIA 2VLKA 4F57H 2VNCA 5CKAA 4JRWA 2J8UA 5FB8B 1OP5H 1HZLA 1UJ3B 3BKCH 2J21A 1YUKB 2F68X 4NQVA 3FRPB 1ZEAH 3BPOC 2YC1B 1H3PH 1TQTA 2B16A 5J5EA 4P2QB 4M4PA 1A8JH 3KR3H 4M7ZB 1PY0A 4L1HA 1FL3A 4A7QA 3C2AH 3BH9A 3HZMB 4FZ8H 3ZDWA 1A3QA 3PJNA 1PKQB 1HCZA 2PR4L 4YDLB 2WUBH 4HOZA 2X87A 5KVFE 2EYSB 2AJZB 3GMLB 3IJEA 2DI7A 4N0CD 4GS7C 2CO3A 4QI3A 5I74B 5IJKA 3RB7A 4PJ8A 3ZZ1A 4HZ1A 1YECL 1P4LA 4YO0B 1FZJA 5BUPA 4KAQL 5ENWA 3QHFH 4RMSA 5KSVB 5JNYA 1KYDA 4U6XB 4I0PA 3HC3L 5DD0L 1IGFL 4FXKB 4HUWB 5CJXA 3TCLB 1Z5HA 4NZDA 4JRXB 3O9WC 1FGVH 3V0DA 2WQXA 2BO0A 5BRZD 1EFQA 1N2RB 4Q0XL 5LAXA 4HSQA 1NGYB 4NM4L 5L7XH 3S4SG 2R1WB 1QHQA 2WNXA 1HHHB 4OLVH 5DJ8A 4W6XB 2GAZA 4HX1B 1G9HA 3FAWA 2Z31B 3AZUA 3TEUA 5GRWA 3WXVL 5BZWA 1D2PA 2EDRA 1UWYA 2DQFA 1CUOA 5AENA 2PO6B 1EK3A 2WV3A 5AUMA 5CGYC 5GSVB 1BMZA 1HEJC 3G6DL 3PQYA 4NZFA 5SWSB 2M83A 3K46A 4KK8C 3LZQA 3ZBMA 2WXHA 1U8MB 3RIKA 4ATTA 4URKA 1ID2A 4R7NA 2JELL 3QARA 1G4RA 3SBRA 1B9ZA 4OD1H 2YSTA 3GMQA 2AVGA 1MIEL 3KWUA 5F6IB 2ERJC 2RFXA 4WHTA 3WNOA 2ZKHH 4NAMA 1I7RB 3BZFB 2Y22A 4MCZB 1A4CA 4HCRL 4G8FA 5KSBA 1SZNA 5INCA 4QDGA 5TTRA 3CNKA 1I7UA 3DX0A 4FD0A 4X83A 1E5AA 4D0CB 3WL9B 4WUKL 2WW8A 4EZLA 2Y1AA 1OP4A 3DUHA 4OZHE 3WS3A 4PREA 1OF2A 4OT1L 4PM1A 5F96L 1KGXA 4U6YA 5H35B 1J0KA 1WS8A 4YHKH 3LEVH 2X89D 2B59B 1KIQA 1MCSA 3QIUC 4JNXA 2YJLA 3EOAA 3HHSA 3JYBA 5DHVA 4L4TA 1ND0B 1NAML 4YPGB 2AANA 2ZKWA 2CBTA 4G5ZH 4MCYB 1F4AA 1X7QA 4K5MA 5DS8A 5F6HI 3LRHA 2G60H 4JCLA 1KCSL 2C7UA 3LXUX 3PWJB 1WBYA 1I85A 1RH8A 2VXQL 4NJ9L 1J9RA 3C6EA 5HI3C 2BDNL 2EJ1A 4PJ7F 1FC1A 5I16A 4FCHA 4M02A 2NT0A 1D5XB 3GKZA 5IM7B 5DZLA 2A73B 2AV1B 4OFIA 1I7ZB 1YMHA 1DVTA 3NPSB 2WLKA 3CZUB 3RAJH 1KTJA 5GGRA 1BBJB 1WD9A 2W9EH 3VD7A 1AGFB 1SEBA 1I1AB 1IGYA 2K1MA 5C0AD 2CO2A 5F8QC 5IESL 4K9EL 3BJ91 4L37A 5I6XC 1GKEA 2WSPA 2XN9A 4S11A 5EO9B 4P5TC 3T08A 5FS5A 1C7TA 2IBBA 3D2UD 3EFFB 4GBXD 3OXSA 4C54A 4ELMB 1EHAA 4P3DA 2E5EA 1GY1A 4RGOH 4U7MA 1W72B 1N0XH 1IC7H 5D96C 1ZWIA 5I0VA 2ZXAA 4M3HA 2Y72A 2B9BA 1IC0A 1AP2A 1OW0A 3N41F 4PIRF 4PYHA 3T3PE 2JB5H 3ZRFC 4X6FB 3TPKA 1TJMA 2YHGA 1OP5K 2W95A 4AGPA 3ARDB 3ARPA 2FBRA 2EE6A 1KF9B 2B4CC 4CC4A 2XN0A 1VFAA 5ESQB 5F0LB 1GW0A 3VB8A 4N2IA 4NKIL 3GT6A 2KLTA 2XZZA 5DLLA 3ATDA 2DD8L 1ORSA 3O8XD 1MKFA 1JPGB 1ILUA 1GMIA 3Q01A 4ZZFA 3OAUH 3NCCB 3F6JA 3V0IA 1NC4B 4AJ0A 1ZHLA 3JV5A 3WUWB 2VDPB 3N40P 1XEDA 2G3ZA 4PS7A 2ZTBA 3MV9D 3QORA 1NLDL 4J27A 2HTLD 2X6BA 5DRXB 1JUFB 1UYWL 2B5IB 5CZRA 3KPRE 2B08A 3HBGA 3OHXA 1YN6B 4K15A 1JFHA 3L4VA 4U31A 3T1WA 2D3JA 2DKUA 3CFMA 4X98B 3SQRA 3WY2A 5JIIA 2ADFH 3MRKA 3CFQA 1OTSC 5AL0A 1RL1A 1QEWB 4QRUA 2Y5QA 3TNMB 3U4EA 1MFNA 2KC0A 2VDOH 2CRMA 4CN1A 1U8KA 1UA7A 4QRPA 1NGZB 1I3GH 1T0PB 1HH9A 3KLAA 3OVUB 3BFOA 1E5ZA 4WNSA 2CGRL 4Z78B 12E8L 2UY6A 2ZUQC 3DHPA 2ZF8A 3ASWA 1KTRL 2HJFB 3CVHL 3QIWA 3Q1EA 2HKFL 4JO2H 3IWUA 2X4OA 3CSYA 4DCQB 5HGBA 2O4EA 3JWDH 2J5WA 1HCFX 5DJ0B 2XKNB 1MG3C 1DJYA 3BUPA 4KJQD 3RIFK 2W0KA 1WQVT 2F7IA 2FHBA 5C08A 3ULUE 1EXGA 2B9AA 4A39A 1SLUA 2Q2LA 3KYKL 1ZTXH 3CFJA 3DROA 2BY2A 2W07B 4GRWH 5F7BA 1HH6B 3QQ4A 1X5AA 2L7UA 3NG5A 1AXSA 1S7TB 4C57C 2LU7A 2E3VA 3NDYE 4JN2A 4JO4H 2PNDA 4MJ5A 4OZHA 1EEYB 2D7TL 4DJMA 1LO4H 2R0LL 4CA4A 3BT2H 1FL6A 3IVKA 4TRPH 3S5YA 1CFBA 5KBPA 2DWEB 1J8RA 2WXIA 4JO3L 1ZMYA 4Z9KB 3HE7A 1VFBA 2NYKA 4E68A 2ZOWA 1UXLA 4CGUB 3BVWA 2QFRA 3QZBA 3B9KB 2P44B 3MLZH 2X09A 3G5XB 5EFIB 4C56B 5EUOF 3X11A 1IIIA 3WMSA 4EZKA 5IG7B 4UM8B 5C0CD 5L88L 3V6ZB 4N0FB 5H94A 4F8QA 4Y2DC 3N1QC 5E23A 1CGUA 2OMXB 1WE5A 3GSQB 2BHUA 4FN0A 4H0IA 5AB9A 1FCCA 1YYMH 3TA3D 1KLUA 3EO0A 5E8DH 4TV3A 3DUSA 5TH2A 4H0LC 4KUZH 4JLRB 1MCJA 3RWEA 4JHAH 4KTEH 2VO8A 1L6XA 5D7HA 2VLJE 4TXVB 2N1KA 3I6LE 1D5ZA 4MAYA 2W5PA 3FUNA 3LTVA 5F3BB 1UH3A 3GKWH 4A7TA 4MS6A 4AEHH 5J1AA 2FATL 3ZOAA 3PU7A 2KQMA 3HZKB 1SPDA 2BRRL 4P5RA 4MKTA 5E94A 4X5QA 3NRFA 3DVFA 3ABGA 3EJJX 3NFNA 3NP3A 3UO1L 1GGBH 1MJ8L 5TF0A 4Q2ZB 3ATBA 5D70H 1A1MB 1XV8A 2X70A 3QXWA 4JJ5B 4S1QH 1W8EA 4QRBA 3HJ0A 5CNHA 5B38G 1NIEA 1DFBH 2DMGA 2XXGA 4IRSA 5DYOB 4M7ZC 1GH7A 3O4LD 1KY7A 4ZUUB 5CP3A 1NCTA 4ZSOB 5D8JL 4XNZB 1XF1A 1EXUA 5GGUA 2ZAIA 4BIKA 2EDKA 4YDLC 3SDCB 3IPFA 2W0FB 2EDWA 5FYKE 1NCAL 4YIQA 3EJYC 4WNJA 5I74C 2DQIH 5AAPA 1E7UA 4HGWA 5D7JD 2R0WH 3IFLH 1R6VA 1G7HB 1UENA 2FT8A 4WEBL 4QHNA 1DCLA 4I13B 1VZHA 3NIFE 4G1MB 1X3DA 7FABL 4LNRB 4HZLA 3FUHA 3RWDB 1BBDL 4FXKC 2FJFB 5DHDA 5T3XD 3RDJA 3WGVB 4K3DL 3NCYP 5HGDA 3KPRA 3CFCL 1S9WA 4UILH 1CGTA 4GNKB 1CFSB 3R0NA 4PJHB 4Z8FL 4X0KA 1DL7H 1E0OB 1MHEA 2EIEA 1OPOA 4POZD 3VQLA 3MRHA 1U0QA 1CYXA 1OHZA 4RETB 1OTUC 1GYAA 2HZHA 1ZLDA 3M7FB 3MUUA 2NX5E 2IBZY 3MDJA 1I9RH 4E0RB 2HKAA 1VF5C 3NJKA 3BE1L 5GZND 1KTDA 2Z31C 1H3VA 2OTPA 3RVTC 2NXZB 3L95A 4GKZB 3SE6A 3BHBA 4K5LA 3EO1A 3V0WL 2PO6C 1OM3H 4N5UA 3L81A 1BQHG 1T5WB 1BFSA 2FJSA 5JOPE 4L1DA 4BZ2H 3B9AA 1OCWL 5IF0B 3QHZL 1MXDA 3IFPB 4OM0L 1P5UB 2YA0A 4YXKL 4U4BA 1O6TA 3L5JA 2GCYA 4ZX4A 1NGXB 1ACZA 2PF6A 2AXJA 2P24B 4F1ZA 4P5KA 5F6IC 1DN2A 4LDLB 3S34H 1LM8V 5F8RC 3S36X 3I2CL 4XNAA 4MFHA 4UTBH 2P26A 2VJXA 3JSSA 5CLZA 2EEAA 2SEBA 1OB0A 1UC6A 3VFGL 4JFTA 3CXHK 2XZAH 3F7KA 4LLQB 2O5ZL 4KI5F 3V6OC 1G6RB 4DZBA 2DQ6A 2IPTL 3FH8A 2XKUA 5E8OB 4DTGH 3GI9H 1TJXA 3QRGH 1IKFH 5IMLA 2FGWH 3W56A 3LKOA 2X3CA 3CX2A 3U7YH 3L3KA 2WIIB 3VFNA 1ADWA 5J6GB 3U0PA 3VFVB 4E9YA 3UTTE 3KGRA 1AACA 4U0RB 4FNTA 3BUIA 5C7XL 2NW3B 4WEEA 5DJDB 1R3KA 2H1PH 1T03H 4DOHE 4MQSB 1AQKH 1OAKL 1YZZA 1EX0A 1DQKA 4ODVH 1YEKL 3E3QC 1T1XA 4DP1X 1RLWA 1IC4L 1WGVA 3VFOB 2VDQL 4ABQA 2UVEA 2ZUUA 5T1DH 4RA0C 3TO4B 2NY3D 3T2NH 4M29A 3I9PA 2PWDA 4CC1A 3G7TA 4Y5VB 2BSDA 5E6IA 2FBOJ 1WVZA 4PVNA 3TBCA 1MFAL 1D2OA 5DJXA 1VZGA 2VSCA 3S8WA 2R83A 2BIPA 5TE7L 1CFTB 4IJTA 5I8OL 1C12B 1SLXA 4R7DB 5CLXA 5BUAA 2FUQA 3ZVVA 2R9HC 4AEFA 4RRPA 3A22A 4JGMA 3FUDA 1KBPA 3NPSC 4P04A 1VRSA 3WHXB 2PR4H 4X8JB 4IW4C 3TVMD 3L16A 1HJCA 4PWHA 2R29A 3H54A 3SY0A 3WFEL 3ZL1A 1LDSA 2ICCA 1G7LB 4FG6C 5D1QC 2UY7A 3UG3A 5SWQB 3OKEA 4Z7WE 1ZVSA 1NJ9B 2YGPA 1YECH 2KQNA 3KE0A 4N0UE 3QUXC 4GXFA 4HWEH 1LEIB 3INOA 5AKVA 3VGAC 3LH2L 1GOFA 5I26A 5CSZA 3ML9A 3GS4A 1G1YA 4RVBA 1CYWA 1LLAA 4FKHA 4R4BA 4XMUA 5KYNA 4HBQA 3RGVA 5KYYA 3OAYH 2X4NB 5CGYD 1CQYA 3DTXA 4HS8L 3C5SB 4J4PD 4R0LA 2CCVA 2F54E 2K3HA 3D85B 3FB7A 1XZ0B 1HILB 4XX1E 5D2LE 4QRQB 5BZDB 5EBWB 5CD5D 5GJSL 3OV6A 3MJ9A 2YA1A 4G7QB 2YQGA 4CVXB 4PIBA 2ZOOA 3FQTA 4OZ4A 2V3EA 1JPFB 1IMHC 1MUJB 3D18A 1YA5A 3V6FA 1W15A 3BP7B 1WK0A 4E9XA 3BGFC 1CLYH 2QSQA 2DM2A 2H6PA 3VFMA 4NN7B 4GLRH 5K9JL 3WTWA 1SQMA 5E4EC 5T5FA 3D6GA 1Q9KB 4CU8A 3RL1A 2XG5B 4CC0A 3E1ZA 1FNGB 4OF7A 4KNSA 4PJBA 1WWAX 4AM0B 3KNBB 4CAGA 2B5IC 4PJIE 1MIEH 2QTVA 3CMOL 2EKJA 2F53B 2NX5A 4N26A 2X6AA 2XN2A 3H55A 4N6RB 2GYSA 2BP5M 3LHPL 1N7ML 3VXSD 3QIUD 4HCRH 4EBQL 4UB0L 4A2DA 1RU9L 1HINL 5F21B 3BZEA 3AY4C 3HG1A 5A2JH 4BK5C 3V5HB 1M3JA 1OAZL 3QIBA 4EE2A 1V3KA 2VQTA 1S7VA 5JPNB 3V4PB 5KVEE 2V7HA 2NCMA 3NPZB 3ZIMA 2BMKA 2XUWA 5KG9B 3TIDA 4OT1H 2LAGB 1QFUL 2Z6FA 5F96H 4KZDL 3HG3A 2WP3O 4QHUB 5I1HL 2GJ6E 1KJ2L 3O2WH 2MOVA 3HA0A 5LO7A 4QO1A 5DUPL 2BC4B 5FLVA 5E1GA 4JE4B 3SBQA 1NAMH 1JHTA 2VR8A 4X6CA 4AKQA 1E2WA 4FYQA 2BVEA 4X2UA 3A3YB 3F05A 3GMPB 3P77B 4XVOA 5CBAA 2Z8SA 3FTZA 2WINB 4OAWA 1KPRB 1SYVB 5GISL 3BAIA 3CH8A 1K2DB 4QTIL 2VXQH 3IPEA 3NSCA 3TBVB 1FO0B 1G7PB 2HVBA 3HAEA 2BJML 3ZTNH 2BDNH 3H8NA 3L9EA 2N01B 3P02A 1E2ZA 3R1GL 4C58B 1PAMA 1JGVL 1G9NH 4OZIF 1IQWL 1U2CA 3VXPB 1RUAL 2BFGA 4LLUA 5FECB 2YD8A 3OG6B 3B9KC 3MRPB 2E56A 2A5UA 4WU5B 3PHAA 1NKGA 5FK9A 2EABA 3MRIB 4AYSA 1YNKH 3MV8E 4AJVA 2E59A 4IIQA 3PGDA 3LQAH 5J6SA 2NQCA 4K9EH 3QCVL 1SDYA 4U33A 3ULUL 3SJVA 5K9KA 3HBZA 3NCJH 1W16A 5ICZB 4OM1L 4IMKA 4Q74A 3GZOA 1SUHA 3EOBA 3GXIA 4NZTH 2K4AA 4XWGH 1A6ZA 2Y23A 15C8H 1R17A 3EJQA 1TCRA 3SGKC 3IU4L 1QRNB 3G5ZA 1NBVH 9PCYA 1VB9A 2A9CA 3PNWA 5CP7B 4KZEH 4B41A 2R2HA 1BZQK 2Y7QA 5AW1B 4ZFQA 2YXVA 2WLJA 1DE4A 3BVNA 2XKSA 2YD5A 4W81A 3LPGA 1DO5A 1MNUL 2PW2B 4Z7WA 4PJXB 1ETA1 5JR1L 3H7BB 4NKIH 4N8UA 2TRYA 3LRMA 3QB7C 2JCCB 5AKTA 3HG5A 2K8MA 4G7SB 3ZHDA 4UYPA 4PBVC 1BM3L 3DWTA 1W0YT 1WGOA 2UXGA 1FNLA 2YARA 4HYTB 3IN0A 4O51A 1JZ2A 2NYYC 1HCVA 4OBSA 3SGDI 1YYCA 1A5FH 2F54A 2NTSP 2ZUSA 5GRZA 3N44F 4TPRL 4U1JB 5D2LA 4TF4A 4H8WH 2B3RA 2JJTA 5GRXG 2X2IA 3UAFA 3QEQD 2IADA 3QI9C 4XNZC 3TYFA 4K7PH 4JG0L 3O6KL 3SDCC 4PRDB 1KB5A 4R7LA 3P54A 2OMVA 4XBEH 4LLMB 4Z7QF 1TZHA 4JY5L 5E1QA 5C0IA 3OLIA 2FHFA 3OAYK 4C8XA 4TQEL 5DEGA 1DQJA 3FQWA 1FIGH 4P23A 1VADB 1JPTL 5LG1A 2XBTA 4FTVB 4UV4L 1WWBX 4NQSA 2BCKB 4AT6B 1YMMA 3W9EA 5LN8A 3DIDA 3FU0A 3IWVA 3CVHH 2XWBA 3ARFB 4PJIA 2HKFH 2Z91A 3RP1A 2Z1PA 1BP3B 4QF1B 3IKKA 3L3GB 3SQOL 4YSQA 5I23A 4OF5A 4NWUL 3CVDA 2WYHA 2OM5A 3I6KA 5H37G 3KYKH 2GTQA 4N90E 3I3BA 2F1EA 1JDCA 5SX4I 1JZIA 4WK4B 4FL4B 4GSQA 4AQEB 5FYKL 1FZMA 2H1XA 3SKUD 1I3VA 3NRPA 1MEXH 1QFWL 3VFWB 4HIIB 3LZLA 4YSPA 4U6HA 1KTLB 1C5CL 5CFAA 4FDWA 1P5UC 4JO3H 4ZOCA 1HXKA 2DKSA 2VQ4A 3L48A 3V4VB 1TSHA 1RUKL 4FP8H 4ZQKB 3S96B 4TL4A 3RA7L 2ZYIA 4BGLA 4KK6D 2VISB 5ACMA 2GJ6A 4CGTA 5IB1B 4PW3A 1N8ZA 4K7FB 4W6WB 1LD9B 2ATAA 2GW5A 2HFFA 4HT1L 1QHPA 3SPIA 5E08H 1QSFE 1JRHH 2AQQA 5HPOA 1CGWA 5L88H 1WICA 4WHDA 3JTTA 4TM9A 5IB3A 3OKDA 1F42A 2MCMA 2VLRE 5HYFA 1QA9A 2F7RA 2YPLD 1P53A 4FQQA 1PKOA 3DSFH 3L7FA 3OKMB 4NAQA 4A7SA 3IU3B 4L48A 3OLDA 3VG0H 1JK8A 4U0RC 3NSDA 4A63A 3MV8A 2CDGA 3LEYH 5E8PB 4OLWH 2JVUA 4P2QD 2YUZA 3B3IA 5I9QB 1FCGA 4LOVA 3TV3L 1J9SA 3UBGA 3VXMA 4AZ8A 4DO6A 3TO4C 3Q5YA 2OBGA 3QJFA 4P06A 4Y5VC 4J6IA 3OKOB 2YAOA 1XT5A 2NW2A 3L3DB 5ICXB 2GSGA 3P9MB 1M1SA 1M2VB 4WHYH 4CVZB 5B4MC 4KK9C 1P7QA 1MFCH 1PCSA 3DJRA 1FBIH 5BZZA 4KK5C 2NY5L 3ALWA 2X12A 1FYHB 3DRTA 1B6UA 2PWFA 4Z1PA 4QWWD 1AGDA 3FAXA 1CG9B 2AK4B 2WVVA 1WIPA 2OTUB 3D3VB 5K1NA 2W88A 1BVKA 4Y2OA 4WO4D 3MNZA 5IEHA 2YD4A 3MLSL 3ZMRA 1TF4A 3LV3B 2XG4A 1ETZB 1NCAH 5JTWA 5CAYB 3VM7A 4KKLC 5GGTA 3UTSA 4H8UA 3FQYA 4NB7A 3WNMA 3RIAK 4JFEB 2P5WB 3NIDE 2L8AA 1UM6L 4PRPE 3TCXA 3MJ7B 4Q8BA 4WWKB 2JKRM 3HC2A 4YE4L 1CF8L 2Z31D 4UZGA 1LP9F 5DK0A 2ZG2A 3RVTD 1LEKB 1TT6A 3UBXG 1BBDH 3UGEA 4Z76A 3G6AA 3FFDB 2PO6D 2ZNXA 4K3DH 3NCWA 3FH7A 5FA4A 2BVYA 3CFCH 3D33A 4D0DA 4GIPD 4RMBA 5SWSD 2NY2B 2AJYL 4Z7UF 4AK1A 2OJEA 2OMWA 2P7TA 2DW5A 3FCBA 1BVNT 3FH5A 1NWPA 1UZGA 4IRJA 1G7JA 2GI0A 5BQ7B 4CRPA 3GSXA 1KBGH 2P8PB 4QRTB 3WG7B 1F8TL 1KXHA 3FQUA 5B39G 4GIOA 3US0A 5KVFH 5KS9F 4ZXBA 2CR6A 3RGHA 2APSA 1O75A 4RGNE 4K94L 3O6ML 4AG4L 3E6HB 3VRJA 1N6QL 1OCWH 2CM5A 3QHZH 4LCWB 3G5YA 1TZAA 3W9DB 1Q90A 4ZODA 3CCHB 4G80A 4ZUVA 3KYOA 4H8PA 2C9AA 3UEZA 1J5IA 1ZHNA 4LIQE 3X13A 1U2YA 1EZSA 2G0KA 5DC0A 4R97C 5IMMA 3T65A 3FQ1A 1P6FA 4FULA 1XF2B 1YEFL 1PU0A 3IMSA 2ZXQA 4LSVL 2X3BA 4QPEA 1PCXA 4I3SL 5AYUH 2H7WA 5JXAH 3HZVB 4APQA 3HE6A 5CHNB 3GFUA 3C60B 5JPNC 1QPKA 1D9KA 2OX5A 3AU1B 1CD1B 3RPIA 4J8QA 3H56A 2WOBA 3BQUB 4NQEA 1I9JH 5G55A 5KYXA 4F2MB 2ADIB 2CNZA 1IBFA 4NBXB 2X4SB 3LXBA 3LJ3A 4GKOA 2IWKA 3F12A 2DQDH 3ZT7A 5C7XH 1ZGLM 4PJGE 3MKGA 2A9AA 4GW1A 3I50L 4OQ1A 2EDOA 3MNVB 2GHWB 3DX2A 1CTOA 3CZJA 1KPUB 4HIPA 1XH2A 4HIEA 2F5AH 2VDOB 4NKDB 5EU6D 1YC8A 2VLRA 1KCRL 4I1PA 3FW6A 3RILA 3DOSA 2B8OT 4PD4K 1JNHA 2XPGA 3QUHA 1I1AD 1CICB 1L5GB 4FG6D 3P69A 4YXLL 3EYUH 2XBZA 4RQQA 3AREA 1ZK5A 3KM2A 5JOFA 3WTVA 1OQXA 5KVEL 1B2WH 1YY8B 3TEYA 2HRHA 2X9XA 4I2XE 4DEUA 5GRUL 3K3QA 3FULA 1QO3B 4GRWB 4HIJA 4JFHD 5C71A 3KPQB 2Q6WA 3NYKA 5G4OA 3OKLB 4FQLL 5FKPB 3IETA 4YS4A 1U3HB 4QTHB 3WFEH 2KH2B 5IW3A 4Z7VF 3QULB 3ARDD 5AOZA 3N43B 1QZNA 4PJDE 2I26N 2SODB 3CFEB 1U8NB 1XWVA 1ZDQA 3AJ7A 3MRFB 3LH2H 4X8XA 1D6EA 1IBZA 5DF0A 2DTML 1YSOA 3K4ZA 1UZ8B 4MWFA 1TZOA 5TE6L 2A74A 3CHRA 3QNZB 4TNFA 3CD4A 4HS8H 1NDMA 4I48B 3AG3B 2MKLC 5T1JA 2OLDA 2XTSA 2BZDA 4PJEB 3ESOA 1E8XA 5D5ME 5I2IB 2BWDA 2BNRE 2CIIB 1I8UA 4PGDA 1LNUA 4PRPA 1JPSL 2IGFL 5LGYA 4ZMLA 1AGCB 3ELQA 3CLEH 4F7EB 3NEXA 2DZEA 2YZ8A 4KDTC 3NJMA 2GBAA 3MUZ1 5CJBA 4AYGA 3UTOA 3PY9A 3B7SA 3RI5K 4PCTA 5K9JH 5GIRB 5EUOA 1J1PH 1B3JA 1KYFA 2B2XL 3AUVA 1F6AB 1A64A 2R2EB 4JFQA 1NFDE 2Z8WC 3WFDL 1PS3A 2AAVA 3SD2A 3UGXA 1LHZA 1DQDL 1EEUA 1IEAA 5D7EA 4EVNB 3RJDA 5JQ6L 1J5CA 2ICES 1OTTC 2X4UA 3B7RL 5IHZB 5I0DA 4OF3A 3RWGA 4O02L 3PE9A 2PYEB 5EIIG 3QO0A 3LHPH 1N7MH 3C5ZB 5DC4B 4JFXB 4EBQH 4F37F 4N8VA 5JHLL 4UB0H 4ZMTA 5D55A 1TFHA 4XO5A 4JK0D 2QVMA 4L3FA 1JV5B 3LRLA 4UQAA 3E8VA 2X89A 3JV6A 1OAZH 3GSNA 4NNPL 5EOCJ 4M03A 3CMGA 1MFEL 3O45B 2BOCB 5KTEL 1UM5H 1IVLA 3FTSA 3L3OB 2FB4H 3QCTH 3ARFC 2C1PB 2CM6A 2GQHA 2HVKA 2WC7A 2J8OA 3D4GA 1GOHA 3CFDA 4GP8B 1XXDC 2CKBL 2EE2A 2OTWA 4JL1A 4DP6X 1VFOA 2V6HA 2J44A 2UZXA 1KJ2H 5FCUL 1AQMA 3IMTA 3DIFB 5DUPH 5CXPA 2R69A 3LH9A 4YHMH 2VDNL 4C56D 2Z92A 1UXSB 3QDME 1DHKA 2EICA 1H6FA 2JKWA 5DGQA 4XNDA 1YEDB 2XFGB 3LZNA 5LUMA 1PQZB 2RQ8A 1MHPH 3K5RA 2Q5BA 2NSMA 2BIOA 4LRIA 2XA8H 4AL8L 1BIIB 1GL4B 1M4KA 3OGOE 2B14A 4PW4A 1DVFC 5C0AA 2Z0UA 1PSKH 3UMNA 5K59F 2P28B 1IQWH 2PW1A 4WI7A 1RUAH 3PV7A 1A9EB 3RX9A 3TBTA 3KXFE 1MRDL 3D2UA 3MGOB 4G6AC 4GBXA 4UZSA 1FPTL 3P0VL 4M9OA 3N55A 4AKOA 1F4HA 1T7WA 4G42B 2BP3A 3DARA 4MNGB 4HWUA 1X5JA 2IWEA 3QCVH 4POUB 3WXWH 4D3CL 1A1NB 4R3SB 3ULUH 3HLKA 4ZDHA 2J8HA 4W9KC 3J07A 4MHHI 2A4CA 4OM1H 4AMWA 4TQIA 4JQXA 3C5JA 4MJHA 5GRYA 5IWLA 2QELA 2VWEC 2GTZB 4QXVA 5E8EB 2QT6A 3D0LA 4HK3N 3CZFA 5F1OB 1I7TB 3Q6FA 3QXUA 5CJQL 1R9FA 4QXTA 4UYQA 1QFPA 2WYZA 5HHVL 2WXOA 2IPUK 1JZEA 5BVPL 1JV2A 2FYYB 2NYYD 3B56A 3O8XA 2Y3NA 1OAQL 4AK2A 1RK7A 1JDAA 4WVRA 1HS6A 2V8MA 4MS8C 4W4NA 5I9QC 3FC8A 1BAFH 5CZVL 5I6PA 1NL0L 4ZO9A 3Q1SL 3HPLB 2OL3A 4PJDA 3KPMB 4MB4A 3KPPB 2H0PA 4NRYA 3SDCD 3STBA 1ZV5A 1QLFA 5IFJA 3C08L 3SCMB 4X6BB 3H9HB 4U6VL 2WN2A 2IAMB 5D2NE 2DF3A 4ELMF 4NPYB 1YJDL 3WCYA 2YUVA 3GSOB 2A6IA 3SPHA 4PTUA 1OEZW 5F71A 4MB1A 4E9VA 4L29B 3V0AC 5TDOA 1ESOA 3EH3B 1PLCA 3VXRB 4D0BB 4I3RL 1JS4A 3ESVF 5KBLA 3U0TB 5ACZA 1LTXA 2H2SC 3BAKA 3MJ8A 4LSSL 2AXFB 1KG0B 4PWFA 1J8SA 2EXYD 3MX0A 3I6GB 4KTDL 3IDGA 4N20A 4GFTB 1JPTH 5C0BB 1R0AL 4WWKC 4UV4H 2VLLB 3VA2C 2AW2A 4E42A 3H2PA 4KXZH 4LSRL 1NFDA 4X9HA 3L2NA 1LK3L 2NXZD 3ULVD 4GQQA 1B0GB 2GC4C 4JRYB 5ETUA 3FU3A 5IOPA 3K6SB 2ZCHL 3FT4A 2WZPD 4NQXA 1S3KL 2AABL 2Y0SA 4PQXA 1CD9B 2ITCA 1FN4A 2NUPA 4RLDA 2VJ8A 3SQOH 4X4YA 5FFGA 4R6UA 3D39B 3F5WB 4L3CB 4C47A 3GYRA 2R7EA 2X4RA 4FJZA 3C6LB 1UZ6F 3S35H 2XA3A 2WSDA 1U30A 3X12B 1CDIA 4MXQC 4NJAL 1YQVH 5FYKH 4FNUA 4C4KO 4A6YB 4PH8A 3F64A 2QR0A 5F9JA 5HJGA 3UDWC 5BXFB 2E8ZA 1E4HA 3W11C 3TTSA 3VGFA 4XI5C 1C5CH 3FQXB 3BCDA 3FB6A 2NCEA 4BA8A 4MDIB 3CZSA 3H6AA 2HPTA 1DDHA 1RUKH 1HESA 2OCJA 3RA7H 2YRBA 1OAJA 2PTTB 4N2HA 3QWOB 5K9QG 1T5XB 5LG6A 1CGXA 1HCYA 3ERXA 4MZ2A 3LPFA 4LPVA 3MLWL 1BX2A 2IANE 2AV7A 3ARBA 1JMZA 3PJLA 4HT1H 3HZYB 3PUCA 2MH4A 3QDMA 4A55A 3TA3A 4UF7C 2AK1H 3P9LA 2EIMB 2XNAA 2A6KA 1G9ML 1F11B 1ZPUA 4YQXL 3VXUB 4R7VA 4EPSA 4F3FA 3FPYA 2J43A 1YYLL 2XWDA 3US9A 2EH8H 4WQOA 2FTAA 2ZJSL 3GLEA 3FYEB 3KJ4B 3QUML 4IYKA 4ZW3A 1AD9B 5FV2A 3ZRSA 1AHMA 4KFMA 5IB4A 4FRWA 5GS0H 1TTUA 3BQUC 3KXFA 4YNYB 2HJKB 1OGAE 3OAZH 3WDHA 3A6CL 5BOPA 2ILLA 4TMPA 4WFFE 5I19L 3VE0A 2HWZL 2MRYA 3BWAB 3L5WA 4LIQL 2NOYA 1QFWM 5CINL 3V55A 5KSAB 5E7FA 3V0VB 3S9DB 2AS5M 3JVGA 4ES9A 2V7NA 3OGCA 4EN3B 1WSST 4B7IA 5H4YA 2IV9A 3WEOA 3TL5A 3D2TA 6TAAA 5T1MA 3KYNB 1CICC 3LNIA 2Q8AL 3D09A 2ITEA 3GXTA 5HGAA 1MHCA 3LNHA 2F19L 2P52A 5A1AA 4WKXA 4DF9A 3DBXA 3ARWA 1GZHC 1D7CA 1MFBL 2NY5H 4M93B 5TDPB 1AZUA 4QR7A 5ALCL 4HLEA 2QLYA 5D9SB 5D7JA 2O61B 1SN2A 4MD5B 3IAGC 1Q0XL 5B3NA 1WWWX 2J71A 1GZQB 4ZTEA 4JFFA 3ROOB 3PG2A 3TPUB 4AQ8A 3K8KA 5IFHH 3D85D 3WNIA 1U3HC 3JWNE 4ZO6A 4GXVL 1VPOL 4U4IA 3M1BA 5AG9A 3BMVA 3SE9H 1K72A 4MMZA 4OUUA 1A4AA 4CKVX 3IDMB 2NDGA 3KW8A 4IKNA 3BN3B 4XH2B 1W91A 1F58L 1CF8H 4PWKA 5FKAA 1KGCE 4B9FA 2YBRA 5E99L 5A6LA 4QXGL 1P7KB 3AADB 5T5NG 1OARL 1DJSA 2MHAA 4JS7A 5GZNA 5DXWA 4YDJB 4XP4L 3TBWB 2AJYH 2ZWZA 4TULL 1I9EA 2J1XA 3NRQA 3PIQB 4P5MA 3H42L 3PHOB 4AE0A 2I9LA 5JA8B 1K6QL 5TE4L 3HS0A 4JBSA 2F53D 1F8TH 1BXUA 2HCZX 5D1XE 2UYLB 4IS6B 2AJSL 4KDVA 3CSFA 43CAB 1A3LH 3AXLA 1OIOA 5E1HB 4R5TA 2O6FA 2YPKB 3NACH 3K8MA 2L7EA 3O6MH 1HNYA 4JDTL 4JM0A 4AG4H 3EZJB 4M8UA 3WU1A 2ENSA 3VGEA 4LLYB 3CX5J 3F01A 3QH3B 2GVYA 5EZOL 5BVJA 3SODB 3BPCA 4UDTA 1PG7W 3FOLA 4U1GB 1F0LA 4HMDA 1LO5B 5IIEB 1F1AA 4IRZL 2HFTA 2FWSA 4FFZA 1CC3A 4NQTA 1CVRA 1NMCB 4ONFL 4PJHF 1JIBA 1JMXA 3C5ZC 2OK0L 2R23B 1NIBA 1GTFA 1BFTA 1E5BA 1K8IB 5FYJE 4MBOA 3DV6B 3RG1C 4DGVH 3TWCL 2FLBT 2BVUA 2FL5B 4L5FL 4F9PA 3PDOB 2CMRL 4H40A 3Q2WA 1KB5H 1S7XB 4YJZL 5J89A 2HRGA 3IAQA 3ULVF 4KC3B 4DP2X 4MRCA 4K3HA 4BA0A 2HKHL 1FAKT 4BINA 2H0FA 2IWFA 4WI2A 3O4OB 4NQVB 3BPLB 5HHOE 4LKCB 4YVNA 1JXDA 2ITFA 2IANA 4NXSA 3LQZB 3Q06A 3RWJA 1CO1A 2EDLA 3I50H 4TKWA 4HFUH 3IMWA 4N2NA 3BEVB 4HWBL 2VL4A 3BH9B 3G04B 2G30A 4WUUE 1FH5H 1VEMA 4ZMWA 2R8SH 1ZKAA 3UPCA 3K1KC 4MDRA 4EJ1C 3P3YA 5E0FA 1IIKA 4H1LA 1KCRH 3D0VA 3H2WA 4LXFA 2QZQA 3L7EA 2PKDA 2BVOB 1EAOA 1P4LB 1QLRA 4JVPA 2C9SA 4YXLH 3FU8A 2YAQA 3F58L 2FCBA 4I87A 3FCSA 4P46A 3TVMA 1OGAA 5JNYB 5KVEH 3QBTB 1KN4L 3D4YA 4KPHL 1E67A 2CLZA 2QQKL 4ACTA 1CLOL 1NOLA 4XVUD 3QGVA 5HYEA 4N24A 5I1CL 3FUKA 4WNQA 4E5XA 2GC7C 4MX7A 2CO7A 5FF6A 2A9BA 5LAXB 1KXVA 5B1AB 1HSAA 1T3FA 4XB8A 5F93C 5EF2A 4A7UA 1E43A 3EFDL 1R46A 2ZUXA 3QNXA 1HU8A 1J9QA 1MREH 1D5BA 1GMEA 3APCA 3CLWA 3OAZK 5AVWB 2GY5A 1WAAF 5DJ8B 4J4PA 4NNYB 1EJOH 3QYCA 2Z4QA 4N2MA 4L3EE 3VH8A 4MSWA 3ZDXE 2DQFB 2VMJA 1BEXA 4WI8A 1NUGA 4W70A 1KV7A 3TN0A 3IPBA 3PQYB 1EEQA 1JGDA 1SY6L 2OA9A 3ZE1B 3ISWA 1ILSA 2FNBA 2VDRL 2Q0ZX 3O3DA 4YZFF 2EUXA 4R7NB 5F9AC 2AP2A 3Q5TA 3GMQB 1U33A 2OZ4H 3ASOB 5GS3A 2O26U 2RFXB 4WHTB 1I9IH 1I8IA 2KDGA 1OTTD 2IGFH 2RMNA 5TQ2H 2Y1VA 2DMHA 3T0XA 3X2QB 5E56A 4G8FB 5KSBB 2IH1A 1DUYB 3PNRB 2ODIA 5INCB 3MRBA 1I7UB 3LXCA 2X41A 3JT2A 4IKJA 2MKWA 4NCC1 3SCMC 4GUOA 5HGHA 2IAMC 5C3TA 2HT2C 3N3EA 3HI1A 4FTVD 4Z0XA 5C09E 3ZMNA 5CJOH 2B39A 3WS3B 4PREB 1OF2B 4TTDC 1NIAA 2XVGA 4D8PA 4QEGA 4U6YB 4WSJA 2BIMA 2OXGA 5JQ6H 5JZ7C 2H6UA 4I0CC 1KIQB 4O02H 4QNPF 3VJ6A 3EOAB 2DQMA 5HY9A 3HHSB 3WUWG 1UVQA 4L4TB 3A21A 4AQ1A 2O93L 1MAKA 2VDKL 3DKHA 3W3BA 3UPAA 3KVDD 3MAWA 2KL6A 4MNHA 3PGFL 4PRIE 1G9EA 5GS2H 3BO8A 4G59C 3D12B 3SZ6A 3MRCA 4NNPH 3ABLB 3RTLA 5GHWL 1WBYB 4URTB 2BS71 5JLZA 1AGBA 3L1OH 3GJFA 1QUNA 1R19A 3O81A 5T1LA 3S3CB 1G9MC 1RJLA 4IU3A 2W9DH 1A6VL 2VCOA 5D7SL 2CKBH 3ETTA 5FHAL 1ZLSL 1QUPA 1DQLL 4JKLA 4ONHA 3Q2CA 1YMHB 3W0WE 2OFQA 2XETA 5D1ZA 2FO4A 5GGRB 4HMEA 2VM4A 1CCZA 4BCZA 4LBAA 4X4ME 3MA7A 4UTAA 2QHRL 2VDNH 2X2YA 1SEBB 2Q76A 4N87A 4F15B 4X8GA 2E7CA 4L37B 3LY6A 3V0HA 1UOVA 2PP8A 1GRWA 1RK0B 1JG9A 1ULVA 2XXMB 3OXSB 3KWTA 3VUAA 4P3DB 2VLME 4AV5A 1E6OL 4PB0L 1TVHA 1THAA 1T6BX 1ZWIB 2VJ0A 3DX9A 1KWKA 4WUUA 3MTXA 3D52A 2DEXX 4K23L 1MRDH 3QJQB 1FPTH 4KROB 2LV4A 4W9CC 5I15H 1PAZA 2MNJB 4NERA 4EIBA 2EVHA 1PX8A 3DJZA 2N0KA 3ECVA 4NQDE 1VFAB 4FZEL 1AYOA 4D3CH 4D9LH 2FR4A 1OALA 3G3LA 2OYMA 5AW2B 3RL2A 3CFKA 2B0SL 5E6SB 4RWYL 1MWAA 1ORSB 2ZNWA 2MMXA 2QKSA 1H6EA 2DMBA 4Z7UA 4G2AA 5DEFA 3KJ4C 3UTZB 4L9DA 4S0SD 4X6DE 3LIZL 1Z3GL 3APNA 5F6HJ 2BP8B 1ZHLB 3FUJA 4X5RA 5HHVH 4KGLA 5BVPH 2A1WL 4C4UA 5HYSA 1OAQH 1WRFA 2NY4B 3QORB 5D4IA 4BH8A 3TS8A 4A66A 4LLAA 2TRHA 1U8PA 2AK4D 3IGAA 4XMVA 3WFBL 4AXWA 5KSAC 3D3VD 3ZDYB 4H26A 2BNQD 2XIIA 4M62H 1XQ4A 3OHXB 2HH0L 3QAZB 4EN3C 3AWEA 1NFIA 1ZSDA 3ATEA 1A7RL 2V17L 5T1KA 2H2SD 4UCFA 3FKUS 3MRKB 4Y16D 1NANI 4ADIA 3QEQA 2D0FA 2ZWKA 2VQ1A 4QRUB 1Y1UA 3C08H 4HEME 2WLLA 4P4RA 3U4EB 1DBMH 1NEZA 4NOBA 4JFED 4U6VH 1U8KB 4JGJA 1HH9B 1YJDH 3DV4B 3KLAB 4M93C 3WEMA 4CU6A 5KZCB 1AZNA 4G6JL 2UY6B 1OZUA 2OMYB 3WTYA 4OCSH 3VW3L 3QIWB 4B96A 4I4WA 4JVWA 3BRGC 2X4OB 3CSYB 1NOFA 1HZHH 1OD7A 1I4FA 1X5IA 5DJAA 4OLZL 2NY2D 3AACA 3P73A 5ESVB 1B90A 4JFYB 3KD4A 2G3MA 1CU4H 1WBZA 5C08B 3E1F1 4AEIL 3CFJB 2XXCB 3DROB 3P30H 4NSKA 4PJXF 4KTDH 2R4RL 5HD8C 1MCIA 4HIXL 3QQ4B 1QBLL 4QT5A 5GGVY 4ES8A 2JCCF 3X1NA 4FABL 1AXSB 1A6WL 4QRSA 2XN1A 1QR1A 1NINA 4OIIL 1M71A 4RDQF 4JN2B 4MJ5B 4OZHB 1A7NL 3H9YA 3WJJC 2B3IA 2MQ3A 2VMDA 2ZCHH 1FL6B 5MEOA 1UT1A 3IVKB 2AABH 3W11D 4G8EB 2YPVA 1SLVA 4XI5D 1VFBB 2ZP8A 1JN6A 3DTDA 4YSUA 5HDRA 4N2GA 1J5DA 2EYRA 3QEUA 3TBSB 8CGTA 1FL5B 4JHUA 4UU9A 4PJ6A 4RNRA 1JTOA 3T0DA 3BAXA 3X11B 4OQTA 3OLEA 3NBNA 4DESA 3KDPB 4CADA 1XSKA 4XNUL 4OGXL 3LH8A 1A21A 4XP5H 2DQEH 2IQ9L 1EO8L 2UX6A 1FZOB 3HVDA 3MXVL 4FFYA 4JANA 4N9OB 2A83A 5CEXA 2D4FA 4AOFA 2C8NA 3C60D 5DD5L 3HB3B 1CS6A 1S5HA 1KLUB 1PZDA 4W4OA 2Q87A 4Q89A 3X3GL 3DUSB 5FGRA 2NNCA 1UT2A 5AAMC 5TH2B 4K07A 3AS1A 3W0WA 4KY1H 3RNKA 3RWEB 3BQUD 3MLWH 2WQ8A 5AZEH 2YPLA 2CA4A 2C7FA 4MAYB 4LAJH 5AVSB 1E27A 4A04A 2LVEA 3HLAA 1KJVA 4QTFA 3K8LA 3WE6B 1BZEA 2VC2L 4PY8I 1UJ3A 4GMSH 1FJ1A 5J1AB 3S5LG 1V5JA 1NCIA 3FRPA 5E94B 4K8RL 4Q6IA 1G1KA 2YC1A 3L9YA 4KXAA 5I8CA 3HI5H 4P2QA 3LRSB 1ECYA 4UOW0 2WVSA 4H8WC 4R4FL 1UATA 1CICD 2P47B 3I02A 3W39A 2X70B 3O4OC 4CILA 3VWKD 3AQZA 3BPLC 3TJEH 1SVZA 1PKQA 3F7PC 4LARL 4MHHG 1RIHH 3SOBH 5CEZL 3RBGA 3VD2A 2EYSA 4PR5A 3A6CH 5DI8A 4IRSB 2EDEA 5C1MB 1U9KA 1LE9A 3SB3A 1I3UA 5CINH 4LIQH 4UINL 1EXUB 3HFML 4LSQL 4MXVE 5GGUB 4E41E 4KKRA 1WT5A 4LCVA 3WN5A 1JNJA 5I30H 3HW7A 3CHXA 4YIQB 5IJKC 1U3HD 4KQ3L 4OLUH 4PJ8C 4UNVA 2Q8AH 1N59A 3GK8L 4HGWB 4HD5A 2WZ5A 4HUWA 4U7SA 5IMKA 4WO4A 3GLDA 3OXRA 1U58B 3DA0A 3QUGA 4QHNB 3BH4A 3OJDA 2D0GA 5AALA 4U1KB 4I0PC 4HZLB 4GO9A 3UYOD 3A5VA 3Q0HA 3F6IA 5CJXC 5HGDB 3KPRB 1PNCA 1S9WB 1QKZL 3KL5A 3KH4A 2VSKB 1DBJL 1WFMA 1EJFA 4HX1A 3MUJA 4X0KB 4E9QA 3FHAA 3NZHL 3MRHB 1CFQA 4I85A 4F27A 2EKSA 1WA2X 1V05A 2NNAA 3P4OB 1J5OL 1DJIA 2NNFA 1QAWA 1JL8A 2JTDA 3QO1A 4MZRA 4HJ0C 3ETBF 4WGWB 5SWSA 4Z3IA 2MPAL 3CN4A 3POHA 1GS7A 2G5RA 1DUZA 4BKTC 1KTDB 5C70A 3L95B 3FS9A 2AJXH 1F58H 4AGLA 4OF8A 3VQMA 2GIYA 2A6DA 4LESA 1ECZA 1WP6A 4QXGH 4H25A 3O6FD 3R4RA 1IE4A 2ZKYA 4TULH 3KMDA 2E7HA 2GCYB 1S46A 4MD0B 1WD8A 4P5KB 2ZX5A 3FTGB 2WXNA 3H42H 5JHBA 1PLGL 3QPXH 4NP9A 4WIQA 4D0CA 4I9XA 1IBYA 3KPSE 2PYED 2SEBB 2ZWNA 3C5ZD 1ZA6A 5TPWH 3OQRA 4Q9RL 3FZUC 5AWNL 1OCOB 1H8NA 4DZBB 2FEEL 2EEDA 1L0XA 4L1SA 4NN5C 3Q8EA 2NQ3A 4UUJB 3LKOB 5KVDL 1F5WA 3L3KB 2IGTA 1UACH 4FHKA 3VFNB 1QLEH 1QW8A 4PS8A 3U0PB 1MI5E 3EOTL 3IB4A 5DRZA 2DQUH 3T0EE 3EGDA 5L4FA 4IRZH 5DZAA 1H3UA 3FMGH 4XBGB 1R3KB 3QJSB 3CFIC 4I77L 5C7ZA 4NO2A 4AYFA 4XWOD 2OK0H 4DQAA 1T1XB 2JKTM 3IFOA 4LOUC 1BJMA 1RAMA 2G9HA 1TTFA 1BYPA 2A9ML 3KYAA 3F62A 1UGKA 1D5XA 1URLA 2E4FA 1T89A 5IM7A 2JCWA 2E47A 2GUYA 5DJXB 5C6PB 3PS6A 2A73A 2HKHH 1I85C 1I7ZA 4JDEA 1F1DA 3MYJB 1LYQA 2Y1YA 3NFSL 5EU6A 2FBJL 2F74A 1BBJA 5J3HC 2VLJB 4B7LA 2QV2A 1I1AA 1MCCA 1PJWA 1PL3A 1SQ2N 4HWBH 4XC3L 3WS6A 3MUHL 4YHZL 4IOFC 1BQUA 4NUQA 3BWSA 4OLEA 7TAAA 1V7NL 2KZ1B 1Y7VA 1MAMH 3PAZA 3SY0B 4JFPA 4F15C 4UZUA 1KYOJ 3HIZA 3OKEB 4EOWL 5J1SC 4LQ1A 1ZVSB 3CDCA 3DOHA 1FQ9C 3ZW3A 3F3HA 4U1IA 4ODHL 2FO8A 1BYOA 4TS6A 3N42B 4JO5A 3HUJF 3B2VH 4UNTA 1OGTB 1NAKH 3CFNA 4R4BB 3O2DA 3ARDA 2GK0B 2QQKH 5F7EL 4F2EA 3RGVB 1CLOH 1E9OA 1HHJA 5AZ2L 4E41A 1OW0C 4Y9BA 5I1CH 4R0LB 3FB7B 4KROC 4M5SA 5DZPA 4TNVF 5FUCC 1M6OA 3TTYA 5F0MB 3UO8B 2QLVB 1A66A 1IJ9A 5JIPA 4GI9A 4M4RB 3ZYIA 4TVPL 4CC4C 1IARB 3EFDH 1PY4A 2A9DA 4OD2A 3II1A 2IALA 4LGPB 2A9NL 2VKWA 3FQTB 4OZ4B 1Z5YD 3GMOB 3JXAA 5EO0B 1ZXKA 3DXAE 3V6FB 4ZOEA 2CD0A 1FRGL 2CR0A 2ICWA 3GXPA 2AF2A 4XNYL 1X9QA 1JUFA 4KJPC 3UMTA 2CJTA 3X1FA 3VFMB 1HK6A 2R29L 3SCMD 1FSKB 4QKTA 3SKOA 1PTZA 1YN6A 2MQ0A 1SY6H 3VG9B 4JKKA 3RL1B 5L2JA 2NY4C 3BVXA 2HT2D 4X98A 3QORC 1TYJA 5KOVC 2EE3A 1X5ZA 4H8VA 3WKML 4TTDD 4NEHB 3VXRD 3QVAA 4GRWF 2NX5B 3OHXC 1TTAA 3QAZC 2A38A 32C2A 4AWJC 3P0YH 1R33A 5I1AA 1BJ1J 1AC0A 1SOKA 5FUZH 4Z78A 4NRXA 2BNUA 1ZE3H 3BZEB 3N43F 1WIUA 1D5MB 1LMIA 3HG1B 3C9NA 3QIBB 5C0NC 5C0BD 3GUTA 4PU2A 3MJ9L 1S7VB 4L4JA 4YLQT 1TQWA 2BMKB 1QZ1A 1Z9NA 4JG9A 3BKML 4YE0A 1EHXA 3QIWC 3TIDB 4JRYD 3LN4A 4RDQG 3V9CA 1TQUA 2D4DA 2WXQA 4P5SA 2H9GA 5A2AA 3VYPA 3RB5A 1QVOB 3QQ9C 1S7TA 4RWHA 3BC9A 5B38A 4M5YL 5LCVL 4G70B 4LBEA 4PJEF 2FIRT 1JJUA 3D39D 2VDKH 4XCFL 1BJ8A 3UJJH 1JHTB 3QDJE 3C6LD 2XTJB 4NI3A 5A7BA 5E4AA 3H3BC 3TF7C 2DWEA 4YSOA 2WAQA 1SXZA 3T0AA 3FUFA 3QZWB 4OAWB 5JMOC 2DKMA 5GHWH 1X7SA 3TYGL 4XT1C 3BH8A 3MCYA 3CPUA 4GY4A 4EEEA 5F1KC 1MCRA 2AEQL 3G5XA 4K4KA 5DMGD 1IC5H 4XPFL 1UHVA 4WHCA 1A6VH 3X1GA 5IR1B 4DOHB 5IKCA 4LLUB 4J3UA 5FHAH 4MKMA 2CBQA 4NO3A 1DQLH 2BWIA 2X6MA 4PB9L 3MBWA 5FK9B 2WQRA 1FF5A 4UOZA 4PFEA 1DSFH 3GSQA 2QHRH 3JWOL 4IIQB 4ZTPH 2BVPB 2AQRA 4Z3FA 4B60A 1RURL 3SJVB 1EMTL 1TETL 4M8QA 4KKZA 5K9KB 3EFOA 3CLFH 2WP3T 4WDIA 4JLRA 2ATPB 3U6XA 3EOBB 2PTUA 2AJUH 2LVCA 3VXUD 3SBWA 4IBUA 3RY5A 1Z9SA 1Z1WA 2DM4A 4OVVA 1TG8A 1E6OH 1WITA 1R5VA 4PB0H 4UQEA 3HB3C 1TCRB 5F3BA 4I3GA 4BQCA 1JSYA 4N0YL 3G5ZB 4U1HA 3PNWB 3U1SH 1BQHA 5C9KA 2R2HB 2ESVE 4KRNA 2Y7QB 2Z7ZA 3IRZA 1Q1JL 4KFZC 2J4WL 2M1KA 1RHFA 3I74A 4MAYC 4XP1L 1DE4B 1IO4C 3BVNB 5E6ZA 4BE6A 1U4EA 3L4UA 1O6VA 1IAKA 1A1MA 2BP0A 3QG7H 4FZEH 4Z7WB 3MCLL 5KSAD 1T66C 5EOCL 3Q8BA 4N0UB 4M48L 3IJ8A 4G7YL 1T80A 3LMJL 1E30A 4JM4L 4EN3D 3CVIL 4YXHL 1VLXA 2W92A 5DYOA 1I1RA 4DVRH 3MLUH 3PXLA 1Z3GH 3OB0H 3COOA 5K93A 5HVWA 4AGNA 4JG5A 3OZKA 2IDSA 2FX9H 5LBVA 2C3HA 2H3XC 2W0FA 4NHCH 2F54B 3UZEA 1U6AH 4JMNA 3WMPA 4IRSC 2X4TA 3LRGA 4JFWA 5D2LB 3L1EA 3VRLF 4FEIA 1TDQA 2JLPA 4PV8B 2IADB 1V54B 1B0RB 3U7WL 1E4WL 2FJGA 1XR9A 2HH0H 1KB5B 4UAOB 4HUMB 1TNNA 2ZPKL 1A7RH 5C0IB 3PPSA 4G1MA 3QNFA 3I9IA 3BKJH 5DEGB 3BPNB 1DQJB 2FJFA 3FQWB 5FYLD 1F97A 1PPIA 1QBAA 2YFNA 1JGLL 5HD8D 5FGBA 1BQSA 4LKXB 1CDCA 4K7PX 2FNWA 4PJHA 1Z0MA 1YMMB 3W9EB 4G6JH 3MOBH 1E3FA 2FEDC 3VW3H 3CSPA 2HLEB 4IKLA 3N40F 2XWBB 4DN4H 3IFNH 4N9GB 4H0HB 4J23A 4PJIB 5T3ZD 1JGIA 1XGQA 4E0RA 1LO0L 1T2QH 2J56A 4OLZH 4FNSA 3EO9H 4JDZA 4GKZA 3FFCE 3I6KB 1HAWA 5FFOA 2WZPA 2WLIA 3WDIA 3D4CA 4AEIH 4ZUTA 1M05B 2R4RH 5LGJA 4HIXH 5GPRA 1QBLH 2QQLH 5LKNA 2E7LA 1IGIH 1A6WH 3V5DA 3SN6N 3CDFA 1V3LA 4OIIH 4GRMA 1ET7A 4X7SL 5E2TL 1ZTMA 5DD3L 5C8JB 2XQYG 3B5GA 3POCA 1R24B 4U6HB 1W80A 2VZVA 2VR3A 1LEGA 1L9TA 2NSQA 1ADQL 2GJ6B 4GMTL 3V8CA 4LLQA 1N8ZB 5GGSY 3RBSA 4IBLT 5CCGE 2YMOA 4LLVB 3SKMA 1GJUA 2OSYA 2HFFB 3BIKA 3UIYA 3NN8A 1EANA 3D69A 2P46B 2Z7WA 3JWNH 1BLIA 2WIIA 2FWUA 3JTTB 3KS0J 4FLHA 5IB3B 5J6GA 3OKDB 3QFJD 3WIAA 4DP4X 3IMBA 1GGUA 2JJSA 2A77H 3LNEA 1QA9B 3TJPA 4N3TA 4FQQB 2BIIA 1EFXA 3L7FB 1RSFA 2JH2A 3VFOA 3X3GH 4L4VE 5I1JL 5F9WB 1JK8B 1WAAA 3RU8H 3NMEA 3MV8B 2IG2H 3N1PC 2CDGB 3VGHA 3FOMA 3VI4F 3B3IB 3QC6X 3K0YA 2FLMA 4NFBA 3VXMB 2GUOA 3QJFB 3VFRA 1J1XL 1MW0A 4K8RH 2HT4C 3TJHD 2J5LB 1P69B 4J6RH 5E6IC 3KW7A 4WFHD 2DLEA 3DMMD 2NW2B 4R4FH 2HT3C 4GAGL 1F3RB 5I1IL 5E5MA 3WI9A 1FFTB 4YX2L 4OIBA 4D94A 4QJ4B 3MGTB 4KNUA 2HLFD 1PFCA 4OB5L 5HHNA 4Z0BL 4PG9A 4F91B 1X4YA 4UT9A 3NTCL 1GVIA 2D9QB 2WVVB 3DYPA 4KKPA 1BVKB 4Y2OB 3FT9A 3GXFA 1NJ9A 3HFMH 2Y36H 5IEHB 3SZKC 2IDQA 1AFVH 2NTFB 3FBKA 3O6LL 2OI9B 3QQDA 4KI5E 4L8SA 3QJXA 2XG4B 2GI7A 4OH2A 4F7KA 2G3NA 2VW6A 4EIUA 4Z5RA 1LXMA 1IU1A 2ZD0A 5FYJH 3UTSB 4P9HL 5I5IA 4NYLB 5D72L 3WEXA 3BP4B 3STLA 4G71B 2GIMA 3U4AA 2JXMA 4KVCL 1J11A 2P5EE 4YL4A 4FFVC 3VFUA 2XQ0A 1NCBL 5DC9B 2VR7A 1U8JA 3G6AB 5TQ0H 3RGVC 1AZRA 3AM8A 2HB0A 2Z65C 4HJSA 4S1RL 3ZKMD 5FA4B 4D0DB 3PQYD 5E2VL 4R0LC 1QKZH 2CBPA 3WNKA 2HFEA 2OJEB 2OMWB 2P7TB 4XMLL 5F9OL 5FA3A 3OB0K 4XMPL 4IRJB 3U6RA 3S48A 3WIIL 1MJUH 1BZOA 3FTWA 2AFNA 2CUHA 3T3ME 4TVSa 2IVFC 4WK2B 4QGTA 3L1FA 2MPAH 4XN9A 3FJTA 4KRMB 4NQUA 3PDGA 4EAEA 4TTGA 1ZANL 4K3GA 4ZXBB 1OPGH 1T1YA 4AM0A 3RNQA 3FZUD 1AQDA 2PPAA 3ARGA 2IFGA 4BFRA 1IBGL 1FSKC 2F53A 4OJFL 3VRJB 4G9DA 5BNXD 2NUTB 5FWQA 5GGTL 3VG9C 2DIBA 4AYEC 2QGEA 5E0QA 4IK7A 1JHKL 1NGWA 1J9CT 4G80B 4X6EB 4ZUVB 2H8PA 3LYRA 1ZHNB 2BSBA 3A47A 1A7PH 4BFEA 4N28A 2WUCH 1NSNH 3LCYA 4UV7L 3ZZQA 3HMXA 3T65B 4WI3A 2V9TA 1YEGL 1QI5A 3FK3A 1N3NA 4B9IA 1WZMA 2XRAL 4Q9RH 5AWNH 1CGVA 3L3HA 2NR6A 4U2YA 3ZR6A 1LK2A 3WIHH 2D31A 1F02I 4F93B 3RLSA 1MCWM 3U1QA 4APQB 5CF3A 3QIBC 3UAJD 3HE6B 1D9KB 2OX5B 3BXNA 2VXVL 4QHUA 5KVDH 1XTLA 3RPIB 2F6AA 3T2LA 1DEEA 4P2RE 5CU5A 3WTUA 1TQSA 3EOTH 4NQEB 5KYXB 1DP0A 3QPKA 1GXEA 1XH1A 3F12B 1T20B 1J0HA 4JQVA 1IM9B 1QSFB 4PGCB 3Q13A 3WTSA 4PGBA 4G3YL 3THML 4N68A 3GRBA 3PGCA 1PIFA 3TBVA 4HIEB 3CU1A 1FO0A 1G7PA 4IOFD 1FFPB 5IGXH 2XTJC 3DETD 1S7QB 2VLRB 2YIHA 2A9MH 5D7IE 3DOSB 4Z7AA 1JNHB 2XPGB 1E5YA 1CZ8H 4H0GA 4D2NA 3MRPA 4JHVA 4NBYB 1NBZA 1QPXA 2X44D 4L4VA 5C97A 1WZKA 1XXFC 3QZPA 2FBJH 4X9IA 5GGQL 3AREB 1X9LA 3LNGA 4JO1L 1K5WA 1FHGA 5JOFB 3V7MA 3IRPX 3B1TA 4NUGL 4PRNA 2R2CA 1FVEB 1Q94A 2DYRB 2VABA 4GSDH 1K3IA 4CSSA 4HIJB 3QAQA 2Q6WB 3M8OL 1OAYH 3H4HA 5JIDA 3DOIA 3IETB 3KCPA 4IIQC 1WZ1L 2FZ3B 1QTPA 2ZUWA 1VFUA 3OWRA 5LN4A 1T83A 4HHWA 1BZ9A 3BLPX 3MJ6A 4EOWH 1F4WL 5CP7A 4I7ZC 4IMKC 3WHE0 1ACXA 1SMAA 2VYRE 2YD3A 2WHVA 2CR3A 4OQTH 4ODHH 1D6EB 1CDHA 4K5NA 3DDGA 1NDTA 1RPKA 1W8OA 4MWFB 2WK2A 2A74B 1KN2L 5EU4A 5JPMA 1OM9A 3O2VL 4PJXA 4V33A 4XN8A 5ADPL 1D6VH 3Q05A 4R90H 1NDMB 4MAUH 3MMEA 1WV7T 3UYRH 4RISL 3DO4A 2NY4D 4LK4A 1CXKA 4UAHA 3CTTA 2C34A 3QORD 2R0KL 4HSCX 1S5IL 3D7PA 1LNUB 1OSYA 1W9XA 1CE6A 4PRPB 1FVCB 1ACYL 4PP2A 2F08A 2XX1A 2X2HA 4ANXA 4H2AA 4U1JA 1RULL 4TSAL 1DCEA 3MO1A 2HX9A 5HHQA 1XR8A 2E4TA 4KO6A 3GIZL 4X7EC 4X4XB 4JFQB 4DUXA 3WFZA 4PS3A 1QWHA 2X53A 5C0ND 4LLMA 3H1ZA 5KZCD 4NLAA 4YZWA 5AQ0A 2JJTC 4DAGL 3IDNB 1AR1C 1IEAB 3NK4A 1NH6A 5C9JA 2CK0H 4PP1C 4U1NA 3Q7JA 4UAOC 3RWGB 1CN4A 2CHDA 4FTVA 3QO0B 3UAAA 4EUPH 5DRWA 3FL7A 3OM3B 2BCKA 5FUOL 4FADA 3QQ9D 1DEDA 2I60L 5E1AA 3K6IA 3D8MA 3BPNC 3DYOA 3MR9A 4XP6L 5FEBA 3FCTA 4WU7B 4P23C 3SGJA 4RGNB 1IEBA 1TNMA 3ZHLA 3GSNB 5JW4R 4S10A 4BFBD 3OKKB 4RAHA 2JWYA 4WI9A 4UNUA 3E7JA 1DZ0A 2C1OB 1EV2E 3SKJL 1GIGL 2HVKB 4RRPM 3SDYH 3CFDB 3ZE1F 4AQEA 2ZF9A 2Z93A 2OTWB 4OLYL 3LS4H 3QDGE 5LNEA 1IAIL 4M5YH 2UZXB 5LCVH 4FNRA 5E2WH 5IVZA 1RPQA 3U83A 2RR3A 4HIIA 5B3JE 4QAWA 2LGNA 4JEGB 1A3ZA 4XNXL 5C0EA 3BEWA 4L3AA 5M7QA 3GO1L 3MHZA 4K5PA 1RJZB 2DICA 3KCWA 3UJIH 1MQ8A 2HJLA 1N26A 1HKFA 3TYGH 1MLBB 4P2RA 2BK8A 3GHBL 1QABA 3TU6A 4M1GH 5C0AB 1SFHA 3MXWL 4PJGB 1OV8A 4ZFGH 2PW1B 3HB3D 3QA3A 3TBTB 3UBXA 4PB9H 3GSNL 2IDTA 4Z7QE 4AYDC 3D2UB 5DGRA 3MBXL 1RZGB 3MVSA 1MVUA 3ULSA 5LB1A 5AVVB 4MJ2A 1V27A 3CN2A 4LL4A 3E2HB 4G11A 3ZKSD 5L8LB 4JM2A 1TETH 4ZDHB 1KYUA 1T66D 3C5JB 3NOIA 3CGTA 4D9RE 2HAZA 2QKIA 1NFAA 5PCYA 4ECNA 3V79C 3D0LB 1A6PA 3Q6FB 3M45A 3T8VA 3UC0H 4QXTB 4G6ML 5IHWA 2PPEA 4MQ7A 3MBEA 5F9WC 2WXGA 3VCLA 2WNWA 3PP3H 2K9UA 4IDLA 3RI5F 2C3XA 4WSKA 2APTA 4L05A 5GRVL 4IRSD 3TFKC 5ICXA 3T8XA 4TNWF 2D73A 2OL3B 1MDAA 4PJDB 4XXWA 1KB3A 4LLWA 4NC2B 2VOTA 5EOCH 4NRYB 4M48H 1S9XB 2J5LC 4FI8A 3CVIH 4Y1TA 4WRLA 4BHUI 2VIRA 4TLSA 2L0DA 1BZDA 1CG9A 1QLFB 1QLEB 5IFJB 5DVKA 2OTUA 2Q20A 2DQCL 2BNQA 2AXWA 2DBLL 1RLBA 1U8HB 3N1FC 3SY6A 4E2OA 1OAXH 1UJTA 2A6IB 1ETZA 4PTUB 1MPAL 3ZO0A 1JTPA 4TSBH 2CAKA 3LKRA 4Y16A 5TDOB 2JQZA 3QDAA 4YGVB 4J5VA 4XVJL 3KPRD 1E4WH 1LO3H 1VKXA 5ACZB 3NGBB 2EO7A 2G75B 3MJ8B 2ZPKH 3PL6B 4ALAL 2VDLL 4XE5B 4V1DE 1LEKA 2Z1KA 4KXZI 3MX0B 4RFOH 3FFDA 4MJ6A 1V55B 3IDGB 4J2QA 4ZW6A 5TFSL 1JGLH 1UXWB 4A2HA 1G6VK 1Y1DA 3OQ3B 3AXHA 4E42B 1NFDB 2NT1A 1EZLA 3ZGHA 5ETUB 3D4ZA 5IOPB 1KULA 4M7LH 3EYOA 2BXZA 2Z34A 3FT4B 3G5VA 2KERA 3JZ7A 4NQXB 3EBHA 3VD1A 2P8PA 1R3IL 4NOFA 1IV8A 4L9LB 3EXJA 2ITCB 3AG2B 3MLXL 1LO0H 3EBAA 2NUPB 4X4YB 3Q3GA 1E8WA 2HTKD 1CLZL 1E3XA 1SVBA 2BOLA 4IRJC 5LBSH 5CBEA 3X17A 4DKEL 2R7EB 2X4RB 2OJZL 1CL7H 3ZDYF 1PDKB 3WN6A 5F44A 2A0LC 2CDEA 4JKWA 3L3JA 4KUCD 4YC2B 4JFOB 4FAAB 4AUUA 1FNEB 4ZXBC 3OR7A 2Y25A 1CI3M 2QR0B 4NZJA 1RZ7L 4X7SH 5DWPA 5E2TH 3SDDB 4OGAD 5F9JB 1SF5A 5DD3H 1HIML 3NIGE 3I9GH 4KKNA 3FB6B 4ZRGA 3S35X 4A2LA 1XF2A 4P99A 1M2OA 1DDHB 4ODTH 4TLTA 3QDGA 1Q9LA 4YFLI 1ADQH 1NPUA 3GGWA 4JCMA 2OYPA 4EDXA 1BX2B 4I18A 1KELH 2AV7B 3ARBB 5AVZB 3WIFB 3QDMB 3RY6A 5CHNA 3C60A 4HJIA 3M07A 3HUJA 4BDVA 3P9LB 4EN2A 5J56B 1IILE 2A6KB 1P2CA 1PIGA 1AD0A 4HXAL 1LWJA 3AS2A 5DCCA 1LP9E 4P2YA 4APQC 4GW4A 1CFMA 4F3FB 3HE6C 3CSGA 1SBSH 4MASA 1AXIB 2WBJA 3S3SA 1T4WA 5IQLA 1ZIAA 1D9KC 4OZHF 3CQPA 2EO9A 1V3JA 1KPUA 5IB4B 5DR5L 1RZFL 1GS8A 3KXFB 4NKDA 2OP4L 5I1JH 4N1CA 1KCWA 3UERA 4MJIE 5IQ9A 1BGXL 4DN3H 5A43C 2PP7A 2VLJD 3I6LD 3M46A 3K2UL 1CICA 1L5GA 3VE0B 3L5WB 3VWKA 3U4BL 2V7NB 2WXLA 2OR7A 2G2NA 3OGCB 1O5PA 4XHJC 4ZPTA 4YHIA 1J1XH 1KIRB 3I3EA 1WPCA 5CILH 1AS7A 2QADD 1UASA 5HGAB 3X1EA 1MHCB 35C8L 5E2UL 1QO3A 4HGKC 3KPQA 1J8HE 4LSTL 1CXIA 4XVSH 3AREC 1UA6H 2EDHA 5FKPA 4N0CC 1KC5H 4OB5H 3OMZA 1U3HA 2CBMA 3BOVA 4HD9A 3NTCH 1F6LL 4WEMB 4ZG1A 3ILQC 1CXEA 2ZYSA 3O11B 2ENQA 2X1OA 3CFEA 1U93B 4L2YA 4JFFB 3WY4A 9CGTA 3B2PA 3MRFA 4P49A 3O6LH 4GXUN 3UFIA 5FYKD 3PJSA 2VXSL 1ITCA 2KLSA 5J13B 3MREA 3IMUA 3M1BB 4ONGL 1PD0A 3MNWA 3PP3K 5CWSB 4P9HH 3GHEL 1HQRA 1XD1A 1KTKE 4MMZB 2FX7H 1GAFH 2GJPA 2YJQA 4MA8H 5KW9L 2K7QA 3R4DA 3QXDB 3IXTB 1RJCA 5GRJH 1DVYA 1IFHL 1KIUA 2YBRB 2A74C 5I2IA 4MA1B 2I32A 4B0MM 4H20L 3WAKA 5B7FA 3QJUB 2MHAB 5E2VH 5DJ2A 4B5EA 1W0WB 1T7ZA 2C9QA 4F7CA 5CMAB 5F9OH 3SE4A 4XMLH 3CIQA 4CW1A 3DHUA 4V1DA 4IOSA 1DQTA 2I9LB 3O6FA 3HS0B 4R84A 1KGUA 5IW6B 4OCRL 2NX5D 1F13A 4GP4B 1F6AA 4PMEA 2E86A 1TUPA 5JHMA 3P3UA 3BSGA 3QEGL 5C92A 3AXLB 2Y7LA 2ZWSA 3AT9A 4OFQA 3UPRB 2QPFA 4EVNA 1FFQA 3HNVL 2Q1EA 5JW4N 4WTZG 1E6JH 1S9YA 5GS0D 5JOPD 1E3ZA 1RIVL 4MBRA 4OJFH 5T3XL 5AW3B 5JA9A 2XSKA 3QIBD 1AHWA 4BWWA 5BVJB 5BS0A 2IWGA 3BPCB 3EUUA 4JFXA 4JFDE 1FFOA 1JHKH 3FOLB 4UDTB 4XBPA 5IUCA 1NZRA 3EJTA 5EC2B 2LLGA 5DMKA 1E9QB 1SXSA 1J05A 3ZE2E 4BFFA 1JGEA 2FH6A 3FN9A 3W37A 7CGTA 1JWUB 2D7OA 1FP5A 1WHOA 3FSZA 5I1EL 5F7LB 2VW4A 4B9GA 3MCG1 3O45A 4HUXA 3MODL 3L3OA 1WYJA 3B9DA 3C12A 3IGUA 4RGNC 2VXTH 4TL5A 1NQBA 3QZOA 1CI5A 3A4AA 2LFEA 5CCJA 5EU5A 5IFAL 3WDJA 4X5PA 3TZVD 3WY3A 3BLBA 5E00A 3DX1A 2WLNA 1TVBA 1YEHL 1A7QL 2NY3B 5I6KA 3L4CA 2KI6A 4XOCA 2DYSB 2IANB 4Q7DA 1UXSA 2O5NA 3MN8A 4P2OA 3RWJB 4Q9BA 4Q14A 1YEDA 3U2JA 2YK1L 5ES4B 1U91B 2XY2A 2ZCZA 2QL1A 3THMH 1SBBA 3QT2A 2J12B 4IQHA 2CNYA 4PMFA 1Q0YL 5CEYA 3BKYL 4TSCL 4KUCF 4I88A 3U36A 4H1LB 3D0VB 1LQBC 4CMHB 2BZCA 5MP6L 3K71A 1ZA3A 4FFZL 1A9EA 4ODWA 1CXHA 1TPXB 1QLRB 3MI6A 3WY1A 3SJVD 1ED3A 1BVOA 2QVKA 3MGOA 4LRIC 3VXQA 5I1KH 1Q0EA 3N85L 5GGQH 5DD1L 4P46B 3FCSB 2WLZA 3BUBA 3ILDA 1OGAB 4JO1H 4MJIA 4AC2A 2P42B 5LGHL 3TBYA 2CLZB 4JRXE 4BWTA 4NUGH 4GH7B 3BDYL 2QMJA 4ELDA 5IBTL 3HN8A 4BZ2A 2APXA 4HVBA 4WNQB 4E5XB 1WF5A 1EO7A 5FF6B 1BFVL 2HYMA 3UJTL 4AV0A 1WZ1H 2F1BA 1HSAB 2QSCL 3QNXB 2WVUA 2ZAGA 4ZYKA 1D5BB 3CSBA 1UD5A 2R0ZL 5EHFA 4JQXC 1EQWA 3K0WA 5IWLC 4HC1L 1HL9A 2Z4QB 3SPVA 3VH8B 5D7KD 2DB8A 4X7CC 1CD0A 4MSWB 4V2CB 1TLKA 4ZMVA 2DQTL 4HPOL 3TN0B 3O2VH 5ADPH 1JGDB 1ETJA 3KPPA 3LNFA 4ZT1A 1L0PA 3O3DB 1MRCL 2F54D 5L4JA 4KH2A 2IEPA 3CC5B 4K2UL 1TEGA 1GR7A 2R0KH 3FHEA 3GNML 2IFFL 1DVQA 3RTQA 3L08A 3H9HA 1YAIA 1I8IB 4PP1D 3OR6B 3S36L 4N2LA 3V6OE 1E28A 5J4MA 4I89A 4U1MB 5J57B 3QJZA 2IH1B 2WTRA 1RULH 2XYCA 4L29A 4TSAH 3ZL4L 5CLWA 3VXRA 1GOGA 3CV5A 5K59E 1JNNH 3NCEB 5HGHB 4B97A 3GIZH 3NCXA 1NGQL 2FVNA 4UT6H 4F1SA 4P4KA 4OZGA 3N42F 1BAGA 4Z0XB 1JYXA 5ITBL 1ONQA 3ZGIA 2R4SH 4N8CL 3OSVA 3I6GA 4PVMA 4KQ4L 5D93B 4JUTA 2OXGB 5CCKH 4AVJA 4V11A 3E3QE 3NGBC 4PGJA 3VJ6B 2VMCA 1GTNA 1UVQB 4DKAA 1XEUA 2C3WA 2I60H 4AQ1B 3K6SA 2CGYA 2OQJA 4JRYA 5K1JA 1UD3A 1OT1A 4XP6H 3HEIB 2HRPL 4J3XA 4MNHB 2LHAA 4YHLL 1KPVB 3CHOA 3BO8B 3SPJA 3APMA 3AWGA 4HG4J 2VL5B 3AQDA 1QNIA 3MRCB 1NOAA 5CZKA 2ZOKB 3GI8L 2WCSA 4QHPA 4X0NA