3WKNA

Crystal structure of the artificial protein affinger p17 (af.p17) complexed with fc fragment of human igg
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Adaptive Assembly: Maximizing the Potential of a Given Functional Peptide with a Tailor-Made Protein Scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 39
structure length 209
sequence length 209
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wknA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wknA01
4D0DA 1CXIA 4K7PH 3HUJE 4QWWC 4JHWL 3STLB 4GG6F 4FZ8H 1FYTE 1ZA3B 3ARQA 4GW1B 1LO0H 3BKJL 2OJZL 1MCBA 3WFDL 2HT3D 1QHOA 4C58B 2RFXA 3DNKA 4K23L 2EYSA 2L7UA 4RGOL 1FVCB 3CXDL 3ARFC 1MQKL 4IOSD 4OLEA 3P4OA 3F6IA 4JFZL 2Q8AH 4OCYL 1MHHA 2F53B 4LEXH 2GITA 3MRLB 4PR5B 4PJDB 5CHNB 1NEZG 1JGUL 4LK4A 2FSEB 1MFBL 3MLZL 1KCRL 1V3MA 2OI9B 2GT9B 3DURB 4LSDA 2VN7A 3C6LC 4YJZL 1N26A 4YHML 1RZKH 1CF8L 5E5UB 1WZMA 2AV7A 4WFGE 5MENB 3SDCD 1L9MA 4QXWA 2QLVB 5IHUL 4JFFD 1ZE3C 1F58L 4WI8A 4Q7DA 3Q5TA 4HJJL 4PY7B 1YMMD 2OK0L 1GL4B 3AAZA 3GJFK 3DECA 4JFOB 2NY2D 2F5AL 3QUYD 4TULL 5CKGA 3DSNA 3HRZB 4U6YA 5GGUA 5F3BB 3EYVA 2GAZA 3MRKB 1ZHNB 1EH9A 4L9LB 2YD4A 5H2BB 5DURD 2HYMA 4JQVC 4UNTA 5IKCA 1JNHA 5DRNB 1IE5A 5J57B 2WV3A 2EKJA 5D93B 1NMCC 5TQ2H 2C3WA 4NYLA 3KYNA 4KUZL 2VZVA 4QRPD 2QQKH 3KHOA 2DMCA 1JTOA 1YEDB 3QXAA 3GMOA 5EN2A 4YEEA 1TJIH 1NMAH 4M61B 1QVOB 5GRXG 1UWGH 2IAMD 3BGMB 3PWPE 1WBZB 4ZS6C 1I4FA 2KDGA 5DI8A 4FQCH 4JPKL 2CIKB 4NQDA 3ME0A 2VDOH 3LQZA 4C55A 3RI5F 5C0CB 4K71B 5IHZA 2R23A 2RAMA 4D9QE 2A1WL 1YQVH 3WDIA 3ZO0A 1WBYA 4YDVA 3PWVA 3EDJA 3HI6L 5JOPD 1RK1B 2X4RB 3QG7L 5H37G 1X5JA 3X12A 4P4KB 2A9MH 2FSEA 5C3TA 1CXEA 5IB3A 4G7VL 4N5UA 5CJ8A 1RUML 3C60B 1MIML 3QNYA 4YC2C 4NQED 5TPWH 5JXAL 1MCNA 3IAPA 2V2WB 1Q0YH 2MCPH 4E42A 3P4NB 4YWGL 1LK3H 1E4KA 5IVXA 4Z7VE 4LHJB 4FZ8L 4ALAL 1I1FB 1H15B 4HUXA 4NM4L 1NCUA 3U36B 3MO1B 1AHWA 2C9AA 4OLVL 4J1UB 3EOTH 1YPZA 1KJVB 3P3YA 4U05A 4F33A 1UVQA 3EYFA 1Z3GL 2XWBB 4NQCB 2X05A 1GGCL 1KCUH 3SJVD 5FHBL 4HC1A 3HZMA 3MRFB 4WO4A 3MBED 3BIBX 1E27B 3IU3B 3E3QC 4MZ3A 1P4LA 5HVHB 5I0DA 2WW8A 4APQC 3BWUC 1J18A 1NCWL 1WTLA 4DN3L 3NFPA 1PY9A 5HPMA 3DUUB 4KDTC 1ZT1B 2BOBA 4HJ0D 4QHMA 2H2SC 2ICWB 2PR4L 4G8FA 1KFAH 3HPJB 3V52H 1TMCB 5D7IE 4FXGA 4H0GA 5CINL 3HLAB 3VDCA 1G7JA 1I1CA 3DV6A 3S37H 5DC0A 2VLKB 4MA8L 4TSCL 4Y2DD 1NCWH 4HMDA 4MD0B 4PYGA 5E7FA 4DN3H 3WKNA 1UG9A 3OXSA 1VKXB 3QWOB 3BIKB 5GZOD 4EEEA 3C5JB 4MD4A 5FO7B 4LHQB 1AGEA 1I9JL 4ONFL 1RU9H 3C2AH 2H3NA 4QHLB 4F7MB 1MLCA 4OFYA 3OB0K 1I8IA 3O9WC 1FZJB 5J4MA 4AL8H 3O4LD 5EU3B 3MSPA 5IVNA 2BHUA 4QRRD 3L5JA 5B39G 2IQAB 5A16B 1BFSA 1YN6B 2W1NA 2WIIA 1NC4D 5C09E 3ZE1E 1I7TA 4KTYA 1MLBB 1C5BL 1P1ZB 1A7PL 2XFXA 1WT5C 2I5YH 3K2UL 1FZOA 1YEFL 2X1OA 5GGRB 4ZNEA 4Z7QE 3LKNA 4MNQE 3MPCA 4YXHL 4P46C 3V6ZA 2APBA 1ZT7B 1UACH 3CX2A 3RIAF 3BEWB 4N8PA 1A4JB 5I17A 3MNWB 3D6GA 4KKNA 2A2QT 1NBQA 4OCSL 5BJTA 4M02A 3VXRD 4QWWD 3PP4L 3QDMB 4FFWD 4FMKA 4RBPH 4LMQE 3S88L 4P2OD 3BUTA 3QULA 4JM4L 5J9PA 1CQYA 5E9DA 4KJPC 1AXTH 2FRGP 4CUCA 5B8CB 1U58A 1A6UH 4PLOB 5IMMB 1MCPH 8CGTA 1UT9A 1L9NA 1Z9SA 5DJDB 2ICCA 5HI4D 5C07A 4OZGE 1A6WL 1C5CH 4ACPA 3MLRL 3VWKA 1A7QL 4YDLB 4LLAA 4Z7UB 4GUPA 2WWKT 4M6AA 3OKYA 1KXTB 3QEUA 4HGWB 4M1DL 4P3CL 3L3GB 4NJ9L 1TJHH 1T0NA 4UBDD 1MRFH 3IXAB 4MA1B 3E2HC 3WE6B 3DLQR 2A9NH 4HFUH 4QF1B 4EI5B 1KEGH 1B2WL 3FOMA 3MLYL 4ELMB 4DQOL 2W9EL 3I3BA 2EYRB 5DEGA 2HG5B 4ELMF 5E9DB 4XI5C 3WUWB 1EUUA 4CMMA 3TPUB 4MJID 2LTQC 4U6HB 3WSQH 4LKXA 1U2HA 1YYMH 3DO7A 4HHAB 4JQIH 2OK0H 5K9JH 1ZXQA 1G9NH 4R0LB 5DRXB 5D1ZB 3PL6D 5T5FH 5FUZL 4YDIL 4WU5A 1VB9A 4WHCA 4PJ9B 4LVHB 1MCIA 3WXWL 2XACC 1BOGA 1FZMA 5C07D 3O3UN 2YEZA 3CFEB 1SBSH 3SKJL 2DD8H 4MNHA 2GAZB 3MRKA 2GK0A 4JM2D 1U8NB 2YD1A 3KYOB 4KJWC 2XPGB 5E2TL 2X1WL 4P3CH 1BJ1J 5I1DB 2PTTB 2JB6B 4WIQA 2YPKA 2YZ1A 4OFDA 2XY2A 4XNMB 1TJHL 1PZ5A 1T66D 1KCVH 3D0VA 4DOHB 1QHPA 1RUAH 1SJHA 4GO6B 4JRYD 1Y18A 3FB5A 2DTSA 2HTKC 4DTGH 3ULUF 3DVGA 3MRNA 1MQKH 3WLBA 3BKML 3O8XB 4EI6B 3P0VH 3V95A 4L29A 1ORQA 1N64H 5TF0A 4Y5XC 4CVWA 4F15B 1FHGA 2O93L 4LVOC 3OXRB 3KJ6H 4JREB 1S7SB 4YEFA 4X4MA 4NRYB 4QGTA 4P23B 3RHWF 1T1XB 4F7TA 5HDBF 2OTUA 3U7YL 1S7WA 1X5XA 3IJSB 2NW3B 3K2UH 4DN4L 3GIZL 3CVIL 3IFOB 1KYOK 1GGBL 4QRTA 1KJ2B 1F3RB 1NCTA 2E5EA 2DM7A 1EO5A 3V4VH 1A1MA 2F74B 4LHUG 2ED8A 4PV8A 2JTDA 3VD3A 3ULVL 4OD3H 4PG9A 5LCVL 2AEPL 3C08H 2VLJD 4GW5A 5F7KC 5INCB 1JRHI 3RIFF 2E6JA 1IJ9A 3I9GL 1QSFA 5K33A 1H8SA 1DBML 1LE9B 3FJTA 1ZLWH 1WICA 2ZPKL 3DUSA 2WQ8A 5F1OB 3D0LB 1U3HD 4Z5RB 3OHXA 3PWUA 3S96A 1L6ZA 3O9WB 2E7CA 1KB9J 1S7UA 5EFIA 5GJTL 3QYCA 3JV6A 2FIKB 5INDB 2GI7A 3G5VB 4M8VA 4PRBB 3D85B 5E08L 2ZCLL 3VMPA 4QY8A 1OGAA 1W72A 1BF8A 1I9IL 1UA6L 1MJ7L 1VADB 3Q5YA 4I0PB 3SBWC 1VPOL 4KK6D 3I6GB 5CZVL 4NO0D 1YDPA 3VFRA 3QEQE 3O8XA 3HZKB 3B3IA 2AGJH 3UDWA 1MCWW 3T0XA 1FG2A 3PABB 4W70A 4CVXB 1GJIA 4UB0L 1S7VA 5F89B 5I76B 4YHZL 1IC7H 4S11A 5ALCH 4LDEB 1T21B 5F6IB 4NRZB 1Z3GH 1MRDL 1F3JA 3IGAB 2WUBH 5HHMD 5JNYA 2X4QA 1CGYA 3C60C 1T7ZA 2H8PB 1UM4H 2RFXB 1KNOA 4F58L 5FCSH 1DEEB 4LRNH 2W0LA 4KDWA 3W0WE 1LK2A 3BYYA 2V7HA 2HRPL 5CILH 4O4YH 5FKAA 1AQKH 5KSBE 1JJUA 3U82B 3QFJD 3SGKA 1DUYA 4PJ7A 3SDCB 2Z4QA 4HUUA 4GBXC 2BFVH 3HI6H 4KGLA 1X5IA 1YMMA 4HH9A 4WDIA 4P2OC 1G0DA 3MRBA 2NY2B 5BS0D 4XMLH 5I15H 3V6BR 5HGDB 3BQUB 1ZGLB 4AEFA 3G6AB 3N50A 3U6RB 5E8PA 5A2FA 5I1HL 4LLWB 4MJ4A 3VXTA 2GT9A 3LKQB 1F02I 3QO1A 4NO0A 4PJAE 2DIJA 3WMSA 2IALB 4YBQD 3S5LB 3VA2C 2BERA 1VFUA 3WFBL 3NN8B 4TPRH 4G80A 4OFPA 5TQ2L 4D0CB 2VERN 3LH2L 2NY0B 1MEXH 3GMRA 4BH8B 1R3IH 4Q6IA 2A9NL 3B9EA 4HW6A 4AM0A 4S1RH 3BXNB 3EYVB 4MA3A 3PG2A 1J0YA 3HPLB 4OI9A 5D1XC 4ODHH 4GAFB 3J8F7 3MOBL 5ID0A 4O2CB 1VFAA 3TNMA 1CXHA 3BD4A 1FNFA 5F9AC 2I9LB 1KTRL 2IQAA 2LAGB 5CZXD 4AIZA 5I1CL 4JY6B 5IMOA 5I15L 5C7XL 2NY3C 1R0AL 2DIBA 5EPMA 5E5RB 4KKBC 3RNKB 3ARGD 4JRXD 5IBUB 4YXKL 3RZCD 1I8IB 5SWSD 1PLGL 4PREB 4KJWD 3VMNA 2Y06L 4Y0GA 5C0BD 1BVLB 3BD3A 3UJJL 5JUEH 4XPBL 4Y16A 3MCLL 4MJ6A 1JUFA 2IJ0C 4PLJC 3C6LB 4OCYH 5FUCC 3BWAA 4B53A 2FH8A 5I73B 4ESKA 4R2GC 1PQZB 4IS6A 1ULVA 4JE4B 5I30H 4OZFA 4U1NA 1NAMB 4G6KL 1OP3K 3GIVB 3L3KA 4HS8H 1FH5L 5DUPH 2UZIH 1EIBA 4KKCD 3RX5A 3MUGA 2EH8H 3BKCL 5IJKA 4LLDB 4K7PL 4PJ5A 3MV9A 5K59E 3H8NA 2GEEA 2HKHH 2FX8L 7FABL 4ONFH 5FYJL 1DBAH 1T21A 1BZ9A 4JQXC 1MH5A 1CDGA 2YMXH 3BVNA 4LCWA 3KLAA 4XCFL 4X6FA 3CSYB 3QUMA 4GG8A 5GSRB 3ARYA 5FGBC 1XGRB 4I18C 4I0PC 2V5SA 1Z5LB 3KPPB 1J5OL 1G9MH 4F37F 2VAJA 2JB5H 5CLWA 5D2NB 1ZS8B 5EUOE 4CU6A 1GOFA 3ILQD 4IIQB 3MRBB 5D2LF 1S8DA 4PRDA 3GJFH 2D9QB 4HD9A 4U1HA 4I18A 1NCDL 1NGPL 1B4JL 2HMIC 1K6QH 4WV1C 5F88B 1KTKE 5IB5B 3VFTB 2YD9A 4FS0A 1A9EB 4HK0B 1CGWA 3FKUS 5IIEA 1ED3B 1OWRM 3QRGH 3LB6D 5H35A 4GW4A 3S5LG 3MZGB 3WFHA 4GOSA 3PWUB 3OHXB 3B2UC 2DLGA 2VLKE 4Q58C 2YKLH 4OZIF 3MBXH 3NACL 3OZ9H 4WUKH 5DUBB 2KL6A 1XF2A 2AKRB 2OR7A 3RWJA 1BFVH 3GSVA 3SKOA 3LQMA 4MQSB 4X7EC 3HZVB 3TT3H 1FL3B 4DGVH 4F3FA 1TVHB 3CU1A 2VDML 5CGYD 2BXZA 3T0AA 5FYKL 5IEKB 3HB3C 4GSDL 3WD5L 2MPAH 4X4XA 1JWMB 1B90A 5L88L 4Z7VB 2J6EA 1UEMA 3FFCE 1EV2E 4Y4FA 5C9JB 1KENL 2KUTA 1S7RA 4P3DA 1RJCA 1DQLH 3IFPB 1MPAL 1HQ4A 3L3DA 3MLTB 1I9EA 5DMIL 3VDBA 4HKBB 1EVTC 4OAWA 2X4NB 4P5TC 1EO8H 4PB0L 1IM9B 3UXFA 3RWEA 3O6LH 1PZUB 3BN9C 5F3BA 3X13A 4X8JB 3T0VA 4BYHA 5D2NA 2YA0A 2CGRH 1CD1A 3KDMA 2J88H 3UROR 3DVNB 4KH2A 3SDAC 4YUEH 4Z7UA 5SWZA 4PUBH 5HYJA 1BM3H 1TPXB 4ZUSA 1Q9WB 2XXMB 3K4ZA 1IC5L 1EZVX 4G6KH 4G43A 3L3GA 3CNKA 1EZVY 1MVFA 3VCLA 3NCYP 1H3VA 5D2LA 1HN1A 3GMMA 1UB5B 2MCG1 2IG2H 5DEFA 1X5KA 4MXVE 3TJHD 5IM7B 5HPOA 3JWOC 2Z4QB 5HVWA 4HKBA 2X09A 1R3HA 3VI4F 1EEZB 4A6YH 2C3VA 5F8RC 4NCC1 1HWGB 4JQVA 3EOBA 5IBTH 5KVDL 4U1NB 4QRTB 5IROC 5DRXA 3DI2B 3VW3H 2IANB 5DD1H 3TA3D 1IEAB 2YBRB 4HIHB 3TVMC 5GJSL 1TVHA 1XGQA 5HDBE 4GXVH 4JHAL 1K85A 3E2HB 4CMMB 5CBAB 1IEBA 3LPFA 3GGWA 4UT6H 4TUKL 3FB6B 3CSBA 2EDDA 1U8JB 3GI9H 5FM5M 3UZQA 3TBVB 4H26A 2VDPL 1ZLUH 1IMHC 1WSST 4JFQB 4S1RL 4NP4L 4KRPD 1WLHA 3ULUH 4I48B 1HKLL 5DJZA 1YDPB 2F53E 5F7YC 3VFRB 4DK6A 4UT7L 1JYXA 4EN3A 4HMEA 4GAJH 2JCCF 3B3IB 5LWYH 2HVJA 3T1FB 4NPYB 4TUKH 1BF2A 5E1AA 5BVPH 1ADQL 5KS9B 1FYTD 2GK0B 2PO6B 3RWEB 4HIJB 5C0GB 5MEOB 4Q74A 2N1KA 2PTTA 4HIHA 2Y23A 3NCYS 5CSBA 5CP7A 2NPLX 5HGHA 1CL7L 3D87B 2VXSL 2P8PA 5DJXB 1A9BB 2AEQL 4LSSL 1UZ6F 4FFVD 2E7MA 5KVDH 5EU6E 4Z7VA 4RGNB 2V6HA 5EOTA 5C71A 5ABDE 4LU5L 4KFZC 5DHVH 3NFPB 3LHPL 4O9HH 2NW2B 2ZJSL 3HKFA 5ITBL 8FABB 1KT2A 3QG6A 1XAUA 2Q3AA 2N56A 1YY8B 5D1XA 4QOKD 4PJ8B 2R29L 2VZ1A 4G8GD 1GGTA 4P5MA 1OARH 1N8ZA 4G5ZL 4MXVF 4HUNB 1SEQH 7CGTA 4GW5B 1XR9B 5DRZB 4LQFH 1FNAA 5AZ2L 4AH2A 5EO1B 1T0PB 2J2ZA 4BZ2L 1EVUA 4H20H 2EC9U 4OUUA 1ZT4B 1I8LA 2R4RL 4FNLH 4F7MA 3PQYE 4ODVL 5I66B 5FKAB 4XC1L 4JPIB 4ZTOL 1Z9LA 4U1KA 1DUYB 4POYA 3X3GH 1CTNA 5DMIH 3C60A 1CLOL 3CVHH 4X5LA 3W5MA 3OMZA 1MHEA 1AO7D 2CKBB 4CGTA 1T1WA 4D8PB 4HXAH 5IW3A 3L3HB 2FJGA 4RMVA 3RX7A 3O3BB 5E8DH 1QACA 1CBVH 3L5HA 4G3YH 3QT2A 3EYSL 1MRCH 1RK1A 3WS3A 2LVCA 1D6VL 4ONGH 4QXUL 2Z9TA 5E03A 5F71A 3SGKC 2YPLB 4G9FD 1CN4A 3KWWB 3VXQB 3CU7A 1T89A 1OAQH 4G3YL 1KIQA 2AJ3A 4L4VA 4ZTPH 2QHLA 1BIIA 4KKBD 1WC7B 1BD2E 4O2CA 4PRAB 3ZE1F 4PD4J 5E08H 3D2UD 1P9MA 3V6OC 3FB7B 5FYKE 4L4VE 3O3EA 4OLVH 3S36X 5BV7H 1BQHA 1IC1A 4ZFOA 2IH3A 4NM4H 4CDHA 2XZQH 3AMLA 3AREB 2P45B 3ARDD 5DZLA 1KULA 1RZ8A 5IROA 4QKXB 1WBXA 5T3XE 5TDPA 2FYYB 3WLWC 4RISL 4M93C 5JR1L 5C0RL 2OL3H 2VZSA 2GJZA 4N8VG 4NFCA 1BVLA 3RTQB 1QQDB 1U91B 1ZV5A 2IANE 2BCKA 4YGVB 3MLUL 3JWOL 5BS0B 5FFLA 4ELMA 1ZHNA 4G5ZH 3MMEB 5D7IF 1WEJH 5DMGD 2R29H 1ZT4A 4HXBL 1OF2B 4TVPD 3BGFB 1TCRB 2UY6A 4TTDD 1BQSA 1HHIB 2OXHA 1YMMB 5E2VH 1WWCA 3NIGE 2A1WH 1T04A 4LLQA 4HWZA 4XP5L 4MHHI 4LBEB 5HVHC 2OI9C 3VFUB 1GPOH 4X0KA 3ARGA 4R7DB 3UO1H 2HKFH 1Q9KA 1JYNA 4HT1H 1VESA 2MQ0A 1GAFH 2UZIL 5J12C 5D7LB 5I19H 3MRQA 2QQKL 1RPQA 1SY6A 1EBPA 2AK1L 3N1FC 1BREA 2K9UA 4K2UL 1N5AB 5FYJE 2ZNWA 2R9HC 1A0QH 2NNAB 2X5PA 1SHMA 2FBOJ 2P8LA 3BGAA 2GCYB 4KC3B 3HMXH 2WBJA 1UKSA 2IBBA 4CN6A 4M7ZC 3QUML 4YBHA 4NHCL 1CVSC 3LB6C 4TVSa 1NFDF 3JWDC 5JDJA 3FB8A 3RP1A 2N7BA 3S7GA 3F7VB 4OT1L 3LD8C 1KB5A 3RZCB 4BQ9A 1YYLH 3AAZB 3LMJL 3GMPB 2PYEB 4WWKD 1VFOA 4QNPE 1QLEH 4JJHA 1BD2A 3MFGB 4KHTH 1CLYL 35C8H 3CFBA 3MGTA 4JY6A 3RHWK 5GJSH 1D9KC 3U83A 4NDMB 3WFHB 4UDTA 4JHAH 3H9HA 5HJ3A 2H9GA 3VW3L 1JN6A 4OT1H 4W6WB 4P59L 4ZAKC 5E9DE 5DJ0A 2OMNA 1FDLH 2Q8BL 4Y1AE 1HINH 1UZ8A 1JNJA 5BV7B 1CWVA 3KYNB 3K7UA 1XEDA 1DDHA 2AEWA 2E6PA 2FNBA 1BVKA 4LEXL 5EZJA 3H7BA 3WL9A 1P7KB 4E0RA 5IJVA 1EEUA 4KRMB 1JWMA 3BP6B 4FA8A 3ZKND 4K2UH 1HSAA 3MREB 2M8XA 4HFUL 1LE9A 3MJ8B 1HILA 1LO0L 3BKJH 2BVUA 1A6VL 3QQ3B 1WZ1H 4ZFFA 4NKQB 1QFWI 4PJFF 5FGBA 1ZLVK 4UTAL 4OCRL 2R0ZH 2V9RA 4QCIA 4L8CA 4PGEB 4HV8B 5GGVH 3VCLB 3MNVB 5F44A 4XAKE 4JFEE 3UJTH 1F90L 3ZE2F 1SM3L 3DBXA 4ORGA 4QRSA 4AEIL 5D5MF 2L4OA 4NN6C 4R3SB 4LPCA 1MAKA 5IQ7H 4N1HB 4OUOA 1RVFL 4U1GB 3IDXH 3VXSB 4BZ1H 4X7FC 1IRAY 4OSUH 5C0BA 1MFAH 2A74B 2OLDA 4N9OB 4OLXH 3GSXA 5EUOF 5F1IA 4N5EC 1I1FA 4PRDB 2CRIA 3SKNA 4XXDA 3LRSA 1U8IA 3LQAL 3VFWB 5GISH 1UJ3C 3U9PL 4WWID 1E4WL 3MA7B 2QQQA 1CQKA 2VUYA 2FO4B 4RIRB 4ZOBA 5ENWA 4EOWL 1P4BL 3CH1B 3QEQB 1WBYB 2D03H 1N0XH 1YUHB 2X4PB 1PEZA 4HJ0C 2XTJC 4PRHE 1B3JA 4BSWA 3V6ZB 3VU2A 3MLXH 3KPSD 5JXEC 3GBNL 3KR3L 1GHFL 2R1YA 2X1PA 1GGIL 1UKQA 4JDZA 1I9JH 5IEHB 3S4SG 1S7VB 4I2XE 3N85H 1LE5B 3LN5B 4X6CB 4XWGH 1CICC 4WFED 1UQSA 5LGJA 5ITFB 2O5YH 4QYOA 2R4SL 2X7LB 3ZLQC 5F3HA 1JGVH 1MRCL 2APWA 1K6QL 3FQNA 5JDSB 3MRIB 3GSNH 1RZJL 1T0MA 4LVNB 1G7MB 3P4MA 1XF4B 2DQEL 3FHQA 3RI5K 4P2QA 4E41B 3TBWB 3SO5A 5DJXA 3D39B 4M4PA 4NT6A 5GRUL 1D5IL 2ZCLH 4M7KL 2EXWC 1EHXA 3P9LA 1Q94A 5T5NF 4HC1H 4N0UE 1K8IB 1G7JB 2JB5L 3TH2T 2HJKB 4PRPB 3TWCH 3T0EA 1FV1A 5HBBA 4U31A 5HY9B 1MUJB 2CK2A 1DQJB 4JO2L 1S7RB 1F90H 1HH9B 3M17B 3MV8E 4P3DB 3MOAH 4BZ2H 2NY6C 1EX0A 1T7YA 2XXCB 2ZP0T 3D18B 4LSRH 2DWDA 3S96B 5CIPH 1MI5A 5JDSA 3IXTA 4RA3A 2VXVH 4XXCA 4BK4A 3TEUA 5ICZB 3VE0B 1U0QA 3ROOB 5IESL 1CVRA 2X4SA 4MJIB 3BISA 1QKZL 3FT3A 3FHAA 4TQEL 3MCKA 2CKBL 1I75A 1IFHH 3EYQC 5FB8A 1UVQB 1XGQB 5ITBH 3C6SA 4P9MH 1X7QA 2OTWB 2CXGA 2ZUWA 3KXFD 4LCWE 5IB4B 1NAKH 3G08A 5FKPB 1WIUA 2X4OA 3TNNA 4PP2B 4NNPH 2W60A 1MF2L 2PXYD 3T3PF 4W6XB 4PRHB 1NDMB 4I0KA 4ORZC 4MB4A 3OKEB 3L3HA 4XRCB 1NCBL 3GMMB 3BEWA 3Q6FA 3GMQA 1AJ7H 2HT4C 3HR5B 5EOCH 3NCEB 4Z0BL 1DANU 2QSQA 2AJZA 2PCPA 4XTRC 4PS4L 4Y4FD 1QRNA 4K8RL 4JRYB 4C4KO 3BX7C 2BVPA 2VAAB 3MOBH 2UUDK 3NAAL 4U7MA 4J12A 5DVOA 1TJGL 2VISB 3U0WL 3K4AA 1W72H 1ADQH 5IVZA 4X6DB 4ZPTA 3T4YA 4DGIH 1FNLA 5KSBF 1I3VA 3C5ZC 2Y25A 2A0LC 5GZNC 4Q9QL 1ZHLA 2VDPH 2J5LB 4NC0B 3IDJB 3HMWL 1W72L 3SQBA 4I13B 4KROB 3SGEH 4D3CL 2D31B 3G5ZB 2FGWL 3LH2H 5J56B 4LGSB 1DQDH 2VLKA 1M71B 1LWRA 1P5UA 4TPRL 4KMQA 1MEXL 1YEDA 3QXAB 4XCYB 3E6HB 1JWSB 2BJML 1GOGA 3PNWB 4JFXB 3GSRB 5FAAA 3R1GL 2NTFA 5I19L 1FVEB 1PYWB 4JANB 4J7RA 4JQIL 2IFGA 3FO1A 3FB7A 1AQDB 3G6JA 4HT1L 4PJAF 3T65B 4WI5A 1KJ2H 2IH3B 4YFEA 3TM6A 3WNPA 4ZUWA 1JPTH 2XZAH 4R90L 1A22B 4A6YL 5GSVA 4M7JH 2IMNA 3SDDC 5JLZA 3EJYC 4PJHF 5JTWA 1KIQB 4OGXH 1BVZA 1DBKH 3MV8B 1N4XH 4G7YL 5GS2D 2QQNH 5T33L 4PGBB 1Q0XH 1M4KA 5IR1B 2E7LA 4YPJA 3L6FA 4N0UB 5DO2D 1LGVA 3U30B 2E9WA 2CQVA 4U0RC 1FPTL 5ESAB 5IVXB 4KVCH 5HYJE 4NRXA 4LRIA 4ZFGH 1T1XA 3SDXA 1KPUA 1FBIH 2DOCA 1DBBL 3QXDB 4RMUA 1AO7B 4F58H 4M93B 3CCHA 3FQXB 3P9LB 4DW2L 3MUZ1 4LCIL 2BVPB 3WN5C 4Y1AA 5GSVB 4HF5H 4JVUA 3OF6D 5D70H 4PRPE 2C26A 3ETBF 1ORQB 3T1WA 4BFIB 2AQ3A 3TGXA 4Z77B 3SGJA 1KELH 3FCTB 1NBYA 2B4CH 3QAZC 1UWEL 2YPLD 5ECJE 1T89C 1QFWH 1KJ3L 4OIBA 1IC7L 5ALCL 1KCLA 3CJJA 3WO4B 1BBJB 5AG9A 3STLA 1OAQL 1ZA6A 4HKJB 3IDMB 2F19H 3WD5H 1LEIA 4NO5A 1LO2H 3H3BC 3UTSE 1BFTA 1EBAA 4K9EH 4N8VB 3FN0H 4ZO9A 5JOFA 4P49A 4L1HA 2EEBA 1I7UB 3ZKXB 5GGQL 4M1GH 3H0TA 2YEZB 3CFEA 4I2XB 3OGCA 2WP3O 1A3QA 1IKFL 3KYMB 2IWGA 5EUOB 5BZDB 4GRWE 5DD6B 5E95B 2Q20A 3UYRL 3NFSH 5EZJB 2DN7A 2NY6B 5AAMA 4JFPA 4Y89A 2DYPA 1DTUA 4GBXA 5FECB 3WO4C 4MJ5B 5GS0D 3PGCB 2DLFL 2EDWA 4KI5C 3NFSL 4MCZB 4L9LC 1KLUA 3VG0L 3SY0B 1YNTA 3FQUB 2HLFD 5D5MA 1JHLL 4YHIB 4PJFB 5AZ2H 3VWJA 1UM5H 5I1JH 1U8QA 1MY5A 2V17L 3CFBB 4U7KA 2HFTA 4Y5VC 1KYOJ 1J1XH 3QFJA 2YOCA 1CK0H 4Y1AD 3I2CH 5EUOA 4ERSL 4UIMB 5LGHH 4H1LG 3TJEL 1SJHB 2XWTB 5C0EA 2XY1A 4K3GA 3ARTA 5JORA 3GUTA 5FOBB 2F19L 1AP2A 1SEBB 4NO2A 4ZUWB 5C0AA 4Z18A 4PRNB 5J11B 3W0WD 4AM0B 4XCFH 4PJXE 1JZ5A 3SKUD 2JKXA 1TZGL 3QIUC 4OZHB 5D7SH 3EFDH 3QIBD 5GGVY 3KS0J 5H35B 5FHAH 4UILL 3MJ9A 3WHE0 3MJGX 1N59B 2ZCKH 1KSRA 3HZKA 3MLVH 1HOCA 4ZAKA 1S7WB 1B0RA 3IJSA 3QXWA 3RUGE 1BQLL 4GT7A 5B39B 4J1UA 4OKVB 3K8MA 1LO5B 4U6XB 3GB7A 5F7DA 5EO0A 1XR8B 5KZCD 3WDHA 1MIMH 3HRZA 5GGUB 5LWYL 3JUYA 4G7VH 1YA5A 4XMKL 1RIUH 3ECBB 1S7UB 4R8WL 5GGSB 2VIRA 5E2TH 1F8TL 1JGEA 1PLGH 1FRGH 3HI5L 5GHWH 1V7MH 2PNDA 1I85A 2VXQH 2QQLL 4JFDD 4MB3A 5T33H 3DIFA 4GKZB 4Y5YA 4N9GB 1DBKL 3ARBA 4H1LH 5JW4Q 5C0BB 5D7JC 4HH9B 5HYJB 2DD8L 5FUZH 3TP4A 1L7TH 4BSVB 2CMRL 2AXGA 4R7NA 3H9SD 4FQJH 1R3JA 3AXLA 1RJZB 2RCSH 4PTUA 12E8L 4DKAA 2IC2A 4M7ZB 3QQ3A 1Q72L 3RRQA 4XPTL 3RTQC 1XR8A 3L9RA 1YY8A 5D1XB 1UXSB 3EFFA 4HS6B 3BYTA 4F7EB 4XNZC 4QHNA 3OKLA 2ZOLA 5J1TC 2BNQE 1NAMH 5HDQH 2HFEB 3SGDH 3G04A 4OLUH 2ARJB 5C3LD 4NM8L 5F96H 4PJHB 5IOPA 3KPRB 4FQXD 1I1AB 2JF1A 3F62A 4ODWA 1U2CA 2EC8A 1P6FA 1I7TB 1KPRA 2GJ6B 4KTEL 3MXWH 4YUEL 2NY5L 1F6AB 1K8DA 3THML 2DTMH 3O2WL 3UCRA 2APFA 3PWJA 3C87A 1A6ZB 3SDDD 2AJUL 1YEHH 3TNMB 3IVKB 2Q1EA 3M1BA 4XBPA 2FWOA 3GSQB 4E9LA 1PDKA 4DKEH 2Z31C 3RWFA 4GS7B 1RZJC 5DSCB 1IGTB 2VLME 5HHOB 1X4XA 2Q6WA 3T0DA 1FN4A 2WBJB 2AVGA 3MV11 2R1WA 1JGUH 1DQLL 3MLUH 5KSBB 4IMKC 4U1JB 2IBZX 1IAIL 2I25N 5E8NA 3QCUH 4ZYKB 2IBZY 1AGCB 3R06A 5SWSA 2XA3A 2I5YL 5HDOA 4PV9A 1ZT1A 1MH5B 2BOBB 4QHMB 2IPKA 1NGWB 4IMKA 4YDKH 1MAJA 3U9UA 2ID5A 4I4WA 1OT1A 4JDTL 4ODSH 3O0RL 5I9QB 2BHZA 4IRJA 3FO0H 2H26A 2MFNA 4V2CB 2VDRL 5T3XD 3AM8A 3AUVA 3QIUA 4ZTPL 2BNRD 3VG9C 2ESVE 3LDBB 1T2QH 3GSNB 1JMZA 5HI4C 2FATH 1JMXA 5C0FB 2ITCB 1GZPB 4NN7C 3VJ6A 5L6YL 1V5JA 5HVFB 4UMGA 1ORSA 1P7QD 5T5NG 3SE3C 1U6AH 2VITB 3GNMH 3NPSC 1ZSDA 3RA7L 1BJMA 3GMLB 5T3ZD 3B9AA 2ADJB 1Q1JL 3JXAA 1G0YR 3OKDA 3QJFB 2NR6C 5HYQB 1WZLA 2DQGH 1NGQH 2Y9RT 5JMRA 3GHBH 1WUNT 2YR3A 1J87A 3U48A 4M7LL 4Q6YA 3WS6A 2DKMA 5FYLL 2I9LA 3RWFB 3PQYB 1CICA 5J06A 3HI1B 2ZUUA 5IMOB 1CXFA 4RX4A 1U41A 4F7PA 3RFZC 9CGTA 1UKTA 2R56L 2VDRH 2R2BB 5L0QC 4U6TA 4ODSL 4QRUB 3LIZH 4H25A 4NQEA 3RU8L 3FO0L 1JZ3A 1AKJD 5KW9L 2CJUL 1UB6B 5C6TL 2D03L 1MSPA 5KSVA 4YWGH 3FN0L 1P4BH 1J0ZA 1B88A 2PXYA 4K9EL 2P24A 5C9KA 4MNQD 1U8QB 2A77L 2LU3A 4CU8A 2D4FA 3O6FA 4O2FB 2FJGB 1HIML 2XA8H 4DOHE 4PJBB 1FO0B 5MHSD 3CMOL 4LCCC 3T4AA 1TTGA 3PIQA 3DX8B 2MTPA 5JUEL 5GRVL 3UJJH 4FN0A 1AGBB 3NCCB 2CLZB 1MNUL 3S9DB 4HLZG 4X7SL 1YMHB 4QOKE 3VGDA 3PJSA 3H6JA 1ZEAH 4YHKH 1N64L 4NJAL 3UTQA 3WFEH 1B0GB 4LCCA 1Q9LA 1F11A 4S10A 4O5LH 4XVSH 1YEJL 2QSTA 4ELKA 3FRUA 1MCSA 2WIMA 1FBIL 3MBEC 4OGZA 1QO3A 4DTGL 5C0JB 2OP4H 4YZFF 1I7UA 4OLYL 3C2SA 4OD2A 3MGTB 2HA1A 1OF2A 1UYWL 3ZDZE 5I1LB 2Y07H 1Z5LA 3O4LA 6FABL 4ZQKA 5D2NE 4U7SA 4HDIA 1AY1L 1U3YA 4JO4L 3CFKA 1U3JA 4RWYL 2DJUA 4OAWB 3D25B 3KS0H 4X7TB 2WQRA 5ISZE 1P2CB 2WINB 4FFYH 8FABA 2V9TA 2WUCL 3PV6B 4K3DH 1N4XL 4G7YH 4EDXA 1DEEA 4JLRB 4Y2DC 3L3OA 1NBYB 4JHZA 4KQ4H 4WFHD 2OJEB 1EFXA 4P46B 2FB4H 4PY8J 5DQDL 2XZAL 5I8EB 3VXME 1G7QB 3OKNA 3ZKSD 1HEZA 4PV9B 4EXPX 3RY6A 2I07B 2JIXB 4DVRH 5DD1L 3VFNB 5GS0C 4W4OC 4HIEA 1JVKA 4ZUVB 2RB8A 4XPTH 3B83A 2ZOKB 5E99H 4L9DA 4DCQA 2BZDA 4CL7A 5L2KE 2F8XC 1DQML 4LHUB 4YHOL 5CD3A 1DQDL 2BSTA 1NFKA 4JZOB 4M8QA 4IMLB 3QCVL 4G8IB 3VXMB 1I7ZA 1AE6L 4YHMH 4M6NH 4HPYH 4CN4A 3DX7A 1KEGL 4R8WH 4RAVA 4BA8A 3QO0B 3PUCA 1U93B 5IW6A 1DBJH 1G9MC 3T0EE 3WN5A 1JK8B 3X13B 3P9MA 1CTOA 1RIHL 2XNAB 4Y5XA 1O5DT 4I0PA 4O4YL 5IGXH 5TFSL 4PUBL 1RQ5A 5FECA 1FFQA 4K23H 2BC4A 4ETQB 3BDXA 4RGOH 2OJZH 4ZUVA 1A6UL 2D7MA 2WWKO 3PWPA 4P2CG 3HE6C 1UM6L 5EZLB 3QIWC 1MHCA 2ZCKL 4FQ1L 5CGMA 1JWUA 3U46B 1OTSC 4L8DB 5HYSB 1GC1L 1IBGH 2BSSA 1T3FA 1WC7A 5DZNA 4P5TB 2AP2A 5DQ9B 5HGGS 3Q0HA 3HAEG 5DQJA 2IADB 4GG8B 3FQNB 4LLYA 4MLIA 5D7SL 2APXA 3CX5J 5EIVA 2WINA 3NCFB 3EOBB 1D5MA 4V1DD 5AD0B 4XP5H 2VO5A 3AU1B 5F1KC 1NMBH 3RVVD 4XNUH 4JCLA 2NZ9C 2UWEA 1S3KL 4L3EE 1S9KC 2CKBH 5I8CB 1BAFH 4TUJB 4R26H 5F1NB 2OS7A 3PXJA 2YWYA 3SPVB 3UTZB 4ERSH 1NCAL 4LLUA 3ULVE 2EE3A 5D7JD 1RI8A 3ARED 3ARDB 15C8H 2GUOA 2YXMA 3QDGE 3QI9A 4XI5D 4UNVA 1M05B 3VXNA 3BP7B 2P49B 1HXYA 3T77A 3TBVA 4GKZA 5KSUB 2SEBB 2HFGL 3CXHK 4TNVF 2YKLL 4OV5A 3P30H 4F57H 4UV4L 3RTQD 5DJAA 4JM2A 3G5XA 5J1AA 3O81A 5HI5C 5FGRA 3VXSE 3I50L 4WI4A 3TYFA 4U1SB 5BV7L 3CUPB 1C5DB 1Q9LB 4XCEB 5TDOA 5FV2A 1NJ9A 2QADB 1AGDA 2PETA 2VDKL 4JM2C 3EOAB 4GKSB 4K9EC 1NCDH 4TUJA 3WIHH 4LCYB 4KHXH 5CEZH 4OF7A 3VGHA 1TTFA 3S8WA 3UMTA 3PGDA 4KZDH 1D5ZB 2AW2A 1QSZA 2BY1A 3BOVA 4R4ND 1HCFX 5CEYA 4HEPG 4QXUH 1CG9A 5BZWA 3G9AB 5IQ9B 4ONHB 4YO0A 1IKNA 3HNSH 2R4SH 5I2IB 4XNUL 4NO2B 2O5YL 5CZKA 3T0BA 2FX9H 2O5XH 3MCKB 4KK5C 2NY4C 2C3XA 3BGFC 1QG3A 4UDUB 1QFWL 3PHSA 4JR9H 5EUKB 5TGBA 5J89A 5ETUB 1JZ6A 4UIMA 1N3NA 4U6HA 5GS2H 1KIUA 3BZ4A 4YDKL 3UAJD 2MCPL 2ZUSA 4WW2A 3IYLW 2DQDL 5DGRA 5DK3A 3BO8B 5DDHB 4WCYL 3LKQA 3PHQB 4XH2B 2PYED 1J0IA 4WWKB 5GISL 3U9PH 3TVMA 4HG4J 4M4RA 4L4JA 4PREA 4C56D 4HKXA 3GJFA 4M8QB 5CBEA 1OLZA 2OM5A 3T77B 3TYGL 3WEXB 3T2QA 5DD6A 1BQHB 1RZFL 2NY4B 1E6JH 1UXWB 3QO0A 3QEHA 4LSPL 3TO4A 2R8SH 1G7MA 1OAYH 1XF4A 3QCVH 1ZS8A 3R4DA 1KN4H 4IRSB 2VDOL 5ISZB 3MRPB 3TFKD 3BPLB 3PWNA 5SV3A 5GS0L 2ATPB 4R90H 4PJGB 4XB7A 3U9UB 3QDMA 2GITB 2HT3C 3MRLA 4PR5A 1BX2B 3AY4C 5CJOL 3MXWL 4X6DE 1KIRA 1OTTD 4KAQL 2F54D 4X80L 1LK2B 1J0KA 2NY5H 2A73A 5DJYA 4PV8B 4PP1C 5M7QA 1AIFB 5DXWA 2OTWA 1JF6A 1ZVHA 3U0TB 4E42B 1A2YA 4UI2A 3R1GH 2CXKA 3BWAB 1J86A 2GJ6E 1QSEB 4L8SB 5BVJB 5D7KD 2XN9A 3RDTA 3RY4A 5TDNB 2F58H 4PRIB 2DQHL 4IRSA 4IBLT 2VLRA 4AEEA 4YDVB 4Q9QH 4NBYB 1S9VB 2EDEA 4PJAB 3SPVA 2BNQB 4HJJH 1MVUB 2ZZUT 5GRYA 1ND0B 1NQBA 5HTSA 1FCCA 4RDQF 3GO1H 3K4DA 4TVPL 3ZKNC 1M05A 1OY3B 3TCXA 3V6FA 4O51B 4JRYE 1IAOA 2WBJD 2VQUA 1E6OL 1FFOB 5EBLB 3M1BB 4XBPB 2GFBB 3IS1X 2QQLH 3HUJB 5D71L 5EN2B 4NNXB 4PJ5B 2Q87A 4G6AD 4XBEL 3OG6B 1FZMB 3MJ8A 3HG1A 1NGWA 2D9CA 1A1OB 3HI5H 5GHWL 3ZYJA 3FQTB 5IW1A 3S4SA 2ADFH 3F5WA 4FG6C 2IANA 3QUMH 1JF1A 1MHPH 4ZFFB 3C8DA 3O3AB 1ONQA 2XWJA 4MA3B 5JXEA 3SGJC 1BVKB 5E8NB 4ZYKA 1T1YA 2CLVA 5CJ5A 4HCRA 3CXDH 4BZYA 4GJTB 5AUMA 1PKQA 4IRZL 2J4WH 5FGCB 3ZDYE 5ADPL 4RBPK 1IGFL 2AXHA 2ZNXA 4X9IA 1BEYL 1RD6A 1G0XA 1P6AB 1OTSD 1SYSB 2VXVL 4ODUB 3WNMA 1CDBA 1AGFA 4D9LH 4P9HL 1QRNE 4LAQH 1U8KB 3M8OH 3HUJF 2YZ8A 2G5RA 4UILH 2CGRL 2GIYA 4KUCD 4FQ2L 2YRZA 4OZGA 4TSAH 4X9HA 4TTGA 4NKIL 4EKXA 3WJLC 4YNYB 2O5XL 4KDVA 2HN7B 2IPTL 4PJGE 3DVFA 3QI9C 2DDQH 3GMNA 2ZKHH 3U36A 4D8PA 3BPOC 4LLVA 4TSCH 2QKIA 1XF1A 2R69H 4N0FB 4WDIB 3DI3B 3I2CL 5IBUG 1I3GH 3AREC 4HAFA 1KFAL 4YX2H 1CICD 1J0HA 1IC4H 2I60L 3GMLA 4HWUA 5DC9B 5I8OL 1TLKA 4U1IA 3TJHC 1JHLH 2HTLC 2HJFB 5JW4R 4OLZL 1ZLSL 1UCTA 4HUWA 5E2UH 4GXUN 3CFDB 4M6OH 2FATL 4K3EL 4XHJC 3PP3K 5DHXB 5L2KD 1MCKA 4MD5B 4C83A 4LMQI 2C3VB 3MV7E 1J05A 4Y5VB 2XPGA 4UV4H 5JQHC 3FTGB 3UYRH 1OW0A 1ZA3A 3L95B 3QDJA 3FFCB 4FTVA 3VFGH 4ISVB 2W92A 3BZEA 3IFNH 2LU4A 2GSIA 2B1HL 2VC2L 2H2SD 4Z7OE 3QWRD 5A3IC 4JRWA 5JHDB 3QWQB 4HS3B 3SDAB 5EC1B 3O4LE 1QA9B 4UNUA 4HCRH 2JELL 5ESQA 4G6FD 3PDGA 3QDGB 4FTVD 1QLRA 1L6XA 4LASL 3EHBD 1MFCH 1P7QA 1NGPH 3QIWB 3SDXE 2YA1A 4ZOCA 1CBVL 3ZL4L 5KVMC 1FFNA 5J3HC 5KS9E 1FGVH 4OLXL 3LPGA 5K9OA 4YAQA 2UWEF 4WV1B 4K55A 5ACZA 1I8MA 4JFPB 1CL7I 1DUZA 2YPVL 4OSUL 3OAZH 4WGVB 1A5FH 2DQFB 4QEGA 3ZSTA 1SMAA 1A02N 4YNYA 1A64A 5KS9A 4RWHA 4XXCC 3BP4A 1Q9OB 4NZTL 1CDUA 2J5LC 4XHQA 5IMKA 4G6ML 1N3NB 1FO0A 4NQTA 1P4IH 1XF3B 3KPMA 2R2HB 4FNLL 2X4UA 4HS3A 4KI5E 3MROB 4Y19D 4P2RD 5AEAA 2F15A 3RVVC 1BFOB 4XPAH 5GGVL 4KRNA 4D0BA 4ZFGL 4HAGA 2AK4B 3F7PC 3B5TA 5DS8A 3VFPA 4KVCL 1X6LA 2QTEA 4LARH 1BZQK 1KCVL 4WHTB 3ILQC 5IBLD 4P46D 5JLZB 1HKFA 1NDMA 1F6LL 3WNLA 1T7WA 4Y4FC 1DE4A 5KG9A 2PN5A 3SE9H 3UTPD 5B8CC 4Y4KD 4DEPC 4AT6A 1I7RA 3W39A 3RPKA 2ZOLB 4IDJH 4PLKD 4ZDHA 4YDIH 3TO2A 4XCNB 3MRJB 1F4HA 3BDYH 1MCDA 4NQSB 4PP1D 3V0AC 2AQ1A 3ZTNL 2QKIB 1KPUB 1JZ7A 1CDIA 2GJJA 4DVRL 1AC0A 2AK4A 4JB9H 4YC2B 3C8KA 3I75A 4Y4HB 3QO1B 4AJ0A 2Q86A 2CMRH 3QQ9C 3CMGA 3MV7A 3SQOL 1HSBA 2E8ZA 5HI3D 3V7MA 3MRGA 3NABL 2PW1B 3V79C 1IQWL 2DIAA 3P73A 1A7OH 2XQYG 3O6KH 5T1MB 5E00A 3LKSA 3TIEB 5I1DA 2CIKA 4NQDB 1MFBH 1FVDB 3MLZH 4OQTL 5FF6B 4DWHA 3OKKA 1WCBA 1F3DJ 5CMAB 3OJDA 4JZJB 1S7TA 1QRND 2BVQB 2AAVA 2F58L 2X9XA 1JZ4A 1JGDB 5C0CE 1KJMA 1PX4A 3HMXL 2H6PA 1N8ZB 5CP3A 3ARFB 2FIKA 4N0YH 3ESVF 4K7FA 3IFOA 1EAPA 2DYPD 1NFIB 2B5IB 1AXTL 4RNRB 1DZBA 5FDWB 3UAJC 2RR3A 1QA9A 4NRZA 5FGCE 3D1MC 2BSSB 4JY4B 5IEKA 5SWSE 3B9KB 3UYPA 1MF2H 2JJUA 1E27A 5DJ8B 1QPXA 1JNHB 2IFFL 3NCJH 5FUOH 1E4JA 1OTUD 3KYKL 3FFCA 2DB8A 3H42L 4PTUB 3L1OH 3WS3B 3O11B 5D6CA 4K07A 4QF1A 3ESUF 4NKDA 1JBJA 1BZ7B 3FT2A 1HIMH 4FABH 1YMME 4JFOA 4OLWL 4W4NA 2HVJB 1A1MB 3U4EA 2OL3B 2B39A 3ZKQD 1ODAA 4CJ1A 4QHUB 3DETC 1NLDL 1JNLH 4JRYA 5JIKA 2NW3A 3MA7A 2Z8WC 1XIWD 3L5WB 2ARJA 2LABA 2VISA 1TTUA 2C1PB 1OTTC 2R56H 4WHYG 3Q3GA 4MAYA 3OKEA 1I1AA 5EWIH 1OD9A 4MXWL 4U1SA 5E2WH 4PB0H 4NC1E 43C9B 4M7LH 3S37L 3CPLA 1WT5A 4MAYD 4NZRH 1IKNC 4RFOL 5EO9B 3O2VH 4JFXA 3U0TA 1FGVL 2EIEA 2X7LA 3PDOB 1YJDC 1D5IH 2BK8A 1RZJH 2F54E 2ATPA 4B7LA 1KJMB 1F3JB 1WFOA 3K8LA 3HC4H 3MRFA 4WO4B 3LKNB 4NQVB 3IDJA 4NOFA 4R9HA 3CSPA 3O45A 4OQ1A 1D5BA 5L8JB 3TBTA 2VXUH 3H3PH 1JRHH 4MQXD 3V6OA 2H1PH 1RULL 5DURB 3EZ8A 1T2QL 4HXAL 5EOQH 4KHXL 5CEZL 4XWGL 3N85L 1EA9C 5ANMA 1HHIA 3X3GL 4XBGA 3S3SA 4EUPA 4M5ZH 2L0DA 3FQTA 5IW1B 2NX5B 2BY0A 4PJFA 4MJ6B 1C7TA 4HUUB 2YA2A 5BQ7A 4CDGC 5ACMA 1B0WA 3HUJA 5ESAA 4D94A 3D3VD 4RMQA 2VSDA 4DZBA 5BV7C 3QPXH 5CGTA 4Z6AT 2Y36L 2CO7B 3BHBB 2C1OA 2W0FA 3VGGA 3FQWB 1IC4L 4NFDA 2H2PD 2JCCA 4NHUB 3Q1SL 3CLEH 1II4E 2C4FT 1VFMA 4YDJA 4LQFL 1KB5B 1BLNB 1OPGL 2XI9A 1N6QH 1QFOA 3NPZB 1CE6A 2UV3A 3DUUA 3TH3T 4JFYB 3KLDA 1G7PA 4GQ9H 1ZOXA 3QDJE 3DX9A 3S3JA 3C60D 4X9FA 3BMVA 2FEEI 3DVIA 1IGCL 2ZUTA 4GRMA 3UJTL 1VEMA 4KJQD 3MOQA 2M2DA 3NCJL 2Y7QB 3STZA 4XP9H 2EKSB 3H42H 3VWJB 4CRPA 3G6DH 5JOPE 2GHWB 3QI9D 4ZD3L 3MLSL 2DLTA 4LAQL 3RVWC 3O6FC 2BXYA 4O02L 1TJIL 3QEGL 3UTTB 4GLRH 1HEZB 2M26A 3O41B 4WW1B 3P0VL 2HH0H 2ESVB 5I74C 5SX4I 2HP4A 3DHMA 4P99A 4Y5XB 2C1PA 3V7AE 2GFBA 2FL5A 3DROA 3TN0D 2MQ3A 3VXSA 4BQCA 5A16A 4I3GA 4PJDF 5I66A 2Q8BH 4ODTH 3BD5A 1FDLL 4XBGB 3ULUL 4IMLA 3CSGA 4OZ4B 2IPUG 1CFBA 2FIRT 2DWEB 3FQRA 4QTIH 3FOLA 4J3VA 4RZCA 1KC5L 3GRWH 2KZ1B 3KPPA 1EHLL 1ZHKB 3L3JB 4X5WA 5KSAC 4JB9L 4B5EA 3BH9A 4LLYB 3CDFA 4R97B 1ZWIA 3DYPA 3REVA 4I4WB 1AD0B 5KS9F 4BSWB 5E6ID 3ZKMD 5J12B 2VOTA 3TCLA 3HE6A 4PJEA 3QH3A 5D1ZA 1BOYA 3U0PB 2XKSA 3L3OB 5FA3B 4PRIE 2EO1A 2DBLL 4JFFA 3G08B 3SE9L 1JI1A 2ATKA 3HN3A 3LPWA 3CFKB 1IFHL 2CRZA 3NZ8B 4KV5F 1Z2KA 2BY2A 3MROA 1IGJA 1GYAA 1DSFH 2AXJA 4XP1L 4KGJA 3FT3B 4HIIB 2ENSA 4OCLC 2DLIA 5DSCA 5DK2B 1LHZA 3BIAX 3TV3L 4B0MM 1GAFL 2Z91A 3QBTB 3MRNB 2J12B 4OZGB 3MOAL 2ED9A 3LRHA 1AGDB 4HGKC 1HHGA 3L7FA 2DAVA 1H3XA 3AMKA 3DX7B 5BS0A 1OAUH 5DJ8A 1FL5A 3DURA 3VXRB 3H9SA 4PTTB 4G9DB 3QDMD 4G6MH 2CIIB 1R5WB 3DRTB 5BQ7B 4WV1A 3QDAA 4XVTH 3ZMRA 1T5WB 2F54A 4LHUA 5F9JB 4L3ED 2X1QA 2F5BH 1HILB 3HNVL 4HUKB 1YY9C 1EUTA 3OB0H 5IB1A 2DMKA 4LASH 3GRWA 2Y5TB 4HX1A 4JRXA 4H8WC 1C1EL 4H88H 3F7RA 2ADIB 4EDWH 2NLJA 3EYUH 4XPFL 3EFFB 4HUMB 2AEIT 2VNCA 4LRNL 4PJFE 3ARWA 5JPNA 3BH9B 3LZFL 1J05B 4Y5VA 5ANME 2GK2A 2PXYC 5I18H 3QDJB 3O4OC 3WKMH 1AXSA 1D5MB 4MNQB 3BZEB 4G6FB 4KY1L 1A7RL 5GPRA 5E56A 3QDGD 4FTVB 1CXKA 1KJ2A 2HJLB 2Z92A 1EGJL 4JDVB 4YR6A 4APQA 1WCBB 1QNZH 3ILPA 2P48B 3WKML 2JJSA 1ZVSA 4JVWA 4WTXA 2FX9L 5MERA 3CGTA 3BPLC 4MNGA 3QNZA 4JKPL 1HH9A 3S3PA 3C6LA 2VWEC 4XXDB 4OLZH 3QZWG 2I26N 1SVCP 2OTUB 3MRJA 3NFNB 3HC4L 4PJ9D 1PQZA 4MQXC 3GBLA 1K3ZA 2JJSC 3QDHA 3ES6B 2A0LD 4DZ8A 4NOBA 4WW2B 3RA7H 5ACZB 5BMFL 4JM2B 4YGAB 2F5BL 3B2UD 3QXDA 4LPVA 3TT1H 1FNSH 1P5VA 2D4DA 2W9DH 1ACYL 3MRRB 4UUJB 5LAXA 4P2RB 3C6SB 1P84K 2CR6A 5I0ZA 3RWCA 4X7DC 1JYVA 2AK4D 4P2QD 4NWTH 2GY7B 5I1EL 5L9DL 4IIQC 1JPFB 7FABH 1NUNB 4XP4L 5CGYC 4QYOB 1PY4A 4KK9C 4J3UA 5C0CA 5FDYA 1TENA 3HFMH 1KTLB 3MR9B 1GRWA 2HKHL 4NQXA 5CEYB 3IGAA 3WNOA 3MREA 5C07E 1HH6B 3T65A 1D5XB 3BP4B 1CGVA 3V6OE 2Y5TA 1FH5H 4GRLC 4LCWD 3RL2A 5I75B 3QUXB 4OD3L 3HE6B 2AI0L 4URTB 1DEDA 4J3TA 4PIRF 3MJ7A 3HI1A 1JWSA 2VR9A 2ZJSH 1ED3A 1J1PH 3IDUA 1CFNB 2J8UB 4I3SH 3WDJA 3P4NA 3I6LE 4GW4B 4NKOA 5HYFA 1H3PL 2FCBA 4XP6L 3HC0A 2YD7A 1EHNA 3UBXI 1FFOA 1OAZH 4G9DA 1JPSH 3G5ZA 3RDTC 2UVFA 3QB7C 3VFVA 3O6FD 4LSSH 5GGRY 1ITCA 1J9CT 5EU5A 2A74A 1FJ1A 3AXLB 2DM3A 1EEQA 1QZ1A 2BJMH 5FOJA 1HSBB 1XR9A 4ENEC 3DX6B 3AS1A 3JTTA 4OIAA 5ICXA 1PX3A 4QOKA 3G9VA 1U8HA 2DKSA 2ITDB 4UT7H 1G1CA 4M03A 3EDFA 2ESVA 4FQIH 1OM3H 5JOEA 1GXEA 4KUCF 5F9OH 4KUZH 4ODTL 3TF7C 1YUHA 2XQBH 4RRPA 4RCAA 4NHCH 5GGTA 4QRPA 4M6NL 2W60B 3LOWA 3VXRE 4NGHL 1IAKB 1ACZA 3MFFB 4ZS7L 3TA3C 5EBWB 4NYLB 1UCBH 2VDNL 3VFWA 3K81A 1KT2B 1ONQB 2ADIA 1M6OB 1CT8B 5IVXE 5B38G 2BHYA 5ELIA 2P24B 4J6RL 5E99L 3K3QA 4O02H 3MRPA 5IBTL 3DX6A 1MJ8H 3QQNA 2DJSA 2GTZB 4IDJL 4Q0XL 4WHTA 2CUMA 3ARZA 2DL9A 1CFVH 3IAQA 5D7JB 4ZNEE 3V4PH 4JGUA 4PGJA 2A6JB 1DQQA 1IM3B 2W9EH 1I1YB 2HFFA 4DQOH 4KI5D 3MRHB 1MCWM 2FEDD 4FQQB 5IVXF 3LSOB 4LLQB 1AXIB 1RZFH 2EDTA 4WFHE 3U7AA 3QHFH 2IG2L 4Z76A 1ND0A 3VXOA 4XAWH 4MCZA 5EB9A 5SWZD 3KYOA 1VFAB 1L7IH 2YC1B 2VSCA 1DQJA 4XPHL 1T03H 2JB6A 3MXVH 1GGYA 4QHKJ 2FD6L 1KXVC 3CLEL 1Z9OA 4PJGF 4EVNB 1J1OH 2XZZA 3QP3A 4FQHB 1CXLA 1K9TA 2OP4L 5CILL 2QADD 1FGNH 3EO0A 4L3CB 2DKUA 4HBCH 4JN1H 2DQDH 4WENB 1AQDA 1S8DB 3SE3A 3WFDH 4FXKB 2V7NB 4HWBH 4WCYH 1J1OL 1J8KA 1XCTB 1EO8L 5I74B 3SGDI 1PW3A 1CLZL 2D7QA 3S88H 32C2A 1MELA 3L9RB 4RFNB 5IUSA 1MRDH 4XGZB 1S7QB 4X7SH 1MNUH 5TGBB 3S35X 1RJLB 2ARJQ 3HZMB 3DRTA 2WLYA 1ZTXH 3SGEI 3IU3A 5E70A 4WTZA 3ZL4H 3VGAC 3A67L 4LKXB 1YY9D 4PY8I 1S7TB 5GZND 3K8KA 1CFVL 5E1AB 4WUUE 4ZODA 4NQVA 1WTGT 4NZJA 1GIGH 4X5WB 3HNSL 5BOPA 2BNRE 5I1IL 2ZSWB 1A6PA 1MFEL 1MQ8A 4NIKB 5L8KB 3V5KB 3H9HB 5HJ3B 1MHEB 3MODH 2NY0D 1R5IA 4DVBB 5C09A 5C0AD 3TYFB 3SKMB 3WJLA 1A3LL 3O3BA 2EECA 5HGAA 2E9JA 3HAEA 2BCKB 5J13C 2SEBA 3LS4H 4PRHA 1X6NA 4GG6A 1NGXA 2IAMB 4K3EH 3PE9A 5F7LB 5AG8A 5GS1A 4JJ5A 1LO5A 2O26U 1KPVA 5J1AB 4X4ZA 5TDPB 5B4MC 1NGZB 2NY4D 4NSKA 1LP9A 4LLUB 3X12B 3S37X 2R4RH 3ZDZF 1VGKB 2WBWB 3U4EB 3QUZB 1Q1JH 3KPTA 4IRSD 3BP7A 1KIPB 4GAGL 4JZNB 3ARGB 4X9GA 2UYLA 5JOFB 1MJJA 3RGHA 4K7PY 4GW1A 3MYZA 5GGQH 5BW7C 5IK3A 3AY4A 1MIEH 4XNXL 3NIFF 3BW9B 3U2SB 1WZKA 2P5EA 1SEQL 5GGTL 4PGEA 3QCTH 3ZDXF 5DQJB 3IDXL 5CUSH 4JFDA 3DX9B 4KMTL 1DCLA 3QUKB 2HWZH 2FJFB 3ARDC 5L2JB 3BSZL 1NMBL 5DA0B 4FQ2H 3CVIH 3LHPH 3OKMB 4O9HL 4TSAL 3LCYA 4YGVA 5DD0L 1RZ7H 1PVHA 3DSFH 4KK9D 1YNKH 1UWEH 1MREL 1DBAL 3H7BB 2C3HA 3JV5A 1JHKL 3CLFL 5HHQB 3EOTL 1KLUB 1X9QA 4LVOB 5DJ2B 1T6WA 4WI7A 1CLZH 4KV5E 1UM6H 3V2AR 4FQLH 3EUUA 2YC1A 1V3JA 5IF0A 5FF6A 1Q0YL 3REWA 1T5XA 2BNQD 3VFOA 1VKXA 3ZT5A 2V5RA 5F7WC 4LIQE 2P46B 3QEUB 5I75C 4LDLB 3HPJA 4Y5YC 2H9GB 2OTPA 2ICWA 4P4KC 1R24A 3ARXA 4EI5A 2KPNA 2OR9H 2VDQL 4WY7L 3MCLH 4NBXB 1LEKA 1FIGL 5DTFB 3ARDA 4X4XB 4APQB 4MCYA 4PBVC 4PJ5D 5I16B 4NWTL 5FO9B 1YEKL 3T2OA 2CLRB 1D5ZA 4YHOH 5IOPB 4X6CF 3RWIA 1WWWX 3IFLH 1SYVA 1VGKA 4FQPA 4MQ7B 4LIQL 1BBJA 1XCQA 4L4VD 1OAKH 1T7XA 3FMGL 1T7VA 5I1CH 3MCG1 4X83A 2ICWI 1FLRH 2AJVH 1YYML 3DXAB 3U0PA 3HA0A 4KTDH 3IF1B 3OTTA 3I6KA 3TZVA 5DQDH 5JHLL 4UIKH 2XV6B 4XT1C 2EE9A 5CWSB 3OR6A 3S34H 1DLHB 4ZS7H 2Q6WB 1X4ZA 1PG7X 4L5FH 3GKWL 5IFHH 4U2YA 1MCCA 4YHPA 4FFYL 5D2LB 1FFPA 3RNKA 1B6UA 1YN6A 3CZFA 4P48A 4M1DH 4OM1L 4MNGB 1KACB 4X6BB 1F11B 3IXTB 1F58H 2G5BA 1A7QH 3V5HB 1VCAA 4AK1A 2BDNH 1XF5B 1L0QA 3FRUB 5D5MB 1FL6B 2EIBA 5DRZA 1WFNA 4MAUH 5KTEH 3N06B 2GYSA 3MV9D 5IF0B 4O5LL 5D96B 1ZEAL 4YHKL 1YEJH 1LNUB 4YXLH 1JI2A 2FEDC 2BFVL 1IM9D 4NC1C 1INDL 1XGUB 5IP4A 4YHLH 2ZWLT 4TNVK 1UACL 2X4OB 3TNNB 5ESVA 4LVHC 3B9KC 2P43B 1YEFH 4K7FB 4UQ2A 2HRPH 2COQA 1H3TA 5D5ME 3EZJB 3QDJD 3MX0A 1JF1B 4YLQT 2A77H 3LN4B 2Q76B 5EC2B 4GKOA 3QDGA 4MVBC 3B5GA 4ZFZB 2OL3L 2XN9D 3RDTD 4GSDH 5INCA 2EYRA 5DEGB 2AI0H 4OGAD 3TPUA 1FL6A 4HMCA 4AIXA 3MLVL 3K74B 2WK2A 3DXAE 4OFIA 1N6UA 2VE6B 1O7VA 2PO6A 5BRZD 1Z0MA 2NY7L 4LSRL 4S1SL 4X6DA 2XZCH 4PGCB 3ULVF 2WUBL 1U3ZA 4ZXBC 2ICWJ 4C54A 3UTOA 4DFIA 2AJZB 4P9HC 1G7IA 1ZMYA 3IT8D 4XHJD 3VXMA 4JO3L 5EU4A 3PL6B 4ZUUA 3GSWB 2VABB 2YXFA 5LBSH 5ILTL 4P23C 2ZG1A 4M9OA 1A9EA 4L8SA 5C07B 3ZYIA 4XRCA 4Y19E 1NL0L 1OAKL 4P2QB 3GK8H 2I60H 1ZVSB 4YX2L 2YBRA 3P4OB 3QHZL 3DVGB 4DAGH 3QNZB 1DR9A 3VXUE 5JXED 1UA6H 2F9BT 5A2JH 2F53A 1FAIL 4NUJB 4N0CC 5EBWA 2E6QA 1JP5A 4HV8A 2PTVA 3KYMA 3EHBC 1LO3L 4LSQL 4ZTOH 3ZE2E 4XC1H 1M7DA 2PUQT 2Y6SD 5E94A 2YUZA 3ZHLA 4UOJA 5B4MD 4NQCE 3EGSA 2BVTA 4Q9RH 3NVQA 5KOMC 4S1SH 5D72L 4KKLD 2LV4A 2NY7H 2ZPKH 3KR3H 4Y4KB 3RJDA 3IJHB 3IDNB 3GSUB 3VG9B 2BNRA 2CDFB 3C08L 4M5YL 5HY9A 3S4SB 5IB1B 3LZFH 1CE1L 3FAXA 1QO3B 1U8PB 4RGND 3M17A 3QCUL 2GJZB 5DWUL 2RQ8A 2YK1H 2FX7L 3ALXA 3SOBH 1K4DB 1NGYB 2A9ML 1W0WA 2NY1D 4TNWK 1N7ML 1INDH 4Z5RA 3KJ6L 2EDJA 3D0LA 3MUJA 3SDAA 1OVZA 1YEIH 1GC1H 3CZFB 3LSOA 2AV7B 4FFZH 5JW5A 4YXKH 4FQ1H 1RK0B 3V8OA 3CFCH 1OAUL 5LGJB 1DVFD 3DMMD 3BKYL 3L6FB 3BJ91 1QRNB 2X10A 2P4AB 1W8OA 2AJUH 4X6FB 4N8VA 5J1SC 1QD0A 1QYGL 1RUAL 2P5EE 4ZPVB 4I3RL 3ARFD 4NWUH 2VXTL 4J8RB 1DANT 1BFOA 1CE6B 5FM8A 2QSVA 3D85D 3N1GC 4Y88A 1DN0A 3T2NH 2VWEE 5KN5B 5TDNA 3HC3L 5F96L 4I0PD 5HDQL 3OPZH 2VH5H 4PGZA 1VA9A 1NAML 1NJ9B 4Q6IB 3VFSA 4PJEB 2P8LB 3EOAA 1KPVB 4GKSA 4IOFD 3WXWH 1FZKB 1DDHB 1DQMH 1MI5D 5TE6H 3SKJH 3PWPD 4NN6B 3W11D 4J3XA 3MYJA 4LPWA 1A1NA 4CVZA 3VH8B 4G9FB 4QRRA 1A4KB 1SJXA 4HWZB 2MWCA 4FQJL 5IG7A 1UXWA 3ZDXE 4IRSC 1UH3A 4X0KB 2PO6C 3JTSB 4PGCA 5E4IA 3V5KA 3PWLB 2VQ1A 1J8HD 4JCMA 4DJMA 4HFWA 3HE7D 5ISZA 3UZVB 1XIWB 1EHLH 1HQRA 4Y16C 4LPUA 3RBSA 5EBMB 4C4KT 4D3CH 2DI9A 1MCQA 3AM8C 2IGFH 3MNVA 3UTZA 3LKOB 4YBLC 5DMKB 3VRLF 4QGYA 3TA3A 2C7UB 1F4XH 2EDKA 1CFNA 2J8UA 1X5YA 3OR6B 1FZKA 3UC0L 5IFAH 4PJDE 4DGIL 1AQKL 1FFNB 5HHQA 1SJEB 4PJCB 1HI6B 3RWDA 3MRMB 5FEBA 3BP6A 3A6OA 3VI3F 3TH4T 2P8MA 4O58L 1HSAB 5EOTB 5C0ND 2ZUQB 3OKOB 1J8HE 3O6LL 1WF5A 4WU5B 4WO4D 5DVMA 5H94A 4JHWH 5C6PB 1X5FA 1P7KA 1FAKT 3GSQA 1KBGL 1YNKL 2FWOB 3EO0B 3OAYH 3OJDB 2VL5B 4L3CA 4OCSH 2XWTA 3VXUD 4EIZC 5C0EB 4U0RB 3WUZA 2FEEL 4FABL 4PG2C 2C7UA 3GMNB 3UPAA 1AP2B 3QNXA 5J6HA 1JN6B 2VJXA 3SCMD 3L1OL 5C0AB 4UB0H 3U6RA 5DJ0B 4PJ7E 5L88H 1J1XL 1JYWA 4P5KA 3MRRA 4UUJA 3ORJA 4MAYC 5DYOA 3TJEH 4MJ5A 3A6CH 1BMGA 4XNYL 4CJ0A 2V2WA 2KQNA 5E7BA 5IMMA 3OB8A 4KK8D 1M1SA 3SDCC 1I9RL 5D8JL 5ERWA 4EIGB 4O58H 2RBLA 4D9QD 2VDKH 1QRKA 4WUKL 2BSRB 2DLFH 5ADOL 4WEBL 2FH6A 4H1LB 2D2OA 1X44A 3D39A 3QJHB 5I17B 5T1DH 4L8BB 2DRUA 3OX8B 4PJBE 1QR4A 4NBZB 1CZ8L 1MHHB 4AG4L 5B3JF 4X8XA 5BCAA 4ISVA 1G7HB 1NDGA 4BKLB 1OAXH 3ZKXC 4HC1L 2CPCA 4A2MA 4QRPE 5E8EB 3U1SH 1TQBC 1KLGB 4NNYB 5CINH 2A73B 5F7EH 4C56A 2P5EB 3V52L 1LEGA 2DQEH 2DQIL 5D7LE 4Z7QF 1FORL 3RWIB 3C5SB 4UINL 4N0CD 5LCVH 1P1ZA 1X5HA 1NAMA 5MI0C 3GUTB 5I8KH 4PJXB 4U1LB 1PEWA 5E8DL 5T1KD 5C8JB 4XP6H 5EU5B 3PWLA 2YMXL 4HX1B 1XMWA 3OX8A 4H8WH 4X6CE 4Z77A 4WW2C 3FONA 2O61A 2R1WB 1VEPA 2I24N 1Q94B 1PKQE 1A9BA 2WBJC 1U3HA 4YPGB 1H0DB 4G9FA 4PJIA 1T5XB 3O2DA 4LFHD 3L5WA 4KJQC 4QTHB 4FXLA 4MX7A 2NCMA 3WFCH 4HGMA 2W0PA 5TF1H 4X6BA 1G6VK 1NEZB 2BSTB 1T03L 1QBBA 4OZFG 2Y7QA 3PWJB 4ETYA 1KTDA 3IDIA 4F7CA 3TN0A 1SY6H 3VXSD 4XAWL 5SX5K 1CFQA 4GRWF 4HPYL 4LFHG 3ISWA 4OKDA 5DUMH 4NQCA 1OT2A 5JO5A 3ET9F 1Q0XL 4MD5A 2QQNL 3C09C 4JFYA 4FQCL 2DWDB 1DVFC 3DMMC 3VGBA 2YPVH 1G9EA 1YECL 3DGCR 2C1OB 2W0FB 5EZIL 3W9DB 3TZVC 3MA9L 4JPKH 5J7CC 1T83A 2R0WH 1JWUB 4UTAH 1MUJA 2Z0BA 4BELD 2X89A 1G1YA 1UXSA 2B2XL 3TIDB 3KPSB 1T1WB 4Z7WF 3OKDB 3QJFA 3LKPA 4M5YH 4UBDC 1QR1A 5DHVB 4OLUL 4ZNCD 5TE4H 5C70A 1JNNL 1L0XA 3LKSB 5C0IB 1ES0A 3VJ6B 1X5LA 4HGWA 4PG2A 1AFVH 5K9KB 3ROLA 2WUCH 4YHPB 3TO4C 1QFUL 5J8OA 5I18L 2JJTC 3H9SE 4I77L 5C08A 1A7BA 5DMJB 4QLRA 4O00A 3RAJL 3JV0A 4PJXF 3MGOB 2EDNA 2RGSA 12E8H 2X4RA 5CSGA 2Y07L 2X4NA 1LP9E 3O41A 4WW1A 1QQDA 2C4FU 1H5BC 4MA7H 1OP5K 1QSFB 5E8EA 4PS4H 1TQCB 4L3EB 3FO2B 5JPNB 4BUGA 2CD0A 1HXMB 1UH4A 4ZFZA 1I7RB 3BP5A 2DLEA 1QR1B 4PRPD 5JMOC 5HHVL 4XNYH 1RZ8B 5BO1H 4EQ3A 4NRYA 4GFTB 1FVCA 5IVOA 2Y5EA 5GGRA 3QUYA 2V7NA 4NUJA 3G6JB 5A1AA 2P5WA 3W2DH 3RL1A 3FN9A 4JO3H 4KDTA 2HT2C 1AD9B 4WI2A 5CFHA 3DRQA 4L8SC 3F8UB 3N1MC 2KH2B 4JG0L 3SE8L 1LNUA 3FFDB 1C5BH 2YRLA 2XNAA 4O2EB 5LGKA 2FHCA 4FFWC 4BQ8A 1FL5B 1DSFL 1E4XL 1Z0NA 4GLRI 4OF0A 1PKOA 3K1KC 5CSZB 1JTPA 4V2BA 5DHVA 5DLMH 3ARBD 4HZAA 4QCIB 4L8CB 3BE1H 4NQUA 1P4IL 3DV4B 3P77B 3DV6B 4JO2H 5FYJU 5CBAA 3IDYC 2VL5A 5JPMB 3TWCL 5CJBA 1INEL 1K4DA 1NGYA 3JV6B 2ADFL 1QBAA 3DX8A 1GZPA 1F4XL 3T0WA 4WUUD 2DQGL 5EH1A 4Y4FB 3RUGB 1LILA 3LEYH 4V1DE 3QIUB 4G8FB 2BRRL 3IJHA 4KK8C 5ESQB 4QRQB 3UYOD 3INUH 1EK3A 2EDLA 3RQ3A 1O0VA 5DF0A 1KGCD 4MDJA 5C0FA 4IRJC 2CR3A 3RVUC 2UYLB 3LN5A 2WBKA 4X6CA 2J6EH 5EZOL 1F97A 5GJTH 3S5LA 2D7PA 4AENB 3HG1D 2LQRA 5EBMA 2PO6D 2ERJC 3F12A 5TJWK 4LCWB 4BFGA 4UZGA 1BFVL 5DHYB 4Y16D 2FJHB 1A7RH 4OV6F 3ZTJH 2CKNA 1ZKAA 1C5DA 2EIDA 4G6AC 4G43B 1AFVL 4RA0C 4LCUB 1NPUA 1D9KD 4KU1A 3JUZA 1WFUA 4I0CC 2C3GA 2NR6D 2NY1B 3QEGH 1BJ8A 1CD1B 3KDMB 3BN3B 4OF5A 2XTLA 1LDPH 3RNQB 2HTKD 2V7HB 1B4JH 5FYKU 1OSZA 2JJWA 4HIEB 4I3RH 4PJBA 4U1GC 3MUY1 3QXUA 2ZSVB 4LL9A 1KB5L 4I8DA 4U6XA 1EEYA 4AMKH 1WITA 2QR0B 5KG9B 3VD9A 4RRPG 4OUUB 3MBEA 3LDBC 2FGZA 3QA3A 5JZ7D 3I85A 4OFVA 2E9IA 3STZB 4JZOA 1FIGH 3ROOA 3FO9A 1IT9H 1P2CA 1N7MH 1BWMA 2IPTH 2E27L 4RMWA 2YN5A 5E6ZA 3O4OB 1DBBH 4ODVH 3GDBA 3P0GB 3DOSA 3SCMC 3HZVA 5FB8B 5HSFA 4AIZB 1SM3H 5DQ9A 5FO9A 3U2SA 5IT2H 1E4XI 2EH8L 3BKCH 3IKCA 4UQ3A 1Z6JT 3WFCL 3PGFH 4UU9A 1MI5B 4FQLL 3X14B 5I9QC 3PWPB 2CDEB 1OP5H 2H6PB 4R4BA 5B22A 5CCKL 3SY0A 2A6IA 4OM0L 4P0DA 5TQ0L 1P7HL 3QAZB 4XVUD 4OFYD 1SBSL 3RGVC 3OQ3B 4F7EA 1UJ3B 3L3IA 4XPBH 5CMAA 3WUWA 1Y6NR 3CFJB 3DV4A 3P77A 3BZFB 5D1QA 4XCCL 5INDA 1IVLA 3IDGA 5KSAA 1N5YH 4RZCB 4YE4L 1S9WB 4M6ML 4X6DF 1U8HB 1TQBB 3E8UH 4B7IA 3LRGA 1DLFL 1JK8A 1JTTA 2Y72A 4ZFOB 3SDYL 4AH2B 5ACLA 1BHGA 4LLWA 5SWZB 2CDFA 3D9AH 4NUGL 5FV1L 1IGMH 3IRPX 1H8NA 5KSVB 1QLEL 5HHXH 5MI0B 1YYLL 3LMJH 4CVZB 1C08B 1F13A 3WXVH 4XPGH 4NZRL 4RFOH 4QTIL 1I3UA 1JGEB 2VLMD 2NQCA 3CSYA 3QUMB 5GSRA 4NNYA 4F8TA 5AAWA 3P0YH 1CZ8H 2NZIA 4P4RA 1S5HB 5ILTH 2I27N 1HKLH 1LEGB 5T1DL 1VEOA 4JFFB 4LLMB 2AJYH 4I9WD 2E7LC 3PIQB 4AG4H 1RIUL 4FP8H 4WTZG 4PJBF 5J3HD 4Z0XA 3OKLB 3RBGA 1YPZF 1NH6A 5JNYB 2EYTB 4IS6B 3P30L 3VXUB 4OZFB 4R0LC 5SX4H 5EZLA 3A6CL 2HJFA 43C9A 5D8JH 1AI1L 4JM2F 4JQXA 2N7AA 4Q97A 3SKMA 4MXQD 1FE8H 1M7IA 3BPOB 1QLFB 3PL6A 4PJHE 4ZUUB 2X40A 5TH2B 3DGGA 4WNQB 3MJ9H 2HT2D 1HXYB 2CIIA 3QEHB 1A6AA 1PG7H 4RSVA 5GS0H 5D2LE 1FP5A 2IFFH 3MJ9L 3C5JA 2NXZD 1I3RA 1UJ3A 3NGBB 4DZBB 4YFLF 2H3NB 1ZK9A 4TQEH 5I8CA 2P7TA 1QEWB 3BPNC 4XVJH 3CFJA 1K8DB 1XT5A 4HUVA 32C2B 5M95B 2V17H 5KZCB 2R0LL 3N1PC 1BM3L 1SVZA 3EYQD 1KG0B 1WCQA 1XGPB 2QSCL 1LVEA 1RJLA 1VFBB 1OW0C 1FGNL 4QT5B 4RISH 3QUZD 5DC4B 3WL9B 4E0RB 3KPLB 3GI8L 4G80B 3S98A 4S2SB 2VRAA 4DKFL 3VGEA 5IGXL 2DI8A 3LV3A 1HDMA 4JHBA 4S1QH 3WCYA 4NQEB 1NC4A 1IAKA 5EA0L 5KVFH 4OTXL 3UC0H 5IFAL 5L8LB 2HVKB 2XZQL 4EUPH 3BVNB 2EO9A 3LKOA 1S5HA 1TFHA 4GMSL 4OCXL 5ITFA 4FQHA 1KLGA 1RURL 1PJ9A 1EXUA 3H0TB 4YHZH 5HHXL 2PR4H 4LPYA 4XTRD 5DJCA 5T1KB 4N9GA 3T4YB 4W68A 1AR1D 3EAKA 2EEDA 4X6EB 2R15A 4PJEF 5D1XD 2X4TB 6CGTA 4HSQA 4NQCD 4OCWL 3ZYOA 5E8PB 3EYSH 2N4IA 3IDMA 3FQWA 1EGJA 1LEIB 3TN0C 2JK5B 4ONGL 1NLBL 4U3XA 3MO1A 5CZVH 5LVEA 1HHHA 3MRDB 4JKLA 3VXPB 3I75B 2HFFB 4KVNH 1VPOH 4OQTA 1ORSB 5LAXB 3Q6GL 3FMGH 2Q86B 2BNQA 1MJ7H 1KJ3H 2FB4L 4UAOC 3OZ9L 3WHE1 4KQ3L 1HHKB 4DKDC 1ETZB 5TQ0H 1K3IA 3CVHL 4PTTA 4OM0H 1N0XL 2K7QA 1DFBH 4XC3L 1ZT7A 2ZSWA 2OZ4L 4Y2DB 1OM3L 1CGXA 2P42B 1SYVB 1LK3L 2A38A 1Q9KB 4DGYL 4MS8D 5KJRH 4HJGA 4DEPB 2FR4B 1D5XA 4XPAL 4XAKD 1D5BB 3OAUH 3B6SB 2QL1A 3MRQB 3PV6A 1JNLL 1FNHA 1F42A 2DQCL 3P9WB 2DMBA 3LS5L 2ZG2A 4L4VB 2X2YA 4OZFH 3N1QC 4J4PA 5GS3A 3IU4L 3UPRB 1PKQB 1NBZB 5DD5H 3O4LB 3RKPA 3DXAD 1T6VN 1A5FL 1VGEL 4POUB 1I85C 2V2TB 4HH8A 4IM8A 3QA3B 3DJ9A 1FZJA 3BN9D 4DN4H 3IKKA 3REWB 3VFOB 2FX7H 3QEQD 1NFDE 3WEXA 1JPTL 3SOBL 2D7TL 2V9QA 1KJ2L 4PRBA 1UZ8B 5KSBA 1CL7H 3EYOA 4OBRA 3QWOA 2WNGA 3BHBA 1KUMA 5HGHB 2EDYA 3RTQA 2VXSH 5T1LA 5DMKA 4PGDB 2AJSH 3OJMB 4ZOEA 1NANH 1S7XB 4FOMA 5IVZB 3WN5B 3GSUA 1OP9A 2UZXB 3TBWA 2K3TA 1CS6A 5EBLA 2BNRB 3P4MB 1NBZA 1OSPH 4YHYB 4RDQG 3RGVD 2RIKA 1ZHLB 4TUOA 3W9EB 3CK0L 5DJZB 3BDBA 1UQSB 1BECA 1LO3H 4LSQH 4JFEB 1MWAA 2Y06H 4PJAA 5HHNA 1S9YA 5L0QB 3JWDH 2BNUB 2L7JA 3BJLA 5D6DC 1AE6H 3A0OA 5I71B 3LN4A 1Y0LA 2B0SL 3SO3C 5KAQG 4JZNA 5KVEL 4Y2OA 4WEBH 4XCNA 3DRQB 1FNSL 2DM2A 3GI9L 5H94B 1AO7E 3TVMD 3GK8L 1CLYH 35C8L 2CK0H 3N9GH 4C83B 4EI5D 1HNFA 5F7MC 3CH1A 3QEQA 2XTJB 3SDDA 3OKNB 1OSZB 5JA8B 4E5XB 2P8MB 1X5ZA 1I1AC 1NL0H 1LP9B 1NCBH 1ROWA 3IJYA 5CIPA 3RKDC 3PQYD 4JPIA 1F2XK 3S97C 4M43H 4EDXB 5FYJD 4JKPH 1INEH 4L3EA 2ZUQC 3OXRA 3NGBC 4LQ1A 2J7LA 1U8OB 5MERB 5EU4B 4JFZH 2Q8AL 3K1DA 1OB1A 4M7LT 2FJHA 5H8DA 3GSXB 5D9SA 3PWNB 3JTTB 5ICXB 1P53A 4Y7MA 5EORH 1QFWM 4KROC 3LY6A 1AXSB 4LARL 5L2KA 4LCUA 2YPKB 1E4KC 3DVNA 4UTBH 4YDLC 1RIVH 3D0VB 3KXFB 4D2NA 5EO0B 1HZHL 4TOYL 4IRZH 1Y18B 3FB5B 4MNHB 4LSVL 5EU6D 1MCHA 3FT4B 5AYUH 3TIDA 3VH8A 1HHJB 3PF2A 3B9KA 4IDLA 3PDDA 2MSPA 3QIUD 3WFEL 1I8KA 4YHLL 1CGTA 2XG4A 5FYLD 1K2DA 1JHTB 2NW2A 1KN2H 5I73C 3QR2A 4L8BA 4PJ9A 1AR2A 1XGYH 1REIA 2EDOA 1LQSR 4H0HB 4OCNC 4G6JL 2LVEA 2Q7YB 1RY7B 2JJVA 4JG1L 3RVXC 5FYKD 2EH7L 4FZEL 3QFJE 3PNWA 1INQB 2ARWA 1U93A 4XCYA 3P11H 5BW7A 4ZPTB 5FYKH 3FAWA 3IB4A 1QFHA 1AI1H 4Z76B 1HHGB 1LO4H 2APTA 5GIRB 2BVEA 3IFNL 5I1GL 4JPVL 5MENA 1H15A 3VFGL 4LKCB 3S34L 1CIUA 1GGIH 2AABH 4MA1C 3C8KB 1PSKH 3ZDYF 1MCFA 3FL7A 2VH5L 2FL5B 3DROB 3HS0A 3HC3H 1JV5A 1UWXH 5A43C 1U92A 2EDFA 1N2RA 3B43A 3FONB 3MQIA 2X6MA 2ADJA 2E7HA 3U4BH 4IOIA 4KRPC 2B2XH 2XQBL 4PJ7F 2XTJE 3CCHB 3CUPA 3FQXA 4CMHB 3TZVB 3TO2B 5F9OL 1IM9A 3F7YA 2X9WA 1U3HB 4YPGA 3VXNB 4U0QB 4LHUD 5EBGA 3UTTE 3O9WD 4RNRA 5FDWA 3MV8D 1IEAA 1QPPA 3TBTB 3CDGB 1HHHB 3VXPA 1IARB 3V4UL 5F1NA 3H7LA 3G5YB 3UTPE 4FFVC 5CP3H 4M6MH 4EUPG 3AS3A 1DE4B 4NO0B 1CD0A 4FQXC 1SY6L 4NKIH 1FVDA 2EXYC 1RHFA 4R7DA 1M7DB 2NXYC 5E94B 4PJ8A 5E8OB 5FXCH 2FBJL 4LNRA 3BPCA 1OSPL 1Z9MA 3D39E 2NXZC 4Y2DA 4ODXA 2OX5A 1NC2D 5FIEA 4EBQL 1VHPA 1S9WA 2XRAL 1KG0A 2DS4A 4KJPD 4WFEE 1CFSB 1OARL 2D0GA 5HHMB 3QNYB 4HKZA 3VFTA 3DSFL 3UTQB 4V1DB 3W81A 1RZ7L 3MJ6A 1IAIH 2ORBH 2HJKA 4MHHG 3GFUA 4HBQA 3OSKA 3LKRA 1D9KA 3QWRA 4Q2ZA 4POZD 3HAEH 2R1XB 4KWUA 5CUSL 1OP3H 1VGEH 1UC6A 1NSNL 2F53D 3O11A 4JFQA 4OFKA 4CKVX 2H8PA 2EDHA 3KPOA 4HIIA 5JW4N 4I48A 1A7NH 2R0KL 2W91A 4FTVE 1FAIH 2OL3A 4NDMA 5CEZD