2Y7LA

Structure of n-terminal domain of candida albicans als9-2 in complex with human fibrinogen gamma peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
312
Chain Sequence
b'RKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKNSEADSDGDVIVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ-LIKE ALS9 PROTEIN
publication title Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
total genus 76
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7lA02
5IHWA 3IS0X 1R19A 4F20A 4LEEA 2Y7LA 3AU0A 5CF3A 4LE8A 3V10A 5CFAA 4F27A 4B60A 2RALA 4F1ZA 2Z1PA 3IS1X 1N67A 4JE0A 2F68X 4F24A 2VR3A 4JDZB 3ASWA 3AT0A 3IRZA 4LEBA 4MBOA 2YLHA 2Y7NA 4JDZA 4MBRA 1R17A 3IRPX 4B5ZA 2Y7MA 2Y7OA 2F6AA
chains in the Genus database with same CATH superfamily
4ZO9A 3RNKB 3HHMA 5AL0A 4M93B 1E5ZA 1SHMA 1WUZA 4BZYA 2L7EA 1SM3H 2MH4A 4U49A 3WLWC 4F1ZA 1BVKA 1T0MB 3LZQA 1CZ8L 1DUYA 3WY2A 3V4PA 1XGUB 4BK5A 1CGVA 3F7VB 1NEPA 1X9UA 1XZ0B 4LDCA 1UJTA 4HX1B 3AXHA 3HBZA 5BV7L 3VRJB 5C6TL 5AKVA 2WLZA 1G9MH 1HXKA 4I18B 2CJUL 2F53D 3GJFA 1KG0B 4MD5B 1JPTH 1JPGB 5AL8A 3ULVE 4KH9A 2YPLD 1I1RA 2VTFA 1E8WA 1WFNA 4Z76A 4ZTOL 2FSEB 5B7MA 2Z64C 2ZP8A 3PV6A 4GSUA 2ZKWA 3NIDB 4Y5XA 3MLWL 3QRLA 4BKLA 1R1CA 5C0AE 3D0VB 2C34A 1INDL 1DE4A 3RG1C 1HYSD 3WMPA 1YYCA 4OD2B 2B5IB 1KGCE 2H4EA 1LEGB 2BP8B 1I8IB 3E9TA 3LEVL 3TJEH 3MA9L 2V5SA 3UTSA 4F7EB 1L7TH 4GLRH 1ZK5A 2LFGA 4A2FA 4PHXA 2EUXA 4NKQB 1EJOL 2D0GA 4KNTA 2EDOA 4HPYL 3L95A 1IIKA 1ZSDB 3ARYA 3ISYA 1V55B 1AGFB 4NWTL 2XY1A 3G6AA 1XIWA 2QTEA 1IAIH 3J07A 1U93A 5EFIA 4DN3H 1WPCA 4NAMA 2K6YA 3MRDA 1TETH 4N0FB 1KJVA 5D5MF 1N59B 1QLEL 4Q6KA 5E5LA 4ZAKB 3TVMC 2OMVB 3TH2T 3D39D 4FQJL 4Y4HA 4LT7A 1BW8A 4JPKH 4AGOA 1JZDC 2EH8H 4DFIA 1SDDB 3EKCA 4L3CA 5BVPL 5CN3A 2IH1A 1AGCA 1EBPA 3HE6D 3L9BA 3PABA 5J56B 2DIJA 1EVUA 3TO4D 4GYBA 3TA3B 3ZDYF 2O5ZH 3WN5A 5BCAA 3WNPA 3KD4A 3N2JA 4QY8B 4DKDC 2EIBA 4PLNC 4KK9D 1BM3H 4P2RB 3W0WB 3OWEA 2X9XA 2NYYD 3BPNC 2G5BB 2QVKA 4PI2A 1HH6B 1OAKH 1JZFA 5HHXL 3U48A 4H0IA 1S7WB 4YO0A 1ITCA 4FKEA 4CMMB 2G75A 4TUKL 4JRYB 4Y2DA 1F6FB 2AJZA 5MP6L 3SE3C 2F8XC 2IQ9L 2FIRT 4Q6IB 2JJUA 2YUZA 1RI8A 2AI0L 3T0AA 4YAQA 2R1WA 1JNLH 1LO0L 3ARFC 3P4OB 4PGBA 4J8RB 2OXHA 2EEFA 3V0VB 5GIRB 4H13C 4CRPA 3CAFA 1UKSA 2V6HA 5F44A 2Y36H 4QXUH 5IHWA 3Q5OA 4YIQB 1GGYA 2FYYA 4AT6B 2EP6A 4NC1E 4P2OC 1TXKA 1I7TA 4FAAB 3GSNA 3REWA 3FB5A 5E2VH 3TWCL 1J8HE 3ZOAA 3SDCA 3L8QA 3HZMB 2IVFC 3IMVA 15C8H 3TA4D 3RUGA 2DW5A 1OGTB 4RGNC 3BSZA 2XN9D 2CIIB 2IQAB 3ZKMC 1J8SA 2FO8A 2PABA 4HIJA 4KJWD 1ZA3A 3RI5K 1JHLH 1B0WA 3UDWC 1KSRA 3QC6X 2JB5L 3DJRA 2E4TA 2WCGA 3L9RA 4M7JH 4HKJA 4OI9A 4FNSA 1IEBA 1KTBA 5GJSL 3IGFA 1D7DA 5GS1C 3GIVA 3LH8A 4FFYL 4H8QA 1LO4H 4GSDH 1BOGA 5L9DL 1YEKH 4Y4FB 3CDGB 1GKOA 4F3FA 1G7HB 4HUVA 2X7LA 4J3OF 1I9IH 2Z31D 3H54A 5AZUA 5KANI 4F37F 1KTRL 1LO2L 1KEML 3DJSA 2X0VA 3C2AH 3P2DA 4M8QA 1CUOA 1VRSA 4Y5YB 2XWZA 3MJ9A 4IMLA 3H3PL 2UY7A 4J1UB 3PWPD 4NFDA 2WAHA 2OMBA 1U8OB 1XMEB 1KBGH 3ABZA 4GW1A 4CSSA 1FNEA 4ZX5A 5CJ8A 3KPMA 3MGAA 5GRUH 2ZSWA 3D30A 4LF3B 1GYWA 3SBRA 3MLUL 3MBXH 2HSIA 3WFHB 2XWTA 2AJYH 4MNQE 5GZOA 3GSXB 4P3WA 2W95A 2ADGA 4BFIA 5BZDA 1HQ4A 2YGPA 1Q4NX 4GXFA 1D7CA 2WTRA 3P9WB 1MI5E 4RX4D 5KSUB 1YEDA 4XHQA 3WG7B 5F1KC 4OGAD 1R3KB 3BAEL 2E9IA 3QS2A 3H53A 4NPKA 3VRLF 2OMTA 3FTGA 4XCEB 1P5VA 5KBMA 4RAVB 4Z0XB 3EIFA 5F96L 4MAUH 5D6DC 5I26A 1KN2L 5D2NA 4QLRA 2R27A 4M62H 1KJ2A 3M46A 4FLHA 4RSYA 3AMKA 5GHWH 3F12A 5CR1A 5FO8B 5TE7H 4QO1A 1HE8A 3UCRA 3GSWB 4GQ9L 3CHXA 2QL1A 4DHLA 1KJMB 2A0LD 2AJSH 4XBMA 4KTGA 2W60B 3DUUB 3QUXD 4PLOB 4QRRE 5E6IC 1N6VA 3ORJA 4OLVL 1HEZA 3QIBA 1DBBL 4LRIA 3G5ZA 5K59E 3STLB 1RP9A 3OZLA 2EDKA 4WW2F 3HCVB 4PLJD 3N42F 5FK9B 4Z9KB 3NA9L 2OMYA 2H6OA 2HJLA 3MV7E 2Z92B 4RGOH 3FRPG 2NTSP 4PWHA 3QORC 3TBSB 2OQJA 1DEDA 3QUMH 3T3MB 1KZQA 4FQ2H 5E1AA 5ADOH 4P04A 4LDLB 4N2LA 4Y9BA 1NBCA 2WBJD 1FIEA 4A2EA 4WHTB 3ECQA 5CZVH 1FRGH 5C09B 4DCQB 3MVSA 4KQ3H 1CTOA 2WOYA 4NGHH 4R7NA 1ZVNA 2ZWYA 3BPNB 3U6RA 4W9HC 2EDTA 3LKOB 5DQ9A 3A4EA 5DGRA 3VNZA 3QJFB 4Z77B 2NY3B 4D2NA 1E7UA 3QT2A 5LCVL 4GMTH 5I19H 2Q3AA 3G6JB 1L3NA 1ZHKA 3QQ9C 3HOGA 2NYZA 3K2KA 4IRZH 4ALAH 3K8MA 4FTDA 4M7ZC 4E9WA 1AQKL 1FNHA 4NUJA 5DVMA 4PGDA 1I1AD 3UP1A 2CCWA 3C12A 2J55A 1FZJA 4LRNH 5E8PA 5F1NB 5HPMA 3GUTA 3U9WA 1DCLA 2WBXA 2A74A 4LHUD 5AKRA 2G0KA 3N85L 1KTDB 4ELMF 4CVUA 4JHUA 4KI5E 4U2ZA 3ILQD 2AEOA 4ODSH 3SCMC 2DMGA 4BFBD 4P4KD 1TNMA 1ZT7B 3P3SA 5C71A 4TQEL 3HUJA 3EJYC 2FGWL 5ISZA 5D9SB 3ULVL 5F1OB 4KDWA 3WFBH 3FO1A 3MV8A 3VXSD 5IY5B 2YXMA 4AQ1A 1PNDA 4PWFA 5JLZA 4UV7L 4IEFB 3LHAA 4BSVA 5AZEL 3L6FA 1MFAH 3PWVB 4P05A 5J13B 2X4NB 4L8BA 3ZO9A 2ZX5A 4LHUG 1P4LB 1A4JA 3HAEA 4YDIL 3WS6A 3DVIA 2MMXA 4H8HA 5CD5D 3O6FD 5DJYA 2UXTA 1TZOA 3BKML 4XBEL 4F2EA 3VTMA 1SY6L 4GG6E 2OCJA 4J8QA 3T0EA 4HH9A 1D6VH 2I27N 2CNZA 5IHUL 2QKIC 5I6XC 3HRPA 3US0A 5INDB 3EH3B 2HTLC 4KMTL 2V17H 1BIIB 4X6DB 5DR5L 4ZO8A 1A0QL 4BDVA 4D0DA 4YSQA 3T04D 3LQMA 3GYRA 3P69A 5IBUB 5IJBC 3BDYH 5E70A 5IFAH 4R2GB 3U83A 4F9LC 2EQDA 3MRNB 3JBG7 1P69B 5EOCL 3NFNB 2IAMC 4PJEA 1ITBB 1A1MA 1H6EA 3QI9A 4RZKA 4U3HA 4Y1AD 3FOLA 3OTTA 1RPUA 4NQCB 3CHSA 5HHOA 4GEJA 3RWJA 3ARUA 2ZPKH 4F8LA 4HXBL 3FPYA 4FXGA 4NCDA 2B3IA 4DJMA 2VLKA 3V0GA 1PVHA 3ZYOA 4MSWB 4FFWC 1DVUA 1DVXA 3ZHFA 5BQ7B 4G6AC 2HLFD 1QHQA 1S2EA 1ML0A 1SJHA 4L9LB 1QA9B 1TOXA 3INUL 3VI3B 2Z0BA 3CDZA 3V0WH 1IM9B 4UOQA 5D1QA 3ULUE 2FH6A 2XOTA 1JZ8A 1JZ4A 4HA1A 4LLUB 4HP5A 4RBPK 12E8H 3OR7B 2NNFA 3D0AA 4F57L 4L4VA 2QVMA 1U8IA 1IV8A 3GHEH 3IDJA 2F61A 3KXFB 4JL2A 1KIQA 4OLWH 3WKNA 3RPIB 2Y69B 1T20B 2IOOA 3HZ3A 4HZLA 3ULVC 1JPFB 3P77B 1TQSA 1JGVL 1EIBA 3MUJA 4NZFA 1NL0H 2OSLB 3CVHH 1JGEB 1UZ8B 5IB2B 2E6QA 2XI9A 1UACH 4KHTH 3UAJD 1HSAB 2CIKA 2DN7A 2F08A 3DTDA 4HOZA 2HFEB 1JK9B 1Z5YD 3EYFA 4K94H 3TS8A 3LVTA 3H3KA 4A38A 2NUPA 4XNQB 5DF0A 4LIQH 5F9JB 2ESVA 2IWEA 4N8VA 4PBWD 3PE9A 4Y2NA 4ZSOA 5EA0L 5FYLD 2YRLA 1N70A 2UYLB 1WZ1L 5E4AA 4AV0A 3Q1EA 1CFNA 4OJAA 3S34L 4L5FH 3SQOH 3QYMA 4D3CH 1ZHNA 3DC0A 4NCC1 4LL1A 5CU5A 4LCWB 4ZAKD 4O2CA 3A47A 4GG8B 4WI8A 3WELA 3O6MH 1J0KA 4ZQKB 2F53A 4WI6A 4KH2A 2NUTB 1A7RH 2CU9A 4TPRL 4DZ8B 2Q8AL 5I8OH 1B0IA 3GRBA 5HDBE 4OZ4B 3O3DA 4JO3H 5IOKA 3TA3D 1A6AB 1F5WA 2DMHA 3NSDA 5KSAB 1DSFH 3QULA 4KVNL 5F7AA 2LAAA 4PJGF 3P3YA 3W0WD 3EOTH 4H8PA 4JFOA 1YMME 3WHXA 3EH1A 4ZXBB 4LPWA 4HCFA 2BVQB 2VZOA 2IJ0C 2W65B 3QIUC 2A3TA 5BOPA 1F4AA 4R4ND 2IDQA 4XCFL 1CFQA 5LN8A 5I73C 3L4VA 1ORSA 4JRYD 1DBML 3BLKA 1JAEA 4QRPE 1NCAL 5D4JA 3QA3A 3T1FB 2C9XA 3LZPA 4J6IA 4HJ0D 3KLAA 1ZTMA 4WGVB 3ZQXA 4AVHA 2AABL 3WLBA 4NLHA 3FO2B 2V3EA 4RLDA 5EPMA 1KB9J 4MDRA 4Y2OA 3FYIB 2NX5B 4PM1A 1XWVA 4CVZA 2ATKB 4MDJA 3DUSB 2B20A 2IXQA 5G4MA 1J1OL 2X6AA 4UT7H 4N2OA 3D39A 4N90D 2DLTA 2NMSA 3I6SA 5E6RB 1KLUA 5ILTL 1WO2A 4J3TA 3GMLB 1T4WA 2FBOJ 2ZXEB 1Z9PA 2XETA 3HE6A 1BQLL 2EDHA 3BIKB 5GRJL 3TO4A 1CFSA 3A6CL 5EBWB 4NC1C 4ODUA 3P4MA 2AZAA 2G9HA 1JV5B 3KM2A 4QJ4B 4JO2L 5AB9A 1GCFA 2X4QB 3CX2A 4Q9CA 4J3OH 5KS9F 2IADA 3CFKA 2ZAHA 4LOUD 4U6HA 4NKMB 2V9TA 1OSZB 3HI5L 3ZU8A 1Q0YH 1W0VB 2JCCA 4HMEA 3GM8A 2DQEH 2GIYA 3O2WH 2QKIB 2X4TA 4O51A 2E5EA 2ED6A 4P59H 4PRHA 3HE7B 2PTUA 2KLRA 3QDGA 1XTMA 5I30L 4LEXL 2PNDA 4XTRD 3RURA 4Y4FD 5DSCB 3HNVH 1YJDL 1S5HB 1NPNA 5IQ7H 4R84A 3GI8L 5BMFH 3WHE0 4AW4A 1M3IA 7FABH 1NBVL 1R0AH 4YFDB 1XDTT 4IBLT 5H37A 2QADD 2GITA 2VM4A 4IRJA 1T04B 4BK8A 3TEYA 5ANMB 2F58H 2HVKB 3FU6A 1U8CA 2VXSL 3QDME 2MEJB 4RVBA 4YSOA 3WEXA 1N4XH 1T1ZB 4FHJA 32C2B 1SJEB 2HWZH 3QR2A 3TTYA 5LG6A 1ETZB 2KT6A 3ZK0A 4FLQA 4HKBA 4NO0D 1JD7A 5IQLA 4X6CB 2XN9A 3AXLB 2E8ZA 2EUVA 1QLRB 3WLWD 4LCYB 4AL8L 3WL9B 1Y07A 2IFFL 5I1LA 4OTXH 3IJHB 1SYVA 3U4BL 1NC4D 4NI3A 4XCYA 5GRYA 3IDUA 2RFXA 3F05A 2XWRA 3S7GA 1BXXA 1TQCB 3IGKA 4Z7QB 1VCAA 1HHHB 3VXME 1KCLA 1XT5A 3US1A 4NRXB 1YEFH 5C0BD 4E9QA 5CUSH 3NMEA 3B7SA 1E2VA 3PGCB 1IO4C 4HHAA 3TCLB 1AI1L 4MRBA 4Y5VA 2Z31A 1E27A 1JHTA 2COQA 4H88H 1EH9A 2XG4A 4KTDH 4J3VA 4YHML 4K5LA 4G9FD 1FG2A 1RZKH 5IVXA 3BP7A 3MOBL 3FQXA 2AMUA 1TJHL 4YDLC 3STZB 1DLFH 3QE5A 3PWPA 3OKMA 3PWLB 1ZT4B 2R7EB 3FT3A 3CZNA 3MLZH 3FCGA 4YS4A 1CGXA 2ZYIA 2FNWA 1RMFH 3KGUA 4RWYL 2E56A 3DOIA 5C0CB 3HG1A 1O7DE 4J2XA 1PDKB 1YSOA 2VM3A 2WXGA 3GMRA 4A67A 2DM2A 4BZ2L 4XOBA 2I85A 2AKRB 5ESQA 1PX4A 3LEYL 4FXKB 4RX4A 4OJEH 3ARZA 4G7YL 3RWGA 4PJAA 1IARB 2F8IA 5M7QA 2PXYB 3KPRE 3RZWA 3MRRA 1CBVL 2B77A 1TIUA 2BVUA 3L3HB 2BHFA 3MKGA 1VHPA 1YJDC 5ICYA 5HHMD 4EZJA 4KZEH 1ZIBA 4WQOA 3MNWB 4NP4L 3QS3A 5J11B 2OL3H 1BLIA 4WFHE 4ZW3A 4D8OA 2HAZA 3PP3H 3AY2A 4NRZB 1T7XA 1HXMA 4JRFA 1XGPA 2F8OA 4N8UA 5F7FA 4AK2A 4MNGB 1QSEE 2NRDA 5H2BB 1EXGA 1YAIA 2EDDA 4ELDA 2BO0A 3ZRCC 5T5FH 5JOPE 2ICWJ 2ZXWB 3PJLA 2WVUA 3QJZA 4U1NB 3VGAC 2QQNH 1EFQA 4G72B 1TKWA 1S9YA 4PN6A 1S7TB 5E8EA 3QUYA 3T4AB 3ASNB 1KYAA 1N8ZA 1ZHBA 4XXDB 3BP5A 4Z7UA 3NDYE 4YL9A 1DJWA 1OAZL 3A23A 3ARFD 4J7RA 4XMZA 1ZJAA 1DJYA 3PNRB 1ZGLM 4HSAC 3OLIA 3S3JA 1EXUA 1O9WA 1YY8A 1MIEL 1ZV9A 5DS8B 5LO7A 1XGQB 3D07A 1XH1A 1F8TL 1TQTA 2VDPL 3M1OA 1PKQE 3FB7A 5EOQH 1WH0A 4PJDB 1EO5A 4QOKD 3H6JA 5B1CA 4JVPA 4P2OD 3ULUL 2YUXA 2ZUTA 4M1DL 4C56B 1C12B 5HDOA 1YUHA 3NCWA 4F15C 4ANXA 2X28A 2WBJA 3FFCE 3DOSB 4S0SD 1WA2X 2HPTA 4KI5C 4UQBA 4K3JL 3U0PB 1RZ7L 2A1WL 4CGTA 3KPSE 2Y6SC 2VMFA 4YHIA 2APVA 3MQIA 3ZKMD 4OCWL 5DRZB 3WFCH 5SWSD 3NZHH 3VVVA 2V8LA 4DGUA 4Z7NB 1HHKB 4UINH 3GLEA 2IWFA 3TZVB 4L3ED 3ARRA 1JFQL 1OP9A 1YYMH 4NOBA 2O26U 1TJGL 2YS4A 3ROOA 3WIFA 3GB7B 3GIZL 4UQ9A 4HLZH 1NOAA 1Z9OA 5F70A 3B5TA 3EGSA 3WO4B 4KTYA 2IH8A 1WJ3A 4ANVA 4PRIE 4FQLL 1YNTF 1VPOH 2UVFA 2WVVB 4JBSA 1T4KA 5CMAA 2CPUA 4P5RA 4AC2A 4LASH 4B0MM 3ET9F 5IMLA 3II3A 5B39G 1TEYA 3MNVA 4G1EB 1RVFH 3VI4B 3ABLB 2W59A 3OF6A 4NOFA 4KMQA 2HKFH 1UVQB 1F42A 4L8SA 4JCLA 3RL1A 3BOVA 3KDMA 4IDLA 1W9XA 4LAQL 4WWKB 4FQHA 3SJVE 1UYWH 1FL3B 3ARDC 4TQ8A 1FH2A 2F9BT 5JR1L 1KGXA 2VZUA 1DJZA 2VDQL 4Q9QL 1AFVL 4PHZA 2WD0A 5JIIA 3KLHD 3IFOB 1S7UA 4K5NA 3ISRA 1CJYA 2RD0A 3B2VH 1TZGH 3DWTA 4CSZA 4OB5H 3K8KA 4YFLI 4X5WB 4HUXA 1BD2B 5F9DC 1DBKH 4OLYH 3O6FA 3G5YA 3P9LB 5IFJA 5ERWB 1CDJA 2DQDH 4MA1C 5GS2D 2P43B 1FPTH 4QRAA 2X0WA 2BOBA 1IC0A 4HPHA 3WMSA 1IM9D 4BFKA 3SO5A 4U1LB 5EO0A 1NGXB 4R9HA 1MFVA 5IVZA 4OH2A 3AWFA 4QRQB 3RBSA 1INEH 1XXFC 4O02A 2OR9H 1TYEB 4YBHA 4B3VA 4MBOA 4HJUA 1IGYB 3P3RA 3ULUC 1K5WA 3RKDC 2A83A 4XPFL 2A6JA 3A4FA 1G84A 2J2ZA 3CTTA 3FZUC 1T1YA 1EJFA 5DYOA 5EZPA 3WTSA 1LK2A 2ARJQ 3M8OH 3UJIL 5I71C 2I5YL 3IPEA 1L9SA 5E6ID 4JEGB 1L7IL 3ESPA 3NIFB 4W81A 3TP4A 1CLYL 1PZ5A 4GOSA 3QC5X 3P40A 2JVUA 2QR0B 4QTHA 3HHSB 2CDGB 1NLDL 2BSCA 3LH9A 3UYOD 2B1AH 1S3KH 1OARH 3PL6C 2WXFA 1Z3GH 4XNUH 5DVNA 5F72S 4ZPTB 2E7MA 4BQCA 3FQ4A 3HJ0A 3AS0A 1T0MA 5KYXA 3V79C 2BIHA 3MLVH 2EZ0C 4Y7MA 1XGUA 5DHVB 3L2LA 3F7VA 3VFWB 3SKJL 2N1TE 4EOWH 4HX1A 3D9AH 4UILH 1WA1X 3VRJA 3ZDWA 5KSBA 1ADQL 3B2UD 3SB3A 4GQPH 4WI3A 2NNCA 5GRXG 5B21A 3A6BH 2FT7A 2AXWA 3BUTA 4MD5A 1KG0A 1I4FB 1JPGA 1QUNB 1XX9C 1FZMB 1WFIA 3CMOL 5DJCB 1ZHLB 1HOEA 2FSEA 4JE0A 2XIDA 2CHDA 3VCLB 5MENE 1SHSA 2J20A 3QUHA 3D0VA 1QFPA 4RRPA 4ZTEA 2HKHL 2X2HA 5EORH 3QQ9D 3V6ZB 4F9PC 4ZXBD 3F83A 4OD2A 1G9EA 4OJFL 1LEGA 1DQMH 2BP8A 1I8IA 4KX8A 4WFED 3UAJA 1FAIH 3BVTA 1L5GB 2QPSA 3HKZA 1OWRM 4PAZA 5E2TL 1K9TA 2KQMA 4HT1H 2OZ4H 3L5WB 1ND0B 3BMWA 4KKPA 4F7EA 3FCBA 1JXKA 1KEGL 2FWOB 5E95B 4E9VA 2XA8L 1ZSDA 3NSXA 4EZKA 2H3NB 4ERSL 3SCMD 1AGFA 4A7UA 1FH5L 2WUCL 2WBKA 3FAXA 4N0FA 3EJYD 4ZUUB 4F8TA 1A7NH 3VXTB 3IPFA 1AXSB 1MREL 4ZAKA 4AK1A 2FQGA 3NFSH 4LARL 2OMVA 4OGYH 4XPBL 2BP5M 1ZANL 1KCRH 2WTPA 5EIIG 1SDDA 1CF8L 3HC3L 3WEAA 1MFDH 2BXYA 3TA3A 1NGQL 2XVKA 2UVEA 4QY8A 1BFSA 4EQ3A 1F4YH 4TRPH 4YDZA 4P2RA 4HOMA 5LBGA 3W0WA 4WWOA 4MB3A 3IE9A 5KVGH 2G5BA 1HH6A 1PLBA 4WF7A 4NJAL 1S7WA 1IBYA 4HIPA 4WGWB 4JRYA 2R9HD 5JPNC 4Q6IA 1CMOA 5G4NA 3IFNH 1S7QB 4HUUB 5DD5H 5F97E 1FFTB 4G7RB 3E7JA 1A6ZB 1MHEB 3P4OA 4MX7B 4J8RA 1F1GA 1SJXA 4WHDA 3POCA 5LGHL 4K3DL 4AYFB 4DK3A 3AGWA 3E6FB 4YIQA 2IAMD 3APNA 3WEMA 1UOLA 4GRWB 3D05A 4AT6A 4B60A 4R4BB 2WLLB 4WAFA 1K3ZA 3WIIL 1T5WB 5E4OA 1A25A 3RY4A 1OPGH 2ZCZA 4WI5A 3HZMA 3LQAL 4OZFA 3U0TB 1HTYA 1MNUH 1OGTA 2R2BB 4DVBB 1X5IA 2CIIA 4PYGA 3WIHA 2IQAA 3NSYA 4FFWD 5GGTL 4MZRA 3Q9PA 3TT1H 4G6AD 3VXRB 1RIVL 3NJHA 1MG2C 1SJMA 3W37A 5I6MA 2WNWA 4YLBA 1CFMA 4JG1H 3AM8C 4DN4L 5BW7A 2WN2A 4GRLB 1BREA 2VOTA 4M6OL 3ZR5A 2VLRE 5I24A 3TN0B 3DUHA 2XG5B 3IAQA 4KPHL 5E5MB 4Y4FA 3CDGA 1G7HA 1I3GH 4UV4L 1CIUA 4D9LL 5LBSA 4B27A 3QHZH 1FYTB 4JFQA 4S1DD 2E7DA 4YPJA 1FO0L 1A6UH 4Y5YA 5IV2B 2VAJA 4IU3B 4J1UA 1BBJB 1U8OA 1UXSB 1RK0B 1AO7E 3QDJE 1MKFA 3SBWC 1E4XH 4W68A 4LE8A 4KZ0A 4LBEB 4LF3A 4RETB 2YQGA 4TSCL 4L05A 3WFHA 1KGCD 4OQTH 3LY6A 2QVTA 5CGTA 3GSXA 4NDMB 4PJIF 5C0CD 2Y5TB 5FFLA 3VFTB 1ILUA 1NC4A 2NCMA 3LOWA 1D5XB 2EDFA 3T3PB 1X7TA 4CKVX 5KSUA 2ZUYA 1TZHB 3G6JE 2YUVA 2DI7A 3GXDA 1O7DC 2EIDA 3VAEA 2PXYD 5BPPA 1UH3A 3RUGF 3JWNH 3LTVA 3VFMB 4XCEA 2K9UA 4RAVA 4Z0XA 1SN2A 2GG1A 5KYUB 1OWWA 3KEDA 1A6VH 2Q86B 1EX0A 2P24B 1JE6A 4DVRH 4EDXB 2Y1YA 4AH2B 3TESA 5FO8A 3N5AA 4N5ED 5IZ7A 4IDJL 4M48L 1DQLL 1GOHA 1KPUB 3GSWA 1U36A 5MEPA 3QIUD 4X4XA 2ADFH 1KJMA 1A9EB 2BVTA 4WRLA 1DL7H 2W60A 1DCEA 3DUUA 3LQAC 3MRJA 4HWEH 3DSFL 1WZMA 4OAWB 5ACMA 2I9LB 4PS4H 1YN7B 3K6SB 4GSXA 4HWBA 3STLA 5EZIH 1OSPL 5FK9A 4GXUN 3RWIA 4BH7B 1MAML 2DQTL 2Z92A 5KYNA 2EXWC 4YWGH 3TBSA 2R1XB 2ZICA 5EUOE 4A6YH 3MLRL 5D70L 1YEEL 5JHLL 2Y2WA 4RA3A 3NJKA 1CG9B 3JZYA 4OIBA 2F5BH 2PW2B 5MHSE 4XMKH 4LEOB 3KVPA 5TDPB 5HY9B 4WHTA 3ZXAC 2MCPL 5DLMH 5LBVA 5C09A 4DCQA 3GGWB 4RDBA 3S0PA 4OZGB 1IKOP 3IJSB 3LKOA 3B6SB 4EIUA 3QJFA 8PAZA 4Z77A 2KQNA 4MQ7B 2YXWA 4RAUB 1G7PB 1I1FA 2YBRB 3O3UN 2Z7ZA 2C9RA 1MZYA 2J4WL 3W82A 1CDIA 4JO5A 2WXJA 5DJ8B 1IQWL 5IKCB 3I6KB 5DWUL 1QFUL 4HF5L 2D3JA 4C55A 2CA3A 2EDRA 1JHKL 3VTAA 3MBEB 4KROC 1HAUA 3OG4B 1KGIA 3CLEL 1FFPB 1KTDA 3MSPA 4XCCH 4L1TA 4X98B 3APCA 1W8EA 5GRZA 3D52A 1ZT7A 3WOVA 4JFEE 1RKRA 1W91A 1G6RL 4Z5RB 5TQ0L 4Z95H 1ROCA 4MBRA 4IEFA 5CM1A 4Y7OC 3FTXA 2V2XB 1YMHB 4FI8A 2VR7A 2YFOA 3N0PB 3KXFE 3ARTA 4XPTL 3UDWA 3L3GB 1EAJA 1P4LA 4RAHA 2HH0L 2WXIA 3N43B 1BD2D 2XV0A 1INQB 1VFBA 1BG9A 1J12A 2K9FB 3O4OC 4HWZB 5I1KH 2TRYA 2FJFB 1HT6A 3LPGA 4M3KB 4ODHH 4P5TC 3VSUA 2A38A 1AQDB 2QQLL 1MI5D 3EJJX 3TFBA 1O6TA 5E6ZA 2J88H 3TJHD 3DV6B 4MD4B 3MJWA 2VQ1A 3B7RL 5INDA 2APTA 4ONOA 1BIIA 3D8MA 4X6DA 4Y2LA 2QMKA 5BXFB 4UT9H 1M4KA 4LSRL 2F15A 4WKXA 2KS0A 3BPLC 2Z93B 3MMEB 4MCYB 3MRNA 2L0DA 1GC1L 1EWHA 1RJYB 3NFNA 1TZIB 4FFZH 4NLAA 1F02I 3VXQA 4NQCA 3O0LA 2NQ3A 3EH2A 2HG5B 3K1KC 3QIWB 4BINA 3K91A 1MCCA 2H0PA 2WQAA 1W72B 1XF4B 3V4VL 2Q7NA 3EH4B 3QSKB 2XA3A 4G6KL 3BDXA 4PJ5E 2EVFA 3VW3L 4GUPB 3W2DH 3JV4B 5CZKA 4N2KA 4EAEA 2E27L 2VDOH 4MSWA 1KBPA 2OPCA 3UC2A 1QBLL 5BQ7A 2VDNH 3BWZA 2VW4A 4QRSB 2Y3NA 4L9LA 4QRTB 4R26L 1QA9A 3IAPA 4YBLC 3VI3A 3VXOB 2VW6A 1IM9A 4JPWL 3BPOB 5D6DA 3DTUB 4JM2F 3D18B 4LLUA 1RJCA 3OR7A 4ZX3A 3GRGA 5D7JC 4FNLL 5I8CA 3ZRSA 4JGNA 4I3SL 4LVOB 5BUAA 1V3KA 5GRVL 1TTFA 3RPIA 4ATTA 4LSUL 2Y2TA 1JPFA 1TJIH 3P77A 5TH2B 1AKJB 3NAAL 2OSLA 5IB2A 1JGEA 1F58L 1UZ8A 4M8VA 2EC9U 1JVKA 2X4OB 4EJ1C 1HSAA 3JYCA 4R0LB 4XB3A 1XFPA 2YQ3A 3QQDB 4XT1C 2CRYA 2VC2L 2HFEA 5LWYL 1JK9A 1PZSA 2C3XA 4XNQA 5F9JA 1UJ3B 4LOEA 2VO8A 2P80A 4OCXH 4OBSA 4PJEF 3T77B 1IGML 3V4PH 4G70B 4MA8L 1XH3B 2UYLA 4FG4A 3TBVB 5HYFA 1MFEL 2XZZA 3QFJE 4KI5D 3TT3L 4N0UA 3MLTB 4J3BA 5T3XL 1J18A 1HI6B 4LCWA 2LABA 4GG8A 4ZQKA 4OI8A 2YMXH 4WI2A 4DZ8A 3GJFH 4XP1L 5ACZA 2J12B 3GXMA 2L8AA 3K6FA 1AC6A 4OZ4A 2VW7A 5DGQA 1QBAA 2X3CA 3LXAA 1A6AA 4MA7L 1C5CH 1KGYE 1D5IL 4RMRA 5KSAA 1GC1C 1DLHB 3ZE0B 5CZRA 3VD7A 3QYNA 1YEGH 1OAUH 2DJSA 1GAFH 2CHNA 3NIGE 5ANME 3T8XB 4ZXBA 5AG9A 2KPNA 2OI9B 3IB4A 2DQHL 2BVQA 4DKFL 2W65A 2JKLA 4NM4L 2W92A 5AVUB 1V8HA 5TFSH 1AMYA 1TZ8A 4BGDA 2Y7MA 1QPPA 5E2WH 3TLRA 3S5YA 2JTYA 3S6CA 2GJZB 1NDMB 1AHMA 3S98A 1GW0A 3T1FA 3BZEB 1TTUA 4H0HB 4KUCD 1GOFA 3MXWL 3E2HB 4ZMTA 3CN3A 3H9SB 2Z7YA 5AALA 4UQIM 4PW3A 1QWUA 2NX5A 4DWHA 5CEXA 3QZNA 2ATKA 3ARDD 3DUSA 3B56A 4FE9A 1VFMA 3FSAA 1Q72L 2Q1EA 3GMLA 4LLQB 3WEOA 1TSRA 3BIKA 3T8MA 3RI5F 4AJ0A 1JV5A 1BMWA 2AEWA 4MCNA 1XH2A 2O5XH 4OCSL 1S9XA 1M1SA 4OM0L 2X4QA 2ITEA 1DZ0A 3LXUX 3VFGL 3VXRD 1R5WB 3Q2CA 4Q0XL 1OE1A 2PCXA 4YOKA 3U36A 1N7MH 4A39A 3Q1SH 4CA4A 4NKMA 2M83A 4Q89A 1OSZA 2CRMA 2OYLA 1TCMA 1W0VA 4XVUC 5FA4B 5KG9A 2UXGA 2QKIA 1NCBH 1HESA 3HE7A 4UTAA 1RULL 3TN0D 4CC4A 4I4WB 3RTLA 2DD8H 3FTUA 1SBSL 1EQWA 4L37B 5DSCA 1RZIB 3UROR 3ULUD 1S5HA 3LZLA 3EYUL 3L2MA 3ZL4L 5DFAA 4FX5A 6FABH 5L2JB 5HXMA 1IE4A 2AZUA 3HNTH 1ED3B 1FYTD 3FZUD 35C8L 5E99H 1ZPLA 3MHZA 1WISA 5TE4H 4U1GC 5I1CH 4LCIL 3ATFA 2VRAA 1T04A 4KVCL 4M7KL 3CFJB 2HVKA 3U7WH 4O5LL 1T1ZA 1BSIA 1SJEA 1ZWIA 3C08L 3NSCA 5CLXA 1WSST 3EDJA 1ETZA 2ZCHL 2NDGA 4I3RH 1YECL 3PL6D 5ITBH 1X5LA 3ZDXF 3RFZB 4X6CA 4MNGE 4LCYA 3BSZH 1E4JA 3WL9A 1IBZA 4BFEA 4HG4J 3TBWB 5JXEA 2D7QA 3IJHA 3SN6N 2EZ0D 1XTLA 3NH7L 4PRDB 5K9OB 3PJSB 3PPEA 1SXAA 1Z7JA 1J5OL 3T0BA 4XAKD 2EIMB 1T03H 4NRXA 3S88L 4C54A 1P7BA 2WLYA 2XRAH 3PGCA 3BFWA 3EZ8A 1UB5B 1HILA 3NEOA 3TCLA 3NJFA 1LGVA 4JO4L 5HYJE 1GPOL 3MCG1 2ZKMX 4DO6A 2ZJSL 4GRMB 5D96B 2P5WE 3WEBA 1AKPA 4K73A 4C56E 2JCCF 3MJ9H 4WO4B 3STZA 2DMKA 1AY1L 5DHMC 5B22A 3PWLA 1ZT4A 2R7EA 1GSKA 3NZ8B 3TM6A 3ZBMA 5DUMH 3KWWB 1CD0A 1GJUA 3U0WL 4PLKC 3CC1A 1WS7A 4O58L 4L1DA 3DJTA 4DGYL 1UB6B 3BSGA 1YMMD 4GFTB 1MHPH 5C9JB 3GBLA 3S2CA 4HC1L 1P1VA 2HT4C 4RMUA 5C0CA 1BECA 1PDKA 1SY6A 3APFA 2EEAA 5C08E 3DJ9A 1P53A 4BM7A 1KMGA 5FCUH 2AKRA 4JY5L 2JCWA 2VITB 3HMWH 4QNPF 3LEXB 4NZ8A 3P30L 3CHQA 1FFQA 3LIUA 2PXYA 4XO4A 3BAJA 5CSGA 3L3HA 3IM1A 2B08A 3X1GA 2VWEE 3OB0K 5I0XA 3MNWA 5DHXB 2DM7A 6CGTA 4NRZA 3BGFB 3T6XA 3SD2A 4LGPB 3E8UH 4NBYB 3N04A 2PCFB 1NMAL 1O75A 4WHYH 3RVTC 1KJ2H 2F7QA 4XH2B 4MNGA 5H2BA 3UZQB 4LVEA 3OAZK 1E9QB 1A22B 3F6JA 3GSUB 3QIUA 3HFFA 4PW9A 4U1NA 1T0NB 3ARBB 3GBNH 3Q44A 1VZGA 3LZRA 3V4VB 3G6DL 1FSKB 1S7TA 3T4AA 2EC9T 3LMJL 4HD5A 4OLZH 4XXDA 4AITA 4FZEH 4B9GA 4G8GE 3BD3A 4TV3A 5F7YC 2A4ZA 3DURB 5IVXF 3OPZH 2C8NA 3HC2A 2AEIT 1MLBB 2EC8A 5E1IA 3HPJB 5DS8A 1SMOA 3QZWG 1XGQA 3KLDA 3MBED 1Q9WB 5FHBH 1SEQH 2UUDK 1G5GA 2LR4A 1KOAA 4PJDA 1C5BH 3JT2A 1SXNA 4W9GC 1XV8A 5T33H 4NC2B 3UGUA 3ZDZE 1UQSB 1CD1B 2D7MA 2SODB 1C12A 4GLRI 4Y16C 7TAAA 2APSA 5FDWB 1JMXA 1CDUA 4BFRA 3DSNB 3NZUA 3DOSA 3QUMB 4L1BA 4PV9B 1KBWA 3CVIH 1NFKA 3U0PA 1IAII 5TPWL 4M6NH 3QDMD 4XVTL 2R29A 1HIMH 2AFNA 1EMTH 5GQBA 2HFGL 1WBZB 3AUVA 5DRZA 5ELIA 5HYSB 4MCMA 3UPCA 4PJAF 4ETQB 1HHKA 1VA9A 2SEBB 4QXGL 3ATDA 1MNNA 1BZ8A 5K9JH 3TZVA 4UU9A 2J44A 2AEPL 4GUOA 4PGEB 3GF8A 4NBXB 1KXVC 3QEHB 4RMBA 5I6KA 2X9WA 1GGCH 4GQQA 4RFNC 2RGSA 2VABB 1I8MB 2X3BA 3VXMD 2VLLB 5FWQA 5LNGA 5CLWA 4W4OA 2WVVA 5EIVA 1IX2A 1JZ3A 4G5ZH 5LVEA 1U95B 1JGIA 4JHBA 4WV1C 5KW9L 3ERXA 2XKSA 5I16B 4HJ1A 1A3RH 2JJVA 4G1EA 2APWA 3HFML 3VI4A 3LSOB 3QG7H 4DO5A 1UVQA 3UJTH 1D5ZB 1URIA 2Y25A 5DMIH 1OD7A 1U21A 5B38G 5MI0C 4WWKA 4D9RD 3AWEA 1FL3A 4YH6A 4L1SA 1IJ9A 3EYOB 2LFEA 1TFPA 3F3HA 3IFOA 3BDBA 3FUJA 3GQFA 5CLTA 4FQCL 3E38A 1M05B 1V05A 1J88A 1NPUA 4X5WA 5D71L 1WHOA 3HAEH 1BD2A 4JQXA 4KZCA 5D1XB 3RE0A 1CR9L 2QDWA 1SEBB 3OVUB 3P9LA 5FYJH 5ERWA 3AQYA 2MFNA 4NZRH 2QPFA 5AVSB 1ZSHA 3F58H 1T83A 2P5EB 1UT1A 3D2TA 3UACA 2W8CA 3LS4H 1T89A 2QSCH 4U1LA 1NGXA 4JN1H 3KPRD 3NQIA 5C0FB 4ZFZB 1S46A 2EH7L 5GJTL 3BYYA 4IQHA 4UIKL 4QRQA 3UPRB 3MA7B 3MUGB 1HL9A 3M1CA 3R4DA 4FMFA 4Z0BH 1MCNA 1IGYA 4H20H 4ZUSB 2D9QB 1X5KA 1SXBA 2PWDA 4H8WL 4KY1H 4JPVL 1A9VA 5IESL 5BVJA 3V9CA 1RPQA 1WIPA 4LCCC 4R96B 1AKJD 3O2DL 3RX5A 1JD9A 1W80A 1C16A 2D31B 3H9HB 3L45A 2JQAA 2QR0A 3HHSA 1KUMA 4PV8B 3SBQA 2CDGA 3KDPB 1O9VA 4P2QB 3NACH 3AT0A 2GJRA 3ALXA 4YQXH 1CICC 1PPIA 4J12A 5FUCE 4ZPTA 3H4FA 3NYKA 1JTOA 2EXWD 3U9PH 4DP6X 2JI1A 5JW5A 1F3JA 3FB8B 3IRPX 2YD0A 2XV2A 1UEMA 2EXTA 1XZWA 2NY7H 5AKSA 5DHVA 1HINL 2J73A 2CZNA 1FBIH 2WJ7A 3VFWA 4ETYA 1JBJA 4ZUWB 2NY1B 2FDBP 1OE2A 4QD2E 1HX0A 1QI5A 2YMTA 1FL6B 2XKUA 1FDLL 9PCYA 4CC1A 4X0KB 3A4DA 4GNKB 1GTNA 1FZMA 4ZOBA 3CV5A 3OJMB 5DJCA 1ZHLA 1DBJL 4WU7B 4C47A 3KPSD 4OQ1A 1KCVH 1M3JA 2O6DA 3VCLA 1NM4A 3Q8EA 1YAZA 3ZYJA 3CQFA 1SXZA 1UKQA 3V6ZA 5F7MC 1J9TA 5HHVL 3EF7A 3EJPA 3V4UL 1OGAB 4KROD 3L5WA 4A2MA 1ND0A 2RALA 2Y07H 4PY7B 2FWOA 2WZ6A 5KANG 4H7VA 4XNZB 2D3NA 4F33A 1A4KB 4PRID 4CDGC 3DTXB 3IU4H 4YHKH 1HOCB 5JIKA 3H9SD 4IIZA 4PU2A 3UJJL 4ZUUA 3ZIMA 1RLWA 1FNFA 1NCDL 3VXTA 1NQBA 3BVVA 1AXSA 2ZNXA 5E1HB 4M6ML 5IUCA 1ZIAA 1DQIA 4W1TA 4XMUA 1UH4A 1Y1DA 4QHUB 4H8WC 4JR9L 2O6FA 1WYJA 3RB7A 4HPOL 1KPVB 2TSBA 4JDTL 4JGMA 1MLCB 3ZTCC 2DI8A 2UZXB 3SEPA 1TLKA 3KWTA 2F54B 3KBPA 1JZEA 2VXQL 3BUDA 3QPKA 3IXAB 3TIDB 3NBNA 2GSIB 3MTRA 1P9MC 4LSPL 4OCYH 3UC0H 2YFNA 4HIXL 5DMGC 1ZXKA 4HUUA 5HHPB 3JQOB 2JJWA 1A6ZA 1MHEA 4MX7A 5I1HH 1H3PH 1JK8B 4JFFB 3T3PE 4MAZA 3X3FL 4DK5A 5CGYC 3DGGA 4KQ4H 4Y9CA 3FFOA 4QJ3B 5CINH 4AV5A 4EXKA 1TT6A 3LAFA 4HCIA 4AYFA 1NUDA 1GYVA 3CBKB 3E6FA 4AVJA 4RCAA 4IOSA 1FLRH 1KCUL 4MJ5B 5H94B 1YVLA 2EDYA 4R4BA 1JZ6A 2WLLA 1C8PA 3U4EA 1T5WA 3B3IB 1WF5A 1QZNA 2D8KA 3DO4A 4KGJA 4X9YA 1B4TA 4Z7OE 2H3XC 3HJEA 3U0TA 2R2BA 2GCYB 2IPKB 2Y06H 1RURH 1BQ5A 3V6BR 4MXVE 4DW2H 2VE6B 5CJQH 3VXRA 4UOW1 2YD3A 3QCVL 1E6JL 3DOHA 4E9SA 3SYQA 2CXKA 4IS6B 1A6WH 1H5BC 4NO5B 2XY2A 1IGFL 3QWOA 4FLOA 4GRLA 4PS7A 1BWMA 3BRDA 4XMPL 3AQZA 3TN0A 1OOAA 4N8CL 4PFEA 2K1MA 3GO1L 3BO8B 5D7JD 2ZP0T 4AGNA 5DQDH 1D5RA 2XZAH 1BWWA 1UM4H 3OX8B 1FYTA 3WXVH 4BWTA 2HXAA 4I1NB 5IV2A 4NN6C 2P42B 4JFWA 2ZOTA 1ERNA 3PHSA 4IU3A 4WO4D 4U3CA 5H37H 4BKSC 4MFHA 1BBJA 4CADB 1UXSA 5CR8A 1RK0A 4G1MB 2DQCL 1IBDA 4JKLA 4KFMA 5MEND 5GZNA 2ZOUA 2C3WA 4LBEA 1CE1H 4WCYL 4HIIB 1NFDF 3LX9A 5F7KC 5LUMA 4NDMA 3RP1A 3DRQB 2Y5TA 3VFTA 1NC2D 1V7MH 1ZS8B 4N6RB 1M7IB 1D5XA 1JNNH 1FI8C 2WB1A 4L0YA 3HR6A 1PFOA 1TZHA 1W6LA 3NJJA 3QQNA 4KFZC 4QRBA 3VG9C 4YNYA 1OAJA 3BH4A 3ZE2E 4YSEA 3I02B 5GGRA 2C1OB 2ZX6A 2UWEB 3VFMA 4HUWB 5C2BL 3C60B 1D6EB 3FCUB 3OHXC 3S3PA 3VXPB 2PWFA 2EKSB 5KYUA 4ZZKA 1L9PA 3QEGH 1RZJH 3UBGA 1YYLL 5DEFB 5TF0A 2Q86A 2P24A 3W56A 3FUDA 2FJSA 4HULB 2O5YH 4I2XE 4AH2A 2R56L 1LEKB 2VWEC 4L8CA 4TVPD 4ZPVB 5HJ3B 3EZJB 1FNSH 1JF5A 1KPUA 1V3MA 3BCFA 1EHAA 1L6PA 2F6AA 3IFLH 1OM3H 3ARBD 4FHBD 1M6UA 1A9EA 4WW2B 1HL4A 3N42B 1ZLEA 4OIIH 1BMGA 1I7ZB 2K4AA 1MWAL 1I85A 2C9VA 4OCMC 4YK4C 4OAWA 3E1F1 2I9LA 3US9A 4F2MB 1YN7A 2FL5B 3NTCH 4XMWA 5IREA 2NNAB 1NEZB 3K6SA 2VDKH 2PO6B 3HW7A 4ONGH 4OFYD 2JKSA 4BYHA 1EERB 2QPDB 5KJRL 2F7RA 4HGWB 4BH7A 1WV7T 3HC0B 4B5EA 4XPAL 2MOVA 3AT9A 1B90A 2R1XA 3IPBA 4JFHE 4HV8B 1KGJA 3FXIC 3TNNB 1CG9A 4W9IC 4LEOA 1IBFA 2BW4A 5TDPA 5HY9A 1ES0B 1UCBH 3O6KH 4G5AA 3GGWA 4J5VA 3EHBB 2OL3B 4OZGA 4PGCB 2K3HA 1CE6B 2N7BA 3BFOA 6TAAA 3BYTA 4YC2C 3O41B 3IRCA 3B6SA 2Q6WB 5J1AB 1K72A 4UCFA 4R5TA 2ENQA 4RAUA 2ICWB 4AQ8C 1G7PA 1PLAA 2BSSB 3AU1B 2O61B 2YBRA 4WTXA 1XMWA 4NN5B 5DUJA 2XCMC 5D7SL 5DJ8A 1ANUA 4OM1H 5IKCA 3I6KA 1SXCA 3LQZA 4OD1H 2Q7AA 4A7QA 3MROB 2X09A 3BT0A 2E7LA 2LU4A 3WD5H 5AOKA 5DZLA 2VLRD 4BFNA 3GDBA 3MBEA 1B4JH 1BZ7B 3P3UA 1E42A 4P3CL 3BH9B 1CXFA 1NAML 1FFPA 3X12B 5T3XD 4G8FB 5KVDH 4X98A 2VIRB 1B2WL 2IV8A 3FO0H 3D5OF 4K9EH 4L1HA 4KZDH 1IC4H 3N40F 4QMEA 4E9LA 3C6SB 1YRKA 2XQ0A 3LKNB 4Z5RA 1PY9A 2Z6FA 1LXMA 1SLVA 2X6UA 5GGRY 5DD3H 3QAZC 3QDJD 5HYEA 4DGIH 1UURA 4RBPH 2V2XA 1YMHA 2BRQA 4HWNA 4C83B 3QWRD 1N6QH 3EADA 3QXVA 2ZCLL 5IFHH 3L3GA 3QK0A 2VERA 3R1GL 1H5BB 4U0RB 1MIML 4YXHH 1KV7A 3GXIA 2H45A 3HEIB 1DFBL 4DEUA 4HWZA 3DNKA 2FJFA 5FYKD 2CK0L 5ESVB 2G60L 1AQDA 2P5ED 2J5LB 1L3WA 4FYSA 3V7AE 1D5BB 1BV8A 4KOBA 3Q48A 3OKDB 3EBGA 1T0PB 3DV6A 4KJYB 4MD4A 1SFDA 3QCUL 3SPHA 4AGLA 1IGIH 2Q76B 4DIXA 2F19H 3RWDA 5JA9A 2FEDC 5BXFA 3I2CH 4Y4KC 4F58L 5E08H 1DR9A 4MJ6B 4PLKD 5AW7B 2Z93A 3MMEA 4Z8FL 4MCYA 2WLHA 3EFDL 1RJYA 1RUQH 2KZKA 2BNQB 5FV1L 1TZIA 2DTSA 4PWKA 3MCYA 4AE0A 4TSBH 5GGSB 4WENB 1HNGA 3CH8A 4D0BA 4ENEC 4W9DC 2HG5A 3QIWA 1JZ5A 2HT4D 2VDML 3DVNB 4P2QD 1W72A 1XF4A 2R69L 3WNOA 2EE9A 3FU5A 3PU7A 5CJOH 4GUPA 3JV4A 2V9RA 4YHOL 1KCKA 2CCVA 3KVDD 3LRGA 5AVRB 4HZ1A 2EYSB 1RU9L 2FLMA 5K1JA 3BUIA 5FUCC 3KJ6L 4QRSA 4QRTA 5ICUA 3SKOB 3VXOA 3Q7JA 3UOAB 5ALCH 5T5NG 1JPEA 2VISB 3QUKB 2NY1D 2ED8A 43CAB 5E6SB 5I8KH 2EVGA 3MJ8B 3D18A 1CGSL 3RVTD 3WSQH 1A9BB 1JCKA 5MHSD 1CLOL 4P2AA 5E9NA 1ASQA 4HCRA 4O02H 3WNKA 3OXSB 3EH5B 1NUGA 1GGBH 3IGAB 4AYGA 4PIRF 3D4YA 3QNZB 4PJXF 3KJ4B 1BZDA 2OFQA 3ARSA 3RDTB 1AKJA 4GAJH 5CF3A 3BVNB 4XODA 3QJHB 5L0QB 1NSNL 4R0LA 4Z7WB 5E03A 3ECWA 3QQDA 3PREA 1WIUA 1OGAD 2YXVA 3QEQE 1MCQA 4J27A 4YXLL 1NMBL 1ZLSH 2WXMA 1UJ3A 4Y16D 2WZPD 1CI5A 3T77A 1AZBA 5KSBF 3SZ6A 1XH3A 2V2TA 3TBVA 4GKZA 1IM3B 1EO8H 2QT6A 1LP9B 2B14A 1B4RA 4XVSL 3MLTA 3MR9B 4XNBA 1AZZC 1HI6A 4FI6A 5GGUB 2K8QA 4KRMB 4FF9A 4KK5C 4JO1L 4KAQL 1KYUA 1T2QH 4KGLA 3HVNA 4EKJA 1OV8A 3BGAA 3IRZA 5BZXA 4NQEB 5EC2A 1U4EA 4X80L 3ZHLA 3LIZL 4ZO6A 2F0CA 1DLHA 1N9PA 2OKMA 1XB3A 3VI3F 3T8XA 2ALAA 4AQAB 3IU3A 2Z65C 3OMZA 1PG7L 3B3BA 4PCKA 2AXGB 3C5SB 3O9WC 4UTBL 3UO1L 3BKYL 3NCBB 2HX9A 4FG2A 4LOFA 2A9DA 4OJCA 4GKSB 2YGQA 4P9HH 3OKEB 5A16B 4FCAA 5C0GB 1SFHA 3WJJA 2GJZA 1NDMA 4KXDA 3BZEA 1U3ZA 2ZX9A 3RAJH 2R4SH 4APQC 4MJ2A 3QWNA 1IIIA 2YC1B 1TVDA 5DJZB 2DICA 4L2LA 2IPTH 3ZQ9A 1MJUH 2PETA 2DDQL 3H9SA 3ZTJH 4OCLC 5FYLH 3EO9L 1NCWH 4KX9A 4AJVA 4ZMAT 4LLQA 4PJCA 1AGDB 3L4CA 5JIHA 2IALB 4BWUA 4YJZL 3QCTH 4ZO7A 1H6UA 2PP7A 1WEJH 3QPQC 4ISVB 2OTWB 4RFOH 2NYKA 1C7TA 2DYRB 4JZJC 3S9DB 3B9KB 1XCXA 1R5WA 3E80A 3F62A 3UBXI 2P26A 3IMSA 1NBYB 1DBAL 2DWTA 4PJ5D 4ABVA 5FGRA 4ICWA 4OV6F 4Z7VF 3NCMA 5FA4A 5DD6B 1Y18B 3QYCA 3BKCH 4HJJH 4I4WA 4OCNC 4GW4B 4L37A 5F0JB 1V5JA 1OL0A 2Z34A 4H1LG 1RZIA 4K3GA 5L88H 1CLZH 5L2JA 3ROLB 3T2QA 1UENA 3MCLL 5C3LD 1UD5A 4JQVC 3AREC 1SN5A 1URZA 1NUFA 3FKUS 1V7NL 1ZEAL 2ID5A 2YEZB 1CFBA 1MW1A 1WAAE 2P1YA 3CFJA 1NIFA 5L8LB 1R3HB 1IEAB 4UBDC 4UQCA 1BZ9A 1MFCH 4DOHB 4UAOB 1CICD 3RFZA 3C09C 4JHAH 4OZFH 2JIXD 4YSCA 2VSMB 3KW8A 1EO7A 3TBWA 3WIHH 1GYUA 2Q8BL 1YEJH 5FPIA 4PRDA 1XAKA 1PJWA 3PJSA 1QTPA 4JFVA 3BE1L 2OMNA 1ZAGA 2ZKHL 4X5XA 5GGVL 3S35L 4UT6L 1OCZB 4ORZC 4PB9H 2MCG1 2YKKA 2D7PA 4UQEA 3E6HB 5LXGL 3GLDA 3RJOA 4EN3B 5TGBB 2Y7NA 3R19A 3C60D 3SDYL 4QCIB 2CUHA 2X9YA 3U1QA 5I1GL 3LNFA 3QARA 2VRKA 4DP9X 5C1MB 3IETB 3RY6A 5JW4R 4K7PL 5G5DB 2OV0A 1T7YA 4WO4A 3MRQB 3NZ8A 1FZKB 3KWWA 4DT2A 5CJ5A 1HJBC 3CZLA 2DB8A 4JRXE 1EXHA 1EJ6A 2MCMA 3CSPA 5B8CB 5L4JA 1UB6A 2LV4A 3S35X 5D4QA 1X9RA 3QJXA 2ZX7A 2DJMA 2NT1A 1J1PH 3EUUA 4XWGH 2K8MA 4HLEA 4TQIA 5IGXL 4K7FB 5DD1H 4TULL 2WGXA 1RUPH 2CKBL 2BWDA 7PCYA 5B3SB 5DURB 1MG3C 1N0XL 1AR1B 4M02A 2BJML 2I24N 2E46A 2VITA 5TE6L 4B6ZA 1M2VB 3LEXA 4E41B 3S36L 1Z9NA 3INOA 3SZKC 2BNRB 1KB9K 4U6YA 1AIZA 4K7PX 2BZ7A 4NZUH 4PUBH 5EUKB 1MF2L 2IANB 3OLEA 5C07E 1SM3L 2ADIB 3PLYA 5HGDB 4IKKA 4XH2A 4DF9A 3UZQA 1K5NB 4Z7QF 1KCBA 1E9QA 3GSUA 4ESKA 4QRUB 1BJ1H 1T0NA 1VEPA 3ARBA 3FSZA 4ACTA 1NBQA 3RVXC 3V4VA 2JSFA 3SDDB 1J05B 4EI5C 3BQUC 3ZSTA 3RU8L 3IJYB 2DJUA 1B0RB 1XF2B 1G9ML 5DMGD 4WEEA 1JPTL 4M7LL 3T08A 2FO1A 3DURA 2WKOA 3RWCA 4AQEB 2W0KA 3HPJA 5CAYB 4MMXC 5A2CA 4OUUA 1USZA 1Q9WA 4DEPB 5D1XE 2KL6A 3L9YA 3GMOB 4AEHH 5E5RB 4XP6H 4YX2L 3MRMB 1UQSA 1CD1A 4AXWB 1VKXB 1AHWC 1J5DA 5FDWA 2BNUB 1NMCC 3SPVB 5LNDA 3DSNA 4NUGH 3QUMA 4IMKC 4PH8A 4PV9A 5AWNH 4MJIB 1FVDB 4HMDA 5FGSA 1NCUA 2O72A 1MCPH 5AW6B 3VFPB 1WBZA 3NG5A 4AMKH 5HYSA 5B7FA 1S7RB 4FL4C 2KZBA 4FCHA 1VENA 2ATAA 4ETQA 1IAIL 3D1MC 2SEBA 2GVYA 4R8WH 2ADYA 1V3JA 2ZUWA 5KSVB 3LXCA 1YNTB 4L1LA 4PGEA 1AZNA 4A7SA 5KVFH 3PXJA 4JPKL 3FCSB 2W07B 3L1GA 4Q14A 3D4ZA 2ODHA 1I8MA 1H8LA 2DKMA 3KVQA 4DZBB 2WXQA 1OW0A 3NABL 1U91B 3TV3H 1UADC 1U95A 1QBBA 1AP2A 5H4ZA 3B5GA 4ZFOL 3N50A 5I16A 3T71A 3LSOA 1ODUA 1A4CA 1D5ZA 1WFUA 3BEVB 1WBXB 3RGVC 4FS0A 4DETA 1X6NA 2DQJH 2BNQD 4IGBB 1NGWB 3QZMA 1JNLL 1E67A 3EYOA 1U8PB 3OJDB 1UKTA 4X42A 1WZLA 2XXCB 3DIFB 3FCTB 2CM6A 1HHJB 2ZOOA 2B1HH 1N68A 3UG5A 1EHLL 2YGOA 3D2UB 3BZFB 4RH4A 3EAKA 4PJDF 1MJ7L 2RCSH 3VWKB 3MRKB 5LQBH 4Y9EA 1M05A 1ACCA 3SGJA 1TYJA 2Y36L 1MFNA 3LEVH 4KJQD 4QXUL 4Q9RH 1PAMA 4Z3HA 2XQYG 3AS1A 3WNMA 3MA9H 3GTNA 1G9MC 5C08D 1UD2A 1HVXA 3RWFB 4AMWA 5E2VL 2P5EA 1EJOH 4N2AA 2CCLA 4J2QA 2MOGA 3X1BA 4ZX6A 1HCVA 1T3FB 15C8L 4KVPA 3E0GA 5D5ME 5C0FA 4ZFZA 3CXDL 3WTTA 3U46B 2B15A 1X5ZA 3UPRA 4JKWA 4MYPA 2AXHA 3MA7A 1I8LC 3CFNA 3MUGA 2WVSA 3FUNA 1WWCA 3HS0B 4ZUSA 1JHLL 1RD6A 4LIQE 4QYOB 5E1GA 5B4MD 4YBQC 3FTVA 3SOTA 4M7JL 1Z3RA 3BAIA 3EJQA 2Z9TA 3ZDYE 4Z3IA 1OHZA 4M4RB 4R96A 1LO4L 2D31A 3H9HA 4L5FE 4J28A 1YEKL 4PV8A 2FWUA 4P2QA 4X9HA 1X5XA 2CAKA 3C2AL 4M5ZH 3VI4F 1SVBA 3GSRB 1E4XI 2WQ8A 4AW7A 4G8GD 4AEIL 3BWSA 4X9BA 1JGUH 5DZNA 1NWOA 4N9OB 2DLIA 3CZJA 1KBGL 1QSFB 4D9QD 4NQDE 1UWEL 2KZWA 4F27A 5GS2H 2RA1A 1MJ8L 2DWDB 2C9AA 1IM3D 5GRUL 1XCTB 1BVNP 2VDNB 1EANA 4K71B 1Q0EA 3K74B 3MBXL 3MRPB 2IDTA 1FL6A 4WI4A 4TNFA 2FT6A 4FTVB 5J12C 2DL2A 1A6TB 4WSKA 4X0KA 1DO5A 2JH2A 4DUWA 3MLYL 3RIKA 1JGDB 2TAAA 5EWIH 4WU7A 3Q05A 3WY3A 4NQED 2OJ1A 4B9IA 3TWCH 2CM5A 2GIMA 4NRYA 4I1RA 1PZCA 4RDQF 1UXWB 2A73B 4UMSA 1MUJB 1WWBX 1CXKA 5ADPH 4BA8A 5I8EB 5EH1A 1NCNA 3GSVB 2NY5H 2GB2A 5I74C 4P9MH 4ZQTA 1PIFA 5EU6E 4AC4A 4M62L 5AEAA 4CGUB 1G1YA 2WBWB 1OGAA 3T8VA 3EJCA 4PJ9C 4PY7A 2WXLA 3EYVB 3WKPA 2AAAA 4TUJB 5TE7L 2G3XA 1JYWA 4K9JA 3DTXA 5ABZA 4DFHA 1HOCA 3ZKXB 3VU1A 1K85A 3NIFF 1BEYH 1KXQA 5JUEH 3T0VA 1VGEL 4BJLA 1E6OH 3CFMA 3QHFH 1BVKB 1SF5A 1DUYB 5KJ7E 3F6IA 4S11A 4P2YA 5JNYB 4ONFH 3SDAB 2E3VA 3EJSA 3HG2A 4XR8C 3P54A 4GJTB 1I1CA 4QHUA 3QPXH 4H40A 5T1KB 5K59F 1TZAA 5C8JB 5KUMA 4YLCA 1KPVA 2GI0A 1Z5LB 5C86A 4RGOL 1R3IH 3GJFB 1U3HC 3KPPB 1MLCA 2PYFB 3BSHA 2UZXA 2AJXH 3B9KD 2F54A 1JXGA 5ADOL 3KBFA 4OFQA 3SD5A 5EF2A 3QRGL 3HR5B 3IXAA 4KK8C 4WU5B 4WVRA 3TIDA 4V1DE 2GSIA 2E9BA 2LHAA 1GRWA 4N2HA 3FQUB 5CZVL 2AQQA 1FRGL 3WJLA 1QI4A 2OX5B 3ILPB 3RTQB 4KQ3L 1QASA 5I0VA 2FBRA 5HHPA 1HK6A 1BF2A 4NGHL 4OCRH 2FEDD 1NOFA 4Y4KD 5JPMB 4X8GA 1JK8A 4JFFA 3BAEH 2VLJE 3S4SG 3V55A 3WBDA 4A7TA 5I15H 4YN3A 4NNXB 4GMTL 1F6AB 2APXA 2FJGB 2YAHA 2BHYA 5F96H 3T2PA 4Y0GA 1JVLA 4W93A 4BA0A 1PZAA 3ZSSA 4ALAL 3HPLB 4IRZL 4MJ5A 5H94A 1ETJA 3HRZC 4RIRA 4ENED 5IB3A 2HCZX 4MVBC 3B3IA 2XX0A 5F2FA 3DHUA 4LRNL 1QSVA 5EOTB 3BRFA 1PYWB 3FN0L 2GCYA 4TMPA 2IPKA 2XQBH 1OT4A 4HFWB 4FJ6A 1YEHH 4ODSL 4KI5F 4OLVH 3NZSA 4JDVB 4YSAA 1XGRB 4IS6A 3LPOA 4U1JB 4NHUB 4NO5A 3WFBL 2R2EB 3JV5A 4JVUA 5B7EA 2XTJE 2A6KB 4A7GF 3L1OH 3X1FA 3NA9H 3MPCA 2C3VB 4UTAH 5IW1B 3B83A 5JZ7D 4TUOA 4YSDA 5D1ZI 1NDTA 4APXB 1U2CA 1PG7W 4FA7B 2R23B 3MV9B 2RMNA 3FQTB 3OX8A 2WM0A 3TBBA 2YRBA 3EYQC 3T6QC 3VDBA 1MJJB 2BRRH 3BT2H 4G8IB 1URLA 2B7DT 4CADA 2PMZA 1D6VL 2W9DH 1ETB1 2BY3A 4G1MA 4PJIB 5ANHA 2QELA 2WWKT 4QAWA 2XC8A 4KUCF 4UB0H 4XBPB 5E8OB 4HIIA 5DHDA 1HH9B 2DJ4A 2V17L 1IAOB 5AOIA 4A68A 5LCVH 3DX2A 3VXUE 1FN4B 3DRQA 3BAKA 3NESA 2ETWA 1ZS8A 3BDYL 4N6RA 1M7IA 5IFAL 4GRWF 5DURD 1AQKH 1AR1D 2JJTC 1YEIL 3AWGA 3ALWA 3U25A 2ZT9C 3I02A 2C1OA 5PAZA 4ELME 3BLPX 2UWEA 1KWGA 3GHBH 4HUWA 5TTRA 2ZPKL 3C60A 1D6EA 2FRGP 2MWCA 3VXPA 1QR1B 2EKSA 5L4MA 2O6EA 1LNUA 4ODWB 5DEFA 5E9DB 5HP5A 3HI1B 4ILDA 2FGWH 4F3FB 1PCXA 2DMCA 1WGOA 4ALAC 4ZPVA 5HJ3A 5K33A 1DVYA 2RR3A 2GSMB 3O9WD 1RUAL 1IAIM 5F6IC 2DL9A 3V0WL 4WW2A 4EIZC 4IU2B 1I7ZA 4IK6A 3ULUF 1F41A 5BOJA 4PJ9B 1GZHA 1E5UI 4R97B 2NNAA 1NEZA 3CLFH 4JFPA 4APQD 1AQ8A 4AKQA 2PO6A 4JKMA 3IDXL 5ENWB 3PPSA 4P3DB 1G1OA 4OLWL 5D2LB 1LMIA 3KYKH 1SY6H 1SDYA 1RY7B 4XP4H 4HGWA 4ES8A 4K8RL 2EADA 3HC0A 2Q0ZX 3BKJH 3WAKA 3X3GL 2H2PC 1DDTA 2CGZA 3CVHL 3F7PC 4HV8A 1IGCL 1P7KB 1D9KB 2MQGA 1UACL 3EOAB 3TNNA 2ITFA 4OZIB 2DOCA 3GI9L 1ES0A 1HS6A 3LZOA 1E3XA 1Q1PA 3QPQD 1LL1A 2DWEB 4K94L 5IMOB 5J06A 2ZNWA 4LIQL 2V3FA 4HALA 3WFEH 5EOCH 4NXSA 4PGCA 4JK0D 1CE6A 5J0BA 2AQNA 1QO3B 3EJTA 3O41A 3NCYP 2G9KA 5IB4B 4KY2A 4L5FL 3SQOL 2A9AA 2NZ1A 2ICWA 3F12B 4D3CL 2BSSA 1AIFB 3AU1A 2O61A 3N6YA 3RVUC 3O6ML 3EO0B 1JP5A 4FG6C 1A7RL 1YPZB 2WWMC 5I8OL 2KDYA 3MROA 4J39A 3QXUA 4JO3L 4LDOB 2J25A 3B7TA 3VSQA 2PP8A 1BZ7A 1DSFL 3ARED 4WIQA 3FYEB 3INUH 3VWJC 3X12A 3EOTL 1ILSA 4G8FA 2VIRA 3MRHB 3HRZB 2OMYB 2HJLB 1E3ZA 5DDHB 4UBDD 4DGVH 3LKNA 4U1IB 4F7MB 4F57H 2OQJB 2DYSB 1PQZB 2AQ3A 4YMPA 2WSPA 1I8UA 1EEYB 2MSPA 3ZHDA 5BS0E 1IVLA 3DPDA 2R29H 3AJ7A 3D2UD 2J8UE 4C83A 1G1CA 4KOCA 3FQRB 3VWKD 5ABDE 4QHKI 5E5UB 1HDMB 1MSPA 4JCMA 4PQXA 1H5BA 4P8QA 4LCUB 2X1XR 1OO2A 4UT7L 2P5PA 3NP3A 4K5MA 1WE5A 4PRBB 5TJWK 3R7RA 4OLXH 2JKIS 4HGKC 5HJBA 3WUWA 1D5BA 4OZGF 2XNAB 4WGKA 1E9PB 3VD5A 3OKDA 4BFFA 1RZPA 2ATPB 4KJYA 5EA0H 1Q9KA 4K8RC 3TXAA 4ATWA 4EPSA 1WZ1H 3SKUD 4I77L 1LDPH 2Q76A 2Z4TA 3RWHB 1I9JH 2J3SA 4WWID 5JW3H 5IJKC 2BY1A 4MJ6A 5D55A 4KXCA 2RJMA 4POZC 4TVUA 2DQEL 3P0VL 4P59L 3GS7A 3FUIA 2Q8AH 3ZKQD 4F2MA 2BNQA 2AEQL 1R17A 4K94C 5GGSA 4IJ3C 2HZHA 4V11A 3ZIYA 4PJGE 1OAQL 3M17B 3HNVL 2NOYA 5ISZB 3DVNA 4FERA 3S96B 5BMFL 4AYEC 4XWOC 7FABL 1R0AL 1RPKA 3RZCC 3BFQG 5IT2H 1TEGA 4XCFH 3Q6GL 2MPVA 3FHAA 2GK2A 2EYSA 4QLWA 5AVXB 4JM2B 2F58L 3MLSH 5SWZD 4FQXC 1QD0A 5ICZB 1I9RH 2YPVA 3SKOA 3OHXA 2WXKA 4OVUA 1ZLVK 1WZAA 3QUKA 3UTTB 3L1FA 4P57B 5BRZB 4JFHD 2AABH 3W39B 43CAA 3MJ8A 4QKTA 2V7HB 4L48A 1A9BA 4HH9B 4WW1B 4HISA 4FTVD 1OAYL 3F00A 3OXSA 3ZJAA 3HI6H 3IGAA 3HA0A 1CDGA 3RVXD 3QNZA 5A2KH 3G5WA 2N01B 2X2YA 3FQ1A 4OSUH 3BQUD 3EGDB 3PQYE 1YEFL 5CUSL 4JKPH 3A6CH 3BVNA 3QJHA 3TONA 4JHWH 1T1XB 4LKCB 5KS9E 2CG9X 4C59B 2AK4B 4Z7WA 2CBQA 4H88L 4KTDL 4J4PC 1RZKL 2CKNA 3P4LA 1DLFL 1MVUB 3QHTC 4FXGB 1J48A 1B88A 1CCZA 9CGTA 4NUMA 3MLZL 3CSBA 5DHVH 4EKXA 4JREC 1IM3A 3C8HA 1CD9B 4ZT1A 1LP9A 1H15B 2B4CH 3NJNA 2X1PA 1RV6X 1X3DA 4MLSA 5EBMB 2R0KL 1X4XA 3MR9A 4YHPB 3Q8AA 5GGUA 1EGJA 1NBVH 3SO3B 1M6OB 1KWKA 4J3OC 4EI6B 2HRGA 5T1KD 2NY4C 2GUOB 2C7UB 4JJHA 4ZOCA 4WUUE 4HJIA 4NQEA 2P3YA 2W0FB 5C7ZA 1JOIA 4AQ8A 3DX1A 4AQAA 2D03H 1KIQB 3UYRL 4OBRA 1LQBC 3C5SA 3A21A 4KZEL 2DQFB 5DTFB 4GKSA 2VB5A 1CXEA 4OW6A 3OKEA 5C0GA 5A16A 1DQKA 2BDNH 1BQHG 4X9FA 5AW4B 3RQ3A 4PG2C 5DJZA 3RL2B 4N22A 1WWAX 2QQNL 2BY2A 1G5AA 3RGVD 3A22A 1EZVX 1YNLL 3LD8B 1H3UA 1AI1H 3UZEC 4EMZA 2VXVH 3CXFA 2YEVB 2BP3A 4KDTA 4OFDA 4TOYH 3BHBB 4F5CE 2D3VA 5B3NA 4MMZB 2YAMA 3R4RA 2YEQA 5AW3B 3SE4C 3MOBH 1AGDA 1TJHH 1TQUA 3KZ8A 2IALA 2YWZA 1ZHNB 3ELAT 4LVNC 4Y19E 4ISVA 2ENSA 3IDNB 2MNWA 1JZGA 2OTWA 2F53B 4AVIA 3IMBA 3QH3B 4MAYC 2YPLB 1GGUA 4M56A 4WTWA 3V7AG 3B9KA 3VGBA 1HHGA 5FECB 3O3DB 3O0RH 4RWYH 3KGSA 1NBYA 1E5CA 2DYPB 2QPUA 5HHQB 4ANUA 2WAQA 2XACC 1BBDL 1BM7A 3ZGHA 5J7CC 5DD6A 1Y18A 2MOQA 4KO5A 1RZKC 2ROXA 2KLSA 2H2SC 3V6OE 4GW4A 4LVHC 1LDSA 2PF6A 4G7YH 3NZHL 4GAGL 4Y4KA 4YUEH 2FX8L 3ROLA 2X0UA 4WFGE 2XTJC 2DRUA 4UINL 4YBQD 2RAMA 3VGGA 2X70B 5I66B 1YYML 4E41E 3K3QA 2W5PA 3PFUA 3ZDXB 2BNRE 2YEZA 1QR4A 1AS8A 4GRWH 1FZOA 3JTSA 1R3HA 4Y2OB 1IEAA 4AZ8B 4CVZB 4JY4B 2GC7C 2IANE 3MLXL 4JGUA 4MDJB 3OB0H 1VPOL 2IXQB 4NT6B 3JWNE 4NENB 1PNCA 1R34A 4XO3A 1YY9C 3D85D 4G8EB 2O4EA 3DLQR 4NWUL 4RISH 5DI8B 5CJXA 4PJBE 3SIKA 1RVFL 2H26B 3APDA 5E0FA 2CUAA 2HKFL 3HN8A 4ANKA 3OAZH 4ODUB 4ZTPL 4GI8A 1C9SA 1OAZH 3UTQA 1EZLA 2IEPA 4NKDB 2YARA 1A1OA 1WVZA 1UYWL 2X4RA 5HI5C 1NPJA 4PJCF 4X4MA 4PI0A 3S37H 1UT9A 2FHFA 3E6HA 1BCIA 1B0GB 3W38A 2DQUH 5TGBA 3BAXA 1T7WA 3B2VL 1TZGL 4QCIA 3ULUH 4KKZA 4OB5L 4OZHE 2JI2A 3C9NB 3Q9QA 1E9OB 3MJ6A 2UUDH 4F8PA 1KC5H 3F5WB 3IETA 4XAWL 4GUCA 4WEBH 5G5DA 5J9PB 2DQDL 3MRQA 4TNWK 5I17B 1FZKA 2QKSA 4A37A 4N2IA 5K1NA 3QDAA 1CXIA 4MJIE 5B8CA 1EHXA 1MCOH 4PJ9D 5HYIA 5EEUA 4X7SL 3LNGA 2E47A 1DSWA 3ZKNC 2X4SB 5G4OA 4ABUA 1JFQH 1TJGH 3GZOA 4K7FA 3NA4A 4IBTA 3GIZH 3ECUA 4TF4A 5EO1B 2OS7A 4EZMA 3M8OL 1XGTB 4DESA 1M2VA 4E41A 3M7FB 2WZAA 4L4TB 1E4KC 4FA6A 4XI5C 2BFGA 1J1XH 2B1AL 1QWHA 1OARL 1UM5H 5EUKA 5L2KB 1Z3GL 2BOCB 4XNUL 2XVBA 2LTQB 2ADIA 1U3HD 5HGDA 4AV4A 2JF1A 2FT8A 3GMQB 4X99B 1K5NA 3MLVL 1N2RB 2ITCA 1QSZA 3ZQWA 4WNJA 3O9WA 4QRUA 1A1NB 5IEHB 1KTCA 1W2KT 4EOWL 4KK8D 1QACA 3LVEA 3BP7B 3D9AL 3SDDA 1J05A 3KPLB 2ZUQC 1IKFL 1YQVH 1ZVSB 3IJYA 5A2LH 4ABWA 4F24A 1B0RA 1XF2A 3A6BL 3HBPA 3QFDB 2P4AB 4DTGL 3FT3B 5AYUH 4YHYB 4OV5B 2WXRA 4WK2B 2C4FU 4PGJA 4AQEA 5IIEB 1LM8V 3BUYB 3PS6A 1C7SA 3FPXA 4GS7B 3GMOA 1JCVA 4WKZB 3DI2B 4M1CC 1OALA 2JKRM 4JG0H 3TURA 4AXWA 1DQML 1KELL 1VKXA 4PS8A 1GS6X 1FAIL 4MVBD 2BNUA 2BS8A 2IBZY 3SPVA 3NVQA 1PEZA 4UNVA 1YC7A 4XPFH 4HT1L 4MJIA 1FVDA 4XC1L 4ELKB 2VMDA 2NW3B 2CMRL 1GIGH 3VFPA 2VJ0A 1UZGA 4ZNEE 3DDGA 1S7RA 3FMGH 3WKML 2OM5A 1MXGA 1YN6B 1L7IH 2ZKXA 5MEOB 1P6WA 1CLYH 1NCHA 1ET7A 3I9PA 3GKWL 3RYMA 3GBDA 5AAWC 4HG4K 1T1WB 5KSVA 1YNTA 4OGYL 1SMAA 1ORQB 1KCRL 1KB5B 3FCSA 3K6IA 5FKAB 4ODXB 2I60L 3BC9A 4L0ZA 4KQ0A 4DZBA 3QUXB 1D7FA 3VDCA 4Y8AA 2IOIA 1U91A 3D3VE 4JQVA 3PF2A 2XFXA 4P5KB 4TLKA 5E4EC 5LXVA 1O7VA 3EYQD 2F1AA 1OGSA 1QSFE 3BEVA 3FT2B 1EDYA 4PBXA 1FHNA 5A6LA 5KBLA 1H0DB 4ODBD 3NP4A 4IGBA 5E56A 1NGWA 3CMOH 2WKOF 4U31A 3IFNL 4WK4B 4ZG1A 2F2HA 5DD5L 1I1YB 1U8PA 4N0RA 4JZOB 1OXYA 1GHFH 3FCTA 2EE3A 2N1KA 2QSQA 1HHJA 2WBJB 3DIFA 5KN5B 2HKHH 1F18A 3D2UA 1DZBA 1Q38A 3BZFA 4ODTL 3VWKA 4WK0B 3MRKA 1HL8A 3PHAA 4FQ1L 2IOMA 1I82A 1E5YA 1QRND 4N2CA 5B1JA 3CIQA 5DJ2B 3WHE1 3FU0A 4TTDC 2DEXX 1MAJA 2X6MA 4PY8I 3RWFA 1NFAA 3JVGA 2JI3A 3BXNB 2EUZA 2XA8H 1T3FA 3MACL 4EEEA 1MNUL 1QATA 2YK1L 4KKRA 3U46A 3QJUB 1OP3K 1I1AB 1KLFA 3TT1L 3D4GA 3KGTA 5IR1B 3U2SB 3HS0A 3IDYB 4XPBH 4PJHA 4QYOA 4LHUB 4JG1L 1P4IH 4M43H 4YE4H 1CF8H 4UT9A 3F7KA 1CI3M 4M4RA 2NR6A 2GBVA 4P4KB 5C3IA 4OKDA 1R4XA 2AQRA 1TVBB 3KDMB 5A2AA 4GPVA 2CLVB 4G6MH 4QTIH 2QVFB 2ZQKA 2DLFH 3C5ZC 4GKNA 3VXSB 1D2OA 4MZ3A 2FECI 3K5SA 3QHZL 1EZUA 1NWPA 3MNDA 3GSRA 1ZE3H 1A6UL 2OP4L 5C0RL 2BVOB 2H2PD 2WQVA 1S7UB 3EG9B 4LPTA 5HBBA 4KI1A 2BVEA 1E8YA 1XBDA 1E4XL 4ICXA 2DWDA 1CXLA 4GKOA 2WIMA 2YD1A 4GMSH 4N3UA 2K3TA 4I0PB 3T09A 4W9CC 1E8XA 1U3NA 3MRPA 2JKJA 4HBQA 4FTVA 3VD0A 2ZP9A 5J8OA 5DFTA 1A6TA 3P2BA 3UTSE 4HCRH 1JGDA 5GGQH 1MFBH 4KRPB 4TNGA 3ILEA 5MERB 2R0LL 2OYPA 4C4KT 5I75C 3O8XC 5EBGA 1UXWA 2A73A 3FTYA 1MUJA 2EICA 4Y9GA 3RVUD 4DUVA 4FG6D 5I76A 5I8EA 2XYBA 2VR8A 2WWMD 3GSVA 4KWUA 2OYKA 3V8CA 4L18A 1A6VL 3ZN6A 5HGBB 1P5UC 4Y1AB 4OD3H 1VJSA 2A4EA 5D93B 3FT9A 4DVRL 1WS8A 3EYVA 3VWJD 1B6UA 1PZUB 1YC8A 4HEPA 1HN1A 3S97C 4GAYA 1CD8A 2R51A 1FFRA 4I9XA 4NC0B 2YKLH 4KPHH 1WFTA 2ADFL 5CZXC 3RFRA 3MRIB 1DL7L 3Q3GA 1A2YB 5A6IA 3D87B 4UV4H 3VD3A 5KYXB 5C6WH 2NDFA 4LQFH 5JNYA 4PS4L 3QUZB 1LJMA 2JJSA 3JV6B 4KNUA 3SDAA 2OTUB 1NGPH 2YR3A 5JXAH 2PLTA 3OD3A 1EEZB 5T1KA 5DUPL 4Z23A 4ZMLA 5C8JA 4XE5B 4K5PA 4RMQA 3TNMB 2GSGB 3DETC 3AZUA 1NIBA 1U6AH 3WUZA 1Z5LA 3TBTB 4CU6A 5IWLC 3SPCA 1VGKB 3KPPA 1QPXA 2PYFA 4A6YL 2KERA 2F5BL 1CVSC 2ZTBA 4XGZB 4XMKL 4XPGH 3DX6B 2DYPD 4GBXC 3NCJH 3HR5A 4WU5A 1EV2E 2C26A 5DLML 1NM9A 1ZD6A 3FQUA 2PPDA 1BDYA 4K8RD 2OX5A 3ILPA 3RTQA 2A9NL 2Q20A 2FSDA 2C4FT 3RIFF 1CFVH 3GFUA 1ASOA 1H3TA 3FRUA 5JPMA 5HI4D 3RUGE 5HI3C 4NNXA 4H8UA 4POZD 5AZ2H 1UWXK 3LNEA 1F6AA 2FJGA 4NHCH 3V6OC 3VYNA 3WU1A 2IGFH 3HPLA 4W9EC 4QIRA 2E7BA 1W0WB 3K81A 3OLGA 1MN4A 1OKEA 1SOXA 1YNKH 1H3GA 3H56A 4X83A 3SOBH 1PX3A 1PZ3A 2BP0B 3FS9A 4M48H 2CPCA 1DQLH 2LQRA 3CLWA 4XWOD 1PYWA 5EOTA 3OV6A 3FTWA 4DKEL 1U8LB 4XCCL 4HFWA 5C6PB 1PSKH 3MREB 5I1JH 3JWNC 2CO4A 4OF3A 1DYZA 3QJOA 5D4IA 4JDVA 2HLAB 2QFPA 3F2LA 1XGRA 4AVKA 4U1JA 4NHUA 1BVNT 2H41A 4Z95L 4LSQH 2R2EA 3DYPA 2F7PA 1GY1A 2A6KA 2EDWA 1F0LA 2J1XA 4L3FA 2C3VA 1MAMH 5IW1A 3EF4A 1DSYA 1DVZA 1I3RB 3OAUH 2F7IA 3NGBB 1JERA 4OJYA 4APXA 4H25B 1YEEH 3KYMB 5H8DA 2R23A 3CG8A 3MV9A 3B2DC 3FQTA 1A02N 1LYQA 4NQSB 1K2DB 1RSFA 3FTZA 1MJJA 1NFDB 2MCPH 5I1KL 4ODHL 1BZEA 2L4OA 4G8IA 1FORH 1PLGH 3IWUA 2CBPA 4PJIA 5BV7C 3RKPA 2NCEA 4XBPA 5E8OA 4A2HA 4RQQB 2YAPA 3AG3B 5AAMC 1HH9A 1GY2A 4J4PD 2VDLB 1ZS2A 3NRPA 2OMZB 1IAOA 5CLZA 1IFHH 4FFTA 2CWRA 1FN4A 5D2NE 1L9TA 5EU6D 4OZFB 5IQ9B 1IQWH 4R90H 1QFUH 4HF5H 2ILLA 4LLVB 4TYUA 4FFZL 1QNZH 3H1ZA 1TQBC 3Q43A 3Q06A 3U7YH 3ZO0A 3SE8H 2OK0H 4WZ9A 4A63A 4L4TD 1T66C 4F7TB 4J3OD 3RB5A 2EDBA 2NY4D 3W5MA 2Q7YB 1QR1A 2BIPA 3FU7B 1USQA 3ECBB 1BFVL 3FU3A 3ZVVA 5L2KD 1MFUA 4ODWA 1L6ZA 3X14B 1N18A 5E9DA 3W2DL 1G4RA 1OK8A 3CSYB 3HI1A 1A4AA 2VDOL 4M29A 5LNEA 4FULA 1OPOA 4JFDB 1G94A 2J5WA 4YHLH 4JFQB 2CXGA 2G3ZA 4MJJA 2QADB 4IU2A 2VMJA 4E5XB 5DK3A 3JZ7A 4U6XB 3U6XA 2DEYX 4PJ9A 2BXZA 1CL7L 5FFOA 3V0FA 3N0AA 4KHXH 5AW9B 4J3OG 5C92A 3X1NA 1U4FA 2WANA 4PRPD 4V1DD 5ENWA 3SQRA 4ZMXA 4P3DA 1GSMA 5D2LA 1EEUA 4NO0B 3CWGA 2HFTA 1XL4A 4M6AA 5EU7E 1TJIL 5L6YH 4PJ7A 1X9QA 3FSVA 1XBRA 3E1ZA 4QJ5B 1NC4B 3F7LA 2VLJD 1P7KA 1D9KA 3EOAA 2BSED 4OZIA 2BH0A 4EI0A 4G9DA 5FDYA 3UFIA 5EZJB 5C0BB 2DWEA 4U1HB 5IMOA 1R9FA 1NCJA 2ERJC 5D1ZC 3F6LA 3HMXA 3TIEB 1GC1H 4F8QA 4OCXL 4NFBA 1QO3A 3NJMA 4TVPH 2OSWA 3K4ZA 3KR3H 4FD0A 4G9FB 5IB4A 2JKTM 2UWEF 4XMTA 4KXAA 4F7PB 5IHHA 4YL4A 1AIFA 3V4VH 3IJ9A 2OR7A 5MEPB 3EO0A 2H2SD 4K23H 4X4XB 3HUJE 5ISZE 1YPZA 4P46C 1OP5K 4IBVA 3MV8E 2C3GA 3IJ8A 3MRJB 4WTZG 3L4UA 3N44B 2XTJD 1C5CL 4FQQB 3D12B 4JQIA 2QGEA 3BUPA 4KKAD 4V2CB 1YEGL 1AACA 1OAUL 3PAVA 2Y1ZA 2DBLL 2EDNA 3MRHA 3HRZA 3RWI<