4CBZA

Notch ligand, jagged-1, contains an n-terminal c2 domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
306
structure length
291
Chain Sequence
SGQFELEILSMQNVNGELQNGNCCCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Uncovers Lipid-Binding Properties of Notch Ligands
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN JAGGED-1
total genus 54
structure length 291
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF01414 DSL Delta serrate ligand
A PF07657 MNNL N terminus of Notch ligand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cbzA01
4CC0A 4CBZA 4XBMA 4CC1A
chains in the Genus database with same CATH superfamily
3UG4A 2XYBA 4G71B 3Q7JA 2AJZB 4AYGA 1E3ZA 4JZNB 4FNTA 5CSBA 1BQLL 1AR1D 5I8EA 4YHML 5E6IA 4Z0XB 3KL3A 4Y4FD 2VDOL 1KEGL 4G7YH 3ARBC 2DQGH 2HZHA 3BP6A 2FIRT 2XVGA 4KTEH 4OM1H 2VLJA 4Y5YA 5F71A 1P4LB 2YD1A 4OLZL 3FUJA 1A9VA 3VXRA 5D93B 2BOCB 4PG9A 4LPUA 3PABB 1WP6A 3E8UL 4KKQA 4OJCA 2Y06H 4F3FB 4CVXA 5IB4A 1G7JA 1JWSA 2QVIA 2ZCHL 4MA8H 3RI5K 4LXFA 5DQJB 3CMOL 3SE9H 1CJYA 3EGSB 3HHSA 2F54E 2R2HA 4DSYA 2K6YA 3LB6D 1BF5A 2CIKB 5KTEL 3GSUA 3NSJA 4KX7A 1A47A 1U3JA 3FCBA 1AG6A 4J3XA 3KWVA 3GS4A 4TL4A 2FK9A 1X7SA 4FFZA 2AMGA 4WSJA 4LSSH 1WZAA 4JRFA 2ZXDA 3PG2A 4P04A 3UGEA 2B4CC 1HFUA 3FONB 4IHOB 3PWNA 1RIHL 2OSLA 3EYUL 4GP4B 3BN9D 4WUKL 3VM5A 1ZK9A 4W4OA 4GS7C 3S96B 1S5HB 2PABA 2VLLA 4J3TA 4LVHB 1RMFH 1RLBA 4JM4H 4P2CG 3MREA 4OI8A 1XIWA 1MJ7H 2NQ3A 5DD6A 3OF6A 2QPDB 4N8PA 3G5YB 1E7UA 3D34A 1FL5B 5AD0A 2E75C 3FUNA 3QORC 4X0KA 1KB5A 4ODWA 3G5XB 1HYRC 3VI3B 2CG9X 3T71A 4RAUA 2Q3AA 4Y4FA 4Q9CA 4N25A 3AU1B 2OJEA 1DVQA 4L3FA 2VCOA 2AV7A 3NEOA 2KH2B 4F37F 2IPTH 1EGJL 3CV5A 1N5AB 3ZKXC 3LYRA 5EZJB 1NKRA 4X9FA 4BFIB 3V8OA 1UB5B 2PR9A 3LN4A 4TUJA 1CLYL 1TFPA 4YWGL 1MW0A 5BVJB 5HYJD 1Y0LB 2EJ1A 4WV1B 1A6VL 3KDMA 1TOXA 1LO2H 4ZMZA 1OZUA 1RZFL 4MCZB 5DEJA 4OJAA 1AC0A 1YPZA 3B3IB 4E9XA 3LHPL 4FQQB 3CSFA 2VMCA 4ONGL 4WJG3 5FCUL 3WIIH 3PPEA 5CINH 1MPAL 3OWRA 4PJ6A 5K69A 1P4BH 3BWAB 2H0EA 3FO0L 1QLEB 3MLXH 5EO1A 1UKSA 4NI6A 2ZUVA 2YD2A 2PYEA 4D0CA 1J9TA 1JD7A 1G1KA 1QBMH 4RGNC 5C0DB 4QWWC 4CUCA 1BBJA 3FUDA 1R24B 3QB7C 4PJ5D 5HGGS 4NFCA 3EBGA 1E6JL 4KUZL 5DQ9B 3UO8B 3P1VA 3OKKA 5CS7A 1IX2A 1OP5K 1Z5YD 2ADFH 2BZ7A 4KK6D 1I8UA 1HQRB 4U6YA 4WEBL 3VXOA 3TYFB 4BFEA 2WYTA 1KPRA 3MRNB 4HDIB 4HXAL 3T3PE 4W93A 5K59E 3ZOAA 3MGTA 4PGEA 4JFFE 4JFVA 3GRWH 1CUOA 2DWDA 1N70A 5LLIC 3II1A 3MLWL 4ZUSA 4K9EC 3WO4C 3F7PC 5M95B 5DMGC 1FC2D 5FYLD 1NGYB 1PZ5B 4WJ5B 2PR4H 1JJUA 5D1XD 3C8KB 2A6JA 4X9HA 4RNRA 2VXQL 1A7PL 1MJ8L 1I3RA 1SYVB 4NZDA 3GUTA 3H3PH 2AQQA 3Q8BA 5MERB 3VMPA 1AHWC 1EFQA 2VSKB 3KCWA 4PQXA 3MRHB 2LAAA 3EO0B 3OKNA 4JDZA 2YD8A 4PTTB 3APNA 1EZSA 4AEHL 1LDSA 5FHAL 4DP5X 2NUPB 1A9EB 2GTZA 3FQTB 1J5HA 5D96C 4X7FC 1II4E 2C4FT 5AVYB 2I24N 4JJ5B 4LOUC 1FNEA 4LGPB 4IBVA 2V0AA 1SJVA 3BPNC 3K3QA 3NSCA 1RZJH 5H2BA 3T2NL 3HPLB 4MAYB 4FE9A 1RV6X 1MQKH 3P9LB 3X2QB 1MCWW 1QSFE 3N1PC 1NKGA 1VPOL 3E2HB 1DQJB 3ZHDA 4GMSL 3RYMA 5HYJA 4H0LC 1OSPL 4NN7C 4U1LA 2DZEA 2ZOUA 4I5BA 3II3A 1MRCL 1NGXA 5IK3A 4EN3B 2EZ0C 4Y2LA 2P5EA 5CJQL 4AM0A 5E51A 2ZF9A 1MUJB 1E9PA 5HDBB 1L9MA 1U3YA 2MQ3A 3QCUL 3SGEH 4F1SA 2FGZA 2FECI 5HGAA 2E8ZA 1BAGA 5C86A 1I8IB 1GIGL 1H9DA 3JVFC 1WO2A 1F3DJ 4P5MA 2D31A 1QX1A 2O5ZH 4AENA 2GTQA 4GUPA 2D03H 3RTQD 1HNYA 1HXMA 4O9HH 3VXSB 4EEEA 4Q8BA 2FX8H 3SKUD 2V3EA 4HF5L 1C8QA 1FN4B 1V7NL 1N3NA 5JW4N 2E5EA 3OL2A 5AYTA 1ZLVK 5ICXA 3C87A 4ENED 1M7IA 1JMZA 3QNXA 3SQBB 4Z3JA 3LKSA 4K2UL 5IHZA 2EKSA 1FDLL 1CBJA 2IADB 3NGBC 2NY6B 1DVXA 1F90L 1QFUH 4DGVH 4LCUB 1S2EA 1RKRA 4PW3A 4PAZA 1VGEL 1OB1B 4GG6A 4HJTA 2CO3A 3NEEA 1YNLL 2DY2A 2YPLE 1N8ZB 4U1JB 1CF8H 5EUOF 3C6LA 2MJWA 3MJGX 4MDIB 4TS6A 3T4AC 2JF1A 1XL6A 1F3DH 1YQ2A 5AW1B 3X12B 3QUYB 4MD0A 5F9OH 5EBGA 4D0DB 2B8OT 3B7SA 3LHAA 1S7VB 2QQLL 3VX0A 1P69B 3MO1B 4MXVE 1DQQB 2IMNA 1WCQA 3R8BB 3OXRB 4KJPC 3SDXA 3TVMD 1G7PB 1QO3A 3VXRB 1CXEA 3CXDL 1CE6A 1VAHA 2WC7A 5AVUB 3WFDH 4CNIA 3C9NA 5GS0L 3HCVA 3M07A 3R19A 3AUVA 3DHPA 5IMMB 4NHCH 3BDXA 4K07A 4M5TA 3BWZA 5A16B 1JV2B 5F3BB 1IL1A 2CCVA 5ID0A 2E4TA 1NAML 1RD6A 3QBTB 1UA7A 4JDTH 4XNZC 5EEYA 4XNYL 3GMMA 1C12B 3WHE1 4KO6A 4QHLA 2IG2H 4WY7H 1XXFC 3IRPX 3QHTC 3S97C 4KVNH 1NMBH 2C3HA 2EC9U 4XNQB 4AGLA 4QO1B 4NJAL 5AW6B 1VCAA 2DQJH 2IXQB 2WP3O 1YSOA 4ZUWB 5AWNL 2Q2EB 3TYGL 3JBG7 4WWID 1AP2A 1QI4A 4X99B 4O4YH 2ICES 3EHBB 3PHQB 3NRFA 1CLZL 2GSGA 1OGTA 2WKGA 3CFNA 1BQHA 2VDNB 1BEXA 2Z0UA 2EO1A 2YA2A 4HG4K 3I2CL 3S8FB 3L3HB 1TTGA 5DHVB 4HFUH 2PXYD 4ODUB 1BQ5A 5IBUG 2W1NA 2IANA 4JKPH 2C3WA 3NQKA 2CAKA 2C4XA 1IGTB 3FBQA 4IKKA 4UNVA 4DVBA 3U36B 5L8LB 4F33A 4TSBL 1MCWM 2AJ3B 2FEJA 2O5NA 3MJ7A 1N2RA 2NPLX 4X0KB 3PYCA 2E6QA 3BXNB 2XLLA 5J12B 5IEKB 3MOBH 3V8CA 1ZLWH 3SYAA 2DF3A 1FYTB 4P5KA 4OIFA 1HH6B 4N2HA 3VFSA 1BYOA 3DIFA 2KLRA 1K6QH 4OFIA 3MV8B 3VAEA 4AUJA 2JIXA 4AW7A 5JQ6H 2JE8A 4QOKE 5GGRB 1NICA 3FHEA 4KZEH 3PDDA 2OLDA 4XGZB 1PZDA 4OLVL 1QHPA 3SJVD 1GJWA 1LO0L 2O4EA 4H25B 2BH0A 2PWDA 3EJPA 4IU2B 1BZDA 5E00A 6PCYA 3X1BA 3HS0B 3PWPE 3TH3T 2R56L 2XN9D 4R5XA 5CJXA 2B1AH 4JQXA 3VGBA 4A2MA 1C8PA 1NCDL 2E27H 1NDMA 3ECBA 3SE9L 2P43B 1ROWA 5KW9H 2F7QA 4J8RB 4X6EA 1ULVA 1XD1A 1XR8A 3A6CL 3O41B 1GPOH 3KVPA 4G9FB 2JKSA 1KIUA 3QEQE 3GHBL 1NCAH 5EF0A 1T5KA 4NNYA 1XGTB 1CE6B 4YSRA 5AALA 3FF8A 4NWTL 3JV5A 2VLKA 3ULAB 2XRAL 3O4OC 5BV7B 1FVCA 3LNIA 1IGIH 2BVQA 4F92B 1IL1B 2YARA 5GRUH 5ID0B 4OZHF 1I7ZA 4P4KA 4XNUL 1S3KH 3V5HA 3FO2A 3ZSSA 1PG7X 2V2WB 5IB3B 3X13B 3WEOA 1F00I 3GJFH 1XSOA 1JPSL 3DXAA 1HESA 4UZSA 2IDQA 1RUKL 1UM4H 4YSUA 3MA7B 3BZEB 4X5PA 3K72B 3MGOB 4P2QB 1KB5L 2ENSA 4WWKD 4XVSH 3DX6A 3LV3A 2APVA 4XVUC 3EYOA 5DTFB 1JNNL 1G7HB 1IIIA 2OL3B 1D6EA 4DESA 3FT3B 2L8AA 3L8QA 5CLXA 1FVDB 4PJBF 4E42B 2VYRE 3BSZH 4J28A 4JE0A 4NZFA 1TVHA 2AJXL 2CGRH 2BCKA 2AXHA 5IVXE 2J8OA 3ZIYA 4LPVA 4PRBA 2WQAA 1E28B 2VXTL 3L3IB 5ANMB 2D3LA 3NJIA 3ETBJ 4M5ZL 5EU5A 3O2VH 1N67A 1A6AB 4P3CL 4NBYB 1INEH 4X7TA 1BECA 2UWEA 2XTSA 1XF4B 3KXFD 3MLZL 4LAJH 3K6SB 3VXSE 4APQD 3WDHA 5E1GA 5F6IC 4GAYA 2RB8A 1CPUA 3WS6C 1NC4D 2GHZA 3AU0A 5DGRA 2CO4A 3F7VA 4G6JL 5EOCH 1TQSA 1JCVA 2LFGA 5IFHH 4NZRH 5JOPE 2W80C 1I1YB 5DCCA 1MQ8A 1RL1A 2WB1A 2IDFA 4PEEA 4BFKA 4NQQA 2AJYL 5E2UH 2AC0A 2R4RH 4I5BB 2OXGA 2V5RA 3C60B 5A3ID 3A4EA 1F8TH 4G9FA 2F19H 2WINA 5A2JH 3TCLA 1CWVA 4WK4B 1TZ8A 1E9OA 2VL4A 5HGDB 3VFUA 1YAIA 3F7LA 2AEQL 2ITDA 3RKDD 2OULB 3NP3A 2KHAA 1S7QA 4NLHA 4NQDD 1HZHL 3OKYA 2JWYA 4L4TB 1JPFB 1XGRB 3MLWH 2OS7A 3ESVF 1AGBA 5GGSB 4UIMB 1HILA 1KEMH 2PP8A 5T5FH 1KYOK 3LKOB 4KK8D 4P2RD 5A2FA 3GBNL 2C7FA 1F58L 5HHQA 1TJHH 4HCIA 4LE8A 4X8XA 1ETB1 5IUCA 4MA7H 5A6LA 5AW8B 4PHXA 4BUHA 1Z9SA 4K23L 1ZTXE 3ALXA 3G6JF 4XP4H 4JY6B 2E7BA 2EKSB 4M5YL 1BREA 4K5NA 4NOFA 4X7SL 4GRLB 3PHOB 5AW0B 3WHE0 1N0LB 5FUCE 3G9AB 1NGZB 3A4DA 5E8NB 4XB8A 5ICUA 1MAJA 1E90A 4D9QE 1SXNA 2FH8A 2X87A 4X98A 4HKXB 4DO6A 4XMXA 3VH8A 2Y22A 2HLAA 5ICXB 4YJZL 2ZPKH 1N19A 4N2AA 3US9A 5EH1A 1ZGLB 4QXUL 1E4KC 1WC7A 3BIBX 4OGZA 2BSRB 3CZFB 4PMFA 3JWDC 1BXXA 2X3AA 4LVEA 5I74C 1BQKA 5E8OB 2G2RA 3BVDB 3ABLB 3S4SG 2D0FA 1HS6A 2A0LD 4K3DL 1KTBA 2ZX9A 2HSIA 3C6LB 5A7BA 3RJQB 3VO0A 4NP4L 3QAQA 2BWDA 4YEEA 5CN1A 1MCOH 1TVBB 4IEFB 2QBWA 2X0UA 4M03A 1MHCA 3FO9A 1CD1B 2XWJB 4HFUL 4WGWB 3EYVB 1ONQB 4W4OC 3WOVA 2NR6D 4HLZH 4LSUL 4POUB 1JYNA 4RFNC 5L2KB 1AD9A 1SXSA 3D09A 2FO1A 1ZHLB 5CCJA 1S5IL 4CMHC 2QKIB 3FCSA 1A22B 2HKFL 3C9NB 4OI9A 2L7JA 4TQHA 5ISZE 1QFPA 1KPUB 3H9SD 2B08A 5JIHA 2VDQH 5D2NC 4AYID 5C0GB 5KAQG 1JV5A 4YDZA 5ESAB 4Z7OB 3MLTB 1NFDE 2HRHA 1FGVH 5IB1A 2D7QA 1XZ0A 4G6MH 2VR7A 3FB8B 4PGBA 2ZP0T 5IQ7L 1FO0L 2XQYK 5ID1A 2GUYA 5DEZA 4JO4L 4HKBB 3WUWB 4U7KA 4LNRB 4XC3H 4FQLH 5BQ7A 2ESVB 2DLIA 2OL3L 3W2DL 3G5VB 4MJ4A 4FULA 3SHSA 1A66A 3MRDB 4X8CA 4Q9QL 2WVTA 4MLSA 3QEQB 3MJ7B 3LXUX 2EABA 1SHWA 4GIAA 5D70L 5MEND 2EEXA 4GKOA 4XI5C 2M1KA 2AXGB 4ZFFB 5C1MB 3QEUB 3BKCH 4UTBA 5FEBA 1MFAL 1VRSA 4Z76A 4HUUB 5INCB 4Z3GA 2LU5A 1U42A 5KVDL 1JMXA 3L16A 5C7ZA 3FB6B 1C5BL 4EXPX 1R5WB 5CGTA 2X9ZA 2JCCB 3DRQA 1WUZA 3BDYH 2HTLD 1IVTA 1CZ8L 2JNZA 1ZEAL 1QPPA 1W72H 3ZW3A 2A99A 1OAYL 3O45A 3UDWA 4L8CB 3NFSH 2XA3A 1ZANL 5CD3A 2IPUG 4J4PD 1K8DA 4AYMC 3WNPA 5ABDE 3HJEA 3GB7B 4XN8A 4F37K 4XT1C 3ABMB 1CVRA 3MBWA 1LILA 2H1XA 3C09C 3IBOA 3VW3L 4XWOC 1XH3A 1RULL 4KBPA 2E86A 3ARBD 4M8QB 1U8IB 2BOCA 3CH8A 3BW9B 2D9QB 3WFBL 3ZE2B 5ITBL 2FT7A 1HHJB 1YMME 1CD0A 3IJ7A 4XBMA 3VA2C 1DCEA 3HZVA 2FSEA 2G0KA 3KD4A 1K72A 1S5IH 1JPGA 2OMBA 4XMKL 2PW1B 3K8MA 3NJNA 4X42A 4BYHA 4OCWL 3QQ4A 4MKMA 4XHQA 2H0FA 2PXYC 1RZKC 4Y4HB 1WA0X 3BP4B 1MREH 1VEOA 1AGCB 3FRUA 4YDKL 4ZPTA 3VDBA 1A1NA 3MROA 3NESA 1D5MB 3ORJA 3ARDC 1CXFA 1RUPL 1CGXA 3FSZA 3G6JE 4XAWH 4XCEA 1DQLH 1UXWB 4XO4A 5JDSB 4OTXL 3IDIA 2PLTA 2FQGA 2DQEL 5GSRB 2QADD 4KFZC 2BVPB 1YEJL 1A6AA 1P53A 2APWA 1OL0A 2HT3C 2VAJA 5KSAC 3O8XD 4L5FL 3H54A 3WEBA 1JZ8A 1FIGL 2E9IA 4G9DB 4S10A 5C0EA 2TAAA 4XRCB 5EDSA 3B7UX 4RLDA 4FQ2L 3DVFA 5I5JA 4DEPB 4HH9A 5ESQA 3APDA 4NQED 1XB3A 2BNUA 4KOCA 2AV1B 2YHGA 2UZYB 3B9EA 3RBGA 1MI5D 3C8DA 3RB7A 2VMFA 3ZHKA 4GKZB 4JM2B 3MN8A 2WYHA 4QTHA 1I85A 2NY7H 4JL1A 4QXTB 4YUEH 5I8OH 1Z9LA 3Q06A 4CVZA 1NZRA 1AGEA 1RZGA 1BZQK 5AVTB 4QNPE 4JLRA 3TWYA 2I85A 1W2KT 3A67H 3PCYA 5SWZB 2V9RA 1X5MA 4GRLD 4IRSC 2XVLA 3WLWD 4FL4C 3P2BA 4FQQA 3AAZB 4PREA 3L1EA 4ZZFA 1UWYA 4QCIA 3UAEA 3KPTA 2DWSA 2X9XA 4DUWA 3L3GB 4UDTA 3E8VA 3A5VA 3PDOA 2G9KA 4PJDB 4MBOA 4U2ZA 3PWJA 2F54A 4PWFA 2YXMA 5LVEA 5MERA 2YEZA 3GMPA 4K0OA 4W9LC 4J3OD 3KMDA 2CK0H 3FQWA 1OSPH 1WK0A 4WW2C 4HBCL 5FA4A 3BUIA 2BFVL 1IKFL 4KUZH 1BD2E 1MRFH 5E8PA 4KK9D 1MH5A 4KTYA 5PAZA 1RJYB 2Q3XA 2Q10A 3ZU8A 5JO5A 4M8VA 3VFMB 5KANG 1BFVH 3BGFB 3Q8AA 1NFDF 3II2A 3L5XH 4GRLA 3FPXA 4JG0L 4AVKA 1XH2A 4V11A 4N2NA 1ZDQA 4KKCC 4L3ED 2YAOA 3AXLB 1FV1A 2MEJB 2VOTA 5E99L 5FK9A 3VH8B 1G9ML 2ICWB 5F9DC 3VXMD 2GQHA 4R7NB 3GMRA 3KJ6H 1I3RB 1SYVA 1BVKA 1R6VA 3UG5A 2VDLH 3CHOA 5E4EC 3UTTD 4UQCA 3BFOA 1ECYA 4WFFD 3TA3B 3CXHK 1FL3B 3NFNA 4HC1A 5DHYB 3ULUE 2E7CA 3TFBA 4BSVB 2OMVB 4YDIH 1P4IH 2QADC 4M5ZH 5TE7H 3R18A 3GSRA 1P4UA 5KYNA 1HYSD 2WVSA 1OLZA 1XX9C 3ARDD 4J3OF 3U4EB 3KYKL 4PRIE 2PPDA 3FSWA 3MUHL 4B9JA 5ANHA 1JIBA 4QXUH 2PMZA 3U2IA 1H5BC 1U58A 4JHAH 2NY5L 1B6DA 1X5HA 1NPJA 3CC1A 1U8HB 5F72S 1LJMA 2JQZA 1M56B 1IJNA 5DUML 1JXGA 2YFNA 4CVWA 3FMGH 4G6AC 1TZGL 2OX5B 32C2A 5LNDA 5K9OA 1FI8C 1S78D 4H88H 5D71H 1W0WB 2AMUA 5C0BD 2UZXB 3QQXA 4W9HC 4JUSA 3SE3C 3D51A 1A9BB 1DANT 1JE6A 3MKKA 3QFDA 3LN9A 1A4JB 1XZ0B 3VUAA 4LL9A 2BZCA 2HKAA 2DRUA 1KENL 1BWWA 2GTZB 1FE8H 3VXUD 5IV2B 4E41E 1O6TA 5AVSB 4LSUH 3GKWL 3FQXB 2OJZH 4LU5L 1TFHA 2VC2H 1I4FA 3MZGB 3MUY1 1PZSA 2UX6A 4OW6A 4QRAA 5CJXC 5C92A 3R1GL 3WEXA 1QLEH 1JDCA 5AWNH 1FRGL 2O6FA 1T2XA 5I66B 4WW2F 2WNWA 1J1OL 1XGUA 4BQCA 4YDIL 2UX7A 3GI9H 1T7WA 4GSXA 3RWFA 4IBTA 2YA1A 5E2TL 4NO0D 2DBJA 3DTXB 4LCIL 3ARFC 2BY1A 5DRXB 2A9NL 4XPBL 5T1DL 3VH8G 2P8PA 3FB5B 1OEZW 1RHFA 2NQCA 3KR3L 3GSVA 1I8AA 4NC2B 4P5SA 3ECVA 3UTPD 4FABH 4PJCB 5CZRA 5DYOB 4P4KC 4JCMA 4N8VA 4R0LA 3RGVA 4PVBA 4XNQA 1T89A 1ZGLM 2DJSA 5KJRH 2M2DA 3WS3A 1L9RA 1DBJL 1NLBH 1ORQA 3IM1A 4G9FD 4JG0H 4NKDB 5BZXA 4KXZH 5BRZB 3K1KC 1ET5A 3TJPA 4N87A 4J4PA 1SEQH 5AZUA 2D31B 2CO7A 1NGWB 3S37X 4CC4C 4JGMA 5FYKE 3RNQA 1RLWA 3ZPDA 4ZX4A 3Q2WA 4XBEL 5JIKA 4AGMA 2NSQA 3QEGH 3JWDH 2VC2L 3C6LD 3DYMA 5F96H 2X10A 4YK4C 1UWEL 1MIMH 3HCVB 4Y4KC 1FSKB 2AJSL 4ELMA 2JCCE 4E9QA 4GQRA 4OZIA 3C5JA 1CFMA 5G55A 5B39B 3KPRA 1WUNT 3LH2H 3MJ9L 5I0ZA 5KYYB 5J9PA 3S5LG 3LQMA 2DH3A 5EO9A 2B2XH 4TUOB 4WHYH 3NIDE 1URIA 3QXWA 5AW2B 3I6SA 1IEHA 4CKQA 5J6GB 4PRDA 1HHGB 5GISH 4KXCA 1MHPL 5DRWB 1NAMH 4JDTL 4UQ2B 5AOKA 3VCLA 2K70A 4YC2B 1YN6B 1X5JA 3WS6A 5E00B 3EYQD 4AXWB 2QLYA 2WW8A 4U2YA 1BM7A 3IJ9A 1ZIAA 5G4MA 2IBGA 1NWPA 3DUUA 2XQYA 2VXSH 3BIKB 3QIBC 3K6OA 3MO1A 2XQ0A 2VDRL 1BVLB 4XHJC 4ZFOL 1S7XA 3L1GA 1ZA6B 2XT1B 4WO4C 2TRYA 5ACZB 3KPQA 2ODIA 1E0OB 1LEIB 2RCSH 2F8XC 5DDHB 1JL8A 4IDJL 4PRNB 1DJYA 3VWJC 3GTNA 1QWUA 1MWAH 3B2PA 4L1SA 1TITA 2IWFA 3FUIA 4N0YH 2NNXA 3QT2A 3Q1EA 1NMCB 4RCAA 3VFGH 4O2FA 2HT4D 2NR6A 25C8L 3T0XA 4PCKA 1BZEA 1EEUA 4AYFB 4DKFH 3SE3A 4D0BA 2YZ1A 3CHPA 4MXWL 3TA3D 2FE0A 5J13C 3PHQA 5CHNA 4S2SB 3WE1A 4TVSa 4Z78A 1CURA 2QPUA 1S7UB 1KCWA 2X89A 3S96A 5I71B 1PU0A 2O5XH 3PWJB 3KPOB 1TLMA 4WSKA 3RNKA 2P48B 3HBGA 2O5ZL 4GUCA 4JBSA 3BEWB 3GBDA 4MNGE 3ZDXE 1FZMB 2OCCB 4F7CA 1B3JA 2ED9A 2NZIA 2QVTA 2VN4A 3ZXAC 1Q0YH 1Z3GH 1ZT1B 4LLWB 1INDL 5JHDE 2PR4L 4DP7X 4EI5C 2CK2A 1MW3A 1YUHA 5IHWA 5EBWA 1XEUA 2VRQA 5E6UB 1UGKA 1EEYB 1JZJA 2AEQH 4A04A 1E4KA 4R3SA 4PUBL 1PY9A 3JV0A 5EPMA 5ES4B 3IGUA 3FS9A 2PETA 3A24A 3DXAB 3O6FC 3AXLA 1MRCH 3CG8A 3VRIB 3UC0L 2EDFA 5LXGH 4YPJA 1QW9A 1U93A 3FTXA 3J2PA 3QIWA 3QUYD 4C56B 4GRWE 2WBKA 2WMPA 3U6RB 1SHSA 4IBLT 1IGFH 1TO4A 3HBQA 2GKIA 4IM8A 5D7LE 3PQYD 4P2QD 4B6ZA 2FB4H 1UH2A 1EAOA 5T1KB 4R7DA 3CFMA 3DJRA 1FH5L 2WZ5A 4Z7UE 1QSED 3KXFA 4ZXBB 4F7PB 3IMRA 5GJSH 5H94B 4TTDD 4QRBA 9CGTA 3Q13A 4RRPM 2FIKA 2TSAA 4FCAA 4F1ZA 2LAGB 5LHDA 1JXDA 4UTAA 1U95A 4ZUTA 2J2ZA 2EE9A 3O3BA 1A6VH 3S3JA 3UP1A 2VNCA 4QRPE 5AAPA 3RWGB 3TV3H 1XBRA 3QUML 4ZFQA 2GFBB 2VB5A 3GSQB 4JHBA 3IT8D 1HHHB 2LVCA 2MHAA 2F2HA 2O1AA 4OCWH 3ARGC 3RY6A 4QOKA 2NUTA 1QLRB 3QHZL 1G7HA 1N6QL 1HL9A 4JO8A 4NN6C 2RD0A 4PJHB 1NC4A 4KITB 1ZD6A 3DSFL 3IU4H 1RURL 2EH8H 1TJMA 1XR9A 1G7QA 4K3GA 5LG1A 4JFHD 4XCFL 4KVNL 2OYPA 1XIWD 4EI6A 2QGDA 4HUCA 2VJXA 1Y07A 3BKMH 1C16A 4HJ1A 4HHWA 5TDNB 3LZFL 1IE5A 2OMUA 2J1XA 2XZQH 2CLVA 3EO1A 3UP6A 5D7KE 2DLEA 5LQBL 3OLDA 3BGAA 1ZLSH 2WXJA 3CCHB 3G6AB 3LQAH 4JFPA 4ZOAA 3N43F 4YIQA 2X4SB 1NFAA 5GRYA 3WKYA 4EKJA 1Z9OA 5AFAA 5IV2A 1FIEA 5FGBC 1BAWA 2H45A 3DO4A 4U1NA 1QA9B 4KC3B 1SYSA 4G8GE 5IROD 2XYCA 3FT1A 2OAAA 3UACA 2HX7A 4L5FH 3BUDA 1RIVL 2Q5BA 4K3JH 1EHLH 3GUFA 1RXLA 4NGHH 1JNJA 4KGJA 1H6FA 1X7QA 3H2PA 3MR9A 2YMXH 4L8SB 5J1TC 4UQDA 3MRKB 1I9IL 1PLBA 5K9JH 3NH7H 4JW3A 1SVZA 3OMIB 2HLAB 1ADQH 1G6RH 1GZPB 1I7TA 2X2JA 2YOAA 3FCSB 4PJ7E 4QEGA 5F6HJ 4XODA 3TJEL 4YHYC 3LEXA 2BM3A 2FHBA 3LD8C 3P4MB 3MRJA 5ADPL 3SEPA 4HWEL 2DMHA 4KKPA 4ZMYA 3UG3A 4TVPD 4UB0H 1GA2A 2AJSH 3NIGE 5J3HC 4G80A 1AR2A 5CSZB 5E9AA 2AJUH 3SGJC 1BOYA 4AMXA 2AAAA 3U9WA 3O9WB 4E36A 1Z9SB 2IGFH 4A7SA 4DETA 3LRGA 2X4QA 3DRTA 1KYDA 4I18C 1H3PH 2XN9A 1H3GA 2HWZL 4FC3E 3UTSB 3TN0B 2DBLH 4JRWA 4MZIA 3MUGA 3JTTB 5MENE 4L0PB 4OCNC 2AK4A 1MAML 4MMXA 4NQXA 5E5MA 1KN4L 3FMGL 1E43A 2EVIA 5LAXA 2J6EL 3TIEB 4AMKL 2X40A 4YZFE 3EW3B 3OR6B 4N1HB 4OJFH 5LG6A 1L9QA 4YEFA 5I0VA 1I9RL 4ODWB 2A6KA 1FHNA 1ZHNB 4V1DB 4KHXL 2F7IA 4KMQA 5DWUL 4DGIL 1LD9B 1T5XA 4KK5D 3WY1A 2GUOB 5K9QG 3AVEA 3TS8A 4BEIA 1D9KC 1AIZA 4EBQL 1K8IA 2CO2A 4PJEF 1B2WL 3MSPA 2R69H 1WWBX 2WQWA 1RJLB 4JFSA 3V4VB 2EDHA 3L17A 5E5UB 5I9QC 1KXVC 3ZYOA 2LE9A 1E42A 2JKRM 4YLCA 2HLEB 4KDTA 4BKTC 2CRYA 2L7EA 3OKOA 2FD6L 3TJEH 5DJZB 3AUWB 3FU0A 4P5TD 3D3VA 1T6VN 3V6OC 1T3FB 1VHPA 4HFWA 4UQEA 5D7IA 3V4LA 5I6KA 4UTAH 3I9PA 3T0EE 4PJIE 3FFCA 5KS9B 3RY6C 4LARL 2KLTA 1YMMD 2V9TA 1HJCA 5JOEA 2ERJB 4EOWH 4OGXL 3PL6C 5FC9A 1J0ZA 1VB9A 4DGVL 1Q94A 2AW2A 3KLHC 4ZMVA 4DP0X 1NL0H 3RDTC 1G7JB 5IB4B 1WFJA 3CIQA 3WHXA 3UYRL 5IVXA 4WRLA 3NJLA 2VR5A 3WTTA 2RFXA 1JV5B 4QT5B 1F5WA 3AREB 4L8DB 4AG4H 4B5EA 1DJZA 2OSXA 1QTPA 2Y3NA 2FBJH 4E9SA 4XP6L 3B2VH 1G9EA 4HLZG 4O9HL 4ICXA 4MXQD 3DUHA 4UAOC 2EH7H 5EF2A 3VG9B 3GLDA 2ZZUT 1N3NB 4UYPA 4P3DA 1QEXA 1IM3A 1WWWX 3F01A 2W0FB 5DHXB 3SE6A 4MWFA 2HFEB 3B9KC 1F1DA 3GWJA 2DEWX 4RSVA 2DQIL 4NN5C 4Z3IA 2VN3A 1AMXA 43CAA 5EU6D 3KYNA 4MVBD 2XJKA 2YLHA 4PRHB 3N1MC 1W8EA 4OF3A 5I6PA 4HIJA 1SF3A 3SD5A 1AKJA 2WVUA 3BAIA 4NUQA 5ADOL 3SZKC 3MRHA 5IJKA 4EDXA 4F7CB 4JRXE 5DJYA 4NFBA 5F6HI 4HV8B 3DMMD 3GMOA 4FXKA 5EOCJ 3HS0A 2Q8BH 2WQVA 3CIAA 1NC2D 1PNDA 3ZYJA 4X4XB 5IW1B 4MA1C 2E27L 2O6EA 3SOBL 3INUL 2HLFC 1OTTD 3PY9A 4AH2B 2ZYIA 4ADIA 4HSCX 4G8IB 4WK0B 1DJXA 2VM3A 1M7XA 1ACCA 1GC1H 4JDEB 4FNSA 4AG4L 2YOCA 4PY7B 1D5MA 4Z7VE 4QKTA 3B1TA 2Q7YA 1T7XA 1U93B 3QR0A 5GJSL 3GM8A 4N0UB 1NH6A 1ID2A 3SGEI 1UM6H 4TV3A 3KPSE 5E6RB 4A39A 2I9LB 2JI3A 3L3GA 3BWUF 1UT2A 3Q2NA 4L48A 1S9KC 4K5LA 5SV3A 2FL5B 3K4AA 1QLFB 2HN7B 1G7MA 3HN3A 3NIFE 5C3TA 1EZVX 1BQHB 4OIAA 4MMXC 1NBCA 4ZPVA 1L9SA 2VQ4A 3CBKB 3BE1L 1I3GL 1A25A 2JLPA 2ZOKA 3IB4A 5ADOH 5D4HA 1BF8A 4OFQA 4DVBB 4WWKB 2EDWA 1G5AA 5HYEA 1N9PA 4BH8B 2YXFA 3PWUA 4YGVA 1N64H 4XN1A 3RIAK 3VXME 5EUOE 1NDGA 1ITCA 3SDDB 3UZQA 2W0FA 4KVPA 3TT3H 1Y6MR 2IDCA 2X12A 3C5SB 4FLRA 1Q0XH 3DVGB 2CXKA 5AOJA 3KPNA 5I6XB 3TFKD 2IFGA 4NOBA 2R2BB 4IHBA 4KDTC 4RDBA 2P42B 5F7WC 5I0YA 1I8KB 3P3RA 3ARFA 1D9KD 4BCXA 3MCLL 3SDAC 4MSWA 4EQ2A 4ODXA 2OZ4A 2FJFA 3MYJB 2FJGB 3OZLA 2O93L 1KCLA 2QVMA 5DJYB 1I9EA 3FL7A 4S1DC 3G08B 3SDXF 3DSFH 3NSXA 5E9DB 4NM8H 4W70A 3DX2A 3UTQA 3K7UA 2X09A 2XI9A 3BUBA 4MXWH 5D55A 1GPOL 4UOQA 2NX5D 3U9PH 2G75A 2N1TE 3Q5OA 4LLDA 3K71A 3KHQA 1G6RL 1WA1X 2H32H 4XH2B 1NEPA 4DCQB 1Q9OB 2X6UA 4OZ4B 1B0RB 1TTRA 2IPTL 3WNOA 2D0HA 1UXMA 3HEIB 1NSNH 1S6NA 1NIDA 4I9WD 2B3IA 3U9PL 2ZCZA 4MB1A 5AENA 3QVAA 4MNGB 3QORD 1HILB 4ZQTA 3T3PB 1YYML 3H53A 1KIQA 2W0PA 3B9KA 5EZOH 2W65A 2GTWA 4GG6E 5CEXB 3BKJL 3AQYA 1F45A 1P1ZA 1YDPA 4NQCB 3CX2A 4XWOD 5TE6H 1UH3A 4ZODA 1OM3L 1A6PA 4BUGA 4Y5VA 4TQEH 3MUJA 5J06A 5T1DH 2UV3A 4EIBA 1M2VB 2XV2A 3MCLH 5CXPA 1DCLA 5JW4R 2V9QA 1VDGA 1RPUA 1B4TA 2K7PA 5D7SL 1T22A 4G5ZH 3VRLF 3KGTA 3HR5A 1SUHA 2LTQC 1R34A 3KM1A 4V1DD 1NCHA 4RZKA 5E6IC 3ZK0A 2VDPL 2XZQL 4NC1C 5CBAA 4YBQD 5D7IE 1EXGA 4AUYA 4PR5A 3QIUB 1ML0A 1L5GB 3V4PB 2EDOA 1KJVB 2FECL 3DVGA 4AQAB 1P7QD 1I1FA 1WFNA 4PBXA 1FLRH 1HHIB 5DZJA 1KJMB 5HHOB 1YY8B 4XVTH 1J18A 3M7FB 3CH1B 2VABA 1CLVA 4QHMA 4BDVB 1SEBB 1BCIA 2X4TB 4XNXH 2X1QA 3EXJA 4P5TB 4B3VA 2JI1A 2V5SA 4M00A 4UQAA 2WHVA 4YDLC 5GRJH 1AR1C 4I0CC 1EO7A 3IN2A 3QQ3B 4G8AC 4UT6L 3BHBA 1OLLA 3ETTA 2XQBH 2CJ3A 3FYIB 4K3DH 2FGWH 1NIBA 1NEZB 3DPDA 1MHHA 1HQ4A 5CGYD 3BJ91 3RZCB 3VFTB 1J0HA 1MELA 1JYWA 2ZSVB 3QUMH 1O75A 1SY6H 1UUNA 2L7QA 3DBSA 2GT9A 4HH8A 5C9JA 5JXAH 3K2IA 1DL7H 1GHFH 4LOEA 1DBML 4R2GC 4OZ4A 1CYXA 1JXJA 4DN3L 1AZBA 1ZHLA 3QS2A 4Y1SA 5CUSL 4QRSA 2NLJB 5INDA 4ODHL 3SOBH 3GXDA 3T08A 2YMTA 4OB5L 2WV3A 1GS6X 1J7VR 1KV7A 4RESB 3VJ6A 4EI5A 3W3BA 1QSEA 4ZDHB 3UMNA 5CZKA 2FD6H 1I7ZB 4YAQB 4IRJB 4B9FA 5C07D 3M45A 3B9KD 5CMAB 3IN0A 5BOPA 1U8NA 2V7NA 2DN7A 3TGXA 1V10A 5IREA 4PJGE 2XQYG 3WS3B 1TZHB 4MWFB 2OJZL 4LU5H 5L8KB 5IW3A 2ZWKA 5JHDA 4CADB 4LASL 2W60B 2NNAB 1T22B 2GY7B 4Z7QF 5IFAL 1M53A 5F0JB 3WKNA 4IS6B 3PHOA 3I50H 4LKXA 1G43A 4QGTA 4G82A 4NQCE 4DK6A 1MCOL 3ATDA 1PVHA 3L4VA 4ZAKB 9PCYA 2ZKHL 5AZEL 2KI6A 4ATWA 1CO1A 2WLNA 4NXKA 5EOTA 2XBZA 4IJ3C 4N68A 5SWQB 5EV7A 3DTXA 1MF2H 4KROB 4HIIA 4RMBA 2XY1A 4AZUA 1K4CB 2BSRA 5C08D 5IHHA 3TO4B 1J8HD 3TV3L 1IQWL 1X5GA 3GXNA 5AZEH 5F9OL 5KSBB 3EGSA 2Y07L 5DD1H 2FTAA 3EH5B 3BGMB 4UILH 2WXLA 3IDNA 4OIIH 3HG1B 2RGSA 3B7YA 1MSPA 2X4OA 1AYRA 3CQFA 3FPYA 1NEZA 4XMTA 3V4PL 5DUBA 4QXGH 2CKNA 1U8LA 3WE6A 5F70A 1U3ZA 4FHKA 3BPCB 2AQSA 4UM8B 3JVGA 2QEJA 1OCWH 1J9RA 4L37A 2JVUA 3EIFA 2LU4A 4LGSB 4K2UH 1XIWB 5KVDE 1EJ8A 1AH1A 2CRZA 3V6FA 3AS2A 1LQSR 3KPOA 4FQPA 5LGJA 2IDTA 3AG2B 1HYSC 2EXYC 1MJUL 3HRZC 5E8EA 5GS3A 3OQRA 3UADA 5DQ9A 1J9SA 3GMLB 4OFPA 5DD5H 4HCRA 5KYYA 4JHZA 1XVSA 5IIEB 3B7TA 1AGBB 5K93A 1IQDA 5CR1A 2WXPA 1TPXB 5MHSD 4BGLA 1I9RH 2NY0C 5FGCE 1OP9A 2YZ8A 4LVNB 5A16A 4JN2A 5IVOA 1N68A 2EEFA 2X89D 3KPRE 1Z3GL 2AF2A 4GIOA 4ELME 2B59A 1MDTA 3U0PA 3FRPA 1QUNB 3T3MF 2FWSA 3L1FA 4XPFL 1BG1A 3KYAA 2GK0A 5C0ND 4LEXH 2YLKA 4G7VL 1LTXA 2O61B 2YKLH 2TRHA 1H8SA 5B21A 4IBWA 2H6OA 5IVXF 1OF2A 3B1UA 1BVZA 2PO6B 2Q7NA 4K73A 4IBQA 4DUXA 2PNDA 1JBJA 1NGZA 2BP0A 1QFOA 3L54A 3UJIL 1A8ZA 3U4AA 1MKFA 4Y4FB 1UATA 3O0RL 4EJ1C 4MMZC 1S7WA 3QJHB 4JANA 5I1DB 3MBEB 4PP2B 4JFFD 3QDMA 2ZAIA 2Y3AA 4OZHE 1INEL 3NT0A 1MCLA 4R97C 4YBLC 4OCYL 3GJFK 2MOGA 5GS0D 5KW9L 4I0KA 3ZL1A 3Q3GA 2Y5TA 3X1NA 2RAMA 4X50A 2N3JA 1S46A 5F1IA 3WI9A 2FJFB 2B1AL 2PP7A 3EOTH 1O9VA 5FW8A 5CJOH 2H0PA 3K2UL 3VFSB 5I75B 3AACA 4N9GA 3UFIA 3P0VH 4ODBD 4L8CA 4EVNA 1E7VA 1PX3A 2EACA 1ASQA 2GIYA 1W72A 5JW3L 4UILL 3W5MA 2FX9L 1DYZA 3MV9B 3RJDA 3DO7B 1HKLL 2BVTA 4O5LH 4PJDF 3DARA 1BJ8A 3DX7A 4ETYA 1DLFH 3GI8H 3GUTB 2R2CA 4ORGB 1A1OB 3OAUL 1IC4H 1JWUA 1A6WL 2G75B 3AQXA 1D2OA 4X6CF 4JEGB 2X7LA 4FYQA 4NQDB 2MKWA 2CR0A 1LQBC 2GYSA 1HKLH 2Q76B 3ULUF 4DQOL 4YHPB 1JS4A 5FKPB 4F9PC 3P4NB 5HDBF 2HT2C 4A7UA 1RUMH 2QPFA 2Z91A 2VIRB 4C54A 1RK0A 2ITCB 4WTZG 1JXKA 2ROXA 1PKQE 1CI5A 1PAZA 4Y16D 2PW1A 1NBZA 2EC9T 1XO8A 1KFAL 2GTWB 1KC5L 4NO0A 5CEXA 4CJ1A 5L6YL 5GGRY 2OTPA 2QKSA 2OMUB 1EAPA 4LBEB 4U31A 3D85A 4FFVD 3CHQA 2BC4A 4FXTA 5EA0H 4NKMA 1QZNA 3GS7A 5I73C 2OM5A 4OLEA 1RHHB 5C07B 1HHHA 2MHAB 1NCAL 3PAUA 1ASOA 3C5ZC 3GKWH 4FXGC 3RUGE 4A2EA 1NJ9B 3I6GA 4K9JA 5IKCB 3CFBA 3GGWA 5FA3A 5KTEH 3QHZH 5D72L 1N6QH 5D1ZB 4HEPG 4R7XA 2NYKA 1R3HB 4GMTL 4YX2H 4G9DA 5C0EB 2MSPA 4PJHA 5DSCA 4J3UA 1E65A 4PTTA 4HJ0C 5DUMH 4XPFH 3CLEH 1PMYA 4PRIA 2ZWZA 4QHNB 1IKFH 1HSBA 4GLRH 5DHYA 4K7PY 1MZYA 1T1ZB 1PLAA 3GIZH 4TVPE 1DVFA 3HS8A 4F7MA 1G84A 5BO1H 3CPLB 3VTAA 2EILB 2XWZA 4UDUB 2X4TA 1YN7A 3S6CA 2BXZA 5IB5A 2ZX8A 3MRMB 4RMSA 5C0IB 4Z7QB 1NCTA 5ADPH 3HG4A 1E8YA 4FNPA 4AITA 5I15L 2VL5B 3LS5L 1C5BH 1WF5A 4PJ8A 3REWA 5AZ2L 4LB8A 3VFVA 4B9KC 4ZW7A 3GJFA 4B7IA 2VQ1B 1MCCA 4J6RH 5FUOL 1RZKH 1FN4A 1L0YA 4M62H 3T1FA 3S5ZA 3VVVA 1N59A 5EB9A 2DWEB 1P9MA 4OFVA 3P2TA 3P4OA 4UDTB 3ARDA 5DFVD 2VDLL 4HIQA 5DJ2B 1TSRA 1A1OA 1J1OH 2XUWA 5AZ2H 2CIIB 3W11C 4MQTB 2ADJB 1O6VA 5KSAD 4C83A 5K59F 2WWMC 2X6VA 5BV7L 3LNEA 3TJHD 4FQXC 5FA4B 4J27A 1YYLL 5TFSH 3RWEB 4FQLL 2I07A 3BD4A 3R0NA 4GRMA 4NQXB 3RFZA 4RMWA 4UQ9A 3D2UA 5IUSA 2VDPH 3P30H 1KENH 2H4EA 3F5WB 4Q0XL 4X99A 1HHKA 4XXDA 4UINL 2CUAA 1BBJB 2EINB 5E1IA 5G5DA 5BS0D 3P0VL 3HC2A 4MDJA 1FGVL 3CFCL 1JPFA 1XGRA 4Q2ZB 2Z31B 4MJ5A 4OR1A 3UBXB 2VLKE 5CSZA 3VSUA 1MJ8H 2HG0A 1R3KB 3BUYB 4GRWH 4QRUA 1UXSB 2X42A 3FQRA 4LPXA 4JFYB 1TETH 5C07A 3RE0A 1U8MB 1KJ2L 4UT6A 4HIIB 1SZNA 3NZHH 5HSFA 5I0XA 4IRSA 5DD0L 4BFGA 4DPRA 5KYWA 4DZ8A 1FCCA 1HH6A 4HK3N 2EDQA 4JFXA 5DU7A 3IDMA 5I28A 4XPHL 1JXFA 3C8HA 3D9AL 4ZAKA 4L3CB 2R83A 5F21B 1K85A 5IFAH 3C8KA 1EBAA 3GBNH 4PJXA 5IOKA 1A7OL 4NRYB 4KK9C 3PV6A 4UOJA 5TPWH 4GEIA 5IBLD 4YHZH 8PAZA 2YPLB 1FYTD 4TUKH 5FS5A 3OKNB 1T0MA 1PLGL 4AMKH 2J6EH 3R06A 4XO8A 1JTPA 2KS0A 4GQZA 3VD3A 3NACL 5C8JB 1NDMB 5JQHC 1U8CA 3OLEA 1I1AD 1NGWA 4NM8L 4NIKB 1UFUA 3LCYA 2J21A 5T3XH 5KBNC 1MHEA 4OZFH 4P06A 4Q6YA 3DX0A 3V52L 4K7PH 4HYTB 3I02A 2HYMA 1MG2C 1RK1A 3BH4A 3U2SA 1VACA 4XI5D 3BO8A 3AMKA 2J55A 2XN9B 1UOLA 4ANKA 4K5OA 1V3MA 2BSTB 4TLKA 4QCIB 4HWUA 2XICA 3EFOB 4XN4A 2A6IB 2CIIA 3EOTL 3H3PL 4PJAB 1H19A 4BSJA 3SO3C 3GK8H 5EO9B 5JPNB 4H1LB 3QWNA 5BZDA 2YPKA 1JN6A 2NY3D 3L3KA 1T80A 4ZAKD 2B16A 3SDAA 5L0QC 1DBBL 1X6NA 3WJLA 1B4LA 4AW4A 2X44D 3H4HA 5I8EB 4Z7OF 4XP4L 4EN3A 2E7LA 3E3QE 1RJCA 3QUXC 4OT1H 2IANB 2D7NA 1P4LA 3VWKC 4XOAA 3NSFA 4XC3L 2FT8A 1UKTA 4GW4B 2QHRL 5AVQB 1UB6A 3AT9A 4ZI8A 5HGHB 2Z64C 3KWWB 4KQ3H 2CNYA 3TU6A 1KB9K 4XBEH 1AO7E 2BVOA 3CFCH 3F7RA 3KPLA 4NKIH 2VE6B 2XWBA 5DURD 3SCMC 5DZLA 4WUUD 3AXHA 1KN4H 2CDEB 1XB6A 5BUAA 3AW5A 3BP7B 3LKQA 4PJCA 3R0MA 3FF7A 1R3JB 2VZTA 2QJDA 3GRBA 4L3CA 2WLJA 1F4XH 2BMKA 3AGWA 2NT1A 1QKZL 4QD2E 4TNFA 4M9OA 4HH9B 4YNYB 2YPLA 3IU3A 3IETB 2H26B 4HKZB 4MKTA 4KKZA 5CCGE 4X5XB 3O3EA 1CK0L 4FLSA 4PWHA 2LLNA 5DEFA 3L2LA 1KBBA 4QUOA 1BFSA 3DV4A 4IOIB 4HPOL 2Q3ZA 5HDQH 3RVVD 1EVTC 1E3XA 4WDIA 3TZVC 2ZXGA 1K4DB 3BKCL 7FABL 3ARZA 2DIBA 2PCPA 5F9AC 1IU1A 3DHUA 1ZA3A 2DQEH 3AAZA 5FKPA 3VE0A 5LWYL 2BCKB 1R5VB 5CP7A 2P5WE 3NN8A 2K6ZA 3C2AH 4G8FA 5JHBA 3JUYA 3CFJB 4RA3A 1FNGA 1ZV5A 3US0A 5EU4A 1UASA 4A6YB 3HJ0A 2F5BH 4PB0H 1U4EA 4GINA 4OZGA 2KDGA 5AAMC 4EUPA 1WFIA 1FCGA 2X4PB 2X38A 2H5UA 3HAEH 3QW9A 3H2QA 4HUXB 5C3LD 4LLUB 1IQWH 2H1PL 4BK4A 1J8SA 3N0PB 1SY6L 4X6DA 3Q6FB 2IBZX 2N56A 2R29L 3DURB 5F0LB 4KX9A 4LCVA 4W81A 3IGFA 3S34H 1WT5A 5B22A 1AZUA 3BUTA 2J6WA 1AQ8A 3IRCA 4X80H 2WGNB 2XTJC 4OCYH 2VMEA 5CEZH 2EIZB 2VW6A 2EEBA 3B83A 2YAHA 4L3AA 4B9CA 4LRNH 5LQBH 2HA1A 1IAIH 4MJ2A 3OBAA 1GGBL 2Y6SD 4ZW6A 1MVFA 3L4CA 4ANWA 1BW8A 5KYXA 5EA0L 2NY5H 4PD4J 4PRBB 5LBVA 4JCWA 3SE8L 4AEEA 2QHRH 1QNZH 4NNXB 3G6JA 3T2QA 2AXJA 4NRXB 1CLYH 2MKLC 4U0QB 1N64L 2HFFB 2A1WH 3MBXL 4UUJA 1PW3A 4LPYA 4Y4KA 1SDDA 3WEAA 1EHXA 3ECQA 4YL9A 3K6SA 5D2NA 5JIQA 3UCRA 2K1MA 3EZ8A 4DERA 4DGYL 4RBPK 2Z1KA 1IFRA 5DXWA 2E3VA 1WICA 3TNMB 5GRXG 5I76B 2XSKA 1X5ZA 2NY4B 2V2XB 4M62L 5JA9A 3OGCB 3O3AA 3FYEB 4QTFA 3SQRA 1A4AA 1TU2A 4WWKA 5GS0C 5FV2A 1YN7B 3HI6H 2J5LC 4WEUD 2A77H 3CDFA 2XV3A 3EGXA 3VWKA 1R3LA 4HK3J 1TTAA 4PJ9A 1TQBC 3D2UB 4QF1B 3ARBB 1M1SA 5H4ZA 2H8PB 3MOBL 1FNLA 1RZGB 4PI0A 2D3NA 1CGWA 4KHTH 5D93C 4W9GC 1NINA 2Z8RA 4NNYB 2ZUWA 4R5TA 2FLMA 1CT8B 1A3RL 1X5XA 4R3SB 1BDYA 1IGCH 2J8UF 5DJXB 4E5XG 1QFWI 1QWNA 4J3OH 2HAZA 3OMAB 1SQ2N 5E8OA 3T0WA 5ECGA 4GSQA 4XCNA 1WJ3A 4XVTL 2BSDA 1RUQL 3RFZB 2CLRA 4LBAA 1NFDB 1FLRL 4Y9GA 3VI4B 2YGQA 1XFPA 2WZAA 4HJ0D 1MLBB 3A6BL 4OZFG 5F8QC 4FLOA 2JQMA 2VDRB 4YSAA 2L4OA 4LAQL 4PJ8D 4QHKI 5K1VA 2GIXA 4HP5A 1QR1A 3FQUB 1DBBH 1T20B 5T5NF 4GS7B 4YDVA 4LEXL 3DNKA 3LZQA 1Z9MA 3HZYB 3KXFB 3P3SA 4ZXBA 4K7FB 1QBBA 1UXSA 5HHNB 4PG2C 2FYYA 3SJVA 1KT2A 3CFDB 3D18B 3DDFA 4EZMA 3V5DA 1D5ZB 1EDHA 4NCC2 2D7OA 3HRZA 3FB5A 3R7RA 5GZOC 3JSSA 1JZFA 3FCTB 4JFXB 4UZGA 4Z95H 5GRUL 1WBZA 3SKMA 4P5TA 4QMEA 3HMXA 2MCPH 3FTZA 3MNZA 4ZBJA 4JHWH 1SN5A 2I27N 3GZPA 4HGMA 4UNUA 2QQLH 2NW3B 4JZJC 3V52H 4ZMTA 2AJYH 2N4IA 1WH0A 5MI0B 1EGJA 5D1QB 3RVWC 3TN0D 2P5EE 5ETUB 1F1GA 1L0QA 1RK1B 2J1WA 5CIPA 3FO1A 1NPUA 4WV1C 3SDCB 1Y7VA 3QG7H 2HVJB 3FN9A 3P69A 4KOBA 4KJQC 3BQUC 1SRDA 1A21A 3GKZA 5DS8B 1IGYA 3QIWC 2BNQB 1IV8A 2QTVA 4O02B 1IGCL 5IHLB 4BJLA 1Y6KR 5MENB 4B9YA 1AKPA 3DSNA 3QDJE 2IFFH 5GGVY 1F02I 3QXUA 1XH1A 1ZPLA 2HUEA 2OXGB 3EOYG 1MDAA 4UQIM 3RU8L 3S2CA 1F42A 4EN3D 4ZMAT 4FKKA 3S35L 1CFVL 4G7SB 4PJEB 3IDJB 3RX5A 2J1YA 3OXRA 4LFHD 3D4GA 3SDXB 4A68A 3EGDA 5GS1B 3PXJA 3OC5A 1E3FA 3GO1L 4LL4A 3KGRA 1JZ5A 1KWKA 2CBMA 2WY3B 1Q0YL 5GGSA 1KNOA 5G2NA 1EHAA 3IJEA 4F15C 5AW9B 4N2GA 1NM9A 3BLKA 1PEZA 2A4EA 2BLFA 3G04B 5F1SA 1SJHA 1BQHG 4QKXB 2VISB 2YJLA 5DUBB 1Z9PA 2OMZA 3N42B 3VGGA 1G7LA 1ZSDB 4LEOB 4XX1G 3HNVL 1ETJA 4XNMA 4XBGA 4GW4A 2FUTA 1CLZH 1JFHA 1XZWA 3BI9X 1ZJAA 3B5TA 4OQTA 5JQIB 3BAJA 1DSFH 2EVHA 2VM9A 4PRNA 3A23A 3QDAA 4JO2H 5AOIA 3V10A 1UA6H 3TEUA 2JXMA 5IMLB 1IGTA 2Y7LA 4P23C 4U1SA 3I75A 1J0IA 4KJPD 4U1HA 3TVMC 1QRNE 2EE2A 4ZJ9A 5F88B 2HFTA 2CJTA 1KCRH 5JPMB 4CMMA 3FT9A 2ILLA 5D96B 3BXNA 4GO8A 4NP4H 1CXKA 5C09D 4L9LB 1YECH 2H3NB 3GTVA 1BEYH 4NSKA 2AQTA 2OTWB 4QY8A 5D1ZD 4NKOB 4S2SA 1KCBA 2X4OB 2VERN 1Q9LA 1QSEE 5EWIL 1T0NB 2Y6SC 5B1AB 3V4PH 4CADA 1FORL 1G7IB 4RFOL 3E2HC 1IC7H 3QWQB 1C7SA 3GSWA 4JB9L 4UTCA 1PGRB 4O02A 3FT0A 4G5AA 4N2BA 3ULVF 4NN7B 3QJZA 4PB0L 1AD0A 1CDBA 3SOTA 5E23A 3I6LD 1IAOB 4Q97A 2VZ3A 3F83A 4E41A 4XXCC 3FQWB 4PBDA 4LIQE 4YDKH 1D7FA 2OFQA 4EDXB 3RUGA 3CHXA 3FU7A 5B38A 4NFDA 5J11B 1LK2B 1JPST 4WI9A 5D1XE 4Y8AA 3UIZA 2OI9B 1AD9B 1JPSH 3DBXA 5D1ZI 3ZRCC 1EZUA 2E0PA 4NAJA 4XVOA 3TEXA 1DVFC 3L4UA 4X4ZA 2CPCA 1T5WA 3MV7D 5BXFB 3RWHB 4NO5B 5F9JB 3LIZH 1IAMA 1MFBH 3MBXH 4AE1A 4L9DA 1HE8A 4PIRF 1RMFL 4OIBA 2DQDH 4N9GB 4XPGH 4JG9A 3SGJA 2X4SA 2XDHA 2IAND 3JWDL 3U0TA 3U6RA 4ZO9A 1G9MH 1XCXA 2OA9A 2A3TA 1WE5A 3BEVA 1D7CA 2XNAA 2P8MB 1Y0LA 4WV1A 5AAWA 4I18A 4LRNL 4QRQB 1VADB 4HJGB 4MD4A 5HVGB 4GXVL 1A6UH 2WUCH 3BQUA 1INQB 2VLRD 1Q0XL 4HSQA 1KB3A 1T21B 4X80L 3CXHJ 3NGBB 4KQ0A 2BP0B 1EX0A 1MPAH 3ZE1F 2EXYD 4KPHH 4ZFZB 4F7TB 3AROA 3WJJA 4ILDA 4Y2DA 3HI1A 4HZLB 5HXMA 4Y1TA 1UUSA 3T9WA 1NCGA 1SJXA 3FULA 2YAMA 1I8IA 4YFLI 3H6AA 4NQUA 4B97A 3X14B 2NY2B 4U7MA 4L3EB 3PWPB 5TE6L 3KYKH 3SGKA 1ET8A 3IDGB 4XOBA 1TEFA 3QC5X 4R26H 5DFTA 5GGUA 5JYMA 1CFQB 1WCBB 3CN1A 3OVUB 5C2UB 3MJ8B 2NTSP 3GSQA 4U6YB 4PJ9B 2HFEA 1KJ2B 2ZUQC 5AW5B 1SBBA 3E9UA 3ZE0B 1T1YB 3B6SA 3ES6B 5EIIG 2GJ6A 3IE4A 4LSDA 4J5VA 1U8QA 1BEYL 4P9HC 4PJFB 5EULV 4Y2OB 2C3XA 1CT8A 3CVIH 3QRLA 4X7TB 2YRLA 4MHHI 3MV11 3ZUNC 2UZXA 3M1BB 3D39A 3IJHB 4N90D 2H0JA 2WSPA 1QNIA 1FC1A 5HYIA 4DZBA 1LP9A 1IGJB 2WLIB 5IB2B 1SXZA 3TASA 3FNKA 4PJ5B 1ICTA 2NY1C 2WPGA 1LMIA 4UCFA 4FFZH 4FZEL 3D87B 3IKCA 3EJTA 3FOLB 1GW6A 5C0DA 1JNNH 5AL8A 2DQJL 4PJBB 1EEQA 5D2LF 3P40A 4FJ6A 4CW1B 4KI5D 3F00A 4FA6A 2OYMA 3PHSA 1QASA 4GXFA 2AV7B 1RPKA 1O9WA 2BNQD 5LDSA 4KK6C 3U9UB 3MFFA 1UWFA 2ZYHA 3CK0H 3MRGB 4RSYA 2P24A 4OZGF 5GS0H 4OF0A 4NWUH 4YE4L 3MLYH 4LFHG 1NCWH 1SMDA 2BS8A 3JWNH 1JHKL 4PD4K 2XNAB 4Y4HD 1CGTA 3SKJH 2XACC 3RVUC 4LAQH 1QTYT 4KDWA 2UZPA 4NYLA 5D7IB 2VZOA 5DHEA 5FFOA 3RHWF 1UCBL 1EO8L 15C8H 3QZWA 5EOCL 5JZ7D 4XNBA 3MCKB 1P5VA 1OAUH 5CZVH 5CD5D 2VLME 4UTBL 1Q38A 4UQ3B 3D18A 4Y9CA 1G5GA 4NBXB 3IFOA 4XZ4A 4F7MB 3DETC 1P5UC 2HCZX 2VWEC 5KAQF 1I4FB 1XF3A 3OKLB 4POZC 1Y1DA 3HS0C 3QIUD 1B4RA 2CBOA 3QUXA 3HR5B 4AM0B 5T1LB 1UVQA 2R56H 4IRZA 5DK2B 3RTQA 3BT2L 2RACA 5HHXL 2PF6A 3G5ZB 2Y1ZA 2H3KA 3QIUA 5JOFA 3WYRA 4AYEC 3EJRA 5DZPA 3CVCA 1MXGA 3VB9A 3GGWB 1CICB 2KPWA 3O6KH 2X53A 5FA3B 5KN5A 2ZTBA 3HC4L 2XIDA 5F1NB 1A7NL 2ZXWB 2DH2A 3AM8C 4E5XB 1NBVL 3JTTA 3LPWA 4HS8L 1DQJA 4S1RL 3WL9B 3UIYA 3UL4A 1RH8A 1CE1H 3N50A 4DH2A 3D25B 1A5FL 3X11B 3BN9C 4PGCA 1ZHBA 2EXWC 3BWUC 3SYQA 1QSFD 2HPTA 3DK2A 5FYKL 4NUJB 4BWWA 5H37H 3IGLA 2DQUL 4F9LC 1FNSH 3FUMA 4IEFA 4Y19D 3VFPA 2DLHA 1DSFL 4L3EE 1IM3D 5EU6E 2XOTA 4XPHH 3BLBA 1YHPA 3ZRFC 3O41A 4PJ8B 3I84A 4AVHA 4KAQL 4AH2A 4BD4A 2BSED 4KH2A 3LVEA 2AITA 1FO0B 3NIFF 1QNZL 4FOMA 2NY1D 3CDGA 2J8UA 4DN4H 4YSSA 1G94A 3T8XA 4PJIF 4N5EC 3JT0A 3ULUD 3R4RA 4Y2DD 3RJOA 5J9PB 4JRYD 3HHSB 4BCZA 2ZKWA 3FQNB 1VGKB 4G1MA 5IB1B 4KHTL 3NABH 1QA9A 1HXYA 3WN5B 4JDVA 1B4JL 1OGPA 4FG6D 4MAUL 4NRYA 3D12B 1AHWA 2BW5A 2DS4A 4HUMB 1QHOA 1LO5A 3HS9A 4UB0L 3B9VA 3QDJA 3PXHA 3WGVB 2CHXA 4QWWD 1UD4A 4QHLB 2E56A 5B4MD 1C5DA 3BDYL 3HE6A 3ROOA 5SX5K 3U4KA 1OAXH 1WT5C 4TOYL 5D4JA 5HI5D 4KKLD 3GC3A 3IJSB 1AO7D 1ADQL 5ICYA 5I5MA 1TQWA 3CXFA 5IVZB 1WS8A 2SEBB 5DT1L 3L3JB 1ZS8B 2ZXBA 4DF9A 3CFIC 3BSZL 1WD8A 2DDQH 3APMA 3QQ9C 3S35X 4YVNA 4JKPL 4NEHB 2FATL 3N91A 1KG0B 3DRQB 3V0DA 4E9RA 5FFLA 3LQAC 1XV8A 1FDLH 3N85H 5ALCH 4IMKC 4W9DC 1CXLA 5C70A 3PDGA 2K8QA 4POZD 1JZ4A 1H3WM 1MJ7L 1J8RA 5JPNA 4HQQH 4E41D 5GGTA 2VLRA 5I18H 1IC0A 2JJSC 2DJ4A 2OMXB 1YN6A 2EO9A 5DWUH 4DGIH 2OMYA 1TIUA 1MWAB 4HD9A 4BGDA 2QGBA 5CHNB 1JK8B 1E6JH 3L2MA 4YHOL 1H15B 2GJJA 1GJUA 2KKQA 5A2LH 4YHNA 4NC0B 5KBPA 2EKJA 4GT0A 1PZBA 3CFEB 2R9HC 4YXHH 3ELQA 3DUSA 4XNAA 1SJEA 4JPSA 3M46A 1GZHA 3GNMH 2DBLL 1LMKA 2JTDA 1R0AH 3S34L 4M5YH 3QXAA 2IH9A 2E9GA 1IC5L 1W72L 2GUOA 3CDCA 1GY2A 5JOPD 3MLUL 5B3JF 3QUKB 3WU1A 2GB2A 1NL0L 3LHPH 4H8UA 4LPTA 4ONGH 1FIGH 4G43B 3HI1B 4HWEH 5EEVA 3BZFA 4EOWL 2QQKL 4N8UA 1YNTF 4CDGC 4IBUA 4YAQA 3FT2A 5FGSA 3VFGL 1VJSA 1F6AA 1TJHL 1INQA 2VJ8A 3AT0A 4F2ME 3ARSA 2IDUA 3QQ4B 1UQSB 5EF3A 4PMEA 1KGWA 3K2KA 3LS5H 1O7DE 4HWZB 2QQKH 3C6LC 3G7TA 4LLYB 3F3HA 4OLXH 5EU7C 4BK5A 3EDDA 1I7RB 3GIZL 1LO4H 4FG2A 3NQIA 2BP8A 1KOAA 1LLAA 3SKNB 5CJBA 1AI1H 2SEBA 1ZS8A 4EQ3A 1HKFA 2F08A 3CLWA 4GKZA 4RX4D 1F4YL 4QTHB 5HI3C 3D0LA 3EJSA 2HRPH 5IESL 4UQBA 5TQ2L 3MLVL 2AV1A 2WN2A 3EOBA 1FWXA 4MDRA 3W9DB 5EUOA 1MHPH 5CFAA 3ZO0A 4TQ8A 2EIEA 3CDZA 4IOSA 4P2OB 1GGYA 1A6ZB 1S7RA 1SUJA 2RALA 2J72A 3PLYA 4N85A 4EKXA 2QR0A 2MTAA 3JTSB 5D6CA 1XB8A 4PRPA 1HOCA 2C9XA 5L6YH 1PQZA 1L3WA 3HNVH 5TF0A 1XD0A 5ECJE 2EIZA 4GAYB 3QRGL 1SJEB 3DX1A 2X2IA 3D1MC 4MQ7B 5ABAA 3R7QA 2YEVB 4JMXA 4IRJD 4N5UA 1KXHA 2IH8A 1XT5A 4FG6C 3MFFB 2PCFA 3HB3C 3UEQA 4AQEB 3S88H 1Q1PA 3MNMA 4GG8B 1OPGH 4WF7A 4FQCH 2F58H 1QZ1A 1G9MC 5I8CB 5ESAA 3APCA 2ZOLA 2VZSA 4JFDE 4UMGA 3HVDA 4H44C 3BQUD 4TQIA 1XWVA 4G42A 3ZE2E 2XZCH 3OKKB 1S78C 3BT2H 2APXA 3ZKXB 3ZDXF 5DJCB 1TT6A 5CMAA 4XVJL 2FCBA 5I76A 3D5OF 4HWZA 1KXTB 5ISZD 1DN0A 5DC2A 5SWSE 3UAJC 3DPBB 3J8F7 3FZUD 4YFEA 1BVOA 2OK0H 5AOMA 3S4SB 3QIWD 2AI0L 4ISVB 4I4WB 1B0IA 3F2LA 2FLRT 4OFKA 4IRZH 1USZA 3ZMEA 3UTSA 3TN0A 4IS6A 4JQXC 2IQ9L 1AIFA 3MV7A 4XP5H 3GSRB 1JRHL 1HE7A 2FT6A 3DI3B 1I31A 2OMVA 3ARBA 2GBVA 3PL6A 3MYZA 3QPXL 4Y0GA 3BH8B 4PUBH 4GI6A 2VAAB 3G5YA 3K6DA 4AK1A 1WGOA 1U58B 2CHNA 2IH1B 3WIHH 1PJWA 2CO6B 4YE4H 4J6IA 4LCYB 4P23A 2OJEB 2ZONA 3MACH 4QYOB 4XMZA 3EJQA 1TZIA 4TSCL 3HNSL 3BD3A 1OPGL 5K39B 2YAQA 1G7PA 1QO3B 4Q4EA 3D08A 4R2GD 4RQQA 4YFDB 1E6OH 5JTWA 3CDGB 3DX7B 1U3HC 3P77A 3SDCA 2XXMB 4KQ3L 1DVYA 3MACL 2Q86B 5J7CC 2ZP8A 1HH9A 4U6TA 1QVOA 1D6VH 3OLIA 3P0GB 4BELD 3PGDA 3IS0X 3IFPB 2ENYA 4G8GB 1EH9A 2O5XL 1L0PA 3ESUF 1QWHA 4IIZA 2JCCF 2F7OA 1CDGA 5D72H 3RWDB 3UX9B 2IGLA 2JKXA 5CD5C 3Q1SL 1T4KA 4HCFA 4O2CA 5KSAB 1ZT4B 4U6XA 5LAXB 2XCMC 3D69B 2ZG1A 1BAFL 4W6YB 1EHNA 2VDPB 5FR3A 3NK3A 4WAFA 5BV7H 2DQCL 2A9ML 4A2HA 5G5DB 4HOXA 5EEUA 1OAUL 4WY7L 3P73A 1NLBL 4JM0A 1A1MA 2OZ4H 4JM2C 5K1JA 5FUZL 1MFNA 4F3FA 3BPNB 1PZCA 2VR4A 2WXMA 4LGRB 3WSQL 4RZCA 5LXVA 1F3RB 2FR4B 1OCZB 1CICD 2EE0A 5DRZB 5I16B 2G3XA 1DL7L 2WXRA 1RZ7L 5HGBA 4LKXB 2BK8A 4O02L 1P7BA 2CIKA 5KVFH 2UWEE 1EDQA 2Q7AA 1OP3K 3UPCA 3RVTC 3NIGF 2NSXA 2AVGA 4XCCL 1LNUA 5EBLB 1XL4A 3B2UC 4HKJA 1OVZA 5F3FA 3GI9L 5JIIA 1UA3A 2FBRA 3BKYH 3RNQB 2B2XL 5TH2B 3WY2A 4WW2B 4XAWL 4ADGA 4HK0A 2BIQA 5BRZA 4BCYA 5CBEA 1IM9D 3LKRB 5HVHC 5F7MC 1M42A 4Z3TA 3K81A 4HBCH 1H8OA 3MLRH 2CO1A 3SYCA 5C0IA 5KSBA 2XX1A 4MA8L 2OR7A 4CBPA 1W9XA 2NZ1A 3FSVA 2K8MA 5GRVL 3GO1H 5ENWB 1M57B 4U1JA 1RJLA 2D4FA 5GRWA 1JSYA 3DTUB 2HT3D 3QWRA 3E8UH 4JRYB 5ILTH 1C08A 1G0XA 3Q3GB 4Z9KB 1N6VA 3EYSL 3KYOA 2VDQL 4KTGA 3WY3A 3VD0A 1LE5A 2ODHA 1TEGA 3QWOB 2G9HB 3HFFA 1KPVB 1EDYA 1BJMA 4X5LA 4GKSA 3JV4A 1MIML 4MB4A 1F97A 3NZSA 2HXAA 4CGUB 3QG6B 3QA3A 5F9WB 4YHNB 3T6WA 2W07A 4JM2F 2B4CL 3EFOA 1DBJH 3EOAA 5TGBA 2EAEA 4TNGA 5AG8A 2CM6A 3JYBA 3STZB 5KZCD 2AJZA 3TA4D 4DPAX 2NY6C 5E70A 2Q20A 3NJGA 3DUUB 2BY0A 4F93B 1NC2B 3B3BA 3TA3C 1WA2X 2LV4A 1KDIA 1EHLL 4DQOH 1IAIM 3D69A 4WHTA 4B27A 5E6ZA 2X41A 5JXAL 2K3HA 4IBYA 2G4GA 4D8OA 2JLLA 2ADGB 2WTRA 3ULUC 2PCYA 1MUJA 1YJDL 1WV7T 4JNXA 1DJWA 1FNFA 4JFZH 3TBVA 2BNRA 5HHME 5FYJL 5A43C 4PIBA 3QUYC 4JPIA 3GRGA 3C60D 2FUQA 2R29A 4NKOA 3RVTD 1ODUA 2IVFC 4YZFF 3TZVD 3V0GA 5E2VL 2FR4A 2W95A 3H85A 4LCWB 2R7EB 1KPRB 5HDQL 5CJOL 5FUZH 4JR9H 5KG9A 1XTLA 4JFQB 4O2FB 2VLRE 4RRPG 1XEDA 2WO4A 2RTTA 4YXLH 2A83A 1ROCA 4UAHA 3GLZA 3SDYH 2GSIB 3K80A 2YUWA 1VGEH 3PGCB 2AHIA 5EZLB 5HDLA 1RIHH 3EYUH 1MFBL 2WZ0A 1SMOA 1FBIH 5HJ3B 3GDBA 4A38A 2IPKA 4K23H 3CQQA 3O0RH 4JFFB 4NJAH 1CGYA 3MBEA 3L7EB 3HUJE 1MCSA 4F7TA 1AQKL 2X2YA 3FTYA 5B1JA 5F1KC 5J56B 3DTDA 2KQNA 4OIIL 3WBDA 2APBA 2GAZA 1B90A 1TQCC 2DQHH 3EHBC 4PJXE 2MPAH 2Y7NA 4LQFL 4ONFH 3OXSA 4N0UE 3SPVB 3AB0B 3VW3H 3DV6A 4Z7WA 1IE4A 2DYPD 4WDIB 2G4EA 4WIQA 4C59B 2J1KA 5ESQB 1FUNA 3LX9A 1ETZA 3QWOA 3WFDL 2BXYA 2Q7YB 2LR4A 5EZJA 4JO1H 4UOZA 1HZHH 1I1AA 3U0TB 3IJYB 1ZANH 2BIPA 3H0TB 3U79A 1YEDA 1R5VA 5CP7B 1IC7L 2N0MA 3HC0B 4OM1L 4ANUA 1U91A 5IM7B 2W07B 3HPLA 3OZ9H 4PLJC 4OD3L 2IAMD 4KZ0A 1K6QL 5E08H 4L23A 3D30A 3KNBA 2HVKB 1VADA 4HJGA 4MD4B 4Z3EA 5JXEC 1QFWL 4UM9D 5F3BA 3LMJH 1UT1A 2ICWI 4JFOA 4Y5XA 4XPBH 4Y19B 3LKNB 1JZGA 2XFGB 1G1YA 2NX5E 1HL8A 3Q2VA 1SF5A 1U30A 5FKAA 3TBTB 1RUML 3DC0A 4KI5E 2BIIA 2P8LA 2V17L 1JRHH 3OKMA 4PJBE 3VFNB 1A8JH 2DD8H 1ND0B 4F9LA 3ARYA 3QG7L 1NBYB 2Q1EA 3D39D 3EBIA 3ZTNH 1QLEL 5IHUH 1IUZA 1HL5A 4Z1PA 3HZVB 4PJCE 5KVEH 1PZUB 1CTMA 1SLXA 3M6DA 2H9GB 3KW8A 2MCG1 3WLBB 3C5SA 2X6AA 1UKQA 4HKXA 4QOKD 2NYYD 3N40P 5CIPH 2Z9TA 3UZVA 1DN0B 5AVXB 3CC5B 4UIKL 1OSYA 3EYFB 1T1WB 1BX2A 2XKNA 2CXGA 4UU9A 4Y2OA 5FO9B 5EORL 2ED6A 2G30A 3KGSA 1FVDA 2IAAC 5D9SA 3L9BA 3PWPD 4F8QA 5BV7C 3MX0B 1DDHA 3QDME 1LP9B 3IDIB 5GSRA 1QPXA 3NZUA 1A7PH 3EJCA 3WN6A 5F93C 3RY5A 2GJPA 1BFVL 1SBSH 1IRAY 1UD5A 3QO1B 2CR6A 2IMMA 2XQBL 4JHVA 2H6PB 1OF2B 4KTDL 1HQ4B 2IAMC 5AVZB 3V4VL 2ZOOA 3EZJB 4YC2C 2K9UA 3RU8H 4BWUA 3SPVA 1NC4B 5A40E 4OF6A 2QFRA 5F7FA 4LHJB 4HG4J 3MV8E 2JKJA 1AANA 2VKXA 2OR9H 2EYSB 1RZQA 4AKQA 3KM2A 1MCHA 1CGSL 1W0VA 3VD1A 2VKWA 3DX8B 1PNCA 1UWXK 1IGMH 3PJSB 4AY0A 1BZ7B 3TCLB 1K5NA 2CDFB 4KY2A 1FL6A 1GAFL 3HIZA 2Q86A 4KK5C 3VWJB 1BSIA 3JWNE 2DTSA 3C5XA 5DK0A 3BVVA 3V6ZA 3CZLA 2IBBA 1GYCA 4YS4A 1FLTX 1NBVH 4HS8H 2O6CA 1BLNB 4FLHA 2KT6A 3CCHA 3G6AA 4L4TA 4XMVA 3BSGA 2JB6B 3KJ6L 2DMCA 2A9DA 4R90H 5HHMB 1J5OH 1NMCC 3FB8A 1WZMA 2V7NB 4N2IA 1PKOA 3U1QA 2P5PA 2VO8A 2ZPKL 2IGFL 2JJSA 3HI6L 3IKCB 4X2UA 4Z95L 1NFDA 5DC4B 5LCVH 2XTJE 2XU9A 3MRLB 3DJZA 4YN3A 1D5BA 3NJHA 5I8KH 3Q0HA 5C9JB 1XXDC 2BPBA 4BZ1A 2HP4A 1V5JA 5CZXD 4QRTA 4R7LA 1RK0B 4N28A 3A4FA 3C60C 3FOMA 1I85C 1WISA 4H26A 3MRGA 5FHBH 4CU6A 2CUHA 2Z0BA 3H6JA 1IJ9A 2R69A 4LLMA 1KACB 2JSFA 3QUMB 1IZJA 4LSQL 3UO1H 3R1GH 4JK0D 4W9CC 5AW3B 1TG8A 4PCSA 1AXSB 5CKGA 3B9DA 5D1QD 4POYA 3D9AH 3MX0A 4NGHL 4W9ZA 3RBSA 1KIPB 3MNZB 3LKPA 5TDOA 3V0JA 2XPGB 3APFA 4KHXH 5JHLL 2JV6A 5B8CC 2IADA 4GNKB 4MNHA 1ED3B 1HXYB 3MFGB 5F7DA 2MCAA 3WN5A 2BNRE 4HS3B 5EC1B 1TTUA 4GKSB 5L7XL 4GXUN 3QSKB 5IFJB 3O6FB 4OZIF 5I0WA 4FFVC 5AKRA 5DEGA 1B2YA 1CR9H 3L5HA 1OARL 1F1AA 3IFNL 3T4YA 4BKLB 3V0AC 1VFBB 3C5ZD 4ONHA 1CFSB 4M1CC 4UV7L 1R17A 4XBPB 4MX7B 1LM8V 2C34A 2NNRA 1CZ8H 3EJZC 4GRLC 2EDBA 3QH3A 4KXBA 3OR6A 3P3TA 5HTSA 3KWTA 2PKDA 3NFSL 2K9FB 1E50A 1BA9A 2BCMA 5F89A 2G5BB 2IV8A 1EA9C 4MMZA 1FNHA 1I3VA 3EYVA 1BIIA 4NZUH 3I9IA 1AZRA 5DI8A 4DP2X 4WNQB 5KYUA 3GTTA 2OX5A 3ATEA 3CFTA 5EPMB 4L8BA 2WKOA 2BHYA 3F6JA 1KNOB 2NZ9D 1UJ3B 1SJMA 3ZZQA 1P2CA 4KO9A 2ATKB 2KUTA 4C56D 4FNQA 4MXVF 3JZ7A 3N42F 4LP5A 3NFPB 4R0LB 1DVTA 1QFWH 4S0TD 5BVPH 4FJYA 4QJ3B 4EE2A 3U0WH 4TOYH 1FE8L 1X5AA 3F05A 3GHEH 4PVMA 1LO0H 5EZLA 1RJZB 4C4BA 5IVXB 5DS1A 3U6XS 4OJFL 5DD0H 5DO2D 2WIMA 1J5DA 3BZEA 5B39G 3AREA 3H8NA 5E8EB 1IC5H 2C9PA 2WNGA 4OAWA 1WAPA 2XIIA 1UG9A 3DK0A 3O2DL 2RFXB 2CQVA 2F7RA 3BP6B 4HHGA 2ZG3A 4JPQA 5DD6B 5FFGA 1PF3A 2I69A 1P4BL 3FO0H 4CMHB 3OKDA 4YXHL 3GJEA 2YD6A 4P2QE 2WCGA 3T0EB 1VGKA 4FN0A 1DDTA 1UZGA 5D2NB 4XNUH 4YO0B 3UTTB 1MIEL 4IMLA 5D1QA 4FP8H 5F7AA 3KPRB 1MCDA 1ETA1 3H1ZA 1TZOA 2CH8A 1W15A 2CK0L 4LHUD 3RX9A 1AS7A 1JK8A 3NPSC 2WBJC 4A63A 3ML9A 5DMIL 3IVKA 2DM2A 1FBIL 3ZTJH 1X6LA 2X0VA 1YEIL 1BPLB 4AV5A 4HJEA 4Z0BH 2BIOA 5IT2L 3FKUS 3L2NA 3GEWB 3OXSB 3MRRA 4MFHA 1P4IL 4HIHA 4JGNA 3LZPA 4Z7VA 1ZVYA 1T66D 2RQEA 3THMH 2FX7L 1BP3B 3QHFL 4Z7UB 3CN0A 3QNFA 4L8SC 1BZ9A 4HV8A 3AWEA 4QF1A 3VNZA 2XVBA 4Y5YB 2A2QT 4YXKH 2A4CA 4WTZA 3ZMRA 1QR4A 2BS9A 2DKMA 2P3YA 5TDNA 3DBXB 2Z7ZA 2WKOF 3PP4H 4EUPB 5DVNA 4M48L 1H6TA 4HUNB 2Y5TB 4KH9A 4IBZA 2W59A 2BVQB 2GC7C 3I85A 4OFDA 1BF2A 1FORH 4JRXA 4RFOH 5DK3A 3L3OC 1JVKA 3JTBA 3FB7A 4XE5B 3RVXC 4AKPA 4WUUA 5C0CE 1FO0H 3U0PB 4YHIB 2ZD0A 2MIZA 3MNWB 4G6ML 4UU9B 2KZKA 5F7KC 2NXYB 1UOKA 4P3CH 1P9MC 4XNMB 4OUOA 2YGPA 4Z18A 3VFOA 1MFDL 4MCZA 4I18B 5E0QA 1PYWB 3GMNB 3MHZA 3BJLA 4MJJA 3PV7A 1QFUL 3L9YA 5EEXA 1EBPA 3C09B 1J8HE 2A6JB 5BOJA 5EU6B 3IS1X 5KVGL 1HK6A 2X05A 1U8PA 4FQIH 2PYED 3E1F1 1SN0A 4AIZA 1I7TB 3BZFB 5HDRA 3N41F 1LXMA 3LN5B 4HT1H 5JPMA 1GYVA 3AG1B 4NBZB 2WXQA 5I1CL 2A74B 3CPLA 1B0WA 4K7PX 4UANA 4CBZA 3OB0K 1Q9WA 3PWPA 4FFYA 3VWJD 2UY7B 1QSVA 3COOA 5KBLA 1U4FA 4WO4D 1WC7B 3VXMA 4LEEA 2HTLC 3DOHA 3DX8A 5D7JB 5I9QB 2NY7L 1T1YA 3B6SB 3ES6A 1EJOL 4Y4HC 4GSDL 4PGEB 3FTGB 4XCCH 4Y2NA 4YLQT 5T33H 5E1AA 3MRFA 5IHBA 2VDKL 2X6MA 3TP4A 3QRFM 5C0NC 2W91A 4KX8A 3S3DB 3QFGA 3WJMB 1VA9A 1X44A 4APQA 1A4CA 4U1GC 5TFSL 4QHNA 5GGQH 3RWEA 1M7DA 3BE1H 2ITEA 3OC8A 3H9SA 5D2LB 5FO2A 3RWCB 1EZLA 4RIRA 3OAYH 2OSWA 4PY8I 4NM4H 3V5KA 2YC1B 3L6FA 4M93B 3D0VA 4L2LA 4DEPC 4NO0B 4PLJD 5I2IB 5DZOA 4G1EA 3QK0A 4NT6A 4OJDH 2ORBL 2ZOLB 3PQYE 4ZMOA 1RZKL 3FQ2A 3H7BA 4Y4KD 3SDDD 2VXVL 5LGYA 1RZJL 3T2NH 4G8EB 5DQDH 2YGOA 5FAAA 4PJ5E 2WUBH 4UV4H 1BAFH 5IIEA 5FWQA 1KGUA 1PY0A 35C8L 3S3BB 1CXIA 4WWNA 2R59A 4PRAA 3BFWA 4OZGB 4Y89A 3BYTA 4RQQB 1YPZF 4X4KA 4JUTA 2JB5H 5DMJB 3WFEL 5KZCB 3BD5A 2GBAA 3QI9B 2Y2TA 3P4OB 4D9RD 1HXMB 2P8PB 3O6MH 1DSYA 2W65B 4A6YL 1ORSB 3BLPX 3S0PA 5C0RL 3MV7B 3QZOA 4FD0A 2ADJA 7PAZA 4K71B 5DYOA 1E5UI 2MOVA 4NB7A 3N5AA 1XCTB 4MNQE 2XETA 1K2DA 3G9VA 4J1UB 4NWUL 2QPEB 4D7BA 4WWPA 4D94A 1NCIA 2LLGA 1F4AA 1HEZB 1QTSA 4R83A 5CAYB 3TJHC 4HS3A 1CDHA 1TO5A 4HZLA 4QRRE 1FG2B 1NCCL 1FFNA 3QORA 2VLKD 5K9KB 1SVBA 5IB5B 3QAZB 3VFRA 5CBAB 5JNYA 1XAUA 4GG6B 1PG7L 4OF7A 1MJJB 2GITA 1XF3B 5CJQH 3SKMB 3HI5H 3S3SA 3ZO9A 2HKFH 2GCYB 1IKNA 3BKML 3QISA 1L4IA 1U8OB 2A1WL 1TR7A 5ETUA 1SDDB 4H2CA 3CN4A 3DGCR 5DO8A 2NX5A 1U8MA 3QUGA 2BZDA 2V5MA 2PXYA 1Q9LB 5AOLA 1EEZB 1TXKA 3RL1A 3IBEA 5MEOB 5CF3A 1VPOH 3MRFB 4G5ZL 4ACPA 2WXOA 4WI8A 3O11A 3RIFF 4F8PA 3FTWA 5EU7E 3PGDB 4G8GA 1BQLH 4ZZKA 5B3SB 1TVBA 3L4ZA 3J07A 3LSOA 2VMJA 5E4EB 1KELH 3QYCA 4CC1A 3MZTA 3BVWA 1W0WA 2BRRL 3F5WA 3DGGA 4QXVA 2E9WA 2OL3H 3W2DH 3DJSA 3RZCA 4GH7B 4JPKL 1XQ4A 3OX8B 3PWVB 1DBMH 3IPEA 1X4YA 4G1EB 1SFDA 5I1LA 2Z4QA 2IXQA 4ZUWA 3OHXB 5B1JC 5B1BB 1GGUA 4Q89A 3SGDH 5L4JA 5C0AE 3VXNB 3VI4F 2H8PA 4HIXL 4I3RH 2VDKB 4X6CA 3ULVH <