2DIAA

Solution structure of the 10th filamin domain from human filamin-b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
GSSGSSGPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 10th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2diaA01
4TVPE 1JPSL 1NCDL 1A7NL 3RPIB 4MXVE 3SDXE 1G6RH 1VESA 1A9BB 4IOIA 1PY9A 2FEEL 1F6LL 1DQTA 2VL5A 4HW6A 3OR6B 1MVUB 4O02L 4O2EB 4QXGH 3P9LA 4YR6A 3FZUC 5SWZE 3T09A 1GGUA 3H0TB 2G2RB 1PYWB 4I13B 1XGYH 1KULA 4OF5A 4L8SA 4NGHH 4XNQA 2V2XB 2XZQH 4JPVL 4LIQH 1OWRM 4LVOC 1HHHA 4HS6A 3ZDXF 5TE7L 4D0BB 1KCKA 3WNOA 1MFBL 4ZYKB 4R4FH 4Z7UB 5CD3A 2FCBA 4EEEA 2BRRH 4GQ9H 2HJLB 2Z92B 5I17B 4QHKI 4WWID 2DLFL 4AEHH 4ZSOB 5E8NA 2DJSA 3PV6A 5F1OB 4JKLA 5E2VH 5D4QA 5DQDH 2B1AL 1P1ZA 4OLXL 3OR7A 4I1NB 4PJ8D 5IKCA 4LEOB 4HFWA 3ZSSA 3DETC 4O51B 1I1RA 3F58H 3DETD 2AK1L 3HRZA 4YIQB 3U30C 3EOTL 3WKNA 4HWEH 3NZ8A 3LN5B 1NH6A 1GZQA 1MSPA 2DQIH 4R8WH 4EIZC 4LNVA 1KEMH 4NQDE 4DKAA 2VLLA 1ZVHA 2C3XA 6FABH 4BA8A 5JXED 5C0DB 5J12B 4ZXBA 1FDLH 4GRWE 1Q0XL 3LZFH 2BZDA 4Y5YB 4RMTA 3MJ7B 1S8DA 5B39A 5ESVB 1QRNA 3ZE1F 3PHQB 2XWJB 4U6VL 1RMFH 2H32H 5F44A 4LCWD 5DZNA 3PL6C 4ALAH 3HZKB 3I6LD 4K8RC 4N90D 3D3VD 3PL6D 1FJ1B 5DD6B 1FIGH 1FZKA 4K8RD 4G5ZL 4ODWB 3MRGA 4GRMB 4XP9H 4MA7L 2MNUA 2GK2A 4Z7VE 2IAMC 3KYMA 4N8PA 3SPVA 2BJML 2IAMD 2PETA 3HC4H 4PIRF 1C8PA 1A0QL 1UYWL 1XZ0B 5HYJB 1MCHA 2HRPH 1K4DB 1XCTB 1J0IA 5GSVB 3CUPB 4AENA 2R69H 3GDBA 5J1AA 1KB9K 1U3HA 2AVGA 4FQXA 4E41E 4WV1B 5HYQA 5A2FA 1GIGH 1CF8L 2GITA 2B1HH 3BPNB 5D71L 5DVKA 1J1XL 3RY5A 3L3JB 3MJGX 3UTQB 5I19H 4JHAL 2JJSA 1FAIL 2L7JA 2NY1B 1Q9OA 1EERB 1R5IB 2F5AH 3HR5B 4UIKH 3VG0L 1EV2E 1JV5A 5D72H 3B5HA 4MAUH 4LLQA 1Z0MA 4LASH 2AGJH 4L4JA 3T1FA 4N0FA 3TPUA 3GMLA 3I84A 5DVNA 1MRDH 4R0LC 1F4HA 4JN1L 4K3JH 4B41A 1YNLH 4NWUH 3GMMA 4I77H 1AP2B 1YDPA 2HLAA 3QUXA 1FHGA 3C2SA 4C83B 1A6PA 1ZHBB 4TTDC 4KGJA 3VFUA 1AGEB 2E6QA 3KYOB 5GISH 3CFKA 2AERT 2J5LC 4NO0A 1ZLWH 2DYPD 3QUKB 4Q0XH 1P5UA 3KXFA 1MOEA 3VRLE 3L3IB 5ITBH 2X05A 3IFNL 3S34H 1D5MB 3PQYD 3Q3GB 4YHLH 1MCOH 4LSRL 4PJBB 1BQLH 1VFBB 1D9KB 1FNLA 4D0CA 5E5MB 3MFGB 1S7XA 1JGDB 1NCBL 5AUMB 1RURL 1YZZA 1T5WA 3FOLA 3U1SL 2BNRA 1FGNH 5DJDB 5GQBA 1A7PH 1QBBA 5JNYB 4R7NA 4MAYB 1J9CT 3IXTA 4YXLH 3LEVL 1XIWB 3BRGC 1F3DJ 1MUJA 1NAKH 4DWHA 6CGTA 1T1WB 3MJ6A 4OGXH 1CU4L 4LKCA 1G9EA 4I3GA 1P7QA 4NO5B 5GS2H 5JQHC 5CCKH 3GSRB 2P5WE 2P7TA 4OZ4A 4GAJH 4U6HA 4NQCB 4K9EC 3TNMA 5KSVB 2QQNH 3ROOA 5C0GB 7CGTA 3QBTB 3VH8G 5K33A 4HIHA 2P1YA 4F8QA 4ELKB 3RVVD 1ZHLA 3RI5K 1ZVSA 1DVFC 5HJ3B 1ORSB 5GIRB 1QBAA 4M62L 5FYJH 5IMLA 1DVFD 3WN5B 4PJFA 5JORB 1KYOK 5IF0A 1G7PA 1MY7A 3K4AA 4KUCF 5CEYB 2YXFA 4G80B 3KPLB 1IE5A 1F3DH 1BFTA 1HN1A 2UWEF 1Q8MA 2VLKE 3E6HB 5HYSB 5JIIA 4JRWA 4Y4KC 3JTSA 3TVMC 1BEYH 4OF0A 1JI1A 4MNGA 4Y4KD 2IANE 4HXAH 1UM5L 1I75A 1AY1L 1KPUA 2MHAA 1SJEB 5D1QC 3QEHB 5BV7H 3BXNA 3L3DB 5D1QD 1UB6B 5MI0B 2MOVA 4HMDA 3CFDA 2BFVH 5CZKA 4ERSL 2XTJE 3MLPA 1S9XB 3FB8A 4PGDB 2X6MA 5LAXB 2YPKA 4RGNB 5TJWK 3D18B 3TIDB 5GS1C 3SKOB 1UEYA 1T0MA 1KNOA 4JDVB 5IJVB 4JFXB 2OL3A 2BDNH 4E42A 4C56D 2CDGA 1M7DA 2BC4B 1MFEH 2Q76B 3HLAA 1EH9A 5IP4A 3IDXL 1INEH 2CO7B 1UZ8A 3WUWG 3VXNA 1YQVH 3OKMA 3U0WH 4OF7A 5IMOA 1S7VB 4H20H 4BSWB 1JPSH 4R7DB 3QEUA 4ONFL 5E2WL 1A7NH 4NHCL 1FLRL 3ORJA 2VABB 1LVEA 3AMLA 2AXFA 2WBJA 2Z91B 4WUKL 2V5SA 2FO1A 4F2MA 4CDGC 4LRIA 5DJAB 4WHCA 4GW5B 3X3FL 3MRPA 1LO0L 1GGIL 3DVNA 3JXAA 3PHSA 4O02H 1WC7A 2Z35B 4PJ8B 1XR9B 4QGYA 2DWEB 5DQ9B 4HUVB 3T0XA 5I8EB 3JWDH 3DBXB 2Y7QA 4NQXB 4QCIA 1EUUA 1JF5A 1JGLL 2VXQL 5E8EB 2BCKB 4JPVH 3L3KA 4F9PC 1D3CA 4QRTB 1P9MC 3JTTA 3MLTA 3U30B 5E9DD 1MFBH 5HHMD 3DVIA 3JV0A 5C2BL 1OP3H 3RDTC 3LDBC 1GOHA 1OAUH 4UILL 3RDTD 1EZVX 5C9JB 4ZS6C 2WAHA 2X4SB 1MWAL 3R8QA 3IDGA 2J6EA 3SKJL 3HRPA 3MACL 4W70A 4WU7B 4ZS6D 3B6SB 3VXTA 5BCAA 3BP4B 5FIEA 4P2QD 1A6WL 2RCSH 4F33A 4ZFFB 5IB1A 3UZQA 2PUQT 2OCFD 4Q9CA 3EYOA 3FRUA 2JCCF 1BD2D 2GI7A 2YMXH 5BMFL 1LK3L 4LCWB 1CD9B 1WBXB 5HHXL 3EOTH 1KCUL 3L5HA 4ZQKA 2Q7NA 2ADIA 3D3VB 1BF8A 3QWRD 2FECL 1F6AA 1UB5A 4G9DA 4OI9A 3KYNA 2AKRA 3L5IA 5DMGD 4QOKE 3P4MB 3U79A 4BZYA 2D9QB 3ARQA 5DXWA 3BEWB 1BBJB 1XF4B 3BPCB 1Q0XH 2GFBA 1I8IB 3F6IA 4N8VA 2IAMB 5CGYC 3IDNA 2YOCA 1I7RA 2AQ3A 4ORGA 3QZWB 4JHZA 5D2LF 4X6DA 3SDAA 5CGYD 2BX5A 2ICWB 4PGCA 4U6VH 3F7PC 2GSGA 3RWFA 3FFCD 5EO1A 4UV7L 5GS0C 2MQCA 3STZB 5DMYA 3VE0B 5FO7A 3WDHA 1S7RB 5F96H 4JRXD 5DK0B 1F6FB 1RZ7L 3CDGA 4MA7H 4PRNB 2ZNXA 4GFTB 5E00A 3X12B 4I5BB 1KJ2B 3KAAA 1R24A 2VAAB 4V1DB 5L2KD 2BJMH 2RFXA 4G43A 4LLVA 1YYML 4DK3A 5ISZA 4QRRE 3IJHA 3K74B 1UYWH 1CGWA 1J8HD 3H2WA 3Q6FB 1DQDL 3MREA 3WO3B 4GUPA 4PBXA 5FUZH 5L9DH 2MPAH 4ODUB 1RZFL 2PO6A 4R0LB 1IM3B 5IGXL 1U8PA 2ZUXA 3ARTA 4EVNA 3PWPA 2WWMC 3QUZA 1CD0A 5GSRA 1R5WA 3SGKA 4PPTA 5DFVC 1Z0NA 3TP4A 3ZL4L 2WWMD 1JYXA 5D71H 5FYLD 3VXOA 1J1XH 5BZDA 1W0YT 3VXQB 2HTKC 4FQJL 4JHAH 3SKNA 2XKNB 3IJSB 3P4NB 1EAPA 2DYPB 4JFEE 5SWQA 3U7YL 2AXJA 5ERWA 3NACL 4L8DB 3ES6A 3VG0H 3L9RB 3ECBB 3LHPH 3HCVA 3P40A 1Z9LA 1HNGA 5BO1L 1JHLL 3RWEB 4NKOA 1A4KA 1CXFA 4XXCA 1SEBB 2BVPA 3HPLB 1D6VH 4NPYB 4Y16C 3VFMA 3PQYB 3MNVA 3HNSL 4KMTL 1UH4A 5IMKB 4P5MA 3EHBC 3GIVA 4Y16D 4JN1H 2CO6B 4BJLA 4YPGA 1LHZA 5TE4L 4FXLA 3EHBD 1BJMA 4IRJC 1QVOA 2F54E 2FH8A 5T5NF 4U0RB 2R2EA 1MFCH 2D3VA 3P73A 4IRJD 4X6CB 3O4LA 2PYEE 5CWSB 5DC0A 3UTPD 4CVWA 4ODXA 2C3GA 3GZKA 1EPFA 3HUJF 2ITCB 1Q94A 5C0JB 4PLJC 1R5VB 2CKBL 3SHSA 4KJPC 4PLJD 4Y4HA 3P9MA 2DDQL 4GMTH 4HUWB 3CK0L 2B8OT 4WW1B 1MLCB 4YDIL 2OJEB 5EZLA 1BFSA 1R3LA 2CR3A 4PJCF 5HGGS 3NAAL 4LSRH 4AEEA 1EO8H 1C16A 1HKLH 5MERA 4PJ5A 5EU3B 1NCBH 1RURH 2AEQH 1XF2A 3MUGB 3BX7C 4JAMA 3BWAA 2Q20A 5ENWB 1LEKA 3W2DH 4BZ2H 1DP0A 4JVPA 3U1SH 4KDWA 3DUSB 2XYCA 3HI5H 3IS0X 2J2ZA 1MI5A 4G6MH 4HKJB 4LPXA 1G7QB 3HE6A 4NRXA 1A5FL 4Q6YA 4XGZB 5DRWB 1DVFB 1YJDH 3BO8A 5HHOA 1WT5C 5E08L 5LG1A 1CU4H 3DVFA 3FO2B 5KSUA 1U41A 3R06A 4LLUB 1BX2A 1KENL 3DX7B 2I24N 5B8CC 4PJ9C 2X10A 2UZIL 4W4OA 4Y4KB 5L2JB 1F11A 1DQJB 5D5MF 4PJ9D 4MSWB 4QY8B 5C6WH 4UIMA 3G6JE 3AY4A 4NP4L 5D1QB 4PJIF 1BOGB 4Y19D 1WF5A 2D7PA 1IEBB 2HAZA 3MV8A 3KPSA 3OB8A 1QNZH 1WIPA 4G8IB 3EDFA 1U3JA 1T89A 4OZHF 1EXUB 4RAVA 4M62H 3F7RA 4BK4A 1G7JA 4KTEL 4NHUB 5MENA 1NAMH 1NSNL 2BY3A 4JFHD 1KV3A 3B9VA 3NN8B 1K3IA 4C56B 2KQMA 1RZGA 5IK3B 5ALBL 3QDMD 1T1ZB 1J7VR 2H6PB 4F7TA 3FQUA 3ZKXC 1HHIA 4ERSH 5CJOL 3GSVB 4D8PA 4YHIB 2FGZA 4WUUE 5HPMA 4WI2A 4LCIL 3K7UA 1BWWA 4FQ1L 4U1GB 4PBVC 4RMVA 4KZEL 3U7WL 2VN7A 3WUZA 4CVZB 5I1GL 3RQ3A 1J87A 1UA6L 2FD6L 3MRLA 5FUCE 2J8UF 1KLUA 2AP2A 1IKFH 1ND0A 1A6AA 5HHVL 3CX5K 4GRLC 5C0BB 2B7DT 4X7FC 3S4SG 3ZKND 1MREH 4GRLD 1T7YA 4G6JH 1EHLL 1WJ3A 3LS4L 3EZJB 3IDXH 2C9AA 4OZIB 3QCTL 3V4PH 3C9NA 4X8JB 1JGUL 2EDKA 3T4AB 2APBA 5E9DB 4XP1H 3DX8A 5HHMB 3I6GA 4ONFH 3O3DB 4BSVB 2AABH 1QLRA 2JF1A 3C6LC 4WUKH 1BPVA 2COQA 3AU1A 3QIUC 3LDBB 3LPWA 2EIZB 4R4BB 3RDTB 5K9KB 4Z8FH 3RPIA 3QYCA 3C6LD 3IFOA 4NKDB 3RZCC 3QIUD 4KTDL 4PJGF 3X3FH 4N0UA 3REWB 1CDBA 1GGIH 3RZCD 4JGJA 3WJJC 1SMAA 1UCBL 3UPCA 4AIXA 3OR6A 4AZ8A 4C4KT 4YHOL 4UTBL 3UJIL 1BD2B 1YECL 3VJ6B 5TE6L 1GC1L 1N26A 4TRPL 1ROWA 4XB7A 4LU5L 5KSBB 1U8NB 4Z7WF 5C2BH 2OZ4L 4PJHF 2X89A 1RFDH 2FATH 1AGFB 4D0BA 3RIFK 4QF1B 4UILH 2AV1A 1UXSB 2I5YL 1MWAH 2X44D 4EBQL 5C0EB 3SKJH 3MACH 4KUZL 2ARJB 2HJLA 2N1KA 3BUYA 2DLEA 5HPOA 4XX1G 4MWFB 3I50H 5IVXF 4QHMA 4G8EB 2CRZA 3GRWL 4O51A 4GXUM 2D0GA 3FFCB 5JW5B 5BMFH 1IGJB 1LK3H 2Y36L 3DROA 5HHXH 1KCUH 2Z31A 1X4YA 4HWUA 1VENA 2XWBA 4U2YA 4NZUL 1W72B 5F7KC 2JB6B 5GS3A 4B7LA 4M1GL 3PNWB 4TUOB 5J1TC 3OAZK 3IRPX 4F7PB 4TVPL 2FWOB 3OKNB 2RJMA 4X4YB 4OCXL 5L2KB 4JQXC 1JGVL 1IGTA 1X5FA 1ZANL 4UINH 2CDFB 1KTDB 4X4XB 5AG8A 4Y5YA 1NDMB 1J8HB 1YA5A 1PY4A 4PJXE 1MQ8A 4JZNB 5M7QA 1PX4A 3VMNA 4M8QB 3QT2A 4H88L 3HZMB 1T04B 5I1CH 3V95A 2ZSVB 3CLEL 3HZKA 1I9EA 5HDOA 1FJ1A 2SEBA 4I3SL 4GRMA 3RUGE 3VXUE 1EBPA 1GOGA 5DVMA 4JO2H 2A73B 5JHDE 3N1QC 2Z8SA 5T1DL 4MXQD 4RRPA 3LQZA 4S2SB 5IW3A 1VFAB 3PGFL 4MXVF 3GSNB 1UXWA 3B9EA 1CE1H 5AZEL 3THML 2EE3A 1DQDH 2VXSL 4RZCB 4JFOB 1XZ0A 4Y16B 1T2XA 2CD0A 1FL6A 1K4DA 2F58L 4PJ7E 5GSVA 3EYFB 3LKRA 3CUPA 3C6SB 3LKOB 4AEFA 2DB8A 2HP4A 4H5SA 2P49B 1X3DA 1Q1JL 2R56L 4IRJB 4LCCC 3ZL4H 1YMHB 4LBEA 1HIML 2X7LB 3IF1B 5DMJB 2I27N 3MROA 1XGTA 1W2KT 1KGCD 1RZKC 1S5HB 1F00I 1W0VB 3U7YH 3L3JA 3UTQA 4Y4FA 4D9QD 3ARFC 4ETQB 2EC9U 4FG6C 4N0CC 3G5VB 3HR5A 3FT4B 3IXAB 3GGWB 1OM3L 5E4EC 3HNSH 4KMTH 2QSTA 3LV3A 1Z5LA 4XMPL 2X4OB 2YBRB 5TE4H 4JFFD 2B5IC 1LO2L 2EO1A 5DT1L 4LVNC 4N68A 4HMEA 1YPZA 1BQHG 1AP2A 1EFXD 1P4LB 4C83A 2MCPL 4MA1C 4TUKL 5CUSL 4R9HA 1Y0LB 2CKBH 1AGEA 2HLFD 3KYOA 1SM3L 2DDQH 4YUEH 3CK0H 1TJGH 1J0HA 3DX9B 2X5PA 4YDIH 3ARBD 1FYHB 3L3IA 3ZTNL 4E9LA 3MYJA 2AQ1A 4RQQA 3NAAH 2GJ6D 1OT1A 5T33H 1D5MA 5K93A 4GRWF 43C9A 4X5WB 5J57B 5HYEA 1VFBA 5IVOA 5B8CB 4PJ9B 5E5MA 4ZOEA 1NJ9B 2X4PB 2OTPA 1A47A 3MBXL 4OJFL 5AUMA 5D6CA 2AJ3A 4YWGL 4Y19B 5FB8B 2QADC 5FGBA 4JN2B 3E8UL 5MHSD 2QADD 1A5FH 4XNUL 4ZUTB 4MAYA 2VSDA 2DAVA 4FFZH 1XIWA 5BRZA 3LN4A 1T1YB 1XF3B 2BNQD 1N6VA 2FIKA 4G6FD 3VGAC 4ETYA 3SDCC 3HKFA 5J0BA 2E9IA 4X6EA 1V3JA 4XT1C 4JKWA 4HH9B 3W5NA 5K9QG 3SDCD 3WEXA 2M26A 4Y5XA 2GJZB 1RD6A 3QDMB 1FYTE 2CLVA 3N50A 1I9JL 4LDEB 4NP4H 4BH8A 1YEEH 1C5BH 5C0GA 3ZKXB 3ILQC 4HG4K 1EAJA 2XY1A 2ZCLL 2UZXB 3QUML 9CGTA 4BFGA 5IMMB 4NZRL 4PJAE 4ELKA 1UFUA 5MEOB 1DDHB 3ET9F 4JRYB 5D2NC 3RL2B 1ORSA 2A6KB 5GIRA 3B8SA 4D94A 3DVGA 5IFJB 2ZUVA 2P43B 1OWWA 4TUJB 1O7VA 2WIIB 3DXAA 2Q86B 4G80A 5EIQA 1AGDA 3KPLA 5T5NG 5J7CC 4IMKC 1P53A 3E6HA 5KBNC 5ALBH 4J1UB 3QH3A 4JZJC 1A6ZB 2QQKL 2X1WL 4YHNA 4X7SL 4M4RA 5FFLA 3ZE0F 3QEHA 1FORL 4KI5E 3L3DA 5A2IH 1UB6A 2W60B 3DX6B 4EI5C 5C0IA 4LCIH 4FQ1H 4OBRA 4KZEH 5F7FA 3C6LB 3U7WH 4EI5D 4HS8L 4PGDA 3QIUB 5LAXA 3P0GB 1UA6H 2FD6H 3RZCB 3TIDA 3VXMA 5C0NC 1G6RA 3V7AE 1H3VA 4J3OC 5C0ND 4JFXA 5HHVH 4G8GE 3V6FB 1TTGA 4K94C 3VRLF 5I71C 2ORBL 4NIKB 3UTTE 1H0DA 1EHLH 3LS4H 4DK6A 5JOPE 3TJHC 5DI8B 3QCTH 4NRZB 3TJHD 1JGUH 3ZYIA 4F37F 2C3VB 2VXUH 5GGRB 3OJDB 3D39A 2BY2A 3G6AB 5FCUL 1S7VA 2NYYC 4OIIL 4PRAA 4R7DA 1JF6A 4K7PH 4GT7A 2NYYD 2VABA 2FEDC 1BQHB 2Z91A 5GZNC 4KTDH 3X13B 4FA8A 4XAKD 4KJYB 2FEDD 4U3XA 2EO9A 5GZND 2KDGA 3H7BB 1UCBH 1A7QH 1I1YA 4YHOH 3U82B 2Z35A 4UTBH 1YECH 4PJ8A 4Y89A 3QXAB 5TE6H 1NBYB 4ZUUA 1GC1H 5DQ9A 4HUVA 3LSOB 4IDJH 2JK5A 4LU5H 4NQXA 3FQTB 3R0NA 5E8EA 2BCKA 1S7WA 4QRTA 5E8PB 2K7QA 1IVLA 3TFKC 4GKOA 1ZT1A 4HWBH 3DNKA 5FOBB 3TFKD 2I5YH 4P49A 1F4WL 5C09E 5C9JA 1N2RA 5JXEA 4PRPE 1ZLSL 3B6SA 4IJ3C 2IALB 4AL8H 5IW6B 1P84K 1PKOA 1TENA 2CUHA 3GRWH 2ZNWA 5FYKU 2Y36H 4H1LB 3G6DL 4HULB 1U8OA 3C09C 3MA9H 3UROR 4LCWA 4NZUH 4JM2A 2XPGA 1U6AL 3D3VA 2GJJA 4M1GH 3UAJC 3QAZC 2H8PB 1LK2B 1AI1L 2VLME 5L7XL 4TVPH 5DMIL 1VADB 3P4MA 1MAKA 3L6FA 4GLRI 4U6TA 3JUZA 1JGVH 4MA3A 1BBJA 4RBPH 1ZANH 2AK4A 1XF4A 4JY4B 1WAAE 4JPWH 3RL1A 2FNBA 3BESR 5H94B 2BK8A 2ICWA 5ACMA 3FT3A 2G75A 3DGGA 1DEEB 1X6NA 3VE0A 2WNGA 5MEQB 1A1NA 4LCCB 4I3SH 1L9NA 3VGGA 5HI5C 4HT1L 2H2SC 5FCSH 4IOSD 1CYGA 5T1DH 5HI5D 2F8XC 4PREB 1B0GB 1ZWIB 3O2VL 3X12A 3CSYA 4LF3B 1V8HA 2VAAA 4V1DA 3EYVB 4OCRH 5AZEH 3THMH 2V7NA 1LDSA 2VXSH 4HIXL 4KV5E 1N8ZB 1Z9MA 3Q6FA 1IJ9A 1Q72L 4X9BA 1JZ7A 4TTGA 5E4EB 4JFFB 3BEVB 1ZE3C 1FBIL 2HKFL 4IDLA 1D6EB 4WHDA 4ODUA 4QRSB 2B5IB 4R0LA 1Q1JH 2HT2D 2EDFA 4LVNB 1U0QA 4NN5C 3WIIL 4HJGB 2HH0H 4P0DA 1EFXB 1HIMH 5CJ8A 5E6YA 5GS0L 3RVXC 1GSMA 3MLRL 2EH7L 2C4FT 3WKML 2KZWA 4UV4L 4YC2B 3RVXD 4MA1B 3WUWA 4L8CA 5A16B 1CDGA 1KPRB 3P4NA 3S98A 3NCBB 5DRNB 2YD8A 5D1ZC 2ZUTA 3GUTB 3ARBB 5IHBA 1GXEA 2I9LB 3QO1A 1OM3H 4DW2H 3RWEA 5D1ZD 5J8OA 5J11C 4JFDE 1SEBA 2GJ6B 4XMPH 1F3JB 5IMKA 3VGEA 4M7LL 2PW1B 2NY4C 1X7QA 5IFAL 2NY4D 1NCAL 2R23B 3K8KA 3BVNA 3BPOB 4X6CA 4TVSa 5HVFB 2MCPH 5CUSH 4B50A 5CWSA 4UNUA 3BKCL 2CMRL 4Y1AE 1BREA 2ITCA 5C0JA 3J8F7 2QADB 3EO1B 3FB7A 5ITFB 1R5VA 3TBYB 1NDGA 4DGVL 3VI4E 4HUWA 2YUVA 4KRPC 3ZTNH 2DMCA 2XQYK 3EDKA 2P46B 4KRPD 4UT6H 2BNQB 2HVKB 4G6FB 2VLJE 1F8TL 3ULSA 2HG5B 3VGAB 3SDCB 2A38A 1VFMA 2VLRD 5KW9L 1ONQB 3BYYA 2DQFB 5EU3A 5E5RB 3MBXH 4OJFH 3OHXB 4HEME 5HXMA 5CHNB 4YWGH 4PRHA 4LQFH 1AHWB 5CEXA 5JIPA 3WNPA 3BDXA 2FJHB 3E8UH 1P7KB 3RGVA 1J1PL 3MNWB 3MODL 1G7QA 3EOYG 3NIGE 4XNUH 5HGAA 5IB4B 2NY3C 2ADFL 3WFDL 4WEMB 2NY3D 2OR8A 4LLMB 5D2NB 2NNAA 3F5WB 1RK1B 4CDHA 4DCQB 4NKIL 4ZPTB 5I6XC 4EXPX 1JIBA 2UVFA 2XN9D 4LLUA 3H3PH 1VEOA 3VGDA 5F1NB 5JZ7C 1I1AC 1I9JH 4QXUL 3LKNA 2R0ZL 2YN5A 5JZ7D 2BERA 4ONGL 3KPRD 1C5DB 1VPOH 4FS0A 4K71C 3O0RL 5C92A 1IEBA 3ULUE 4R26L 4EI5B 4B5EA 2FSEB 4NQSA 4G8IA 2BVTA 1BJ1J 4PJGB 1SBBA 1EXUA 3O11B 3BD4A 2PTTB 5IIEA 4H0IA 1DZBA 3U46A 3VFPB 1T2QH 4C56A 2Z8RA 1PJ9A 2LAAA 2EDDA 2QQKH 2YK1H 3G5XA 3NFNB 4X7SH 4DVRL 4ZTOL 3BSZL 4S1RL 5C70A 1OAZL 5ELIA 3D85D 4AY0A 4LLWB 4XC1H 5TF1L 1N4XL 1PX3A 1JP5A 3LEXB 4U1HB 3LN9A 2Z8WC 3E2HC 2Y6SC 3ULUC 3GSVA 5GRZA 3VFSB 1MHEA 1HE7A 1RUMH 4HS8H 2Y6SD 5ESQB 1FN4A 2I25N 2J4WH 1MHHA 1E0OB 5DTFB 4CVZA 3VXRE 3OKEA 3BZDA 4X4ME 3DIFA 1BJ1H 3VFTA 1HYSC 3JWOL 3MGTA 4OLWH 3RX8A 1N5YL 5C0BA 5KVEH 1KXTB 3PV7A 1PZ5A 3GSQB 4MQTB 4Y2DD 5E95B 4PG9B 1HH6B 1JNLL 2W0FA 3WJLC 1MJ8L 1I7ZB 3U2SB 3ULVE 3CZJA 2ZCHL 5FCUH 4WTWA 2WMPA 1A7BA 4OIIH 1RZIB 1ZS8A 4WFGD 5E9DA 3O3DA 3QG7L 4BSVA 3DUUB 4N9OB 3W9EA 2A9NL 1WITA 2EDRA 2MWCA 2EIZA 4MZ3A 2VAJA 5K9QI 4NKDA 2V6HA 1QEWA 4P46D 4MA8H 4N5UA 1GVIA 4QRUA 3L95B 4LHQB 3QDGD 4LSQH 4IJ3B 3VFVA 1U95B 3MBEC 4JG0H 5CFHA 5JQ6H 5F7WC 1AQDA 1XF1A 3MBED 2RHEA 3VJ6A 1MCRA 5JW4R 1VEMA 4ZFZB 2C7UB 4L3ED 4PRDB 4YEEA 5FM5O 1CDYA 1D5BB 1U8NA 1GGBH 1URLA 3EO0B 4DZ8B 1VGKA 1YUHB 3B9AA 2AXGB 3QEGL 2XQBL 4OLYL 1F4WH 3OB0H 1Q9LA 3G6JF 1BVLB 1PFCA 1UXSA 3RWHB 4WWKC 3U9UA 3S9DB 4F57L 3KS0J 4LMQE 1JPFA 4LLAA 1ZLSH 2ARJA 4WWKD 5F8RC 3EDJA 3LRSB 1UENA 4MWFA 4P23C 5KVDL 3V4UL 4P4RB 3DHMA 4G8EA 3G5ZB 1ORQB 1RY7B 3G6DH 3FFCA 3IFPB 5JW4N 5L8LB 1U6AH 1ETZB 1DUYB 4LSTL 2Y5TA 1XGQB 1AI1H 4V2BA 1U42A 5L7XH 2GY5A 3WNKA 2NMSA 4F7PA 2VZTA 3OKNA 3VWJA 3WMSA 4X4YA 3B3IB 3CNKA 3WL9A 3B9DA 2CDFA 4CJ0A 3KS0H 1V05A 2AEPL 4M43H 4Q7DA 5D7JC 5TDNA 4OGAD 2X4RA 2CJUL 2C4XA 4XNXH 2C1OB 4LCYB 4S1DC 5C0AE 4M8QA 2MFNA 3HZMA 3IFLL 1ZLVK 1T04A 5FOJA 3KHOA 1UWEH 2ZSVA 2QLVB 2GEEA 4P59H 4KQ3L 4NN5B 4PV8B 1FZMB 3CLFH 4YAQB 3OV6A 5E1HB 4HT1H 1BIHA 1T6WA 3QDAA 4HZLA 5F3HB 4JQVA 3IGAA 2A73A 3O2VH 3U4EB 1DQQB 1HWGB 2D7NA 4UNVA 3UCRA 4GQPH 2XIDA 1WFOA 4HBCH 5CP3H 3OL2A 1Q72H 1NMCB 4RZCA 5JO5B 2A9ML 4JFOA 1FBIH 2HKFH 5EOTB 3HG1B 1B6DA 4DZBB 4Z9KB 2VWEE 4QEGA 3WIIH 1MCIA 3LKOA 2AJZA 4K2UH 2NY4B 3S4SA 5GS0H 3MLRH 4BH7B 1XEDA 3WKMH 1YMMD 3AS3A 4UV4H 2R39A 5BQ7A 2X7LA 1AFVL 4LSSL 4ENEC 5EUOE 5I30L 4U4BA 4I2XA 4LSUL 1W0VA 4RX4A 4ENED 4JANB 3AREC 3G5VA 4H8WC 4S1SL 3IXAA 4KRPB 3ARED 3FTGB 3TN0D 3VXSD 5KG9A 5L6YH 2XA8L 4RMUA 1FCGA 4M7LH 1BAFL 32C2B 2VITA 4MJID 4R97B 2VLRB 1UWGH 3D0VA 5T3ZE 1ZGLM 1OLLA 5IFAH 4XCFL 1TQCC 3JZ7A 1NCAH 1LP9F 1T1XB 4L9LA 2V5MA 3EO9L 1JCKA 5FYLH 3FONB 2CMRH 8FABB 1LEGB 1IAOA 4OD1H 4J3TA 1O5DT 1Y0LA 2NY6C 4KDTC 4LCUB 1KLGA 2NY6D 1RZKL 3L3HB 1Z3GL 3DRTB 3DX9A 2NY3B 3D5OF 2UUDH 5HDQL 4ODTL 1HXMB 3H9SD 3QFDB 3ZKSD 1NGZB 1F8TH 1NCCL 5E6ID 1YEGL 1KPVB 3UBXB 2Q8BH 2XN9B 2O26U 5KW9H 4CMHB 1OTUD 4PJXF 1G9MC 3JVGC 5GGVY 3OKDA 3RKPA 1MCKA 1R0AL 3BRFA 3KPRB 3MV7E 2BSRB 3MRJB 4AH2B 4Y19A 5FB8A 4L4VA 5JMRA 4M6NL 3MV9D 1J1PH 3MODH 3KDMB 1KTLB 4ZTPH 4K71B 1PQZB 5CGTA 2B0SH 2ADFH 2ZOLB 5D7IE 3WFDH 1YC7A 5DVOA 3RUGF 1YN6A 4AIZA 3BP6A 3VXPB 3FFDB 4MCZB 3V6OE 3CC5B 1HNFA 4ODBD 2W1NA 1XF3A 2Y07H 1VKXB 3TWCL 2IPTH 3OKKA 5L8KB 1T66C 1MIEH 2XRAL 5I2IA 4HH9A 3SDDC 4I9WE 1T66D 4QXUH 5BVPL 3SBWC 2R0ZH 2E8YA 5FECB 5J6HB 3QDMA 3QDJA 5DUPL 3SDDD 4KC3B 5JR1L 4GW4B 4PJ7F 2UY7A 1S7TB 4ONGH 4U1NB 1MCSA 4PB0L 2LQRA 4X9IA 1QOKA 3WE6B 3I75B 5DD5L 4D9LL 2PXYC 2B4CC 4R26H 2IBGA 4GBXD 3EJZD 3U0TB 2PXYD 4L4TD 2O5ZL 4JRYA 3RL2A 2A6KA 1BF2A 1MCLA 2VISB 3TC9A 5IFJA 1DBBL 3VD4A 4LIQE 4BZ1L 2Q6WB 4WCYL 2Q86A 2F8VA 3AROA 4Y5VC 2XA3A 1AQKL 4ZS7H 4ZTOH 3QRGL 4DVRH 4S1RH 4Y2DB 3GHBL 5TF1H 1A6ZA 3HMXA 3QULB 1XGUB 3OAUL 5K9OA 5F9JA 1L7TH 3DX6A 4NQVB 1CICC 1FFOB 4PTTA 4DKEL 2N7BA 4LHUD 1CICD 3TO4A 1AO7E 4LPWA 4KRMB 4P46B 3B5GA 4QHUB 3JWOH 3AB0C 3QDGB 2HTLC 2DKMA 1UM6L 1NL0L 3V6FA 3MX0A 2HTLD 1MCCA 5BOZG 3DTXB 2UYLA 4NO2A 1JNLH 5IW1A 4OF8A 1MJ8H 3LCYA 4L3EB 2XTLA 1S9YB 3BJLA 3BMWA 3D6GA 4NRZA 2ZCHH 3NTCL 3TBVB 3LEYL 3MRCB 2C3VA 4R90L 4QHLB 5T1KD 3G6AA 3QG7H 1SYVB 2A9NH 1TTUA 3ZDZE 1BQHA 3IB4A 3RWJB 2PCPB 1TZGL 3KNBA 5FYKD 1F90H 5CMAB 2HN7A 1PKQA 3RZWA 3SCMA 1UT9A 4M5YL 4U49A 1VHPA 2RQ8A 3T77B 2YZ1A 5D2LA 3BH8B 1BFOB 4MD4B 5H8DA 1FP5A 2E6PA 3LSOA 3SJVD 1NPUA 4HFUL 2VXTL 5IBTL 4GKZB 3OSKA 1J10A 1I3GL 1P2CA 2XQBH 4OLYH 3L3OA 2CIIB 5FOBA 5KSAA 3LPGA 1JYWA 4GG6B 2XWTA 3IKCB 5AYUH 2JIXA 4L8SC 2Y5EA 2FYYB 4PJAF 1E28B 2VZVA 5KVDH 3V4UH 1J86A 1FQ9C 2YPLE 4RIRB 5IW6A 2NTSP 4FXKB 2GSIB 5DQJB 4HXBH 3ZHDA 2NZIA 1QLEL 2ID5A 4WO4A 4POUB 3FQXB 4LSTH 5T3XE 1SY6H 3RHWF 1J5OL 5DDHB 1ZK9A 3B2VL 1ADQL 2PR4H 1LNUB 1QRNE 2D31B 5F7EL 4KI5F 1VADA 1J0JA 3K1DA 4MMZC 2DLHA 5DEFA 3F7VB 4JY4A 4P9ML 3E0GA 2AEPH 4Z7QE 2ED8A 5DUBB 3MRHB 3GBNL 1EJOL 5IB3B 4D9RD 1NMAH 2FB4L 3S37L 2D0FA 1N0LA 4M9OA 5F7HA 2JJUA 4Z95H 5BOPA 3IFLH 5FKAB 4AYFA 4ZXBC 4KQ3H 1B6UA 1YMMB 2G9HA 4N0RA 5E7FA 4ZXBD 4LHUG 4G9FD 4IRZH 4Q2ZB 1PD6A 3LKSB 3IETA 1K2DA 5T5FL 3CH1B 4NM8H 1R3HB 5IFHH 4LVEA 4R2GD 2XV6B 3CFBB 1TPXC 2FBOJ 1QUNA 5JW3L 4YDLC 2FZ3A 3AREB 4LOUC 3TN0B 3VXSB 3BGMB 3MLUH 4MQ7A 1YEIL 4XP5L 2A9MH 1B0RB 4LOUD 4OFVA 4I0CC 4Z18A 2P8PB 4JFFA 3ZKQD 4MJIB 2W07A 5FKPB 3TA3A 4XPFL 1D6EA 3P2TA 3TLRA 4QRSA 1TQCB 1P4IH 3QUYA 1EFXA 4KQ4L 4XBGB 4OZFH 1NFIB 3L5WA 3M07A 4LSSH 1Q9KB 5DSCB 1ZA3B 5AWNH 2W9DH 1U3HC 3JV4B 3T0BA 1JWMA 2NY6B 4FQXC 5F88B 1KPRA 1EK3A 1U3HD 4S1SH 4CW1B 3O6FC 3ARBA 2I9LA 4X8XA 1MY5A 2XA8H 3O6FD 4GXVL 1EHNA 2ESVE 4EXKA 1HZHL 5E6IB 3GO1L 2EXYD 4JG1H 5FGCB 3ZZ1A 4JLRB 5GGQL 3VDBA 4TULL 2PW1A 5K59E 1MRCL 1XGRA 1Q9WB 5C86A 4J23A 2DI8A 1UQSA 1EFQA 1MFNA 1QLFB 1Q38A 3KXFE 3EAKA 5D7KE 4PJEE 1KB5B 2R23A 3U7AA 3EO9H 3TV3L 4WI4A 2ZG3A 1BWMA 5IHZA 3KPOB 3QXDB 4DVBB 3MV9B 5GGTH 3BFOA 4FMFA 15C8H 4M8VA 1RZKH 1Z3GH 5LGKA 2ICCA 4RWYL 5I1DA 5HDQH 4ODTH 4M93C 3V79C 4ZDHA 1BLNB 3QUXC 3PHOA 1XMWA 2P8LA 4F7MA 1UJTA 1NCCH 3QUXD 4BKLA 1K6QL 2BNQA 1WAAF 1U8KB 5H35A 3GSOB 1SJVA 1W8NA 4CRPA 3OZ9L 4LKXB 3DI3B 2AV7B 4NO0D 2A6DB 3SDDB 1R0AH 2CDEB 3OHXA 4UDUA 3MJ9H 5C0RH 5EORL 1FSKB 2X09A 4LNRB 1AHWA 4HEPG 3HFML 1A8JH 3I6KA 1YEDA 2FJHA 5C08E 1P7KA 4GBXB 3X11B 5IBUB 3MNWA 2PXYB 5EC2B 2CLZA 4L4TB 1FNSL 2IFFL 5IT2L 4NDMB 3ARRA 3D1MC 4CVUA 2LE9A 2EKJA 4DCQA 3TWCH 1P6FA 2AQ2A 2O5YL 1YEJH 5SWSA 4KRLB 2X1OA 2BNRD 4QYOB 4Y5VB 3MLSL 4U1KA 5DLMH 4KV5F 1AD9A 2YXMA 1FVDB 1IBGH 5DUPH 4WHTB 3SEPA 4HLJA 4Z5RB 4K3HA 4PB0H 5DJCB 3HZVB 5F6HJ 4XBEL 1OGAA 2W38A 1IGCL 2EEBA 4D9LH 1DUZB 1FNGB 1P7QD 3DO7A 2W0KA 4LHUB 1CICB 4OZGE 4PJGA 1MCQA 1DBBH 3O11A 2GY7B 1IFHL 2R0LL 4BZ1H 2VUYA 4BQ9A 4DFIA 2FRGP 4XVSL 3EJYD 4PRID 2EDHA 4NO3B 1LWRA 5H2BB 1AQKH 3T2QA 1XCQB 3LKPA 2EDEA 3QRGH 2Q1EA 4JPIB 4UUJA 4OIAA 3GHBH 3NFNA 4RISL 3CSBA 3I9GL 1IQWL 3OAUH 2CIKB 4Z7WA 3D87B 4OZFG 1ZTXL 1AD0B 4PJHA 4N9GA 1JF1B 4RFOL 3N0PB 1KUMA 4PLKD 12E8H 4EZMA 1QQDB 4JHWL 2WP3T 3QEQE 2EXWC 4YX2L 3QFJA 2FDBP 5CLTA 2EXWD 4JHBA 2BNUB 3BDYL 3WFCL 5DTFA 2ATPA 4ZFOL 5C07E 1OY3B 1UM6H 1NL0H 3VI4F 1MJJA 5F72S 4C59B 4F7CB 2BSTA 3TT3H 4WU5B 3VGFA 1FZOB 3SJVB 4PG9A 3NTCH 4FQ2H 4IOIB 3LEYH 1ZLUH 1INDL 4R90H 3S35X 1JZ3A 4UZGA 1NFDE 1ACYL 2EKSB 1DLFH 2R1WA 3ZYZA 3DUUA 4YR6B 2OZ4A 2R1YB 4OT1L 1TZGH 3ULUL 1F58L 1EGJA 4M5YH 2R0KH 3NIGF 2BXZA 4XNQB 3L95A 2IJ0C 1HHHB 3F7YA 4NN7C 4Q9QL 4HS6B 4HC1L 2WBJC 2Y23A 1T21A 4K94H 2GQHA 4WDIA 4LRIC 5D8JL 2C7UA 1BM3L 5FUOL 4BSJA 1T4KB 5E8NB 3QO0B 1I3GH 2M2DA 2APVA 3EO0A 5EO9A 1P1ZB 3T0DA 2EYTB 2VMFA 3CFCL 4U31A 5EZOL 3P0VL 4HFWB 4L8BB 3GM0A 2O5XH 5CLWA 4GW1B 3ULUF 4JDTL 2IQAB 3LRSA 1VACB 4U1MA 3BI9X 3NZ8B 5B4MC 3TJEH 1GZQB 4P4RA 1RUAL 4HK0A 3MMEB 1ORQA 1QLEH 4XNZC 5IESL 1NGPL 1E6OL 3NA9H 2YD5A 3IFPA 2NY0C 1QFUH 4HJ0C 1J5OH 3ULVL 5SWZA 1DUYA 2NY0D 2VB5A 4Q9RL 4HJ0D 1U91A 4OLEA 4G9FB 1XGQA 4X6DE 1U8IA 3CH8A 3MLXL 2W65B 4MJ4A 1S8DB 3BKML 3QQNA 5F7EH 3QHTC 5GGSY 5B39B 2R2HB 5F7DA 3SQOH 4R2GB 4PUBH 3HHRB 4WI8A 3MGOB 1AXTH 4A6YL 5GRJL 2FX7L 3CVHL 1F4YL 2OR9H 5CSGA 1EJOH 3STBA 4AM0A 4YDLB 4Z78B 1FZKB 2FB4H 3S37H 1ZHNA 4LCYA 3MQIA 5D9SA 2J88L 3NCCB 1MPAH 2VZ3A 4DKFL 4WFFD 4S11A 1LP9B 3UP1A 4YGAB 3FQNB 4ZD3L 5LBSH 5INCB 1JWUA 1HHGA 1F13A 4YE4L 4PV8A 3LPFA 3SDAC 1FZMA 1HINL 1HI6B 3ULVF 4Q58C 3ZYJA 1B4RA 2DJUA 4KJQC 5C2UB 1NBQA 2JJTA 3U4EA 3PWVB 5JW3H 4KJQD 1U3HB 4NQDA 1BHGA 1YEIH 4XP5H 3O6FB 3VMPA 2H45A 5EG6C 2GITB 5DGQA 2A83A 4XPFH 3HG1A 3S3JA 4DZBA 4NFCA 1AGCA 4YHZH 3MCKA 4GAFB 2LVEA 1RIHL 2P5EE 1IRAY 1M05A 1QKZL 4ZO9A 4YHML 2Z4QB 2X4NB 4FQHB 4LLQB 5ISZD 1V3LA 3TT1L 3T1FB 4N0FB 3TPUB 3GMLB 1J88A 4EUPH 4POZD 4X83A 2PO6C 4JREC 3QUZC 4O5LH 2PO6D 3RI5F 3SGKC 5JOFB 3PWPD 5EIIB 3QUZD 4GXVH 4M93B 3IAQA 4Y88A 1HZHH 3QUXB 3GO1H 3Q1SL 4NZDA 3C2AL 1Z6JT 5GGQH 4Z7NE 4TULH 1MRCH 2DM2A 3MRKB 2V5RA 5FA4A 4QRPD 3CFKB 1FPTH 2VLRA 4NO0B 5E2JA 5JPNB 5AAMA 3TV3H 4HV8B 5IJKA 1WFNA 5A3IC 3L1OH 4E41A 2R9HC 1BIIA 1LEGA 3RVWC 2IPUG 2R9HD 1NC4D 3RNKB 1IMHC 1CE6B 3HMWL 4PJ5E 1MFDL 2QBWA 3RVWD 5I18L 3DRTA 3ZE2F 1JL8A 1F2QA 1OAXL 3W81A 4DOHE 3V7AG 3QFDA 1K6QH 1T5WB 3GKWL 3O4LD 4H8WL 5F7NC 3FOLB 2BNRB 4DN3L 2AEWA 4YHKH 1HHKB 4U3HA 2XN9A 3OZ9H 4QKXB 4Y4HC 3CDYA 2E27L 3HNTL 4PRBB 2M1KA 3KPRA 3IAPA 4LPTA 4JFYB 3HFMH 4Y8AA 3MOAL 1GCFA 3TZVA 1P7QB 4OM1L 3TBWA 1QBML 5IEHB 2ZOLA 1CTNA 2IFFH 3QUMA 5A43C 1H8OA 3EIFA 2P7TB 4OZ4B 5C7XL 5ICYB 1I7UA 3VXPA 4MCZA 2O5YH 3ROOB 4E0RA 1SVZA 4PLOB 4PRIB 1VKXA 1MIML 2DTML 2CSPA 3MLSH 3HE6C 4TSCL 3MV8E 1MI5D 1KOAA 2BXYA 1I7TB 3HE6D 5I74C 1ZVSB 5T3ZL 2R1XB 1BVKB 5FECA 5EH1A 2IF7A 1G9ML 4MQXC 4XBEH 5IMLB 5HHOD 3AS0A 4PJFB 3J7HA 1REIA 3IJYA 4MQXD 3WE6A 1QSEE 2X1QA 3AFLA 2PW2A 4W4OC 1CCZA 3JTSB 2VR9A 4MNGB 3FQWA 3MRNB 3MZTA 4EDXA 5DA4A 1Z2KA 5CGMA 2R0LH 1MCWM 5EUOF 2VISA 1KPUB 4XVSH 2MHAB 1KB9J 2DICA 1IAIL 1E4XH 2DL2A 1CI5A 3BXNB 3EYUL 1RUKL 3S35L 3RWCB 3QXVA 3CFDB 4UT9L 1WEJH 1DBMH 5ICZA 1T89C 3QNYB 4Y2DA 3KPSD 4QO1A 3E3QC 2Q87A 5GGVL 2YPKB 2YEZA 3MRMB 2VERN 3QULA 3V8OA 3TBTB 3O6KL 5MEND 1T0MB 1ZTXH 1R3IL 3IVKA 3L5JA 1FG2A 1LO5A 4E42B 4C57C 4EUPG 4NQVA 4YX2H 1FFOA 3V0WL 3EFFB 3HLAB 4QLRA 1OOAA 2D2OA 3WFCH 4JKPL 5I16A 4P46A 2DM4A 4PJAB 4ODVL 1M1SA 4KROC 4KKBC 1B0WA 4AIOA 1DJSA 4KKBD 5IMOB 1QO3B 1J11A 3S3PA 3H9YA 4NN7B 3DTXA 2AXFB 2D0HA 1KTRL 1FO0B 3DECA 5KS9F 2F8OA 4F2MB 1G0DA 1S9YA 5DJZB 2VLKA 3TBVA 3MRPB 3DVNB 1YEFL 2ILLA 4Q6IB 3TGXA 2IANA 1WC7B 4MX7B 1SYVA 3Q0HA 4OT1H 4OD3L 3ZT5A 3QIBA 1G9NL 4QXGL 3ULUH 1NBVL 1F58H 3RWJA 3DMMD 2PCPA 5C0CD 3OGCA 4NBYB 2APXA 3RRQA 3L3KB 1RIVH 4OCMC 3PGCA 5EPMB 5D7IF 3ARDC 3MLVL 3MLTB 3Q6GL 4IRSA 4CUCA 4Q9QH 4NGHL 2XZQL 5HDBF 4LIQL 5I8CB 2ZG2A 3ARDD 3T08A 3OAYK 4Z7UE 2ARJQ 3BH8A 2WWKO 3ZYOA 5D8JH 1UCTA 4R4FL 3F8UB 4LGSB 3OBAA 1BM3H 2BRRL 3C8DA 3MRFA 4XNZB 4CU6A 4JFQA 4ZSOE 4NCC2 2NY0B 2EDLA 1RUPL 4GKZA 2R4RH 2X41A 3T0ED 4F33B 5IB1B 3CFCH 2OJZH 3P0VH 3PE9A 5DQDL 4D3CL 1I3RB 2CIIA 4NZJA 4XCEB 2QHRL 3AGVA 1H9VA 1KJ3L 3GMOA 2GCYB 5IB5B 3IKCA 1A7RL 2A74A 4UAOC 3D2UD 3HZYA 1AJ7L 3DSNA 4ZQKB 5F89A 5L8JB 1E28A 2ADIB 3LQAC 1RUQH 5IG7A 4XVUD 3NH7L 5JLZB 1H3GA 2X89D 1UB5B 2X1PA 4FXKA 4G9DB 5DC9B 1JNNL 3KYNB 2AKRB 2DQIL 5DQJA 1NGPH 4HS3A 3AMKA 1IAIM 3BZFA 1KEML 3WS6A 2J12B 3ULVH 4Q9RH 1CXLA 6FABL 4N8VB 3HAEH 1I8MB 1HQRA 1I7RB 4ORGB 4WIQA 5DDHA 3MLXH 4L1DA 3BKMH 1KYOJ 2GIYA 4PGCB 5BS0D 2Z31C 2CXGA 3RWFB 2FHCA 1CFBA 4A6YH 4HCRA 3CVHH 1F4YH 5EU6D 4OFPA 2Z31D 5F7LB 1RMFL 4ALAL 5FO7B 1T22A 1CD8A 4YQXH 3MXVL 4DKFH 3LH2L 1CQKA 2CQVA 5J12C 3OWEA 3AM8A 1TCRB 3BN9C 4NQEE 4KPHL 4YE4H 3BQUD 2AJYH 4Y5YC 4LLVB 1HINH 1YMMA 3BN9D 1IGYA 5ISZB 3IJHB 2UY6A 3E1F1 3HS0B 5HYJE 5IR1B 2HRPL 3BKYL 1T7WA 1N6UA 4YFDB 1QFPA 5E2UL 4JREB 3CFBA 1U8PB 3VDAA 4QOKA 4EVNB 3PWPB 3ZDZF 3QUZB 2WANA 1R5WB 3TN0A 3VXSA 1GIGL 3VI3E 5BZDB 2WSKA 4TPRL 4QRPB 5FKPA 1RHHB 1RIHH 5DHXB 5SWQB 1UADC 2H3NA 4MD5A 5ERWB 1DBAL 3O4OB 5T3XL 1TDQA 1CXIA 3CCHB 1FH5H 2OLDA 5HVHB 4XMKH 1KIPB 4NKOB 4XBGA 1NFIA 2BVPB 2D7TH 4NOBA 3MNVB 1UEMA 4P5MB 2AGJL 1Q9KA 1NC4B 4YPGB 1A2YB 3JV4A 5AEAA 3FO9B 5F88A 3DRQA 3ARPA 1QVOB 35C8L 4CW1A 1YNLL 2R2EB 3P73B 3Q1SH 2R2BB 3C2AH 3O4LB 3BPNC 1W0WA 1IM9A 3S8WA 1WIUA 5E6IA 4ODXB 2FLRT 1ED3B 3N1FC 1ITCA 1TLKA 1Q94B 1KG0B 4Y4FC 2ZUWA 4QRRA 1OQXA 1NLDL 3V7MA 2NY1C 4Y4FD 5GISL 3P9MB 1QLFA 4KKLC 4BK5A 4F7EA 5CEZD 2NY1D 4J7RA 2E7LA 3NMEA 4KKLD 4BUHA 2QSVA 4GKSA 1V5JA 3BH9A 3KPOA 5ITBL 1R3LB 1R3JB 4EIGB 4PGBB 3MV9A 4PGZA 3NZHH 3SE4A 2H2PC 1IGFH 1C16B 4PJBE 3HMWH 1MFDH 5MERB 1MCOL 3JSSA 4R96A 5I18H 3GHEH 4FFWC 1CT8B 1OAXH 2FH6A 1XF2B 4FFWD 4JAMB 5DFWH 1LEKB 3RWGB 4H8WH 1CDUA 4JFEA 3MXWH 2DLGA 4F3FB 4DN3H 4XWOD 2ZSWA 4KY1L 4U7KA 3MC0A 4P4KA 5F6HI 4Z7QF 4J8RB 1MI5B 2E27H 3HNTH 1FGNL 4P5TA 1A7PL 3OXRB 5TGBA 3HE6B 5IVNA 1HYRC 3P3YA 3BRDA 4AEIL 3LIZL 5I74B 2Q7YA 2CDEA 5HHOB 3HAEG 3BO8B 3SBWA 1NBZB 3AAZA 1T20B 3MNZA 2HFEA 3MOAH 5HHQB 1KIRA 3UPRA 3BIAX 4OM1H 4NC2B 1TVDA 1QBMH 3R06B 4GBXA 3C60A 4TSAH 3X11A 1BX2B 1GRWA 2VKXA 5C7XH 1N0XH 5CZVL 3QP3A 3WYRA 4NQCE 1IARB 2DN7A 3T8XA 2QSQA 4F7CA 1MIMH 2DTMH 2EZ0C 2QQNL 3F65A 5FGBC 43CAB 2B2XL 4TSCH 2EZ0D 4K7PY 4WFHE 1JZ5A 3KPSB 5T3ZH 4NSKB 4KRNA 1DE4B 1FVDA 1G9MH 1XIWC 3MR9B 2C1PB 4Z5RA 5DJCA 3VW3L 5MENB 1KSRA 2R29H 5BRZD 4TNVK 4JVWA 3ZMRA 1DUZA 4C4KO 3RIFF 1CLCA 2YA0A 4Y5XC 4LHUA 1AR1C 1RZGB 4ZMAT 2WLYA 4FP8L 1IAIH 4HXAL 4F7TB 4XAWH 4X6FB 5I15L 1HHIB 3EYUH 1JPTL 2FR4A 1GJIA 2XZZA 4NO3A 4UT9H 5BV7L 4OGZA 1XCQA 2KPNA 5HPMB 4ZUVA 3JV6B 1G7IB 2BFVL 1CN4A 5GGVH 3RWIA 1I3VA 3IDJA 3O6KH 4N1CA 4FN0A 5K59F 1R3IH 4HAGA 1TVHA 5ETUB 1TVBB 1DLHB 5CSBA 1KLUB 4FZEL 1AD0A 4KK9D 4F9LA 1JF1A 3DXAD 3HE7D 1A6AB 4IEFB 4PJEF 4U33A 4PB9L 2DQJH 4CMMB 5CSZA 3CAFA 2B4CH 1QQDA 3DMMB 3G6JA 4JCMA 4ELMB 1U8JA 4JKPH 4A2MA 5C0CB 4ODVH 1YEHL 5T1LA 2BNUA 3M45A 1INEL 3ARDB 1YQVL 3L3GB 2YSSB 3T3ME 3TBSA 4P5KA 4H20L 1CXEA 3SGDH 3AU1B 2H9GA 1FZOA 3SJVA 3IFOB 4RGNC 1RZ8A 4N0UB 4PG2A 1YEFH 4RGND 3VXMD 1PG7L 3OGOE 1A21A 3T0EB 4OD3H 2K3TA 1G9NH 2EKSA 1RI8A 2GUOA 1NBVH 2R1YA 3BD5A 1N7MH 3PP4H 1L7IL 3D2UB 3OF6D 1U92B 3JWDL 1YEKH 3MLVH 3PGDA 2FL5A 3Q6GH 4UAOB 5HHPB 3D39D 5E1AB 2Y72A 3EUUA 5DJXB 4EN3D 1QSZA 2YN3A 2Z93A 3FHQA 3FT2B 3ARXA 1KCVL 1ZGLA 2AV1B 1OAUL 1CL7H 3BHBB 5DYOB 1RUPH 1T4KA 3QO0A 3BUYB 4D3CH 4PJ8C 2EEAA 1ZHKA 2VDPL 4QHMB 2QHRH 2RCSL 2EYTA 1KJ3H 3D48R 3GI8L 2EIBA 5BS0B 5CIPA 1A7RH 4L8BA 2BMKA 4LVHB 3DROB 4LCWE 5EU6B 2Z31B 1AJ7H 2H1PH 3OJMB 3I6LE 3CZFB 2XWBB 2YMXL 4GW1A 4N90E 1UC6A 2IQAA 4U1IB 3D3VE 3NH7H 1W8OA 1VACA 4OZGF 1KT2A 1JNNH 3QJFB 4OBSA 1JYVA 1X9QA 3MMEA 3QJHA 3GMPB 5JXEC 4RAHA 3BQUB 3CMGA 1IGTB 1DBJH 4DUXA 1S5IL 3MTRA 4WNQB 4G9FA 5DO2C 4KKAC 1WV7T 2W65A 1LO3L 4J4PA 5DO2D 2YRLA 4KKAD 2R2HA 4ODSL 2XOTA 4LLDA 3N1PC 5HY9A 4JM2C 4MB5A 1TJHH 3MGOA 2CK0L 2EIDA 2P8MA 2DQGL 2W92A 4JM2D 3DI2B 2K7PA 1QYGL 1BZ7A 1GGCL 4Z78A 4PJDB 4XP4H 1U93B 2SEBB 5DA0B 3MXVH 5F96L 2BSSA 5EC1B 1G7HB 5D1XD 3LH2H 2QKIB 5CJQH 3V6ZB 4KPHH 3LQZB 1LP9A 2AK4D 3VWKC 2FX9H 3FQNA 1CDIA 1MCFA 5INCA 1UXWB 4MHHG 3VWKD 2I60L 3SKUD 2RR3A 5FXCH 4I0KA 1HI6A 1JUFA 2LTQC 1OSPL 3BKYH 4HUMB 1FL6B 2DQEH 1NFDF 4OZFA 5E2UH 3CX5J 3LKRB 5FUZL 3PWVA 5L9DL 2MPAL 3NIFE 1UZ6E 4H5SB 5I1IH 5I1LA 2FX8H 3O6FA 1CR9H 4LBEB 3UC0H 3MROB 2JELH 3I3DA 4TPRH 1XGTB 2ED7A 4CAGA 4Y4FB 1BFVL 5J06A 4JVUA 4PJXA 1DBAH 1FZJA 4LSVH 5T3XH 4KMLB 3RBGA 4HKXA 2Z4QA 2X4NA 4V1DD 2GKIA 4WFED 4FQHA 1QSFD 4FQQA 5JDJA 3LHPL 4WW2F 3PQYE 5DS8A 3LV3B 4XMLL 1Z5LB 1D6VL 4YZFE 3VD3A 4I8DA 5LWYH 1NKOA 35C8H 3RUGA 3A6CL 1CXKA 1CLOH 2AJSL 4FTVD 4J6RL 5GRXG 3CFIC 5HHNA 4DQOL 4RAUB 5JOFA 1IGMH 5EIIA 1YPZB 4NRYA 1MFCL 2JJWA 4MNHA 2XKUA 2GW5A 1NLDH 3MRKA 2DJ4A 4FMKA 1BVZA 5JPNA 2V7HA 4OLUH 5KN5B 4I4WA 1T83A 4GMTL 4HV8A 3O3BA 2Z8VC 3QQ9C 3U9PL 2KUTA 1E4XI 3MYJB 3F12B 4RQQB 3PDDA 3GSUB 3UYOD 3QQ9D 3EW3B 1UVQA 4NCC1 4P2OA 5FV2A 43C9B 1BECA 1J12A 1FVCA 1JNHB 5FM5M 5EU4A 3RNKA 4X6DF 1CE6A 1EO8L 2FJGA 5F7YC 5CILH 1HKLL 4U0RC 4WJ5A 4Y2OA 3QR2A 1A6VL 1DCLA 1P69B 2AEQL 2VYRE 5D6CB 4KY1H 2AJVH 2F74A 3DUHA 3O2DA 3S7GA 3W2DL 2IFGA 4BZ2L 2AJ3B 1T80A 1NKRA 3TO2B 1G7LB 3O3AA 2JJVA 3EYSL 4ZG1A 1HHKA 3HI5L 3VA6A 4G6ML 2WUBL 4AEIH 3LIZH 1JN6B 4Y8DC 3UTSD 4PRBA 4JZOB 2GHWB 2I26N 1EX0A 3JWNC 3PG2A 1A1MB 5BRZB 5MEPB 1YJDL 3OB0K 3LN4B 4JFYA 2FIKB 2R8SL 4X6EB 1FFNA 2ED9A 5IEHA 2P45B 5CZVH 3WEXB 4HUUA 2RGSA 4Y5XB 1EHAA 2IG2L 2CLVB 2NPLX 2E9WA 5ICYA 4MDIB 4BH8B 5GS2D 3MJ8B 2B2XH 4KHXL 4PRHD 4XPGL 4PRIA 4GG8B 1AKJD 5HVWA 3RGVC 3RVVC 4YXHL 5ID0A 3RGVD 3F6LA 4JEGB 3G5YB 4HWNA 4MNQD 1I7TA 5KS9B 3FB6A 2R1XA 1QNZL 3VW3H 1BVKA 1G7MA 3DVGB 3T2OA 4XPBL 1U8QA 2F15A 3OAZH 1NAML 3BKJL 2ZG1A 3DXAB 3HE7B 3KYKH 4C56E 1AGDB 3V0VA 4NOFA 5FYJD 5FDYA 3D69A 4JDZA 2E7HA 3QH3B 5F3BB 2QR0B 4YHNB 4FP8H 3MRNA 3WHXA 1JMXA 5I15H 1JPTH 1KJMB 3RX7A 4XCYB 5C0IB 3RWCA 1FLTX 1HQ4B 4BM7A 4ORZC 3QNYA 3NCEB 4Z7NF 1S7SB 3SOBL 1MCNA 3MRMA 5DJYB 3VXMB 1QFHA 3MRDA 3TBTA 2I07B 4FZEH 1G6RB 3CXHK 4OCNC 4PB9H 1HOCA 1IKFL 1RQ5A 4PD4K 1FAKT 3V5DB 1HDMA 1H0DB 3EFFA 3N9GL 3VFNA 1YEHH 3QXTA 4LL9A 1MREL 1YY8B 4G6JL 3CSGA 2HJKB 4OZIE 3NCMA 4PJAA 3DURA 1SMOA 3V4PL 3D39B 5E9DE 5HHME 4EN3B 4PRAB 3QDHA 1QO3A 4UDTB 4XP1L 3WHE1 4DEPC 4M5ZL 2YR3A 2AABL 4U1GC 4UU9A 4AMKL 1DQLL 1FO0A 5LGHL 4Z8FL 2BVUA 1U58A 1PG7H 5DJZA 2J8OA 2YD1A 4YO0A 1NFKA 4M03A 4P2QE 3QB7C 4CU7A 4HDIA 5CP7A 3BGFC 1I1YB 4Q6IA 4MX7A 3ZO0A 5C0BD 2FLBT 1BD2E 3ZE1E 4ZUUB 1L7IH 2OTWA 2JTDA 2JK5B 1F02I 2F53D 3B43A 4YDKH 5KSBE 1S7WB 5EPMA 3GFUA 4L9DA 3PP3K 2H41A 5I8CA 4NN6C 1KCVH 1ZT1B 4B7IA 1RFDL 2FATL 2ENYA 4HSQA 3STLB 4Z77B 1NCTA 3FAXA 4G8GA 4LMQI 1Y18A 3MA7B 4HKBB 1KIUA 4OLVH 1N2RB 1QP1A 1IAKB 1ZGLP 5DJ6B 3ALXA 3O9WC 1NLBL 4O2FB 5ADOH 2VDPH 3G04B 5B21A 2OL3H 5I1AA 2IBZY 3X14B 1QBLL 3O9WD 3VCLA 3GI8H 1I3RA 3I50L 1ADQA 4XCEA 4NNYA 1B2WH 2BP3A 4G7VL 4MJ6A 3FFCE 2ZUUA 2GCYA 3M17A 1U8OB 5IB5A 5IQ9B 3M8OH 5JHLH 1OTTC 1PLGH 4JM2B 2XPGB 4YGVB 3KJ6L 1OTTD 2KZ1B 2VXVH 4RNRB 2H32B 2HT4C 2VC2L 4JRXE 5JLZA 3IS1X 5DMGC 2HT4D 5D1XB 1JPST 4HG4J 4WI5A 3L6FB 5DK2A 2WQ8A 3RAJH 3VH8B 4MA3B 2VZUA 5L2KE 3OKYA 2AK4B 4ZNEE 5KJRL 3FO1B 1OGTB 1S5IH 1RJLB 1I8MA 3VWKB 4UINL 1J8HE 1WLHA 1LO3H 3RL1B 4ODSH 2LTQB 3FT3B 2ICES 5EU7C 2G75B 5C8JA 3O6ML 2CK0H 2CLRA 2DQGH 3DGGB 1G84A 5I1CL 1QYGH 2BOCA 3V5KB 4URTB 4GAYB 5I75B 5C09A 1GGCH 3JBG7 4M6AA 1A1NB 5FYLE 4PRPA 5KOVC 4W4NA 3VWJC 4WI9A 4J12A 4JO2L 3VWJD 3RU8L 3CSYB 1TCRA 4YFLI 4KK8C 1QSFB 4KVNL 2V7NB 2I60H 3ZT7A 4KK8D 1EUTA 2C4FU 4M3JA 1OSPH 1CE1L 3HS0A 2VDMH 2YUWA 5GRUL 5IR1A 1ZAGA 3T04D 3UYPA 1FRGL 1S3KH 1ZA6A 3PXJA 1ZVYA 3WO4C 4FTVB 2WUCL 4EUPA 1PAMA 3T65B 3ILPB 3Q5OA 3OJVC 3UTPE 1MEXH 4JQVC 3MV11 1WZMA 2EC8A 1BFVH 3WUWB 4L8CB 3EOBA 4QRPA 1RHHA 4MD0B 3QHZL 4Z7UF 3QO1B 3P4OA 3OG4B 4JO3H 3CCHA 1F97A 1KIPA 3A6BH 4XMLH 4KK6D 4ZAKA 2I9TA 3UZVB 3G9AB 4YFEA 1NC4A 3WSQL 3BT2L 5DRXB 3FQRB 3JV5A 2A0LC 3GSXA 1A2YA 3ALWA 3A6CH 2AJSH 4GLRH 3FO9A 4J6RH 1X7QB 4DQOH 2IC2A 2A0LD 4OCWL 3BUTA 3KPQA 2OSLB 4U6XA 3BVNB 2R2BA 3HN3A 3D9AH 2YA1A 4HUNB 1ED3A 5SV3A 1KG0A 5ILTL 3IDMB 3FB7B 1NDGB 4RX4D 3UTSB 4YUEL 1TJGL 3U9PH 1IAII 5I8OH 7FABL 3QG6A 3QA3A 1G1CA 5CBAA 2H26B 1R3JA 4AG4L 4PGBA 3ULSB 2DBLL 5DHVH 1P84J 1VERA 4XNYH 5T33L 4U1JA 2WBKA 3NBNA 3QSKB 1CT8A 1A6VH 1YNTA 4L9LC 1QPXA 5IHUL 3RWGA 1T7XA 3Q48A 4PRHB 4BQ6A 1AKJB 4MHHI 4F3FA 5CEXB 4Y19E 3EYSH 3X3GH 4J8RA 3RGVB 1PEWA 2WUBH 5EBLA 5FO9A 5HGAB 3OXRA 4MNQB 5HGBB 4JFDA 2UV3A 25C8L 4XVTL 5CINH 3W0WD 4U6YA 1EDQA 3H3KA 2NNAB 4JFHE 3GB7B 2OYPA 1NBZA 1T20A 4FFZL 3FKUS 1S9WA 5DJ2A 4KUCD 5HHQA 2R8SH 4HX1B 3CVIH 5JDSB 3SGDI 1TETH 5EO0A 5IBLC 3IT8D 2IG2H 2DIBA 3QDME 4Y1AA 5SX5K 3PWJB 5ICXA 2XNAA 4MDJB 5IBLD 3LKNB 5B3NA 4KHXH 4XPGH 2V9TA 3DLQR 1YEEL 43CAA 1SYSB 1C5BL 4YXHH 1T7ZA 4L4VD 1EEUA 5I1KL 5D6DA 1C08A 1UM4L 2IH1B 2ICEA 5BV7B 4U1SA 4NQSB 4NSKA 2VLJA 1DE4A 4POYA 2OM5A 3MR9A 4HQQH 4XPBH 2C1PA 2YWYA 1NUNB 3BKJH 3E6FB 4HIJA 4W81A 3NCFB 5IIEB 1R6VA 1IQDB 3U46B 1J05B 3BP5A 4KDVA 3G5XB 2GTZA 1CL7I 3VRJB 4M3KB 5C08B 2V2WA 5EN2A 4ZFGH 1MAML 3UYRL 3QDJD 5JUEL 4X6FA 2DLTA 4ZFOA 5FGRA 2AW2A 1L4IA 3JV6A 1MHEB 2EECA 1G7IA 4DEPB 3CJJA 1DN0B 5L88L 4PS4L 1FN4B 4HF5L 3SOBH 1KCSL 4JRYD 1MHHB 3SY0B 3OKEB 3OKOB 5ETUA 3VD9A 2X4TA 2O61A 1TVBA 4C54A 3DIFB 5E2TL 5F8QC 1U8HA 1DLHA 2NY7H 3VFTB 3MGTB 4P57B 3ZKNC 3BGFB 3IDYB 4HWZB 3N9GH 4IMLA 4CMMA 4ELMA 3DMMA 4QNPF 1PZ5B 5DD1L 2W0FB 1J8KA 3MFFA 5C0CA 1UKTA 2F53B 4PJBF 1JZ8A 1QZ1A 5GGRY 3W39B 3K1KC 2CRYA 1ZS8B 2VXUL 3F7QA 3ARDA 4L1HA 3O6LL 5HI4D 3L3GA 2YSSA 4M5ZH 4AMKH 2OP4L 3QNZB 4NN6B 1DQLH 2XI9A 3W9EB 3TO4C 5LGHH 4K7PL 4HC1A 4AQOA 1AXSA 3DPBA 3TO4D 1QEWB 4QRUB 1OP5K 2OR7A 3D25A 2FHBA 3VFVB 3O9WB 3T0EA 1A7QL 5TDOA 2VO5A 5DF0A 1AQDB 3H9HA 1FFPB 2NCMA 1E4KA 3V4VL 1QRKA 3D2UA 1B3JA 4IDJL 1U92A 5J56B 2ZP0T 5HHPA 1J1OH 4P2RD 5E7BA 5E1AA 1VGKB 4JKMA 1CFVH 5DJXA 3FT2A 4X4MA 4HWBL 1Q9LB 3U9UB 3SCMC 1JPFB 1HSAA 1NLBH 3BHBA 5DYOA 3SCMD 4EQ2A 5EDXA 2XXMB 1QBLH 4AL8L 4U2ZA 3CX2A 5LVEA 5LGJB 4G7VH 1IT9H 3HAEA 4TNWK 5BS0A 1QG3A 4GO6B 4XWGH 3D0LA 5DWUL 5GHWL 4PBWD 5EU6A 5ECJE 3KJ6H 3CZFA 3MA9L 2RAMA 3EOAB 4U1IA 2DM3A 2VC2H 2Y5TB 2EYRA 2GAZB 3CVHA 5KSAC 3CD4A 3ARGB 3QJFA 5SV4A 5CZXD 4JB9H 5KSAD 1DQML 3VWJB 3GMPA 5I8KH 5KJRH 1NCWL 4RCAA 2JIXD 5FA3B 3WL9B 3BQUA 3ZT6A 5EB9A 4WNQA 5TDNB 1JJUA 1RVFH 3MCLL 4JPWL 5CJ5A 2X4RB 5LXGL 1M7IB 3SGJC 1JZ4A 2G60L 1IL1B 4WO4C 3N06B 3O6MH 1CLYH 1I8LA 3LRHA 5I1JH 4WO4D 2CK2A 5C6PB 1FIEA 3WO4B 5FEBA 4Z7OE 1FV1A 2IQ9L 4XCCL 4XHQA 4PJDA 1XF5B 1U93A 2XXCB 4HZLB 1KGCE 1JPGB 3H7LA 3IGAB 4KKNA 5EC1A 1G7HA 1OL0A 3QNXA 4MXQC 3RU8H 4D9QE 1EBAA 2QKIA 3V6ZA 3T3MF 3NABL 4X7TA 2EE9A 4BELD 4I48B 4KVNH 4HPYH 1ZSDA 1KCLA 3SDXF 1VFOA 4OQ1A 4OCRL 3V9FA 5GRUH 3BGAA 3QCVL 1LE5A 3F62A 5H37H 1H5BB 1FRGH 4JFFE 5EBMA 5JXAL 3KLHC 1RJYB 1RSFA 2DBJA 1AIFA 3PDOB 4X7EC 2WUCH 3C5JA 3KLHD 2AJZB 5B22A 3S4SB 2BSED 3CFEB 1QFWL 2HH0L 3GJFA 5BQ7B 4K8RL 1N59A 1RK0B 4TOYL 3QQ3B 2EDJA 2OX5A 4H25A 4I2XB 3BN3B 1BOYA 4I0PD 3QHZH 2IWGA 4TYUA 5B38G 4HKZB 3WXWH 4MCYA 2C26A 3S36L 4DW2L 5KG9B 2GJ6E 5AZ2H 1MAJA 3TA3C 3WSQH 3BT2H 1OW0A 2VITB 2NY2D 5FHBL 1L0QA 3ME0A 3TA3D 3D0VB 3QUYC 3MRQA 4OCWH 1S78C 4NUGH 2IBZX 4RAUA 3QUYD 1S78D 4L9LB 5FAAA 1E4WH 5GXBB 2HFFB 4YC2C 3V2AR 2QEJA 2MQ0A 1IAOB 2HLFC 5ILTH 3PWUA 1OSZB 2OI9C 4OUUB 5MHSE 2VNCA 4MZ2A 5F1SA 5L0QC 1KLGB 3W0WB 2X4UB 2RIKA 3ARBC 1MCPH 5TDPB 1KJ2L 2LV4A 7FABH 5KN5A 3BISA 4AQ1B 3F12A 4AG4H 2BNQE 3GSUA 2DBLH 4UT6L 1IILE 2N7AA 2UWEB 2E6JA 1Z9SA 1JNHA 4CN1A 3OKDB 5CKAA 5D7LD 4K7FB 5IHUH 4PR5A 3BPOC 1CLZL 3RP1A 5E8OA 5J9PB 4N8CH 1SHMA 3GMNB 1OPGH 2NX5D 4LQFL 2J7LA 4L4VB 3TO2A 1G7LA 3GNMH 3HI1A 4P2CG 25C8H 4XVTH 3Q2CA 3BZ4A 1X5LA 3EKCA 4AT6B 1JN6A 1YN6B 4AIZB 1H3TA 4BFBD 1HH9A 3WLWC 4JZOA 3BP6B 5D2NE 1A1MA 4Z7VF 5MEPA 1KEGL 3RNQB 3SQBA 2PF6A 3RGHA 3WLWD 4JJ5A 4BQ8A 1FC2D 1MRFH 3OKKB 1TNMA 1IC4H 3GBML 5CS7A 4ODHL 5I2IB 1JVKA 3H3PL 3QDJB 4IIQB 1AHWC 4MDIA 2DQTH 4F58L 3MJ8A 1D5ZA 3NIFF 5HYIA 1UZ6F 4GG8A 5BXFB 5I1KH 1GHFL 2ZJSL 1UM4H 1VPOL 4QWWC 4CKVX 4PTUB 3G5YA 3PJSB 1QFWM 1ZT7A 5KS9A 4PJGE 4QWWD 2IBBA 5KANG 4MVBC 2X9YA 4WEBL 2DQUH 1LDPL 5EU5A 1HKFA 3B9KD 4MVBD 3FOMA 5EFIA 3HE7A 5H37G 5SWSD 1A14H 4HLZH 3MV7A 2JKXA 1T2QL 5F3BA 1MAMH 2QR0A 1X5XA 3UYRH 2YK1L 2EDNA 4YZFF 1H8SA 5J3HD 5JUEH 2YPVL 5D7IA 5IV2A 4XC1L 2FO4A 4O58H 4FOMA 1EZVY 1OGAD 5BVJA 1KJMA 4K9EL 4LSPL 5K9OB 5KVGL 2GTWB 5F9JB 4XCYA 1ZLVH 1HQ4A 3H6JA 3K2MC 4PTTB 5L88H 4PS4H 4HF5H 4XAKE 1KCSH 1RUML 3TO4B 3WDJA 4JGMA 1S7SA 4AJ0A 5DJYA 5E2TH 2J4WL 4IHOB 4FFYH 2I07A 1Z9OA 3QISA 2LABA 4D0DB 5B38B 5TPWL 4OLWL 4UT7H 4X98A 5HGHA 2JCCB 3V5DA 5DMKB 2UYLB 4L3CB 4NO2B 5DD1H 5IW1B 5KVEL 1YY8A 3OF6A 2HJKA 5DJ0A 3CU7A 4JJHA 3TF7C 4P2RB 3O6LH 2VDKL 2BVQB 1ZOXA 1J18A 4EN3A 2OP4H 4UDTA 3WD5H 3A67L 3QPXL 1L0XA 3U6RA 4YDJB 4ZPVA 3T1WA 5IROA 4BFIA 3QFJD 3KNBB 4RRPG 5FO8A 4KAQL 2HN7B 1P4BH 3MZGB 1PKQB 3SCMB 4QT5A 4YDVB 3RFZC 4J3UA 1MWAB 4MA8L 3ZDYE 1I85A 5D2LB 4LSQL 4P3CH 1C12A 4N0YH 4JG0L 1DFBH 5JQ6L 3V4VH 2AJUL 2X70A 1MVFA 5ANME 1I1FB 1ERNA 2WIMA 4M61B 2X9WA 3O81A 5DGRA 1R3KB 1P2CB 1GGBL 2KBGA 4NJ9L 4XPAL 4H0HB 3L3OB 5SX4H 5KSAB 3STLA 4Z77A 1XAUA 2XWTB 1V3KA 4M48L 2JIXB 3MA7A 4HKBA 2A6IA 1IAKA 2XACC 5DJ6A 5LKNA 3WS3A 4O2FA 3G04A 3X14A 4Z76B 5GJSL 4LP4A 1MJUH 5DWUH 5GHWH 5IQ9A 4WO4B 4YGVA 3NA4A 4HHAA 5GPRA 5HDLA 3FZUD 4RNRA 2H32A 1OP9A 3HI6L 3EYQC 1DQMH 2VDQH 3RIAF 5D1XA 1NCWH 2QSCH 3EYQD 2CGRL 3VH8A 3KYAA 5DEFB 1DN2A 4TVPD 3FO1A 1OGTA 1HILA 5FK9A 5C3TA 3MCLH 1RJLA 3VWKA 5LXGH 4K55A 4M43L 2VR4A 4HLZG 2G60H 4XNXL 1MHCA 3HNVL 1G1YA 4FQPA 2G5BB 2FIRT 1RIUL 3RY4A 4J3XA 2IQ9H 1JYNA 4XCCH 3V5KA 2G9HB 1UWEL 4GAYA 5SWZD 3K80A 4P59L 3VA2C 1NGYB 2QQLH 5DUML 4OZIF 3CLFL 3IETB 3HUJB 1K2DB 3KPNA 4I3RH 2VZ1A 4I0PB 2YPLA 3NABH 3KPMB 3QCUL 2PYFA 1QR1B 2IGFL 3FHAA 1S7UB 2FZ3B 3CGTA 1QSFA 2ICWJ 4MQ7B 3QCVH 2AEIT 4HBCL 5JXAH 4PJCB 2YD7A 4L3AA 2NY2B 2YD3A 3HG1E 5E8DH 1RU9H 3WIHL 3TA3B 2HT2C 4MXWL 4PP2B 5EUKA 2CR6A 3IU4L 3C5SB 5GGUB 4FTVA 5F93C 2DLIA 1QFWH 3QUYB 4K2UL 3T65A 3ILPA 3MO1A 1W72L 4K8RH 2A77L 1PZUB 4TOYH 4YBLC 3L5WB 5KSBF 2JJTC 1NUDA 4YXKH 1MQKL 1JWMB 2OI9B 2VQUA 1OAKL 4MD0A 3U4AA 4WY7L 5L0QB 2CKBB 3S36H 4NQDD 1NMCC 4NUJB 3WNNA 4DAGL 4NQEB 4PY8J 5L6YL 3MLWH 5HYSG 1UWXH 3KG5A 4Q74A 5FHBH 5CAYB 5MP6L 1U2HA 3HG1D 5DRXA 2VLRE 3FQRA 1XGRB 4OGYL 1GAFL 4PYGA 4DTGH 1IKNA 2Y25A 4OFDA 1UQSB 5D7LB 4YEFA 1UWGL 4LAQL 4NKQB 5D5MB 1M4KA 3VFRB 2OSLA 1D5IH 1BZ9A 5IHZB 2NX5B 4PJIB 2VKWA 5FYLL 4H0GA 2V2TA 3U48A 3KPPA 1Y6KR 4OD1L 5T1MA 4XC3L 3IDMA 1DR9A 2PN5A 3K4DA 5DEGB 5DR5L 1KJ2H 4OZHB 3UTSA 4P9HC 5I1DB 2CXKA 4ZDHB 1A4JB 1FL3B 3PHOB 3QI9A 2P8LB 3GSNL 4F7MB 4BKLB 2H26A 5H35B 2XN9E 4R97C 1JHKL 1RULH 2Q8BL 4CVXA 4RSVA 5BJTA 4FZ8L 1CLZH 1D7FA 3ZE0E 5A2LH 3WXVL 5IJKC 4NWTH 4UDUB 3KPRE 1F42A 4XRCA 1DL7H 1AKJA 1H3PL 1ZT4A 3G08A 1CDHA 4E41D 3I6KB 1WZKA 4U1LA 1YEDB 2C5DC 4Z0XB 2JLLA 2ESVA 4ZTPL 2CLZB 4MNQA 5HGBA 2WP3O 2B0SL 1KIQB 4DGYL 1UJ3A 5TQ2L 4U7MA 4TTDD 1KEGH 3GB7A 3B9KB 2J8UB 4S0TD 1TZIB 2JE8A 5GRVK 5SWSB 3GBMH 4PJEA 4HX1A 1C1EL 1P5VA 2Y07L 4ODHH 5JDSA 2IPTL 4CMHC 5BZWA 4U1KB 1Y6MR 1AD9B 1MIEL 4GSDL 1LE9B 1WBYB 4O2CA 1NEUA 3PWJA 4MDJA 2YC1A 4F58H 5AYQA 2VUOA 1OGAB 2CPCA 5E4IA 1TIUA 1K85A 1GHFH 3TZVC 2ZJSH 1SYSA 2E7BA 1F4XH 3TZVD 3QWOA 5F6IB 3DO7B 2IH1A 3U36B 4WEBH 1LDPH 3E6FA 1KCRL 1FNFA 3PWLB 1IQDA 1J05A 5ACZB 3LKPB 4QTHA 4KXZH 4UUJB 3P11H 4ZS7L 3NCJL 2NW2B 3VRJA 5C08A 5C0FB 4F80A 2YPVH 5FM4A 4Z7WB 3LMJH 4K9EH 1LQSR 2VQ1B 4LSPH 5KVGH 4WFGE 4PJHB 4N9GB 4GKNA 1F2XK 1L7TL 5INDA 3QFJB 1MLBB 4WI3A 4XI5C 1DN0A 4WHYH 3SY0A 4XI5D 4ONHA 1XR8A 2ATPB 3OKOA 1FE8L 2D7MA 3QDGE 3QZWG 5TPWH 2ADJB 1MJJB 5IVXB 4P57A 5KVMC 2BSTB 4Z0BH 4K3DL 2NW3A 4Y2DC 4HWZA 3RTQC 2NTFA 4WRLA 5ADPL 4XB8A 4L3EE 1GPOH 3RTQD 5TF0A 2F53A 5D70H 1TQBC 5IVZB 2VDKH 4OZGA 2VIRB 1PDKA 4I18B 3W39A 3ARUA 1A7OL 2P5WD 3A67H 3QPXH 3TVMD 4OV5B 2R1WB 4XPTL 3QNZA 3MOBL 3TPKA 2OQJA 4KAQH 4P46C 4ZUSA 4LGRB 1F90L 3QIWC 5F71A 1NGXB 1KXVC 1X5JA 3S5LG 1MJ7L 3WFHB 2VZSA 3F7YB 3QIWD 3O9WA 5GRYA 3GJFK 1KXQE 1OF2B 1T21B 1XGPB 1V7MH 1FFPA 2AJUH 4WDIB 2MMXA 1G0YR 4W6WB 3B2UC 2VLKD 3HMXL 3QEQA 5KANI 2MCG1 3VGHA 4NJ9H 3B2UD 3BIBX 4XPAH 3MLZL 5EO9B 3QIBC 2DQHH 2P4AB 1A9EA 2IAND 3N1GC 1X4ZA 3QIBD 5C07A 1WTGT 4GG6E 5KTEL 4M48H 1NCDH 4LVOB 1E4JA 2XTJC 2E7CA 2VDOL 4XCNA 4OIBA 2NY5C 5AYUL 4IRSC 5DURD 2XTJD 4Y7MA 4KGLA 3PABA 2VE6A 1CXHA 3SDXB 4U1MB 5HVGB 4IRSD 2EIEA 5GJSH 2APFA 3I85A 1JRHL 5LGJA 3K2UL 2BHUA 4HK0B 5AD0A 4YH6A 1NFDA 4HXBL 3BPLC 5FDWA 4ISVB 2D4DA 4GH7B 4EI6A 4N1EA 3WIFA 5SWZB 3EOAA 1J0YA 1U91B 1SY6L 3HI6H 4JFPA 2GAZA 2VZOA 1U8IB 1QA9B 2PR4L 2WLZA 2IPKA 3ARGA 4P3DA 3H8NA 5TE7H 2CGRH 4NBZB 1LILA 3RPKA 4NQTA 5F7DB 5FA3A 4OGAC 4FXGA 1MH5A 1A6TB 4AM0B 4QTIL 2DLFH 4WW2A 1ZHNB 1CFSA 1EVUA 1M7IA 2B1AH 3HNVH 5D9SB 2VN4A 1NMAL 4OLXH 1IL1A 3WS6C 4FABL 1RIUH 4U7SA 3GIZL 4LFHD 4Z95L 1I8KB 2YRZA 3FO0L 1YMME 3T2NL 1JWUB 2AK1H 1HHGB 2BVYA 5DUMH 2J8HA 5E94A 4GOSA 1MCDA 1XF5A 1C7TA 4IRZL 3PL6B 1H15B 1JPGA 2APTA 2DMBA 4YBLB 1WISA 4NM8L 3QCUH 4PLNC 5IFHL 3LKQA 2IGFH 1WFTA 4WHYG 4I48A 4NQDB 3AXLA 5EBGA 3C8KA 3VXSE 2YRPA 3MLUL 1INQB 2A83B 3WIHH 3ZSTA 4GRWB 5HTSA 1H5BA 4MJIE 4MXWH 3AM8C 1RJYA 3IU4H 5IM7B 1HXYA 1AGCB 3MCKB 3PDOA 4RFEA 5GGSA 1M05B 3C5ZA 5I76A 3CFEA 1W72H 3REVA 2A77H 4JM4L 1P4IL 3S37X 2IMMA 1RK0A 5GS0D 3QQ3A 4G5ZH 1G6VK 1MQKH 2ZWLT 1P7HL 5I1HL 5IOPB 1OAKH 4QRQA 4WY7H 2WWKT 3MUZ1 5AWNL 2W9DL 5HGDA 1JGEB 3TN0C 1IEAB 3H9SE 4HKZA 4QOKD 4Z7VB 1FC1A 4DAGH