4CBZA

Notch ligand, jagged-1, contains an n-terminal c2 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
306
structure length
291
Chain Sequence
SGQFELEILSMQNVNGELQNGNCCCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN JAGGED-1
publication title Structural Analysis Uncovers Lipid-Binding Properties of Notch Ligands
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 291
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cbzA01
4CC1A 4CBZA 4XBMA 4CC0A
chains in the Genus database with same CATH superfamily
3VFUB 3W3BA 1N5YL 1MJUH 3ABMB 5AZEL 1MFNA 3DRQB 4LT7A 4R3SA 2WUBH 4PGBA 1CLZH 4HLZH 1FVDA 1DQLH 3WIHH 2ESVE 3IRCA 4MNGE 3FOLB 4JRXA 4WEBL 4KAQH 3DOHA 2XWJA 1E9OB 1G9MC 5CWSB 3T6WA 3FT4B 2HT2C 1INEH 1HQRA 1BFSA 4Z3IA 3D12B 3VXSB 4PHXA 3RWGB 3AM8A 5C0CD 1BF8A 5DLML 3KJ6H 4Y16C 5HTSA 1KYOK 1P1ZB 5DK0A 5CZXC 1ZT1B 1DN0B 2ZX5A 5J9PA 3VWKA 4BKTC 2ZT9C 1OTUD 4AGOA 4ANUA 43C9A 3MRIB 2CJUH 5J5EA 2G60L 1OANA 1RK0B 2I24N 1HXKA 1KGCE 1EWHA 2XPZA 5JNYA 3V0AC 1J88A 3TX4A 4BCXA 2P42B 4PP1C 3NCYP 3PNRB 2WXRA 5HDLA 3RWJA 2FUQA 2NUPB 2H1PL 3NRPA 4NUPA 3EO0B 2Q6WA 2BCKA 5CP3H 4P2OD 1A8JH 2P8MB 1MZYA 3BN9C 4DKDC 1UQSA 3WO4B 2DKSA 3OR6B 4B7LA 1S7XB 1O5DT 4YIQA 4TKWA 3ZL4H 3UC2A 4I85A 1TIUA 5FA4B 2GFBB 5C9JA 4PJ8D 4GBXC 3V52L 4JPWH 1KDIA 1UFGA 1OP9A 3MOAL 1G1KA 1II4E 4MXWL 3MMEB 2ZXCA 3A67L 1WFOA 1S9WB 2XWBA 2R4RH 3HNTL 1ASQA 1NCCH 4JY6B 2V8LA 2BVOB 4K8RL 5B3NA 4I18A 5TDPA 1ACCA 2GY5A 4N0FB 3SE9L 4NC0B 3V95A 4N6RB 5EBLB 1JV2A 3RA7L 2WN3A 1NIDA 3CN3A 2JVUA 4YSEA 2OZ4A 1EEZB 1BZ7A 3BPOB 5KN5A 1I82A 2XZAL 3UTQA 2H45A 1XT5A 4G8GD 4PVBA 2PTTA 5EFIB 1KLFA 3INUL 3GI8H 3TA3B 5EO0B 2EC9T 2HX7A 2Z1PA 3O0LA 2YMTA 4ZTOL 1E7UA 1OD9A 2CAKA 4MZ2A 3QORC 3CVBA 4IRSD 3WLWD 1ACZA 2HUEA 4HS8H 1NBVH 4R84A 3Q8CA 3ES6B 4PS8A 2ADIB 3JWDC 3FFDA 1NLBL 2AC0A 2X1OA 3EFOA 5GXBB 4XXWA 4A7UA 5MERA 3HOGA 2BRQA 5DZVA 3PCYA 4JFFE 4G80A 4P4KA 1MW0A 1IO4C 4A04A 4YHLH 5AENA 4Z7UF 3WIFA 3QIUC 3S34H 2J5LB 5F1IA 1DQJB 4WTWA 1GCFA 4A7TA 3PGDB 4DJMA 3BWSA 4YDVB 4ZFGH 2VZ3A 2XN1A 1JPGB 3ZZLA 2HWZL 4XRCB 3C09B 2X6CA 1JNNL 5DTFB 2TSBA 4R4BB 2N7SA 3NCFB 1ANUA 4PS3A 1MELA 3RGVA 1CLVA 1DSFH 1XH3A 4K23L 5DHYB 6FABL 2AV7A 4YHKL 1QA9B 3CUPB 4LSDA 2ZXGA 3RX7A 2BNQB 3HHRB 5I76A 5JW4M 4KJWD 2BJMH 2IPKB 4GPVA 5T1MB 5E6IC 1KBGL 3P02A 3G9AB 5FYJU 1FI8C 4BZ1A 1AXTL 3BI9X 3O45B 4N2IA 3ZOAA 4LAJH 1A7OH 2N56A 2YJQA 5CSZA 1HS6A 2EIMB 1KCWA 3U9UB 2LT9A 5L88H 5EU6A 1YEJL 4E41D 1J8RA 1MF2H 3B8SA 4JFDE 5SX5H 3V5KB 2R4SL 4JHBA 3MRGB 4TSCL 5C0ND 4XX1E 1M6UA 5L2JB 3WBDA 4FD0A 3DO7B 3IDIB 4U1LB 4ADGA 1KNOA 2ZXAA 5H35A 1A6ZA 2JWYA 4Q58C 2DQUL 3D33A 2X9WA 4HIEA 1A9EB 1LDSA 1IC0A 3BQUD 4ETQB 2BFVL 1JTPA 5E00A 1OAQH 3AXLB 1KLUA 2Z35A 3SKMA 4R8WH 3FNKA 1CGXA 2ZOLA 35C8L 1OTTD 2J43A 4PG2C 3RKPA 1RZKC 4JQXC 4FTDA 1G7PA 1H15B 1Q94A 4Y8AA 1MCWW 1ID5I 4LHUB 1DBBH 2IGFL 4AVJA 4ODWB 3W81A 4EPSA 3RDTA 3IS1X 3RAJH 4AGPA 4XP6H 1WZ1L 4ZAKA 1P5VA 4LU5L 1CE6B 4ZOEA 5FXCH 4GIOA 5DQ9A 1CYGA 4B9FA 4LIQH 4WI2A 2V6HA 3CDGB 1OAUH 1PTZA 1A6VL 1N7MH 1SYSA 1YNLL 2ZTBA 3MCKB 4NHUB 4A2FA 5BVPH 4YBHA 3QC6X 1QLFA 3VWKD 1U8JB 4S0SD 1CDCA 3PGFH 5EC1B 1G7MB 3QO1A 1RZGB 2FEEL 5DF0A 5AOZA 4X5XB 1XCQB 3N0AA 4WWOA 4JKPL 5HHVH 1AHWC 2OJ1A 3QJSB 1ADQL 2R56L 3P4LA 1CGTA 4LGSB 2CUHA 3ZE2F 1TVBA 1N9PA 4FFZA 3EH2A 4K71B 3FTXA 5CR1A 2ZXDA 2XX0A 2E7MA 3P30H 5DEJA 2BSRB 2OW6A 1Q72L 2WO2B 2XN2A 3REVA 4HHWA 5L2KE 1E5BA 3DXAB 4QXVA 5FFGA 1JPEA 3MLZL 3D3VE 1J05B 3RFRA 3C6LB 1EZVX 5CEYB 2IDTA 2YKLL 4XVSH 1YMME 1S8DB 2E7LA 2KKQA 3QYMA 2GSGA 4FAAB 1JVKA 4TSBL 5GGSB 3VVVA 3LXBA 3TNNB 3PP3K 4PJ7F 4YDMA 1CYWA 4KMTH 5FYKU 4K0OA 3OKLA 4XCYA 5DD3L 1SOSA 2E46A 4Q6IA 3JVGA 2CPCA 1EAQA 4IMKA 4QAMB 1EHLL 1OAYL 3F8UB 5FYJD 1CG9B 1WGOA 2APWA 2LABA 5C6PB 4XPAH 5FUOH 2CE6A 2PCPA 3U30B 4CKQA 1MXDA 3C60B 3V8OA 5DRZB 2H26A 4H26B 5C0RH 1DEEB 3FTVA 4ECNA 1IJ9A 2PPCA 3CQPA 1SXAA 2W07A 1CIDA 2GUOA 2K7PA 3NCJH 4JL1A 4ATWA 2O5YL 2H47C 4KHXH 3BPLB 3D39A 3QUYB 1PVHA 4DGIL 5HYJE 5KYXA 3VJ6A 3FSOA 4XAWH 1SMOA 2YMXL 1OGAA 4YFEA 5KTEL 2Q2LA 5FC9A 3ULVH 4NSKA 4Z76A 1A7RL 1RJYA 2AABH 3ZYOA 4ADJA 1JGEB 2E6JA 5IHZA 1FL5A 2HLFC 5IMKA 3EUUA 4HUMB 3NSJA 3TESA 1JYWA 1OVZA 3WI9A 4PRHD 4MNGA 4K3DL 4TNVK 3LIZA 1F4HA 4PB0H 3CZFA 5CJOL 1IM9A 1D5MA 2H8PA 2GJRA 4IOIA 4PWJA 2OQJA 3E2HC 1M56B 4N0RA 4XX1G 3RZCB 4BSWB 2OR9H 4YHMH 3LRSB 5HD8D 1KLGB 1WH0A 4LKCA 2X2IA 4M61A 5J57B 1JGDB 1WC7A 1ZT7A 4JM4L 4KROD 4JO8A 4F8QA 2WWMC 4HP5A 5EU7C 1IBGH 4K7PX 1WEJL 4WTZG 1AOZA 1MWAA 5CIPB 1TVHA 1N0LB 4OQ1A 2OTPA 2E5EA 4OLZL 1MNUH 3Q2VA 3OV6A 2VXQA 1LDPL 2MCPH 3VFPA 3GRGA 3J2PA 2Z92A 4AGMA 3VNYA 4UT7L 3QG7H 3RILA 5AOLA 2PW1A 3JYBA 5IBLD 3QNZA 3RVUC 1FFPB 3EYVA 4OJEH 1CF1A 3VFVA 3VXMA 1KJMB 5KSUB 1CF8H 4MMZC 4NZUL 4TVUA 3MLRH 4XC1H 4ZPVB 5IF0A 4M00A 1E6OL 4GAJH 4AQ1C 1ZS2A 3C2SA 3NN8A 4CU6A 5DD6A 2P48B 4PWKA 4BDVB 3RDTD 4QRPE 4U2YA 3JTBA 5E2TH 2YZ8A 3Q06A 1DE4B 1ODUA 1LO0H 2WM0A 5I1JH 1C5DA 2FEDD 4ODUB 5FYKD 3SDDD 2O30A 2OL3A 4X4YB 1PZ2A 3LZQA 4J3OF 4OLWL 1BMZA 3D5OF 4JFHE 1P7HL 1L0PA 1QACA 2MKLC 3FB7A 2ADFL 3QDMD 4AYDC 2WO4A 4PRDB 1T7WA 1ZA3B 3HZ3A 3UO1H 4J4PA 3Q8FA 3C08H 4AMWA 5A16B 1UCTA 1CK0H 2VR7A 2HAZA 5AAMA 1QBMH 1G1YA 2VR8A 2WXHA 3F7PC 1W8NA 1CO1A 2VR4A 1NEPA 4LNRA 4LRNL 2E4TA 4H0HB 4NP9A 3HRZC 4KVNH 3GSQA 4HD5A 5JYMA 3GZQA 2AEQL 2F58L 3W0WB 3CZUB 4F15C 5FB8A 3UYRL 3B1TA 3TBWB 1X44A 5BCAA 3Q3GA 2V17L 3RPIA 1VENA 3APDA 4R96A 2NY2B 2Y6TE 4DKTA 2L7EA 1KYUA 4I0KA 1DBAL 5IG7A 1HHHB 1TQUA 2DEWX 2XT1B 5GRJL 3RVWD 5LNGA 3NQIA 4X7DC 3MV8B 1NC2A 4WY7L 1A9BB 3R4DA 5IOKA 2Z0BA 5IOPA 4Z7VA 1L0YA 3O11B 4ACPA 1YEHL 4DO4A 3CLWA 3HAEG 4MS6A 4O4YL 3T1WA 1KENH 1ESOA 2PYEE 2RALA 5DJCA 3ZGIA 2CXGA 2R0LH 4PJCE 1KFGA 2DBLH 3BEVA 1EO5A 3NFPB 4N90D 4AMXA 3DTUB 1Q1JH 4KFZC 5L4MA 3ZTEA 5BZZA 1NSNH 4N2LA 4Y2DB 4UMSA 4P5MA 2AAVA 3QXUA 4XP4L 4WEMB 4U6YB 3S4SB 2QSTA 3ZQXA 4GRLA 2CO2A 1N64H 3F58H 5H8DA 7PAZA 1YPZE 2JQZA 4ZMQA 3QCTL 3SBRA 2A9ML 4L4VA 4P5SA 2VM3A 2W91A 2CG9X 3CVIL 3RU8H 3DX6A 1WITA 5D7JB 3V4UH 3MLUH 4RMRA 1Z9OA 3N43B 5ADOH 2B1HH 1ZGLA 3T3MF 5DWUL 3IJ8A 4LCUB 4NHCH 3WAKA 5HHNB 2JMRA 2ORBH 3FO1B 3GXMA 3ULAB 1U8HA 1ZV2A 2ADGB 1DQIA 1F41A 2DKMA 1R3KB 2E59A 3FB6B 4IU3A 2R2CA 2AJYH 4J8QA 3SPIA 3PL6A 3I9PA 1AIZA 1KJ2A 1ITCA 1FCGA 1JV5B 1SN5A 4K7PH 1IAIH 2ISDA 1U42A 2ZYRA 5C08A 5LGHL 3GIZL 1B9ZA 4YNYA 3QEQD 3WTXA 2WWOA 3K81A 1ZVSB 3C6SA 4KVCH 5I8OL 3CVHL 1UKTA 4I5BB 2DY2A 4Z7QE 1JZ5A 1BF2A 2DMGA 4WTZA 3UAAA 2JTDA 2CCWA 2VNCA 2UZXA 4LLVB 4YMPA 4IDJH 1EGJL 1DQDL 2RB8A 1RUML 3C9NB 4N5UA 4O02H 5JHLH 3BFQG 4HK0A 3B43A 4I4WA 3DRTB 4QCIA 3CFCL 1RL1A 4L2YA 1WK0A 4I1PA 1JYNA 1S7VA 3L5XL 3MOBL 3TPUB 5I19L 1MJJB 3RTQA 1D5XB 2VW4A 4HUWB 2AXGA 2X70A 5FCUL 5I1HH 3MCYA 2XZCH 1M7IA 5EU3B 1MAKA 4YXLL 5EU5B 4UOW0 4A6YA 5CJ5A 4Q9QH 3IFPA 2WBJD 1F1DA 1E4WL 1FFTB 2YHGA 3L5WA 1KT2A 1IFRA 2WTRA 2UUDK 2D8KA 2FJFA 5D7SH 3JZ7A 3TNMB 3LEXB 3ZDZE 5AG8A 3T6QC 5GGTA 3KWXA 4U1IA 3EFDL 1C1EH 2YAEA 5FHBH 6PCYA 5CLTA 2WQWA 2J1WA 3BHBB 4MNQA 3NSFA 3ECUA 4MJ2A 2F53E 5F3HB 4X6EB 2B9BA 1BFOA 5C0GA 1B0RA 4P46D 4H2AA 1COBA 4J7RA 1FV1A 2MHAA 1R3JA 3KLSA 3OPUA 3RY4A 5C0FB 1QYGL 3BRFA 2YGNA 3VG9B 3PWJB 3MRNA 2MIZA 2XN9A 3V6OA 4EO5A 1X9UA 1F8TL 1AO7B 3C5XA 4RH4A 2FGZA 1YJDL 3BO8A 5EPMA 3BT2H 4LCWB 4WI0A 3OJ2C 4J28A 2EKSB 2WNXA 3PWNA 1E9QB 4PW3A 4PLJC 3SE8H 1CD8A 2NX5D 1JNJA 2G2PA 2M26A 3P77A 3KYAA 3HS9A 4UT9L 2YJLA 4YDJB 3QZWA 1V7NL 3JV6B 1AANA 4AUUA 3T0EB 1CXKA 2BIOA 1AZUA 4D3CL 1O9VA 4UDTA 4GSDL 4DPAX 3G08B 2ITEA 5DEFA 2X88A 5SWSB 2P8PB 4B41A 4KOCA 5I1AA 4PEEA 4U7SA 4QXWA 3GHPA 1EAPA 3WY1A 3OMAB 2JB6A 3BE1L 3U83A 4ZSOB 2FATL 1HHIB 2Z8RA 4HWZA 4LZKA 3MRCA 3SQBB 3MLWH 5IK3A 2WQXA 2N4IA 2QQNL 1BBJB 4FERA 3FFCB 1RURL 3RG1C 2QHLA 4P5TC 4X4MA 4K9EH 4XZUB 4ALAL 3KDPB 2E4FA 4ISVA 4LMQI 2JQAA 1LP9F 3KPQB 5D55A 1K4DA 3FT2B 1XEDA 4BKLB 3N3EA 3HZYA 1CN4A 1KIQA 3CU7A 4NN7C 2E6PA 3B9VA 4YO0A 5HYJA 4Q2ZB 2WZ6A 4HPOL 2NY7H 3DJSA 2Y3NA 3TV3H 5TE4L 3HG1D 2VDNH 2EVHA 4AV5A 2IWEA 2HYMA 1UD6A 3MRBA 2YFNA 4G7SB 2ZAIA 4PGCA 1MFCL 1U8KA 5IGXH 4JDVA 2YD4A 4YJZL 3GMMA 3SDAA 4H20H 3BT0A 1IC4H 1JPSH 1YUHB 5A6LA 5AB1A 3VFOA 2UWEB 1JWSA 3B9EA 5EEYA 4WUUD 2YMOA 4PW9A 5FGBA 2RACA 1GZHA 2DI9A 2IH8A 2MNJB 4Y2LA 4MAYD 5IBTL 4FLOA 3PWVB 2H1XA 5C0IB 1CXFA 4EIBA 1ZOXA 4M5SA 1PCXA 3UEQA 3NJHA 4OLXL 3PQYD 4K3JL 1K2DA 5D2LA 3QSKB 4LRIC 5ANHA 5AW1B 4MD0B 1O7DE 5F7DA 3P4NB 2GUYA 3MGOB 4JRLA 1L9OA 1LK2A 4KFMA 4W4OA 1BVOA 1OB1A 3ML8A 4W9DC 3UYPB 4OIIH 2EQDA 2ATPA 5DVOA 1UCBH 1T7XA 2OXGB 4E9SA 5E8EA 1AE6H 1UT2A 1FZKA 4PWFA 4K8RC 2OULB 3S96A 4PJAB 1MI5B 4KV5E 3KPSD 1CDHA 2CPUA 4LDCA 4FKHA 2Q3ZA 3MV9D 3IMBA 4FZ8L 4L1HA 1YAZA 1HXMA 8CGTA 3BAEL 4TQPA 3OL2A 2Z34A 2GK2A 5E2UL 4E9XA 3VGGA 4XMTA 2VR5A 5SX4H 1SXSA 4YC2C 3RRQA 2EVJA 3PJLA 4NS0A 4DKFL 2V8MA 4JO1H 3T65B 1PYWA 4LB8A 3FU0A 3L08A 3ZT5A 1KACB 2OSXA 3OD3A 5IEHA 5B39A 1VFAA 3CWGA 5CP7B 5I74C 1FL3A 1IZKA 1U93B 4MSWB 4UYPA 1N0XH 1I1FB 4QWWD 1HKLL 5HJDA 2I9LB 1E9PB 1YG9A 1GZQA 2R2HA 3U7WL 3VE0A 3FUMA 5GS1B 4X8CA 3BEWA 4MCZB 4M6NL 4WO4C 5DZPA 1GYUA 1AKJD 3OZ9L 3QDGE 1OE3A 5FYLL 4AWJC 1BQHA 1PY9A 1KJVB 4LVHC 3OHXB 5JOEA 3O3BA 1AZRA 2A99A 4XOCA 1LWJA 2H32H 5A7EA 1NMAL 4LO9A 2J1XA 4WUKL 3I6KA 5F9WB 4ZUTB 3VG0H 4TMPA 2GJ6E 4C59B 2F54B 5H2BA 3P0VL 2MWCA 1E7VA 4LSPL 1FSKB 4PJCA 2DM7A 1NAMA 5HHQA 1TITA 1HEZB 4POZD 1HINL 1MHHB 1RMFL 3MODH 3QJZA 5DD5H 4OI8A 1TSRA 4KTGA 4NWTL 3FQNB 5EUKA 3ROOA 2LVEA 1FBIL 2CDFB 1THCA 2CALA 3JV0A 4OZFH 3IMVA 3ZJAA 1A7BA 1LM8V 2BOCA 4NQSB 4R5TA 2R8SH 3CCHB 3NACL 3OLDA 1RUQH 4N9GA 4UT6L 2VH5L 3HE6C 5JW4Q 1LEIA 3OXRB 4NT6B 1TNNA 5FM5M 4KKZA 3N1FC 3NAAL 1ZSDB 4M3HA 5C0CE 1S7WB 4NQUA 3X11B 4DPCX 5F21B 3ULVD 3OR7A 2WXNA 1J8KA 2NZ9D 2GCYB 1AGCA 4NB7A 3H2QA 4JFZL 2D3JA 1Y1DA 3T4AA 1IGJA 3VCLA 4XXDA 1JXGA 2VLRE 3LHAA 1SMDA 4L4JA 4DTGH 5IB3B 3Q9QA 4GKNA 1ILUA 1QBAA 2Z91A 1JGUH 4H25A 3FQWB 1IC7L 5AL0A 2Z4TA 4X0KA 3T77B 3WD5H 3DX1A 3BKCL 4Y5XC 3IVKA 2PP9A 3L4TA 3MBXL 2LLNA 5CUSH 4FFYA 2WVUA 4D0CA 1ETJA 3HZVA 3ZHNA 2CA3A 4I0PD 4M02A 4Z7UB 1A3QA 1KN2L 2AEPH 4PBDA 3KE0A 3ARPA 1F0LA 1RZ8A 3SDAD 4AYBA 2FIKB 4NN6B 3VQMA 4NUMA 3D2TA 1T66C 4N2CA 3HIZA 1E5CA 1L3NA 4RGNC 2GABA 2I69A 3E6FB 4DP1X 4N86A 3HHSB 3BVUA 3MXWL 2AV1A 4OZHF 4JPIB 4EXKA 1U2YA 1RIUH 3PWLB 4CVXB 4YHNB 4R7VA 3U7AA 4OFYA 5KWYC 3WFBH 3ZDWA 3M88A 1TQCB 3I6GB 1RK1B 5J3HC 2DLIA 4EIUA 1CBVH 2AMGA 1G6RL 1MRDH 4X5RA 1QSZA 4PV8B 4HIJA 4DN4L 4M6OH 3QIWB 4ZX3A 2XVBA 4JZOB 1RUAL 2HTLC 4GMSH 4WNJA 2VZOA 1W15A 2HN7B 2J2ZA 1AC0A 1MHCB 1SEQL 1VJSA 2OA9A 3MLTA 2PPFA 3QPXL 2GBUA 2AI0L 3JWNE 4IEFA 1RULL 4JHZA 1BQRA 3NYKA 2CUAA 3JBG7 1YCSA 2GJZB 5DRNA 3TBCA 5DR5L 4RX4A 2DLTA 5CINH 3VB8A 5I1KH 1NGQH 3LB6C 3P2TA 2VDPL 2X1WL 4AV0A 1QHOA 1T83C 3O4LD 4C47A 4PJDE 1R24A 1J9TA 2Y5QA 4HG4J 2C26A 5IQLA 1G9MH 1T80A 2A1WL 1N19A 3CFDA 4J3TA 4MDRA 3HC0A 3BSGA 3DTXB 4GB9A 1Z9MA 4R2GB 1MZZA 4G71B 4EZMA 1LO5B 4PBVC 1JZHA 4GUOA 3EYOB 2WMPA 3OKOA 5D2NE 3UTPD 4EMZA 3EF7A 3ZTNL 4BK5A 1RUPL 2NY0D 3FO9B 4Z95L 2AJXL 3S3CB 1YLBB 1F86A 4N8VA 1W0VB 3HN3A 1GVIA 2J25A 1KIPB 5EWIL 1B4JH 3S9DB 1ETA1 2ITCB 3MA7B 4JRYA 4X6CE 4UQBA 2CBPA 1EJOH 1Y1UA 2F68X 2IPUK 4PREA 2R0ZL 3U7YH 1D6VL 2DJUA 4KKCD 4NJAH 1E28B 1T7VA 5GISL 1CYXA 3MNZB 1WFTA 5EIIA 4Z3JA 3ZE2B 4IS6A 3VYNA 2XNAA 4YQXL 4PGDA 3RGHA 1EHLH 2EE9A 2DMCA 1DVYA 3WV0A 1DUZB 12E8H 4MQSB 4U3HA 5BUAA 2OS7A 3GK8H 3E9UA 1A1MB 4IHOA 3RJDA 2BHFA 2WANA 2FL5A 4N25A 4DP5X 4ZFOA 4UWQB 4WV1A 1C8PA 1P7QB 1GPOL 2KMWA 3MNVA 4CMHC 2WGXA 2DD8H 1CXEA 2Q8BL 2VITB 3ULUC 4OCSL 3H42H 5TDNB 3VI4F 4PJ7B 5BOPA 3F05A 4NKOA 1GTNA 4KVPA 3P3YA 4F8LA 3GBNH 1USZA 2RCSL 3FT3A 3GJFB 5DS2A 1YEKH 2VDLL 4LASH 1AXSB 4ZNEE 3SDYH 1J10A 4HG4K 4EI5A 1LO2L 3M7OA 3T2OA 2XG4A 2EYRB 1N59B 1DJHA 4IOFC 1F1GA 3B6SA 2F19L 4JQIL 3VXQA 1BD2A 1TQBB 5F1KC 4D9QD 3IAGC 1FIEA 5K1JA 2ZONA 4FXKC 2A4EA 1EPFA 1NCGA 3HR6A 4F7CB 1KN4L 3I6SA 3DI2B 3OPZL 1JDCA 4QRQA 2OI9C 4DP7X 5JXAL 1ONQB 1YEDA 3KLQA 3DLQR 1D9KC 1KB5B 1KCVH 3ARDA 4PY7B 3V4PH 1S5HA 3APNA 4FADA 4HWBA 4TRPH 1AI1L 5LO7A 3TCTA 5KVFH 1XCXA 5EOQH 3CN1A 5C07B 3VW3H 1S7RB 1VGEL 2XDHA 2ZPKL 3G5YB 1U8CA 2UV3A 2FX9L 3A6CL 1I8IA 1IT9H 4ZQKA 5EZJB 3LS4H 1NDMB 2CLVA 2WINA 1CE1H 3B83A 4MAZA 2Z65C 4JM2A 4OCNC 1NPNA 3EO1A 2EILB 3PDOA 3V0WL 4CADB 4HFWB 4OCMC 3APFA 4IOSD 3OKNB 4PH8A 1U95B 1ZVNA 2D0FA 1ADWA 4GW1B 3IDYB 4UV7L 5FO7A 4OLYL 3S3SA 2HT4D 1JK8B 2VDRL 4HKZB 4TSAH 5ID0B 1WS7A 1A1OA 1V8HA 4M03A 3EH5B 3UTSB 2VT0A 1R3HA 1O6VA 1ZIBA 1BAWA 4E42A 3L8QA 4J3SA 3JWNG 1DFBH 1S78D 5J6SA 4FG4A 4X9GA 1EIBA 4GMTL 5KVDL 2AK4D 1YECL 3P4MB 4LEEA 4QTIH 5FYJE 5DSCA 2F6AA 3EOYG 3HLAB 4XH2A 5F0MB 1TZ8A 4X6DA 3A6BL 3SDCA 3QI9C 2QGBA 3HI6L 3IJYA 1C16A 1E65A 3P40A 4JFEB 5E1IA 2BW5A 2FX8L 3HZMB 2PR4H 4RWYL 4YBLC 2B7DT 2X9ZA 5IIEA 2Q10A 2YAOA 4UDUA 5AW3B 3SGDI 4I48B 1IBYA 1TJIL 3EH4B 3V0JA 4A2EA 4APXB 4J23A 5HVHB 4NC2B 2W65B 4JFYB 4QIRA 5JW3L 4KK6C 1YAIA 3R7QA 1S7UB 5AUMA 5KYWA 3MRKB 1BVLB 5ECGA 1IZJA 3L3OB 2X4SA 4N2KA 5JZ7C 4DW2L 1QBLH 3U0PA 2DM4A 3GGWB 2ZG1A 3M6DA 4CSPA 3GJEB 3QEGL 1PX3A 1TENA 3QRBA 5GSVA 1UA6H 1UM5L 1WBZA 1TZIA 4Y4FC 4BINA 5AALA 1B90A 4HH9B 1H6UA 1XCTA 4ZOAA 1OM3L 4HGWA 3HE7A 3V0VA 4C4BA 1GJIA 3PNWA 2AVGA 3G5ZA 1OK0A 4PRHE 1RH8A 1BXAA 2ZCLL 5E6YA 4YXKH 4X7EC 3ZHDA 4LMQE 1AYOA 3V0HA 5HBBA 1DFXA 3QXAB 4WFFD 2F61A 1AJ7H 4WI8A 3UAJC 2O26U 3NFNB 4AIEA 2XYBA 3LPWA 1Y6MR 5DRXA 4I89A 4TULH 1RCYA 1DDTA 1KZYA 1GOHA 4HCGA 2ILLA 2WLIB 1BW8A 3QUXB 1OSYA 3L5HA 3ZYZA 2FWOA 4BWTA 4OR1A 3D4YA 5C2BL 5GS0H 2DQDL 1FNEA 2DF3A 4LPVA 4YBQC 2WLHA 3H1ZA 5JA8B 4EQ3A 4YR6B 3HI5H 1IQWH 2B15A 3ARZA 4G2AA 3ZN6A 4UTAL 3DBSA 2EEXA 3MA9L 5T1KD 1J5IA 2HJFA 4OB5L 1IM3D 4WU5B 3MUUA 3WN6A 4RLDA 2VL5B 4PP2A 4P2RB 3IF1A 3NJJA 2FBOJ 2OJZH 4L3EB 2QMKA 5ILTL 4AL8L 4YDIL 3V0EA 4NWUL 5LVEA 1L9RA 2E7CA 3AUVA 5K9OA 5ALBL 3FUDA 1C5BL 3PABB 2P24B 1OAXH 4P3CL 4CW1A 4L8CA 4WLCA 4N0UB 4P5KA 1WQVT 5DU7A 4WCYL 1G7QA 5FYKE 3MZTA 5DZAA 1AQMA 4NZDA 3L54A 4IIQA 3T4YB 3BQVA 3BD3A 1RHHB 2GSIB 2XWRA 4FYTA 4I2XE 1FIGH 4ZO8A 1NCIA 3QDME 2FBJL 2PWFA 4L29A 5ECJE 4L23A 5LG1A 4UM8A 1MUJB 5JPMB 5EEWA 2OMUB 4FZEH 5I66A 1T0MB 1K4CB 2ZSWB 2EUXA 1BOGA 3OGCB 1Q1PA 3T3MB 3V9CA 5F7FA 1HHJA 4ZXBA 1GA2A 4OCYH 4JDTH 1YJDC 2CO1A 3NTCH 2Q86B 2CO3A 4GXVL 2C7UB 2DQIL 4GS7B 4FE9A 1QLEL 2GSMB 2OSLB 3AY4C 2WLLA 3GEWB 2JJWA 1KTDA 1ORQA 2R23B 3CX2A 2YA1A 5JXED 2QPFA 1T4KA 2FX7H 4JHUA 4OZGE 4XBGA 1CD0A 2CU9A 4JY4A 2GY7B 4QAWA 3KBFA 2GJPA 3ARRA 4WI9A 5IT2H 4KHTL 4PI2A 3H4FA 4CC4A 5IR1A 1EUUA 5BRQA 4K5PA 4G8IA 5AOJA 2KT6A 5F97E 3RGBA 2XLLA 2BY2A 3TN0A 1MLCA 4CA4A 5KVMC 5JQ6L 4HJ0C 1KBBA 3GXIA 2X0VA 4DIXA 4D0BA 4MQXC 1T3FB 4YZFF 2EYSB 4ZTPH 3F12A 1IGMH 1SBSH 1TTRA 5I23A 4F8OA 2Y1YA 5E8NB 1MCIA 4FEIA 4WWKD 3CXHJ 5EUOE 3TH2T 2W1NA 4BUGA 4NM4H 3N1QC 4D8PA 1P4LA 4W9ZA 2RQ8A 2HH0H 3L9RA 2MEJB 4DKEH 5FO9B 4X6CA 3L48A 5AL8A 4FTVE 3IFLH 2H6PB 3V6FB 2NDGA 4FQ2H 5GGRY 2AZAA 1KTKE 2NSQA 1IAII 4QF1B 4UOQA 3ELQA 4PJBF 1QHQA 2VZVA 4PJHE 4WW2F 2KZBA 5I30H 3DRQA 4FA7B 1VAHA 1AS8A 3X13B 2X7LA 1MHEB 4GBXB 3SE4A 4TVPD 4JPQA 3FOLA 3JTSB 1BYNA 3O4OB 4WQOA 4ANKA 3QEQE 1RK7A 1OF0A 3PG2A 5CWSA 5DFTA 4DZ8B 3VMOA 1IEHA 3T0VA 3FT4A 5AWNH 5KS9E 5IJKA 1BAFL 1NCUA 1ZAGA 2ICWJ 3LNGA 4AT6B 3RWGA 2X5PA 1D5RA 4PRID 4TYUA 3PXHA 1GAFL 2O6DA 2VN7A 2ZUSA 5IVXE 3H56A 1P1ZA 1ZT1A 5F7MC 1DN0A 5EZOL 3TT3L 3SCMB 1J1PL 4A2MA 1U36A 2OW7A 3GXNA 1QPXA 3D08A 3ZGHA 4LPXA 3EYUL 1NCBH 3MRIA 4KGJA 3S36L 3WFHB 4LSSH 1RSYA 2CKBB 3QRGL 4R4NC 4XMUA 4P04A 2VXUH 5D1QC 5LAPA 1ORSB 1DBJL 3KW8A 4JN2B 1TTBA 4NM8H 2B1AL 1B2WL 1EO8L 2NUPA 3EO0A 2X4PA 5KSAC 1H19A 1A4BA 2YWZA 1DZBA 2E9IA 2P8MA 1QUNB 2BP0B 1G87A 1TYJA 2D9CA 2AKRB 1S7XA 2JK5B 3WG7B 3IEAA 5FA4A 1SM3L 3M1OA 1NMBH 5C97A 3A23A 3O6FD 2EEBA 1HL9A 2ZXEB 1XVSA 2WJ5A 3O3EB 3CXHK 1LP9B 1TYRA 1S9WA 1UD2A 3NT0A 4YEFA 1CGVA 2CR3A 4WGKA 1OE1A 5EDXA 4F57L 1K8IB 3T0WA 2F9BT 3E8UL 6PAZA 3GBML 5E4EC 5E03A 2WWKO 4LVEA 2RR3A 4N0FA 1TUPA 1BAGA 1NFIB 2XU9A 4GQZA 4KMLB 5TE6L 4N6RA 5EBLA 5HDWA 5DGRA 2MTAA 1T2XA 5A2JH 1H3UA 5DMIH 3Q13A 5IJCC 2BVTA 3MLXH 1Z32X 1EEZA 3NPSC 5AW0B 4K3EH 5GGSY 3NCEB 2NX5E 1YMHB 4RVBA 4QRRA 3G04B 4FABH 4LVOB 2BH0A 3KNBA 6TAAA 5E6IB 4HUUA 3RX8A 2DYPD 2CLZA 1B0IA 1T6VN 2BRRH 4KX9A 4V2CB 4M1CC 2B3IA 5T3XL 4BQ8A 2NY1C 3L2LA 4ZW7A 1CB4A 5EA0L 3EFFB 3EJYC 3I2CL 4K3GA 4KZ0A 2ADIA 4ZS6C 4A7QA 2ZNWA 1JDDA 5FFOA 2Y6SC 2MMXA 4ZXBD 5EBGA 3T1FB 4F9LA 4ZUUB 4TV3A 4S1DC 1MCOH 4M48H 1EANA 5AVZB 3VXRB 1EDHA 1W72A 4DQOL 1AOHA 1DQJA 1E8ZA 1XTMA 4PRPB 4XB8A 2VXSH 3PGDA 3HMXA 1MY5A 4XP1L 4YDVA 5ISZB 4FLQA 1JPGA 2ZX9A 4XRCA 1NC4A 4R4BA 4EF3A 2ZKMX 4KGLA 4OF6A 3W9DB 1MXGA 2UY7A 3TH4T 8PAZA 4BM7A 1DANU 2H0PA 3QJUB 2GTWB 1DLFL 3ZUCA 4HS3B 3CUPA 2H3KA 1QO3A 5I0VA 2DH2A 2VL4A 3AG1B 2BNQA 4YHZH 4OI7A 1FHNA 3BD4A 3C5ZC 3HG1E 3O9WC 2IPKA 4AC2A 5T1MA 5AAPA 2CSPA 2CGRL 4NO2A 5EH1A 4L9LB 3O45A 3OMZA 1E8XA 3LN9A 4OGYL 1CFSB 1WBYB 4Q74A 3EDEA 4Q9RH 5JTWA 3RFZA 1XF4B 3CN4A 3K72A 3D85D 3GDBA 4QHMA 4HSAC 3CHOA 3T2LA 4WUUE 4HLZG 3V5KA 3MRGA 3W5MA 2FSEB 4R7DB 4R0LC 4HIQA 1A3LH 3PWPB 5HHOB 1PKQE 1AHWB 2I32A 3IDIA 4G1MB 4U1LA 1KZQA 1I3RB 2E8YA 3GHEH 3MCLH 1WZAA 4FN0A 3O2VL 3PQYE 2BP8B 4ETQA 1KCKA 1UJ3C 1IJNA 4IGBB 1JPTL 5BVJB 3GWJA 3V7MA 3WIIL 1MVUA 1FNSL 2BZCA 4AX3A 1VGKA 4OZ4B 4DETA 1NINA 2AQ3A 4RESB 2EECA 1H15A 3JUZA 4E5XG 4X7TB 3VX1A 1SDYA 2NTSP 2YUZA 4G5AA 3FTYA 4Q0XL 2YA0A 2BVUA 4LIQE 3TYGH 3ULUF 4JFXB 2BFGA 4WWNA 3VXSD 4HC1H 3RTLA 3CDGA 4GUQA 4E9TA 3QG6B 5L4JA 3GSNB 1FO0A 1BVKB 3MV9E 3RYMA 1TNMA 2QDVA 3MCKA 4YHIB 5SX4I 4ZYKA 4IRJC 4LSRH 4DAGL 4KU1A 1KV7A 3UP6A 1SN2A 1E3XA 1U8JA 3JV4A 3VU1A 3S37X 4K07A 1MJ8H 1G7MA 2QVFB 1RZGA 1RLWA 2BNRB 3NCBB 1KG0A 4X9IA 1L3WA 2W94A 4X5XA 1XCQA 4KKLC 1N8OE 5CLWA 4OLVH 5CJBA 4AZUA 1E5UI 1ES0B 2J8UF 4A2DA 3CXFA 2F7IA 1F1AA 3BXNB 2E8ZA 2XFXB 2EDKA 4XMPL 4X4KA 2DH3A 1JXFA 3DECA 1AZBA 3GLDA 5EOCH 3OJMB 4LSUL 2VN5A 5IBUG 1KC5L 2BSRA 2EDNA 3UERA 4OGXL 4XVJL 1N5YH 1MPAL 2HJLB 3UPRB 1ZLVK 5AZEH 5AW9B 3DXAA 4BRJA 3NA9L 4ORGA 3KYKL 4WEBH 5B3SB 1VFBB 4PJ9C 1S8DA 4RZCB 3U46B 5FLUA 1I8UA 3ARBB 5GGSA 5TQ2L 1ZTXL 2X44D 2D9QB 2ZUTA 3AG3B 4Z6AT 2NXZD 4OZGA 5DLMH 3F04A 2Z3FA 3F7RA 1MLBB 2YD9A 2HP4A 2DLHA 2KI6A 3FSAA 2EDHA 4P06A 4GKZA 3FZUD 2DN7A 3KMDA 4ODXB 1CG9A 2OZ4L 2G60H 3E2HB 3LQAL 3UJTL 2EXSA 3KXFB 1MCPL 3Q8AA 2H2PD 3TA3D 3UBHA 3C60A 1QEXA 1F4YL 5I82A 4FXLA 1HFUA 5A2LH 4Y4KB 5DRZA 2DQHL 5D9SB 1CI3M 1DEEA 2H1PH 3SZKC 3TZVC 2DQCL 4OZHB 3KPTA 3IXTB 1MCJA 3IT8D 5D1ZI 2E76C 5JOPD 5EUOA 3SOBL 4LLQB 3FKUS 3GSRB 4F91B 2HKAA 4U1JA 4LSTL 1ZPUA 3V52H 1L9SA 3MOAH 3ULVE 4MXWH 4KI5D 4WU7A 3A67H 4J3VA 4FTVA 2VDRB 2YPLB 3IMUA 3N85L 3HNTH 4FMFA 4LPYA 3RIFK 1HNFA 4FFVC 1PFCA 4K8RH 1JGEA 5HGHB 1HH6B 5A40E 3BVDB 4P23A 4L8DB 3SE9H 3ZKMD 4MMZB 3ULSB 4FA8A 4UM9B 5KJ4A 2CD0A 2KS0A 2WOBA 4ONFL 1MVFA 4AQ1B 1L6PA 4KXCA 3RA7H 4BFNA 5E2VL 4XNQB 4RGOL 4YDZA 5GGVL 1WTGT 3S3JA 4ABVA 3OAWA 2Y2WA 4AK2A 5KS9A 3QQ4A 1V7ML 5B8CA 2Q20A 4GQQA 2XZAH 3EBGA 4Y7OC 3RZCA 5F44A 1QEWB 2P7TA 3PHSA 4BSWA 1DJSA 4DP8X 3KGRA 3T0AA 1KLGA 5GSRB 3ASNB 2Q76B 3INUH 1JGDA 4XBMA 1CWVA 1NMCB 1QSFB 4MCNA 4GXFA 4ZTOH 4BZ1L 3B9KB 2A7BA 1IL1B 1FORL 1SYVB 5E5MA 3OG6B 3SGKA 5GS0D 3WFCL 4XE5B 4RRPM 5CIPA 1N0LA 1I31A 3ME0B 5GJSL 3N44F 1NLBH 3DX9B 3A4FA 3D18A 1ZANL 2Y0SA 3HRZB 5A2FA 3BAWA 5GJTL 4AMKL 1XF2B 4GT7A 4YDKL 2IDCA 1TZGL 3CHPA 4FQQB 4N87A 4M5YL 5CEZE 1JPFB 4ESKA 3UTZA 4YH6A 2C7FA 2OCJA 4MX7B 3WXVL 4FKEA 5E5LA 1KJMA 4ZOCA 1E8WA 2MCAA 3F64A 4ZPVA 5BO1L 1QR1A 2HWZH 2ZUQC 3KAAA 1GSKA 5F9AC 4LHUD 1JNNH 2JB5L 3QS2A 1WBXA 4BDVA 2JLLA 4HIIB 3BVNB 4F9PA 3WTYA 2OMYA 3BP4B 2ENQA 3NK3A 2WKOA 1HWGB 1DE4A 4K23H 6FABH 4YHKH 4NQCD 4ODUA 4AGQA 4ORZC 4DF9A 4BA0A 1U92B 2NYYD 4X4YA 3BUPA 1XB3A 4WHDA 2CNYA 1V55B 4BK8A 2I9TB 4DO5A 1M2VB 1KBGH 3WHE0 3WOVA 4Y2NA 4YL4A 1TF4A 1M6OB 1R3LB 1ZA3A 1AXTH 1WWWX 3BZDA 3SOTA 3R4RA 1FFOB 2BX5A 5F7YC 5A16A 3KDMB 4XBPB 3AREA 2W92A 1AP2B 2ZD0A 3CIQA 3O4LE 2HRPL 5B4MC 4PB9L 1MH5A 1YEJH 4CVZB 5TF1L 1NCDL 3VM7A 2R4SH 3RBSA 4KO5A 4TSCH 2OMTA 2QL1A 3VI4B 2A0LD 2XY1A 3LSOB 1A6AB 5DUML 4KRPB 1J5OL 4IBWA 1OSZB 3EYFB 2XVLA 3TBWA 1P84J 2AQ2A 4IU2B 2DQUH 2WLNA 3QWOB 3UTPE 7TAAA 2BFVH 1HHHA 4FFZL 3EJSA 2ZOUA 3DGDA 4A7GF 4KKQA 35C8H 1A9BA 1KEML 1IGIL 1CQKA 4GW5B 4X9HA 2ZE0A 1CBJA 3I9AA 4IJ3B 1RJLA 3QEHB 4JZJC 3UTTB 1XGTB 3MJ8B 2IGFH 1HTYA 3LKPA 3C6LD 3C87A 5C2UB 3L7EA 1V3MA 4QHPA 4JPSA 4JFWA 4NYLA 1WZ1H 5AVYB 4QRTB 5CHNB 4RAHA 3TIDB 3BGMB 4LU5H 1AHMA 4AVHA 2AFNA 3NFPA 5MEPB 3MZGB 2W9EL 2ZG3A 4K94L 4Z3GA 4G6ML 4Y2DA 2NNAB 1A6VH 3CLFL 4P49A 1YNLH 1IILE 2R2EB 2Z7UA 4U6YA 3S4SA 3PS6A 4AH2A 3DOIA 3WDJA 2KQNA 3K6SA 1WO2A 4TNWF 1VERA 5ITFB 5KVGH 4M7ZC 3QYNA 1AQDB 4EUPB 4ZW6A 5JHDD 5HGGS 5K9KA 2YS4A 2WNKA 3DIVA 1A4JB 3U36A 3T6VA 4JR9L 3VWJD 5CNHA 3MV7D 1UVQB 2J1KA 3QXWA 4JKPH 5DZ9A 3S97C 2XIDA 3I84A 1ADQH 2R56H 3O8XC 2GT9B 3FO1A 3PPEA 1MEXL 2EIDA 1B4RA 1R3KA 1FZMB 4U6HB 3WN5C 3IPBA 4PRNB 4WNSA 5FO2A 3F7LA 5E9AA 3MRMA 1JV5A 1V3JA 3QUYD 4KNQA 2A77L 4KK9D 4PGZA 1Q72H 1WUZA 4YPJA 4DN3L 2PO6C 2C1OB 5DO2D 5A3ID 1IFGA 1PJWA 3KLLA 1LMKA 5I1EL 3MLZH 4PBXA 4I5BA 4YFLI 3WEOA 4D9QE 2F8VA 3ZE0E 2CO4A 3U48A 1P84K 4H8PA 4TSBH 3V6ZB 3ZVVA 4LLVA 3ABLB 4K7FB 3ET9F 4U49A 5FCSH 3MYZA 5DD3H 1JCKA 2A6KB 1L9QA 3DRTA 3ESVF 3LIZL 5E5UB 3F6LA 3H7BB 1R5VB 3EH3B 1OAKL 3GKWL 1O7DC 3QQDA 3TPUA 1OAYH 1SOQA 3RKDC 3CFTA 2ZP0T 5KUMA 2VDKB 1D5XA 3EGXA 4XI5D 3U1QA 1EBPA 4P2AA 4ZNCD 4X5WB 1SHWA 4M62L 5EU3A 5K59F 2IXQA 4QUOA 1A7QL 2IH3B 3RDJA 3KLAB 3D0VB 1X6LA 2FBRA 4Z5RB 4OVVA 4U1NB 2WGNB 3VYPA 3AGWA 3FUHA 1MWAL 2ALAA 1H3PL 4KTEL 1K8DA 4H8WL 2O5YH 4BSJA 3FO2B 3UACA 2BXZA 1MVYA 4HX1B 3BHBA 1F2XK 2VXQL 4DGIH 4JO2L 5F3HA 2BY0A 1AGBB 2YMXH 5KTEH 2IWFA 4HJUA 4R83A 3ZT6A 1JYVA 4Y4HB 1MN4A 3K4DA 1X4XA 5C0FA 2IH1B 5BRZD 5ACLA 1A7RH 4O2CB 3UGXA 5DJZA 1CICC 3N55A 1GW0A 3VRJB 3CJJA 3OJDB 4WKZB 1AO7A 1QI4A 1L7TL 4FI8A 2N3JA 4NN7B 4K3DH 2AJVL 2N59A 4MNHB 1E9QA 1NM9A 2ZUYA 3ILDA 3LZPA 2P1YA 1XF5B 4X98B 5CJOH 4XNBA 5DURB 2A9BA 3N91A 4YDJA 2Z93B 4P2QD 3JV6A 2OL3L 1AXIB 2X2HA 5BXFB 1TTUA 1F3DH 1I1RA 3QFGA 4LCVA 4K5MA 3T0EA 2IADB 2C5DC 2VDML 1DVTA 2NOYA 2RIKA 3QZMA 3G08A 3BISA 3DETC 5SWSA 1AR1B 1CFNB 4JM4H 3FTGA 4F93B 5AYQA 2NZIA 1RUKL 4PV9B 1AC6A 2FO4B 4AC4A 1WEJH 2UVFA 1NFKA 1I1YB 1OARL 2Q9OA 4GG6A 4KXAA 5IHHA 2UZIL 5ERWA 1HHIA 4KY1L 1PS3A 5CGYD 5GS3A 4OLZH 3SQBA 3P0GB 4PTTA 4PAZA 3W0WD 5E51A 3O0RL 4JG0L 1HHKB 1BBJA 3CFJB 4FGMA 3DTDA 1LDPH 2EC9U 3AMLA 1U3HC 4HGKC 2FSDA 4HBQA 4UT7H 5SV3A 3SJVB 2EXWC 2GW5A 3NEXA 3T8VA 5GRVL 3KPQA 2OAAA 1UEYA 1T2JA 1ND0B 3MV8D 3DMMA 1JS4A 3FT2A 2BVQB 4WFFE 5I17B 4LP8A 5J89A 4BKLA 3L3KA 3S2AA 4NZUH 4IBLT 2LTQC 1CDJA 4Q2ZA 1E6OH 4BWWA 3VI3E 4XHJD 4L3AA 4M8UA 3UTOA 1KCSL 5DJ8B 4K7PY 1INDL 1Q9OB 4OLWH 1MDAA 4Y2DD 3KVPA 4HAFA 3CFIC 5CEXA 1BZ9B 4CILA 3GSXB 2ADFH 1U0QA 4FNTA 3GM8A 1PF3A 1YUHA 1HOCA 1IQDA 1OTUC 2UWEA 2AEIT 3WKQA 4JKMA 4YC2B 4XP9L 5C09E 5AKSA 4LRNH 2ED7A 4HJTA 3DJ9A 4JKWA 5D7JD 1FVCB 3RHWK 3PWVA 2BWDA 5C0IA 4OI9A 4ZW8A 2AEQH 2F58H 4MKTA 3UYRH 5A2CA 2FQFA 2AERT 2V17H 1DUYA 2AITA 4P2OC 3UOAB 1X5KA 2H6UA 3H0TB 2XTLA 1G1CA 4MD0A 1KULA 1DBAH 4H0IA 4CN6A 5GRJH 3B37A 5BZDB 3P4NA 3MGOA 4WY7H 1L9PA 3CC5B 3GJFH 1JZGA 3HPLB 1AVAA 4PJ8C 3TO4C 3UYPA 2HG0A 4X4ZA 1RZ7L 1HH9B 2CIIB 2VOTA 2WWKT 1YEHH 5IHWA 3MLPA 3CU1A 3OWEA 5FFLA 4O4YH 2VLLB 1OXYA 1X7SA 3DV6B 4YS4A 1LEKB 2W38A 4NC1E 3HB3B 3KM2A 3UGUA 5ADPL 1UWXH 5D2LF 4XNMB 1UKSA 4ZX6A 3E6HA 3QWRA 2WIMA 4X99A 5AKVA 4OFPA 4XP4H 4O2EA 4FQXA 3MBED 1FZJB 1N18A 2DWEB 2H9GA 5F0LB 1CFQB 4QRBA 3QCTH 2QKIC 3STZB 2A9MH 3ECWA 3QUHA 4LLWA 3CVIH 4P3DB 5I28A 3UZEA 3WGVB 3MRJB 4P3WA 3GB7B 3S98A 3QJOA 4EKXA 2VRAA 5CP7A 4OV6F 3MRLB 4RBPH 5DWUH 1JZEA 4MSWA 3RNQA 4A6YL 4U1SB 1J1OL 1M7XA 1XGUA 1I1FA 3HJEA 4IRSC 3OM3B 3A4AA 3WLWC 2V2TB 2HRHA 3JWNC 2WNGA 3B7SA 2I9LA 3M1BB 1FN4B 5HYJB 2NYZA 1S5IL 5GGTL 3ARUA 1ECZA 2WLYA 4O9HL 5GS1A 4R3SB 1Q90A 4MCZA 1FVDB 2OFQA 2WCSA 5JIPA 2VISA 5LGHH 3ETSA 3GIZH 3K74B 2XWJB 2P5ED 1W8EA 3T6ZA 5I8OH 3CVHH 3OHXA 3K0WA 1ZD6A 2DWYA 4GI6A 1UENA 1OLZA 2PWHA 4AGLA 2G2RB 2Q0ZX 3IMTA 2EABA 5L6YL 3MO1A 4DP6X 3E7JA 1EGJH 3IGUA 1DQDH 2B2XL 1RUMH 2JKXA 4GI9A 5DK0B 4OFKA 3NIDE 4FCAA 4LCWD 3BWUF 4G6FB 3FSWA 3SQOL 5D2NC 1WHPA 3QCVL 3CFCH 4MJIB 4YPGB 1HSAB 3POHA 1TVDA 3ZT7A 3L5XH 2CKNA 3MOBH 1I8LA 4KJWC 1F58L 1MHHA 1UD4A 2OYKA 4GAGL 1KPVA 5FCUH 5DJAB 4N0CD 3LD8C 3LQMA 3AT9A 1BJ8A 3QGVA 4LLDA 5CN1A 5DK3A 4YXLH 2R29A 3RWJB 5T5FA 4N2DA 2CDFA 2XKNB 2BCKB 2Q6WB 4NQSA 5HDQL 2FJGB 1E4WH 3CCHA 4LLAA 4U2ZA 2NRDA 4BWUA 1UQSB 2ED8A 1UD5A 4I77L 1ZSDA 4PJCF 3TIEA 5C0NC 3EFDH 4PRIE 1S7WA 2COQA 3N6YA 3FFCD 2J88L 2GCYA 4L4TD 2XWBB 3BIKB 3TBYB 3BQUC 3CE1A 2VLKB 5D6DA 2AABL 4KKAD 2APFA 1CPUA 3E8VA 3S3BB 1CD9B 3HR5B 3CZNA 1QYGH 1OTTC 5IB3A 1YPZF 2FECL 3S3PA 2EAEA 4U31A 3VGDA 3FQWA 3LJ3A 5AVXB 1JV2B 1F8TH 2DPKA 4UI2A 2F1EA 3BLKA 1XH2A 3N40P 3V0DA 2YK1L 3OSVA 3P9MB 2FB4L 3CZJA 2ADYA 1BZ7B 4QI3A 1MCQA 5E7FA 4WW1A 1F00I 4UT9H 3WJLA 3H8NA 3FRPA 2NY3D 1KLFB 1HOEA 1V7NH 2QBWA 4LPWA 5E8DL 1QABA 2FIKA 3EJZD 3PXJA 2X89A 3RE0A 3F7YB 4GSDH 3LTVA 3QE5A 2XZZA 4ODSL 1Y7VA 1TKWB 3FUKA 2VAAA 3E6FA 3EG9B 3KH4A 4NGHL 3EFOB 1YEWA 3L45A 2WQUA 3BE1H 3LXAA 2FATH 4Z7QF 3LPPA 1NBZB 3DIFB 4GP4B 4PJ5E 3ZKND 4ERSL 3PWLA 4P4KB 4JKNA 4CVXA 5CCGE 3FULA 4YHNA 5C8JA 1IGTA 2QQNH 2AANA 1MREL 5BV7C 2N0KA 1RURH 1KUMA 1UD8A 4XCEB 3I6GA 3KPPB 2OYLA 1RK1A 2EEDA 4ALAH 1KTJA 2XKUA 5CZRA 5JDJA 2ATAA 3QIBD 2EH7L 4B9JA 3DGCR 3N06B 5JDSB 4PV8A 1A4AA 2XVKA 3QIWA 1BPLB 3KEHA 3K46A 3MREB 3OLIA 3BUTA 4Q8BA 4FHKA 4OGAD 3RGVB 3SE3A 5IWLC 4QOKD 3KGUA 4A1RA 1XH3B 4HPOH 4FULA 2AV7B 4WI5A 4HT1L 2HN7A 4H8UA 5FLVA 1FYTB 2JJTA 4DZBB 1MI5D 4NXKA 3ZDYF 5TE4H 5I76B 4G7VL 4DGUA 1J8SA 2ED6A 3U1SL 5GRYA 1IAMA 2M2DA 2GJZA 1XL6A 1LQSR 3CFQA 3R0MA 3PDDA 4WSGA 1MFCH 3BWAA 3ATDA 1E42A 3TJHD 1TLKA 2XQ0A 4JRFA 4H88L 4X5PA 5CSZB 2CRMA 5E9DB 3NGBC 5EU6B 2D7QA 5E08L 3ARGD 1NBYB 1NKOA 4S10A 2WN2A 1A14L 5IBTH 1PL3A 3FH7A 4LGRB 4CMHB 3ZZ1A 1HQ4B 3HN5A 5C92A 3KYOB 1RU9L 1A6ZB 3NJXA 1F6FB 1R17A 1LO5A 2VQUA 3IBEA 4OLXH 4XVUD 4HIEB 1QATA 3BZFB 4YAQB 3EYOA 2VWEE 3VQ2C 4K3JH 1OPGL 2Z35B 4P07A 3SKMB 2F8IA 5HVWA 5AOIA 1WS8A 2GTZA 3FO9A 2ZOLB 2BIPA 2DI8A 1ZLVH 2EVIA 1JMZA 3ALWA 5AYTA 3HVDA 2E27L 1I8AA 1KIRA 1W0VA 3WIAA 1CLOL 3W2DL 5EBMB 2ERJB 3GC3A 4PUBL 1UXMA 2ITCA 4ZAKB 1P5VB 4F3FA 1NFDE 4Z1PA 3CBJB 4YVNA 2J8UB 5CZVL 5LDSA 1E28A 5DQ9B 3PY9A 3MNZA 4AZ8B 3EO9L 4FXKB 5DJDB 3RHWF 3AS3A 3BZ4B 3QUGA 1XBDA 4OJAA 4FNSA 2OI9B 3OX8B 4FZ8H 2APTA 2GPZA 1D9KB 2YRPA 1QLFB 1X5YA 2F54D 3BAEH 3P11L 3VTMA 1J5CA 5E2UH 3QO1B 1A1MA 2HG5B 4OKDA 1NAML 3CZEA 3KPRB 3MFFB 4ZTEA 4F5CA 3SYQA 4DKFH 3VD0A 4OCRL 1P7QA 5B3JE 5HD8C 2HVJB 3EAKA 3QUMB 3MTRA 2VITA 3FQRA 1O7SA 3DI3B 4KROC 2FHCA 4R97B 5E4AA 3CDYA 5TDNA 4BUQA 4MB4A 4PJ7A 1TVBB 3CZGA 4ES9A 4UU9B 1CMOA 1TTCA 1HKLH 3K4AA 4TNGA 1ZGLM 3LHPL 2YXMA 4D0DA 4LCCC 1AXSA 1TQSA 3U7WH 3QZBA 5I0ZA 1ZRUA 2B5IB 1MOEA 1RAMA 2KLSA 4M6NH 2HFTA 3OZ9H 4NO0D 5FYLH 2PPEA 4N3UA 1P7KA 4BHUI 4H8QA 2ZWLT 2GSGB 5IBLC 4NQED 1N6VA 2GHWB 3FU3A 1ZLSH 5E6RB 4AYID 4F7CA 4HISA 4JX0A 4PLNC 1NBQA 3R7RA 3P3RA 2VLJE 1NMAH 4XCYB 5DC2A 4WUKH 3T5WA 4CC1A 4Q6IB 5DEGB 1KB5A 3CBKB 5DD0L 2PCYA 3RDTC 5HHME 4YBLB 4RAUA 3VMNA 3P0VH 1GYVA 5C07A 1S7RA 4LSPH 2FEDC 1DBML 3G5YA 3SDDC 4FFYL 3KCWA 5EZJA 4B9YA 1HINH 4W6WB 4H7VA 3D48R 1RMFH 2PCPB 1LD9B 2KBGA 2RA1A 2UXVA 3PHOB 4HUXA 3SPGA 4CADA 4HFWA 4NWTH 1KYAA 1DTUA 2AXJA 3OKNA 3UYOD 1CC3A 1EMTL 1FBIH 2WLJA 4O5LL 2NSXA 2EC8A 4ADIA 1SJMA 2W07B 3NACH 3OQRA 4HKZA 4UT6H 2VH5H 2JI1A 5ID0A 3VXPB 4Y4FB 3F7KA 1QSEB 1GY2A 3NAAH 1DZ0A 1L0XA 3UTSA 4KV5F 2AJSL 3WHXB 5BS0D 3UL4A 2BS9A 3FBKA 2Y7SA 4JFZH 4Y9GA 2Q2EB 1I8MB 1CJYA 1AS7A 2MNUA 3OB0K 5H37H 3P4MA 5TGBA 3RVWC 1FL5B 5IMKB 2PNDA 2IGTA 1EHAA 4CGTA 4L3FA 4PJIE 2IPTL 3X1GA 2ESVB 4JFEA 4BQ9A 4MNGB 1IC7H 4FNPA 1HYRC 4HKJA 3HZMA 1KYFA 1KTCA 4HALA 4MA7L 3O3DB 3BKCH 3NJFA 1P9MC 4OF7A 5CKGA 4I48A 1IM9B 3B5HA 3MBXH 2NXYD 4AUYA 4APXA 2VKXA 5F2FA 1N6QL 3JT2A 4JFYA 4B7IA 2YEQA 5AAWA 4LKCB 4JMNA 2FGWL 1NCTA 1KN2H 3MRKA 3NIGE 4M29A 2F1AA 3FF7A 1IEBB 1ZT7B 3L3OA 4M1GL 2VRQA 3GGWA 1A22B 3CZKA 1MWAB 3GJEA 1TVHB 2WY3B 4JJHA 4RFEA 1QFWM 4ZO9A 1SPDA 3D0LB 3QCUL 2VN6A 5I1CL 2O72A 4HIHB 4HH9A 4IRZA 3MXWH 5CD5D 2R0KL 4KX7A 2GVYA 4R2GD 5L8KB 4LVNB 3VFPB 2IDQA 1LO3L 3FXIC 2XXCB 1BPVA 4FI7A 1MCRA 1IIIA 5T3ZD 4NRZB 4QKXB 2RGSA 3H9ZA 2W60A 4AG4L 3LH2L 2VR6A 2D2OA 3AROA 5A2KH 5D1ZA 3V0FA 4BV1A 3QXAA 1G6RH 5AOKA 4DN4H 3B2VL 3CFUA 1JVOA 1SUJA 3LKNB 2YZ1A 4CNIA 5DD6B 1RUAH 4OD2B 3NIFE 2YGPA 4WNQA 1Y6KR 3QUXA 1MCWM 4X5QA 3U25A 1CGWA 4Z77B 4QXTA 1SEQH 2FDBP 3QPXH 5DVLA 1WGVA 4ZFFB 2AI0H 1RULH 3A5VA 2AW2A 1MJ7L 4KJQD 4NNPL 3LPGA 1T6WA 4JHWL 1ERNA 5DR5H 1N10A 5TE7L 4MAUL 4UB0L 2VDPH 4WU5A 3HBQA 1BV8A 4LNRB 1XGQB 2VL5A 5D4JA 1J7VR 1ZV9A 3QUKA 4JRWA 2A1WH 2E9BA 3KJ4C 2FZ3B 4L3CA 4EIZC 2HTKD 4NAMA 1WD9A 3WSQL 3PLYA 4EXPX 4ZFOL 2F8OA 5FB8B 4UQEA 4CRPA 3VSUA 2ZOKA 2QZ5A 2WBKA 3LN5B 3U9WA 2WBJC 1A21A 4NUGL 4QYOA 4RNRB 4N0UA 4L0ZA 3OAYH 1JNHB 1WYJA 4BQCA 3ZTNH 1RUPH 1TTAA 3HG0A 4NQCE 4XOAA 4Z95H 3OZLA 4P9HL 1AS6A 2AJXH 4PJ5A 3T4YA 3N41F 4JFFB 2GSIA 2IO5A 5IVNA 1IE4A 1E4HA 2VUKA 4RMBA 5EWIH 1PD1A 2AP2A 1DR9A 5JPMA 2OMUA 2WQ8A 4JREC 5DJCB 2WPGA 1K4CA 2ZSWA 4P46C 2R0ZH 3BEVB 2ODIA 3FU7B 1D6VH 5GISH 2EYTB 3MJ7B 4NNYB 1R0AL 2Q86A 4P5MB 3AGVA 5AVVB 4YQXH 2C7UA 3Q43A 2RBLA 4GRLB 3DDFA 5EO1B 43CAB 1NCOA 2JKJA 4LF3B 4HWBL 5BMFL 1N4XL 4B9CA 2BSTA 3DX6B 2R23A 1RJZB 1UXLA 3GXFA 3AXIA 4Y2OB 3ZSSA 3MJ6A 1ZGLB 1GPOH 2E56A 2GITA 4EDXA 2HKHL 4NKDB 3FB5A 2CNZA 2WBXA 2Q8BH 2DMBA 1U8HB 2LHAA 4OCSH 1DVZA 4KX8A 1EVUA 4IU3B 3P9WB 4JFDB 3AY2A 3PL6B 4KXBA 4F20A 2RCSH 1ET5A 1KJ2B 5DK2A 2VDLH 2DQMA 3DJTA 4Z7NE 4Y16A 3EBIA 2CR0A 5DZLA 5D7IE 4EN3D 2LR4A 1LO2H 4XN4A 3C6SB 2DBJA 2YBGA 1CUOA 4GAAA 1LTXA 1IC1A 4FG6D 4P4RB 3TO2A 4JQIH 3GUTB 2F19H 4NP4L 1E2WA 5E8NA 2PTUA 4AI7A 4BIKA 1NPUA 2VDOL 5JHDE 4MD5B 2IG2L 4PJDF 1SVCP 1KN4H 3PXLA 3OPZH 2YSSB 4BXVA 3MV7E 1SN0A 2HKFL 2OJEB 5JXAH 4HK0B 1T0NB 3BYYA 2WQAA 4YZWA 5FO9A 4QCIB 3J7HA 1PD0A 3KVQA 4LK4A 1Q4NX 3V6FA 1NFDA 1AI1H 3WYRA 1WJ3A 2BDNL 4ZMYA 4M56A 4QF1A 1VGEH 4JLRB 2JIXD 2ZPKH 3MNWB 2FX9H 3A6CH 1ZHLA 4D7PA 3OWRA 3X13A 2IDSA 4GBXA 2XKSA 4ONGL 4QRUB 5CJQH 1OK8A 5E56A 4NJ9L 3IFPB 3JTSA 3V0WH 4MQ7B 1M7DB 3L5WB 1EXGA 4TVPL 2JCCA 2M1KA 2X4RA 4DZ8A 3ALPA 2FJFB 1KY7A 4UQIM 4UV7H 4OLYH 4Q6KA 4U1IB 2VDRH 2C3VA 4X6CF 4AT6A 5E4EB 4MAYC 2VDQB 4BJLA 3L3DB 1EA9C 3ZE1F 2YSTA 3DPDA 1J0IA 1SF5A 4NQTA 1CXLA 5C0GB 1KGWA 1XXFC 2P5WD 3HMWL 1B0RB 2UXTA 4UTBA 4KUZL 1R3JB 4L8SC 4V1DD 3WFHA 2CKBA 1QVOB 2NNXA 4GMTH 4JUTA 4XAKD 5KVDH 1YECH 2XN9B 3FU8A 4QHKI 4F33B 4KH9A 1NOLA 1UURA 4JN2A 2QZQA 5I8EA 5L2KB 5DHEA 4U05A 3A6BH 3HI6H 1YVLA 3D3VB 4J3WA 3WTVA 2FX8H 3QUXD 3QORA 1YMMB 2NY1B 4RWYH 3UCQA 1MFEL 1ZVHA 3DYPA 1TMCB 4KUCD 2DW5A 1B0WA 1QUNA 4HWNA 4CDHA 1QFOA 3P77B 1TJIH 1OAZL 2DB8A 4OF8A 4DP9X 2JK5A 1R5WA 3LKOA 1AMXA 4MZ3A 2GG1A 2YUVA 4N1HB 5JW3H 3JWOL 4WHTB 2N01B 1L0QA 1UGNA 3O3EA 4QLRA 4UDTB 5FK9A 4BD4A 3SPHA 2FHFA 3VQLA 4DW2H 4YOKA 2V9RA 5HJBA 3HAEB 3WS3B 1K8IA 3S88L 2JB6B 3QEGH 3SGEH 4P2RD 3FO0L 4O00A 5BRZE 1UM5H 3MDJA 4HWZB 5I16B 4OW6A 3A6OA 3MRCB 3Q48A 1NFIA 4L3ED 4CKVX 4XOBA 3VDAA 1OM3H 5IVOA 2BWQA 3DYMA 9CGTA 5ITBL 3DHMA 1H8NA 1I7ZA 2B8OT 3EOAB 2C8NA 4QWWC 2IDUA 3KYNB 1MY7A 3F62A 4KXDA 2ZCLH 3CAFA 4R4FL 4WJKB 1KY6A 4Y19E 5KBLA 1YMHA 1C12B 1PZCA 3C5ZB 3FHEA 1UH2A 3G04A 4WFGD 3WMSA 1AR2A 4P2QE 4LCIL 5E6IA 3IGAB 3P3UA 2X6UA 4WGWB 2JKLA 5L9DL 3HZYB 1KIQB 1FL6B 2WBWB 3M8OL 3PV6B 4GMSL 3FQUB 1GMEA 2PXYD 4YO0B 1A4CA 3DX8B 1MW3A 1O6TA 4RMTA 4ZX5A 3MRQA 2BWIA 1HILB 1BXUA 2ZF8A 5G55A 5EF0A 2MPAL 1Z9SA 3MRBB 5HHXL 2DQDH 4EBQL 5C2BH 3V6OC 2BXYA 3T1FA 1U8KB 2EE3A 2ID5A 4ZW5A 4FC3E 4DFHA 2EDYA 4HWUA 5ANME 3VXRA 4PN6A 4L0YA 4UBDC 3IKCA 4FNRA 4UTAH 2ZKXA 1L5GA 3MA9H 1YQVL 5B38G 1MRFL 4NQXB 1JWSB 2HFGL 4PRPA 4XMKL 3TA3C 4OB5H 1UJ3B 4AENA 1ZEAL 4POZC 4BK4A 5ISZA 4PG2A 3EIFA 3TJPA 4JQXA 3GO1L 4JEGB 2WAQA 1BP3B 3M17A 2A9CA 3GMOA 3SDXE 3W9DA 5ILTH 4AL8H 4YDIH 2ZP8A 1QTYT 1MW2A 3OF6A 3R18A 4NWUH 1K2DB 2R0WL 2MJWA 2GTWA 5ALBH 5D2LB 1C5BH 4X80L 4P3CH 1UZ6F 1W9XA 3W9EA 3I75B 4UQDA 4WCYH 1ZHKA 2CLRB 2CM5A 3AQYA 2CBMA 4J1UB 3FCSB 5ACZA 4OGZA 1OB1B 2OTWB 3LNDA 3AABA 2ZYIA 1CDYA 3ULVC 1QZNA 2ATPB 1CFSA 4W9IC 2NZ9C 3IU4L 2FBJH 2WZPD 1KXQA 2A6IB 1XF4A 3D50A 1FZKB 3HFML 4ODBD 3VFSB 1NKRA 1AZVA 3GXDA 4HDIB 3II2A 4NXSA 1MAML 3S96B 3KH3A 2NY4D 4P59H 2VXVL 2ZCZA 4AYMC 1JF1A 2FQGA 2FSEA 1T04B 4EUPH 4JKKA 2QTEA 3PWPA 5HHOA 5BJTB 1AHWA 1OTSC 4G1MA 1HJBC 4PP1D 1HXMB 1BG1A 1KWKA 1FVEB 3FPXA 4GXVH 4QRPB 2BMKB 5TJWK 3P69A 2BP8A 2DQIH 2EP6A 1QLEH 4F2ME 2ZWNA 4I0PC 5BVJA 3WE1A 2HFFA 1MQ8A 1NCHA 4DGYL 4OZ4A 4CUCA 2Q5BA 2DD8L 4A66A 3Q5YA 3ARQA 4J12A 4X7TA 5PCYA 3G5WA 3SO5A 4O2FB 1QLRB 2NYKA 4KHTH 4PJ9B 5F0JB 5SWZD 3TVMD 3LXUX 5C3TA 1M53A 5C0BE 3WFDL 5F88B 1MQKL 3GSNA 4WK4B 1BVKA 3BEWB 3F85A 4YHIA 1YY9D 5DFVD 5J0BA 5I73B 2NDFA 5JQ6H 3SCMD 3VXNA 1SQ2N 3SYOA 1RP9A 1T5WB 1Y0LA 4AIZB 3N1GC 3SB3A 4JPKL 4PM1A 3GMNB 4PGEB 2YD0A 5IM7B 2B59B 4RSVA 4NX0A 4NAJA 1AH1A 4TNEA 1M05A 3BXNA 3I6KB 4GUPB 1BYPA 3FUJA 4HHAB 4KO6A 1K6QL 2XFXA 2LAAA 2PYEB 1XIWD 1FNLA 1RJCA 4PJCB 5DHXB 2K78A 4I0CC 4POYA 3K91A 3FB8B 2HLAB 3P4OA 2AQRA 3QHFL 1XSKA 2HJLA 5H94A 4XP5H 3WJMB 1WDAA 3H85A 4HAKA 4QT5B 5DGQA 3DBXB 1EVTC 5EUKB 3LN4B 3S6CA 4YSTA 4OM1L 1VEMA 1VFBA 1YPZB 2P5EE 4RZCA 3OZKA 4N9GB 3U46A 3H6AA 1LEIB 3CPLB 5GZNC 5TDOB 3MR9A 1BAFH 1NCJA 2EXYD 1ZMYA 1GAFH 3Q1SL 4J2XA 1SHXA 3OR7B 4NZTL 5DMGD 2HXAA 1IRAY 2XA8L 1KYDA 1MLBA 2X2JA 5EZOH 3SN6N 3TT3H 3CSYB 1J1PH 5F9OL 3QVAA 3T4AB 4FXGC 3VCLB 2AHIA 2XN0A 2ICWI 4XNXH 3EYUH 2NY0C 3S36H 4PJGE 3QRGH 1PLAA 3BVXA 3KXFA 5I0DA 1YN6B 1U41A 1DBJH 3JYCA 3BYTA 4Y4KA 5D7IA 5ABDE 3D8MA 3UX9B 3IVKB 2QHRL 4KTYA 5AW4B 2B1AH 1B2WH 1EO8H 1KDJA 3ABGA 3BW9A 2R15A 4OZGF 5DI8B 4OZHA 4Z7QB 4D0CB 2ENJA 1E5YA 4N8UA 1XBRA 1PG7W 1OOAA 4KKCC 1JHTB 3X3GL 2P8LA 2AEOA 4GEIA 4LLQA 3CK0L 1B6UA 1GKEA 1NLDL 2HJKB 2OBGA 3PUUA 4LLUB 5DXWA 3RUGA 3VAEA 3G6DL 4X9BA 1R34A 2QPSA 1SM3H 2H0EA 1HDMB 1PBYA 4WHYH 1PQZA 2C9SA 4L4TE 1XB8A 1E50A 4F57H 1SXBA 3C8KA 4DESA 1H5BC 3E8UH 3HMXL 3GBMH 1HH6A 1KCBA 1I3VA 3VA2C 4MMZA 4UM9A 5EUOF 1TEFA 5TE6H 2ZUQB 2MQ3A 4AQ1A 3ZDYB 3OF6D 1K3ZA 1H6FA 4XNQA 3UROR 4XPHL 3VDCA 4IDLA 2XWZA 4U0RC 3ZDZB 3MLSL 4HCRA 1U8NB 4HAGA 3Q2NA 3RY6C 4OKVB 1QEWA 3BP6B 5GSRA 1HU8A 2XJLA 2Q3AA 3BSZA 2Q76A 2VZTA 3CSGA 4F2EA 1QSFA 4MXQD 2F53B 3B9KA 1D7DA 4PJHF 3APMA 3QISA 4HH8A 5T3XH 2J2ZB 3AG4B 5IY5B 3ME0A 5EA0H 3AUWB 1OCRB 4IEFB 3I2CH 4C4UA 3K8LA 3HRZA 2QLVB 3TEXA 1EEQA 5KS9F 5GGQL 3L2NA 3HUJE 5GRWA 1EDYA 2XV2A 3N42F 4RFOL 4U6XA 1XF2A 3UG3A 3FUEA 3GUFA 5IVXF 2H3XC 4FQQA 2VO5A 3C5JB 4DQOH 1R24B 3K1DA 2BZDA 2KDYA 1SFHA 4IGBD 3GBLA 4MB3A 5JA9A 5KAQG 3B3IB 4X6BB 2FE0A 3RJQB 5I15L 4XP1H 1U58A 2X3AA 5J1AB 4DUWA 4JZJB 4MQTB 2WXPA 1WIOA 3QEUA 3BVNA 5EG6C 1XXDC 2QJDA 2WMPB 3BP4A 3OKOB 4QOKE 4IIZA 5EULV 1AZNA 1DLFH 2NR6D 3WTUA 2HT4C 1U92A 1IBZA 4D94A 2I9TA 1M2VA 3PRZA 2OPCA 4C56E 2CGRH 2XXFA 4OFIA 1FO0L 1YO4A 2CGYA 3K6FA 4JRYB 3KDMA 3CHXA 1WA1X 4OGYH 4XBPA 3T71A 1U6AL 1AP2A 3QFJD 4FHJA 4PREB 1S78C 3FHAA 3G7TA 5DJ0A 4M7ZB 3CHQA 2BNRD 3D9AL 1F90L 2H0FA 3A22A 1HK6A 1M3JA 4CVZA 4NZ8A 4D9RD 3AXHA 5EIIB 2XBTA 4Y1AE 2MRYA 5EMYA 1OSZA 1SQMA 1CTNA 3EYFA 2WIIB 3O8XB 4JL2A 5CKAA 3L6FA 5A6MA 3W37A 1UKQA 4IU2A 3CBRA 4HXBL 2W0LA 3O2VH 1SZNA 3QWOA 3DOSA 3TFKD 4LOVA 1JPTH 3WN5B 3WIIH 4ZFOB 1FNSH 1I9RL 1MFVA 3ATEA 1QG3A 1VF5C 1Z3GL 1JGVL 3QEHA 2PO6B 4RIRB 1O5PA 1GW6A 4DUXA 4BFBD 5AEAA 1JK9B 4Q0XH 5CHNA 4IK7A 3TIDA 3ARBD 3BGMA 1N5AA 4PR5B 4ZD3L 4YDLB 3LKRA 2WCPA 1A25A 2QSQA 2NNAA 5FWQA 1JD7A 5DQDL 3W57A 4MCMA 3ESUF 3ZU8A 3MJ9A 1EFXD 2ICCA 4J6RH 4KXZH 3BDXA 4DAGH 4H5SB 3NH7L 5ITFA 3B6SB 3VXQB 5T33H 1AQDA 1WZMA 4RGNE 2E7DA 5D1XD 2EIKB 3MJWA 5I18L 4M1DL 1A4JA 3O6KL 3DX3A 4BCYA 4X7SL 3KXFD 3E38A 3KEDA 3WELA 4GRWE 4WAFA 2YKKA 5J8OA 1YEDB 1KXHA 3WNMA 2E7HA 3BKML 4Y4KD 3D25A 2GT9A 1EX0A 2R39A 2HLEB 4LOFA 4XMPH 1MRCL 2YARA 3ZUNC 2JTYA 1FZMA 2Y5EA 4U6HA 3V5DB 1E3ZA 2GK0B 5JQHC 4TL4A 1X5HA 1I8IB 4YE4L 2CLVB 1NL0L 1R47A 4X6FA 5KSBE 4LSUH 1KC5H 3DUHA 4IQHA 4OGXH 1RI8A 3IU3B 4XVJH 1MPAH 3EO1B 3PDOB 2C1OA 5I6NA 2KZKA 1EJ8A 5D7KD 4U1HB 3NA9H 2YPLD 3KYKH 4W70A 3RVTD 4MHHI 2DJMA 2XWEA 1THAA 4LNVA 5FO7B 4F2MA 3ZLQC 4NQEE 2Z6FA 2XWTB 3V6ZA 1EHKB 5TQ2H 1ZTXH 2NNRA 5I5JA 4UINL 3GPSA 2EDFA 1R3HB 3BDYL 2IAMD 3GPEA 3FQXA 2A6KA 3WFZA 3RPBA 4UIMB 4HKXA 2C9RA 4DCQB 1R5VA 4YSSA 2V37A 2VDOB 3K3QA 5G4OA 2OMZB 1UEMA 4GG8B 2EUVA 2OZ4H 1DJZA 1QW9A 3LQAH 4AK1A 4X5WA 1ZDSA 4XH2B 4ZMTA 3SDCB 3UJTH 2EO7A 3IJYB 1C16B 1MCPH 2IH3A 1PZAA 3L2MA 4FDWA 5KYUA 3QDGB 3B9KD 2HMID 4Z5RA 1LILA 4GEJA 2QT6A 2DQHH 2DQCH 4NC1C 4TPRL 1EHXA 4LAQL 5CCKL 2TRYA 3MUHL 3SOBH 3FO2A 3RVXD 1J18A 4OFVA 4HX1A 5AKRA 5AUMB 1CXIA 4LSTH 4E9RA 1KPUB 2GJ6B 2X4SB 3DVFA 4P5TA 3O3AA 3T2NL 5BS0E 2EXTA 4U1GC 2VYRE 2QR0A 3N85H 5J7CC 3BESR 2IH1A 1WBZB 5CLXA 2DWTA 4RDQG 1S9VA 1WZLA 4UQ2B 3SO3B 5JXEC 5LNEA 1U3YA 1XCTB 4KPHL 3TPKA 3VRJA 4HGWB 2Y2YA 2VRKA 3G5ZB 4WRLA 5EEXA 2LTQB 4ONFH 3T8XB 1UM4L 4MNHA 5FV1L 4W1TA 5E2VH 4AEHL 5GGVH 1NUDA 5L8JB 5FKAA 3CZLA 2Z93A 2JELL 1V7MH 5CMAA 4ZI8A 3AACA 2OTUB 5C0CB 2VLMD 4N2AA 2IADA 5DC9B 1TXKA 3IK2A 5DRXB 5CR8A 1J8HA 1D5ZA 2GBVA 1G9NL 4G9FD 3NCYS 1XMWA 3W11D 4BZ1H 1CFNA 3ZMRA 3X14B 1OO2A 1FORH 4GP5B 3VTAA 3WFCH 1QSVA 2FO4A 1OP5H 3NFSL 1I1YA 1KCUL 2VLRB 5GJSH 4WWKC 4PJGA 1M71B 4GSUA 4A63A 1ZANH 3CFBA 4KRPD 2QPEB 1HHKA 1OSPL 5GJTH 4AMKH 5J11B 2GC7C 3EJPA 2V9TA 3OHMB 5I0YA 4MTMA 3WS6C 3CQFA 4YDKH 2HVKB 4FQPA 1TZGH 1PY4A 3SJVA 4M5YH 4LRIA 3D05A 2AGJL 3OGOE 1ND0A 2DWDA 3WXVH 2BVQA 4KKPA 5I17A 2NNCA 3KLDA 4GG6F 3BP5A 4IHBA 4PJ8B 5BO1H 3TO4B 3UTTD 1QRND 5KEZA 1EXHA 3MN8A 3U4BL 5K9OB 2JB5H 3SE6A 4Y5YC 4L8CB 1Q0EA 4UV4L 4P5KB 3SBQA 5CO1A 1G7QB 5DJ8A 1BBDL 4NCC2 3QJRB 2BSSA 2R1WB 3MC0A 1RZPA 3CMOL 5D4QA 1P0SE 1BZ9A 5T1DL 2GTQA 3GSXA 3V55A 2YWYA 3WDIA 2J8HA 5I66B 1SLWA 1FG9C 1PZ5A 4X5LA 2CBTA 2IANA 2HRPH 1FC2D 4FX5A 4PB9H 3TTSA 5TF1H 1FVCA 1NCDH 2ROXA 1WG3A 3B56A 4GRMA 5DUMH 5FECA 3ZBMA 1J5OH 4AQAB 2EDLA 5L0QC 1G7JA 5IQNA 2EH8L 2WXLA 4IRSB 3S5YA 1JDAA 1KYOJ 2QVMA 4E0RB 4MXVE 5LNDA 1KTDB 2BOLA 1ORQB 2N0MA 2UWEF 4FFZH 3UMTA 5BZDA 3B9DA 5EORL 1KEMH 1IGIH 3O6FC 5CXPA 4ZZFA 4OAWB 1T4WA 1HH9A 1V54B 1ZV5A 2CIIA 4M9OA 3SPVA 2F74A 3BUYB 1M4KA 2VLLA 4PRAB 4PJDB 5F9DC 5IR1B 4N2FA 3OMNB 3Q6GL 4KTDL 4F37K 1LEKA 2FLRT 3GIVB 2EE6A 4GKSB 1LNUA 4DPRA 2MQ0A 1GS8A 4XNMA 5DD1L 2W9EH 1MLCB 4K94H 1MKFA 4FFWD 5J1TC 4G6MH 3QAZB 3CLFH 2XRAL 4D0BB 4UCFA 3UJJL 5D2NB 3VH8G 2VZUA 4G9DB 3ERXA 1V27A 2DWEA 3LZNA 1WFUA 3EDJA 4JVUA 2CMRL 3LX9A 2QTVA 1OP4A 4P3DA 4IIQC 1P4LB 4JR9H 4C56A 3QUZD 1OLLA 4G5ZL 3LD8B 3GS7A 3HC3L 3MRLA 4OM0L 4HZLB 3L3JB 4U1SA 4X6CB 2J56A 5BOZG 3F6IA 1MEXH 1JP5A 1SLVA 2ZXQA 1FLTX 3HE6A 1FN4A 3O81A 2WLKA 3IMWA 4ZXBC 5MHSD 1YYLL 4S0HA 4Y1AA 2X7LB 2A77H 5FM8A 5L8LB 4DN3H 5C70A 2UZPA 1H0DA 3S8WA 1ROCA 5I1EH 4Y4HD 4TF4A 3BQUB 1ROWA 4JGNA 4BFFA 2IGLA 3EDKA 1SOKA 1WFJA 2G2RA 5DHVB 1G9HA 1HJCA 4YSPA 4ZMLA 1J5DA 5IB5A 3T3PE 4Y5XA 2EACA 2VWEC 4MJIA 3B2MA 3LIZH 4OJCA 4YPGA 4CC4C 1HSAA 1FRGL 2YXWA 3G6JA 3GKWH 1OAKH 5K9JH 1NIBA 1FZOB 1JZ6A 2X4NB 4YXHL 3BIAX 5DDHA 5DJAA 4MA3A 3L7FB 1AHKA 1MFBL 3HI1B 4M62H 1P69B 2KPNA 1A7QH 1AR1D 2DWSA 2X4PB 2XKNA 3EUDA 2FJGA 1KGJA 1BM3L 2WXGA 1GR7A 3MLYL 1MWAH 1PGRB 3P2DA 3ZR5A 2YD5A 1H3PH 4KTEH 4H8WH 3IKKA 5IROD 4I9XA 4L8BA 3ENEA 1ZHNB 1I1AB 2HUHA 2DMHA 4JDZA 3BIKA 2VXQH 3TBYA 5BV7B 3PIQB 4JO2H 4XNAA 1P5UC 3RIAF 2P5WE 5LHDA 2VLKA 5JLZA 5HI5D 3TEWA 2VQTA 2WV3A 3E1F1 4V1DE 2W88A 3HR5A 4XCCL 1TG8A 1WSST 2NTFB 3TL5A 4XAKE 2QGDA 2D2CC 1RSFA 2X4TB 4Z7WE 3PREA 5JHBA 1EUTA 4UZUA 1L7TH 3V4VA 1DL7L 15C8L 1RVFL 2X6BA 3P9MA 2BS8A 1ZKAA 4QHLA 2AJVH 4KDVA 2Z4QB 2C3HA 2CO7B 4QXGL 2E9WA 4QRRB 2CUIA 4HFUL 2VC2L 1UZ8B 3KNBB 4MS8D 4LL4A 4HUUB 2AZUA 2CLZB 2OL3H 3LRKA 3BAXA 4B6ZA 3LMJL 1EAJA 5T3XD 2V9QA 1EV2E 3NK4A 2VDMH 3F7YA 3SGEI 1LGVA 1R19A 1K5NA 2Y2TA 3BH4A 4ZOBA 5DUJA 1T83A 5HYSG 1TKWA 3RL2A 3EG9A 1FLRL 1RUKH 3NGBB 2Y5TA 4FYRA 4IBQA 4JFQB 1OARH 4QPEA 4P2RE 2UZIH 2KYIA 1NBZA 3DIFA 4KY1H 4DOHB 3IYLW 5K69A 2CZNA 1A3ZA 2XQYA 1SJEB 1W6LA 3ZE0F 3O0RH 4JG0H 4HK3J 3P3SA 1W72B 2PPAA 3DKHA 4XCEA 3LPOA 4Q4EA 2YN3A 3NZUA 4E36A 4E68A 1A1NB 1S7TB 3KPPA 4XT1C 4APQD 4OIAA 2BHUA 4OFQA 2BK8A 3QRFM 5JDSA 5EF3A 4PJEE 2EO9A 5FUZL 3MREA 1NC4B 1W0YT 2NW3A 2SEBB 2V3FA 3TF7C 2UY7B 2CQVA 4TUJB 2WOYA 1MCSA 2DQTL 4KKRA 2XCMC 2R9HD 3BLBA 1FYTA 1QO3B 4DZBA 5I6LA 4ZUWA 2CUMA 4M8RA 3TYFB 5CEZL 3HB3D 1PLGL 1X9QA 4R7NA 1KCSH 1CCZA 1C7SA 5FOBB 2E74C 1INDH 1NQBA 3ABZA 4NO2B 1L6ZA 2NXZC 2WXKA 1U8PA 2XETA 2TRHA 1NTDA 4GXUN 4PRHB 5HVGB 3CQQA 5FO8B 4JO4L 3RFZB 3K72B 1JZ7A 5KBDA 4QHMB 5E9D