2DIAA

Solution structure of the 10th filamin domain from human filamin-b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
molecule tags Structural protein
source organism Homo sapiens
publication title Solution structure of the 10th filamin domain from human Filamin-B
rcsb
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2diaA01
2ID5A 2Z8RA 3O2VH 5EZIH 5EO1A 1JZ3A 1MCOL 3VXUD 2OJZL 1IQDA 4X80H 3U9PH 4LRIA 1U8NB 4KQ4L 1II4E 3CFKA 4HIIA 5AG8A 1NJ9A 4QEGA 3BO8A 4G43A 4WUKH 1MLCB 3HCVA 4LRIC 2GJ6D 5I75B 2FJHB 5D2NB 1I4FA 1IGMH 3KAAA 3BHBA 3UJTL 4NKMA 3P9MA 4HUMB 3X3GH 4PB9L 3VRLE 4Y4HA 1AFVH 1OB1A 1QZ1A 3I02A 1D9KD 3QDMD 3MRBB 1X44A 5SWZB 1ORQB 1UENA 3QUXD 2XN9D 4P59H 1U95B 4PJIA 4ZTPL 1ZHNB 3VWJA 1UB5A 1CL7H 1HQRB 3O0RL 4GG6B 1D5MA 2JB6A 1FLTX 2G5RA 3MLZH 1UEYA 4YDVA 3S6CA 4GW1A 1DR9A 3D69B 2NY7L 3QFJB 3VMNA 1F90L 1F45A 4P9HL 4QCIA 4XBPB 4YDJA 3IDNA 2YXFA 2CKBH 1D9KC 1EEZB 4RGNB 1LHZA 4JFDB 4JM2F 5HD8C 4HDIA 1CICA 1I1CA 4P5KA 1TDQA 4NYLB 4K3HA 2W60B 3OG4B 3O3DA 1NMCB 2ZNXA 4HCRL 4AQ1B 1FDLL 4MMZC 3TFKC 4KKBC 2FJHA 3S37X 2XTJC 2FX8L 2HFEB 3GM8A 4YBHA 1RMFH 4KVCH 4JDTL 1AGCB 2EXYD 4P99A 4Z7VA 4LLVA 4QGTA 4HWZA 3KPSE 3INUL 1U95A 4KMTL 1HSAB 3BP4A 4TVPE 3KWWA 3SHSA 1MUJB 3WIIL 2PR4L 4HMEA 4NQDE 1FGNH 4E5XA 4M3KB 1BFSA 2HTLD 5D71H 1JHLH 1I7UA 3DXAE 4M5ZH 1GGCH 1FZKB 4PV8A 4O5LH 2FRGP 1A7NL 1EUUA 3DETC 5EBLB 1Y18B 4IDJH 1AQDB 1I8MB 3BPOB 1IM3B 5I76B 3W11C 4HIXL 1DBJH 4D94A 1ZWIB 2ZCHL 5KG9B 4E41B 3BPLB 1BZ7A 3LKQB 4LSUH 1MH5B 1Z2KA 2EYSB 3D0VB 3T0BA 4QLRA 1EEZA 4M6AA 5D7SH 1AIFB 1LE9A 1WITA 2P8MB 4JY6A 1BGXL 3PP4L 1NMAH 3JWDH 4U0RC 4EUPA 1MELA 5J1AA 3QPXH 1TITA 4LAJH 3QQ4B 1A7BA 1P1ZA 2AXJA 2P7TB 5EA0L 1P2CB 3WHXB 1JGUL 4P2QE 4NKOB 1HNFA 2YD1A 4MMXC 3GEWB 3PV6A 3SGDI 4IJ3C 1YNLH 4ZUUA 1QUNA 3P11H 2WV3A 5HHPB 3BP7A 5DTFB 3LVEA 1AR1D 3SKMB 2JJSA 3CFKB 4LQFH 5TDOA 1HSBA 1YEEH 3V0AC 5SWZE 1BJ1J 2AV1B 2VLLB 3HA0A 1M4KA 5CJQL 3QDJD 1UM4L 3MUJA 1EH9A 2LAAA 2IFFH 3LZFH 1FE8L 3MV9D 3HN3A 4PLKD 1R3JA 1X6LA 4LEOB 4OLVH 3S96A 3KHQA 4WUUB 3N1MC 4XPHL 1QP1A 1F3JB 2X1WL 5D1QB 2QQKL 4HC1L 5KJRH 3CLEL 1XZ0B 3E6FA 1R3HA 1IC5L 5DC9B 3T3PE 3D87B 4D0DA 1IGJB 1KN4H 2OQJA 1S7XA 2FJFB 4IRJD 1J1XH 1TVHA 4ALAH 4JO3H 5KVGL 4XX1G 3SPVB 4PJCF 2VLLA 1GCFA 3NH7L 5DJXA 3SOBL 1BBDH 2BFVL 1NBQA 4LSRH 1CLOH 4DW2L 1BQUA 1NCNA 4HLJA 5F3BA 1UJ3B 3DUSB 2PXYA 3M1BA 3UYPA 1G7IB 1RJLA 2H1PL 5EB9A 1Y0LA 1Z9MA 5BS0A 1A0QH 3MNZA 5EBWA 1Z9SA 5DJ0A 4OZ4B 4HS8L 2YD3A 4U1NB 2VLKB 4M7JH 5A1AA 4FFWC 2OR8A 5JIKA 3KYKH 5ICXB 1PDKA 1P5UA 3QUMB 4DAGL 5DJ6A 3W0WE 5DJDB 2HKHH 5CGYD 1CK0L 2AXFA 3S9DB 1BIIA 3BAEH 5HBBA 1QBAA 3NGBB 3OF6D 3C87A 4MNHA 4HQQL 1RMFL 5HYJE 5I1HL 5I8CB 1BVKB 2XKNB 3E6FB 5IMLA 4QWWD 5E94A 2GT9B 1ZGLP 1M1SA 4LFHG 4XWOD 3V4PL 4CMHB 1S7UA 3HZKA 4YHNA 4MYWB 2HLAA 2HRPL 2HWZL 1W2KT 3MRRB 4QRSB 3RWIA 5H2BB 2B2XL 2HN7A 1K3IA 2NY3C 4YFEA 1TNMA 2W9EH 3MRGB 3TF7C 5D7JA 5LCVH 1F02I 3N1QC 1EFXA 2BNQE 2R1WA 3ARED 4LCWB 3VFNB 4P46D 4ZO7A 1MRDL 3V4VL 1EEUA 5CJ8A 4ZAKB 3W2DH 1T4KB 4K8RC 1NGZB 3EYSL 2B39A 4KFZC 3RWCB 3UTTE 4Y19D 3CVHB 3RL1B 5DEGA 4X6EB 1DSFH 1BQHA 3OKEA 3TBSB 3RNQB 4OCSL 3CSPA 3D5OF 4WI5A 3PHOB 3BKJL 3VRIA 4ELMB 3FFCB 4QRUB 2KUTA 1BEYL 4WU7A 4EUPB 3U0PA 5C86A 4IIQC 4ERSL 1V3MA 1GGBH 4CJ0A 4FXKA 2C26A 3GGWB 3TH4T 2VDRH 1JJUA 4KMLB 2Y36L 3VXTA 2PO6C 1U41A 2EEAA 4TQEL 4Y7MA 2VKXA 2FL5B 4K94H 4QOKB 1DE4A 3DNKA 5L2KA 1RUAH 5GGRB 4MSWA 1RJCA 2HKHL 2YD4A 5TE6H 2RJMA 2AJVH 5ETUA 5DO2D 3TWCH 1U8MA 5CD3A 5I30L 3BW9B 3NPSC 4B7LA 2PYEB 3QZWB 5E5UB 1MI5A 3IDYC 5DXWA 5CJOH 3QFDB 4DTGH 5FDWA 3TESA 2H1PH 2ZUUA 2R23B 2NY3B 3V6OA 1FIGH 5LXGL 3BPNB 3MRBA 4PJHE 3QO0B 4MA1C 4I4WA 2MNUA 1CLOL 3QG6B 4G3YH 2AJXL 3WFBL 3MV7E 2GAZA 3TLRA 4WGWB 3V0VA 1GH7A 4TQEH 2DWDB 2OTWA 2DQUH 2Z35A 3WNNA 3GBNL 1J5OH 2HVJB 2J88L 1S7SB 5MHSE 2ENYA 3KDMA 5EOQH 2PYED 4JDZB 1VCAA 3A0OA 2P5EA 4YHIA 3QUXB 4UOW1 3KPRB 4M1GL 4M61B 2VLME 5DK0A 3L5WB 4GXUM 1X5JA 3NABL 4MNQE 4AEHL 4ORGB 3CK0H 1KJ2A 2R0LL 3OKKA 3F5WA 3VFTA 4HWBH 4P2CG 4PJBA 2V5TA 1NGXB 1JNLH 3PXHA 4JZJA 3EO9H 1F58L 5HPMB 5IV2A 5D70H 4GQPH 2EYRA 5ECJE 1EHNA 3O6ML 4JZNB 3TBWA 1FRGL 4IOFC 5KSVB 3FO2A 3GJEA 5C0BE 1QSFD 4FFVD 5K59F 1OGAD 1A6WL 4NKDA 4MAYA 3RI5F 4X0KA 2ADFH 2ADFL 5C09B 1DN0B 1TCMA 2YA2A 2LV4A 4X9FA 4TNVK 5EUKA 5BQ7B 5ISZE 1QVOA 3QUKB 5F6IB 1ZT7B 3MLRL 3GJFA 3H7BA 5I1DB 4ZTOH 2IJ0C 3O3UN 4Q9BA 5T1LB 2QSTA 2D9CA 4EN3D 3V4PH 5IG7B 3KPLA 4ZG1A 4XH2B 4C83A 1FLRH 2FGWH 1XF3A 4LASH 3T1WA 4OD2B 5I9QC 5AWNH 1QYGL 5GQBA 1NANI 4EEEA 4HKBA 2IWGA 3EO0A 3FO0H 3X14B 5J1TC 4J2XA 2NR6C 1FO0A 1P6AB 3OPZL 3NACL 1CFNA 3O41B 2D31A 1GGIL 2VE6A 5D1XC 5E6ID 4KHXL 3E1F1 4OM0L 4D0DB 3SGKA 3KXFD 3OKEB 3TBSA 3UTPD 5CP3H 5ILTL 4X6EA 5JXAL 5CBAB 2HG5B 5GGVL 1C12B 2DQTH 3NFSH 1QLFA 3QXDB 3QUXC 1A22B 4OZGA 1SY6A 3I75A 1LO0H 1YECL 5DMIL 3C5ZC 1UXSA 3OJ2C 3TZVB 1DLFL 3VRJB 5EC2B 3R1GH 1FNSH 3AY4A 1R5IA 3AREB 2JE8A 1KTLA 2X70A 3SKMA 4LHUD 3MGTA 1HDMA 4D8PA 1K8DA 3QQNA 4PJAB 2VDPL 4WHCA 5EZJA 4FQLH 4KKLC 1F4HA 4PJ7F 1NAMB 4OFYA 2HG5A 4OJFL 1LO5B 1EBAA 3QUZA 1TZGH 5IQ9A 1T3FB 2ICWJ 3INUH 3QDJB 4XP4L 4V2BA 5I8CA 1CGUA 3MUGA 3NIDE 2RCSL 4POUB 1YEJH 2OXHA 1XF4A 2DQHL 4OKDA 4QWWC 2IFFL 2R8SL 1WJ3A 4FTVA 3VXUE 1VFAB 3KJ4C 3MLWL 1GGBL 5GS2H 1FHGA 1R24A 5I1EL 2V5RA 4MA8H 4MD5B 5DJCB 1RULL 4QHKJ 4LCYA 4UQ2A 4LSPL 3H9SB 4LAQH 1A6TA 3WFHB 2FEDD 1ZGLB 2HFGL 2WP3T 1P9MA 3IDIB 1YQVL 3JUYA 1NH6A 5T3ZE 2DMCA 4N0RA 1UJ3A 3WS6C 3ZYOA 5D96C 4Z7QF 4OLYL 4NBXB 1QSEA 3A6BH 5FA4A 5E7FA 1CVSC 4G9FB 5GGUA 1Z3GH 2AV7B 1KUMA 1L0QA 5GZOD 3LQAC 4PJFA 3IXAA 4JFOB 5JW3L 2R0ZH 2MCG1 4F33A 3ZKND 1RZJL 3WEXB 5IB1B 2JJWA 4P3DB 4ZFGH 2Q87A 1T0MA 2APXA 1V5JA 3C5ZB 5HPMA 4JANA 3I50L 4NN5B 4AM0B 3DSFH 3HZMA 4YIQB 3O8XD 2LFGA 3A67L 5B21A 1KEGL 1XCQA 3LS4H 2F9BT 4L9LC 5C0CA 3P0YH 5FYLD 3FB5A 1DEDA 4ZUTA 1TZHA 4JFFD 5TDOB 3B9EA 1B0RA 4FQJH 2JTDA 1I1YA 1K9TA 3MCG1 3VJ6B 3O2VL 3K2MC 3S98A 2NZ9D 2Q76B 3H9ZA 1TNNA 2B0SL 1WIUA 5J57B 5KN5B 2CKBB 3RWEB 5F9AC 4MHHG 4NHUB 1HHKB 5J11B 2J8HA 1A0QL 2A9MH 2NX5E 2A74B 4FXGB 2EICA 3ROOA 3WO4C 2QADD 2P5WD 5L8KB 4JG1L 3T8XA 1WIOA 4FMKA 2V2WB 2AK4A 2IAMC 2CDEA 4HH8A 1CQYA 3DRQA 4BK5A 4PLNC 4CVUA 3S5LG 1OAKH 3X11A 1U8OB 3PIQA 3TZVD 3EGSA 4XMKL 2ITDB 1J1XL 4RMVA 3GK8L 4K2UL 4ALAL 5CBAA 5KVGH 4R6UA 4GRMB 2JELH 1Q9WB 4JQVA 2PW1A 1UACL 1BM3L 3EZ8A 4YZFE 3W39B 1SVCP 3OB0K 3CLEH 2IANE 5I19L 4MS8C 3B9KA 3F7VB 4HJJL 1YEIL 5T1KB 5IT2H 2Z31B 5EU5A 3QIUD 4N90E 4YHLH 4PJGF 4GRWB 1N6QH 1CG9A 1NCWH 3UTOA 4OTXL 1T04A 3LEYL 1RZ8B 1U8LB 4DZBA 3SDDB 1DANU 4KKCC 5C3LD 5IB2A 4RWHA 2VXQL 3MLRH 3MYJA 3GHEL 2R4RH 5DJ8A 5I73C 1B4RA 2XTJE 3SDXE 4ISVA 4Y2DD 5C07A 2Q8AH 1A4JB 5DD5H 5FO7A 1DN0A 1KIUA 3QIWB 3MGAA 3OX8A 2Z4QA 2EC9U 1KG0A 2GEEA 3HE7C 5EBGA 1MIML 1TTFA 1A6WH 4BZ2L 5IHLB 4PGDB 4PP2A 3WFDH 1JGVL 4OLZH 1PQZA 3D39D 3SDAC 5D7JB 4WUKL 5D6DC 3H2WA 3HMXA 2XZQH 3WJLC 5D5MB 4B7IA 2UWEB 3JWDL 1NMAL 2F53A 3GMLA 4S1SH 3TNMB 1A3LL 3ZE0E 4OV6F 5EZIL 3QP3A 5F7EL 3TFKD 3HC0A 3L1OH 3P4NB 1KCSH 3WMSA 3BPOC 3FB6A 3FHAA 5TQ2H 5BW7C 5E8EA 1JHTA 2E27L 1HHHA 1T5XB 1WBYA 2ZCLL 3HUJE 4F3FB 3L3JB 4YDJB 2VDNH 4DZ8A 3PWUA 1F3DH 1YN6A 3HI1B 3TA3B 1QPPA 5FA3A 3DOSA 3GJEB 4JKLA 3RVXC 3K8MA 2W0PA 4NBYB 4L3CB 1I1AD 2X4NB 5A2FA 4J23A 1KJ2H 1VHPA 3OAZK 4IRSB 3ZKXC 3TM6A 2X4OB 3WSQH 4QT5A 1IT9H 4PJFE 5HGAA 3IDXL 4JLRA 4IBLT 4LPXA 2IPUG 1P69B 3PUCA 1HN1A 1XIWC 5TDNA 2R69L 1EHLL 4LBEA 3UBXI 5LG1A 4DFHA 1H8SA 4OIBA 4JFEA 1AGCA 1N26A 3TIEB 3T0VA 1HZHH 1UCBH 3STZA 3EJYC 2QTEA 4LK4A 1NLDH 4Z77A 1FPTL 1VERA 2GAZB 4J3SA 5DRNB 3OB0H 3D18B 2ZSVB 5F8QC 5C70A 4NZUH 1N7ML 3ULVL 1H3TA 4NWUH 3IU3B 3U2SA 2BHZA 1GJIA 1KELL 3TCLB 4LLDB 5IVXB 2R2HA 2XWBB 4IHOA 2R1XA 3P0VL 4ERSH 1HHJB 4TULL 5BMFH 1CGYA 1NEZB 2NW2A 1A6AA 2VLRB 4KQ3H 4NWTH 3DRQB 2J6EL 1XH3A 1JRHL 3V6FA 1RD6A 2BSRA 4X5WA 4Z7OF 2VWEE 2VN7A 5F7DB 1D5ZA 1VACA 4PRDB 2HFFA 1Q0YH 1A7QH 2I24N 4XCCL 1NPUA 5AYUH 4Z7UA 3O0RH 4MNQD 4GAFB 4TSBH 3FO9A 5LQBL 3L5IA 3GGWA 3CK0L 2QEJA 2P5WB 5DJAB 3CFEB 1MPAL 7FABH 4RMQA 3ZO0A 3THMH 5FK9B 2F8VA 3CDYA 1E28B 2WSKA 5ESQB 1MWAH 5L9DH 1JPTH 1XIWB 4HFWA 3KPRE 3Q6GL 2K9UA 2N7BA 3TCXA 1IE5A 1NFDE 2NY6D 3C6LB 2OJZH 3WHE1 2XNAB 4NRYA 3DMMD 3KJ6H 4OCLC 3MRJB 3IGAB 5EC1A 1SEBB 2F54A 3WE6A 5I18H 2BC4A 1PG7L 4YUEL 1G0DA 2VN4A 3NFNB 4BKLB 1ZLVK 1QFWI 4HW6A 1EZVX 4W81A 3GI8H 2EH8H 6FABH 1I8MA 3T04D 1ZLSL 4MJID 2AV7A 1MAJA 3VWKA 1OAQH 3FB7A 3MNZB 4O00A 5D7IB 3ROLA 1N2RA 5EFIB 4YUEH 4Y1AB 4JVUA 1IL1B 4WDIB 3WXWH 2QKIA 4PTUB 3P40A 4WW1B 2YOCA 3DO3A 1IM9A 5CILH 2BFVH 2ZG1A 4K94L 5IGXL 1J1PH 3U4BH 5DFVD 4OGXL 2JIXA 3VFGL 5HHOA 4MLIA 4XC3H 3MO1A 8FABA 4M6NH 3I9GL 4QF1A 2A77H 3MZGB 1MCFA 5B8CA 3DV6A 3AGVA 4YH6A 3B6SA 1UYWL 3RA7L 3GMQB 1DUYA 1S9WB 1ZK9A 1PEWA 3QI9C 3JTSB 5EZJB 2LU4A 4MDIA 4QHUA 1NAMA 1MCQA 1DSFL 3RIFK 3HE6D 1DQJB 5AYUL 4EN3B 2UY7A 4H0HB 1RK1B 4PJ7E 3MV8A 1QNZH 4P5TD 1EAPB 4TUOA 5E1AB 4CVZA 3OKDB 2KKQA 5IBTL 5TE4H 4K55A 2BNRA 2E7LC 5HI5C 1NUGA 4LCWE 3LKPA 4KUCD 4OD3L 2YD5A 2X7LA 3P4LA 4FQXC 1QRNA 1ZVYA 3L5XL 3G9VA 3ZE1E 5IWLC 2X4OA 5EWIH 3GNML 3RTQC 4JFYB 1U9KA 5SWQA 2EDEA 2VE6B 4PRPA 5DRWB 3RY6C 1QLRA 4NFDA 4X4XA 2R0KH 1QQDA 3O3AB 3RX7A 2YPKB 2P8MA 3U46A 1B0WA 1ZANH 3VMPA 3BGMB 5HYJB 1OQOA 4Z0BL 3O6FA 5E8EB 1LDSA 4M7JL 5ERWB 1HXYA 1U8PA 4KTYA 3SKNB 2W92A 5A16A 3VD5A 3QISA 2A1WL 3DMMB 4RFOH 2O5YH 5DQDL 1ETZA 5FV1L 4XC1H 3UTTB 3LV3B 5D2LF 1AGEA 1CDCA 3GSWB 5T3XD 1NAKL 5E2TL 4QHKI 1JTTA 3DO7A 4HIEA 2BNQB 4I0KA 4Q9RL 1VADA 5ACLA 4OQTL 3MLUH 1KLUA 5C08D 4I48B 4YE4L 1G7PA 5CLTA 1B88A 3BMVA 1OGAB 5EIVA 3QUXA 5IHUL 5KVEL 5KVEH 4BUHA 5L2JA 2WUCH 1UM4H 2RHEA 2VDLL 3BPCA 4EVNA 2BVUA 2YS4A 1WWWX 3MOBL 4X7TA 4Y5YB 5D1ZB 1W8NA 4WI7A 1N4XL 4PGZA 2H8PA 5EU5B 2ITCA 1B3JA 4BZ2H 1UXWA 1WT5A 1IGCH 5MI0B 4X4ME 1H15A 2ZCKL 2WBWB 3TH3T 1J87A 2X4PB 4MQSB 2ZPKH 4N0FB 5H35A 5DJZA 4Z7NF 5HYSB 3Q5YA 1RIUL 1OAYH 2YUWA 3SDDA 2HP4A 4XVSL 3WFEH 1NLBL 3BIKB 4Z7VB 4RFOL 4PJXE 2QADC 4P2QB 3BOVA 2A2QT 2Y06H 2W0KA 3ULVC 5DRXA 5I17B 1HIML 5ESAA 1FN4A 3HMWH 2V7HA 2DQEL 4OV5A 3QIBB 1NGYA 4AEFA 1MCKA 5IBUG 3SBWC 5IIEB 4A6YA 2ZUVA 3VI4E 4WVRA 5SWZA 1AFVL 3TO4C 3VFOA 2WLZA 4MDIB 4QXGH 3SDCD 3PP3H 3DTXB 1T83C 1MJ8L 4R96B 2P46B 1AI1L 2NY2C 1XEDA 1JPFB 3CH1B 2XV6B 3HC4H 4PGBA 5ENWB 4TSCH 4GW4B 1WICA 1ORSB 5TJWK 3K4ZA 3CFDB 4Y1AE 1KPUA 4POZD 1PLGL 1YPZA 1IAOA 3G04A 4ORZC 4P3WA 3IS0X 3ROOB 5H35B 4PJ7A 4EBQH 3G5ZA 3RVWC 2C1PB 2EIZB 4NKQB 3RZCC 2BSTB 1QKZH 3F12A 4UQ3A 4ZAKA 1EERB 3WIFB 1NGZA 4GXVL 1DDHA 3LN5A 4R8WH 5SWSD 3SCMD 1MJ7L 5F88B 5MI0C 1VDGA 1N0XL 5DVMA 3SJVD 4JREC 3F62A 5EU6A 5J6HB 4PD4K 4JDTH 4L3ED 4FZEL 2A6JA 1YEKL 5FYJD 5JPNB 1P4IH 3RL2B 4LU5H 3RWGA 3KPQA 3LOWA 3QJFB 4NOBA 4XNQA 1CDBA 2MJWA 3SE3C 2V5MA 4XCFL 3GI9H 2HVKA 1GC1H 2P5WE 4FP8H 4YFLF 5ACZA 3X3FH 4JY5L 4DEPC 1YQ2A 1M7IA 4JQIL 5E8OA 4LLWA 3LSOA 4ZSOB 5F1SA 4MXWH 2Z91B 4ZFFA 1RZJH 3VA6A 3LQZB 3JWOL 3O9WC 5FK9A 5DJ6B 4JB9L 4FZ8L 4P9HH 2D7TL 3G6AA 3U30B 4H1LA 3C09C 4L9LB 3PHQA 1WEJH 4OZHE 4ZPVA 1SYVB 1HKFA 1KYOJ 4TUJB 4J3TA 4NC2B 1T3FA 1J05B 3QDJA 5T1KD 1EO7A 2C7UB 3G5XA 3KLDA 3MV9A 2IFGA 2DIJA 1CDJA 4FQ1L 3BYTA 1QRKA 3O11B 4WENB 5F3BB 3OAZH 1WC7A 2VRAA 5I1LA 1A9BA 2H41A 2FR4A 4MNGE 4NJ9H 3PGCB 3WLBB 5HHXH 4HKJB 1KOAA 2AEPH 1K2DA 4KHTH 4Q6YA 1HH6A 3PQYD 2DQGH 4MB3A 5KAQF 2VXSH 2C9AA 1RZIA 2UZIL 4G8GD 1P7HL 1TENA 4ZS6D 1N6VA 2XA3A 3DRTB 4ODSL 2VDMH 1TZGL 1AI1H 2X5PA 2GQHA 1GHFL 1M71B 2VXVL 3GMOA 3PL6C 4S1RL 1A2YA 4H88L 2OJEA 4NQCD 2J8OA 2A6KA 1QTYT 3TPUB 5KSBE 3QNXB 4PD4J 3Q0HA 5IR1B 4FQQB 5HHQA 5D6DA 4HIJB 4NUGH 1MF2H 2DM7A 4DJMA 2Y07H 4PGCA 1JGDA 4JFDE 1GSMA 5I1AA 1EV2E 1YJDC 2JCCF 4DEPB 5IB3A 2HFTA 3J8F7 1A7QL 3ARFA 3L3GB 1Q0YL 3CMGA 4GH7B 5FYJU 4X5XB 1E6OL 4PJXB 1RUMH 4NHUA 1DVFA 2EE6A 1I7RA 3DX9B 5LWYH 3CUPB 4Q97A 5C0FA 4GG6E 1AD9A 2HKFL 1H3PH 3SDDC 8FABB 3K4DA 1B0RB 3FQTB 5CZXC 2ZCKH 3FN9A 4DKAA 2VLRD 3FT2B 5FA3B 2VDKL 4P2OD 1OSZB 5K9JH 2X05A 1WTLA 1EHXA 2YPVL 3NTCH 5IB4B 4ODVH 4F15B 5FUZH 4PRIA 4HWEL 4OCYH 4HPYL 4R4ND 5D7LD 5DEZA 4KPHL 3CXDL 4NP4H 2VDKH 4E41A 3EOTH 4JO4L 3V8OA 4X6DA 4G6AC 4LIQE 4NQTA 4ZS7L 3V4UH 4A2MA 1KCUH 3GSNB 3OB8A 4Q9QH 3KXFB 4K71B 2H32H 2NZIA 1FV1B 2CLRA 4M5YH 4QHLA 5FHAH 2AKRB 2C4FT 2NXZB 1KCVL 3EHBD 3PL6B 1OM3H 2FO1A 5CZVH 1E6OH 1JWMB 4OZGB 4RA0C 3WSQL 1YMHB 3LRSA 1C5BL 4JN1L 3MSPA 1FRGH 2YD2A 3BVNA 4HLZG 5BJTB 1MFBH 2CR3A 4LRNH 3VDAA 4QRRE 4HMDA 1U3YA 1JUFA 5JQ6H 3UBXB 1EEQA 3MR9A 4S2SA 2R2CA 2AJSH 5DMYA 4QRPA 2EKJA 1P4LA 3MOAL 1UYWH 3PHSA 4H88H 1GRWA 2IH3B 4H26B 5C0AA 4JPWH 3MLPA 1JNNH 2DB8A 4Q6IB 3FO1A 3T4AB 3IVKA 1EDQA 1W72H 1A1NB 3SQOH 5JO5B 1AGFB 1WQVT 3QG6A 4PJ9C 3MXVH 3H7BB 4OF8A 2X4SA 1YYMH 3WXWL 4KK8D 5CJ5A 3L95B 2X70B 4U1KA 4GMSH 5HHMB 1U8KB 1G7JA 4QO1A 3AS1A 1RZKC 2LVEA 3ZE1F 4MXQC 1R5VB 1CLZL 3SO3C 4Y16D 2CPCA 2G9HA 3BP6B 4KUZL 2AABH 1UKTA 1WWBX 2QSCH 4EKXA 4K71C 4QT5B 5DC0A 1NMBL 5KSBF 3GO1L 3MJ9A 3JZ7A 5D93B 4R7NB 5DI8B 4M1DH 1UH4A 1NDGB 3HNSH 5L8LB 4JFFE 3O45A 1NL0H 4NQCE 5HVHB 3STZB 3DGGB 4Q74A 4UILL 1CGVA 1E4KA 3BGFB 4F7TB 5BVJB 5IVNA 1OGAA 1UACH 5E6YA 4P4KD 1UVQB 4JLRB 3MLXL 2BVPB 1ZLVH 3WHE0 2P4AB 4RGMB 3TBTA 1K6QL 5FO9B 5C2BL 1F4XL 4NCC2 3D2UD 3JUZA 4I18A 3WUWG 4UIMB 3RGVD 1YMHA 3F7PC 2EDQA 4NN6B 4L8DA 1ZOXA 3QEQD 3MPCA 1KB5A 3LIZH 3P9LA 3OGCB 1RIHL 4S11A 4UAOC 5T3ZD 3BP5B 5E6IC 4HGKC 4ZOAA 1IBGL 3HC0B 2ATKA 4HF5H 4FFZH 5D1QC 5E6IA 3SDYL 1T89C 5IVXF 1AQKH 1F2QA 4K7PY 5AD0B 4BFEA 2GJ6B 2XIDA 2WLYA 4L5FH 2F15A 3BGMA 4HUNB 4M7KL 5EULV 4BQCA 2CXGA 3CSYA 4UINL 1HI6A 4OUUB 1DBBL 2VIRB 1G6VK 4JRYB 2HTKC 2NY5C 1AY1L 1WCBA 2BNQD 4WWKB 1CIDA 3DPBA 3MLSH 1QG3A 1RFDH 1JTPA 1KNOA 3PGFH 5BS0B 3QAZB 4HUVA 3BGFC 4LVOC 4WUUA 1J8HD 4KTEL 1MREH 2EDOA 3BQUD 2CRMA 4MCZA 2NPLX 1NLBH 3R06A 3A6CL 5HDOA 2ICWB 2DM3A 4TUKH 3HE6C 2F5AH 1A7RL 4E42B 2NX5A 3ALXA 3LRGA 2ZZUT 4DKFH 4V1DB 3VRJA 5GPRA 5I1LB 2E7CA 1MCJA 1HHIB 1ZS8A 3TV3L 2UWEF 4FN0A 3MOQA 4JFPA 3VXRE 2XRAL 5L6YL 4P23B 2DLEA 2YEZB 3NPZB 5K9OB 1H5BB 1WBXA 5KJRL 1EEYA 5JLZB 2CO7B 5HHME 4APQA 5FYKH 1A6UL 4P5TB 2K1MA 2XWJB 1IGTA 3LHPL 1D6VL 1LMKA 2AXGA 5DR5L 1QBMH 4QKXB 1A3LH 1PD6A 3G6AB 3VW3L 3TN0A 5FM5O 3RVWD 1RV6X 3L7FA 1J10A 5HHOB 1NSNL 1AJ7L 3DARA 2VDOH 4JAMA 1J7VR 4DUWA 1N6UA 3RTQB 1YEEL 1KSRA 4J6RH 1GIGL 1M7IB 5DJ0B 5HXMA 3OAUL 1UB6B 1L7IL 5D1XA 4YIQA 3FN0L 3KPNB 4MDJA 35C8L 2BY3A 3QULB 1IM9B 4N8VB 4PJDB 4I1NB 1E4WH 3TVMD 2X09A 1EGJL 2ICWI 2VR9A 4F33B 5KSUA 4PR5A 1N2RB 3IDXH 4XC1L 4XBGA 5EFIA 3SGDH 1KFAL 4XI5C 4KJWC 3O8XA 3UJIL 3EOAB 4Y4KB 5EOCL 4XP5H 1G9NH 1FL3B 2P8LA 3PDOA 4K23L 5F70A 2HN7B 4U6VH 3SQBA 2X4QA 4LVOB 5GGVH 5C07E 5F21B 5IMKB 3R4DA 5F88A 5J1SC 1S7UB 3MLTA 4ODWA 4GAGL 4KJPC 4O2CA 5FHBH 4JFFA 5ID0A 1NC2B 1FCGA 3C6LC 4OM0H 1WK0A 4OZGF 1DBBH 4IM8A 1G7LB 1U8QA 1PFCA 5MENE 1E6JH 4YX2L 1FFPB 2WQRA 4S1RH 3KXFE 1BFTA 4H5SA 1OAUL 3DVIA 4BFGA 3KPQB 4MNHB 1ZKAA 5I74B 4RWYL 3O3EA 1CE6A 1XGPB 4LASL 5EUOF 4WJ5A 5EH1A 3S35L 3WYRA 2JJTC 3HE7D 4P23C 2Z8WC 1SJXA 5CHNB 4CVWA 1IGTB 5DQJB 1F4AA 4HF5L 4K94C 2ADGA 4K8RD 4RMRA 4ZUVA 4OZIE 3RVUC 4Z18A 3HC3L 3FQRA 4I4WB 3BPNC 3O2DA 1HEZA 3DUSA 3BX7C 3CFBA 3QXAA 3VXSE 1VACB 2DKMA 3BMWA 4KMTH 4PY7A 1ZA6A 1S7VA 4Q0XL 1U3HD 4DN4L 4M6ML 3VGAB 1YMMA 1JPGA 4R2GD 5D70L 4MA7H 4UT9L 1K6QH 1BFOB 1SEQH 2OZ4L 5FYKU 1YDPA 1KJMB 3ELAT 1WFUA 3DX8A 1C7SA 3HNTL 2O61B 5J7CC 4LKXA 4GRWE 1SYSA 1JZ4A 3VXUA 3IFLH 1Q94A 2J2ZA 4DKDC 5KSBB 3O41A 1QOKA 1GC1L 1PSKL 3VFGH 4UDUB 1MHCB 3CPLA 4JHBA 1YEGL 4JQXA 1T66C 4QRRB 5D2LA 4XMKH 5EU4B 5DWUH 1Q9KB 4PV8B 4TSAH 4MA7L 4H25B 1SY6L 3ZE2E 4X6DF 3TO2B 1AR1C 1PYWA 3BT2L 1PZ5B 4ZNEE 1NCDH 2AK1L 3MFGB 4HLZH 3BXNB 4XVJH 2M26A 3PWVB 3V5KA 3REVB 4L3CA 3VFRA 5E9DA 3P9LB 5C0RL 2HT3D 3DYPA 4H20H 3HPJB 3SEPA 4G6JL 4KVNH 4KI1A 3RDTD 4TRPL 5FOBA 3T2NH 2BNUA 3MLYL 2CLRB 4Z76B 1AIFA 1ERNA 1LE9B 1N8ZB 3DURA 1DUZB 3SDCC 5JNYA 3T65B 5JIHA 3ZKSD 3V6OC 3UO1H 4JKKA 5T1DL 3S4SA 4Z7WE 3KPRA 2YMXL 1E4XI 2YRPA 3FAXA 1FYTE 5K9KA 5DFTA 3TZVC 4NNXA 2BNUB 5FHBL 1PQZB 2A9NH 4TNVF 5C8JB 3DYMA 3RVVC 2GY5A 2CK0H 3FCTA 1NGPH 4YDVB 2XZZA 2VDQL 5TPWL 3MBED 3E8UH 3K2UL 4OUOA 3KYMB 1JCKA 2NQCA 1F2XK 3NCJH 1KTRL 3WFEL 1SMOA 3A6BL 2R23A 4U6HB 1OL0A 4H25A 5FHAL 2Q6WB 3LKPB 3RHWF 5LCVL 1PZ5A 4PV9A 3TA3D 3U30C 3C09B 1ADQL 3VFPB 1NBZA 3CVIL 1I4FB 1EMTL 3IJYA 2H2SD 4MS8D 4R90H 4M62H 2L7JA 3KJ4B 2BOBB 3FO0L 4NO0B 4HPOL 4P2QD 1P84K 3E0GA 1S7XB 1WT5C 1Z5LB 3MC0A 3MA9H 3HG1A 4P9HC 4RGND 1QFWM 1YYLH 1RZKL 4WI8A 5B38G 3F7RA 1KEML 3BJLA 4M7ZB 3WJJC 3SGJA 1F4YH 4KRPC 3S88L 1X5YA 2X89A 3ULSB 3QO1A 3IDNB 3D48R 2LQRA 2P24A 2KL6A 2B4CC 3ZKNC 3HKFA 4NQVB 3HLAA 3STLB 4JPKH 2E7LA 3AU1B 1ZSDA 3REWA 2BVOB 3CCHB 4FABH 1TJIL 4U1GB 3E8UL 4PB0L 5I8EB 2DKUA 4LSRL 3HB3D 4QHUB 3I02B 2FX9H 5BZDB 4ZSOE 3L3OB 5GGSY 3SOBH 3CSBA 5JXAH 1T5WB 4J3OC 4UZGA 3UZEA 3MLSL 1UEMA 2ZCLH 4NRZB 1FV1A 5DD6A 4RAUA 1RUKH 4D0BB 4LCWD 5C6TH 3W9EB 4EI5C 1NFIB 4EDXB 2EYTB 4CN6A 5DD1H 4XPHH 4LLWB 1BP3B 2BSED 2R29L 3KYOB 7CGTA 5ELIA 5DYOA 5D2LE 5GJSL 3RZCB 5J11C 4KHTL 2AEPL 3UPRB 1EJOH 1AGDB 3DVGA 2QSQA 4WFHE 4ZTOL 1OTSD 1U3HC 1IM9D 2WAHA 3BEWA 3JV4A 2XTLA 4QY8A 4N90D 3IDJA 4ZUSA 4OAWB 5DLML 4N0YL 5FA4B 2XKUA 3UTSA 4ZFOB 3C2SA 1QSEB 5EORL 4PJ5A 1D5BA 5BVPL 5TE6L 1LDPH 2A83B 2E8ZA 4EXPX 4XVUD 4CAGA 3D0LA 3ARGC 4PJDA 4N5ED 4ZD3H 2GTZB 1C8PA 2DQIH 4KRNA 4WI2A 4WV1A 4BJLA 2N56A 1HYSD 25C8L 3BUYA 5IT2L 3GSUA 3KPTA 4I5BB 4HT1L 2FJFA 1A2YB 4P5TA 2Q8BH 2F8OA 5K9QG 4DOHB 5F1IB 3TJHD 4U3CA 4OGXH 2PETA 1GPOH 3MV11 4LVHC 4FZEH 4JFZL 4LOUC 5I73B 4Z7VE 1UM5L 5IB3B 5EN2B 3VFSA 3ARRA 1EFXD 5B39B 5MEQB 1YEDB 1MRDH 3VXSB 5I16B 1FZMA 4KUZH 3D6GA 3SY0A 5F93C 1UADC 3D69A 1AR2A 1TLKA 3BE1L 4NZDA 4RGOH 4JCMA 4Z78A 1Q0XL 2FZ3B 2B2XH 4ZFZB 2DI8A 1EGJA 5EU3A 3V5DB 2W9DH 4CDHA 2HT2C 3E6HA 3S4SG 3QXDA 1QFPA 2AJVL 2B0SH 1VGEL 4HMCA 1XCTB 4O51A 4ETYA 1IKNA 3Q5OA 5DWUL 2JCCA 3PF2A 4CBPA 3UROR 4QRQA 3QDHA 3EYVB 1ACYL 2DJSA 5BXFA 2WIIB 3SDAA 2Y36H 5E8OB 3V6ZB 1JYVA 1OPGL 4HHAB 1FIEA 3U48A 3KYKL 3THML 1JWSB 1YNKL 2G60L 1U2HA 2WINB 3HRPA 4YO0A 4CU6A 4F9PA 2E9IA 1CGWA 3IKKA 1ZA3A 4JQVC 1IJ9A 1PW3A 4ELME 5F72S 3UTZA 4OCSH 1C1EL 1TTGA 4OFIA 3ZT5A 1QVOB 1MIEL 3TNMA 5I6XC 4PJ8D 4HIEB 1AKJA 5GGQL 3BWAB 2X1OA 4AEIL 5IFJB 4B50A 3STBA 3H8NA 3LDBC 1FFNB 1KC5H 4Y2DC 4P59L 4FRWA 1CT8A 4PJGA 1R3KA 3P4MB 1BJ8A 4I3RL 4K3EH 1W0WB 4W68A 3NA4A 1P7QB 4PJBB 2H9GB 2EIZA 4JZJB 1NGXA 2Z93A 5IV2B 1UFUA 2DRUA 3GMPA 3HI5H 5F96H 5KG9A 5HHOE 2YWZA 3P0VH 1D6EB 2V9TA 3R8QA 1XIWA 2FD6L 5C6PB 1FG9C 2IBGA 4KPHH 1UWEH 1A7OL 2EKSA 4BM7A 2R4SL 1T7WA 3UCRA 2I25N 1T1XA 3ULVH 1HXMA 3UYOD 5KTEL 1JL8A 4XB7A 4P4RA 1A8JH 5EPMB 4UT6L 2I27N 2IC2A 3FO9B 1UZ8A 1NKOA 3QRFM 3W0WB 4YWGL 4P5KB 3GMPB 3OXRB 3VXMB 3EYFB 2YPLD 2J4WL 4OBSA 3WUWB 3KYNA 5HTSA 5JHDB 1IGIH 4GKSA 1FNSL 3QDGB 3VFUB 4APQC 1MQKH 1M6OA 2LU7A 4AEEA 2CUHA 1CT8B 3CFDA 2ED7A 1AP2A 3OKYA 2F19H 4TVSa 2H6PA 5CD3B 5DURB 2IF7A 4Y16B 5AEAA 5BS0E 5E2WL 4XNXL 3DSNA 2B5IC 5DK2B 4Z0BH 1FVDB 2A74A 5T3XL 1OARH 1P5VA 4JM2B 4FOMA 4LLMB 1L7IH 1V8HA 3MJGX 4PJ9B 1S7TA 1R0AH 1SM3L 4R0LA 2VLRE 5CP7A 1QA9A 1DUYB 1KCSL 1OSPH 3ME0A 3DV6B 2GK0A 3HUJB 4KZDL 1X7QB 1DBJL 1WZ1H 2VWEC 3D39E 5IBLC 5BZWA 1GGUA 2VISA 3GIZH 1MRCH 3DX7B 3GDBA 4UNVA 2NLJB 3U0PB 5FYKL 1I7TA 5DA0B 2VXTL 1TVBB 2F74A 2XYCA 3MFFA 5DRZB 5HHXL 1JGVH 3H3PH 3WUWA 5LJYH 1RZFH 3P0GB 4OBRA 1GGCL 3N85L 4K9EL 1G7LA 4X8JA 5L88L 4XCYA 1ITBB 4IRSA 1HHKA 1NGQL 1UC6A 1AXTH 4FQ1H 3QQ3B 4PJGB 4RZCB 1Y6NR 3B5TA 3LRSB 5DEFB 1NGWA 3F7QA 1I3GL 2QHRL 1TQBB 3L3IB 4NKIL 1OLZA 4WEBL 1XMWA 3EO9L 2QV2A 1NFDB 4U05A 5IKCB 4HIHA 2P43B 4JO2L 3S8WA 4M00A 1N6QL 4HWUA 4NO3B 1FNFA 3ZZ1A 5IMMA 1TJGH 1XT5A 4Z7OE 2MQCA 3CX5K 5IMLB 1B6DA 3OR6B 2ZUSA 5EOQL 1Q38A 2DDQH 3FT3B 2CIIB 5GRJH 2FIKA 3AB0B 4CGTA 1G9ML 4M43L 3EOBA 4Z8FL 1FFNA 3CDGB 4JDVA 3HNTH 3I3EA 3EYVA 5D7IE 3L3HA 1XF4B 4X6DE 1J0ZA 1F90H 3PWJB 4GUPA 5D9SB 2X4RB 4MQ7B 3CZJA 4LFHD 4OZ4A 4UAOB 4N8VG 3PQYA 4RAHA 2AABL 2FYYA 2H2SC 2VO5A 2ZSWB 3ARWA 5HYJD 4OCRL 4O5LL 3QUMH 5IB2B 3ESUF 4P5MA 4LIQL 4D8PB 3JVGA 3EBAA 2BSSB 1U91B 5C9KA 2PR4H 1JGDB 1MWAB 5DJXB 3BD5A 1QQDB 5I1AB 5D2LB 4QRRA 4OQTA 4Z7NE 4W6WB 3MV8B 1S7WA 4O9HL 5CIPH 3O4LA 2QR0A 4LPVA 2ILLA 1UM5H 2AXGB 3IDUA 4HCRA 3RNKA 4XTRC 1MCOH 1CFVL 4WNQA 1OF2A 3BZFB 1F13A 1QBLL 3VE0A 4XCEA 1KN2L 3WDIA 4HT1H 5EZLB 3SJVB 3EUUA 1F42A 2AK4B 5IMOB 4Z77B 3MOAH 2Y7QA 4NZTL 5LQBH 3BUYB 3HE6B 1T7VA 3O4LB 5GGSA 2D9QB 3AS3A 1GXEA 4PFEA 1RK1A 2YR3A 2XPGB 43C9B 4BH7A 3DVNA 4I0CC 2GTZA 5C0DA 1WFTA 1ZT4A 1YN7A 5IG7A 2QSCL 3KPMA 1P7KA 2NYYD 3FB8A 3TVMB 1AXSB 3WLWD 2IALA 4RISH 4N8CL 1CDYA 2Y72A 1FORL 1FVCA 4QXTA 3GSRA 2V7NB 1B9ZA 5D7LA 2AK4D 4GJTB 3Q5TA 5D8JL 3T3PF 1X9QA 2EDXA 2HRPH 1EBPA 5KANG 1BZ9B 5FCUH 1EO8L 4JO4H 4Q2ZA 3W81A 1QLEL 1HE7A 1PKOA 3MBEB 4LHUB 2IMNA 2IG2L 5DC4B 2MPAL 5I0DA 1NSNH 1KACB 4MQXD 3PV7A 3CZFA 4MCYB 2DD8H 5CSZA 3TJEH 1MNUH 5CWSA 2QKIB 4PTUA 1DTUA 4PREB 1D6VH 1ZT1A 2BZDA 4FQXA 2D4DA 3PWPB 5FYJL 3QJHA 5TE7H 6CGTA 2OR7A 4BH8A 4CN4A 5A40E 2DL2A 1YC8A 4S1DD 4DQOH 2C3GA 3SDCB 3IFOA 5FGSA 4FQLL 5I76A 4HS8H 2WWMD 2LAGB 3QCVL 4OSUL 4QRTA 2AJUH 3MZTA 3ET9F 4ZQKA 5JXEC 4NQED 4X8XA 4PJAE 3MJ7B 3SKOB 1GAFL 1WWAX 3IB4A 1G0YR 2YZ8A 5E9DB 4X4ZA 2VAAB 4Y0GA 3A6CH 5JOFB 1FYTB 3PWVA 1MHHB 2RFXB 1BVLA 3BH8B 1OM3L 2WIMA 32C2B 5DJCA 3BJ91 2Q86A 1K8IA 2EEDA 5EO9A 3L5WA 4L1DA 4F7CA 4PJFF 1ORSA 1WGOA 4PP1D 1KPUB 4J4PC 4LVNB 1U8MB 5DUML 1CFQB 1VGKA 2LTQB 4J4PA 3U0WL 1KLGB 2XFXB 2GK0B 4P46C 1YC7A 1KV3A 3O45B 3DWTA 1QA9B 4R26H 3QZWG 1ZXQA 4KI5D 3ZDZF 5IBLD 2XZQL 4A6YB 1ZGLM 3ZDYF 1I9RH 3QEQB 4G9DA 4FXLA 5E2VL 1AQKL 2NY0C 4GAYB 4X6FB 3QIBA 1LWRA 2VXUH 5C92A 1WLHA 5E99L 4ZYKB 4EI5A 1EMTH 3CFJA 4FNLL 1CFQA 1MY5A 4HUWA 4HZLB 3VXPA 2E9BA 3W5MA 4GMTH 3UAJD 5E6ZA 3IT8D 4KRPB 3IJHB 4C54A 4XAKD 4R4FH 4MSWB 5GS1C 1I8KB 4DGYH 2VKWA 1A3RL 4WWKA 3DROB 1J0JA 3O4LE 4Y4FA 3QPXL 2X4NA 4JFED 2NY5H 3G5VB 4K7PH 2VDQH 1I3RA 4LNVA 1DBKL 3FRPA 1BGXH 4PY8J 1LEGB 3VXRA 4M1CD 5JR1H 43CAB 3D2UA 1FZOB 1AD0B 4AEHH 1IQDB 2BOCB 5I8KH 3EYOA 3U4EA 2L4OA 1KCLA 5CSGA 1NFDF 2VDML 3O3EB 4OGAC 5AD0A 2VQ1B 4LQ1A 5FOJA 5B38B 1PBYA 2IAND 4YEEA 3U4BL 1B0GA 3EHBC 4KRMB 1LO3H 2H9GA 5FO8B 4JY4B 2Z93B 2CJUL 3RWJA 1TJHH 3FRUB 4PP1C 5KZCB 1J11A 3MJ7A 3VI4F 2F58L 3LQAL 1ES0B 3LPFA 1BIIB 2V2XB 2Y5TB 3DYOA 1MCEA 1YEFH 3FO2B 3OAYK 3QIWA 1ZA6B 1LO4H 4YK4C 3QEGL 1QBBA 1UKSA 5FM5M 5SX4I 1U3HB 2GSIB 5E5RB 2BVPA 1S9VA 4N8VA 3G5YB 2OK0L 1BAFL 5DK0B 2G2RA 4JZOB 1I3UA 3EYOB 2XN9E 3U4EB 5J13C 3O6KH 1MAMH 4MXWL 3QQ9D 5H94B 2E3VA 4BFIB 4X9BA 4CRPA 4RNRA 3UDWC 1ZMYA 4KK9C 3TIDB 3SPVA 3OXSB 1JNNL 1BZ9A 2XA8L 1CIUA 2R1YB 5JDSA 3MLVL 3Q3GA 2PO6A 5E2UH 5C3TA 1WZMA 3KLAB 3SKJH 2EEBA 5JW5A 1PYWB 4FQIL 2CH8A 2BK8A 5DD3H 4JJ5A 2YN5A 3CXHK 3DVNB 1CG9B 2QL1A 5FM8A 3T0EA 1NC2D 4APQD 4Q0XH 3MREB 1KPRA 1MJ7H 4DN4H 1NC4A 4X7CC 1JGEB 1R5IB 3O9WA 4U1KB 4G6FB 2DQDL 1SHMA 3RY6A 3TN0D 4ELKB 4OGYH 4QHNA 5GGRA 1JZ6A 3HZVB 5B8CC 4OZFG 4R4NC 5ESVA 1A14H 3IU4L 3GM0A 2PW2B 3QI9A 5E2UL 5B3NA 4HUVB 1BBJA 2YHGA 1TQCC 2OXGA 4HKZB 4NHCL 5I1GH 1E4XH 1T1WB 4Z7VF 1LK2A 3IRPX 1Z6JT 4U1SB 5KSAD 4P57B 3NMEA 1NAML 4QOKE 4DFIA 2AP2A 1T0NB 4G5ZL 2Y4SA 2MFNA 5C0JB 3K1DA 3DUHA 4DCQB 4XVTH 2DOCA 3LN4A 4YHKL 5LAXA 3VXNB 2PTVA 3DGCR 3HZMB 1KJVB 4P23D 3CH8A 4KJQD 4NJAL 2ZG2A 4UT7H 5FDYA 5DK3A 5C0BB 4ZUVB 1CR9L 5CD5D 5ITFA 4QTIH 3OGCA 4K23H 5JHDE 5EIIB 3TO4D 3CGTA 1CTNA 1MEXH 1S7QB 4FQ2L 3O8XB 1R3LB 1FC2D 4PJHF 3OJDA 4BSJA 3HE7A 1ZHLA 2J4WH 4G42A 5GZND 5KSVA 5L0QC 4WRLA 5TF1H 3RWJB 1N5YH 4JANB 4ZXBC 4XVTL 1MCCA 3UYRL 3RWFB 1JK8B 4DGVH 2HYMA 3H9SD 5DJDA 2KDGA 1RJZB 2APBA 2JJVA 5GS0C 2X4UB 2MTPA 3KS0J 4RFNB 4WO4D 3QHFH 3GNMH 2YD7A 4YHPA 4K7PL 2FD6H 4X5LA 1S9XB 1IVLA 5K93A 5C0BA 1KIPA 1H5BA 3F58H 4PJ9A 5JA9A 2G75A 3FRPG 4JFXB 3ARGA 3BRDA 4GO6B 1KPVA 2HJKA 5C0JA 1MUJA 4JHWH 3S37L 3RPIA 2ZOKB 4FFYL 4EZMA 1CFTB 3TGXA 2J8UF 2BSRB 3G08A 2NTFA 4YJZL 1T1ZA 3NFPA 4JFHD 1QD0A 4Z7UE 5IMOA 5HSFA 3RZWA 3RGVB 5IW3A 5INCB 1JNLL 2A1WH 1Q1JL 4M7LT 1CE1H 2DQFA 1C1EH 4X83A 4FZ8H 3GMOB 1DLHB 4APQB 4NO5A 4JR9H 2H32A 4MHHI 3I6LD 5CUSH 5MEPB 5INDB 1F5WA 2X6MA 1Q9OA 3HR5B 2NXYB 2J6EA 2IADB 2NNAB 1RZIB 2J5LC 2VIRA 3MRFA 4RAVB 1IEBB 3T4AA 2ORBL 2R0KL 2FJGB 1KTLB 3SCMB 3F6LA 3GMNB 3SKUD 1NC4B 1FAIH 3MCLH 4G3YL 3GZKA 4NN6C 3SBWA 3CFCH 4GW5B 4L8CA 5IFAH 3QG7H 2CDGB 3HFML 1KCRL 1MFCH 3KR3H 4QOKD 3ZYIA 5E6IB 3X12B 4L8BB 2ARJQ 4MNGB 3WD5L 3EYFA 3RWCA 2QQNH 3ULVD 1H15B 3VCLA 1JNHA 2CLVA 5FKAA 1HILB 1G6RH 4WO4C 3AAZB 4HK0B 5ACMA 1JI2A 4JDVB 4JVWA 3O4OB 5HJ3B 4OD2A 5CINH 1VFMA 2G2RB 1T20A 4XNUL 3S3JA 5IJVA 1CD8A 4DOHE 1KBGL 4G8EA 3G6JB 1MH5A 2L7UA 3RA7H 3ULUF 3FFCE 3RUGE 1AGFA 1VEOA 1UVQA 4NM8L 4G6ML 2EC9T 4OFDA 4PRHD 1JF1A 4JFDD 2UWEA 4YDKL 3T1FB 5GJTH 3HNSL 5FOBB 1N59A 3ARYA 2DQIL 4Y2DB 5D6CB 1KC5L 5JW3H 1A4JA 2MKLC 5FO7B 4AG4L 1QSEE 3AB0C 1P4LB 3GSRB 3LY6A 4XCCH 1O0VA 4ETQA 5DDHB 4O2FB 3W0WD 1RZGA 1Q8MA 4KJYA 2GIYA 3NN8A 3U7YL 1FH5H 4KUCF 3NIGE 3MYJB 4X5XA 2HTLC 2PXYB 3QCTL 2H26B 4ZFZA 3DXAB 1ZE3C 5E8PA 3FFCD 4TULH 5BMFL 1NEZG 1P84J 4M93B 1KN2H 1IAII 2X89D 4XXCA 5DURD 2KBGA 1CDUA 1VEMA 5C0GB 2APVA 4AIZA 1A1OA 2DLGA 4C56A 2A6KB 4OM1L 1PJ9A 1N7MH 4TNWF 3BESR 4UDUA 3L7EA 4WU5B 1U8JA 4DKEH 3C8KA 1BAFH 4P9ML 1FPTH 3BAEL 3I2CH 1F8TH 1S9WA 3FO1B 1AHWA 1T2QH 4N5EC 4LKXB 2VB5A 3JWDC 1MWAL 5L9DL 2YK1H 3O6LH 4KGJA 1AHWC 5IK3A 2EIEA 3CMOL 2K7QA 3L5JA 2GTWA 5BW7A 3MXWH 4Y4KC 4ZNEA 1K2DB 3C2AL 1NFKA 2V2TA 4UUJA 1TPXC 4JFQA 2CQVA 4PY7B 4Y16C 1EAPA 3L95A 4TUOB 5L7XL 4FG6C 1IGFH 2WWKT 2V5SA 2EC8A 5DZOA 4XMLL 4F7PB 1TJHL 5JOPD 3I6LE 3QFJE 1KIPB 1D5IL 4O02H 1FVEA 3K8LA 2GCYB 1KCVH 3ZT6A 1Z0NA 1D5BB 3ARDA 5IVOA 1WUNT 2OL3B 2BJML 4L1HA 3ZTNH 5I1JL 4ODXA 3ARDC 4MB4A 3QQ4A 3WKMH 3SGEI 1H3WM 3QUYD 4CDGC 2EKSB 2CIKA 4CU7A 5BV7B 3F6IA 1WSST 1DQTA 1G7PB 4EIZC 4RX4A 5AWNL 5D5ME 3LZFL 2GT9A 3QEUA 3IGAA 5JHLL 3D9AL 3HAEH 1AC0A 1JWMA 2QBWA 4UBDD 1U8JB 2YC1B 4LQFL 4WHTB 1MHEB 4Y1AD 1CDIA 2WUBH 4JJHA 1HZHL 1X5KA 3QNZA 5EBMB 1ETZB 3LS5H 1QHOA 3ARFD 2LABA 2R4RL 3ZKMC 1CTOA 4A6YH 3RZCD 2WWMC 1ROWA 3MBXH 4XCNB 1CQKA 3QHZL 3DXAA 2DQCL 5GZOC 3NCJL 1ZA3B 1UG9A 3ULUC 3G5XB 1D3CA 3IDIA 3ARXA 2C1PA 4CU8A 3T2OA 3EYQC 2F53E 5CEYB 3RGHA 5DHYA 2NY6B 3C6LD 2BDNL 1YPZB 3STLA 3IDGB 4LHUG 3RUGB 2BCKA 1S78C 4F2MA 3NABH 3RJDA 5C6TL 1N59B 4PJEB 4OGZA 2HFEA 4F58L 2PCPA 5IQ7L 1FZJA 1RZ7L 2LVCA 3QUYB 3HUJA 5I66A 3H0TA 4NQSA 2DBLL 4LEXL 4E41D 1J0YA 1J1PL 4V2CB 1DN2A 4OLEA 5E2WH 2EE3A 2WW8A 3UP1A 4RBPH 3N06B 4JRXA 4Z78B 5KVFH 5JPNA 4J1UA 3D18A 1I1FB 1HHIA 5FIEA 1J1OL 4JN2A 4X6CE 1MIMH 1HNGA 1YEDA 5ALCH 5D71L 1NGWB 1MHEA 1KIRB 1NBZB 2ED9A 4NQUA 4HK0A 2NY0B 4YFLI 3SDAD 5E24E 1HHJA 3CX5J 4OZIB 6FABL 3VWJB 2YK1L 3O6LL 5FO8A 1QFHA 1WV7T 1UWGH 1S8DB 1VENA 4KJYB 5MHSD 1RHHA 2PXYD 1JGLH 2DI9A 3QCUH 2R1YA 1DP0A 3KLSA 4ZODA 2FX8H 2YRLA 1MLBB 5C0AD 2Y6SD 4KV5F 2APWA 3RDTB 1O5DT 5GS1B 4OLWL 2NZ9C 3KYAA 1G9MH 3H3KA 4M43H 4E0RB 4PRBA 1KEGH 3CH1A 1AKJD 3GSQA 2D7OA 3IXTA 4NNPL 2IPUK 5D1ZD 3BIBX 5HY9A 3O11A 3GI9L 2GI7A 3HHRB 2IPKA 1D6EA 1BZ7B 3LKQA 4LLMA 4MB5A 1OD7A 4I48A 3I3BA 2L0DA 5GXBB 3HRZA 4F9PC 5M94B 3OAYH 4DN3L 5DDHA 1LO2H 1DUZA 3E2HB 1IAIM 3PJSA 3ETBF 4TPRL 5BOPA 4FQHA 1XIWD 3T08A 4GS7B 3LEVH 1K4CB 2R15A 4ZTPH 1JVKA 3VI3F 1NGQH 3UXFA 5D2NE 3EFFB 1JRHH 2NXYD 2Z0BA 3SE4A 2BVTA 4XPGL 4PB9H 4GBXB 3AS2A 4ISVB 3UJTH 3TBTB 5I71C 1JWUA 4HGMA 2OSLB 4PJ8B 3UO1L 4RQQB 2NW3A 2G75B 5IB5B 3T65A 5HDQH 1BQSA 5JORB 3QT2A 4UB0L 2Y5EA 1IM3A 1MRCL 5J6GA 1RHFA 5J3HD 4NRXA 3ALPA 1QFWL 4R4BB 5F1OB 3GBLA 5F9OL 1NQBA 2YPLB 2W59A 4GFTB 1MLBA 3ILQD 2Z4QB 1NLDL 4B41A 3PNWA 4D9QE 4Y4FB 3BRFA 2W9DL 4MJ2A 4O51B 1JWUB 1SYSB 4ZFGL 1T89A 1OWWA 1UZ6E 5INDA 1V7MH 3MGOA 4PRDA 15C8H 4JGUA 2YKLH 3BSZL 5D2NC 3CDCA 5LGJA 1ZHBA 4J7RA 1X5LA 4XP5L 5IEKB 1UA6L 1U8IA 4G8FA 2KPNA 4MD4A 4Y5XA 4WFHD 2WM0A 4Z95H 2XOTA 2DQTL 2AQ2A 3GHBL 4L9DA 3PL6D 2O26U 4EI5B 4ZYKA 4X4YB 2WBJC 5I1IH 2DJ4A 2CLZA 4NO2A 5FGCE 4BQ9A 2WBJA 1DQJA 3UTZB 4U0QB 3GKZA 3BKYH 1MI5D 1KN4L 5DJ2B 3JWOC 5DK2A 2OL3H 3BH9B 1Z5LA 1IC5H 3W9DB 3KNBA 4XPAL 4EI6A 3V7AG 1D9KB 3QDMB 5B8CB 4HHAA 2VDLH 3LPWA 4RGNC 4Y5VA 5IVXE 3NIGF 1WWCA 4LARH 2WIIA 4R3SA 1TQCB 4HG4J 5D4QA 1ADQA 2VNCA 4M6MH 4HJ0C 1JYWA 1H8OA 5L2KE 2WP3O 2EIDA 3MGOB 3UBXA 3QXWA 1J8HA 1S8DA 4P2RD 2DQCH 2LE9A 3BQUA 1AXTL 3KYMA 1T4KA 1Q72L 4L29B 2MCPL 4N0YH 4GT7A 1UM6L 1DQML 2X41A 1RZFL 5E8NB 4C59B 1MI5E 4PY8I 5ADPL 4HV8B 4NC1E 1XF5B 1QRNE 5JOEA 4ONHA 4PJFB 3ILQC 4EOWH 3CXHJ 4U6XB 1EFXB 5HI3C 2Y7QB 4WIQA 3WS3A 5JMOC 1QSFA 3HZKB 2FWOB 4YHNB 4FA8A 4QRPE 1T21B 5D7LE 3MRRA 4LSQL 5JPMB 4PJIF 4BH8B 3IJSA 2DLFH 2G60H 5IB4A 1E6JL 4AM0A 4XNYL 5C7XL 3T0AA 2DYPD 2CGRL 3NZHL 5HYJA 2FBJL 2Z9TA 2JK5A 1LQSR 1NCAH 2AEQH 2APFA 3U1SL 1B2WH 4X4XB 3DBXA 2EXWD 4Q2ZB 2YWYA 5IMKA 3TNNA 1FLRL 2BMKB 3RUGF 1JN6A 4R97B 4XPFH 4G9FA 3VCLB 1WBZA 2UYLA 4IRZL 5I15H 1SJVA 1CF8H 3MRMB 4UIKL 1EGJH 5HVGB 3M1BB 1LVEA 1BHGA 3CU1A 4H8WL 2GW5A 3PQYB 5J56B 3U7WH 3QULA 2H45A 4OCNC 5A3IC 5ESVB 3CSGA 4DWHA 1C5CL 4M02A 3KHOA 3C5JB 2GSGB 3GSOB 3TN0B 4P2RE 4U1SA 3V52H 3MJ8B 3ZE2F 2O5XL 4AENB 1GPOL 1URLA 1YUHA 4XRCB 4OZIF 3G6DL 4KJPD 1ZLUH 3E6HB 4YXLL 4X99A 3I9GH 1JFQL 1RAMA 3HG1B 2FZ3A 2VUOA 4OFYD 4XC3L 5ICYA 4WV1C 3RFZC 5E08L 3EW3B 4X4MA 4CUCA 3GIVB 2AAVA 3WCYA 4OCWL 1I8LA 3QEHA 5DHXB 4M1DL 2I26N 5MEQA 1CGXA 2V17H 3MCKB 4TVPD 5DMJB 2B4CH 2JF1A 3QQ3A 2CRZA 4GG8A 3MRKA 4DN3H 3MRHB 3GMMB 4K3JL 4OB5L 4WHYH 1LGVA 2OS7A 3P4OA 2YKLL 1XR8A 1Y6MR 4JQXC 1CZ8L 5C0EA 2GSIA 1CXKA 1NGPL 1U3HA 4NO0D 4R97C 2HFGH 4JRYA 4OF6A 4PLJC 1JF5A 2DF3A 4X5WB 4JGMA 2XWTB 4X98A 1VKXB 1ZEAL 1CE6B 3RQ3A 2VSCA 2EXYC 12E8L 1JK8A 2ESVE 2X4TA 3T0WA 1JPST 4YHMH 4XPTH 4I0PA 1CFVH 4NQEA 4M7KH 1KF9B 4LSDA 4UTAH 4NRYB 4UB0H 5FYJE 5A3ID 5T1LA 4PLJD 1TTUA 2VDRL 5IMMB 5GRYA 4JPWL 2A6JB 3QUKA 1BD2A 1Y18A 4D3CH 2XKSA 4NT6A 4A2LA 5TDPA 1V3LA 3D2UB 2X10A 5GISL 1QFUH 2O5ZH 4Z5RA 5JQ6L 3FN3A 2CLVB 3FOLA 1MFBL 5DMIH 5JXEA 3B2UC 1LD9B 1PKQA 4ZXBB 2EDTA 2ESVD 4ESKA 1BBDL 5GRZA 1OD9A 1CN4A 3CFCL 4NN7B 1L4IA 4JPKL 3BD3A 4R7DA 1U8LA 2YBRA 1ZTXH 3D1MC 1TVBA 5A2LH 3UEZA 3HZYB 3M17B 1R5VA 4KHXH 2FBJH 5IFHL 3D25B 3QIBD 1K85A 5E08H 2P5WA 1U6AL 2P47B 2JB5H 2GUOA 4R2GC 4ZO9A 3CPLB 3S3SA 2CDFB 1WBXB 4NYLA 1RU9L 1YYLL 2FHBA 5TGBA 3IAPA 4NNYA 3VXUB 1FVDA 4OKVB 5JNYB 5MEPA 1JZ2A 4UDTB 3REWB 2QLVB 1JPSL 4NSKA 4OZHA 4N1EA 5DT1H 4WWKD 1QHPA 2XTJB 5MP6H 4UI2A 2AQ3A 3ILPA 3QDJE 1XH3B 3X17A 4PRHB 4GMTL 2DTMH 4TTDC 1M6OB 1C5CH 1A4KA 4GW1B 5IEKA 2ZOLA 1RI8A 2EZ0C 3DECA 5FCSH 2DICA 5GS0D 3I6KA 2HT2D 5E2VH 2VMFA 4XP1H 4XP9H 4RMUA 3MODH 4KK8C 3N1PC 2FX7H 3ARBC 3BDYH 4OUUA 1A1OB 3P9MB 2IGFH 1P53A 4LEXH 5F97E 3MA7B 1D5XA 1T2XA 3NVQA 1YY9D 4M8QA 43CAA 1HXMB 1RUQL 3MJ9L 2X4UA 4LSVH 2XZCL 4K7PX 3RWIB 1MJJA 2D0HA 4XWGH 4CMMB 4HC1H 3QWOB 3T4YB 1IC1A 4LMQI 1INEL 1AXIB 2RFXA 4S2SB 4LGSB 3DROA 3DIFB 1X5XA 3VWJD 4CW1B 2UZIH 4I9WE 1ACZA 5I1IL 5TH2B 4NUJA 3RIFF 4XRCA 5EUKB 5FAAA 3I6GA 3ZL4H 1A7NH 1A4KB 1P7QD 4G6JH 4KVNL 3UTTA 1SMAA 2ADJA 2BX5A 1YPZF 4K9EC 4QRTB 5ADPH 3WNLA 1V7ML 5E03A 1AKJB 4PG2C 2ZOKA 5ISZB 4F7EB 3S4SB 1Q72H 5IVZB 5DJ8B 1FYHB 5J3HC 2W1NA 3RBGA 2OBGA 4UT6H 3L3DA 1A1MA 4G5ZH 1Z9OA 3T3MF 4G80B 5KN5A 4ZS6C 5E8DH 4KV5E 4RMSA 5HGBA 3CZFB 4MCYA 1NAMH 3E3QC 3U79A 2X4RA 2BERA 4MQ7A 1A9EA 1YY8A 2EXWC 4G6AD 1NCBH 2NY0D 3SDAB 2HT4D 4FTVB 4PRPB 1UH2A 2HA1A 3DX6A 5I19H 4OQ1A 2LU3A 5T1MB 3VFRB 3UZVB 5L8JB 1VESA 3S5LB 3O9WD 3VWKC 2ATPB 1XZ0A 4N1CA 5EO0A 4F37F 5JDJA 2IALB 4N68A 1C16A 5K9OA 3MV01 4NDMB 5CGYC 3BZFA 5LWYL 3QFDA 3X11B 4PIRF 3SKOA 1KENL 1K8DB 1XGUB 2C4XA 5KS9A 4WFFE 2OX5A 1AO7B 3EYSH 1HH6B 1T21A 3ZDYE 3UC0L 4KJQC 3EJJX 3LEXB 4PJHB 1QSZA 3T09A 1PAMA 5AZ2L 3QH3A 3MBEC 5E1AA 5ITFB 5HYIA 3E3QE 2IADA 2NNAA 5CAYB 1VA9A 2M1KA 1CD1A 3OSKA 3G6JF 4YPJA 3MLVH 4NM8H 4KK6D 2HLFC 4LCYB 5I1KH 4KU1A 3S35X 2X4TB 4OLWH 4MNQA 3QWOA 1MAML 3VWJC 4GLRH 3F7YB 4LP5A 1K4DA 1PG7W 3NCMA 1QFWH 4XPTL 3PGCA 1TPXB 2C5DC 4P57A 4Z7WA 2OR9L 1MJ8H 4QXTB 3RNQA 3IDMB 1BFVH 1T80A 4WW1A 3TT1H 1IBGH 5IQ9B 1FYTA 3RDTC 4S0SD 3P2TA 1OQXA 1RIHH 3SE3A 4M1CC 4XXDA 4YBLC 1MFDH 1RIVH 1S7TB 3MACH 4PJ5B 1AH1A 3QUML 5I75C 3EDDA 2E7BA 1YEFL 2BVQA 4Z0XB 5ISZA 4HEPG 2KQMA 5KSAB 4HKXA 5EOCH 4QY8B 1X4XA 4GXUN 4L4VE 3B83A 2PTTB 3DUUA 1NUNB 3QEHB 3MLZL 2LTQC 2B1HL 5EBLA 1X5GA 1MVUA 4YBQD 4L3EB 3DI2B 2W91A 5D96B 1DL7H 3FQWB 1INDL 4YDKH 4ZFOL 3FQXB 4NCC1 1NKRA 4JY5H 4PLKC 4X8JB 1F11A 3IFLL 4MD0B 1BVKA 2XKNA 4WNQB 3MRJA 4HEME 4WU5A 5B38A 4NO3A 4YXLH 5T1MA 1G9NC 4LVEA 5BCAA 4JFOA 2BDNH 4J3VA 2FEDC 4X7SH 1MCPL 4F7TA 1IC7L 5J06A 2R0WL 2HMID 3C5JA 1FFOB 1U3ZA 4IMLB 1AD9B 5E8DL 4PR5B 1JGLL 1I3GH 1NMCC 2DWDA 2F54E 2QHRH 2Z35B 1FGVL 1NMBH 4OJFH 4HG4K 2GJ6A 4YHZH 3MBXL 4HK3J 5JUEL 4XCYB 2DQJH 2HH0H 5DLMH 1W0VB 2VLKE 1CLZH 3HPLA 3C9NB 5B4MC 3MRIB 1CS6A 1ZVSA 4NQVA 3L3HB 3DX6B 4H1LG 3HE6A 5EC2A 3VG0H 5DRXB 5I17A 4R3SB 1ZLWH 3T1FA 4J3WA 4ZDHB 2XQBL 1B6UA 1HHGB 4YDLB 4CVXB 2B7DT 2E6QA 3N0PB 5GJSH 1G7QA 2CMRH 1LP9A 2X4SB 2PW2A 1HOCA 2AGJH 4LEOA 3S96B 1R0AL 4QOKA 3C60D 1BQLH 4C56E 3WDJA 2WBJB 4MXVE 3NBNA 3AREA 1WAAA 2GKIA 4IMKA 3GSVA 4JDZA 3LEXA 4WY7H 3ULUD 4U6XA 4KROC 3BO8B 4G43B 4WUUE 4KK5D 4J8RB 4LPTA 4AH2A 4PRPD 5SV4A 4XNZB 1KGCD 1QR4A 5EZOL 3QA3B 1RURL 1CE1L 1G9NL 3GMRB 3MODL 5FKAB 1L0YA 3LQMA 1MVFA 4FFZL 3MRDA 2GITB 4PJCE 1KNOB 1IGIL 1DBAL 1QEWA 2FYYB 2ZSWA 4EDWL 1BWWA 3RP1A 4NOFA 4TUJA 4C58B 4JHWL 3UTSE 1MFNA 3FN0H 1FGNL 5CGTA 2MOVA 1Q9KA 3VFMB 5J1AB 4RNRB 5J13B 5D6CA 2NLJA 2QSVA 1HCVA 2PNDA 4DGIH 3QXUA 4PRHA 4DQOL 5C8JA 1F4YL 1AJ7H 4KAQL 3GRWH 2EDKA 2R0WH 4G80A 1HHHB 4P9MH 5B39A 1OAXH 3WJJA 1K5NB 4ODHH 1E4XL 3ISWA 3OKKB 2H2PC 1S3KL 3SKNA 2IG2H 1KB5L 3M8OH 1G9EA 1HINH 4NQEB 4OQTH 2JB5L 3TH2T 5HYQA 5E1HB 4ZAKC 4AT6B 1GZQB 5I66B 1CXIA 4K3GA 2ZOLB 5IFHH 3RWDB 1NANH 2P45B 2HKFH 4IDLA 3UDWA 1NAKH 5HJ3A 1A64A 2GSGA 4KY1H 3TJHC 1SJEA 3OGOE 2CKBL 1ZHBB 3HPLB 32C2A 4KI5E 4IRSD 2DAVA 4W6XB 4XGZB 1JZ5A 4L4VA 5CEYA 1FNLA 4MLSA 4KDTA 1M7DB 4PJ8C 3D0LB 4M61A 5D72H 2MHAB 4IS6A 5DQJA 3AS0A 4IMLA 5IROA 4GMSL 1OPGH 1ND0B 4NQDB 4RFEA 1IC4L 5EBMA 2X9WA 5GS1A 3IAGC 3LMJH 4RBPK 1IEBA 3D3VE 4LCCA 4LLQA 4L8SB 3I6KB 4NQXB 2NXZD 2E8YA 3FQXA 5MERA 3L5XH 5FDWB 1FNEA 1DJSA 4G7YH 3L3KA 2Y6SC 1BFOA 2FIRT 5IM7A 3WXVH 5HD8D 2VQUA 1R3LA 2FWOA 3ARDD 1LO4L 3F8UB 1OP5K 4RGOL 3T3ME 5MEOB 1DFBL 4MA1B 3EOAA 2AJ3A 4I0PC 3VXSA 3BISA 4X6FA 2NTFB 4IRJA 5D72L 2V7NA 1S9KC 2ZKHL 4HKXB 4OCRH 4WV1B 4JO1H 1VSCA 1LK3L 4EN3A 2B8OT 3IFNL 3CFBB 5DGRA 4PJXA 5FB8B 1IL1A 4WDIA 2VOTA 4F7PA 4QRRD 1JYNA 3B5HA 2R1WB 3IXTB 5FUOL 4Z8FH 4ZPTB 2H2PD 1ZSDB 5F1KC 2DS4A 1U36A 4CADB 3DI3B 1U8NA 2AJ3B 3U6RB 4Y8DC 5ANME 4NP4L 5DHYB 5I1CH 4KDWA 5C9JB 4HPYH 1LILA 5EU6D 5ICZA 4LLYB 5JLZA 1R5WA 3G6DH 2UWEE 4ZXBA 1XCQB 1LD9A 3TPKA 3OF6A 1F3JA 5D1QA 1P4IL 5EUOE 3RZCA 1IEAA 5M95B 4HQQH 3TBVB 3RNKB 1SJHA 3CAFA 3GRWL 4IIQB 1F3RB 3GBML 4XNUH 4NGHL 4X9HA 3BI9X 5DJYA 2C1OB 4FFYH 1JYXA 2AVGA 3BWAA 2GJJA 3QEGH 1N3NA 3UJJL 1KYOK 5DTFA 4PPTA 1I1FA 1XGUA 5KS9B 2R2BB 4IS6B 1Y0LB 5I9QB 4JFEE 4EBQL 2G5BA 4K7FB 3RKDD 4P46A 4M48H 1FG2A 5ID1B 5EO0B 1I1RA 2HT4C 1C16B 2CJUH 3BP4B 1P1ZB 2P7TA 3CLFH 5D1XB 5CJXA 3BEVA 4FTVD 2PCPB 2X40A 3GIZL 3IDYB 1LO3L 5JDSB 3G04B 3HC4L 1INEH 4Z7WB 3Q6GH 4UTBH 2C3VA 4U6YA 5B39G 3HLAB 2XWTA 2IANB 1E28A 2FCBA 2FNBA 5TQ2L 4M4RA 3EDKA 1A6AB 2EDYA 4YXKL 3GB7B 4I3GA 2A6DA 2AGJL 3UMTA 5BZDA 2IGFL 2X1QA 2BHUA 4MX7A 2OZ4A 4PRAA 4G8GA 2IEPA 1CGSL 2VITB 4BH7B 4URTB 4XP1L 2R56H 2FDBP 4X4YA 4TN9A 1GOFA 5IJVB 3SDXB 4U7MA 5E7BA 5F7FA 2CR6A 2ICWA 3O4OC 4UUJB 1OAYL 2ZP0T 2RAMA 4QGYA 3QFJA 3TN0C 4LLUB 4UT7L 3B5GA 5CP3A 5AZEH 3RPKA 1R3HB 1KCUL 3W5NA 3RU8L 4QXWA 2D3VA 2BRRL 1TETL 4PRNA 4NGHH 4CW1A 4MVBD 5JW5B 2A38A 4NUJB 3DLQR 4MNGA 1I9IH 3S34L 4ODUA 1LE5A 5JPMA 4NZUL 2CDGA 4LL9A 4HKJA 4O2EB 4LARL 5DSCB 2BOBA 4R26L 5D7JC 5I1CL 4KAQH 5D7SL 5BZWB 3BP7B 4RGNE 4FP8L 3CNKA 1MCDA 3MA7A 5EO1B 4KI5F 4YGAB 1A14L 4BZYA 5DJ2A 3ZHKA 3HR6A 4U3XA 3WHXA 4HIXH 1S5HA 3GSXB 4PTTA 5CEZE 4I3SL 5D7IA 5DVOA 3WL9B 4EI5D 1QO3B 3SGJC 2BVOA 2F5AL 3HNVL 1OTUD 1J8HE 1T7YA 5F8RC 1BJMA 3TA3C 1UA6H 3VDCA 4PGDA 4KTEH 1WAAF 5DD3L 5GISH 4HZAA 4FQIH 5IFJA 1N5AA 5CEZH 4WY7L 4PYGA 3C2AH 2AEWA 1N64H 1JE6A 4F7MB 3QIUC 1FFRA 4UDTA 4AIXA 3OXRA 3VXMA 4L4JA 5ALBL 3QIUA 3VU2A 1EO5A 4PUBL 4NO2B 1GGYA 2H8PB 3I2CL 5DUPH 3VXQA 3GB7A 3O6KL 2DLHA 1Z0MA 5MENB 3BFOA 1S7SA 1GOGA 4Z9KB 1NJ9B 4K3DL 5BXFB 5DS8B 4PRIE 4LF3B 5EWIL 4NJ9L 2VZTA 2DWEA 3IDGA 3NPSB 4YGVA 4PUBH 1QLEH 3PABB 3TYGH 2D7NA 4YC2B 2EDBA 2C4FU 2Q8AL 1XCTA 1HYSC 3ORJA 5TQ0L 1N64L 2HT3C 3V0WH 3EOYG 1QFOA 4O2FA 4G9FE 1DQQB 3SE8H 4Y5YC 4BQBA 2Y06L 1QSVA 3OKLA 1WEJL 3V6FB 2AKRA 4TYUA 4PJDE 4NNXB 3L6FA 1DEEA 1KXVC 3OKNA 4JN2B 4HXAL 3JWOH 2Z31C 5L2KB 2NYYC 4JFHE 2ARJB 4OCWH 3QJHB 5KSUB 5HDBE 4LAQL 3RIAF 3BN9D 1OTTC 2VZOA 1JFQH 1MCIA 3O6FB 4P2RA 4G6MH 4KTDH 5C0AE 4HX1A 3IYLW 1S3KH 4HAGA 3QDME 5ICZB 3VXNA 3QUZD 1YDPB 2UV3A 3V6BR 2K3TA 4LCUA 4JAMB 2I9TB 1A6ZB 1I1AA 2JB6B 3TBYA 4Q6IC 1N0XH 4IJ3B 3B3IA 2I60H 1JRHI 1Z9LA 4QRUA 4QHMA 1QO3A 5GHWH 3C9NA 1WCQA 4V1DE 3ZHDA 3DHJA 4JFXA 2ICCA 1YN7B 3OV6A 2Y9RT 3ZLQC 4NBZB 1ZLSH 3NA9H 5D2NA 3T2PA 3PWLB 4LPUA 3HB3C 5ALCL 3H3PL 4PBVC 4YHYC 5I15L 1FFOA 3QG7L 1FL3A 1QSED 1T5XA 1WBYB 2CSPA 1KPRB 3D85D 3MREA 4U1LA 5C0NC 4JRYE 1CLYL 2HLAB 4KDVA 1RK0A 1AGDA 1OVZA 1MCWM 1OSPL 1OAUH 5HI4D 4TOYL 3U83A 3P73B 4D9LH 4W70A 5CWSB 2IQAB 2XNAA 3ARBD 1TJGL 3RX5A 3FZUD 5E4EB 2ZJSL 3VD4A 5HVHC 2BRQA 1ZAGA 1VKXA 2R0ZL 4GAJL 3TIDA 4Z7WF 2CRYA 4JPIA 3AY4C 1I75A 4NQDA 3P77B 3B43A 3ULUE 1Q1JH 5ICXA 4AL8L 1KLFA 1BD2E 4QXUL 1XGQA 4MJ5B 2PYEE 1HEZB 1KENH 4DGYL 1GOHA 3RY5A 5CZVL 4GKNB 3ARFC 3TO2A 2ATKB 1OT2A 3QCVH 1I9EA 4PS4H 1FBIL 3P30L 3GSQB 5C08E 1C08A 2DTML 4YNYA 4E0RA 3RRQA 4YHPB 3TNNB 3V4UL 1FGVH 2VLJA 2JJSC 3MRQB 1XGPA 1BJ1H 1DCLA 4F8TA 1GZPB 4MNQB 4HUUA 4OCYL 1LK2B 4HWEH 1SJHB 4AT6A 2IQAA 2XY1A 1UWEL 1KT2A 5IF0B 2F54D 1WZ1L 3T77B 4HPOH 4U33A 1I9IL 1Q9LB 3KYOA 4YE4H 1YUHB 2YRZA 4N8PA 4XNMA 1U6AH 3MLTB 2HMIC 1JTOA 3T4YA 1I9JH 4OI8A 4NO0A 4GS7C 4WTWA 4JRYD 2DLTA 3QNZB 5HDBF 1CDHA 1TIUA 4HGWA 4ZUUB 2ICES 4UOW0 4JRXB 2BVQB 4Z0XA 1U91A 3ARGD 1RUML 3RVUD 3IFNH 1OCWH 1AE6H 4L4TA 2BSTA 3BQUB 5HGAB 4NN5C 4N1HB 1OAQL 1J8HB 2DJUA 5ILTH 1F4WH 5GIRB 3B9VA 2GITA 4NFBA 2PO6B 3M45A 4H1LB 4L9LA 1A5FH 1VFOA 3TT1L 3TBYB 5DMKB 2P49B 3FB5B 4Y5VB 3LKNB 1D9KA 3QDMA 2NTSP 1CGTA 4CJ1A 4JZNA 5FYJH 1I7ZA 4RA3A 2XZAH 3D39A 2XN9A 4Z7UF 1FVEB 4XH2A 3UTQA 4C83B 3G5YA 1IAKB 1A6VH 1A7OH 4S1SL 3CLFL 2YN3A 1SBSH 1T22B 1OW0A 3SDYH 3KPSA 3MV8D 4XP9L 3ECBA 1WISA 4JM4L 2YD8A 3WV0A 5ABDE 2FBOJ 3IU4H 4YXHL 4H20L 1MPAH 1ND0A 1KLGA 2XFXA 3BEWB 2FLBT 2GJZB 4F15C 5AYQA 1VGKB 1AP2B 2V2XA 1AO7A 1CICD 2DQDH 2AXHA 3ZE0F 5AZ2H 2E7MA 4L3AA 4OZGE 2PKDA 1T2JA 3CJJA 4E9LA 4XXCC 4LPCA 5HGDA 3JV6A 3U7YH 2ZUXA 4J12A 5TH2A 3BPLC 3BDXA 4OTXH 3RHWK 4JFZH 3ULUH 2VR5A 2V17L 3PNWB 4BZ1L 2Q8BL 1PGRB 4OFKA 3DGGA 3O6FD 3QB7C 4U0RB 4EN3C 5MENA 3SE9H 1JIBA 3K3QA 3L3OA 5LGHH 1QBLH 3P4NA 4LU5L 3JTTA 2YEZA 2DLIA 4JE4B 5BO1H 3GO1H 1ZT1B 4JFDA 2Z92A 2XQYK 2NR6D 4MXVF 4G7VH 2ITDA 1N8ZA 1M05B 3MRPA 5CIPB 3C08H 4Z76A 3QIWC 3NIDF 4MJ6A 3HE7B 1EJ6A 4X7EC 3IETB 3BIKA 3AAZA 3BE1H 2YUZA 2A9ML 3G08B 4YDLC 1YA5A 5KS9E 3CFIC 3FHQA 1HILA 3WJLA 3PWPD 5DFWH 5C08A 3RIAK 5F7UA 1F00I 4CN1A 1NUDA 2DN7A 1DBAH 4EDWH 3BZ4A 2BY0A 3QDGD 4KJWD 2CK2A 1GYAA 2Q3AA 3MXVL 4S10A 3MRHA 3FQUA 4DZBB 1UZ8B 1MJJB 1UXWB 4ZOBA 5HY9B 1NBVL 1XGRA 2ADGB 3DHMA 4JO3L 1JPTL 5EUOB 3MCLL 4YHML 5E9DD 1H3GA 1AD0A 1QLRB 2AEQL 3U1SH 1EFQA 5E8PB 12E8H 1D5XB 4DVBB 3GRWA 2WANA 3GSNA 4S0TD 4E41E 7FABL 3DMMC 3RDTA 2WK2A 1I3RB 1IQWH 1IZJA 4HULB 2AJSL 2OSLA 4ONFL 4UNUA 3T0EC 4NC1C 4W4OA 3R8BB 2BVEA 1AE6L 4LLUA 4OLZL 4WHDA 4X6CF 3W2DL 1RVFH 4Z5RB 1N0LA 3FONB 3H7LA 3HZVA 3JV5A 4BSVB 1LDPL 4NKDB 2VZSA 4QHLB 5TDPB 3CFJB 3V6OE 5DD5L 5GRVK 1S7VB 1CXLA 1C08B 4YNYB 3FB6B 3SDCA 1I9JL 1KPVB 2HJKB 2MQ0A 5K9QI 3HRZB 3KPSB 3VWKD 4PRAB 1UQSB 4OF7A 4U1JB 5JTWA 1LP9B 1TCRA 5D1ZC 3MOBH 3WFHA 3QUYA 3D9AH 1KT2B 5K59E 1MJUL 3QR2A 4NQSB 4GRLC 3KPOA 5A2IH 5I1HH 4QTHA 1G1CA 4S1DC 1MCPH 2IPTL 2UUDK 4WEUD 1RJYA 1YEIH 2DI7A 3ZTJH 4Z6AT 3LQZA 3DBXB 4U7KA 2HAZA 4DGIL 5HHOD 3UYRH 4GQ9H 4NM4L 1BVLB 2XRAH 1R6VA 3BH8A 2VH5L 4KXZI 4PJDF 5BS0D 2JLLA 1WVZA 3NAAL 1BBJB 2I5YL 4LGRB 2BY1A 2KH2B 3HG1D 1FO0L 1OAZH 2M8XA 1P6FA 2X9XA 3QIBC 4TUKL 3K2UH 5JIIA 1BX2A 5FYKD 3O2WH 3VH8G 1MEXL 3TO4B 2F19L 4UBDC 4XMPL 5GS2D 2C1OA 2VLMD 2EDLA 5J0BA 3BKMH 1MQKL 2Y07L 1A9BB 4ONHB 1ZLUK 3T0EB 4BSVA 4UOJA 3PWLA 1MCHA 4HS6B 4JJ5B 3PV6B 3UPRA 1B4JH 2EDRA 5LVEA 2XXMB 1RUPH 4GRMA 4YWGH 2H32B 4IOFD 2J7LA 1BQLL 3C6LA 1FYTD 5CSZB 3FQWA 4TOYH 2ADIA 4AMKL 5KTEH 4CMMA 1AGBA 1S7QA 2P8PA 3MV7D 3O2DL 1W72A 1S7WB 4BA8A 1FDLH 4BFIA 4P3CL 4GW4A 1H5BC 4MJIB 3IF1A 4N0CD