2DIAA

Solution structure of the 10th filamin domain from human filamin-b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
GSSGSSGPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-B
publication title Solution structure of the 10th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2diaA01
1KENH 3HPJB 5TE4L 4H20H 4WJ5B 4XH2A 3GSNH 5C0AA 1AKJA 3OWEA 1T1ZB 4F9PA 5GXBB 3RAJL 5F9JA 5C86A 1AO7B 1WAAF 3WJJC 3RNQA 1XEDA 4R3SB 1CXIA 2F8VA 4CMMB 1NBZB 4QHLA 2ED8A 3C09C 1NC4B 2XFXA 4X8JB 2C1OB 3LV3B 3MJ8B 3QDME 3IXTB 3HUJE 4DN3H 2FATL 1JWSA 5FK9A 3BVNB 3D0VB 5D70H 1LDPH 4AT6A 1JYXA 2H1PH 3RZCD 4A2MA 1CLOH 2QBWA 2HT2C 3QIWD 1O0VA 2MQ0A 3BEWA 3FO9B 3CX2A 5GS0D 4XBPB 5IW6A 1U3JA 3HC3L 5EU3A 2EEDA 4JO2H 1WCBA 4XNZC 4GOSA 4OCSL 4K8RH 5IMLA 4YX2H 1A3RH 4QXUL 3I02A 5GRWA 2FB4H 1VFAA 3KS0J 4O58L 5HHXL 1F2XK 2BVOB 3OKNA 1SY6H 4FQXC 4PJHF 1BJ1H 1WZ1H 4NJ9L 4ODVL 4IRZH 2LABA 4NYLA 3U0TA 2HLFC 4WRLA 2R0LL 1HI6A 5J6GB 1NEZB 1FL5A 1AXSB 4I9WE 1NMAH 3QQ9C 3D3VD 2YEZB 1HSAB 4QXTB 3OPZH 4KJWC 3WKNA 2YD2A 1MUJB 3I6KA 4RGMB 4JVUA 5JORB 1P7HL 2H9GB 3UC0L 5DRWA 3GFUA 1A4JA 4K7FB 2HFFA 3ARUA 4LKXB 5DD0L 5DJYA 3TFKC 3RWCB 3QFDA 3RGHA 4GRWH 4QXGH 5I8CB 4NRXA 3P73B 1I4FA 1P6AB 1N2RA 2PO6C 1L0YA 1INEL 3LN5B 3D25B 3RGVD 3WFCL 2WWMC 1T1YB 5C9KA 1JTPA 5SWSA 3VRIA 2ZPKH 3DSFH 3WIHH 2GTZA 4BJLA 4G9FD 1RVFL 4ZFOL 5GJTL 2B2XH 4KTDL 4MXWL 5KSAB 2L4OA 5IMOB 4KK5D 4LSPL 1MI5E 3SDDC 2I60L 3CVHL 2XWTA 1RJYA 5DK3A 5MEPA 4OZIB 3HZVB 3X13B 3X3GH 4EDXB 3IJHA 4C56A 1MNUH 2XZAL 4RFNC 3MJ6A 3QUKB 1RHHB 2D4FA 1OP5H 3QIBC 1DQJA 5D7SL 1A3QA 6FABL 3VMPA 2HA1A 3OF6D 4DVRH 1A4KA 4F7EB 4X6CA 4YQXL 3PWJA 5D7KE 5T5NG 2K7QA 2ZKHL 3FONA 3HC4L 4L1HA 4PRAB 1NCBL 2EDWA 3PWLA 1P2CB 2AJXH 2IPUK 2R39A 1C5DA 5C0DB 1M6OA 3OL2A 4R2GD 1P9MA 1UJ3B 3ARDC 4ZFZA 1IAOB 2VZVA 3OG6B 3O81A 3NFPB 4F9LA 4Z7UE 4I18B 1U3HB 1Y18B 5ID0A 3VGGA 3L5HA 2HH0L 1U8MB 4LKCB 3WSQH 5SWQB 3U6RA 3PWVA 3X3FH 3KVQA 4U4BA 1TVHA 2AI0L 1S9VB 5SWZD 2H6PB 4P4KD 3T77B 1F3RB 2QHLA 4P9HH 1Z9SA 2D7TH 2FLBT 2ORBH 2P5EE 5C09A 1ONQB 1WAAA 1KCUL 3SJVD 9CGTA 1YPZB 4NQVA 3SKUD 2DJ4A 2X42A 4X6FB 2IAMB 4I4WA 5CJOL 3GMOA 1M7DA 2ENYA 3FFCD 1Q9LB 5AZEH 1QKZL 4WGWB 5I6XC 4PS4L 3QDGB 4PJBB 5DO2C 2BXZA 3UAJC 3O8XA 4AEHL 5DDHB 3DI3B 4UINL 1SEBB 1UA6H 1IGCH 1CGSH 3F6IA 4IS6B 1P69B 3D6GA 1ZVYA 1IT9L 2QTEA 1UZ8B 4RFEB 4X80L 3CJJA 4MA1B 3E8UH 4PJ9D 1JZ3A 4NC1E 3MRJA 1TJGL 5HYJB 5JQHC 1WV7T 5I1AA 4Z8FH 2VR9A 3DX8A 5ACZB 4X6BB 4IJ3B 4XWOC 1MRFL 4WFHE 3QFJA 5ABDE 1HYSD 4F3FA 5IW1B 3VFGL 1J7VR 2CK0L 4MVBC 4OQ1A 4PJHA 5DHVH 4MA7L 5LGJA 2IFFH 1WIOA 4ZXBB 1KJMB 4HUXB 3WN5C 4HX1A 1QA9B 3VE0B 3IDMB 4CVWA 1QBBA 5BW7C 2BNRE 5EFIB 1JRHL 2YRZA 3CAFA 4N8PA 1QFOA 1VPOH 5MEQA 1MFDH 3EDFA 5K9KA 2PYFB 2XTLA 4WGVB 4YFDB 2CLZB 2GJ6B 2EDQA 3QXAA 1HZHL 4OD2A 2P7TA 3ARFC 4DAGL 3ZMRA 1A7RH 1SJEB 3DETD 2C4FT 4Q6YA 2M1KA 3T08A 1ZE3C 4HH9B 4YLQT 5FUCE 4LCWD 1RUQL 3RZCA 1S7XA 1IRAY 3STLB 2OXGA 1I7TB 3QIWA 4GW1B 2I9TA 5D7LE 1B2WL 3FO0L 1OWWA 3L95A 4F37K 4OZGA 4GG6B 4MMXC 3W82A 2EYRB 5FOBB 3FT2A 3MGAA 5AUMA 5FAAA 4O51B 3LB6D 1JMZA 3EIFA 3FQNA 2IPKA 4X5WA 1I7UB 3BN9C 5HHOE 5CHNA 5DTFB 5KSBF 5ESVB 4NCDA 4OZFG 3UJIH 5FECA 3ZLQC 4HGKC 3PDGA 2KQNA 2D31A 2ZCKL 4ISVA 5F9AC 25C8L 3KYMA 5DR5L 3KPTA 1RULL 4OV5B 3D3VA 1EUTA 1NSNL 4N8VG 3ZT7A 1MCEA 3PGDB 1D9KB 5GGVY 3MUGB 2CUMA 5MI0B 3Q48A 1SM3H 2VAAA 1J1OH 2RCSL 3HAEH 4AY0A 2HWZH 1TETL 5DURB 4YWGL 3D87B 1K85A 4ALAH 3WIIH 4TVPE 5I1JH 3QO1A 3PHSA 2QJDA 2IANB 4RQQB 4JCMA 5E8EB 1MLCA 2H2SD 4XNQB 3RGVA 1IJ9A 4DUXA 4BSVB 3T8XB 1ZVSA 1A2YB 4G9FA 1NBYA 3P2TA 1II4E 2CRMA 4G6MH 4P23D 4DW2H 4YAQB 3SDXF 2V5YA 3QCVH 5C08B 1IEAB 2PTUA 5IVOA 4FQQA 4YIQA 4HG4J 5IWLC 5HGAB 4NSKA 2A0LC 3O11B 1KFAH 1XZ0A 2X4PB 3IKKA 4ENED 1U92B 2W0PA 4NUJA 4X99A 4R90L 3GMLB 3RTQC 2J1KA 1AGBA 1UCBL 1DBJL 3NZ8B 5GRJH 2F53B 3M1BA 1Q1JH 3DXAD 4P3CH 2AJZA 3OF6A 2VDQL 5IHLB 1HYRC 2ITDB 4XMKH 4NKOA 3JUZA 4Y2DB 3EOAA 1JFQH 2BDNH 1ZHNB 4XAWH 5I19H 1F4HA 4L3EE 3RX8A 2OQJA 4N5UA 2CR6A 5E08L 3OJDA 5GS2D 3MLYH 3QUZD 4NNXB 1DBBL 1ZT1B 2B0SL 3HC0A 1X5AA 2BSRB 4LSVL 4JM4L 2Y36H 3S3JA 1NAML 4O02H 4LEXH 1JUFB 5JIHA 3OXSA 4JN2B 5CCKH 1KGCD 1D5ZA 4FQJL 4ZUUA 3EYFA 1SYSA 3ULUL 5T3XH 2YZ8A 4M3JA 3ZYZA 3RY5A 4OD3L 2VQUA 3NTCH 5EBWA 3A6BH 1HHIB 4PRHB 4JQXC 4H26A 5SWZA 4RBPH 4P4KA 2X05A 4P4RB 4HUUB 4XMLL 5IW3A 3EFFA 2P24B 4J4PC 4L8DB 1URLA 1X9QA 1U8JA 2XWBB 5CEZE 3IS1X 2YRLA 1GHFH 1GPOL 3NH7H 4LSSL 1BFVL 2V7HB 3LDBB 1X5KA 5CWSB 3KPSD 3OKEB 3FFCA 1MQKH 5D93C 1ITCA 1NCCL 3NBNA 3CX5K 2VMFA 5F7KC 1AGDB 4JFZH 1U3ZA 2W91A 2FLRT 3LS4L 3SGDH 3B5HA 1YDPB 2A6KB 2R1YA 4JO4H 1NUDA 1FPTH 2OBGA 4U49A 4TULH 4MJIB 3SE9L 1FFPA 2A9MH 2JJWA 2NY3D 5AG8A 1QO3B 1QSEE 4I3SL 3VXSE 4KK8C 5KSBA 3F7VA 3JV4A 1W8OA 2Y6SC 3VFWB 1BGXL 4NQEB 2VXQL 4U6HA 4D0CA 4TTGA 3EGSA 5D9SB 3ZDYF 1F3DH 5J13C 3C5SB 4GXUM 5I8OL 4NWUL 2ADJA 5TF1H 4Y5VC 4X9FA 3BQUB 5CFHA 4NRYB 3AY4C 3RI5K 3BIKA 4G42A 1CI5A 3TBVA 1TZGL 3EOBA 3O6LL 2E27H 1O7VA 5I1EH 1JHTA 4LK4A 4Y89A 1ERNA 4W6WB 4FHBD 5M95B 3HG1B 1XH3A 2FO1A 2GY7B 3GMMB 4W6YB 4LCWA 5ITFA 1WT5A 4K3JH 4AIXA 1NBQA 1MELA 1FGVH 3KPMB 4APQB 1KULA 5E95B 4CBPA 1FVCB 5GRVL 1NFKA 3MLVL 4WEBL 3SKMA 1FH5H 3VDAA 1BF8A 1KB5H 3SDXA 4ZOCA 4B5EA 1WFTA 4FQCL 2BRQA 3SGJA 4G80B 2NXYC 3WL9A 1LK2B 1MCWM 1Z3GH 4ZUTA 4UB0H 1T80A 4WO4C 4PJ9C 5HDLA 4MDJB 1E6OL 4LAJH 3IAQA 3M17B 4JY4B 1T0MA 1UACH 3CFBB 1OT1A 1UEYA 3VXOA 1LE9B 3BJLA 3FB8A 1ORSB 4KV5E 3N1GC 4ZUSA 2EZ0C 3NABH 5EZOL 5IB3B 2FEEL 2UUDH 4TUOA 4XB7A 3P40A 1EO7A 5TE6L 1FVEA 3MOQA 3O3EB 1IL1B 1N6UA 2NZIA 4M9PA 1OAQL 3TA3D 3HAEG 4ZAKB 4JJ5B 4S0SD 4YE4L 5J1AA 5BJTA 1R0AL 3BDXA 3BP4B 4JGJA 3JWOH 1MHEA 5T3XE 2WV3A 3HNTL 1JL8A 1FO0H 5F1NB 2EDXA 4EQ2A 2WWKO 5FUOL 4DK6A 4L9LC 4QOKB 3BJ91 5C71A 2VE6B 3UZQA 1MWAB 1T21B 2G75A 2JELL 4CADB 2NXZB 5FYKH 2ZP0T 4YBLB 3QI9B 3JWDC 5ADPL 1HHHA 3KYNA 3CZJA 4KKCD 4P23A 4CGTA 3F12B 4LVNB 2CRYA 3STBA 1FFNB 3EYSL 1MHPH 4HJ0C 2XT1B 5HJ3A 4LHUD 4MJ2A 1QLFB 1KIPB 2EDOA 2OR9H 4ZFGL 2JJSA 3I6GA 3QQ4A 3FQTA 1WCQA 1GZQA 2DMKA 4I5BA 1F2QA 3DXAA 4G6JL 1SHMA 2ZUQC 3GSOB 2YA2A 5TQ2H 4KPHH 1FCCA 5ICZA 2VL5A 1FZMB 3CU7A 5F88A 5A40E 1JGEB 2A6JA 4JRYD 3R4DA 1D6VL 2XTJD 4I3GA 4P2RE 2W65B 1M05A 4LIQH 3QUZA 1PDKA 3FAWA 3ROOB 2V2TB 3V0WH 2D3VA 1QEWA 5FV1L 4WY7H 4WWKD 1VHPA 4JB9L 4UZGA 3W2DL 1PZ5A 3BO8B 3RDTD 4KMTL 3VXPB 2HLAA 1LD9B 2F74B 5DMKB 2ATKA 4POZC 1X5GA 1B0WA 1R5VB 2H2SC 1OAKH 2DRUA 1KCSH 3UTZA 4TSAL 3IRPX 5J1TC 3QB7C 4FZEL 4K9EC 2YPKB 3U83A 3AS0A 3KPSA 1G9MC 3F7RA 4M1CD 2VABA 1YY8B 4GKSA 3TBWA 4YBQC 4QRRB 5IROA 1J18A 5BQ7A 5BS0D 5I74C 3IDJB 4KKBD 4KKLC 4JDZB 1PSKH 4WUKH 2ZOLA 4Y1AA 5EIIA 4PJIE 5CMAB 3GK8H 3LIZL 5L2JB 4OCRH 3TBSB 1DSFL 3SQBA 1P84J 1RUPH 4XVJL 5E6ID 3S4SA 3IGAB 4GQPH 3WUWG 3F58H 3CZFB 5C0CD 3TJEL 3GJFB 4HPOH 3F65A 3NIGE 3FMGH 4QHNB 3MRKA 3NMEA 2VKXA 3L3OB 2BOBA 2YD8A 3OKDA 1UZ6E 2NY2C 3BP6A 4LSQH 3P0YH 3QDMB 5IESL 2YS4A 3H9HA 4K2UH 1H3XA 2O5ZL 3E6HA 3NZHL 1X6LA 1QHOA 5CGTA 1F6FB 1DQTA 3MSPA 2GSIA 3L6FB 4O4YL 4U0RC 1LNUB 5T1KA 3RWDA 4LPVA 2CLRB 2Y07H 1JGLL 4X0KB 5DMGD 4N0CD 1KJ3L 2X44D 4JY5H 2P43B 3V4UH 3HMXA 4OLZH 4JJHA 1KB9J 4U1HB 4XVSL 4YHYB 4X7SH 2BVQB 4ETQA 1A9EB 3JV6A 4WEUD 3V4VH 3B9EA 4IOFD 3ES6A 4JKPH 4LF3A 4NUGL 5IB5B 4F7PA 1AI1H 4H88L 1QUNA 4PV9B 2W60A 5T1MA 1K4CB 2IBZY 5E2WL 12E8H 4PJ8B 4ODWB 4R7NB 1U8QB 1WEJL 5E8DL 2APVA 2IQ9L 1ZLWH 2FBJH 1RZJL 4D9QD 3ZZ1A 3N50A 2HJFA 3IJYB 2DYPA 4J1UA 3U0PB 1LEGB 4JKLA 1FIGH 5CGYD 1MVUA 5DWUL 2IG2H 4O5LH 3UCRA 4GBXB 4EN3D 4BFGA 4UT7L 2A73A 3G08A 3EFDH 4QTIH 5F72S 4HWBH 2ZJSL 4Q9QH 32C2A 1BQHB 3HFML 4U31A 4R0LC 5DVKA 3UTPE 2CIIA 2I9LA 2H32A 4D9LL 3TA3A 2R2EB 1RZ7H 5E8OB 1AGCA 5IK3B 2QV2A 2XN9B 2R2HB 3GMPB 4BSWB 1C5CL 2V9RA 3FHQA 3FRPA 1I3RA 3FFDA 1BJ1J 2OTWA 4DKAA 4OLVH 2ITCB 3VRLE 4TSBH 3L3IB 5I17A 2OJZL 4NKQB 2WWKT 3RHWK 5JPNB 5I75C 4QNPF 5J9PB 3HPJA 5DJCB 4AM0A 4WJ5A 1I3GH 1OQOA 3CCHA 3QHZL 4H1LG 4ZSOE 4F37F 1IEBB 1AO7A 4HFUL 3BZFB 4J3SA 3NCYP 3ARRA 1N4XH 1RPQA 1U8NA 4N1CA 1HK6A 4HV8B 1NBZA 3MGOA 2D4DA 2VDMH 3LEVL 1DUZA 3GSRA 5DRNA 1N0XH 5JMOC 3BVNA 3D0VA 1FZKA 1TJIL 3QAZB 3PHOB 2EH8H 4KU1A 1MCWW 1SVZA 4MJ6B 2ZNXA 3EYVA 4LHUA 4LPCA 3RUGB 1B4RA 3VXNA 3OV6A 2FX8L 2X4TA 3RIAF 5ACLA 2BCKA 2VZOA 1WC7A 4Q9BA 1HHKB 3VG9B 2GEEA 4P5TB 1J0JA 3VD3A 3W5NA 3L5WB 1YMMD 3GSNB 4UUJB 1T2QL 5EOCH 2XY1A 4PY8I 5HDBE 4JRYA 4M7LL 4TPRL 4YXLH 3X14B 5DK0A 4WUUD 2BVOA 4UT9H 4CVUA 1RFDH 1KN4H 3T0EB 1T5WA 1YEDB 1CICC 4UAOB 3B2UC 4FMKA 4KQ3H 1AXSA 2A77L 4WWKA 2X10A 3BKYH 2PCPA 2YEZA 5A2FA 2OZ4A 5DEFB 4G8IA 3RDTA 1B90A 1BOYA 2EDYA 3LSOB 1MUJA 3E3QE 3MLXH 2YZ1A 4P2QD 1JE6A 1DUYB 2H9GA 3N0PB 1ED3B 4QTHA 5F7UA 4LKXA 1MCKA 1IGFL 2X9WA 4A6YB 4OB5H 4URTB 3RWCA 2B39A 5EZIH 4KKCC 1JK8B 5TJWK 3EDKA 1X44A 1ZLSL 3DX9B 4L4VE 1MQ8A 3KPQB 5DRZB 1PLGH 5TPWH 3KYOA 5SV4A 1A21A 5FYLH 5CD3A 1HILA 2JCCF 3QUXD 5IBLC 3RWIA 3IETA 2F54D 2N4IA 1JBJA 5KVDL 4Y19E 4OZIA 1JZ4A 1A7OH 1RZ8A 3X13A 1MREL 3QXDA 4EDXA 3ARED 4KZEL 1CK0H 1W0WB 5E6IA 3UJTH 1RHHA 2WIIA 3C5JA 5FDYA 3VH8A 5C0CA 2DMCA 5F9DC 2VDNL 3V0VA 1CFNA 2YD1A 5DYOB 4GRWB 3ECBB 4Z7OE 5E8NA 2W1NA 2YUVA 2J4WL 3UTTE 1CFVH 3B2VL 5L7XH 4ZO7A 5GGVH 1BLNB 1P2CA 3DO7A 5I1HH 4EOWL 3GNMH 1A7QL 3UP1A 3T0WA 5D2NA 5SX4H 3B9AA 2VC2H 2Y06H 4Q9RL 1CT8B 5D7LB 1AFVH 4IRSB 5EOQH 4M1GL 4D0BB 2Z4QA 3MO1B 2C3WA 4R8WH 1U8MA 1CGTA 5BRZB 2YOCA 3RVUC 2Q8AL 5SWQA 4XXCC 2UVFA 3SY0B 4GKZB 5IQ7L 2D03L 1OQXA 2XPGB 3G04B 3TIEB 1S9VA 5DUML 5E2VL 3CFCL 1MFBH 4HBCH 3T77A 1ORQA 3PWUA 1J0YA 3VI3F 3UTSE 2VZ3A 3U79A 1TNMA 1YY9C 4P57A 4NNPH 1NLDL 5CBAB 4X6FA 2IAMA 4YZFF 3PL6D 1Q9LA 4KAQL 2MHAB 3MC0A 2HVJB 4S1QH 3D2UB 3AC0A 3KWWB 3KDMB 3CIQA 1NCAL 4RFEA 3UPAA 4EN3A 4TQEH 2CDFA 5F21B 5HYJA 1F90H 1F45A 2RQ8A 3OX8B 3RI5F 5T1DH 4LLQB 5ACZA 4KI5E 5D1ZB 4FXKA 2EDEA 1EXUB 4LDEB 3BPCB 4M7JH 4JANB 2VIRB 3O41B 5CJXC 1GGYA 1IKNC 2DD8H 5DVOA 1YEKH 1QNZH 2BFVH 1OPGL 5T1LD 1YN6A 4HUXA 3VXUE 4I8DA 2V6HA 1YEIL 1EFQA 4LLUB 1TVBA 3BKJL 3I2CL 4NKMA 5HHVH 1YQ2A 4TYUA 3RWGA 3VE0A 3IDMA 4FG6D 4N0UB 5KG9A 5TQ0H 1OHQA 3SGKC 2Z92A 4PR5A 3PQYD 4YDLC 3L3HB 2R69H 1A1NA 2VSDA 2Z31C 4JRXE 2CDGB 3HNSH 1KTKE 5IBTL 1WFUA 2X9XA 5FGCE 2IH1A 5F7YC 1CS6A 1A6WL 1AQDA 1YJDH 1SJEA 2X5PA 2AEQH 5HI5D 2R2BB 5CSBA 4MB5A 3VA2C 1RI8A 3STLA 1ZWIA 2BERA 2AABL 4XCCH 5DHVB 4KMLB 4GW1A 3KR3H 5I18H 3OGOE 2FSEB 3S7GA 4A2LA 5CGYC 3O6FB 4PLNC 2VLMD 5BV7C 4AQ1B 2JCCA 4FMFA 1ADQA 3WO3B 2IADB 3E6FA 3S36X 5FEBA 5HHPB 4S2SB 2P5WE 3CVIH 2GK0B 1CE6A 4LGSB 4Z0BL 4O51A 4PRPE 5JZ7C 1I8KB 2IEPA 1I7UA 1JGDA 3QBTB 4GJTB 5DTFA 2FX9L 4P5MB 4WUUA 4JO1L 4FP8H 1FZJB 1LDSA 1W72A 1R3KB 2HFTA 1HQ4A 1U36A 4LCCA 3JWNC 2Y1VA 2GSGA 2DLFL 2P8PA 5EA0L 1FNFA 2W92A 1QRNB 5MEND 4U1JB 1GGBH 4G43A 5I16B 4UBDD 4OSUH 3PGDA 4BFIB 5AAWA 3VW3L 3OHXA 4YEFA 3MUGA 1UM6L 4JGUA 5HYQA 4P2QA 3P4NB 5A16A 3WDJA 3ZT6A 2HT4D 1UCTA 4GAYB 3KLHD 4PJXB 2PR4H 3BDYH 5F3BB 1RZKL 5HVHC 4PJEF 2A9NL 1MIEH 3ULVL 4RQQA 4PJFF 1S9WA 4YH6A 5E8EA 2DTML 3CC5B 4HT1H 4XNQA 3D39B 1P4IL 1EBPA 1A1OB 3T8XA 5D71L 3VFPB 2NY6B 3EW3B 1IC5H 3GIVB 4W70A 5ALCH 2VZUA 1EHLH 4KTEH 3TF7C 1WIPA 4NDMA 5C07B 4ZODA 1TTGA 1OAYL 2YD9A 1YN7A 3QUXA 1UG9A 1K5NA 2F54A 3KPLB 5JQ6H 5HGAA 4CVXB 5E4EB 4Y4FD 5CSZB 5B8CA 2OTUB 2X4PA 1KG0B 5T3ZD 3HAEB 4LARH 5FF6A 3DGGA 4RWHA 1XF4A 1IFHH 1E4XI 5CZKA 2YMXH 4HCRA 3NZ8A 4WU7B 3CUPB 4PLKC 3TN0C 5GHWL 4HC1A 4MAYD 4Z7VE 2AV7A 4X5XB 4TSCL 4RSVA 4O9HL 5F6HJ 3MJ7A 1MWAL 4IRJB 3VCLA 3HKFA 5TDOB 1TZIB 5FYJE 3MRIB 3OKKA 1IZKA 3RA7L 2Y4SA 5HHQB 3VU2A 3HE7D 3KNBA 3UJJL 1EO8L 2WAHA 2BSRA 3UO1H 1HXMB 3Q6GL 2A1WL 2CRZA 4AENB 5JLZA 4GAGH 4JFFE 5LXGL 4QRPD 4CN4A 3NACH 2HFGL 3MA7B 4NJAH 2YPVH 1F3DJ 3T4YA 1JF1A 5K9JH 1HHIA 4HKXA 1F11B 2UYLA 4PRHA 4RDQF 4YHNB 1CDIA 1UWGH 1A6AB 4HUUA 3FRUA 4L8DA 4CNIB 2MKLC 3O4LE 3X12A 2AXGA 4R26L 2G5BA 2DQHH 2XZQH 4IOSD 3PL6A 1F4XH 3UMTA 2PXYB 5E03A 3MOAL 1RJLB 3SDAB 5AAMA 3AREC 1VA9A 1BHGA 3L7FA 4XCYA 3TVMD 2E7BA 4G5ZH 3A6OA 3NIFF 3TNMB 4Z7WF 3LKSB 5DJ0B 5GGTA 1CGVA 1JYVA 4Q6IA 1HH6B 1AR1C 2MQCA 2Q1EA 1Z9LA 4JAMA 4JEGB 43CAA 3BXNB 5C1MB 2DLIA 1F00I 3SPVB 1G0DA 5KVEL 5IHUH 1JMXA 2VLLA 4W68A 2AVGA 3QDMD 2FEDC 3O3BB 4YFEA 5LQBL 1V5JA 2DI9A 3BGFB 5D9SA 1OAUL 3ARWA 3HI5L 4Y4KD 2NTFB 3C5SA 4M43H 5JW4R 5E4IA 1RUMH 1IGIH 1DL7H 3REWA 2UVEA 1CD1A 4MA8H 1AJ7H 3GEWB 3PQYA 2DQJL 1XR8A 4NQCE 4U1GC 5F7DB 5F1OB 3T2QA 3ARBB 1IVLA 1BIIA 5J6HB 1MIMH 5C2UB 3IVKB 1RUKL 1C5BH 1HWHB 3RL2B 4PJEA 5E2JA 4JHAH 5MP6L 3GMMA 2X4UB 4PJFA 5EU6E 2HYMA 4P2RB 3MLZH 5KZCD 3DROA 1KJVB 1ULVA 1MCPL 1PQZA 3FOLB 1X5XA 1Y0LA 1QQDA 3TPUA 1AIFB 4G80A 4I9WD 4HZLB 4M7KH 1EJOL 2H8PA 5HGBA 5HHXH 3WUZA 2X1QA 4FQ2H 2CJUL 1AGEA 5I8EB 3TO4D 2AEPH 5FGBA 3ZKXC 3RHWF 1OWRM 4D0DA 1LE9A 1JI2A 1YEEL 4FQIL 4CDGC 2BMKB 2F5AL 3BGAA 4E5XB 3HUJF 1KLFA 4PB9L 3H0TA 5MENA 2G60H 5J12C 3SO3C 5MEOA 3NCBB 4UOW1 1IL1A 2I25N 1NBVH 4RWYL 1YMHB 3QZWA 4U1KB 4YXHL 3MV8B 5D5MB 1R3JB 3FO1A 4HWUA 1GXEA 1OTSC 5MHSE 4ZAKA 5GS0H 5T5FH 1U93B 2BVPB 3SE8H 4FG6C 4Q97A 1EJ6A 1RIUL 4KKAD 1EEQA 1KB5B 1M71B 4JQVA 3WLWC 1UXSB 4Q0XL 1MI5D 3BH8B 5F1NA 5C0EA 1VFBB 4GXVH 1LE5A 4QY8B 4KUZH 3SQOH 4CDHA 3O2DL 4LAQH 3WKML 4DVBB 5DD3H 5IFHL 1A6ZA 4JFPB 5JOFA 1T21A 3WEXB 2FL5B 1Q0XL 5IHBA 4KRPB 5I9QB 1E4KA 5FYJU 3MV7B 1DTUA 1GGTA 5T5NF 2BRRH 2I60H 1CYGA 5DVLA 5LKNA 3EOTH 1U8IB 5D7KD 1FNEA 1MFAL 3TCLB 4GW5A 4I2XA 4D9RE 4Y4FA 2AJUH 5GGRA 4OBSA 3JUYA 4XPHH 4YK4C 2EEAA 1I8MB 3W39B 1D5MA 1G6RA 3TV3L 1R5WA 1L6XA 1FO0B 3LKPA 3QEQB 3W0WB 2NR6D 3QPQD 1SVCP 1KC5L 3QUYD 5FA3B 4HXAH 5CD5D 4N1EA 4LU5L 3BD5A 1T04A 5BZDB 4G7YL 2ICCA 3QUMH 2Q8BL 5HHNB 1N6QH 4Z7WA 2WSKA 1FZMA 4YHML 3Q6FB 4BK5A 4UU9B 4OGYL 2QKIB 1JGEA 4H1LB 2EDFA 1MCOL 4XPBH 5FUZL 4EVNB 4KZDH 1N7ML 3JVGC 2QADB 2P5ED 4HSQA 1N5YH 3RU8H 2V2TA 3TWCH 1IEHA 5C70A 1Z6JT 3CFIC 1XIWD 5I8KL 3LRSB 3BSZL 1SEQH 3P9LA 4QRPA 2DF3A 4RAUA 5FHBL 2NYYC 3BO8A 2XA8L 3CH1B 2X4QA 3I3EA 4XPAH 2F74A 4TNWK 5DZLA 4X4MA 3REVB 4P9MH 4WW2B 1R5VA 1TQBB 1KPVA 2X40A 3OAZH 1D6EB 1J86A 2HJKB 1FL6A 1KENL 3DMMD 1CL7H 5CJOH 3GSNL 2WMPA 3U7YH 4J7RA 5DS8A 1UADC 1BFOA 3NA9H 1NANH 1YY8A 4Y16D 3RPIB 4DN3L 1S8DB 3SE3C 3TVMA 1ZHKB 4JFOB 4Z7UF 1DBMH 3RY6C 5D70L 1LDPL 2JLLA 3IDJA 5L2JA 3TBSA 5C6TH 2H2PC 3LS5H 5H2BB 4JREB 3QWQB 3V8OA 1GGCH 3PABA 5IGXH 4OLWL 2BNRD 5F7LB 5C0FB 3DARA 1IGJB 3VWJB 4JO2L 1I8LA 3VJ6B 4A6YL 3L3OA 3OR6B 4JE4B 1TQCC 4K8RL 3HE7C 5EU5A 3AM8C 3HR5A 4YX2L 1A3RL 2FB4L 2LU3A 3IDYB 1V3JA 1SMOA 3QDMA 3HUJA 1CFBA 4HQQH 3BPOC 1T2JA 1SY6L 1C12B 4Y4KA 1WZ1L 2YBRA 4IRZL 5DI8B 3CFEB 5I71B 4KJYB 3V5KA 1U8KA 3CMGA 3L6FA 5B3NA 1NMAL 1BFSA 2VLJB 3EHBD 5D7LD 4ZQKA 5C92A 3OPZL 3RWJB 2VYRE 3K4DA 2YR3A 2CQVA 2J8UE 5GS3A 4V1DB 4PRIE 5L8LB 3L5XH 4U1HA 2B4CC 2BVQA 3S37H 5ISZE 1A9EA 3FQUA 2EDHA 1GIGL 4WV1A 2Q7YB 3EO1A 5HHOD 4GKNB 4QXGL 1K4CA 5IEHA 4U6XB 2W0KA 4R7NA 4WFGE 1H0DB 1HQRB 1U8QA 4PJGE 5C0IA 1CDBA 2ZPKL 3DSFL 4HHAB 3WIHL 4KHTH 1K3ZA 2B2XL 1MRDH 1QYGH 1QSZA 4IHOB 5DJAA 3ULSA 3D2UD 1T0NB 3B43A 5F9OH 1J05A 4GKOA 3L3GA 4OI7A 4Z95H 3TO4A 1XF2A 3A6CH 3X3GL 2J7LA 5C6PB 2FJHA 3UX9B 5A2IH 5C0JB 4WW1A 4DWHA 1JNLL 2GCYA 4Z9KB 4NPYB 1INQA 5E99H 1BQHA 4HPYH 5EOCJ 4TVPD 4DVRL 4GS7C 5CJQH 5GRZA 4F7TB 3GMQA 4NFCA 4R4FH 2AERT 5E8OA 2GAZA 3BGMA 3IAGC 5IK3A 3N1QC 2R2HA 3GMPA 2AJXL 4OIBA 2PYEE 4PY7B 3IDNA 3PV7A 5GISH 1MI5A 4DZBA 4RX4D 5HGDA 3TPKA 5JPNA 4Y19B 4XGZA 5DJCA 1DEDA 3MFFB 5FO8A 1OGAB 2HRPH 4R97B 4WHCA 2EIZB 2NCMA 3V6OC 4JR9H 3KHQA 5DLMH 3N9GH 4KRNA 4HLZH 1IEBA 4WHDA 3O9WB 4FTVD 1WBYB 2ZSWB 4M4RA 3WSQL 2VTFA 3C5ZB 2FYYB 1BWMA 4HV8A 2BSTA 3X3FL 2XY2A 3JSSA 4HIXH 5HPMB 5F89B 1X7QB 3CLFH 1P7QD 4P9HL 2D7TL 2ORBL 4YDVA 4L3ED 2LAGB 3PHOA 4PBVC 5JDSB 4MJ6A 4EI6B 3KPRE 2OR8A 4MSWB 5EB9A 2CUIA 2UZXB 3WS6A 1TZHA 4N0YH 3LKOB 4GUPA 4EI5B 3HZYB 1CF8L 4F58H 4ZS6C 5AZEL 4PD4J 3P11H 3B8SA 4JFXA 3QEUB 4Z7UA 3VFMB 1NFDE 5J3HC 4U1LB 3L5WA 5GGUA 1UA6L 1IGCL 2FWOB 4UUJA 1JZ5A 1CGSL 3OKOB 4DGVH 2SEBB 1A9BA 2W07A 4OI9A 3IFOA 3G5XB 4QYOA 1MHHA 4L8SB 3B6SA 3E8UL 1VACB 2V17L 1KEMH 3CXHJ 3UTSB 2P5EA 4AMKH 1A02N 5CEXB 2DJUA 4WEMB 1XIWA 3GSVA 4Z8FL 1YEDA 5CEZD 4KKAC 5CILH 4LRNH 5L0QB 3QHTC 3U30C 3L3DB 4NP4H 2DAVA 4JFYB 3FQXA 3LSOA 4FA8A 2IFFL 3TC9A 4LNRB 4JVWA 4H5SA 3C6SA 1B0RA 3FO2A 1FFOB 1R3HB 2BOCB 4XNUH 5E9DE 1ED3A 1HE7A 3DMMA 2ICEA 1I9RH 5D7JD 4A6YA 4XNMA 1VPOL 4TOYL 1MFDL 3HZMA 3MLTA 1U2HA 1RURH 5GS2H 1G7MB 1IC7H 1KJ2A 4JZNA 4XXDB 3BYYA 4POUB 1EIBA 3S35X 1SY6A 4Y16A 1QSED 4OZFA 3LS4H 5GZND 4QLRA 5EO9B 3VXSD 1A7RL 1TLKA 5EZJB 3BZEA 3QG6A 4K23H 1Z5LA 3QUYC 4ODSL 3WS3B 1IAII 4PGZA 5CD5C 3VXUB 4N8VA 2M8XA 5GGQH 2FR4B 2BC4A 1PG7X 2VLKB 2YWYA 3RNKB 4XWGH 4HS3B 3ARXA 2Z8VC 2BNRA 3GM8A 4G8GB 3RVVD 4ZTOH 3LPFA 1OTUD 4NN7C 3B9KC 5HI4C 5FDWA 4WFEE 5E1AB 1XGRB 3SDCC 2EE3A 3ULUC 3OB0K 2NPLX 3THMH 3IDUA 1S7TA 1G9NC 1BREA 3ZSSA 4Z0XA 3S5LB 1BLNA 5C6WH 1H3PH 3WIHA 3OZ9H 4M62H 3O4OB 1T1XB 3UJIL 3CPLA 3PHQB 3MRNB 3ARVA 1H5BB 4B0MM 3T4AB 1MJJA 2X4OB 2W0FA 5D7LA 4HUNB 4IRSA 1MAJA 2J12B 4D0BA 1KTDB 3RWHB 3RWEA 4DK3A 1SM3L 1J1OL 1HHGA 2Y5TB 3RVWD 4GKZA 2NY4D 4WI5A 2P5WB 4YBHA 3DO3A 1LEIA 5IBUG 3IFPA 4KDTC 4RMRA 5KSVA 2HWZL 1QPPA 4LVOB 4YHZH 4ALAL 5HHOA 3WIIL 4QT5A 5I1JL 2AQ1A 4Y4HD 3C60B 4DGYH 3AS3A 3DRQB 1E4JA 1U8HA 4Y5YB 5D6CA 3CDGB 1K6QH 1LP9E 4G6ML 3IDGB 4DW2L 1XGPB 4RIRB 2IALB 1QG3A 2HVJA 1UB6B 3MRDA 3QCVL 2FJFA 3D2UA 1DLHB 2VXSH 1TNNA 1GCFA 2YUXA 3HMXH 1DP0A 1KFAL 3MBEC 4MNQE 5CEYA 4HF5H 3M8OH 4QRTB 1J8HE 2XQBH 3T0BA 5GRJL 1Q1JL 1JPGB 4P3CL 3FCTA 5ANME 2VUYA 4XMKL 2GK2A 3Q2CA 3ZTNH 1JFQL 1RD6A 2BDNL 5A43C 3TIDB 1AC0A 3BPCA 5HHMB 4FZ8H 4XAWL 5I19L 3C8KB 3DURA 3ZE1E 1QR1A 1K8IA 4GRLB 4NZJA 2XZCH 5ICYB 3MLYL 4PGDA 2NY5L 4YDIH 1GOFA 5GGRY 4HIIB 4U05A 2Y36L 4O02L 4LEXL 4WENB 2ERJB 4KKNA 4FQLH 5CCKL 5JXEC 2EKSA 2XRAH 3G5YB 4P3DB 2IPTH 4YDJB 1IBGH 4ZO9A 5T3XL 3NTCL 4KV5F 1PBYA 3A6BL 4PG9B 5I73C 4Z7VB 2H32H 1AXIB 4WCYH 1P7QA 3DUHA 4KDWA 4L3EA 1F42A 3CD4A 3LCYA 3BWAA 4P2RD 5E6YA 3LZFH 1JGUH 4KQ4H 5CKGA 3HRZB 3NH7L 2NY1B 3ZDYE 1NMCC 5D2LE 3ILQC 3QPXH 4N68A 3KXFE 3UBXG 2E9IA 2XACC 2OYPA 1MQKL 1OY3B 1DVFD 3CDCA 4GLRI 4NQTA 3WNNA 2ZOKA 2IADA 5LAXB 1BBJB 1JF6A 4K94H 4P49A 4S2SA 4JFZL 4QO1A 1L4IA 2EICA 4QHUA 4U7MA 4HKBB 4DKEH 2R29H 3IB4A 4MD4A 5C0NC 4JO4L 5ID1B 5H35B 1FZJA 3MMEB 1FPTL 4M7ZC 2NW2B 4TULL 1R3KA 1RK1B 4FQXB 3SCMC 2A9ML 2VSCA 2X89A 1NJ9B 1OSZB 1ZT4B 2E7MA 3DWTA 2GYSA 5ITBH 1BVKB 4U1JA 2ZCLH 3LAFA 1TCMA 4M93B 2OSLB 2VDOH 5EBMB 1TPXC 4XH2B 4JY6B 3QIUC 5C0AB 1AKJB 4FN0A 4FZEH 2X2YA 5F9JB 4MQXD 3RNQB 5D7JA 1YEHH 5TF1L 2OMBA 2WQ8A 5KANG 4PUBH 4L8BA 1IC1A 1JN6A 1D5BB 2XFXB 4HEME 4C83B 1JHKH 2E27L 1JWSB 5FK9B 2V2XA 5I1EL 4I48B 3QJHA 1QSEA 4AT6B 4BZ2H 4S1DC 4JM2C 5IFJB 3VXSA 5B3JE 1UH3A 3H2WA 1ZGLP 2OZ4H 1IQWH 5LVEA 5DEZA 3BEWB 4K3JL 1FGVL 4C57C 2FZ3B 5IW6B 5DHXB 4XC1H 1KG0A 1JGVH 3HAEA 5EU3B 4GH7B 3T0DA 1FH5L 1WCBB 1KB5L 3QIBB 3CUPA 5C0BE 5IMLB 2YKLH 1Z3GL 3LRGA 4UB0L 4X5XA 2J5LB 4HWEH 1S3KH 4G7VH 3OKNB 4TNWF 1T4KA 4PG2A 1AY1H 2NMSA 1FE8H 4QF1A 1PG7W 2C5DC 3T2PA 1UACL 1D7FA 4NYLB 3U0TB 1B9ZA 1A6PA 3MRIA 1HI6B 1FL5B 3NABL 5EU6B 5M94B 1I1AD 2DQFA 4NRZB 1E4WH 4AENA 2FD6H 2YC1B 1GC1L 4PJIF 1ZVHA 2DQCH 4U6VH 5DRWB 2HP4A 2VL4A 2HFFB 1JNNH 3MNWB 3JWOL 4NHUA 1KEGH 5DJYB 1L0QA 1FO0L 3QFDB 3RKDD 1I4FB 1KB9K 3F7QA 3NIGF 4RGNE 5ACMA 1N2RB 1Q9WA 5D1QD 3LH2H 2ESVE 3IRZA 4CNIA 1UZ6F 2GTZB 3BHBA 5GZNC 5FYKL 4P2OD 1J1PH 4RGMC 1OCWL 2XNAA 1CLCA 4M5YH 5D1XD 1ZHBA 5HD8D 4NKDB 3UTPD 1WISA 1RJYB 5MEPB 2E6PA 1ZA3A 4HZAA 3IJHB 1QOKA 4XNYH 1DQJB 3DGCR 2VZ1A 5CZXC 2OR9L 3LKSA 3P3YA 5DJ0A 2BHUA 1A4KB 4IBLT 4X6CB 3VGAC 4NQUA 2C3HA 1B6UA 5KSAC 3U7WH 3FONB 3BWUC 5TQ2L 4KPHL 3PWLB 4FXLA 3BXNA 1AQKH 4ESKA 4M3KB 1C5DB 2VLRE 1WBXB 3GSQA 5IMMA 1M6OB 2NY0D 2LE9A 4FS0A 4ZFZB 4AIZA 5E6ZA 2WBJD 1NPUA 3O3BA 4LIQL 3WLBA 3ALPA 2DL9A 5JHDE 2YK1H 1F6LL 2NTFA 3HN3A 4NIKB 3QRGH 3V0WL 5ID0B 4BM7A 4P46D 3G6JE 2HMID 5DMIL 4LSDA 2NY4C 4U1IA 4WY7L 3U6RB 3PWVB 2C3GA 1NGYB 2JK5B 4YPGA 3V8CA 5JUEH 3CH8A 3G5VA 1CDYA 2BVYA 1RZJC 4G8FA 5F8QC 4XVUD 4Y4HC 1UJ3C 1OAKL 1KCSL 5CBEB 4NQVB 3WUWA 2I07A 4I4WB 5D8JH 3E2HB 1S9YA 4KROD 1EX0A 4I18C 1M7DB 1U3HC 4P2RA 4AJ0A 1VSCA 4M6MH 2JE8A 3O8XB 1WGOA 3V52H 4F33A 1QLEH 2YXMA 1XCTA 4BQ8A 1DVFA 3V5HA 3BP5A 1X5ZA 4X6DE 4M8QA 1DN0A 4CKVX 4UQ2A 1K2DA 1LK3H 5DEGB 3FB6A 5SX4I 2J88H 4J23A 1PSKL 5IJKA 3GK8L 3MRJB 4OCRL 3UDWC 1EPFA 2WANA 3VXRE 5I1AB 1RUPL 3DYMA 3GO1H 4LPYA 4OF0A 3BRFA 1WIUA 3F58L 4E5XA 1WK0A 1Q0YH 4F3FB 2E7LC 1T6WA 4HPOL 3O3DB 3FMGL 4J3UA 3TT1H 3ARGD 2KPNA 4PJHB 5LGJB 5BCAA 3VI4E 4U7KA 2M26A 4L4VD 3MV11 4LSQL 2VRAA 1U93A 4MA1C 3QP3A 3MACH 3P0YL 3PGFH 1ADQH 3MA9H 3VGHA 5MEQB 4K2UL 3T65A 5K9KB 4QY8A 4PJIA 1AD9B 4Y19D 3L9RB 5K9QG 5HDBF 1KIRA 3QXAB 1NFIB 2GQHA 2Y07L 1WJ3A 3FHAA 4JFPA 4LSTH 4OD2B 3WEXA 2EC8A 1W72H 2P7TB 3W11C 4OKDA 4JY5L 2VJXA 3STZA 3V4UL 4OLZL 4ZXBC 4KTYA 4X7SL 4B7LA 4CW1A 3RZCB 2P49B 3V4VL 2GTWB 1U8IA 3SDYH 3ET9F 4JKPL 2RR3A 3QIWB 3UTTD 2E5EA 2I9TB 2L7JA 2L7UA 3HI6H 1AI1L 3SE4C 2B1HH 1JHLH 3TNNB 4NZUL 4P0DA 4X83A 1IARB 12E8L 5HYSG 4X4XA 3W39A 4XPFH 1CTOA 4KK6C 3FT2B 3QEQA 2FBJL 3BUYA 2HTLC 2DLEA 2YA0A 3FQNB 3IS0X 3LQMA 2APTA 3B2VH 4PJ5E 5DUBB 4X5WB 5CHNB 1FIGL 3HE6D 3Q6FA 4O5LL 5FECB 1FBIH 2D7QA 2D31B 3K7UA 3NFSH 1ZMYA 4O2EA 4ISVB 4H1LA 1F4YH 2R4SH 3EFDL 4QTIL 4B53A 4HGMA 4HWBL 3D3VB 1TMCB 4Q9QL 1UFUA 2EXYD 1T2XA 3TZVD 1RV6X 4X98B 2VAAB 3N1PC 4JPIA 1RZ7L 1BMGA 4DCQA 4HCRH 2CH8A 1BWWA 3CH1A 3VD9A 3GHEH 2W59A 4HC1H 1G1YA 4LHJB 4OLVL 4WW2A 3P4LA 4PJ7F 3U82B 4TSBL 4G8EA 3QO1B 1MLCB 1ZXQA 3RGVB 4CAGA 3QUMB 1FAIH 1J11A 4Z7OF 1I3GL 4M7LT 1ZVSB 5E00A 5GRUH 1K8DA 1D9KC 2BK8A 4G9FB 5FGRA 1ZGLB 1MAKA 3AROA 1N4XL 5MI0C 4LCUB 2DICA 3VGEA 3DUSA 4WTXA 5D1XA 3D5OF 1XAUA 4LVHB 4YIQB 5D93B 4NSKB 2VDML 4KI5D 5IQ9B 4U3HA 5F6IC 1PGRB 1XZ0B 1N0XL 3BD4A 1ZHKA 3TYGH 3UYRH 2EH8L 4H8WH 1CR9H 3MNVA 1AGBB 3WNKA 1CDCA 3P0VL 2EXWC 2IMMA 3UXFA 4HAGA 5H2BA 4NKOB 2FO4B 2IGFH 3KYKH 3VGFA 3EOAB 4BZ1H 4E9LA 1T1WB 2AK4E 5JW4N 4ZSOA 1T83A 1IGJA 3VWJA 2DQUH 5EOCL 4NQDD 3VJ6A 4DN4H 4JRXD 1HIMH 3OJDB 1I1AC 4R2GB 3WV0A 4YXLL 4XHJD 3K4ZA 2UY6A 4LEOA 4UT9L 4MB4A 1R6VA 3OXSB 1C12A 4L4JA 3WD5H 1RFDL 1D5ZB 3INUH 1YMME 4ERSL 4OF8A 5DI8A 3EYFB 3MZGB 1CG9A 4Y2DC 4KQ3L 5GIRA 5EBWB 3BKYL 5GGTH 3RKDC 4Q2ZA 1QACA 3H9YA 2EDJA 5D1QC 5SWZB 3MLXL 2X41A 1GZPA 2KZWA 3MYZA 5H94A 3SJVB 1U8JB 5AD0B 4P2OC 1EAPA 2Q7YA 4FFZH 2L0DA 4KI5F 4PRPD 5E2UH 4L4TE 5INCA 4OB5L 2R15A 3WHE1 3FFCB 1CE1H 4Z77A 4GKNA 2CO7B 5EZIL 3QQ3A 4LP5A 2YD6A 3WFZA 1HQRA 4G9DA 3FT4B 2D7NA 1PLGL 4HHAA 3VFOA 1FYTE 1CBVH 5TPWL 2BSSA 2AJVH 5FYLL 1EHXA 4OTXH 2R1YB 1BD2E 4PJ9B 3SKNA 1GH7A 1A7OL 2MFNA 1FFPB 3LDBC 4JPKH 1CK0L 5C0JA 4OLYH 4F2MB 1U3YA 3VWKD 3UJTL 3RVTC 4FFWD 3VI3E 4JZJA 4ELME 3B9VA 1HKLH 5KSBB 3BMWA 3ARGA 2WBJC 5IBUB 3PF2A 4Z5RA 1NQBA 3DV4A 4U6HB 4D0CB 3D85D 4KXZI 5CJ5A 3TEUA 3EGSB 4L4VA 4M8VA 2ZSVB 4NO3B 5IHZB 4TTDC 1CFVL 3GZKA 5L7XL 4P46C 5KOVC 3RBGA 5GGVL 1CLYH 2ADJB 5I1HL 1M7IA 1MCSA 4NC0B 4ELKA 3GNML 1EHAA 1YC7A 5E70A 3X11B 2D0GA 4Q58C 3BIKB 4G42B 3TBVB 4Y19A 2VC2L 1Z0NA 2B5IB 2Y06L 2JF1A 2VNCA 3EOBB 4HMCA 1IAIM 5IM7B 4MWFB 1AFVL 1JHTB 5EOQL 1J87A 1OP9A 3O9WA 4R8WL 4EQ3A 4LCWB 5ITFB 2J8OA 1A7NH 4QEGA 4IIQC 4V2BA 4E41E 5HYIA 1FLTX 1MFBL 1P4BH 5B22A 3UTTA 1YUHB 3BFOA 3BUTA 5TDNA 5LCVH 5E24E 1R24A 3BQUC 1QPXA 3SKMB 1AHWA 4ZPTA 4EI6A 1T3FA 4OQTA 4MSWA 4Y5XC 5FYJD 3SDXB 3T0AA 4NNPL 1MFEH 3QCUL 2DL2A 3WL9B 2HT2D 4AEIH 4ZUTB 3I50H 3P4OA 1ND0B 3DRTA 4JFFD 4DUWA 2ZUQB 4U1LA 5DD6A 1T0MB 1G7QA 4B7IA 4S1QL 2FWOA 4L8CB 3PDOA 1K4DA 1I75A 1QFWI 3HE6A 3VXOB 3FB8B 4LLMB 4APQC 4XP1H 4Z6AT 4TQEL 3UTSA 4U1NB 4JG1H 4LNVA 3EYOA 1NCUA 1F90L 1RZKC 3O4LD 5T1DL 5IJVA 3TZVA 5J1AB 5BJTB 3IJSB 1SBBA 2HLFD 1HEZA 5DK2A 5T3ZH 3DSNA 1G6RH 2YUZA 2PW2A 3QQ9D 4M7JL 2CIKA 5JO5A 4NM4L 4KJWD 2DD8L 1YEKL 2V9TA 1QNZL 2BFVL 4LNRA 3MRBA 4O2CA 2FBOJ 2X70A 2NLJB 3FJTA 3MRMA 2G75B 3SOBH 4Z7VF 4M6NH 5HHVL 1OD7A 4BSJA 4KY1H 3MODH 5TQ0L 1X5LA 1VCAA 1HHHB 3KYNB 5LJYH 3TFKD 2R69L 4P23B 1G7MA 2PO6D 4R6UA 3I6LE 1FNGA 4XXDA 3HNSL 3MZTA 2WWMD 3C6LD 2Q6WB 1LO3H 4LLDB 2X4NB 1YJDL 2AEQL 5D4QA 5EN2A 2IH3B 3I6GB 3QQ4B 4MYWB 4H0IA 3SDDD 4GRMA 4HKZA 1I9JH 3ZYIA 1GZQB 3B8YA 2NXZC 4I5BB 4XCCL 3DXAB 1TJHH 3VXUA 3KR3L 5I18L 4YBLC 3QXVA 3QI9C 5BVJA 2FR4A 4EEEA 5ICZB 4HS3A 4EBQH 1VGKA 4HJJH 3WCYA 4CMHB 1A47A 2A6JB 4LVNC 1Q72H 1L9MA 2NNAA 4NQCD 2HJLA 2JB6B 3CVIL 1XGRA 3P9WB 4JRXA 1NCTA 1M05B 3IFLH 3LKQB 3CXDH 3QUZB 4OAWA 2EXYC 2OI9B 1FNSH 3S5LA 1FC2D 4AZ8A 4FP8L 3QH3A 5JTWA 1PVHA 5MERB 2F58H 3HB3C 1FLRH 3E0GA 2Z0BA 3ARDD 1MJ8H 1PZ5B 3O0RH 1UWEH 5DUPH 1P6FA 4YR6A 3MRCB 4J8RB 2HLAB 4YNYA 1GGBL 2X4OA 2DLTA 2ATKB 2QL1A 4OSUL 2PTTA 1X5YA 4LVEA 3OXRA 1JTTA 2P5WA 2YD4A 3VFRA 5EC2B 2JJTA 4LLYA 2PR4L 3BDYL 7CGTA 3KPSB 2JJUA 1JZ7A 3PGCA 3ZE2E 1N59A 1MIEL 3LPGA 3SBWA 5DSCB 1RZIA 5KAQG 4HT1L 1I9IH 1JPSH 1BJ8A 4KH2A 3GKWH 3G9VA 4N9GB 3AB0B 1IC5L 4GFTB 4WNQB 1QLRA 1CVSC 4C55A 5ALCL 3CDGA 1EHLL 2ZOLB 5EIIB 4KTEL 4RIRA 5DO2D 3UAJD 1MAMH 1N5AB 5MHSD 3QYCA 5CJBA 5T33L 5JQ6L 2F5AH 4W4OA 1YQVH 4OCYH 4POYA 2NY3B 1HWGB 3BW9A 3VWKA 1MJ7H 1J9CT 3MRKB 3MRLA 1IFHL 4QRTA 4F7MA 2YMXL 4RWYH 4I0PD 3DX6B 2CR3A 3BP6B 1HSBA 4X6EB 4D8PA 3P77A 1OW0A 3D85A 1CL7I 2IF7A 4WIQA 5E5UB 4XWOD 1V3LA 4WDIA 5DQ9B 3BRDA 3C8KA 4UTBH 3KJ6H 5KBNC 4MVBD 1NGQH 4ONOA 5EPMA 2Z35A 4WI9A 2GSIB 2VB5A 1F58H 4N5ED 5JIPA 4XPTH 5TH2A 4MD5A 3UO1L 1MCHA 4GAGL 1MRCH 4Y8AA 4MLSA 3NACL 1QFHA 4ETQB 5CP3A 1VFUA 3JV6B 3WJJA 4LF3B 1VFOA 4Z7VA 1DQLH 2W60B 4ONFH 2P1YA 3ARFD 1ZA6B 3LN4A 4YHLH 3EJZC 3HPLB 1Q9OB 5DT1H 1FG9C 2DQHL 2XZQL 5FKAB 1CFQB 4WI3A 4MNGE 1F4XL 2DJSA 5JMRA 2X4RA 1KTLA 4YHYC 2E7CA 1S78D 4JFFA 1KPUB 3UPRA 1BBJA 4PYHA 3H9SE 4G5ZL 4XCEB 2DI7A 3C08H 4PJ8C 3MUZ1 32C2B 3QXTA 4PBXA 4L1DA 3LD8B 3BN9D 5H35A 2CIIB 3MMEA 2H32B 4LGRB 1RK1A 2GJZA 4FQXA 3TA3B 3O4LA 1AGCB 4EUPG 2DM3A 4MA3B 1G7JA 1E4XH 1I3RB 3FFDB 5EIVA 5GGSA 2D0FA 1RJCA 4K7PX 2OTWB 5I1IH 1RU9H 4GBXC 5CUSH 4LASH 1JPST 4AM0B 3BPNB 4JY6A 2YD5A 3CCHB 4E42B 1NMBH 4M43L 5J7CC 3CDFA 1RUML 1IGIL 1DL7L 2BNQD 4AH2A 1S9XA 1RSFA 1U8NB 4MA8L 1U91A 1AJ7L 3LRHA 3R06A 3WNOA 1N8ZA 3MGOB 1D5BA 2PO6A 4C83A 1DUZB 3GSRB 5DRNB 3V2AR 1MIML 1FZKB 4I48A 3BH9B 4OFDA 1C5BL 1FNLA 2X1PA 5IFJA 3EYVB 4LHUB 4LRIC 4JHAL 5E0QA 1YYLH 3VXNB 3D0LA 2X4TB 1DBAL 3LY6A 2NY7L 2BCKB 4JQIH 4NBXB 3SDDA 3MLZL 4KVNH 3FTGB 1WC7B 5D6DC 1IKFH 2FZ3A 4OLWH 4OM1H 4OGZA 2A0LD 4BH8A 1S7SA 4NO2A 3RVXC 3V6OE 3VXTB 4LFHG 1X5HA 1CZ8H 1QSVA 2CXKA 1FC1A 2RGSA 3RTQD 3QIBA 4A6YH 4JRYB 3ZKMC 4M7KL 4NQCA 2XTJB 4NO0D 3IU4H 1CQKA 3QAZC 5DK0B 1KJ2H 2YUWA 4XMPH 3EZJB 4FQ2L 4PRID 1OF2B 1KCVH 2AEPL 1T5WB 5FCSH 2ARJA 4OZFH 5ISZD 1CFTB 2QSVA 4WWKB 5EU6A 3VG9C 3TBTA 2PCPB 4P5TC 3SHSA 3ARDA 4NRZA 2EDRA 1S9KC 4G8IB 1REIA 3RDTB 2BSED 2G60L 5DJXA 5IVNA 5AZ2H 1NBVL 4U3XA 5F7WC 4WFGD 2YC1A 3I3DA 1VKXA 5BVPH 1I7RA 5GS0L 1ZV5A 2NX5E 5T5FL 3SE8L 4MS8C 4QTHB 1GIGH 2O26U 1BFTA 3MNWA 3TBYA 4PJAE 4AQOA 4PLOB 4QRSA 3T0EC 4GXVL 4KUZL 3SQOL 4LAQL 5FO7A 2R0KH 1B4JL 2DB8A 4KJQC 3UBXI 3C6LC 4OZHE 4BZYA 5DD3L 4J4PD 3VXRB 3KYOB 5L9DH 1OSPH 5KOMC 5CD3B 2PW1A 1HILB 1KOAA 5BS0B 1H3UA 5JR1H 2BRRL 1M4KA 4NKDA 3RWIB 3IETB 5F7MC 3EOTL 2F8OA 1RZ8B 1JPFA 3QXDB 4K8RC 5E6IB 3DIFA 2ZUTA 1JNLH 4NQXB 2WIIB 1CGYA 4HDIA 2PYED 2AJUL 3C5JB 3GGWA 5C0CB 3VH8B 4XPHL 1LO0H 2J8UF 1CFNB 1KLGB 3V0VB 1EBAA 5B21A 4EXKA 4QRQB 3U9PH 1YC8A 4PFEA 5HVGB 5E8NB 1P1ZB 4HXAL 3OGCA 3LQZB 3QUML 1N6QL 2X1OA 3DO7B 5JPMA 2R0WH 1JNHA 1WBXA 5DC4B 4KK8D 2YPLE 4LL9A 4PJGF 1EEYA 1D5XA 4XPBL 4KZDL 2Y6SD 4Q74A 5D2NB 5ESAA 5KANI 2J8HA 3DVGB 1N5YL 3WN5A 3RU8L 3TWCL 3PXHA 2Z4QB 4LLWA 4JFEE 3KPRD 3VFUA 5BW7A 5HTSA 2J2ZA 1SEQL 5TE7L 1T5XA 5JIKA 4ZNEE 2LFGA 5JHLH 4ZUWA 1NGYA 2JK5A 4L5FH 1NGXB 1ORQB 3PWUB 4XPAL 4TVPH 4TRPH 3ULUE 4P9ML 4YPJA 3ARFA 1A1MA 4P57B 5CBEA 2KL6A 4OGXH 1MCFA 4LMQI 1CL7L 4HMDA 4B50A 3U7YL 3U48A 1CF8H 4KJPC 1OTTC 3MOBH 4JKMA 1AXTH 4Y8DC 2H3NA 3DTXA 3NA9L 1PJ9A 5HVFB 3NGBB 3JV0A 4EN3B 2Q20A 2NXYD 2KDGA 1DBML 1E28A 1YNKH 2CDFB 2VQ1A 5DEGA 4WO4D 3U4BH 3MV9E 2V17H 2VAJA 4I0PC 2P8MB 3K74B 1DLFH 5C6TL 3LS5L 3IDIA 5E9DD 3Q5OA 1WTGT 1UENA 1GGCL 4E0RA 5IGXL 5ETUA 4FXKB 4J6RH 1WTLA 2EZ0D 3CX5J 1N3NA 3O3DA 1DR9A 3GBNH 4N5EC 3G6DH 4YFLI 5KVGH 4HS6A 1YN6B 1OAXH 1Q38A 2DBLH 2N7AA 4OFKA 2HKHH 3OTTA 5IVXE 1QSFE 4CJ1A 1LO4L 1TVBB 4JO3H 4NC2B 3ZO0A 4NKMB 3S36H 4RZCB 3RWGB 2O5XH 3PNWA 4DQOH 5KG9B 1UQSA 4HQQL 1MHCA 1FGNH 2Z92B 1NFDF 4PR5B 1HH9A 4TOYH 4P9HC 3PWPE 3S3PA 2GUOA 1JZ8A 1A1NB 5F1SA 1AD9A 1U95B 2CLVA 4OLUH 5D1ZC 3L9RA 2DWEA 1NFIA 2IH1B 1EUUA 1AQDB 4X7CC 4U1SA 1XGTB 4Y1AE 4DOHE 5CEZH 1BPVA 3DVIA 3Q0HA 3L5XL 4WFED 1NCWH 3KAAA 1FFQA 1CGXA 3MYJB 3S37L 4ODSH 2GTWA 4PGBA 1ZWIB 5DJ6A 3OKMB 2GY5A 1ZSDA 5I76A 5IWLA 3TNNA 2E6QA 4RFOH 1S78C 2N1KA 4HJ0D 2JCCB 2KKQA 4YO0A 2HVKA 4QRUB 3E6FB 1YMMB 1DEEA 4MGXA 4HJGA 3BEVA 3RTQA 1CE6B 4JHZA 4KHTL 3S88H 2PTVA 3T3PE 5DUBA 4NO0A 1MRDL 1QYGL 1JGDB 5L2KD 4WUUB 5F9OL 1W72B 4D3CH 2J8UA 1EH9A 4PRIA 1KTRL 4Z95L 1HQ4B 2AJ3A 1A7PH 3A6CL 2ZNWA 4LCCB 3MLWH 5IKCB 2GSGB 2P8PB 1YA5A 3V6ZA 5ISZA 3O6FC 5IR1A 4G43B 4MXVE 4U6YA 5E99L 3OHXB 4HPYL 1DE4A 1WFOA 4OGAC 1XT5A 2UZYB 5CJQL 5HYQB 4O2FA 4P2QB 4X98A 1YYMH 5A16B 4R4FL 3VFTA 4PJGA 2XG4A 5DGQA 4FQHA 5A2KH 3MROA 3S6CA 5D7IF 5GISL 3OG4B 4JQXA 3D69A 4POZD 3D18A 1S9WB 4C54A 3I85A 3FN0H 3K2MC 3QUMA 2JIXB 2HRPL 5EC1A 2MCPH 4J4PA 4RAVB 4MNQD 4JR9L 5DLML 3N9GL 1ZGLA 1J8HD 1MCDA 4NDMB 4LCUA 5JW5A 1YN7B 3QUXB 5L6YH 4HIXL 1K5NB 2F54B 5TF0A 2EDDA 3V79C 4XCNA 2WBKA 5IQ9A 5B8CB 3CLFL 3AREB 4XTRC 2OP4H 4HUMB 4YBQD 3OAYK 4Z18A 1Q94A 1YNTA 5FF6B 3DGGB 1XF4B 2PYEA 4FTVE 4KKLD 4QHKI 4WI7A 2QR0A 3CFKA 4N0YL 3MPCA 2NY6C 2AV7B 3VFVA 4F58L 1GL4B 2FO4A 3P11L 5KS9E 2VH5H 2OK0H 3MJ7B 1WF5A 4TVSa 1T1WA 3QDJD 3VCLB 4DGVL 3OKKB 3OR7A 5E4EC 2BZDA 2XKNA 1FYHB 1Y6MR 2NY5H 2NY2D 1I3VA 3KNBB 4KK9C 5C7XH 1Q9KA 5IB2A 3QISA 5JLZB 1KEML 5K9QI 4AMKL 4QHMA 1LP9F 3QNZB 3C8DA 3KPRA 4WU5A 5CILL 4LRNL 5DJ8A 3NFNA 3T4YB 1JF1B 4Y5VA 4NP4L 4HKXB 2UYLB 3EYUH 3KXFD 4U1GB 3AY4A 3J8F7 4IRJC 4PY8J 3U9UA 3WHXA 1TENA 1ZHLB 4ZUVA 1NFDA 5EWIL 3FRUB 1G1CA 2D9QB 3EJJX 4HIHA 4XNUL 2AXGB 3ABZA 3SJVA 2EYSA 2G5BB 3X12B 4X9HA 5AD0A 1QFWM 4IDJH 1I9RL 3PL6B 1EAJA 2A74A 4NOBA 1RURL 3MRPA 3ZE1F 3H3PH 1IC7L 3GIZH 5JNYA 1MCNA 3L7FB 2R4RH 3FT4A 4XCYB 3EO0A 1O7SA 5GGSY 4LQ1A 3T1WA 3JBG7 3EJYD 2VKWA 4JG0H 4WO4A 4PJ9A 2XQYG 1P5UA 4K23L 4Q6IB 3WMSA 5GGQL 4JAMB 5E9DA 1A6TB 4F2MA 2PXYC 43CAB 4XWGL 3SDAC 2CKBA 2IWGA 4ZTOL 4BUGA 2VLLB 5J12B 3SO3B 2W38A 5T1LB 1T03H 5IHZA 1KXTB 2F19H 2ZSVA 4NO3A 5D2LF 3THML 4Z7NF 5HY9A 1VEPA 4Z76A 3AS1A 1H3PL 3W9DA 3OZ9L 2QQNH 4M62L 3REWB 4N0FB 1CD1B 3PQYB 3X11A 1XR8B 4X7EC 1IGTA 4L9LA 2B8OT 4QCIA 1BIIB 5IM7A 3NIDF 4MWFA 1HOCA 3GB7A 3MREA 1T7XA 4YHPA 3H3KA 4PJEB 4OM0H 1PFCA 5C0BD 4PJFB 4OZIE 4X7DC 4XCFH 3VGDA 2GT9A 3VFNA 4F15B 3QXUA 4FXGA 1YUHA 5DZNA 3DROB 4FNLH 4NT6A 4YHZL 3O3UN 1PQZB 1Y0LB 1QQDB 3TPUB 1I85C 3AAZA 2VN4A 4DGYL 2MOVA 3ARBC 2EYTA 2H8PB 5HGBB 1ND0A 2V7NA 1AGFA 2ZG1A 5I2IA 1K6QL 1AGEB 1NEZG 3N85H 2AJSH 3GSXA 5DHYA 4PGEB 3H3BC 4L8CA 3BE1L 4D0DB 4YFLF 3U7AA 2VXSL 3BD3A 4LLMA 3HMXL 2YD3A 4HF5L 3M8OL 2DBJA 3H0TB 1MLBB 5MENB 4RGND 4UDUA 5MEOB 2XQBL 5B3JF 4U1NA 2ZUUA 1IAIH 1GC1H 2EH7H 2ESVD 3MBXH 3QZWB 1BBDH 3AS2A 3FO1B 3KHOA 2BHYA 4YHOH 3IJSA 1CICD 3NCYS 3ZTNL 4I3RH 3B2UD 5ECJE 1M1SA 4FZ8L 5C0EB 1ZGLM 3JXAA 1LE5B 2ARWA 1LP9A 1BM3H 4PJCE 2Y23A 3FN3A 5HVWA 4N1HB 3K81A 4OFVA 2E8YA 2XZCL 1ZLUK 4P5KA 1YPZE 4WI6A 3MRGA 2NLJA 3UBXA 4YDIL 1A6ZB 4NHCH 5JOFB 1SJVA 5J0BA 1CXHA 2ADFH 3F5WA 4DJMA 2VR5A 4MNQA 4FQLL 1OCWH 3QDGE 4PJBE 4H1LH 3TT3H 43C9A 1OM3L 1J8HA 2XRAL 2IPTL 1L7TL 1IBGL 2LAAA 4UDTB 5DC9B 2N56A 1FNEB 3CLEH 1C16A 2VZTA 4XP6H 4GW5B 5A3ID 4I2XB 2Q6WA 4Y4FB 3HNVH 4WCYL 4LLDA 5GGRB 2X4NA 2VLRD 1D5MB 1G6RB 1A6VH 1Y6NR 2IH3A 1R5WB 4PP1C 1QBMH 4EUPB 2DOCA 2QSQA 3LKPB 3GRWA 4M61B 4YEEA 5IBLD 3LZFL 1JGUL 4KQ4L 4OF5A 3QPXL 5JHDD 4MAYB 1X4XA 4J3OC 1T04B 1XGQB 4Z7WB 4ACPA 2IMNA 4K94L 1YEJL 1LILA 2JB6A 5CLTA 1MCLA 1BOGA 4GT7A 2VN7A 3LKQA 2NZ9D 3HS0B 3GUTB 3HE7B 4DKEL 1XF5B 1KPRA 2R29L 2W0LA 3VG0H 3ZL4H 5DMIH 2VUOA 3K2UH 2B1AL 3ZT5A 4F8QA 1ETZA 5MERA 4NN5B 3P9LB 4WHTA 4QRPB 4OJFH 4RAUB 1PY9A 2GJ6E 2VWEC 5ITBL 3MRCA 4J8RA 2X4QB 2ZCLL 3KXFA 5C3LD 4XC3H 2VDOL 1KPVB 1PKQE 1FL6B 3RVUD 4OF7A 2QLVB 3MRRA 2QADC 1X4ZA 5INDA 5EC2A 3MRFA 3C8HA 2FGZA 1YEHL 5DS8B 1NLBH 4GG6E 2LVCA 1BFOB 4PUBL 1EGJA 1I8IA 3VXRD 5DSCA 3UYOD 5AEAA 2Q86A 3TH2T 1YY9D 1JHKL 4PJDF 3TVMB 2DKSA 4N9GA 4BZ2L 3AU1A 4WNQA 1TQBC 2AGJH 3G6JF 5HBBA 5KVFH 1N5AA 2OZ4L 1IQWL 1H3TA 5F96H 3T3ME 2A6DA 4OFIA 1L7IH 3PABB 3MCG1 3TO2B 2X6MA 5KJRH 3PP3K 3KJ4B 2Y7QB 4XC1L 1JGVL 5I1DA 5JOEA 2AK1H 1C08A 1KLUA 5FB8A 1RQ5A 3R1GH 3DX6A 4NZTH 5EU5B 2RIKA 3PJSB 3HR5B 2YKLL 4X6EA 4R0LA 4HWEL 1S3KL 4G7VL 8FABB 3HMWH 3HUJB 4GLRH 5GZOD 5IVZA 1IM3B 2XA3A 5DFVD 5DQ9A 4Y4KB 1AY1L 1FE8L 2YBRB 1MH5A 3IKCB 5I0DA 3V5KB 2R56H 4JREC 4X6DF 2IANE 3EOYG 1HKFA 4XX1E 1U8KB 5EO1A 4ZQKB 5K9OA 3NN8B 4R4NC 5FCUH 1E4WL 2C7UA 2FD6L 3RZWA 3IU3A 5E5MA 3HZKA 1IAMA 2XXMB 2DQCL 4U6VL 4UOJA 5C08E 3FQUB 2P8LA 1XMWA 4WV1B 1JNNL 5C0BA 2Z31D 1KEGL 4F57H 3MX0A 5I1LB 1CQYA 4PJ5D 1FZOA 3EO1B 4RNRB 4YC2B 5KZCB 5IEHB 4NZUH 1WVZA 1ZA6A 3MJ9A 4LPTA 5I71C 3G5ZA 2R0ZH 3LH2L 1F4WH 5C0IB 3VI4F 3HPLA 2F53E 1Q9OA 4S0TD 1ACYH 2AQ2A 5FKAA 1CFQA 1J1PL 3EJYC 3QEHA 1UYWH 2OR7A 5DJAB 3ULSB 4M5YL 1J05B 3L3GB 3TO4B 1XF2B 1KPUA 2FJHB 2NX5B 3HI1A 3O45A 4WW1B 2DQGH 2GCYB 4XCEA 4XNYL 2CMRH 1PYWA 1INQB 5JZ7D 4XVTL 4NQSA 1VADA 1F8TH 3GMQB 3TH3T 2GAZB 3U7WL 2Z91A 3BGMB 4M02A 4ODBD 4MHHG 1UVQA 4MA3A 4PRHE 1EZVX 4OQTH 4ONHA 1CICA 4XX1G 1AQKL 4FABH 1GOGA 4PRDB 3IDNB 2FGWH 1MI5B 3S9DB 5DQJB 1EMTH 4I0CC 4DZBB 3FAXA 5HGDB 2AV1A 4XGZB 5FO8B 15C8H 4BFEA 2OM5A 1HHJA 2YK1L 4UTAH 4E42A 5H37G 3QRGL 1QFUL 1XGYH 4GSDH 3SKOA 5IMKB 1J0IA 5E7BA 4MXQC 2BSTB 5JUEL 5F97E 4U1MA 2UWEF 4YDVB 2AK4D 3BPLC 3BH9A 3G6AA 4LOUC 4NWTL 3ZDXE 2VLRA 3EYQC 5DD5H 1TZHB 5D8JL 4GUPB 3P0VH 4MJIE 2DIBA 5EORH 3FTGA 3H42H 3QUYB 4M6ML 4JFXB 4Z7UB 5F7EH 1RUAH 5JHDA 3V52L 1DN2A 4IMKA 4OIIH 3C5ZC 3VXTA 5GGUB 1QLEL 3G6JA 3L3KA 2QHRH 1A9BB 5C0GA 3P4MA 4NQEE 2G9HA 3IFOB 3TN0D 4PLKD 4BQ9A 4QYOB 1MHHB 4RGNC 5I0ZA 1LK3L 3GMRA 5CKAA 3B6SB 2J88L 1BQLH 1FN4B 2VR4A 3S35H 4N90E 3WDHA 5I15H 2P5EB 4KUCD 1OF2A 4M4PA 4ERSH 1XIWB 3GSVB 4EI5C 1CFTA 2DM7A 3GO1L 3CSPA 3LQAH 4L4TD 1Q0YL 3ZYOA 1RZGB 3R8QA 4Y7MA 3TT1L 5A2JH 3FQXB 5IIEA 5GS1C 35C8H 3VDBA 1PG7H 2KH2B 3HG1E 4H5SB 3C6SB 3U46A 1DQDH 1B0RB 3FO2B 3DVNB 1FYTD 4X6DA 3MACL 3DMMB 4HLJA 4L8SC 1WWBX 3PGFL 1ADQL 2ICEB 5HYSA 4XXCA 3MA9L 4XNMB 1P4LA 2EECA 3TJHC 1BD2D 2YN5A 3HZMB 3MLTB 1KYOK 1KJ2B 2FNBA 2JIXD 4JZNB 5I30H 1MVFA 3VXRA 5A3IC 4Y16B 4LSTL 1W72L 1A14H 4OZFB 2V2WB 2QSTA 5BMFH 4W6XB 1KN2H 1S5HB 4KC3B 5BS0A 3BZEB 4H0HB 5HDOA 3QG6B 1Z5LB 5DF0A 5EUKB 3SDYL 5BO1H 4UV4H 4N8VB 3FB7A 3FT3A 5DJDA 1H8OA 3BX7C 3GI9H 2BC4B 3HI6L 2B1HL 1MF2H 1EEZA 1JHLL 4NQXA 5I66A 2BNRB 1Z0MA 4F80A 4PJ7E 4KUCF 1KLGA 5FDWB 3NCEB 4XPFL 5SWSD 4QRQA 2NZ9C 3DV6B 3DX7A 2A83B 1P1ZA 3DUUA 1S7TB 1AR1D 2EDNA 4Z0XB 1A5FH 3NCFB 3LQZA 3T09A 2RBLA 4WTWA 5CINH 1FBIL 3CPLB 5EZLA 3ILPB 4QOKE 1QVOB 3NFSL 3OJVC 3DNKA 4C56D 1IKNA 1F4YL 5CJXA 1IQDB 5KSUA 4E41D 3RX5A 1MOEA 2R4SL 1QBLH 4LLAA 5E2TH 1MJJB 4Z7QE 2OS7A 2FEDD 1U8OA 1HXYA 2W0FB 3DVGA 5DJ2A 3MRHA 2MJWA 2FX7H 2OCFD 5E8PB 3RWEB 3W9EA 3BKCH 3GHBH 1HHGB 4OCXH 3SGKA 4CN1A 5HYFA 1DFBH 5EU4A 1LEIB 3IFPB 4HCRL 5KSVB 2WBWB 1BZ7A 1A3LH 2Z31A 5J8OA 1NGXA 5C8JB 3GHEL 4ELMF 4PJ5A 4HC1L 5HHOB 2WIMA 4C58B 1OGTB 4DKFH 4QT5B 1H5BC 2IQAB 5TFSH 3N06B 1FAIL 3QCUH 5GSRA 1WBZA 2CKNA 3QCTH 4X5LA 4OUUB 2HTKC 1U8HB 5GRUL 3BISA 1B88A 5D6CB 3MRDB 5HGHA 2FJFB 2OL3H 3TH4T 4LVOC 2WUCH 3TYGL 5CEYB 5CP3H 3UYRL 4H25B 4H8WL 1CR9L 3ZKSD 2VERN 5C09D 3BAEH 3DVFA 3VD7A 4HKJA 3C60C 2P8MA 4J12A 3FCTB 4Z78A 1YECH 4HIJA 5GZOC 3L1OH 2IGFL 3KYKL 4Y5YC 5DFVC 4UQ3A 1F6AA 4MX7A 4BZ1L 3NA4A 1NUGA 5FYJH 1NKRA 3DURB 1QR1B 4NM4H 2DQUL 1IGMH 1K8IB 4DN4L 3I6LD 1HIML 1W0VA 5F1IB 3KGRA 3FOMA 1JRHI 4PGDB 1OOAA 4RRPG 1OTSD 1VEMA 4RZCA 3AMKA 1NDGA 3L7EB 2MQ3A 4J2XA 2HFEA 3WLWD 3WD5L 3INUL 4U33A 2EKSB 4FTVB 3WXVL 4NQDE 1U95A 2K1MA 2R1WA 4LQFH 4ORGB 2WUBH 1TTUA 5GGTL 4U2YA 1P7KB 2CGRH 1H8SA 3QFJD 4JZOA 4FRWA 4QRRE 1P7QB 4ODUA 4DUVA 2GKIA 4J3VA 1XGTA 2AK4A 4GRLC 4L3EB 3AVEA 2EDBA 3BWAB 1UT9A 3MYJA 3GSUB 3QEGH 4ONGH 2QQKL 5GRVK 3CK0H 4FFZL 4HK3N 5E2UL 2ERJC 1UH2A 3OKMA 4NZRH 1CE1L 3CDYA 1NGZB 4NCC2 2YRPA 2ZOKB 1CN4A 1T89C 4QRUA 1YMMA 2R8SH 1G0YR 4M1DH 1CBVL 3FQWA 2AJVL 5EUOE 1VB9A 4QHUB 1MCCA 3TN0A 4YHKH 4OTXL 1MPAH 4MD4B 2RAMA 5L8JB 1WQVT 3R8BB 1JWMB 1D5IH 2NY1C 1H3WM 5IKCA 4JPKL 4OLYL 5GQBA 2KZ1B 4LCIL 1DBKH 2E6JA 4L4TA 5IOPA 1ZTXH 2AEIT 5KAQF 2HT3C 1HKLL 2GFBA 2XZZA 1Q8MA 3PE9A 2DIAA 1AP2A 1Z9MA 2JKXA 5DD1H 1RZFH 4ZOEA 2HAZA 4HK0A 1FYTA 1CLYL 1IC4H 2NYYD 5D7JB 1RMFH 1G7IA 1KIUA 5ADOH 5J57B 5CJ8A 1UXWA 1BD2A 1YJDC 3L3JA 4L8BB 1JN6B 1EFXB 3WJLC 2JIXA 3FL7A 3VA6A 4P99A 4JHWH 2C3VA 4ZS7H 3B5GA 4RAVA 3MXWH 4KGLA 2V2XB 3QJHB 1QSEB 4M93C 2ZWLT 1BECA 1S7QA 1T20B 3VXSB 4ELMA 1P5VA 1ZT7A 3B4NA 4KHXH 2DWDB 1A7NL 5T33H 4F9PC 5J89A 5EOTA 1P4BL 4ZTPH 3AREA 4OIAA 3HLAA 5GSVB 4OKVA 2UZIH 2XQYK 5LCVL 2VXUH 3MXVH 2BNUA 4OCMC 4L9DA 1MFEL 4NO5A 5JW3H 4AEIL 2Z8WC 3I50L 5HGGS 2H2PD 4YDKH 2AS5M 1U42A 3VGAB 2D7PA 2XN9E 1T4KB 4OZGF 4QF1B 3ZE2F 5CP7B 1EVTC 2GITA 1A22B 4S11A 4XP1L 4CN6A 3X17A 2DQFB 4EIZC 4E41A 5J11C 4JG1L 3QNZA 1C1EH 3NCCB 1OARH 2PETA 3BIAX 4K3HA 4K71B 4ZFFB 4QWWC 4U6TA 2J5LC 4K3DH 4NHUB 2F9BT 5T3ZL 2C3XA 2NY4B 1G6RL 1MFCH 2EEBA 4LLVA 1Q9WB 1ZHLA 1UJTA 4HGWA 2DQEH 4KXZH 3FZUC 3WFBL 3RUGE 4RGOH 4Y4HB 3H9SD 3BHBB 1FSKB 4LFHD 2AJYH 4RAHA 3SOBL 4G3YH 4M6NL 1EA9C 1V3KA 1YEFH 1DDHA 4KY1L 5HDQH 3MODL 2XNAB 4HIEA 1ZHBB 3O3AA 1ZA3B 3JV5A 3Q5YA 1G9EA 1CFSA 1OB1B 1BQHG 3NPSB 1HCFX 4K7PY 3CFDA 3EDDA 1LO3L 4I13B 4MNHA 4P59L 5E94A 1MY7A 1QBAA 1ZKAA 4PJCB 3T0EE 1I9JL 3GSWA 4GG8A 1A0QH 2ATPA 1OVZA 1FAKT 4XBGB 1TJHL 1BEYH 2J6EH 5LG1A 5F3HA 1A6TA 5CSGA 4EBQL 3GSQB 4HJJL 1WZMA 5IMMB 1CGWA 1Q72L 3DHJA 2B4CL 3EKCA 4AIZB 1UM4H 2FIKA 5T1LA 3IFLL 3VRJA 3CXDL 3WLBB 5IEKA 4PB0H 4LPUA 1FNSL 1QFWH 5F9WB 4N0FA 2GW5A 4U1IB 2BX5A 3S34H 4JHBA 1DQQA 4U2ZA 1TITA 2F58L 2ZCHH 1FLRL 3SGEH 4GMTH 4YPGB 1R3IH 1MJ8L 3O0RL 3H9ZA 1UWEL 5DUPL 2P47B 3G5VB 2Y25A 1F5WA 2XXCB 3FKUS 4G8FB 1V7NH 4XAKE 2ADIA 1P9MC 4DKDC 3PIQA 3VGBA 2XWJB 2RB8A 4JFHE 3WUWB 2I07B 3HR6A 1DBAH 3QNXA 1S9YB 2NY7H 4F9LC 2A2QT 3OJ2C 4CL7A 1R5IA 4F33B 3MLSH 1TVDA 1XCTB 4Y2OA 1DVFB 3VXME 3V5HB 3BP5B 4M8QB 1I9IL 1JPSL 1DN0B 4GRWE 1CXEA 3GKWL 1SJHB 4UQ2B 1K2DB 3C2AH 3JTTA 3F62A 2O61A 3FB6B 3LMJH 3UYPA 1QRKA 4ZS6D 4YUEH 2C1PB 2XIDA 2C4XA 2FEEI 5J3HD 1MAML 4KWUA 3E2HC 4PGEA 4PTTB 4X9IA 4K07A 2NX5D 5A2LH 1PKQB 5LBSH 5LGHL 1WZKA 1YQVL 3DYPA 3O8XC 4OCYL 1MJ7L 1MLBA 3LHPH 3JVGA 5BRZE 2E9BA 3V95A 1JYWA 2ZZUT 1RJZA 3ARZA 3RPKA 1FRGH 2O5YH 4JPVH 4YGAB 3V7MA 1A64A 3T65B 4UTBL 4PJIB 3KJ6L 1CWVA 1NGQL 3BN3B 1B4JH 4ZFOA 1F58L 3WBDA 2V5SA 1KIRB 5B4MC 1XGUA 3IF1B 4L3AA 3RIAK 3F7YA 4XPTL 1MY5A 3STZB 3CVHA 2G2RA 1MRCL 1H15A 1JYNA 4CW1B 3R0NA 5EO0A 1HINH 4UDTA 1BX2B 4PGCA 4MAUH 1CD8A 1DQLL 1FG2A 5I1CH 4ONFL 4CVZA 5F6IB 3SE3A 4YHLL 3I3BA 4X4XB 2YPLD 3RY6A 3D9AH 4EUPA 1FIEA 2BJMH 1YEGH 4M61A 3BUYB 5DT1L 5KN5A 1F97A 4PJAF 4MAYA 2Q7NA 3U36B 1Y6KR 1BAFH 1XGQA 2AXFB 4JFED 3VXQA 3C2SA 5JOPE 3RZCC 3V5DA 1S7UA 4I77H 3QIWC 2IBBA 3B9KD 4OZHF 5HI4D 5FKPA 4O2EB 5GS0C 2YHGA 4MZ3A 1IM9D 3SDCD 3C08L 3HS0A 3HE7A 1I1AB 3ULUD 1L0XA 3AM8A 3GUTA 3BZ4A 1XF5A 4L29A 4N0UE 1OP3K 1KCRH 1RIVH 1FORL 4W81A 3DBXA 2GIYA 4XP4H 4JPIB 5TE7H 4M6AA 2VISB 4DCQB 2EO9A 2UY7A 1G7LB 4G6FD 4MNGA 1E4XL 5IF0B 5I1IL 1G7HA 1RU9L 5HSFA 4G8EB 5D1QB 1JNJA 3RQ3A 5CUSL 1NGPH 4LASL 2OTPA 3H9SA 5E00B 4N8CH 1K8DB 1NMBL 4EDWH 1T66D 5GPRA 3Q3GB 3MV9D 4P2OB 2WINB 3DUSB 5CZVH 5D1XB 1NDMA 1ZEAH 4XP9H 4XB8A 3RL1A 1ZANH 1G9NL 2HKFH 2DTSA 1NGWA 3MNVB 2BNQE 1M7XA 3RGVC 1YYLL 1BF2A 3CSYB 4JQIL 1QSFD 3O2VH 4KVNL 1MCQA 3TO2A 1IKFL 1JPTL 4OM1L 3ZTJH 4HS8H 1QRNE 2Y7QA 3ULUF 3MBED 4KK5C 4ZSOB 5FO9A 3PWPD 5H8DA 1CZ8L 3BRGC 4LVHC 2NY0B 1QP1A 3PJSA 2KQMA 1LO4H 2WBJB 3IU4L 1JZ2A 8FABA 2BP3A 5IFAH 1KJ2L 4XMPL 3WFHB 1ZOXA 4LEOB 5DJZA 1IM3A 4PJXE 3RIFK 4Y1AD 1KELH 1KCVL 3MLUH 4P46B 3IKCA 3S96A 1CG9B 1C8PA 5D72H 2LU7A 2BY2A 2YXFA 4LCYA 5GIRB 3D39E 3MFGB 2CDEA 3NN8A 4Q2ZB 2RHEA 4MCZA 5AZ2L 3V6OA 5AWNH 1GZPB 3K8KA 1BZ9B 1QD0A 4R2GC 1JV5A 5C07E 5H94B 5BVPL 1EK3A 5JXED 2CKBH 1EAPB 3MRQA 4KROB 1ZS8B 1NC2D 5INCB 2FDBP 5I1LA 4RNRA 4CU6A 4Z77B 4IIQB 4S1SH 1OAZH 3QQ3B 4HXBH 3VD5A 4MD0A 1G6VK 3KLDA 2C4FU 2R0KL 2AKRA 5BZWA 3LKNA 1U58A 4KDVA 4Y88A 4G9DB 3VFOB 5IVXF 4ODHH 2BSSB 5T1KD 4JFDE 1INDH 5L9DL 4Y5XB 1KACB 4P4KC 3H7BA 1OSPL