3WKNA

Crystal structure of the artificial protein affinger p17 (af.p17) complexed with fc fragment of human igg
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Adaptive Assembly: Maximizing the Potential of a Given Functional Peptide with a Tailor-Made Protein Scaffold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 39
structure length 209
sequence length 209
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wknA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wknA01
2OTUA 4XNUH 1QP1A 2IBZX 4F33B 1ERNA 3HMXA 4YPGA 1VDGA 3G6DL 3RGVC 2A38A 1LE5A 5GHWH 5CSBA 2HTLD 3RWEB 3TH2T 3L95A 4JFDE 2DS4A 1S7XA 2APTA 4RIRB 5JNYA 5K33A 1H3UA 5DFVD 3QRFM 3BD4A 5DD0H 3T0EA 2ZOKB 5GJTL 4ODWA 1P4LA 1UB6A 3A6CH 3QDME 1A1OB 1U41A 4ZS6D 2Q6WB 2R1XB 5BZWB 1ZVSA 1OWWA 4JFQB 4Y2OA 4WW2A 5IIEA 4O51A 2XXCB 2GKIA 4GRWF 4Z7NF 4ZUUA 1CLOH 2CRZA 1CD9B 1K2DA 4GG8B 2AI0H 4MQXC 5IROA 1BAFH 4JREC 3QAZB 4PRIA 1X7QB 4LHQB 5CLWA 1XZ0B 3C9NA 1AKJD 3N50A 4G9FB 2NW2A 4G3YH 4S1DD 4DGIL 3BP4B 4O2CB 2OXHA 4AEHL 3B9AA 1XGYL 5SX5H 4D0DA 3BZ4B 3MLYL 5GGTH 5ISZB 1J1PL 1SJHB 2I24N 5D7IF 3TYFA 2QEJA 2YA1A 4NHUA 4YUEH 5BVPH 4JPKH 4MCYA 1GGYA 1W0VB 1CK0L 4NKIH 5F6IB 1F2XK 1BECA 4NYLB 5D1ZC 1TJHL 1PZUB 2EDHA 2NY5H 4POUB 3SKMB 4GUPA 3TGXA 3KYNB 1QFPA 5CJOH 4R8WH 2ICWI 2AS5M 3O4OB 2W9DL 5C0AE 3T8XB 4OZIE 1EEQA 1OGAE 1OSZA 4KRLB 1JL8A 5EZOH 3EYQC 4HWZB 2E3VA 4EI5D 4KDTA 1KN4L 3H7LA 5BVJA 5JLZB 1ZVYA 2F5AL 3DO3A 1YYML 1MCPH 1D9KD 3R06B 1IGFL 1IEAB 4ALAL 1SEBB 2ZPKH 1RAMA 3VGAB 3BUYA 4HJJL 3QNZA 5DFWH 1R3IH 1UXWB 2FBJH 5D7IE 4HWEL 3S3JA 1HHJA 5TJWK 4OGAD 4CU6A 4LCYA 5EU3B 5SV3A 3QWOA 3PL6C 4QOKD 1LK2A 1Q9LB 4IOSD 5MEQA 2VSCA 2WIIB 3LKPB 4K71B 4PBXA 2HLFD 5ANMA 1AI1L 5J89A 3QUMA 1WIUA 3V9FA 5ETUA 1J12A 1N2RB 5GQBA 1MHHB 3E6FA 2H1PH 4ZPVA 1GCFA 2YPLD 4UMGA 3VWJD 1F8TL 3MV7A 2XV6B 4PJAA 1VEPA 3V5KB 4C55A 1X3DA 3NFPA 1K6QL 1ACZA 3VMNA 1S7VB 3CGTA 4RMRA 1UACL 4U0RC 5F7YC 5DD1H 1HOCA 3VH8A 5E9DE 1YMME 4OSUH 4UAOC 1QQDB 3ESVF 5DMIL 4YX2H 2AGJL 3ARZA 2GK0B 2PR4L 1A6AA 1WFNA 1IEBB 1R5WB 3AXLB 4QGTA 3G04B 2IFGA 1XIWB 1D7FA 1A6TB 2ZCLH 1A3RL 2BVEA 4WY7L 2Y23A 4PP2A 5IEHA 2NX5B 4GQ9L 4TVPE 1JHKL 3O3AA 4RA3A 1RUQH 3GBLA 5A2JH 2JJWA 5J4MA 1YMHA 3B5TA 1A4JB 4P49A 4RAHA 4ZTPL 1E28B 4OZ4B 4EI5C 4KI5F 1EEUA 1S9WB 2IH3A 3TNMB 5A2IH 3QXDA 4YZFF 1NLDL 1FIGH 4KTEH 5DHXB 1EA9C 3OGCA 3EO0B 2DICA 1ES0A 2WK2A 5FHBH 4PJXA 5E8DH 3VI4F 3V0VB 2WBJB 1H0DB 1EAPB 4U49A 3IYLW 3OL2A 2O93L 1BFSA 4MAUH 1EJ6A 4PTTA 4LDLB 1MIEH 3KYNA 5DJDB 4GS7B 1F2QA 5C6PB 3G6AA 3LQAH 4JHBA 1LO2L 3JWDL 1D5IL 5DQDL 3UYRH 1RSFA 4LCWD 3MRNB 3DYMA 3NPSB 3OKYA 5C0RL 5JXEA 3ARBD 4YHOL 4KH2A 3TIDB 3VRIB 1IILE 4N0UE 4U7MA 3P0VL 4TSBH 3MPCA 5AZEL 2HJFB 3QHFH 1Q1JL 4MNQA 2IBGA 4S1SH 2HP4A 1KTRL 4OLYH 1F3RB 1N3NB 2FB4H 3BRFA 1HIML 3AS2A 2CUMA 4K7FA 1BF8A 1OPGL 2HH0H 1MH5A 4UTAL 4HFWB 5D7IB 1K9TA 3RVTC 3I6LE 3TBTA 2DQFB 2CDEB 5IB5A 2FR4B 1AQKL 2AK4B 3WXWL 1YNLL 4K9EL 5FUZL 4XI5D 1KJ2B 3TZVB 3D9AL 5HY9A 4NO2A 4NO2B 2YPLA 2DDQL 2D2OA 1SJEB 1NFKA 4YR6B 1V7ML 4E9LA 3DJ9A 4XNMA 4K9EC 4TNVF 1NGYB 3IKKA 3DGCR 1MSPA 2R1YA 2C1OA 3LV3B 2R2BB 5IBUG 4Y2DD 1A6ZA 3E3QC 2WINB 1SYVA 1YY8A 5K9OB 4V1DE 5C3LD 4N8VG 1KJ3L 3HNTL 3MOBH 5HDBF 3VGBA 3O6LH 3MROB 1T1YA 1F3DH 2BP3A 2D7PA 2W59A 1F4WH 3ZL4H 4KKCD 1ETZB 3L7FB 3L7FA 1WQVT 5C7XL 3DMMC 3TBYB 2KZ1B 5KSBA 4GBXD 1TZHB 5EWIL 1JZ7A 5E00A 3DURA 3MUHL 1KN2L 1A4KA 1KPRA 4J1UA 4RAUA 3OB8A 3L5JA 4X9GA 5K9JH 1K4DB 3NZ8A 2E9IA 1I7ZB 4L4TE 5JO5B 3UTSD 4O00A 4JJ5A 4JFEB 3BUYB 4NUJA 4KVNL 4ZAKA 1P4BH 3GMRB 5D9SA 3CC5B 4F7PB 2W9LA 3V0VA 1MFBL 1N5AB 3T1FB 3ULUL 3MODH 1CS6A 3NIDF 4F9LA 2BFVL 1UVQB 5E95B 5CUSH 2XKNB 3PGDB 5DMGD 1T1WA 5KVEH 4AQOA 3MRGA 2NW3A 3WEXB 1N6QH 2QADB 3T2NL 4WWKC 4XZUA 4MA8L 4YFDB 4X98A 1QBLL 4XPAL 3VWJB 3T1FA 5IBUB 5KSVB 1FFPA 1CDYA 2Z91A 1HSBB 2VAAA 5ADPL 5C2BL 5LWYL 5C08D 2V2XB 2AK1H 3X11A 4K3DL 4JFHE 4GW4B 4PJ7B 1P7KA 2DQUH 5CSZB 4EDXB 2Z92B 4I0PA 4JFDB 4PJAE 1EHLH 3L95B 2YRPA 4LLDA 1EPFA 1EH9A 3B6SA 1A6VH 5EO9A 1MFDH 5F1IB 1JRHL 1JNNL 5EA0H 4OF3A 1J1OL 3UPCA 1LDPL 1T83A 3BXNA 4FFWC 1VKXA 4M43L 4PLNC 1CLYH 2Z4QB 3FFDA 4X6DE 1G7LA 3P4MA 4OD1L 1U8IA 3QJHA 1RQ5A 4JDZA 1DBBL 2IF7A 1UT9A 5A3IC 3SGDI 2A74B 1JNHA 4NUJB 2BY1A 3WIIH 3IKCB 3PWUA 5D96B 3CSYB 2EO9A 1KB5H 3P30L 15C8L 4NCDA 3IFPA 1XGTA 1KEMH 2P24B 1AXTH 2UWEB 1YQVL 4R26H 3JSSA 4Q9CA 4BZ1L 5HGDB 3M1BA 2NXZB 3MJGX 2AJYH 2I07A 3LZFH 2YOCA 1JZ2A 2DJ4A 3O6FA 1FL5B 1IKNC 1F6FB 4GT7A 1NKRA 4G8EA 3IDXH 3Q6FA 4HGWB 1NFDE 4HUXB 4PYGA 5DJZB 3MRKA 1CGVA 4MJ4A 4XT1C 3CFKA 5A40E 3OX8B 4UT9L 5I17A 1QFHA 2J8OA 5IJVB 5DJXA 1DVFA 4UQ2A 1PJ9A 3BZFB 4XAWL 1EHLL 4L4TA 3OKNA 3W5NA 5ID0B 3DV6B 2HT4D 3PXJA 3OKOA 2OL3A 3EZ8A 3SE3A 3Q5YA 1GXEA 1RU9L 1I3UA 2EKSA 2HLAB 4G7YL 4JPIA 3HA0A 3M17B 2FIRT 5LBSH 3O6LL 2WW8A 4QCIA 4P3DA 3BP7A 4YHZL 1YEGH 1JZ5A 3QHZL 2A1WH 5I19H 4DGYH 3P73B 4WDIA 3ZDXF 1KJ3H 5FO8A 4IRZL 2VH5L 5CD3B 3A6OA 4RDQG 3LN4A 3W81A 1U0QA 3CZFA 1AR2A 2VDLL 2NY0C 3O6FC 1CU4L 3I85A 4DVRL 1C08A 3X3GH 4LCYB 3H3KA 2NY1D 4N0UB 1UWGL 3RL2B 4DK3A 4KPHH 5C0CB 4NZRL 3K7UA 4XCNB 1II4E 1Q0YL 4KFZC 3U0PA 4I4WB 3ZDYE 2NZIA 1G9ML 1ZOXA 2WAHA 1AKJA 1MRDH 3ZLQC 1BM3L 3ZKND 1AP2B 5K9JL 4MXVE 1QA9A 5D70L 4XMKL 5I30H 3VXPB 5C07D 1T2XA 1NCWH 2G5BB 4F7MA 1T1YB 4WI9A 5B39G 1V7NL 3VA6A 3OAYK 2LE9A 1FIEA 3P0VH 5IESL 5FKPB 3HS0A 5DWUL 3M8OL 4XP9L 1LP9A 2Y36H 1U2CA 4UU9A 4KUCD 3QDGD 4OZHE 4YE4L 5F1NA 3CX5J 1E6OL 5CFHA 5KBNC 2ZG3A 3MMEB 5F9WB 1S9VB 4U6XB 4ZOAA 4L3CB 4H8WC 4C58B 3H3PH 3NABH 1XCQA 3IT8D 4I1NB 1I3RA 4URTB 1FYTA 1UM4H 5I8OL 1KTDB 4TULH 1QSZA 2H8PB 3T4YB 1QSEA 3P9WB 4N0CD 2D31A 4UB0H 4F15C 2PXYC 4H20H 2PYED 3TO2A 4QHKI 4FQIH 4R97C 4X80L 3WUWB 3OMZA 5CWSA 2BERA 4ELMA 4HS6A 1G7JA 3AU1A 35C8H 4YH6A 5JUEL 4JM2D 3BKCH 1OAXH 3TA3B 4IHOB 2B1HH 2W07A 4P5TA 3FN9A 1WWCA 5T3XD 4OCLC 2OL3L 3KPTA 3HRZA 4FFVD 5EUKB 4HPOL 5EUKA 4ZNEA 2DYPD 4P9MH 4OZHF 1JHKH 2IH1A 4HCRA 5ICXA 1ZLVH 2Q76A 3KS0J 5H8DA 1OW0C 3QEQA 4LLDB 1JYNA 5TE4L 2VISB 2PTTA 2YRLA 2XFXB 3SDCA 2FYYB 5JXED 1CGSH 2FX9H 1FNFA 2NZ9C 5JIKA 1EX0A 3GJFB 3TH4T 3JV0A 4KQ4L 4JEGB 3C6LD 4PJEA 5EIIA 3QPXL 3KPNB 5JQ6H 1WBYA 1HDMA 1HDMB 3CFBA 5DGRA 1IC5L 1NC2D 1B0RA 1KTLB 3SOBH 4RRPG 1IL1A 3ULUD 5E8DL 4P5TD 2J12B 1HXMB 4J3SA 2VL5A 2ICWJ 2PKDA 3DRQB 3H3PL 3RKDC 1MJ7H 4YDLB 3FHQA 3BYYA 3IFOB 1A7BA 2NY1C 3HI5L 1NUGA 5FOJA 1F42A 1KIQA 3H42L 4PRHB 4HJJH 4KXZI 3S88H 2XTJD 2VLJD 3VMOA 2EDKA 1NGZB 4NCC1 2Y5TA 2V9QA 3SPVB 2O61B 3C2AL 5T1KA 5T1KB 1D9KA 4NQSB 4OZFB 1C7SA 2CDGA 4L4TB 3QZWB 1MUJB 1NCWL 4LSRH 1DEDA 3PWNA 3FB7A 4C56A 3KGRA 5DMIH 1MQ8A 3ZE2F 3PXHA 3KS0H 5DD1L 1WCBB 2VXTL 1U91B 3VFTB 4LU5H 2WUCL 1B0GA 1XH3A 3MGAA 4LEOB 5J13B 4NZRH 1TPXB 1OTSC 5INDA 3TFKC 1DBKL 3UJIH 5JMRA 1X9QA 4PGJA 2GJ6D 4YUEL 5BVPL 3P40A 1DCLA 4LSVL 2NXZD 3S5LB 2VLJA 1S7QA 1JV5B 3QDHA 2QADC 4YNYA 4BM7A 5KSVA 1XGPB 1ZHLA 1AD0B 4XMPH 2APBA 4HUNB 4X4MA 3WL9A 2AK4A 4NHCH 4Q97A 1T1WB 3DECA 5IW1A 3PWPA 4Y19A 5A16B 2VXVH 2OMBA 5I1JH 2VLMD 1F5WA 3DIFA 1BAFL 2EDRA 2AI0L 2LU3A 3AM8C 4QLRA 4ERSL 2C3WA 3WIHH 3FQUA 5E4IA 3O9WD 2VDKH 1QFWM 3VXPA 3VFGL 1T2QH 3NOIA 2DM3A 1CG9B 3S35L 3QDJE 3QZWA 3L3JB 3L3JA 2H9GA 2Z31B 1MLBA 3CFCL 1UC6A 3MUGB 5LQBL 5I15L 1HI6A 1Z0NA 1CK0H 2VLKD 3LPFA 2OSLB 2R9HD 4FQ1L 5IOPB 1LEIB 5GS1A 4UDTA 5D1ZA 3IKCA 4Y4HB 5FO9A 1KTDA 5LGHH 2NNAB 4RZCB 1PKQA 1XAUA 1S7SB 4Q9RH 4WHDA 3UROR 3QQ3B 5IHZB 4MYWB 1DTUA 4FQ2H 1FP5A 1ODAA 1ND0B 3WSQL 4DGIH 2VC2H 4TSCH 3I84A 4UZGA 5HI4D 1RU9H 1ZT7B 5KS9B 1KJMB 2EDQA 4Z76A 4V1DB 5K59F 2EXYC 4K71C 4BFEA 2A6IA 4ZODA 1BEYL 1DSFL 1D5ZB 1T0MA 4S2SB 3PIQB 5EU7C 1MVFA 3T0AA 5KSAD 4S1RH 5LAXB 5ACZA 4F7EA 1FYTD 5E8NB 2CIIB 3JV4B 1MWAB 1LDPH 3LB6C 1P4LB 5BZDB 3BN9C 5I17B 5FGCB 4CJ0A 1MFAL 4RQQB 5TDOB 4AMKL 1NQBA 4OM1H 2NLJA 3BT2L 3A6CL 3K8LA 5CGYC 4S1QL 4KDTC 4KJPD 2HJFA 4HK0B 3NPSC 1FGVH 3MRCB 4HKZA 3BKMH 4TOYH 3SDXB 1XR9B 3QWRD 3QEGL 3GMMA 5IK3B 4NQVA 4RGND 5MP6L 4G6JH 2X4RB 1INEL 4H88H 3OG6B 1OLZA 5HHOA 3PGFL 1PQZB 4G9FA 5FB8A 1GRWA 4A6YB 4PJFA 1HXYB 1T4KA 1T4KB 2M8XA 2W0PA 2R2BA 5GRUH 4MJIB 2WBJC 3FFDB 3O11A 4DUWA 4OI7A 3SDCD 1GIGL 1MQKL 3NA9L 4HS3B 4KHXH 1KJVA 1MFBH 2DTML 1IL1B 1D5BB 4Y5XC 1HXYA 4M62L 4JO1L 5DMKB 2P4AB 3VXME 5IQ9A 3RL1B 3B2UC 1UM6L 2VZ1A 4X4XB 5BO1H 1YY9C 3GKZA 4DAGL 3K0WA 2XICA 3REWB 2CKBL 1KJ2L 4TVSa 1PDKA 3DVNA 1U8KB 2ADFL 4HKJB 2APFA 4NQXB 5KAQF 4X7TA 3VRJB 5BW7A 4YEEA 5SWZE 3MV11 2B0SL 3SN6N 3H6JA 5F88A 2NXYD 2WWKO 3EFFB 1J5OL 2R8SL 2D4DA 3C6LB 3PDOB 3T0XA 4HQQH 1WWAX 4B7LA 2AABL 1P9MA 4LP4A 1T1XB 3TIDA 1U8OB 1U92A 4QO1A 2BK8A 2YSSB 1TETH 2A6DA 4NDMA 3AREA 4POZC 2HAZA 1BOYA 2ED9A 5E1HB 3RTQA 4R7NB 1CD0A 3GRWA 3G9VA 3LS4H 5M94B 1NCDL 3KJ6L 4F7PA 4P4KA 3OKEB 4KRPC 4XPTH 1RIHL 2DYPB 5JW4M 3C60D 1QUNA 4HC1H 5MEQB 1XGQA 2X4PB 3RX8A 4ODVH 4S1DC 1E4WH 4OQ1A 1DQQB 2X9XA 4JAMA 4XCFH 3RGVB 1CFTB 1KELL 2X7LB 4KI5C 4JQXA 5KSAA 5E5RB 5DURD 3B9KC 1X7QA 4N0RA 4HKBB 2KDGA 1ZV5A 2PYEB 1A1MA 1A1NB 3MO1B 4QY8A 3T0ED 3L3HB 4P4KC 4QRRA 4E42A 2HKHH 3B2UD 4OUUB 4XVSH 3F7PC 4MGXA 4Z7VA 1IGTA 2F5BL 4IMKA 1ORSB 1FNEA 1RUKH 4GRLB 2Q6WA 3HR5B 5GGQL 1T5WA 3F7YA 1LK3L 3SDCB 2W1NA 1J5OH 1CL7L 4H0GA 2ZOKA 3BN9D 5L9DH 2I5YL 3O8XD 3WLWD 1IEBA 1R5WA 3IJHA 5GSRB 1TNMA 2F8XC 4NJAH 5KN5A 2NQCA 5HHPA 4N1CA 4CMMB 5KS9F 3DO7A 2P5EB 3MJ6A 4HCRL 5HI3C 2OP4L 3DX9B 4DQOL 3NH7H 4HIIB 1NGWA 3WFDH 2YZ8A 3K1DA 5F7FA 1PG7L 1Z9MA 3QCVH 4TTGA 4PRDB 3TT1H 4QEGA 1G9EA 5HGDA 3U83A 3V6OE 3O3EA 1PKQB 2N4IA 2EIZB 4KDVA 3C9NB 5EB9A 1RIHH 2HTLC 3VDCA 3KJ6H 4PRAB 3U1SL 4Z9KB 4XAKD 1QFWI 1KCRL 4XC3L 4KDWA 4NWTH 1OGTB 3O3EB 1JP5A 1CFSA 2IJ0C 2C7UB 1T0NA 3UBXA 1W0WA 4G6JL 1D9KB 4OZFA 5MP6H 4ODXA 1F4YL 4RFOH 3QNXB 4EKXA 3AS1A 1C16A 5DEZA 1C16B 2B0SH 4LVOC 3BXNB 5JW3H 2CIKA 1ZA3B 4TSCL 3WUZA 3SKNA 4I3SH 2F53E 5JNYB 4HW6A 1F3DJ 2X40A 2VDQL 3T0EE 4OFIA 3RVXD 4LVHB 5E6YA 5CCKL 3LD8C 3IXAA 1SQ2N 4I48A 1WBXA 1N8ZA 1NJ9B 2VDNH 5C0BB 4LRNL 4GMTL 4MWFA 1KPUB 1Y6NR 3MGOB 2GY7B 4ZPTA 1I1CA 2DQIL 3MRJA 1EVUA 5E8PA 4CVUA 2EDXA 1XGTB 3C8KA 4HUVB 2DQFA 3K2UH 4N0YH 4FQ2L 3M1BB 1S9WA 3QUZC 4ALAH 1WEJH 2JCCB 4FQQB 3WUWG 1JNLH 1RUQL 2F5AH 3EOBB 1AR1C 1R5VB 2C9AA 3P0GB 4KU1A 3T65B 2J6EH 4ZYKB 3RBSA 3B9KD 4MB3A 4HWBH 3D25B 4WVRA 4DW2L 4EOWH 3CD4A 3G04A 3LEYL 4WFEE 2NR6C 4BH7B 3V7MA 3CH1B 2FJGA 5E8EA 2R15A 2UYLA 3OKOB 4I0KA 3B9EA 1K6QH 2NY5L 3BZEA 1TIUA 4M7JL 5GS2D 4LDOB 5IJVA 3BRDA 1MI5B 2DKSA 4PB0L 3SDAA 1HWHB 2JB5L 3TCLB 5K9KB 4KKLC 3FRUA 4YHYB 3CVHH 3MA9H 2FWOB 2IPKB 1J1PH 1DQLH 5KG9A 2EIZA 3FQWA 3QIUD 5F7EH 2VC2L 3BPCB 1S5IH 5LCVL 1NC4B 2MPAH 1MVUA 5EIQA 5HYSG 5CINL 2QKIA 4JPWL 3N06B 4QNPF 5E24E 2CO7B 2ZNWA 4OTXH 4Z0XA 1IGFH 3C8HA 3MRJB 2VZSA 4JFYA 4MLIA 4YDKH 3ISWA 3MACH 4UBDD 1KJ2A 4PRPE 1Q9OB 3KNBA 1LVEA 5CGMA 2UZIL 5DHVA 4O2EA 1WSST 5T33H 4Y16A 1AO7B 2IQ9L 1IC1A 4QRSB 2DD8L 5BS0A 4OZGF 1ONQA 4GKZB 5EOQH 2P49B 4F9LC 3QEQB 5E1AB 5H35A 1C12A 2XPGB 5FCUL 3VXRB 2CRMA 3BD3A 1AP2A 4DW2H 1IBGH 3HE6B 4TSAL 4WWID 3K8KA 2FECL 3G9AB 1E4KC 3JVGC 4I2XB 4AENB 2O26U 4HX1B 4OLXL 3SO3C 3ROLB 3PP4L 5E8OA 4X8XA 4MA7L 4HMDA 3EKCA 2YN3A 5FHAH 3WYRA 3BE1L 5IHLB 1BZ7B 4G9DA 4KAQH 1EGJL 1S7WB 4X4YB 3GJFH 4JFEE 3E8UL 4BFIA 5J8OA 5B38B 3RWGB 2OM5A 1PD6A 1RJLB 2DQIH 4FABL 4MJ5A 3BPNB 4XNMB 1IM3B 4MXQD 4NIKB 1R5VA 1NMAH 3ZKMC 2R0LH 1N0LA 1QOKA 4PJGB 1A3LH 4JG0L 4RGOH 1MCDA 4YWGH 3ZYOA 1OCWL 4P9ML 3AC0A 1P7QB 3WFCL 5JR1H 3DHMA 5T3ZD 5C0FA 4DK6A 1YC7A 4JM2B 1Q94A 3I50H 5FECB 4I3RL 1VFBB 2DF3A 2F74A 1CDJA 1CGSL 3OJDB 3OPZH 1H5BC 4KJWC 1A6UH 4WTWA 1A02N 4RNRB 3I50L 5JDSA 4LVEA 1VSCA 1QBML 2JJSC 3L5WB 4HLZH 3U2SA 1DUYA 1DANU 3L1OH 5ILTL 5F88B 4MNQB 4EIZC 1CBVH 4RISL 3LEXB 5KOVC 5DRXB 1NL0L 1T5XB 5T3ZL 2FH8A 5DUPL 4HIEA 4P23D 2WWKT 3H42H 4O2FB 1M7IB 2X2YA 2GT9A 2WANA 3EYOB 5HYQA 5JUEH 1YDPB 1NCBH 2WWMC 1K8DA 5JTWA 3LS5H 4TN9A 5ALBH 4YLQT 3DNKA 2NY4D 2XKNA 4K8RC 4YDVB 4I3GA 3HZKB 3ARED 5ABDE 5ETUB 8FABA 8FABB 1I8LC 4YXLH 1RUAL 2UVFA 2BVOA 4PJ9B 3PL6D 4Y1AB 1AO7A 3UZEA 2A6KB 3HC4H 5I1IH 1UJTA 5T3XE 3QJFB 1WGOA 2DLEA 1K5NA 2EEBA 4F9PA 2Q86B 4KUZL 2B7DT 3TZVD 3DRTA 3MV9D 4P48A 1T04A 5GIRA 5KW9H 2NY4B 2D0HA 1WBZA 4MD5A 3QUXA 4HLZG 5BCAA 4Q9QH 2AEQH 1ETZA 1I7UB 1CXEA 1FQ9C 3BGFC 4RAVB 4L4JA 3QA3B 4X7DC 4DCQB 5IFAH 1YMHB 4MDJA 1OAYL 2VDPL 5KTEL 1JYWA 4JRYE 3I9GL 3DETD 1EJOH 4NQXA 1T7ZA 2YPVL 4YDKL 1EEZB 3U7AA 2DQEL 4F7CB 2VN7A 4WEBL 4Q74A 4ETQB 5CJ5A 4L5FH 35C8L 3EYFA 3JTTB 2Y9RT 4KK9D 3T08A 5J11B 4GAFB 2RGSA 3IDJB 4N8CL 5EU7E 3HPLA 3S34H 2E6PA 2F58L 3H9ZA 4UIMA 3O8XA 3D39E 5HYEA 4KJYB 3U0WL 1E4WL 1RZ7H 4KV5E 1JWSA 2P5EE 1MJUL 2FHBA 3FFCB 4M5ZH 1ZLWH 1I1AA 3LKPA 2IPUK 4DVRH 3NAAL 2A74A 1F4HA 1P7QD 2WMPA 4XAWH 5J57B 1N2RA 5HJ3B 2X4OB 2X4NB 1RURL 1TJGL 1UKTA 4BQBA 1N6UA 3NFSL 1F02I 4XPFL 5DR5L 3C60A 4M6OH 4QOKB 5FDYA 2VR9A 2XI9A 2J4WH 1VERA 1OTUC 5I2IB 4L29B 4FFWD 1J87A 1E27B 1JFQH 1JWMB 4LCUA 3BQUA 4X6BA 4BZ1H 5DHVH 1ROWA 2I9LA 3K81A 4R0LC 3FO0H 4OQTL 5GGRA 1AXTL 1TQBC 5FM8A 3CFEA 4KZDH 3MA7A 2DQDH 1P2CA 4LLWA 1MHPL 2OJZL 4F58H 3O0RL 4PP1D 2R2HA 1NAKH 5D7SH 2XRAL 3ZE0F 4PJCE 4DZBB 1AGCA 1AQDB 1G7HB 3V0AC 3VE0A 4UT6H 1MQKH 1NBZA 4Z8FH 4LBEA 1IJ9A 3W0WB 3ZTNH 2JKXA 1S9XB 5DJ2A 4RX4A 4LASH 4XVUD 3D1MC 3JZ7A 3ARSA 4XP6L 1BVKB 2BSTB 3DRTB 2VDMH 5HGAA 2OCFD 2R0WH 4JY4B 1G6RL 2NW2B 2A1WL 2P24A 2EDYA 1MHEB 3U4EB 3C5ZA 4GRMB 1PKQE 3CU7A 5B8CA 1B4JH 1KULA 4RFNC 5JORB 3K1KC 2GJ6B 1CD1B 2X10A 5DFTA 1EUUA 2PETA 3D85A 4UV7L 5DO2D 3I75A 3G5VB 4Z78A 5EZIH 2EECA 3LN5A 4PJ9C 3HLAA 5SWQA 1BJ8A 1CGXA 2GSGB 3QWRA 2R0ZL 1CE6A 5BXFA 2O61A 5F44A 1T03H 3MRNA 4Q0XH 4M6NH 1NKOA 1JTTA 1G1CA 5CUSL 2Z8SA 3F6IA 4HZAA 3MLSL 3KPQA 1AXIB 4UQ2B 4WHTB 1N5YH 4I0PC 1QKZL 1I3GH 3RGHA 2XRAH 3HB3C 1YQVH 2DIJA 3BP6A 4NM8H 2BSRA 1NUFA 2XN9D 4L9LC 4NZDA 2H26B 2P5WD 5BOPA 2VKWA 4R3SB 4PFEA 1XGPA 1ZHLB 4MX7A 2YD4A 4X4ME 1YPZA 3IDNB 4OLWH 1YNTB 3EHBC 5CBEA 1I3GL 3L3HA 5IUSA 4F33A 3L3KB 3QEUB 3MODL 3IFNH 3MGTB 5E2VL 3IJYA 5DC9B 1S7RB 1P5VA 5F9DC 2ADGA 3QUYD 4P4RA 3GSQA 4Z7QE 3VXSE 4GKOA 2ZOLA 3QEHB 5IJKC 2OJZH 1MHPH 2IFFH 4OKDA 4HUWA 4ZUSA 1ZGLB 4JB9H 4MB5A 4M6AA 1MWAH 4O58L 4FTVD 4QWWC 4ERSH 3NN8A 3FFCD 3FB5A 2P8MB 4WUUB 1TCRB 4BKLA 4ZFFB 3P4MB 3CUPB 3MUGA 3CUPA 4M5ZL 5F9JA 3RTQD 5F9JB 2UV3A 3AREB 4G6KH 4H5SA 3BMWA 4XHQA 1QFOA 3NN8B 2C3HA 2BXZA 1YEJH 3SY0A 1KCVH 2HVKB 4XCFL 4EZMA 5HYFA 3DUSB 4ODHH 4XPFH 5HDBE 3P4NB 5DTFA 2R0WL 3P9LA 2UZXB 5T1LD 3STLA 4Q9RL 2QSTA 4PP1C 5ITFB 5LGHL 1KPVA 4FMKA 3EYSH 5J1AB 1MHEA 4LSVH 5J9PB 1MIMH 4U1IB 1SMOA 4AM0A 5HGBA 1OAYH 2QADD 5C71A 3TO4B 4S0SD 1FL3A 3OV6A 3TCXA 2CPCA 2VAAB 2YRZA 2YEZA 3ORJA 5EU6D 3SGJA 3PIQA 2NMSA 4YO0B 3O0RH 1X4ZA 3UBXI 1KJMA 1HQRB 2BNQA 2HH0L 1U3YA 4J3UA 1A1OA 3KPRB 3C5SA 3FZUD 4D9RD 3MNZA 1X5ZA 3I3BA 5GZOC 4MAUL 4K07A 4AZ8A 1OSPL 3V7AE 3MRDA 2VXVL 1ZA3A 3H9HA 2QQLH 1T89C 4PGDA 1DZBA 4TRPL 3SDYL 4NHCL 3TJHD 3KPPB 4QHMA 3F7YB 3NFSH 1M7IA 3RZCC 3MA7B 4FXKA 1IAKA 3HNTH 4FABH 2Q3ZA 1J1XH 3OXRB 3LQAL 3DXAD 5EH1A 4WU7A 4G6ML 1MCSA 1BJMA 4Y2DB 5BV7B 4D0DB 5AYUH 5K9QG 1GGBH 1RUAH 2O5ZL 3O2WH 3MLWL 1NGYA 4OLXH 5FYJU 1JNHB 2PYEE 1DN2A 1H3TA 1IM9D 2QSQA 1SYVB 3OPZL 3OF6D 1YMMD 5F9AC 2HWZH 2AJUH 4PG9B 4MA3A 1FGNH 1FHGA 2D7NA 3R4DA 2VL5B 1AO7D 3HE7B 1FAIL 4OQTA 4Q9BA 4NP4H 1QPPA 3CFKB 3L5HA 4A2MA 5IQ7H 2AEQL 5DRWA 4IRJC 3GSVA 4F7TA 1A3RH 3KDMB 4XX1G 1F6LL 1EHAA 3BP5B 3V2AR 1MCWM 2K7QA 5DTFB 4ETQA 5IW3A 4PJ5B 1KIUA 3MRHA 4NN7C 2ATPA 5I1HL 4QWWD 4B41A 4RRPA 4LLVA 4OZFH 3GRWL 1MCLA 3MLZH 2HT2C 4YAQB 5ADOL 1R3IL 3TBYA 4X80H 3GI8H 4E0RA 5DD6A 4GLRI 4LVHC 1QEWA 3ULVD 2H1PL 1DBMH 4LVOB 3PGDA 3IU3B 2IQAB 4RMSA 3VFPB 5F1OB 4CN4A 4X7SH 2V2WA 1H0DA 4Y7MA 3TVMD 2AXHA 2P42B 3QP3A 1DQMH 4KK8D 4ZNCD 1I1YB 5D1XA 1ZHNB 5DWUH 4UINH 4XTRC 3KPRE 3QPQC 2E27L 3CVIL 4G8FA 3TNNB 3B3IB 4W81A 1Y18A 4XNQB 4P2QB 5D2NA 4PGEB 2CLZB 3VW3H 3IXTA 5LJYH 5ISZD 4NQEB 4DKFH 4PJIA 2EEAA 1J11A 1NMBL 1V3KA 3HUJF 3QSKB 3PHSA 4U6VH 2X1QA 1J8HD 3JTSB 4JRYA 2J8UE 4YDJB 4BQ8A 1A6TA 1RJZB 4FFVC 3SKOA 1UJ3C 2MPAL 1O7VA 1C5CH 1AGCB 1AQDA 3T8XA 1G84A 2CLVA 5L2JA 1NCCH 3HCVA 2C5DC 3MRHB 3L5IA 1P6AB 3BVNB 5AG8A 2VJXA 3O6KL 1B2WL 1MFEL 4MXVF 2IC2A 3FT4B 3ILQD 4UIKL 3KPSA 1DBAL 1OGAB 2ICEA 3DROB 1OAQH 3VFSA 5ALCH 1A6PA 1CICD 1QVOB 2DQJH 2PCPA 5IHZA 4Y0GA 3ZHLA 4XNZB 3KLAA 1HHIA 2V5SA 2HT3D 4Y16D 4QRRE 3RDTA 4PJ8C 4PG2A 5JORA 5EU3A 3LRHA 3V5DB 4G6KL 3AU1B 2H8PA 3T4YA 3O4LD 3PP4H 4JFFD 4LSRL 2V2TB 3I75B 2E5EA 5FYKL 2LABA 3BO8A 4BQ6A 5CIPB 3LEVL 4MAYA 4R2GD 4LPTA 4MJ2A 1LEKA 3O2VH 3RVWC 4M48L 4X83A 2LU7A 2AKRA 2JB6A 1IC7L 3MLRL 2ZUQC 3HE6D 1V3LA 1U3HC 4XNUL 3PHOA 1F58L 1KBGH 4KRPB 3JWOL 5FFLA 3SGEI 4J12A 4P3CL 4PD4K 1OL0A 4N5EC 3X13B 1CDHA 4IRJD 1BQLH 4JHAL 2WQ8A 4I5BA 4RMQA 3QFDA 3RNQB 4KXZH 3WO4B 3MACL 4XMLH 3MYJB 2NTSP 3DSNA 3FB8B 3BH8B 3VXUB 3P3YA 1RUML 3O45A 4KK5C 3H9SE 1QRNA 1SJEA 4JFFA 3C6LC 2AJZA 3VG9B 2NYYD 3RVUD 1A2YB 1UWXK 3OAZK 3RY5A 3MRGB 5FF6A 5IMLB 5HHMD 1PKOA 4GAJL 5JA9A 5ESAB 2JJTA 1CL7H 5L9DL 3R0NA 1B0RB 1KTLA 1Q8MA 3BGMA 3REVB 3BPNC 3BEWA 4U05A 3SDYH 4XPGH 1G7MB 4PJDE 5I75C 2AJSL 2BJML 4XTRD 3TBWB 2DM4A 3NCMA 3CPLA 4HIHB 3TBVB 4TUJA 5KJRL 2G5RA 2IBBA 3UTTA 2PO6D 4JY5H 5DURB 1GVIA 4K55A 4QF1A 5HI5C 1DR9A 4XB8A 4NNYA 4JPVH 3RY4A 4JLRB 3SDAB 4NQDE 5ITBL 2C3GA 3O41B 4ELME 5DK2A 5DK2B 3L3GB 3MOAH 3MUJA 1H8NA 3NACH 2GSGA 2NY3C 1FNGA 4CGTA 4IRSD 3W9DA 3GO1L 1QBLH 4HZLA 3UTQA 1AY1H 3SJVA 5C0IB 4OZGB 3PABB 1F11B 5DQJA 1OP9A 1U92B 3NCBB 1NEZA 3BDXA 4PJCA 3QWOB 1T1ZB 3U46B 4Z95L 4PJGE 1QYGL 1JTOA 3U9UA 2X44D 1AD0A 2D0FA 4JGUA 4HPYH 3KYAA 1P4BL 5EBLB 2X9YA 4XP9H 5TE6H 3TZVA 1NLBL 3W2DL 1JV5A 1MF2H 4JFXA 4PUBH 1CIUA 2DLTA 5J1TC 3WFDL 3OHXB 1JNNH 2AXJA 4JN2B 4JN2A 5EORH 1BFOB 5C0BD 5HHXL 1MFDL 2CLZA 5C1MB 3FO0L 4OQTH 1NC2B 3STZA 2QHRL 1MWAL 1CYGA 1ZSDA 3MQIA 4GLRH 2E7LA 4FA8A 2R0KL 1RZKL 1IGCL 1RHHA 1D6VL 2NR6D 1MF2L 4XPHH 3VFRA 3DSFL 3IVKA 1A7QH 2YPKA 3ZE1F 1KACB 1QFUH 3IDYC 3OKDA 1QSFD 1ZK9A 3BDYH 5DJ8A 1QSFE 2D9QB 4QRTA 4WW2B 2GK0A 1GIGH 2YA2A 1KXTB 4NNYB 3BUTA 3RVVD 3MUZ1 4NBZB 3KPSB 3GB7A 5SWSD 5IEKB 4JFZH 3MNWA 4JG1H 1MJ8L 4JM2F 4P59H 3CMGA 2GFBA 3WE6A 1FJ1A 1CFBA 4U0QB 3B43A 4U3XA 1MPAL 3BKJH 3PG2A 1Q0XL 3G5ZB 1T6WA 3DX7A 1J8HA 3U0TA 1BD2E 1XEDA 1C1EL 1MCNA 2J7LA 5EDXA 2KKQA 2VYRE 4XB7A 3VWKC 2VWEE 1G7MA 5E5MA 2XWJA 2YXFA 4CUCA 3MLSH 3LHPH 4M93C 3QFJA 1Q0XH 4FQQA 3K4ZA 4PRIB 1XR8A 2OP4H 1N4XH 2CMRL 4LP5A 3G5YA 1SJXA 4PRAA 2OTUB 3V6OA 3QNZB 3P0YL 1JGEA 2VABB 1SVZA 5D7JB 2BHYA 5F7DB 5H37H 2QBWA 4XCCL 4P2RE 5FUCE 3PGCA 3MBEB 2YEZB 4S1RL 4YXKH 5IF0B 4N90E 4NZJA 5T5FH 5IG7B 5TE7H 5JW4N 3P77A 1XGUB 4HK3N 3QDGB 3LZFL 1IGYA 1EFXB 3S7GA 4HZLB 4JO3L 3DXAB 3SJVD 1V8HA 1LO4H 4UNVA 2R2HB 1C7TA 3PP3K 5F7WC 1M05A 5DSCA 3ME0A 1C5DA 1P2CB 4XP6H 2CO6B 1VPOH 1DVFC 3NCYS 4LASL 5BJTA 3MJ9A 5F21B 2XQBH 3GB7B 4PGZA 3TN0D 1M05B 5DSCB 5JHDB 2VZ3A 5E8OB 2A6JA 3ULSA 3MFFA 2W0LA 1A8JH 1DBBH 1LDSA 1X6LA 4P3CH 5KSUB 2HLFC 1S7TB 2APWA 3JWOH 4FG6C 4PLJD 4LNVA 4MMZC 4NQCE 1IC7H 2ZKHH 3MLRH 2X1WL 3VFGH 3O11B 4HUWB 2PUQT 3ARGA 1XZ0A 3IU4L 4JANB 5IVNA 2BMKB 3NACL 4G9FD 1W72L 4QXWA 4PRNA 4P4RB 3IGAA 1W72B 1L6XA 3PDDA 5AUMB 3P9MA 4HHAA 4HHAB 2IG2H 2DMCA 4H1LA 4X6FA 2X5PA 1G6VK 3DPBA 3S96B 3SBWC 3QQ4A 4GAJH 1F6AB 5J1SC 4X0KB 3QIWB 1YMMA 2AV7B 3Q6FB 4HGWA 5I73B 4HSQA 2ZSVB 2YSSA 3KXFD 3VXRE 2VDML 3O3AB 1IKFH 1DDHA 1NMCB 3F8UB 2QTEA 2VDRL 1YUHB 2AJSH 2BJMH 2ITCB 1TQCB 1N6QL 5BMFL 2IAMC 1BZ7A 4G9DB 3QWQB 4DN3H 4UIKH 1Z5LB 1MFEH 1TZHA 1UXSA 4HUMB 2UWEF 1FC1A 3O6KH 1A5FL 3CX5K 4HXBH 4YFLI 2PO6A 1NBVL 3M07A 4X5LA 5BJTB 4XBEL 3GZKA 3Q5TA 1MI5A 5DEGA 4FTVB 1ZEAH 5I1DB 2VDOL 2NW3B 3WEXA 2J88L 3B9KB 4L8DA 3GSWB 3BZDA 4OLZL 3S5LG 5ENWA 2VN4A 3EO1A 2YWZA 3GMQB 2X4NA 1MCPL 1KG0B 2DQCL 3QT2A 3LN4B 3QG7L 3TWCH 2I25N 3RU8L 3VD4A 5FYKH 5GGUB 2NPLX 5HVGB 4ZUSB 4R97B 2H2SD 3OZ9L 4IIQB 4PPTA 5F7HA 5F96L 5DHYB 2J4WL 2PXYB 4CADB 3OR7A 3ARDB 1KOAA 4MS8C 3KPMA 5DDHB 5F1KC 2ILLA 5HPMB 1U3ZA 4WO4B 2Z93A 3I02B 4V2CB 5GRVL 5EBMB 2ESVA 5IMKB 2Q20A 1U8PA 2DD8H 2BVYA 2EEDA 3AFLA 5FYJL 2GTWA 4Z5RA 4BZ2H 5CBAB 4PY7B 1RZJH 1V5JA 3DMMD 5MERB 4CJ1A 1FG2B 3SDXA 3CCHB 4ZDHB 4L8SA 1T5XA 5BRZA 1RPQA 3GBMH 2P5EA 1XH3B 4J6RL 5GZOD 2WWMD 4DCQA 5L2KE 4ELKA 5ICXB 4U4BA 3O4LB 1DVFD 4L8SB 1EXUB 4PJHF 3CLFL 3OKLB 2HVKA 3QRGH 2N1KA 1KXVC 2I9TA 4ZUTB 2ITDA 4FFYH 1XGRA 3VXMA 3VRLF 4RGMC 2W9EL 4YR6A 4PG9A 4OUOA 4XAKE 5BQ7A 1EJOL 1HEZB 4FQ1H 3ARGC 4WI7A 3K46A 4LGRB 4RISH 3CC5A 2D7TH 4NUGH 1GHFL 3MRLA 4Y1AA 1UVQA 1KIQB 4GG6E 3S35H 2P45B 4GKSB 2P5WE 2VXTH 5CWSB 1T2QL 4KKAC 1QLFA 1DQML 5GSVA 3U7WH 4G43B 3T3MF 3VMPA 4JDVB 4P57A 2P8LB 4KMQA 2OZ4L 4LGPB 1JZ3A 4XCYB 5E00B 2O5ZH 3O2WL 4KKBD 1MLBB 3RVTD 2M26A 5TF1L 5AYUL 1WEJL 5JHDE 1NMAL 2B4CL 4JN1L 5MEOB 4XBPB 4DWHA 4QHMB 4EQ2A 4M8QA 3N0PB 2EIEA 2XTJB 4F2MB 4F2MA 5EU4A 4NQUA 1SM3L 1BWWA 5I1HH 1U58A 2HMIC 2FX9L 3LPWA 1WWBX 4PGCB 1I8IB 3UAJC 1GAFH 1HYSD 4D0BA 1NL0H 2FGWL 5F8QC 5T3ZH 3BH9B 4PJBF 1RJYA 4GG6F 5HY9B 1PZ5A 4HWNA 2F53D 4YNYB 1MAKA 2QR0B 2W65B 5ISZA 4BSWA 5C9KA 3QUKA 2VZOA 3FB6B 3ULUC 5FA3B 2H6PA 3OJ2C 1VFOA 5AWNL 3IDIA 5H94B 1A6UL 5I8EA 3W5MA 1OTUD 2NY7H 4E41E 4KZEL 3BKCL 5I2IA 5IWLA 3BZ4A 4LSPH 3JV5A 2H2SC 4OIBA 1DQDH 4X6EA 2PYEA 2BDNL 5AWNH 3C60B 3P4LA 4BUHA 1QSED 2Z31C 3GMLB 3SDDA 2IQ9H 4BA8A 3ARRA 2GTZA 5CD5C 4MJ6A 3AXLA 3QQNA 9CGTA 4G80A 4UT7L 4XHJC 1T20A 1KCRH 3S36X 2R0LL 3QCTH 1ZT1A 3TCLA 4BZYA 2FJGB 4OLVH 5E8EB 5C3TA 1GH7A 3CSGA 2FATL 2JF1A 2HWZL 3EJYD 3JTTA 1OVZA 3EYFB 3ULVH 1ADQL 4WNQB 4JLRA 3QI9C 5C0GB 5KN5B 4YIQB 2B4CH 4JN1H 3HPLB 3PUCA 4UIMB 4EDWH 4WFGD 4UDUB 4Z7VF 3FOLB 5I76B 4MA7H 1I9JH 5D1XD 5GZND 5EO1A 4G5ZL 4NT6B 1KFAH 2B39A 4YK4C 2EKJA 1HHHB 2Q3AA 5F8RC 4KKCC 1Z2KA 4X4XA 2F74B 4TUOB 4ZXBC 4MX7B 3IFPB 3ARDA 3IDXL 3MRPB 1KIRB 2Y36L 1KIRA 1HHHA 1TXKA 5ESVA 2WP3T 1ZHNA 2CJUL 2DI7A 3QUML 2Q8BL 4D9QD 1FSKB 3AUVA 2OQJA 5DK3A 4OJFH 3MV7E 2VLLB 43C9A 5I1KL 1CU4H 4NPYA 3JWNC 4M4RA 1X4YA 1N7MH 5IEHB 1T7XA 3VH8B 1Q38A 2F9BT 1ZLUH 1XF3A 4LDEB 4U3HA 3SE4A 1YDPA 3FMGH 3WJJA 4LLWB 5IIEB 2HLAA 5CAYB 1MRDL 1UYWH 2DM2A 4ODHL 3MV8B 5LBSL 5CGTA 2WSKA 3DV6A 2FJFA 2ESVD 4HC1L 3BVNA 1F97A 5F3HB 1Q9KB 5FV2A 1TNNA 2NY1B 4U1HA 4PJFE 2VDLH 5IJKA 4FQXB 1JN6A 4NRZB 1GGCL 3OR6A 1TJIH 2IADA 1FE8H 4XNXH 2CRIA 3QXVA 4XXDB 3UAJD 5D6CB 4JY4A 3QBTB 1HYSC 2VDQH 1FLRH 1E6OH 3BEWB 1XCQB 4TUJB 2WLYA 1ZMYA 4MD5B 1Z9SA 3HE7A 3I2CL 1BBDL 3L3KA 4AQ1B 2F53B 3ZO0A 3OAZH 5GJTH 2XZCL 1WK0A 5DD0L 4YBQC 3C08H 4HAFA 4ACPA 2MKLC 4X0KA 5LWYH 4GMSH 2DI8A 3VXUD 4OLWL 5ADPH 4NZUL 1KEML 1ZHBA 4LRIA 5IROC 1JI1A 4UTBH 1HILB 1IQDB 2WP3O 1K4DA 1KLUB 2NY6D 4W6XB 5DJXB 4EVNA 1SMAA 4Y5YC 4QXUH 1E4XH 3V52L 1L7TH 5I1AA 5T1LA 1MCOL 4LKXA 4XVJH 4NKDB 2F8VA 1P84K 3DURB 3GMRA 3SE4C 3WV0A 4H0IA 2HA1A 2MQCA 3ARBA 3GSNA 3W11C 5I1LA 3RWHA 3RIAF 4HXBL 4I5BB 5DEGB 1LEGB 3V52H 3MRFA 4HMEA 3PF2A 1KCUL 2A83B 4JFPB 3UYPA 3ARFA 4H88L 5FDWA 3O2DL 5F72S 4KMLB 1M6OB 1QSVA 4YHMH 3RGVA 4LAQH 1HHJB 4Q6IA 1UB5A 1C08B 1WAAA 2AEWA 4E5XA 1KC5L 4O2EB 1FORL 3IF1A 1WWWX 4YK4B 4MD4B 3CNKA 1VADB 5DD3H 3CZFB 1T7YA 2HN7B 4JVPA 1NAMA 3MNZB 1CXHA 4Q2ZB 3FN3A 4YHIA 2JCCA 3T4AB 3TBSB 4DZ8B 4C59B 4JZJA 4I13B 1HQRA 4CVZB 2HVJA 1UB6B 3VD9A 3MJ9H 2HN7A 2DWEA 4QTHA 3NAAH 1ZVSB 4Y4KA 4DZBA 5DRNB 2CLVB 2FEEI 1V7MH 4Z8FL 1WC7A 4PJ5E 1WV7T 4IEFB 4KTYA 5FGBC 3U0TB 1ACYL 4YDJA 4PJ5D 5DUML 2G5BA 1EXUA 2J5LC 1E4XL 3BP5A 3T0DA 5J7CC 5ICYA 2WM0A 1JZ8A 3AM8A 3D18B 1WC7B 2QSCH 4NN5B 5D2NC 3UTQB 3GGWB 4JKWA 4WJ5A 4JFZL 2EDTA 1RZGB 2FJHB 3DUSA 1GZPA 5EOCL 5C7XH 5IW6B 4OJFL 2VQ1A 4H1LH 4M03A 3ARDC 4O4YL 4Z7UA 1ORQA 4S0TD 2BRRH 1QBAA 4WHCA 4TYUA 4PJHA 1FLRL 1ZSDB 3JUZA 3ZKXC 1TJGH 3B8YA 3GMQA 1MJJB 3H9YA 3IF1B 3LCYA 3V7AG 1ZANL 2QQKH 3MBEA 1FZJB 3ELAT 3HC3L 3TJHC 3PL6B 4Y1AD 3RIAK 4OFDA 2CKBH 4APQD 1KFAL 2P8PB 3V8OA 1V3JA 5JOFA 2OQJB 4KC3B 2WZPD 3PQYA 2BY0A 2FSEA 2EZ0C 3FO2A 3TN0B 5FA4B 3MV8E 3HPJB 5HPOA 2DJUA 5JHLL 5DJCA 1BOGB 5TDOA 4ENED 3KXFE 1T22B 4GRWH 4DFHA 3S35X 4KHXL 2XNAB 4UV4L 5F71A 5CZVL 2VERN 4OGYH 1BVZA 1NANI 5FYKD 1HIMH 1NCDH 4L3EE 4OCRH 4ZSOE 1NMCC 4JFFE 3TVMA 4PP2B 2R2EA 5HD8C 5E70A 3WE6B 1IAIH 5DT1L 3TA3D 2GITA 1B90A 3MBED 1T66D 4FRWA 3MX0A 3MLXH 1QHPA 3BDYL 4LLYB 5MENE 1XCTA 4U1KA 1EK3A 4KQ3H 4C56E 4F9PC 2PW1A 4TOYL 1JIBA 5T1MB 1SEQH 3B3IA 2I60L 5EU6B 1IZKA 3ARGB 4JANA 2FLBT 3JWDH 4YX2L 4DN4L 2YD8A 4MJ5B 3ZE0E 4OZIF 1UEMA 5ECJE 2OR8A 2VITA 7CGTA 4XNYH 3IDUA 2H32A 3MLTA 2HKFL 4PJXB 2ADIB 1ZGLP 3IFOA 4EXKA 3K80A 4TSBL 4P2QE 3GMNA 1F8TH 3CDGA 3ZL4L 5JPMB 2V7NA 5DZNA 3X3FL 1PX4A 3LSOB 2RB8A 1DSFH 4GAYB 4M62H 1I7TB 3QAZC 2DTMH 3PWNB 3NA9H 1VGEH 1BZQK 3KPSD 1A4JA 4NO0A 3RTQB 4YAQA 1CG9A 3IFLL 2EXWD 3MRFB 4NKDA 3RKDD 2BSRB 2JJSA 1X44A 4P0DA 3WNMA 3GO1H 4EJ1C 4WO4C 4EEEA 3KPRD 4L8CA 3L1OL 1X6NA 5I18L 4Z7WA 2ZUTA 2DLHA 1TVHB 4GQ9H 1XIWD 1FN4A 2GAZB 4WY7H 2G9HB 3RWJA 3DTXA 4OF7A 4HG4K 1JGLL 2D9CA 3HZMA 5F70A 1E6JH 3KNBB 3ARPA 4WWKB 4KQ4H 4M61A 1ZLSL 1A0QL 3QUYB 4OCSL 3AY4C 3VXRD 2GQHA 4KJPC 4LLUB 1S7RA 2NY7L 1OD9A 3U0PB 5FCUH 5FUCC 8CGTA 5CJOL 4LMQE 4YGVA 1ND0A 1Q9OA 2AQ3A 1HHKB 4GO6B 3QEUA 3O3BA 2YPLB 1U8PB 4NRYB 1IGTB 5ILTH 1PY4A 4TUOA 4JFYB 3V4PH 1EUTA 1WCQA 3EFDL 3VXQA 3MO1A 2L0DA 1FV1B 4QOKA 3FONB 2PO6C 3VFWA 3VWKB 4N5ED 4NC2B 3H3BC 2YUVA 3ZSSA 3LY6A 5E08H 1LO2H 3BIKA 1TQCC 3OGOE 2X4TB 2BOBA 4I18B 4YZFE 1QRND 3MR9A 3HC0A 3ROLA 2Z4QA 4G3YL 3P4NA 3VXOB 6FABL 4ZFFA 4K7PH 4UB0L 3RWIA 4HK3J 2Q7NA 1P5UA 1K8DB 4HIIA 4HJ0C 1A3LL 2VQUA 3MA9L 3T09A 4FTVA 4CBPA 3BN3B 1FBIL 3SDDD 1YEDB 1S78D 4KGLA 3B2VL 2WV3A 4PB0H 2ICEB 5FIEA 4NJ9L 3RBGA 1FFOA 1SHMA 4NKOA 2HJLA 4A2LA 1U8MA 4Z7WB 2MQ3A 3LKSB 4R8WL 3QB7C 1RZKC 1XF2A 2W0FA 3S37X 3TNMA 5L8LB 4GXUM 4U6VL 1Q9WA 5FKAA 1NCAL 2LTQB 2OJEA 5LG1A 4EUPA 5CEXB 3PDGA 1WTLA 4J4PC 4GAYA 4XZUB 2E7CA 4Y5VC 2ERJC 3WNPA 2CDFB 2EH7L 1K8IB 4YHLH 5FM5M 3ZT6A 1ZT4B 3PQYE 2IWGA 3I6LD 5EFIB 3NA4A 3CLFH 3IETA 3A0OA 4FN0A 4IRSA 1ZEAL 2AJXH 5I66A 5KVMC 1YJDH 4XBEH 2ZJSH 1FNGB 5KVFH 4I48B 3VGFA 1ITCA 2BY3A 3RNQA 4RSVA 1AI1H 1T5WB 3CFEB 3C8DA 3VXOA 3RA7L 1S3KH 2VH5H 5GRVK 4AY0A 2FX8H 1T3FB 6FABH 2HT2D 3QHZH 2WUCH 5IK3A 3GJEA 3OKLA 1F90L 4BH8A 3VJ6B 4I3SL 4ZO7A 4TNVK 5B8CC 2DQGH 4LHUD 2D3VA 2VL4A 3QIWD 5F93C 5D6DA 5JW5A 5TE4H 1MHCB 2ARJQ 3ARFD 4GKSA 3SKUD 2X7LA 4P2OC 3BAEH 2DQCH 4FQLL 1CQKA 5DEFA 3MRLB 2IMNA 4R4FL 4PRBA 1FCCA 2E27H 5DRWB 4F7TB 1T80A 43CAA 3WCYA 3IGAB 5I16A 3WBDA 5FECA 3U1SH 1JF6A 1A7RH 1U95A 1A0QH 4OCSH 4RMTA 1AGFB 5GSRA 2IANE 3GHBL 3W39A 1NAML 4YQXH 2ENYA 4J8RA 4F7MB 1YEEH 3NIDE 3KPLA 1UKQA 5B3JE 3D87B 5BMFH 3ZTJH 1BF2A 4F7CA 1OP3H 1G7HA 1A4KB 1BPVA 1BZ9B 5GHWL 1CLCA 1MREL 2D7QA 3W9DB 5DS8A 3IJHB 4B0MM 2CIKB 5ITFA 5KANG 1UM4L 3EDEA 4DJMA 4XRCB 2MSPA 1QR4A 4XBPA 3NABL 3QDJB 2P44B 1D5XB 2G2RA 4JO3H 4TTDD 3UXFA 2VUOA 5T3XL 2ICWB 3MV9E 1U3HB 1WF5A 5BRZD 3FQTB 5SX4I 1F3JA 3MRQB 1CICC 3U30B 3HMWL 2PN5A 3W9EB 1IRAY 1FNLA 4PJDB 5HHQB 3TLRA 3BO8B 4JRXA 1JI2A 2G2RB 3JWDC 2YD6A 2GJ6A 4LPYA 1B4RA 4X6EB 3K74B 3D69A 4GXVH 1GGIL 5GGVH 3FT3A 4PJHB 5JW3L 1I75A 2CMRH 1N4XL 3O8XC 5CJQH 1IZJA 1JGLH 2AJ3A 2SEBA 3TT3L 4B53A 4KTDH 4R96B 1PG7H 2FECI 3VE0B 3N1GC 4GFTB 3TYGL 3FTGA 4CW1B 4QRUA 1QRNB 4MQTB 1NFIA 5DJ6A 1OARL 4ELKB 1XF4B 5SWZA 2RJMA 3KYOA 1EGJA 5TPWH 2CGRH 4KKLD 2QSVA 1FO0A 2B4CC 2FEDD 1B88A 2XKUA 3IAQA 3KXFA 4C4KO 3HFML 4ODTH 5ISZE 3NCYP 3IXAB 3FO9B 5DVMA 4IOIA 3SHSA 2OXGA 4IOFC 4X9BA 3F65A 3OKMB 4P2QD 4TRPH 2DLFL 2E7LC 3NIGE 4JO4H 3RL1A 5IQ9B 5MEPB 4G7YH 1DE4A 1QPXA 2WBWB 3UTZA 1FJ1B 3V6FB 3F7VA 3ZDZE 4HCRH 2BVUA 5T1DH 3FQNA 1AH1A 2JJTC 5CIPA 1CQYA 5CP3H 3UPRB 3DI2B 4IDLA 1U42A 4Q6IC 5EU6E 4CVXB 2EYTB 4JREB 1YN6A 1OTTD 1SY6A 2I5YH 1NGZA 3SDXF 5C70A 1KG0A 3UC0H 3VG9C 4MS8D 1BLNA 5E99L 1ORQB 3ARFC 4PLKD 3PHQB 3PHQA 3AS0A 4R6UA 5B8CB 3DBXB 4EIGB 2RCSL 3FCTA 2X4QA 4KPHL 2FL5B 4ODUB 1P7HL 1UWGH 2FDBP 3RY6A 3OKKB 1MJ8H 1URLA 5I8CA 1D3CA 2A73B 2X4RA 1EIBA 1UXSB 2BVPB 3EYSL 3O6ML 4I77H 4MAYD 3NBNA 2XZAL 3WFZA 1P1ZA 2DIAA 3T0EB 2J8UB 4PJCB 3P30H 1DEEB 3WFBH 3N85L 3OX8A 5F7KC 3LVEA 1WBXB 3BKYH 5KVGL 1YPZB 3IDNA 4WHTA 4ZFOL 1G6RB 3ZDZF 1ACYH 4R90L 4PJEE 5DK0B 5C9JB 3WS3B 1HSAA 1IGCH 1GYAA 1DEEA 2R0KH 2R23B 1CD8A 2DN7A 4JJHA 5ERWB 3QR2A 5HHOD 4AMKH 3LMJL 5DJAB 1MFAH 4OLUL 4UILH 5CEYB 3HNSH 1OP5H 4RFEB 3HE7C 5L0QB 2BSSA 4JB9L 3K3QA 1G7JB 4XXCC 4MB4A 5EA0L 3VGHA 5CLTA 1Z6JT 3DVGA 2BMKA 3RJQB 4CADA 3TYFB 2UVEA 2X70B 4JO4L 5TE6L 1CDGA 1I1YA 3LIZH 4CKVX 3VCLB 2V17H 2CXKA 2XZQL 3TBWA 1EBAA 1D5IH 5DRZA 5DYOB 2C4XA 4FQJH 5T3XH 4DVBB 2ADGB 2Y7QA 4GG6A 4QXGL 4CMHC 4L1DA 5E6IA 4LSUL 2HRPH 3NCCB 4KKBC 1JPGB 3QO1B 5HHMB 1INDL 4JFHD 2I26N 3TYGH 5E94B 3GMPB 4PJDF 1ZKAA 1ZLWK 4K3HA 4JO1H 1FYTE 1FH5H 4XMLL 3QEGH 4PBWD 2UYLB 5I9QC 1TTUA 4LCIH 5ICYB 3QEQD 1U3HA 3UJTH 4I18C 1YNKL 1T1ZA 3U46A 3V8CA 1NPUA 1YUHA 3ARTA 3S4SB 3DGGA 5HYJA 4OM1L 5E03A 4Z77A 1KXQE 4GXVL 4NNXB 3BOVA 3WDJA 1U8JB 5DK0A 1MFCH 1EAPA 4P46A 1X5XA 4Z7NE 1L4IA 1TMCB 2MNUA 4NGHH 4ELMF 5HYJE 1TVHA 4L4VA 2KPNA 4Z77B 2GUOB 3OGCB 1VFAA 4ZFOB 1NC2A 4DKEH 1S7QB 1UM5H 4JR9L 1BEYH 3QNXA 5HHNA 2BSED 4YHIB 3LQMA 2DQUL 3OHXA 4KROD 3KJ4B 2YD1A 5FA4A 1BBDH 5I8CB 2AK1L 1BBJB 5C2BH 3D69B 1E4XI 3TO4C 1J10A 2WNGA 1AHWB 4XMPL 2DQJL 2P5WB 4X8JA 2F54B 4JY6B 3RUGB 2OBGA 5CD5D 1FE8L 4X9FA 4IIQA 4K94C 3PNWB 4H25A 1IGJA 3NVQA 1JPSH 5JA8B 4X9HA 1YEEL 3D2UA 4GQPH 1UG9A 2VISA 4HIXH 3ROOA 3QJHB 1U8IB 3WDHA 4FQCH 2DBLH 4X5XA 1DL7H 2IH1B 3G5ZA 4HH9B 5D2LF 5T5NG 3JUYA 3EDDA 4I2XA 5GJSL 3ZMRA 1TVBA 1CR9H 4F57L 2A77H 5IEKA 2I9TB 4CMMA 3DO7B 2PW1B 2FJFB 5C6WH 1N6VA 3CX2A 4UTBL 3GSRB 3SKJL 4WEBH 5KSBE 4KJQC 4NFBA 2YPVH 5EWIH 3IJSB 4OLYL 3EO0A 1NDMA 2C1OB 3LV3A 3N1PC 4S1SL 2J2ZA 4Y4HD 1Z0MA 2DWDB 4K3EH 3FAXA 5C0AA 1SBBA 1U8LB 3MZTA 5TQ2L 4NQED 2GYSA 2EDOA 2YBRA 3EOAA 2W9DH 3I2CH 2AQ2A 4PGEA 1LILA 4MHHG 3ZE2E 5I8EB 1R3HB 1BQHB 2F53A 3U9PH 5MHSE 2YHGA 2Q7YA 2VIRA 2J6EA 4G6FD 4NCC2 5GIRB 3DETC 3X12B 2ESVE 4NN6C 3PV7A 1JUFB 3RZCB 1EO8H 4JCLA 1K85A 5EUOE 3I3DA 5CEZH 1MCRA 1MFNA 2EE6A 2NY6B 5EZJB 5C07A 1IFHH 4K8RD 1J0KA 1IQWH 1MCWW 1P69B 3STBA 4LLAA 4QCIB 4P5MA 2CD0A 5HI3D 3SQOH 2AQ1A 2GT9B 1J0IA 1EEYB 4EN3D 3D2UD 4J1UB 3GIZL 3O2DA 1YEIL 5E08L 1A14L 4HH9A 1CGTA 4DUXA 4WFFD 3KPOB 4JHWL 5DJAA 1BFTA 1CLOL 2MHAA 1TVBB 2YD2A 4JKPH 4KHTL 4UT7H 5HHVH 1CBVL 4XVUC 2ICWA 2BXYA 3MRIB 4YXHH 2BZDA 1LNUA 4PJAB 5C0CA 5AD0B 1B0WA 4PLJC 3KLDA 1BX2A 5I6XB 1I7RB 5D1QA 4PRID 4KGJA 3BP4A 2NY2D 3WIFB 5C0EB 2BDNH 2R4SH 2GW5A 5DZLA 5B38G 5KW9L 1YZZA 2PR4H 3V5HA 1P7KB 1BVKA 2E8YA 3BJLA 4DTGL 3PNWA 3QQ4B 3V0WL 3FB6A 1BIIA 4KK8C 2P46B 1YMMB 4JVWA 5IW1B 3FKUS 3G6JA 4OF8A 4AH2A 2HFFB 4WWKD 5I18H 3KYKL 1KIPB 5E9DD 1Y18B 4P23A 5GGSA 1DLFL 3GNML 4WFED 4NQDD 4AT6A 3RWGA 3S8WA 3HI5H 4L8CB 2K3TA 2XN9E 1A6AB 1T89A 1HI6B 5FB8B 4FNLL 3GSUB 3GM8A 1A7OH 5C0GA 5J1AA 4WU5A 4JFEA 1IE5A 1YEDA 2DKMA 3SKOB 2ZPKL 4L8DB 3L3GA 3KYMB 5B38A 5IW6A 3P9LB 2BRQA 4ONOA 1JGVH 1SBSH 5CZXD 4WJ5B 5FAAA 4UI2A 1DUZA 1JK8A 4O9HH 2YD5A 3MV9A 3UEZA 4E41D 3TJEH 4R7DB 1DQDL 1BIHA 1OGTA 1T6VN 2AJUL 3U7WL 1VGKB 4Y4FD 1H9VA 3SGJC 2L4OA 4M02A 2PXYA 4HIHA 1CGUA 5A3ID 3GMOA 1AFVL 2OI9B 5C0CD 4DKAA 4K7PX 5D1XB 1UACH 5FGSA 3VD3A 4HUUA 1CN4A 2VO5A 3RX5A 3NFNB 3RHWF 1J18A 3RFZC 2K1MA 4V1DA 1KLUA 4EVNB 1ONQB 4GKZA 2VXSL 1FL6B 2UZYB 2R1XA 1EV2E 1N0XH 1OP5K 4OT1H 1RMFL 3D0LA 1MCCA 3QHTC 1J88A 3EYOA 5CZKA 5HYQB 3IS1X 5D7IA 2A9ML 4ODWB 3HZYB 4P23B 4U6HA 3QEQE 4Z6AT 5J11C 5I19L 3NIFE 5KZCB 4PB9H 3S37H 1KCVL 4P2RD 4GW5A 3HN3A 5MI0C 1KCLA 3OKNB 3K4AA 3VXUA 2ITDB 4HH8A 2H26A 3H8NA 5TF1H 4W4NA 2CXGA 5JW5B 3JWOC 3BGFB 4M7KL 3WIFA 4MNGB 5JHDA 4RFNB 3V0WH 4JQIL 5I1CL 2NY2B 3PWVB 3GSRA 3C5ZC 4QHLA 2NY4C 4Y5XA 4JZNB 4YBHA 1H3VA 1BM3H 3GSXA 4XCEB 4YE4H 4XI5C 4XXCA 2W60A 3QYCA 4NBXB 1JGUH 1KCSL 3PWUB 3ZKNC 1ZGLM 5I0DA 3P4OA 2XWTB 1ZTXL 4RWYH 3VFMB 1UKSA 2ZUYA 1KENH 2B1AL 3QDMD 2HRLA 2E7HA 3MJ7B 5D71L 4ZUWB 1U95B 3G6DH 3CVHA 4UV4H 5CZVH 2P1YA 3PWJA 1XGYH 3VFMA 4AEHH 5DI8A 3WJJC 1YEJL 2C4FT 1A9EA 1BQUA 3OBAA 5DD6B 3Q1SL 4NFCA 4PJAF 1N64H 5C0DB 1QBBA 1X5HA 2ATPB 2X89D 5HVHC 2V9RA 4EUPG 5ACLA 4XRCA 1A7NH 2ED7A 4GSDL 5DQJB 2PTTB 1YECH 4M9OA 4J3VA 5TH2B 1K3ZA 5TH2A 5DQ9B 2VMFA 4H26B 5B21A 1IKNA 5AD0A 3WS6A 4XVTL 2EDNA 4YHZH 2EYRB 3O3DB 1S5HB 4QTIH 5E2UH 12E8H 1F11A 1HHGA 1L6ZA 5A16A 1SYSA 3ES6A 4IJ3B 1RZIB 2IGFL 1FRGL 4U7KA 1R3LB 4EOWL 1HH9B 3TA3A 4D0CA 4HWBL 5B4MC 4IMLB 4QT5B 4LFHG 3QUMB 1V3MA 4D3CL 4W68A 5C09A 3T4AA 4DZ8A 3MV7B 5J56B 3MC0A 3QI9A 5KS9E 2XKSA 1JCKA 5L2KD 4PJBB 4N0YL 4Z7WF 4ENEC 2L7UA 1KV3A 3BEVA 3VDAA 4OV5B 3AAZB 3QI9B 2VZUA 1J8HB 1VKXB 2X1OA 1FG9C 1S9XA 3Q3GA 1E28A 4OZ4A 2BNUB 4Q0XL 3KPPA 3MNWB 1WBYB 2AEPH 1OQXA 1T03L 2H9GB 2Z31A 3SO3B 3D18A 1CXIA 1S9VA 5DS8B 5CCKH 1FO0H 1MCBA 2HRPL 3L5XL 2ZZUT 1YQ2A 4OCYL 4K3JL 3FHAA 3C60C 3BPOB 4BSVA 5MENB 5MENA 2ADJB 3H0TB 1EHNA 1FN4B 4TNWK 12E8L 4JQVA 2Y4SA 1ES0B 2KZWA 4BJLA 2VABA 4XVTH 4H1LB 4YPGB 1ZT7A 3MOBL 3NZHH 5E7FA 4GJTB 1MFCL 1OD7A 2YS4A 4IHOA 4Z7VE 2P8LA 4A6YH 1L9NA 4YO0A 4KY1L 5IBTL 1NUNB 3MZGB 2A0LD 2N56A 2DDQH 1OAUL 3B83A 1VACA 5DJ0B 2X89A 4OKVB 1IAII 2VR4A 2NY6C 3B4NA 2V7NB 3INUH 4IBLT 1CLZH 3QNYA 3MXVL 3BP7B 2XFXA 3ULSB 4NN6B 3LQAC 4YHYC 3NGBB 2XZAH 1KN2H 1NANH 2CLRB 3O6MH 4MMXC 3SKNB 2UUDH 3U6RB 1YEKH 2DL9A 1KENL 2B1AH 2IQAA 4PJ7F 1GPOH 3NTCH 2FO4A 1JFQL 1WZLA 1BJ1H 2BFVH 5A1AA 1ZTXH 4PRHD 3G6JF 5AZEH 1XF1A 1ED3A 2RCSH 4OI9A 3X14A 2FZ3A 2BNQD 4QTIL 5E2UL 2E9BA 1RUKL 3FO1A 5I71B 1A6ZB 4NQCD 2YZ1A 3ZYJA 3NPZB 1I9RL 2C3XA 1TJIL 4JQVC 4XH2A 3IJYB 1OB1A 2LU4A 4ZOBA 5CEZD 1HXMA 4Z18A 1UFUA 1UCBL 4Y4FB 2DLIA 3A67L 4MNGE 3O9WA 2HFFA 5DRNA 3OWEA 1PGRB 2YPLE 4RA0C 5FKAB 4QKXB 3GMPA 4XCNA 4YBLC 4PREA 1J9CT 2FHFA 2UY7A 4PREB 4KK6C 4MAYB 3P9MB 2QQQA 1BQHA 1G9NL 2XTLA 1X5JA 5IV2B 4NO3B 5IMOA 1NCBL 4PJ7E 4GOSA 2IALA 3KLHD 4L8SC 5FKPA 3QFJE 1AGEB 4QNPE 3SJVB 3G6JE 4TVPL 4PV8B 4ZTPH 5AAMA 3FRUB 4NRXB 5FO7B 2XWBA 2EDBA 2X4SA 5JMOC 3E2HC 3K4DA 4JZOA 3SCMD 4I9WD 5TQ0L 2VOTA 2CUHA 1T7WA 2R29H 1QBMH 5C86A 3DHJA 5E9DB 4YIQA 5DRXA 4OCXL 2XYCA 4Y16C 3VFPA 4E0RB 1YC8A 1NUDA 2KH2B 3DSFH 4JHZA 1SYSB 4JPVL 1EEYA 1KUMA 5E56A 3S3SA 1GOHA 4S1QH 2AVGA 3B5GA 4HAGA 2QL1A 5CJXA 4LLMB 1A1NA 2WUBH 5F3BA 4IS6A 4FXLA 3QIBC 4R2GC 2QQNH 3CXHK 4K23L 4PG2C 4PJ8A 5C0JA 5EC1B 1UWXH 4CN6A 4BYHA 1I9JL 4EDXA 1K8IA 3DIFB 4YXLL 2GK2A 2CSPA 3QFJD 1U8HA 3SGKA 4P46C 2RHEA 2R1YB 2SEBB 2V2XA 4U31A 2ZWLT 3WLBA 5E8NA 5DHVB 3T0VA 3TBSA 4QRQA 2A9MH 4XNQA 5EUOB 1DQTA 1JF1B 4HWEH 1JF1A 5DDHA 1CFQA 5IHBA 1NGQH 4EI6B 5H2BB 4MA1C 5HTSA 4EN3B 1TCMA 5JZ7D 4XWGH 1OARH 2LFGA 1C5BH 1UJ3A 2VLJE 4NKMB 1FZOB 4LBEB 4X99B 4I0PD 3DGGB 2ZUUA 5FHBL 1LHZA 4D0BB 3SBWA 2IAMD 1QFWL 1H3XA 4PJ8D 4ZG1A 1NAMH 3BKML 5I73C 1IMHC 5E5UB 5M95B 4FHBD 3QIWC 3DX7B 4KZEH 3S4SA 5F3HA 3N1FC 2HG5B 3T2PA 4LAJH 1J0ZA 4LFHD 3I6GB 4M1CD 4WV1C 3K2MC 3FRPG 3E1F1 4M48H 1CFSB 3H7BB 3O2VL 4HKXB 3VFVB 3GMNB 4PRIE 3D85B 4JG0H 4RGOL 3CH8A 5HHVL 2HG5A 4N0FA 1M71A 4JPKL 1YEFH 3PL6A 1RIUL 5C09E 1KLFA 1TITA 1LQSR 4XPBL 3OJDA 3U82B 2BNQB 3T3PF 1RJCA 2ZSWA 1AD9B 4JVUA 4J3OC 5CINH 4JM2A 2VE6A 1TTGA 3LD8B 3LDBC 1IC4H 2O5YH 5LCVH 2LVEA 4WFHE 4QHNB 4L3EB 3OAUH 3QDMA 4YHPB 5HGHB 4YHPA 2A6DB 1RUMH 2BC4A 4W6YB 3RA7H 4OCMC 5IBLC 4NSKB 4M7LH 3QIUB 1DVFB 1WIPA 4OAWA 1KN4H 4LGSB 1N3NA 3D6GA 5F1IA 4BFGA 3GHBH 2OL3B 3MGOA 4QRPB 2DOCA 4FQPA 4OZIA 1REIA 5E6ID 4MHHI 5L6YH 1C5CL 1UWEH 3U7YH 2EYRA 4LLMA 4LU5L 1AIFB 1AIFA 3VJ6A 1LO5A 2XOTA 4OZHB 4B7IA 4ZFZA 4LSTL 5DQ9A 4QRPA 2A83A 5L7XH 1DN0A 4ZFGL 2VDKL 2Z91B 2R2CA 2D7TL 2Q8AH 1D5ZA 1U3HD 2J6EL 5J12B 3LKQA 5DUBA 5EZOL 2FH6A 2FCBA 4QRRD 1JNLL 1A9BB 5CJ8A 4HKBA 3W0WD 3CVIH 4MA3B 1O5DT 3VFRB 4DVBA 4PRNB 2A77L 4ISVB 5AG9A 2P8MA 2AP2A 1S5IL 3MLTB 3FT3B 2EYTA 3VCLA 5IVXE 4JFED 1XF3B 1S3KL 4NJ9H 3CPLB 3E6HA 4NWUH 2VQTA 3GBML 2KUTA 1JF5A 3WFHB 5IR1A 1HWGB 4JFOA 4OD3H 4U1LB 4F3FA 1R6VA 1BHGA 1G7LB 3PE9A 1FC2D 4NDMB 5JDJA 3OAUL 2JE8A 1L7IL 3P11H 5IMMA 4LLVB 3QPXH 5I1DA 3BWAB 1MVUB 1T1XA 1PG7X 1EEZA 3V4VH 3KXFB 3SE9L 1HKLH 3QISA 5F96H 1F13A 3Q6GH 5CSGA 1Q9WB 3ALPA 1LP9E 4FG6D 4JM4L 4LARL 4IDJH 1I7RA 1MLCB 4U1SB 4S2SA 3F5WB 3HUJB 1IGIH 4P4KD 3LRSA 1U93A 2G75A 2I07B 1OM3L 4RX4D 4LSTH 1R3KB 2CKBA 4N1EA 1CICB 3U30C 5GS0H 5IVXF 4WHYG 3DOSA 1A7PL 3PGCB 3RIFK 4QRPD 3WL9B 3S88L 1T0MB 5GJSH 4FFZL 5TF0A 4X98B 2AK4D 3CXDL 5KS9A 5DMJB 2G60L 4ZAKC 4RDQF 3V5KA 2WIIA 5HHOE 4X7SL 1RI8A 3A6BH 1BIIB 1WICA 2VLRE 1GSMA 2PW2B 4MNQE 1U8HB 1WZ1H 1NAMB 1FV1A 3HG1A 4L3ED 1JPSL 4O02H 1H3PL 5B39B 3WXVH 2VAJA 4G8GB 2Z31D 3GUTB 4NM4L 4ESKA 2PNDA 4K7PL 5DYOA 3QH3A 4G6MH 4ONFL 4HD9A 1CZ8H 4MSWB 3D39D 1G7IA 2DQHH 2DYPA 1C5DB 3BQUD 4HK0A 4L4TD 1HZHH 1QVOA 4LCCC 3OXRA 3OKMA 4PRDA 4U1KB 1OP3K 5JIPA 1P6FA 1DANT 5IESH 3IU4H 2F5BH 3HAEH 1NBZB 5TGBB 1S9YB 2HKHL 4XVSL 3DX8B 5IVZB 5L8JB 1SY6H 2NYYC 4PRHA 3RVUC 3G08B 5I1GH 1T2JA 4ZYKA 5DJYA 5DFVC 4H1LG 2WINA 4DGVL 4UOJA 2KQMA 3L7EB 4XP1H 2Q1EA 5D70H 5F7DA 4HFUL 2JIXD 3DUUB 4ZXBD 5ESVB 4W70A 4H20L 3E6FB 2YD9A 1VPOL 4LQFL 5GRXG 5IFJA 4X7FC 5SWSA 3T2QA 4DQOH 1O7SA 4OCWL 3KPMB 3LS4L 1J05A 2P5WA 4X8JB 4FQJL 3FB7B 4C56B 4KI5E 3WO4C 4Y5YA 4ODSL 5T1KD 3KPOA 3OJVC 2GY5A 1RIVL 1U91A 4R7NA 2ZCKH 3SO5A 2ERJB 4R9HA 5LXGH 4AL8H 4KMTL 1IAKB 5I8KL 5ACMA 3MRIA 2V5RA 4Z7QF 5KANI 1M7XA 1RV6X 1TZGH 4LLQB 2ZUQB 1HINL 5INCB 3VI4E 2DB8A 1H15B 1G1YA 1AJ7L 3O3DA 1UCBH 2B8OT 3VXUE 3IAGC 3U6RA 4BK5A 4ZPVB 1FVDB 1U8JA 3ETBF 4WRLA 4WI4A 5I30L 1DBJL 3VFOB 1YEHH 3VI3E 5ICZA 1U3JA 5CMAA 5TGBA 4QRPE 2D4FA 4PUBL 1S7UA 4KMTH 1UQSB 2A9NH 1KYOK 3ZKSD 1SJVA 2BNRB 2WBJA 1CFVL 5E2VH 3BKYL 1GC1L 3CJJA 2R69H 5E2WH 4YDIL 2X1PA 4E41B 2FSEB 5JXAH 1CIDA 4NQEE 3QIWA 3J8F7 4I4WA 4ZDHA 5IP4A 1Q94B 4TVPH 3QUXB 4Y4FA 3EGSB 4B50A 4ZUWA 5TFSH 2QSCL 5GSVB 4OGYL 2EICA 2AW2A 1HH6B 3I3EA 1EHXA 3L3IB 1XIWA 2CK2A 3TT3H 1KSRA 3KG5A 1QNZH 4UDUA 4HQQL 5D9SB 4EN3C 5E0QA 1BJ1J 1RD6A 1XFPA 2BVQB 2YD3A 1I1AB 3SDAD 1I85C 3ARGD 4M1GH 2KQNA 4UBDC 2LVCA 4J2XA 1I9IL 4HIEB 4O5LH 5KJRH 4JRXB 5J3HC 2BOCA 1ZWIA 3EO1B 3QG6B 4R4BA 4XWOD 4JFPA 1XGRB 5J12C 3VXMB 1R3KA 2CKBB 3U79A 3FQTA 1T0NB 4IOFD 1NCUA 2JIXA 1OHQA 4ZXBA 5DJDA 3W0WE 4NO5A 1EO5A 2NY0D 3HUJA 3O6FD 5T5NF 4U1MB 5GRJH 1DQJA 4ORGA 4CDGC 4R2GB 3QIBB 1FORH 4LEXH 5CJXC 5GISH 5DO2C 4LHUB 1BBJA 3WSQH 3X12A 4W4OC 3MCLL 1MWAA 1H3GA 4Z5RB 4Y16B 2IMMA 1T04B 4OIAA 3U4BL 3T2NH 3WIIL 4H8WL 3IRPX 1T21A 3QCUH 3ZT5A 4AH2B 5FGRA 4JGJA 1OAUH 4QRQB 3O45B 1LD9A 2RIKA 3LDBB 3GJFA 4XP1L 3EYUL 5ERWA 4N90D 4NN7B 1PEZA 4N8VB 3ZKMD 1NAKL 5D7SL 2CR3A 3BH9A 5MEOA 5IB2B 2R2EB 3HCVB 2IADB 5DF0A 4CAGA 3DX8A 4RCAA 5IVZA 3MLUH 4ZNEE 1A6VL 1OT1A 2XZZA 3JXAA 3AMLA 4NZTL 1BD2A 4YDLC 2GJ6E 4U3CA 3GEWB 4N0UA 3RL2A 4XWOC 3RAJH 1FRGH 2DQHL 3F58H 3OTTA 1CZ8L 2V9TA 1WAAE 5DMKA 4D2NA 4LSQH 3QXWA 5D5ME 4YPJA 1DDHB 2JELH 3BIAX 4XPAH 5FUOL 4Z7OF 3W39B 5SWSE 3FT2B 1FDLH 7FABL 1WZ1L 5KVEL 3T65A 1KEGL 3OF6A 1YPZE 1J0HA 4OB5L 4WFFE 3FN0L 3M45A 5BV7C 2ADIA 4FZEH 4PRPB 3UJIL 4WGWB 4UT6L 3RI5F 2NCMA 4X6DF 1N64L 5D7LA 5DVKA 2E6JA 4K9EH 4KVNH 4LKCB 4Y4KD 1U8OA 1T21B 4O2FA 4PRPA 2YMXH 4M61B 3RKPA 3WS3A 4P46B 1XF5B 4I8DA 4PGCA 1X5GA 2JCCE 2DQEH 4G42B 1IGIL 4GMSL 3VFTA 3MYJA 4IS6B 2VDPH 4M8QB 3ZKXB 1N26A 4C83B 5E2TL 3C2AH 3S6CA 1BWMA 1BP3B 3PWLA 2IGFH 3D85D 4G42A 2CJUH 1DUZB 1JK8B 4YHNB 1RUPH 2Z93B 3I02A 4ZTOH 2J8UF 2MMXA 4Z7OE 2Q86A 2DM7A 1YPZF 3ECBA 1KJVB 1NFDF 5EOTB 4CVZA 1E4JA 3HI6H 4LF3B 4NN5C 5D2NB 5F9WC 1RZFL 1W72A 4RMWA 4M7KH 2X4UA 3E2HB 3WKNA 1MHHA 5J6HA 1DBKH 3MV8D 3BIKB 4KKNA 4MXWL 4AIXA 3FAWA 3UTSB 1U8NB 1YNLH 3CDFA 2FBOJ 3MJ7A 1UYWL 2JCCF 3RX7A 4DKDC 2FLRT 3AB0B 5IB4B 4X5WA 5CP7A 1KIPA 3ULVF 5ANME 1DLHA 3JBG7 3VXTA 1HH6A 4GKNB 3PWPE 1RMFH 4Y19E 4YBLB 3IDJA 4ONHB 4MQXD 3PQYD 3ZHKA 2VXSH 3I6GA 4OGXH 2FO1A 1BREA 2W0FB 4AEIL 3CXHJ 5C08E 3UTZB 5C0AB 3QHFL 4N9OB 4Y4FC 1AC6A 2DQTL 1XR8B 4CL7A 3TPUA 1PSKH 4XXDA 3FQWB 1VESA 1BFVH 3GGWA 3N9GL 4KJQD 4L4VB 1KPVB 1I9EA 3HS0B 2VB5A 1AFVH 1XF2B 1IT9H 1DQJB 3IB4A 4ORGB 4MZ3A 5I71C 5L6YL 4HBCH 2Z35A 1EVTC 2NY0B 3O6FB 4I0CC 5FCSH 4Z76B 1MJ7L 4GAGH 1MCHA 1RZ8B 2EDJA 4PGBA 3VWJC 3HG1D 4L3EA 3BHBB 1S9KC 4TULL 3NFNA 1MCJA 5IT2L 5I74C 2AKRB 2JB6B 3UTPE 2H45A 3ULVE 3TO2B 1UH2A 4ZO8A 4QHNA 5JW4Q 3VFWB 3HLAB 1J1XL 5IB3B 2IAMA 4Y5YB 3FQRB 2RFXA 1RFDH 1ZT4A 1N0XL 1CE1H 3HB3D 3VU2A 1UGNA 5B3NA 5FYLH 1JPTL 1X5AA 2XQYG 4M3JA 2XN9A 1LNUB 1JHTB 4HIJA 3MRCA 4P2CG 4NO0D 3KR3L 2OL3H 1LP9B 1HEZA 32C2A 2YKLL 4LRIC 1QLRB 4Y5VA 3D48R 5C8JB 2AGJH 3J7HA 4LSSH 4N9GB 5IB1B 2YKLH 4PJ9D 4KV5F 1G9MH 3UTPD 4HGMA 3UJJL 5EOQL 1FVDA 2CR6A 3QUZA 3LKOA 4FQXC 3LKOB 2RAMA 1BMGA 1QA9B 5GGSB 1C5BL 5MEND 4WCYL 2GJZA 4GUPB 3HNVL 5I8OH 3WJLC 1RZFH 3R8QA 2FX7H 5F1SA 5F9OL 5AUMA 5KSBF 1ZHBB 3R8BB 4XP4L 4P2YA 2AV1B 1W0WB 3CDGB 4MNQD 3ARWA 4YFLF 3G5VA 1YEGL 43CAB 4GG6B 1FNSH 1R3JA 3Q3GB 4PJGF 4WI8A 2J3SA 4M5YH 4U1GB 4UUJB 2YXMA 3H2WA 4PJIE 5MI0B 3VFUA 5CEZL 4OV5A 1JPFA 3X17A 2BY2A 1X4XA 2X6MA 2HKFH 1U9KA 1SEBA 2YUWA 4P23C 4XNYL 3PABA 1OLLA 1MUJA 1NEZG 2FWOA 4RGNE 4G8GD 3QG6A 4R4BB 5FO8B 1CGYA 4BZ2L