3WKNA

Crystal structure of the artificial protein affinger p17 (af.p17) complexed with fc fragment of human igg
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Adaptive Assembly: Maximizing the Potential of a Given Functional Peptide with a Tailor-Made Protein Scaffold.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 209
sequence length 209
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wknA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wknA01
4MNQA 1CK0H 3INUH 4ONFL 5F70A 4I1NB 4B7LA 3P4NA 4AIOA 1TZIB 3PQYE 4NFDA 4HIJB 5ADPL 2DJUA 3TYFB 4MB4A 5IW6B 1ZA3B 4PRHB 4WHYG 5F7DB 4U1NA 3LN5B 2D31A 4JRXA 1JUFA 3AB0C 3ROLA 5B22A 1U9KA 3OAZH 3PP4L 5SX5H 4JLRB 4A2MA 3UYPA 2P5WD 3AREB 3LKSA 5HYEA 2N7AA 3MRHB 3LKNA 5FYJH 3PWNA 4WI4A 3H9SA 4I8DA 1M7IA 4R96A 2E6PA 2YWYA 2VLRD 4AJ0A 3A6BH 3PQYB 1L7IL 2A0LD 4PTTA 4RGOH 1RUAH 2KKQA 4Y16D 2MSPA 3ZSSA 3ARGB 4C54A 1SQ2N 3OXSB 5CSZA 2DQCL 5CEZL 5I8OL 3QDAA 5HDLA 5C0ND 3H7BB 3PP3K 3QIWB 2Z35A 3UTSB 1NGYA 3MRIB 4WO4C 5L88L 5AAMA 2L0DA 1A2YB 1J1PH 5GZOD 1PLGH 3BPCB 3W0WA 4FQIH 4QF1A 1A4JB 1RMFH 1ZTXL 4CU8A 2YPVH 1MH5B 4MQXD 3O6LH 2EIZB 4RWYL 4HV8A 4CRPA 1U8LB 1QR1A 3RNQA 3KPPA 1EV2E 5I76B 3S4SB 2E6QA 3Q5TA 4AL8L 5ENWA 5HI3C 4IS6B 1EJOL 4EKXA 4WTZA 1KENL 4ETQB 4CJ0A 1QFHA 5CZVH 1I9RH 1V7ML 5K9QI 1MVFA 4JPVL 1HEZA 4LAQH 5T5FL 3LRSA 1KLGB 1A5FL 5KAQG 4QTHB 5EBMB 1KXTB 4ZUSA 1WC7A 3V4VL 4G7VH 5EU6E 3U0WL 1J10A 3T0BA 1U2CA 2GT9A 3H3PL 3SKNA 4JREB 1I3VA 3O45A 5HI4D 4WHDA 3EGSA 5JW4N 1G6RL 4HKBA 1GIGL 5I17A 1TJGL 4WFED 1F90H 3BZEA 2JTDA 3WS6A 4ODBD 4P5MA 3ZYZA 1OTTD 5F9OH 1IBGL 1UWGL 4PGEA 3BEVB 2FX9H 3NZ8A 1IAOB 1U8MB 5HVFB 1KPVB 2DQHL 5EU6B 2IAMC 3MRQB 1LO4H 2FSEA 1CGXA 1UJ3A 3KPMA 4MAUH 1FVDB 3U6RA 2IF7A 1QHOA 5JUEL 1A21A 4FQ1L 3GJEA 4KGLA 4HJGA 3VRLF 2OL3A 1S7TB 1D5MB 1NBZA 3JV6B 2XPGB 4NN5C 1LO5A 5E24E 1MCQA 3G5XA 2OJEB 3WSQL 2ICWA 4H8WL 1BQUA 4JFDA 5HGGS 2X41A 3G6JF 4KI5C 2ADIB 3UTPD 4J1UA 4ZTPL 4UQ3A 4IRZL 4BUHA 4H5SA 2B1AL 3GMNA 4OCXL 4U1SA 4JFFA 4LLDB 4XX1E 4XC1L 1YEFL 1AJ7H 4HCRA 1SYVB 3TO4C 1Q0XH 1CD0A 2HFGH 3GI9L 5DZLA 1WCBA 7FABL 1BZ7A 2AQ3A 3RA7L 2DMCA 2I60H 4HC1A 3MLTB 2HRPH 2P5WE 1WGOA 5C07D 4MA7L 5I1CH 5HPMB 5GJTL 4RDQG 2DYPA 1BIHA 4QEGA 5KJRL 3TH3T 5GZNC 1YEIH 3WJLA 1PEWA 1XCTA 2DQGL 4ODHH 3CUPA 4FMKA 3B2VH 4TTDD 4R7DA 3T1WA 4P5TC 1UWEH 4PJ9A 4OGAD 1KV3A 2GSIA 2XN9D 4ISVB 3RGHA 3H0TA 4PG2A 2CDEB 1CI5A 4XB8A 5INCB 3MJ8A 3LPGA 1QR4A 2YK1H 3ZDYE 3T65B 4IHOA 4KJQC 2YSSB 1WICA 2APVA 2WV3A 4GRLC 3F12A 4PJBE 5CP7B 5KANI 4NO0A 3V6OA 1FRGH 4K7PH 4K8RL 4KDVA 1SHMA 2P5WB 3MRLA 5HGAB 3W9EB 1I3GH 1HDMA 5TF0A 2GSGA 5GSRB 2J5LB 2VXUL 5D93B 3C9NB 3QUYA 3LRGA 4AIXA 3BKML 4LKCB 2QSQA 3OKMA 1HHJB 4K71C 5L6YL 3RY5A 1YNTB 4H0IA 3TN0D 3PL6D 1NKRA 5CEXA 2ZJSH 3OMZA 3CGTA 5TE7H 4ZO9A 1G9MH 4AEHH 1OB1A 2CUMA 4GKOA 3I6LD 4KUCD 3MRCA 5D6DA 5C0AA 4JFYA 2GUOB 4BZ2H 2JB5H 4PJBB 2IPTH 3GSNB 2DN7A 4JB9H 5ERWB 1DCLA 3QXTA 4PJCE 3VW3H 3KXFD 4KKLC 4F7CB 2GK0B 4ZFGH 5JZ7D 3L5HA 3B8SA 1NMAL 4KK6C 3RDTC 3UTTD 3SGJC 1RUKH 3P9MA 3SCMC 2PYEA 2AJXH 2ZOLA 3L3IB 5I8KL 5SWQB 1IM9A 4M8QA 5DRZB 4LHQB 1DBBL 5T1KA 4M1GH 3ZLQC 3P0VH 3RY6A 4U6YB 5C0FB 1QEWB 2B7DT 2DIAA 4PRAA 3X13A 4O2EB 3DX6A 4WFEE 5I30H 3S5LB 1RURL 4P3CL 3SE8H 2HT2C 4CVUA 1KCUH 3JWDL 4PJCB 1KTDA 3BO8B 2VERN 4JG1L 3LN4B 4ZMAT 5JOPD 5BZWB 3GSRB 5C0IB 1P6AB 3D3VA 5C70A 3HAEH 4M7ZB 4E41E 1FZKB 3OAZK 3S96A 2R0ZH 3QO0A 2KDGA 5DQDH 4WEBH 5EC2B 1JGDA 5ISZD 2FX7H 1KTRL 2FJFB 4TUJA 3RTQC 1A47A 2A74B 3HMWL 5BOPA 4HZLB 3WFDL 1JPFB 2HMIC 4KY1L 4HH9A 3KVQA 3C6LC 3D85D 1GC1H 1KJ3H 3ARBC 2ED8A 3N9GL 3ZKSD 3MUGB 3NA9L 5EC1B 3UTPE 2ITDB 5C0DA 3HNTL 3MLXL 4YK4B 1XEDA 2R23B 4E41B 1K2DA 2JB6B 1RD6A 3RWGA 2VOTA 5DUBB 5L8JB 3ARFB 4NPYA 2IFFH 5DK3A 1IEBA 1CD9B 4UTBH 4W4OA 4C4KT 2D0FA 1P7QA 4ODWA 1DVFD 5AG8A 4GMSH 1U92B 1WIOA 1LEKA 2DOCA 3VJ6A 3ULVD 4Z95L 2F19L 1N8ZB 1MWAA 4GQ9L 2NZIA 4GBXD 3L3JA 5K9KB 1A0QH 1CDCA 1IC1A 1I9JH 1IQWL 4GW1B 4QHNB 2E7HA 3VXRE 3NPSC 4NQED 4PG9B 1G7LB 5ILTH 1D7FA 1ITBB 1N7MH 4UOJA 2XN9E 1XH3A 4F37F 4NBXB 3NABH 4P59H 4Y7MA 2EYTA 4YXLL 5EIQA 1A22B 3W2DL 1EHNA 2DF3A 4JHAL 1T66C 4G8IB 1MRCL 4TVPL 3MSPA 5DVOA 2VIRB 3LQAC 4I18A 5H2BB 4JAMA 4QYOA 5E8EB 3UDWA 3L3HB 1QBBA 4KTDH 5I1HH 3AAZB 4PY8J 1X7QA 5T3ZL 3VXRB 2PR4H 2QSCL 1Q9LA 2EDKA 4KVNH 4R97C 1UADC 2CDFA 2XN9B 5LCVH 4N8CL 3M45A 4HUVA 2AK1L 4HK0B 4K3DL 4PGDB 5D2NE 2R8SH 4ZODA 4LSVL 1C1EL 4RIRB 4U1IA 4HJJL 3I6LE 3EYSL 4LU5L 4WV1B 2DTML 3KXFE 1LVEA 5FCUH 5INDB 1Q9WA 2Z92B 4QWWC 1S9VB 2W0LA 5FYKL 2D3VA 1ZEAH 4XVTL 1A6WH 3KPSA 2EDQA 3LSOA 4AENB 5IB4A 2Y07L 1ORQA 3CXDL 3CIQA 1YEGH 4JY6A 3TN0B 3PL6B 3BXNB 1FSKC 5D2NB 1JHKH 2WK2A 3QWRA 1HIML 2BDNL 1I7TA 2OK0H 2BCKA 4OLYL 1IJ9A 3KXFB 3HS0A 1YPZE 1RU9L 5KSVA 5JOPE 3PGCB 1BLNB 3RU8L 3P11H 2QHRH 3HG1A 3H42L 4KMQA 3OKYA 5DQJA 3HZKA 2EH8H 4L8BB 4EI6B 1KEMH 3FT2B 1KELL 4MJ6B 4D0DA 3L7EA 1NBVL 4O2CA 1JVKA 5ISZE 4PJDF 4WI7A 1YQVL 3WV0A 1AGBA 3WFEL 3PHOA 4MD5A 1HCVA 1EVTC 4FZ8L 4HHAA 5LAXB 1S7RA 5EFIA 3VMNA 5JNYB 2NW3A 3T09A 3O3UN 5C0EB 5D7JC 4CU7A 2IADA 1IL1A 4P5KB 3UPRA 4CNIA 4GFTB 3O8XD 5JMRA 5CJQH 4OSUL 5C0GA 5HDBF 2D7OA 3VDBA 1YPZB 4G9DA 2AXFA 2K1MA 1OAYH 2AEQH 3ZDXE 4HXAL 1LO0H 2ZSWB 3DX8A 5GIRA 1ED3B 4LCCC 3AREC 3FMGH 3DVIA 4FTVE 4KVCL 3O41B 4DTGH 1CGTA 3D2UB 5ISZB 4G42A 1RZIB 2OL3L 4CU6A 2RHEA 4WFGD 3U4EB 1IC4L 2V17H 4FQ2H 1NCCH 1UVQA 2J12B 1QUNA 2J4WH 1KJVA 4S1RH 5DD3H 3ARGC 3D85B 5J6HA 1CGUA 4YHKL 4YQXL 3HZVB 5I19L 2YBRB 4UDUB 1QSFD 4LQ1A 1A1NA 1VESA 4NQEE 1WEJH 5BS0A 5GGSB 4MHHG 3QIWC 3EO1B 4LCUA 1TNNA 3ARSA 3K4AA 1R3HA 5IWLC 5E8DL 1FCGA 2VLKA 4O5LL 3ARDA 3GSOB 3DRTA 4FTVB 3OB8A 1FZMA 4HCRL 2ZUWA 3UX9B 1AY1H 4IMLB 5BW7C 2O61A 1Q72H 1TTFA 3O3DB 2HKHL 4ZS7H 3AS2A 4NZJA 3UYOD 2ERJB 4H0HB 4HC1L 4QRPD 5I1IL 2CPCA 3DTXB 3IDGB 3FQUB 5DF0A 4RWHA 4RMRA 1U3HB 4WFFE 1SJEB 4BQ9A 3DNKA 3RJDA 2D03H 2E7BA 4U7MA 5E8NA 2R29L 4XP9L 4U1MA 3S36L 3WKMH 4KKAC 4E5XB 4QRUB 1T20A 5FECA 4NQEB 4E9LA 1YECL 2G5BB 4F9LC 1KCSH 4LMQI 5C0JB 3O6FD 1KBGL 3IXAB 1WBYA 3GSWA 2BK8A 3QXDA 3VH8G 4NM8H 1BVKA 1FG2A 1G7JA 3O4LE 3ALXA 4I4WB 4M6OL 4XHQA 2Q76B 3K8LA 4LLYA 4V1DD 3ORJA 5CZKA 3NCCB 2FO4B 4LCWE 4JREC 1UXWA 5I0ZA 5CJ8A 3G6DH 1CDBA 3H9HB 1ZANL 3OGCB 1KUMA 3O9WC 1IRAY 4ZO6A 5FM8A 3VGBA 1Q8MA 4HGWB 5GGQH 3VXUD 4EI5A 1S9YB 2EECA 1JGUL 5ACLA 1HNFA 2VABA 4P23D 4W6YB 4ZUUA 5ESVA 5F3BA 4ONGL 3U1SL 2E3VA 1RZJH 3S35H 3QI9D 2VLJD 2P7TA 3ALWA 2DWEB 1S5IH 1LQSR 3O4LB 1OP5H 1NL0L 2YKLL 4X4XA 4JHBA 4QOKA 2BX5A 2HG5A 4LCWB 3QXUA 4MCYB 5IK3A 3QDMD 2CDGA 3WUZA 2I5YL 2YEZB 1TZHB 1QACA 1JRHL 3A67H 1I1FB 1MCSA 1JPTH 4D9QD 4G6JL 3O2VL 5IHLB 3LS5L 3PGFL 4YDVB 1KPRB 4YNYB 4Z7WA 5LXGL 3GMLA 3BQUD 3NN8A 3VGDA 1JZ2A 1TETL 3I6GB 4DKFH 1A1MA 1I8LA 1ZVSA 2VXSL 1A6UH 3TBYA 1OOAA 5BCAA 5KSAD 4N1CA 5FGRA 3T4YA 1HKLH 5MP6H 3K80A 2ID5A 4JQIH 3FO1B 3TVMB 3D0LB 1DDHA 2IJ0C 1RZGB 2V7NB 1AKJA 3CFJA 4HXBH 5F88A 2CIKB 2NY2D 3QCUL 4Y4KA 4F7TB 4G43A 4WNQA 4KK8D 5KSUA 1BGXH 1QYGH 1SEQH 4JDTH 1NDMB 2Y6SC 1U42A 4OUUB 1MCHA 3QUZD 4JM4L 3KLAA 4OI8A 3GO1H 3TJHD 4WFGE 5AYUH 3KYOA 2ESVE 3U7YH 4N9OB 3MV11 3S37L 1JPGA 5FB8B 4OCRH 2FB4H 5FOBB 4XNUL 2VXQH 3RQ3A 4TSAH 2QSVA 3O8XB 1Z3GL 4UBDC 5GQBA 1CDHA 1I9IH 1QLEH 4U3XA 1T2QH 4N0YH 1T6WA 1MJ8L 4PGZA 2AVGA 1FYTD 1CICA 3DV4B 4AMKH 2K7QA 4MWFA 1R3KB 3HZMB 2R56H 4G6ML 1S9WB 2VN7A 1WITA 4OZFH 2J5LC 1KTLB 2L7JA 4XPTH 1I85A 4PGJA 5D93C 4CW1B 1MQKH 5F9WC 1MJUH 4NHCH 4QRPE 2A0LC 1MWAL 3WL9B 2ESVB 3MRGA 5DRWA 1CFVH 2FRGP 1WAAF 3BUYA 3RUGA 5GS2D 5FDWA 1KJ2H 1P1ZA 1QNZH 5CBEA 1HINL 2C3HA 5GHWH 3S98A 3V6FB 4N8VG 5CD5D 4BJLA 2ZSVA 5E94B 1OTSC 1CGSH 3RVUC 5C0NC 1G9NH 3VI3F 5HI5C 1I8MB 4PRIA 3E6FB 1J0YA 4CMMB 4Y4HD 1WZLA 2VL5A 3DO7A 4QRPB 4V1DE 3TCLA 1J0ZA 3VFUA 1MVUA 1A7QL 32C2B 2P4AB 4AEIH 4Z7OF 1NC4D 5F1NA 4NQCD 4OTXL 4L9LA 4P57A 2XKUA 3KYKL 4GXUN 1ZK9A 1AO7A 2CR3A 3NIDF 4GW5B 4J4PC 3VGHA 4HT1L 3FAXA 4ZPTB 3FB8B 5GS3A 2C3GA 4C56A 3VXUE 3JBG7 4XNQB 2XIDA 3HAEA 5FO7A 1UT9A 1UM6H 3DBXB 4AT6A 4CVWA 1ZA6B 4KRPD 4M7ZC 2OTUB 4UILL 4HLZH 3TBWA 2AJZA 4V1DB 3LEXB 2A77L 3JTSA 1TQBB 1X6NA 1S7VA 2WAHA 2MQ3A 2OSLB 1N6QL 3BKCL 4OIIH 3BW9B 5ID0B 3W5MA 1Q94A 1IGCL 3WN5A 4D9QE 3PWLA 3RWHA 4K8RC 4YGAB 2DAVA 4O2FA 1FZOB 3NCJH 3I3BA 4ODSL 3VXUB 3GMPB 3I84A 3FN3A 5A2KH 4P23B 2P43B 3O3BA 4YK4C 3QI9B 1LE5B 2CH8A 4Y5YA 1XGYL 1H5BA 3ARFC 4P2QA 4HWEH 4NKDA 4X7TB 2NY3D 3OTTA 3KWWB 4M1DL 4M6NH 4HBCL 4R4BB 1T83C 1PG7L 4JRYD 2P42B 5IMLB 3L6FA 3EO0B 1CK0L 1CFSB 3INUL 1UA6H 1LMKA 4HUMB 3IFPA 4YGVA 2R1YB 1RZFH 3HR5B 3ULUD 1QFUH 3LEYH 5CHNB 1KIPA 2QSTA 4APQB 5DMGD 3SKMA 2YPKA 4ZUTB 1XR9B 5KSAB 3TZVA 1NDGB 4PJIA 3MJGX 4ODUB 5FUZH 5KG9A 1GZPA 1MFNA 1JFQH 1VPOH 4CN4A 5I16B 3MOQA 1DQQB 5L0QB 5H35B 4JY4A 1L0XA 4PJEE 5F6IC 3NCYP 4WW2B 1G1YA 3EYVB 5FYJL 5IESH 3UAJD 4AM0B 3JWDC 2NNAB 4FFVC 1ZGLA 3A6BL 4NT6B 1AGFB 1DFBH 5HPOA 4BSWB 4X6CF 2WBJD 3TIDA 1RUAL 5IMKA 5TE4H 3P9WB 4ZUWA 4OM1H 4YBLB 1KTKE 1LDPL 4JZJB 4QNPF 2E7MA 1K4DA 4OGAC 4FRWA 1S8DB 2WWKO 4CVZB 5IKCA 2C7UB 1RK1A 2VZOA 5JXEA 1MCLA 3UROR 1HILA 3VXPB 3TNNB 4UU9A 4PJEB 3VFMB 5EA0H 2IC2A 3NPZB 1J1PL 3BE1H 4WV1C 2YC1B 1AXTH 4IRJA 3MO1B 1OP5K 1QQDA 1PLGL 4FQIL 3WJJA 5IIEB 2HFEB 1RMFL 5ICYB 3J7HA 3O2DA 5E9DD 4Y2OA 3G6JA 3HCVB 2YPVL 2F5AH 4NQUA 3O6LL 2PXYD 5F44A 1YN6B 4G80A 2DKSA 3KNBA 5GS0L 4YFEA 4LEXH 1IAIH 1RIVH 4FQXA 3MV7A 3ZE1E 5CZVL 1I9RL 4HGMA 4NZRH 5AAWA 1SBSH 2ZCKH 5MI0C 2AK4D 4NQCE 5D2NC 4D0BA 4LAQL 3C5JA 4F37K 2Y5EA 4WI2A 3FTGB 2N7BA 5D5ME 3FAWA 4X6FA 5H37G 1F3RB 3VWKA 1YNLH 4XBEH 2BNRA 2D2OA 1Q0YH 5IVXE 3MGAA 1U95B 4G7VL 5IHUH 1JZ8A 3K0WA 1FNLA 3ZE0F 3QUXA 4F9PA 5JZ7C 4Z7UA 5DXWA 1JNJA 2DJSA 4KZDL 3VG0H 1T1WA 1Q9OB 1DN0A 1DQJA 5FO8A 3JV0A 4RAVB 3OF6D 5DJDB 2MCG1 1F90L 2F74A 1JPST 5IM7B 4X99A 2GJ6A 4RFEB 4HUUA 3WNNA 5JIKA 5HBBA 4ZPVB 4LMQE 4NQCB 2FX9L 3KPQB 5EBWB 4RQQB 5D5MB 1DQDL 3M17B 3RWDA 1CD1B 2CLRA 2WP3T 1JNHA 2W59A 1VA9A 1UH2A 2EDDA 5DJ6B 1S7XB 4WHTB 5IVXB 5IEHB 1BVLB 1FFPB 1LO4L 1H0DA 2X4SA 1EXUA 4MAUL 5HVHB 5TDNA 4BFIA 1QD0A 3O3AA 2HN7A 3ULVF 4WWID 1J0KA 5DEGB 3BP7B 4IOSD 5H94B 2NY0D 5CGTA 4JRYE 3AU1A 4KTYA 3BP4A 5EO0A 5E1AA 4RBPH 3DURA 2HKFH 5I2IA 4LNVA 5ESAA 1SJVA 3R06B 5CEZD 1FN4B 1AC6A 1Y0LA 4M1CC 3QQ4B 3EDKA 3VFPA 1EAJA 1CVRA 4WI6A 1AJ7L 3OX8A 5JQHC 1D9KB 1Q0XL 3CSGA 3RKDC 4C57C 1ZGLM 5AD0B 1RVFL 3Q5OA 1KJMB 4MHHI 2F54D 4LKXA 2I60L 3S36X 1MI5A 1G1CA 3GIVB 3QIBD 5BV7C 5MERB 2HRPL 5DK0B 3UTQB 3TNMB 5I1CL 4JRYB 2ERJC 1QLFA 3EZJB 1YEIL 4ZS6C 1U3HC 4ODHL 3IRZA 3B2VL 4XH2A 1NAKH 1UWEL 3EDJA 3SBWC 3OAYK 4ZFOB 3SDAA 5TH2A 4QXTA 2YK1L 1K5NA 2V5SA 2HT3D 3PWJB 3ZE2E 5I66B 4I2XE 1N5AB 4YHOH 2DWDB 3BDBA 1LD9A 4K7PL 4HQQH 4P3DB 3WS6C 3MCKA 4JFOB 3MNWB 1I3GL 1I1AD 4WEUD 3PWPA 1LE9B 2CO6B 4LDOB 1G84A 4ZQKA 5HDQH 1OGAA 3WDIA 1TVHB 2JLLA 2FO1A 4JQVA 3SHSA 1MFEH 3WLWD 4LP5A 1PZ5A 4NFBA 3NTCL 5E9DE 4PJ5E 2AXGA 3ROOA 3HE6B 3RWFA 3AS0A 2XFXA 2BY0A 3FZUC 3MMEA 2Z31D 4RGND 2V7HA 2ZJSL 1NBYB 1OY3B 4AEHL 5TE7L 3TBTA 2EIEA 4HK3N 4PGCA 1YY8B 1I7RB 4I2XB 4Q7DA 2IPTL 4JB9L 2IPKB 1HI6B 2AK4E 3VW3L 2Z8SA 3GJFB 5JIHA 5DJ8A 1S7SB 1NCTA 2FJGB 3MGOB 4ZFGL 2I9TA 2SEBB 4UQ2B 3BMWA 1ORSB 2XKNB 3DXAD 4M6MH 2JK5A 1RUKL 1H3VA 2DQEH 5E9DB 4PJ5B 1NGQH 3NFNB 4IOIB 5CZXD 2AJXL 4R26H 3Q2CA 2PXYB 1ZV5A 4M1GL 3P0VL 3AFLA 5DYOB 1ODAA 4X9IA 1IEHA 5K33A 1I8KB 5I30L 3SE8L 3D39D 3WD5L 1KCUL 2I27N 1BZQK 4K7FA 1PAMA 2X09A 2AK4B 1QBLH 1T0PB 3ECBB 3RNKB 4NN6B 4TRPH 2M2DA 1HHKA 2IBGA 1UB6A 4RAUB 5DD1H 3TVMC 4NGHH 2UVEA 3IB4A 1ZLUH 2R0ZL 4X98B 3KLSA 5DQDL 4WEBL 1JHLH 1BZ9A 4G8GA 1I7UB 3STLB 2FX7L 1AR1C 4K3EH 2N56A 3S37X 5E0QA 4LL9A 2EO1A 4EDWH 4UIKH 4X4ZA 3FT4B 1LILA 4HUNB 4GAFB 2EYRB 1ZT7B 3N1FC 2P5EA 3W11C 4Q74A 1GC1L 2I9LB 3V6OC 3NMEA 4DGIH 2OCFD 4FFZH 1GGCH 3RVVD 1LDSA 5F72S 5F7FA 1KB5H 1P4IH 1M05A 1TMCB 2LTQB 2P8PB 1JV5A 3E1F1 3ZKXC 5CEZE 1JYVA 1AI1L 1CU4H 3WEXA 3FCTA 3FQWA 3QXAB 2P1YA 5ESQB 4ZFFB 4RMVA 5DD0H 3DVFA 2XZCL 2IFFL 4LSSH 4UTBL 2R1WA 3STZB 3OJDA 1P4LB 4GKSB 4OZFA 4XNZC 4XP4H 4Q0XH 5IQ7H 4GMSL 4XTRD 5HYJD 4WW1B 3GMMB 2CD0A 1K8IB 1U8KB 4LSTH 1CXKA 5D6DC 3KPRD 4MA8H 1TLKA 1A0QL 1KJ2A 3QZWG 3LQZB 3OR6B 1I9JL 2NTFA 3LKOA 3LKRA 1AD0A 5ILTL 1N7ML 5JDSB 3HNSH 1M6OB 1FQ9C 2XV6B 1CXHA 4KTEH 3NABL 4P59L 1MHCA 1OPGH 5DGQA 4HFWA 4Z77B 1HQ4A 4Z8FH 4BA8A 3QXVA 4FZEH 5TQ2H 3RY6C 1AQDB 3MNVA 5DRXB 5E5RB 3T2NH 4NJ9H 2WWMC 5DDHA 1KCLA 2W07A 3QIBB 4FOMA 4AY0A 3SGEI 2HJLA 2MFNA 4ZYKB 4JPKH 5J0BA 4ZFZB 4KTDL 4YHYB 4IRSD 3PABB 1BOGA 5I1HL 4Y4FA 3G5YA 5FGBC 2PR4L 3HMXH 4KVNL 5D70H 2L7UA 4MCZB 3MREB 3WHE1 4W6WB 1OAUH 5LCVL 1IC5H 4G8FA 3MFFB 3UEZA 5FFLA 4GKZA 2DM2A 2R8SL 4PJ7F 5TDPA 4BZ1H 3AXLB 3CSBA 1YEJH 1A9BA 4X7EC 4YHPB 4P4RA 4KKBC 3TBSB 4F2MB 5FCUL 3U4AA 3WXWL 4JCMA 4Y2DD 1I1AB 5GSVA 3F6LA 3DXAE 3WFCL 2UV3A 4HH8A 4Z7QF 1TQBC 1ZEAL 3O2DL 3P73A 1A6WL 5DJCB 2GFBA 4ODXB 2BNQA 4OGYH 9CGTA 4Y19A 1ONQA 1RHHA 3MCLL 1LK2A 1F4HA 4ZTOH 2H3NB 2E9WA 4RBPK 4HS3A 1JHKL 5IW1B 2VL4A 5DLML 3AMKA 1U8HA 3MRPB 5I1LB 4JFPA 4F58H 5K9OB 1PG7X 2R0KH 3BWAB 4PREA 3T0WA 2OK0L 4TTGA 4G5ZH 4I0KA 1JNLH 4KV5F 4XBPA 3P11L 2QHRL 3D6GA 1UQSB 1T1YB 1J0JA 4JO3H 3U9UA 2EH8L 3DXAB 5CP3H 2CKBH 1KEML 5J89A 4GLRH 2NX5D 4JQXA 4OF0A 2ZG1A 1J9CT 1IM3A 4HIEA 3T1FA 4M4RA 3WBDA 1OGTB 3OWEA 1NJ9B 3MLSH 5EO9A 2GJZA 1NFDE 3EYQC 4LDEB 1T1XA 3HUJA 5DO2C 5EU4A 4EQ3A 3IDMB 4ZUVB 2F15A 4TNVK 2X89A 4P9MH 3QDJA 1H3TA 4APQC 1H15A 2UWEF 5DURD 5CJQL 3G6AA 4R9HA 2A73B 5KSAC 4YX2H 1I3UA 5C8JA 2QL1A 4JRXD 1OAYL 2AEQL 2UZXB 4TPRH 1SEBA 1LO0L 1XGQB 3HE7A 1JWMA 2AEIT 2EDFA 4WW2C 2C1OB 1RIUH 3GGWB 1UG9A 5DJAA 4TVPD 3EHBD 1Z0MA 1GPOH 3VFGH 3SDYH 2V17L 4FQ2L 5HYJE 1NCCL 1NFDB 4OZGF 3TT1H 3LHPL 1CXEA 3H9SD 4UTAH 2J4WL 4S1RL 5DD3L 3KPRE 1YEDB 5T3ZD 5C2UB 3PWVB 2VXVH 5HHVH 2V6HA 1C7TA 4Q97A 4GT7A 2Z93B 4YPGA 2FHFA 5IG7B 3Q3GA 3VXNA 4N90D 4NNXB 4GG8B 3QEHB 4HWBH 2WIIA 4UOW0 2E7CA 5EUOE 3ELAT 1AY1L 4LVEA 1T7WA 3T2OA 1Q72L 4P2RD 1OWWA 4ZS7L 2PW2A 1G6VK 5BMFH 3W0WD 4QT5B 2D03L 2OR8A 1I1YA 1Z0NA 5HGDA 5FYKD 3KPRB 1IEAB 4Z7VA 1AHWA 2VLMD 1JGEB 3WKML 1WJ3A 1IAKA 3I02A 2VC2H 1UWXH 5GRZA 1INEH 3OKNA 5AWNH 1KCSL 1UEMA 4KUZH 3W5NA 4E0RB 4OFDA 1ZHNA 1C5DA 4YBQC 3CU1A 1YNKH 5EUOB 5FYLH 2QQKH 2BOCA 4NM8L 1T3FA 3BN3B 4YO0B 4MZ2A 2JE8A 2A9MH 3RWJA 3FQXA 4X5XB 5I9QB 5B38G 5J4MA 1ZWIB 3CFKA 3G6DL 4GRWH 1BF2A 4IRSB 5J12C 5IGXH 4D2NA 1P53A 1A02N 3EOTH 1MHEA 5BO1H 4MVBD 3TBVA 1MLCB 5GGQL 2A6IA 4M7JH 1A3RL 5CJXC 3BJ91 1P5UA 4UT9H 5MENA 4KDTA 2CXKA 3MPCA 1RZJL 3T0EA 1F4WH 1S5IL 1P9MC 4KXZH 3RZWA 1T21A 1UZ8A 4OLXL 1BFVH 5HVHC 1S7WA 4UV4H 3KYAA 12E8H 2I24N 3HRZA 1T4KB 3CVHH 3QISA 1EGJH 3SDXE 4BYHA 4Z78B 2C1PB 5T3XH 4I5BB 5IR1B 3A67L 5I73B 2EYSB 2NY6D 3HPJA 2BVOA 3BIAX 1JPTL 2YXMA 3HC4H 3BGMA 4XCNA 5GGRA 1X5JA 3ULUF 1AH1A 3HPLB 4RMSA 4DKFL 1D5ZB 2RB8A 5F7MC 1A6UL 4JFDD 1KCRH 1HKLL 2G2RA 3MXVH 4NCC2 4LLWB 2DBJA 4EN3A 3ARQA 2Z4QB 3BHBA 5F21B 5C86A 4HX1A 1EA9C 4JQIL 3I75A 1BQSA 4PJHA 2X7LB 1A4KA 3VH8B 4FQHB 3VWJA 4JFFD 1D9KC 3SDXB 3OHXA 4NRYA 1HWHB 2J8HA 4JRXE 3RY4A 1HK6A 4HXBL 4RSVA 2A2QT 5CKGA 5KTEH 2I07A 2WLZA 5I6XB 2HJFA 1QYGL 1SEQL 2W60A 4JDTL 4AQOA 2KBGA 2X4UB 2R2EB 4Y1AA 2J1KA 3GO1L 5LGJA 1INQA 1UZ6E 3BAEH 4ZOAA 5AYUL 4NN7C 3U7YL 1U93B 3B3IB 4K7PX 2ARJA 4OCRL 2VR5A 1BIIB 2FB4L 3DRQA 2VXQL 1TDQA 3BVNA 4TSAL 4OD2B 4PJ9D 1G7IB 3RVXD 1QLEL 5K9JH 1T2QL 4N0YL 5FF6B 2BJMH 1IGFH 1MCEA 4AMKL 4DN4L 2D31B 2IPUG 3EFDH 4N90E 4RDQF 4BFBD 5C71A 1IAIM 2ADGB 2R56L 3RWEB 2OTPA 3ROLB 2DS4A 1E0OB 4XPTL 4EI5C 1KNOB 1X4ZA 1MQKL 1MJUL 4JFED 5F1KC 4F7EB 3FB6A 2MCPH 4NHCL 4OCSH 4P2RE 1CFTA 4DEPB 4ZNEA 1RIHH 3HE6C 4LLVA 2AAVA 3DMMA 3QUYD 3W0WE 5I8CA 3NACH 1CFVL 3C6SB 5D7LE 1KJ2L 4OZHE 3B43A 4PTTB 4MJ5B 1QNZL 2VLME 3LKQA 3U0TB 5GHWL 1AD9B 1RZKC 2G9HB 4NOBA 1CGSL 3ARTA 3T8XB 2Q86A 3ZHDA 3PDOB 1G9NL 1GJIA 1MY5A 3MYJB 4M93B 3OG6B 4A2LA 1MCDA 4LLAA 5J3HC 2Q3AA 1OSZA 4WGWB 4J8RB 1HHIB 4LOUD 1F2XK 3RL2A 5C7XH 1XAUA 4P2RB 2X70B 1KB9K 1P6FA 3MNZA 5E2JA 2W0FA 1XGPA 2ZUUA 3TC9A 3W0WB 3QWOA 3D18B 5D7LB 4AEIL 4OZHB 3AUVA 3VA6A 5JPMA 5DHVH 1DBMH 4WU7B 5BRZD 1CLCA 1F2QA 3IS1X 2XT1B 5T1KD 1CGWA 3VXQB 1TZGH 5C9JA 4DZBB 4MXVF 1RY7B 4U1GC 2DBLH 4Y4KC 4NN6C 2A1WH 1UM6L 1NUDA 3CDYA 2FECI 5EOTB 3P77A 2Q8BH 1MFBH 1ZMYA 4KH2A 1PY4A 1Y18B 2LVEA 2XQYK 5T1MA 3F7RA 3R0NA 1K85A 2RBLA 3FO9A 4L3EA 2X4RB 3GSUB 3DX7A 2NY5H 3MOAH 2VN4A 4OIIL 3WUWA 4IMKA 1T0MA 3SKNB 3VXTA 4NRXB 3VFNA 6FABH 1CF8H 2VDPH 1CICC 2XICA 1KB5A 3EGSB 3QFJA 3S3SA 3VG9C 4X4YB 3NCJL 5JHDA 1VFMA 1NAMB 1A3QA 4QCIA 4N8VB 1J05A 4C83B 2CKNA 2B39A 2ZOKA 4R90H 4XT1C 2L4OA 3T2PA 4DAGH 1AGEB 4KPHH 4NUJB 43C9A 3U9PH 2D9CA 1I85C 2VKXA 2V2WA 1F11B 2OM5A 2LQRA 1LEIB 3ARYA 4HWEL 3WFBH 3CC5A 1UXSA 4UAOB 1G9MC 5I1GH 4ENEC 3D25A 1CL7H 3SE4A 1UJ3B 2ZUQB 3L1OH 1ZHBB 3DI2B 3OR7A 3EOAB 1UA6L 1P7QD 1H8OA 2H32B 5IB5A 3LQAH 4BH7A 1RZFL 3MUHL 1LO5B 1QFUL 3LEYL 4K9EL 5BVJB 3IGAA 5JLZA 1UWXK 2ICWB 4N0UE 1CG9A 4NNPH 2AJVH 4PP1D 5IEKB 2EXYC 1A6ZA 1RJLA 5FUZL 1HHGA 3JVGA 1VPOL 1JFQL 4HWNA 2X10A 4R4NC 1XFPA 2XOTA 3GMNB 1FNHA 3T77A 3PHQB 4Z5RB 4HF5H 4M9OA 2O93L 5IESL 1XF2A 1II4E 5LJYH 3DV6A 3BP6A 3ARRA 5DRNB 5JOFA 1MOEA 1OP3H 1DFBL 1BZ7B 2A6JA 3MRKB 4XI5C 3HMXA 4PJAA 5CLTA 1XIWD 2ZZUT 3LOWA 4JKLA 4JFEE 5TE4L 4PBWD 3X12A 1LO2H 5BOZG 4OM1L 2P24B 5E8PA 4N0UB 4AH2A 1YMHA 4PLKC 1G7MA 3HLAA 3CFBB 4RMUA 5F6HJ 2YA0A 1T89A 4AIZB 1R5VB 5EA0L 3F62A 3BE1L 1GC1C 1AXTL 2XTJE 5E6IA 1EHLL 1NEZG 5CD3A 3UTZA 3F12B 3WHXA 1TVBB 4PIRF 2F5AL 2ITCA 4PJFE 3BEWB 1I4FA 4JFEB 3ARVA 4O9HH 3W9DA 4N8PA 4LEXL 4R0LA 1IAIL 5C6TH 3QUYB 4Y5YC 2BY3A 1H5BC 4NZRL 1SBSL 2ZCKL 2H2PD 4QHKI 3QPXH 3OKMB 1V3LA 5BRZE 4YBHA 1U0QA 2O5XL 4QRRE 3MRDB 1S5HA 3WS3B 1YNLL 4XBEL 2Y7QA 1Q0YL 2XTJB 5IHUL 4MNHA 3GHEH 5CP3A 2CKBA 1BBJA 4LPWA 2QR0B 4N9GA 3LKPA 5A2LH 4OLWH 4PJFB 3VG0L 4HPOH 2DTSA 1V05A 3BRDA 3B5HA 3HG1D 2M1KA 5B21A 3PG2A 1JHTB 4NZTL 2H2SC 4OZFG 5DJZA 3TIEA 3X11B 5MEOB 1F3JA 5FV1L 4MQTB 5C9KA 3MGTB 1PSKH 2VRAA 4KJPD 3VFVA 2ZOLB 3ES6B 4YFLI 5BRZB 1RJZA 4HFUH 4L8SB 1KIRB 4QRRB 2QKIA 1XF3B 1EO8H 5EIVA 1R5WB 3FQTB 2EC8A 4DUWA 4DFHA 4HEME 4GLRI 4M3KB 2AKRB 3QJFA 3KDMB 5IJVA 1CT8B 1WWAX 4WO4A 2HJKB 2HRLA 5DVLA 2AJYH 5CGYC 3T08A 4PJGF 3NIGE 2VDRH 5FYJD 1K8DA 3GK8H 1UACH 2I26N 1LNUB 5TF1H 2NLJA 1UB5B 5D7SH 2HKFL 4JFXB 4FQJH 3KLDA 4RRPA 5HTSA 3QPQD 3OB0H 3UYRH 4IRJC 2Q7YB 2A6KB 3WJJC 5IB3A 5BZDA 1BOYA 3B9KC 4HWBA 2LAAA 4EOWH 1I9EA 4MD4B 4M9PA 4O02H 2F5BH 4XB7A 5KSBA 3MC0A 3MRNA 3OKDA 4PV9B 2AEPH 3OJVC 3MLWH 4BSVB 1OQOA 3ILPB 2DQJH 2R4RH 4FQXC 3CFCH 3RWGB 4QXGH 1S9XB 4HLZG 3LS4H 4NKMB 2VISB 4NCDA 4IIQB 3SPVA 1NAKL 5GS0D 4PP2B 5KS9E 3HI1B 3VU2A 5HYQA 5EOCH 2HVKB 3QUXC 1U91A 3HHRB 5DK2B 2HLFD 3N1QC 3DIFA 2ATKA 4I77L 4L8CA 3QP3A 3QUMB 3T4AA 2LABA 4YHOL 5EORH 1ZLSH 5EZIH 1A9EA 2YD8A 2A6DB 3E3QE 4HQQL 4QY8B 1JF5A 3F7QA 2IAMA 3D5OF 4MX7A 2ADJB 3TA3A 5HDQL 3DETD 1MFEL 4N0FB 2F8VA 5D7IF 3EOBB 2Y1VA 2NXYB 3GKZA 4KJWD 3QUKA 4FQQA 1XIWB 1IC7H 4L4JA 5FHAH 5KS9B 5F1OB 2ZP0T 1I7ZA 3QG6A 2DJ4A 4RISH 3ULSB 3V4PH 1A7RH 4MAYD 3V0VB 2DQIH 3JTTB 4P3WA 5KVEH 3EIFA 2UYLA 3VXSA 5K59F 2BSTA 3L3OB 1OQXA 3FONA 1NCUA 4M02A 1F4AA 1G7QB 5SWZD 3N0PB 3CVHA 2AJ3A 5D71H 5ITFB 3GZKA 4X0KB 4M6ML 2J8UE 1J7VR 3FO2A 4RFNB 2DQEL 4UINL 4QOKD 4R26L 2CRMA 1HHHA 5HJ3B 3SDDB 3IDJA 2F8XC 4ODTH 4K3JH 3CCHA 1ZXQA 4U6TA 3MV8E 1BJ1H 6CGTA 4U0RC 5HD8D 4KXZI 4XPGH 5DWUH 2NCMA 2DLHA 3F5WA 2V9TA 4JJ5A 1T0NA 1QBLL 1ORQB 4G7YH 3D9AH 4P5TA 4TRPL 1ZGLP 5ETUB 3C60A 5KN5B 2AV7B 4GJTB 4L5FH 5DD1L 2BSSB 2EZ0D 4NGHL 2WINA 4B50A 2J8UB 1CFBA 4GG6A 4LEOA 1JHLL 4UT7H 1CDGA 4FS0A 4PS4H 4K3EL 5KBNC 1LP9E 3SDAC 5I6XC 4UIKL 2XWJA 3MV8B 4Y88A 4YAQB 1OP3K 1TITA 2PCPB 4ONHB 4NHUA 5FM4A 3Q6FA 5F7EH 2LU7A 5EU5B 4MJID 4DGIL 3BZ4B 4FFZL 1GGCL 3NIFF 3KJ4C 4OV5B 3D0VA 5IB2A 3FQNA 1KB5L 1P4IL 1AGBB 3IVKB 2BERA 2FDBP 4JM2B 4NRZB 4HHAB 2NW2A 4RMWA 1QRNE 4BQ6A 1CU4L 4J6RH 4FMFA 2FHBA 5JHLH 1B9ZA 3DUUB 4I9WD 5DD0L 4PJXA 5IHZB 4LSSL 3LDBB 5C0GB 5HHOD 3OJMB 4XP4L 4Q0XL 4XRCB 3SKJH 1LP9B 2VDQH 1DEEB 1VFAB 3IJSB 3GSNH 1MCCA 4PGBA 3V0WH 4FABH 1UKQA 4LSTL 3TFKD 2R69H 3VFRA 2YUZA 4MA8L 4LSQH 4DEPC 3RDTA 2GK2A 4G6AD 3SGJA 5DC0A 2FR4B 3SCMA 5IF0B 4ELMA 4OZIA 4MQ7B 1L9MA 1CE1H 4XBGB 5FKPB 4QRTA 4O00A 3HNSL 2B5IC 1QRNB 2XY1A 4KTEL 1Z9SA 3WIFB 4Z7NE 2DLEA 1OPGL 1BD2D 4Q2ZB 4Z8FL 3C87A 3ZKND 1IKNC 4FZEL 4WI5A 5C08B 1KF9B 5I1AA 5TQ2L 4KKCD 5D1ZA 3VFSB 1NLBH 4PV8A 3T2NL 4KZEH 4NJ9L 3VXMA 1HSAA 2P46B 3GI8H 4PRID 2DL2A 4JPKL 1AR2A 4L3CA 1ND0A 4DKEH 1NFIA 2FH8A 5DHVA 5E6ZA 1W8OA 2A83A 4K7PY 5DUMH 3HMXL 3V8OA 3O3EB 5A3IC 1OAUL 1IC5L 1NC2A 2VYRE 4OB5H 5KVGH 1T5XB 2OR9H 4OF3A 1RZ8B 5SWSD 3KYMA 1TFHA 2YD5A 5F97E 3WCYA 1T20B 1AO7D 1YEJL 3RVWC 4BH8B 3KHQA 4MSWA 4C56D 3UXFA 3GSWB 3VDCA 5SWZE 2E8YA 5IJKC 4XMLH 4HS6A 1G7JB 4OGYL 2XQBH 5DQ9A 3QZWB 3WE6A 2BRRH 3QO1A 5GRJH 4HKJA 1Z9OA 3G5VA 1JNNH 4H25B 3RX7A 1OD7A 4ZTOL 2RGSA 1H3WM 4I48A 3OB0K 2V2XA 4MAYB 1IGYA 3VFTA 3UBXA 2VLLA 4UV7H 3ZKQD 4G5ZL 4S1SL 1JNLL 5D1QD 5H8DA 3BRFA 4D9RD 5SWZB 1QG3A 4JO3L 1M71A 1YC8A 3L3GA 2CKBL 3D69A 4HKXA 3V9FA 3Q6GH 2ED9A 5ECJE 1N0XH 2ZUQC 3CPLA 1MFCH 2V5RA 5MEPB 1X4YA 3SJVA 1OT2A 3MLSL 5JW5A 5KOMC 2Z0BA 5IMOB 1E4WH 1DQLH 1KIQA 5D2LA 3LEVH 3UBXI 4P9ML 5F7KC 3QHZH 2ADFH 2EH7H 3NN8B 4MJIE 4HIXH 4LGRB 4YX2L 1MUJA 1FNEB 1CL7I 2OQJA 2PO6D 4OD1H 5IT2H 2RFXA 4U6VH 2F53A 4U7SA 5CUSH 4TPRL 3TBYB 1KACB 3TZVD 2FD6H 4N0CC 2DI9A 2EICA 2C3XA 5CINH 1RIUL 5EOCJ 4G9FA 4I9WE 3MRMA 5BQ7A 2VZ1A 2DLTA 5HHOE 4YDLC 4V2BA 1GPOL 3VFGL 1IGTA 3SDYL 4HUWA 3QCVH 3TT1L 2XA8H 2KZ1B 5GISH 4UTAL 1HH9B 3CD4A 4NBYB 3L9RB 3VGEA 4WNQB 1GSMA 3QDGA 1SJHB 4MJIB 3IU3B 3KLAB 2VXVL 5HHVL 2H8PB 2MPAH 4LVNC 3GBMH 3QQ3B 5E4EC 1MRFH 5DHXB 5CBAB 1JPGB 2DQUH 3AY4C 4HWBL 1A1OA 1BD2E 3DROA 4A6YB 5JXED 4JR9H 4U7KA 3DX9B 2LFGA 2NTSP 5HHOB 2X4PB 3RIFK 2NXZC 2NY4C 3LB6D 5BMFL 5AEAA 3GUTA 5JW4M 2X4QA 4GAYB 2JIXB 5T5NF 4NC1E 3BPLB 2YZ8A 1INDH 1D5XA 2VC2L 3ZSTA 1N59B 5AWNL 5EZOH 4ODVH 4C4KO 3GNMH 4KUZL 3FOLB 4XMPH 3ILQC 2G75B 1OTUD 4P46B 4HIJA 1G9EA 3TYFA 4PUBH 3MV7D 5EU7E 1ZA3A 1YNKL 1BD2B 3MLUH 4PRHA 1U3ZA 5F7DA 5C3TA 3GMRB 5FYLL 2QQKL 2XTJC 3LN5A 5SWSE 5A43C 4J3TA 2OXHA 2YOCA 2CLVB 3VWKD 3QEQD 2A9ML 4GKNB 4C56E 1HNGA 5AG9A 3GSXB 4JLRA 3G5ZB 3EUUA 3AREA 4DK3A 3AS3A 3F65A 5E56A 3MRHA 1QA9B 2OXGA 1AXSB 4HBQA 1S3KH 1MRDH 4LVHC 5IGXL 2VL5B 3EOTL 2HTLD 2Y06L 5BO1L 2IH3B 3PQYA 3HN3A 5HYSG 2GJ6D 3EFFA 4L8SC 3OKLB 4UT9L 4F8QA 3ARGA 3OXSA 3OG4B 4L8DB 5SWSB 4OF8A 1F4WL 1FVEB 3OXRB 4N5ED 5FUCE 4HUKB 2YRLA 1BFVL 1KN2H 3H7BA 3EAKA 4UV4L 1X6LA 12E8L 3QIWA 4U6HB 4C56B 3UTSA 3MRIA 3CVHL 3MTRA 5IWLA 4D9RE 5T3XL 2ORBH 1JBJA 1A2YA 3B83A 4OFYD 5EDXA 5F8QC 3HC4L 3BPCA 4X8JB 2QV2A 3QHTC 1A4JA 3N1MC 4ACPA 5ELIA 5FA3B 1MCWW 1MH5A 3JTSB 1R24B 2EIZA 4Z0XA 4PRDB 1PDKA 2Z91B 1U8LA 1KCRL 3MXVL 3WNKA 5I76A 3S4SA 4KWUA 4IOFC 4IS6A 5FK9B 1NCWH 4ETQA 4O2FB 2W92A 4F9LA 1CLYH 3QCTH 2R2BA 5D1QB 3HRPA 1AHWC 1KLGA 5IQ9B 5JW4Q 3LZFH 2AERT 4EUPG 4QTHA 5KTEL 3TPUB 4QHUB 2DIBA 4NWUH 4X6DB 5B38B 2VH5H 4UMGA 1EEZB 4D3CH 3BAEL 1BBDH 4IIQC 1F8TH 3L6FB 3B6SB 1P7KB 3SDCD 1QOKA 5F8RC 5SX4I 1ZHLA 4G8EB 2VITB 1GRWA 4JZNB 2GHWB 3BEVA 4WY7H 5K9JL 3S8WA 1NUGA 4MJ2A 5D8JH 2BJML 1IAOA 2PO6B 2PTVA 1IGFL 3G04B 1U8MA 3O11B 3EFDL 2YPKB 2EDYA 5HY9A 4WUKH 1KPVA 5EU6A 3MRQA 3PIQB 3HTLX 4OFVA 3IETB 4XWOC 3G08B 3LH2H 5FA4B 3VRLE 1FVDA 4WI3A 2MCPL 4OCSL 3DI3B 1RIHL 1S7TA 1D5MA 5C09E 4WFHD 1RHFA 1PFCA 5FGSA 5EB9A 3JV6A 1OGAD 2NXYC 2X1WL 3NACL 1Z2KA 2OJEA 3G6JE 4Q9QH 2YD6A 3ARZA 2OTWB 3T3MF 4Q6IB 4XGZB 3SKOA 3FRPA 4HJ0C 4X5WB 2ADIA 1YY9C 1ULVA 2MKWA 1J88A 1EBAA 3MBXH 1EFXD 2AQ2A 1U58B 3MV7E 2ZNWA 4LLDA 4G6FD 1ZVYA 5C7XL 2FGWH 1SYVA 4PRPE 1HWGB 3QEQE 3MLZH 4RFNC 1X44A 5C09B 2DM3A 1FDLH 3SDDC 4KROD 2D0HA 3MLTA 4MLIA 3RHWK 3G6JB 2HVJB 1DBML 1X5LA 1H3UA 2BOBB 3C8DA 1DUYB 1TZGL 1FNGB 1OL0A 2J88L 3H2WA 1P84K 2DBLL 4JFQB 2A1WL 5KW9H 5L2JB 4ISVA 1K4CB 3MV7B 5HHXH 2CDEA 5INCA 5LGHH 2Q8BL 1MFBL 1B0GB 5GRWA 2YSSA 1FFQA 4PRPB 3QEQB 2B20A 5CP7A 3RX8A 3UCRA 5DFTA 3MOAL 3B5GA 2P5WA 5HGAA 3W9EA 4OCMC 4G8GD 3QXWA 1MCKA 5CIPB 3N1PC 5GSRA 2PF6A 3C9NA 5IOPB 6FABL 1CF8L 3C08H 4DFIA 3HB3D 2NYYC 3KG5A 4LKCA 4KJPC 1FVCB 2DRUA 4YDJA 2P5ED 4TOYH 4X99B 3E6HB 2NPLX 4R90L 4Y8DC 4CGTA 1U8PB 4DAGL 4KPHL 3B4NA 1MCIA 3U9PL 5DTFB 5T33L 4JM2C 4HMCA 1AC0A 1F00I 1ETZB 5JPNB 1XF5B 2HFFB 3WFBL 4JG0H 2GUOA 4PJBA 2BSRB 3GSNA 5ERWA 3BGFB 4KAQH 4F7CA 4CJ1A 1SYSB 1CL7L 1J8HE 4D0CB 3L1OL 5I0DA 3IF1B 1OAKH 1JK8A 1TVDA 3KS0H 2DB8A 1HH6A 1FL3B 1UM5H 1PKQE 3VI4F 3LQAL 3DVNB 2YPLD 3L3IA 1KYOK 3IJHB 4RAHA 1B0RB 5SWQA 4POZD 2KH2B 5DRZA 3RVTC 3QPQC 3VFWB 5C0FA 2Y23A 4NNPL 2AJVL 4U6YA 1QEWA 5E1AB 4O2EA 3S5LA 3QA3B 4J4PA 1MHPH 1C16B 1KYOJ 1C5CL 1Y0LB 4PJCA 1UENA 3BO8A 4HF5L 3LN4A 1J8HB 3VFPB 5BZWA 5C0IA 5IB1B 5F71A 1JZ5A 2JJUA 5E00B 2ED7A 1MCOH 1FZKA 1WZ1L 4R3SB 1KPUB 1JCKA 4OD3H 1YJDC 3C5SB 2IWGA 1F45A 1PKQB 5EC2A 1MFAH 2NR6C 1DSFH 4JE4B 4LLQB 1LO2L 2FJFA 1WLHA 4MA1C 2EDOA 3MRFB 2A74A 4XVJH 1E6OH 4HZLA 2X05A 3QQ9C 4WFHE 1F3DH 1JPFA 4Y4FD 4U0QB 5JTWA 3SDCB 3GRWA 4NKOB 3X14B 3MUGA 5DEZA 5EC1A 1T22B 5B3JF 3FFDB 3BD4A 2ITDA 5DEFB 4OM0H 1E27A 2R23A 4KQ3H 4E41A 1GAFH 2JB6A 5HGBB 5DUBA 3ARFA 4M43L 3FHAA 4O9HL 5FGCE 1T83A 1DR9A 5E8OA 1U92A 1L0QA 5C6TL 3EYUH 4Z7WF 4CBPA 1MCPH 1N8ZA 4GOSA 1YYMH 4Y19D 1UEYA 3QPXL 1EJ6A 4L1DA 1ZT1B 5K9KA 1XZ0B 1I1RA 4QHNA 5CS7A 3TH2T 4PG9A 1G7LA 2XWBB 1EFXB 3ZO0A 2VDOH 2Z8WC 1T03H 3GHEL 2ZUVA 3DECA 3MRBB 4G6FB 4OLWL 4HPOL 1YUHB 2R2HA 5DHYB 3C8HA 5FGCB 1DLHB 3QIUB 1JYWA 3C5ZD 2GTWB 4G8IA 1OSPH 4U1LB 4BK4A 2VIRA 4KROB 2R9HC 5H2BA 2X4NB 3O4OB 1PSKL 4V2CB 5E8EA 2ZPKH 4XCEB 2KPNA 3L3HA 4HFUL 3RAJH 1EO8L 3AAZA 3VXRA 2FIKB 1U8JB 4KHTH 2X89D 3QDJD 2XN9A 1UCTA 1MJJB 3GIZH 4HK0A 4PGDA 3S88H 2NZ9C 4RIRA 5LWYH 1NEZB 4KI1A 2AJYL 1UB6B 4WV1A 3HE7D 1W72B 2VDRL 3GSVB 5C0BA 5INDA 1UACL 2Z92A 5GS1B 5TF1L 1VFUA 3RZCD 1S9VA 5F7HA 1VADB 3BPOB 5JORB 5D7SL 5E5MB 3KPNB 4FQJL 3VFOB 3TLRA 4XWGH 3H9YA 3UYRL 3ZL4H 1BM3H 3RUGF 4EDXB 1EMTH 5DVKA 2YPLE 4CMHB 3CSYB 3BH8B 2FJHB 2K3TA 3TN0A 3L3KB 3PL6A 1KGCD 3BXNA 1CLZH 5D2NA 2F5BL 4JKWA 1W0WB 4MS8D 4WHYH 5GS2H 2AEPL 3MLWL 3K2UH 5A2JH 2DQJL 2R4RL 5ANME 4JGMA 5B4MC 3KXFA 2A38A 3CFCL 4QXGL 4C55A 2GY7B 1BLNA 3UJTH 2N1KA 3LS4L 3VGGA 4JDZB 4ETYA 3FFCD 3OJDB 1JPSL 4L8BA 4EI6A 3FT2A 4PJDE 3BPLC 4MJ6A 4G6AC 1KULA 1RQ5A 1KXVC 1F4YH 2X44D 1MCBA 2YPLB 3IXTB 4M5YH 5EOCL 1BREA 4K3HA 4P46C 5LAXA 5JNYA 1MF2L 5C0EA 5TGBB 1SMOA 5EORL 2J8OA 3RGVC 4P5KA 5HDBE 5EZIL 1ZLSL 4YIQB 5L2KD 1XMWA 5ANMB 1IZKA 1YPZA 1F13A 1OARH 3PWUB 4FXGB 2ATPB 1HQ4B 4XPFH 3AM8C 4JFHD 2ZSWA 4P4KB 1LWRA 1VSCA 3W39B 5ITBH 4NC1C 5E7BA 3QB7C 3MNVB 4PJDB 4S10A 2O5ZH 3V7AG 4M8VA 4M7LH 4ZO7A 3D2UA 1FFOB 5FHAL 4MXQC 1RZIA 2W9EH 5ISZA 1P69B 3PV7A 3U4EA 3V4PL 3OKKB 1A7RL 2DQTH 3QNYB 2BC4B 1MHHB 2FCBA 3OZ9H 1ZKAA 3D85A 3UJIH 4Y19E 3HZVA 5DC4B 4UDUA 3ZMRA 4PLOB 4XVUC 3PHSA 5D71L 3T0ED 5IFHH 5GGSA 4HLJA 5L8LB 2A9NH 3EO1A 3BYTA 4B5EA 1QO3B 4HKZB 1WIUA 1G7PA 4W6XB 5CJOH 1I75A 1YQ2A 3GSOA 4FTVA 5E2WH 4IMLA 4ODTL 4ZXBB 3FL7A 4TULH 4K3JL 3GDBA 4S1DD 3O3DA 4XPBH 5I74B 1HYSD 3U36B 1RK0B 5GSVB 2PKDA 3W82A 4XP1L 3DTXA 3FQUA 1OW0C 1U3HA 4XPGL 3KR3H 1SJEA 2G60H 4LQFH 1CTNA 4YXKH 1V5JA 4G7YL 4Q6YA 4QRQB 4Y19B 3D9AL 4ORGB 3V6ZB 3KS0J 2FHCA 4E5XA 1L6ZA 3SBWA 4O51B 2HAZA 4QRUA 3IT8D 1JL8A 4L5FL 4PJIF 2E27H 3IXAA 4EN3D 5D1QC 5CEYB 3QDJE 1MPAH 3EYFB 5DSCB 4UT7L 3VWJD 4PS4L 1FGVH 3P9LB 2VXTH 5JO5B 1S9KC 4NJAH 4ZG1A 5ICZB 2Q76A 3C5ZB 1KCKA 2FO4A 3DUSB 5LKNA 2WSKA 4POYA 4PJ8D 3CZFB 5EO1B 4F8TA 3R8QA 1BPVA 1HXYB 1C12B 4HIIB 1NQBA 4XMKH 3RPIB 3H9HA 3OGCA 3M8OH 4PB0H 1AIFB 2MHAB 3TA3C 4S1QH 1MLBA 5JW4R 4J23A 2CLZB 4J6RL 2JJSA 2GCYB 3IKCB 4HGWA 5JHLL 1S9YA 1U8OA 3QDJB 3CMOH 4HS8H 5GGRY 3G6AB 1RZKH 3SKJL 1F3DJ 2VDQL 1S78C 2X40A 4NBZB 1CFQB 3GSNL 3O4LA 3GJFH 3DGGB 35C8H 4YE4H 3V0WL 4FABL 4IBLT 2WP3O 2R69L 4LSQL 4U6XB 3FT3B 4LCWA 4MCYA 1QSVA 3RZCB 5J9PB 3FFCE 3F58H 2YEZA 1TZHA 1CE1L 1XGTB 1DBJH 1I1FA 1JZ7A 1NGZB 4GXUM 2COQA 1KPRA 3MRRA 4YDVA 3DMMD 4J12A 4OCYH 2VSDA 3MBED 2BVTA 1CE6B 3I6GA 2BHZA 1TJHH 1NGPH 4JPIB 25C8H 5C3LD 1OF2B 1ZLVH 3SEPA 1BX2B 4ERSH 1NLBL 3NCFB 4KZEL 1B4JH 2HH0H 2VQTA 3K1DA 4RFOH 5TFSH 2YD9A 5L2KE 2BVEA 3FO1A 3ABZA 3TVMA 2WIIB 3D0LA 4Z7UF 1N5YH 3GI8L 3T0DA 1FL6B 3V4UH 2VLRE 1RZGA 4DKEL 2V7NA 2DM7A 4JO4H 3FFCB 5F3HB 3C60C 4F7TA 2WBWB 5DUML 5FOJA 3BSZH 1JWSB 4QGTA 1NDMA 4DCQB 3IDNA 4OB5L 4OUUA 5D1XD 5HGDB 5KVGL 5CJ5A 2OR9L 3U46B 4HZAA 3GRWL 2XTLA 4KQ4H 3CXHK 5FB8A 4FP8H 5FOBA 2BVQB 3BI9X 1DUZB 2R1XB 4OUOA 5L2KB 3O8XA 4YZFF 1EO7A 3F7VB 2PTTB 2VLRB 2JKXA 4NQVB 3SGKC 3DV4A 1BVZA 4XMLL 5EBGA 4OLUH 1PY9A 1LHZA 2XQBL 4Y16B 1R3KA 2WNGA 3HZMA 3MUJA 1S9WA 5DJ2B 4PFEA 2BRRL 5GRJL 4L3ED 1KTLA 1FIGL 3ARWA 1JNNL 3CNKA 4CW1A 4B53A 1ZSDB 4NP4H 2HTLC 3KYNB 3X17A 4LF3B 1GYAA 1VHPA 1WAAE 4LHJB 2CR6A 3MZGB 3WL9A 2ESVA 3TCXA 4UV7L 4HDIB 3RL1B 3RI5K 5J57B 1FGNH 1EO5A 2V9QA 1ZE3C 3V6FA 1A6TA 2OYPA 4N5EC 2FH6A 5E94A 2EIBA 3VI3E 3SE3C 2Q87A 2XACC 5CEZH 1RUQH 4UOW1 3BGFC 3Q6GL 1N0XL 3EJZD 3KLHD 1I8MA 3RKPA 4YHNB 1BQHG 1MFCL 2EKSA 3E6FA 3WFZA 1UKTA 3HRZB 4CMMA 2YUWA 4ZDHB 4X6BB 5GRUH 4NO5B 1E4WL 1VDGA 1DQLL 4QRPA 1B88A 4Z7OE 1GCFA 1IGMH 1R5IB 1EAPB 1KIUA 2H26B 32C2A 5D1ZC 3QHZL 5FGBA 3TM6A 2QADC 3GMQB 5JW3H 2V9RA 3NIDE 5M95B 3FQRB 5IT2L 4OD1L 4QRSB 5SX5K 2P47B 3BP5B 1A7OH 4U6VL 5CUSL 5ID1B 4GW5A 2PYFB 4ZPTA 4OKVB 2FD6L 3L5WB 3FRPG 3I6KB 3PXHA 5CINL 4XNQA 3SO5A 1F02I 2DI8A 3DBXA 4U1JB 5FHBH 1V7MH 1AGCB 1ZA6A 5HSFA 4JPVH 3CAFA 1H8NA 2QTEA 1A64A 1OP9A 2OTUA 3QCVL 2XA8L 3EJYC 2RIKA 5GISL 3B9AA 3EO9H 4V1DA 2AJUH 3LEXA 3LRHA 4WENB 4KMLB 2OSLA 3LD8B 4PJ8B 3VXOB 5E99H 3BW9A 5ID0A 1IILE 5LGJB 4ZNEE 3HFML 4WTWA 1TPXB 4X5LA 2MPAL 2NY5C 2CIIB 1MRFL 4LNRB 2DQUL 1FZOA 1TJGH 2ILLA 4O4YH 4X9GA 3VXUA 4JR9L 3GMPA 2B8OT 4P23A 5TPWL 3QSKB 1WSST 1EEUA 3QI9A 2QQLH 1LE5A 5E6ID 5C07E 5IBUG 2B2XH 2NY1D 4X7TA 3KWWA 1FAKT 3DYMA 3QH3B 1CFNB 4R4BA 3SQOH 1INDL 5IMLA 3L3DB 3EO0A 1CFSA 3EBAA 4XCFH 1CFTB 5EZOL 4ODVL 4X7FC 3GNML 4QHLB 4H1LG 4PUBL 2R1YA 3MBEB 3HR5A 3MLUL 5CHNA 2EDLA 1K3ZA 3FB7B 3FRUA 4APQA 2XG5A 5C0CD 4ZUTA 1XR9A 5KSAA 4IDJH 1NDGA 5B39G 4ELKB 2GI7A 4OKDA 4NC2B 2ZNXA 4ODUA 3DPBA 5C07B 2X9WA 5I16A 5DI8B 1DQQA 2EXWC 5H35A 5GRVK 4CAGA 1N26A 4WW2A 3QIUC 1S3KL 1MRDL 4LLMA 4AM0A 4X6CE 2NNAA 2VAAB 4NT6A 1BF8A 5E4IA 1AGFA 2RJMA 4BSWA 1YN7B 4L3EE 2VQ1B 4NKIL 4QGYA 2VAJA 5D1XB 2AABL 4ZOEA 4QNPE 5GGVL 4LSUH 5LG1A 5GJTH 4RCAA 4JZJA 1RJYA 1CR9H 4EEEA 1S8DA 1KG0B 4CVZA 1KN2L 2C7UA 3VXPA 1PBYA 3TNNA 4PJEA 3UTTE 2ORBL 3VFMA 2IMMA 3MO1A 3RP1A 1TQCB 4MB5A 4WO4D 3GJFK 2C5DC 5D4QA 4X6CB 4PTUA 2HFEA 5ICYA 1ERNA 5DMYA 5DFVC 5BV7L 3BPOC 3HCVA 4XHJC 4L3EB 3MCG1 3DX7B 2W9DH 4XPAL 1YN6A 1REIA 3C2SA 4MDIB 1HE7A 4KK5C 2R0LH 5J6GB 3CVIH 3P4MB 4XP6H 4CMHC 1TCRB 1NCWL 1BMGA 1CLYL 3QCTL 3RBGA 2ZG2A 4JDVB 4OV6F 5IP4A 3BH9B 5HI3D 2VDKH 3FTGA 1A6AB 4UZGA 1ZLVK 3UTTB 3LZFL 3TJEH 3P4OB 1EVUA 4OLZL 3ZE0E 1U95A 1R3IH 4OI9A 4NWUL 4WHCA 2AW2A 1QKZH 2VH5L 1WBZB 2Y4SA 4D3CL 3QJHB 4FFWC 1WWBX 3D25B 3PGDA 5FUOH 1BBDL 3RIAK 1F8TL 1Q9OA 1JF1B 2YD2A 4YUEH 4RAVA 5DMKA 5HYSB 5DJDA 3LAFA 4BUGA 3U0PB 5TDOB 4ZPVA 5GGUB 4NQCA 4WY7L 3KPQA 5EBWA 5D8JL 2ZUTA 5JLZB 4RQQA 3M17A 1CD1A 5CJXA 1IGIH 2FIRT 4PLJC 1T1ZB 5DJ6A 2X1QA 1AE6L 1CDUA 1S7XA 4WHTA 4WUKL 5FYLD 5IVXA 4M4PA 1OCWH 5EU3B 3BUTA 1P9MA 1BVLA 3L95B 3K2MC 1FFPA 3OJ2C 5IEHA 3TESA 3LH2L 2HA1A 2BHYA 4U05A 3ULVE 2FYYB 3KPLB 2IAMD 4P4KC 2CMRH 2IBZX 1V3JA 2VNCA 3GKWH 3LIZL 5DEGA 3SY0B 1VEOA 2HTKC 3BP7A 1XGRB 5H94A 1JTTA 2IFGA 4Q9QL 2ZKHH 1VEMA 4FG6C 3TT3H 1WFNA 1BEYH 3MBXL 3DSFH 3R06A 2R39A 3WFDH 1SY6H 4Y5VB 4KI5D 3JWNC 2QQQA 4LLUB 3BZFB 2X4OB 1DVFB 3QQ4A 3N85H 4EUPB 3VE0B 5C0CE 5LGKA 1NCAH 2FGWL 1D9KA 3OKOB 3MLZL 2OBGA 4GBXB 5I8EB 5AD0A 1N64H 5IVNA 5T3XD 1KJMA 1FDLL 4BKLB 5BJTB 3Q0HA 1UJTA 2VDMH 3B2UC 4FA8A 1U8NB 2NY1B 3TO4D 4ZXBC 3GIVA 3RWIB 5MERA 5DK0A 4OF5A 5I74C 1OM3H 3TNMA 3UTQA 3QWQB 5FO9B 3VDAA 3RWCB 3HUJF 2Z8VC 5DUPH 3IU4H 4WIQA 4F33A 1VERA 5GZND 5EUKB 1DQTA 5LGHL 2XWTB 4P5TD 1TENA 5C0CB 3PWJA 3RJQB 5I66A 1IGJB 2C3WA 1N5AA 3M1BB 3MJ9H 2DWDA 1HQRB 4TSBH 4LAJH 1XGUB 4H26A 4P3DA 4GRLD 5JIPA 1BBJB 1XF4B 4JFOA 4HG4K 3MNWA 3K4ZA 3ZT6A 2C3VB 5GXBB 1LE9A 1UCBH 1IZJA 1A14H 1TVHA 3C08L 1N2RB 3HE6A 4TOYL 5T1LA 1R6VA 5DJXB 3TH4T 3SOBH 2E5EA 1NBYA 4URTB 3L7FB 3CU7A 2DLGA 3B9DA 1YY8A 2JJTA 1I7RA 2W0PA 4JN1H 4JG0L 4I2XA 1C08B 2IPKA 1HI6A 4Q9RL 2HLAB 3GJFA 4KAQL 3SGDH 1MCWM 1S7SA 5LBSH 2GJJA 4DWHA 2FJGA 3MGOA 1OAKL 4CVXB 2VE6B 2SEBA 4K3DH 4UQ2A 1JMXA 1ORSA 2XKNA 2DQDH 3BGAA 3T3PF 1UM5L 4X7SH 5DS8B 5E9DA 4ZSOE 2XZAH 4PJ5A 3NFNA 4IOIA 4Z7VF 5KVDH 4KK6D 3RDTD 1K8DB 4Y5XB 2C4XA 3GB7B 2AI0H 3SCMD 1SM3L 1DJSA 2JJWA 5DYOA 1E4XI 1I8KA 3K3QA 1MHPL 2AK4A 1X9QA 5K9QG 3ECBA 4DVBB 2CUIA 2HT2D 5EBLB 3GBNH 1CXLA 5FKAA 4RAUA 1XCQB 1MCOL 3UTOA 2FBJH 1U8IB 2EDXA 4X98A 4OD3L 3EYOB 3I85A 4BQCA 1MFAL 4ZSOB 1DSFL 1I7UA 3STLA 1WF5A 1RU9H 4XVJL 1E6OL 4JFZH 4K07A 3WNMA 1QSFE 2EYRA 4XNXH 4WTZG 3RTQD 5CCKH 1AP2B 5B8CB 2YMXH 2I9LA 2FZ3A 2HMID 1NC2D 5DD5H 2ENYA 3C6LD 3ARBD 5ICXB 2APTA 1NAMH 1FZJB 4OM0L 1GH7A 2ATKB 2P8PA 3BIKB 1VGKB 4KQ3L 1GAFL 3QXAA 5ESQA 2WZPD 4NUGH 4ZFFA 5IVZB 2DLFH 3STZA 4GKSA 1P4LA 2IAMB 2IQ9H 4Y16C 1RULH 3SGEH 2IMNA 3GMMA 3LMJL 3EYUL 1MCPL 1K8IA 1QSFB 1U8KA 3OPZH 1YYML 4M61B 2R15A 2ZCHH 3LQZA 3OR6A 1V7NH 1FP5A 1GOHA 2AGJL 3WKNA 4Z0BH 2H32H 3P0YH 4PB9H 4RZCB 4YXHH 5JDSA 2VDOL 1T03L 1M6OA 5GZOC 4PJHF 5D72H 4ZNCD 4RX4D 1EEYB 1CVSC 1QFOA 4Z77A 4XCYB 4DQOH 3QQNA 5J7CC 1H3PH 4O58H 4MQXC 4S2SB 4UIMB 2J7LA 4HIHB 1AQDA 4OGZA 1OSPL 5DRXA 4LIQE 2MJWA 3TO4B 4TNVF 1T66D 1YDPB 4ZYKA 5J1AB 2ZUXA 3O6FB 4ZFZA 3N06B 5DZOA 3PABA 3RAJL 4F57H 3VRIB 1OHQA 2HKHH 1JP5A 43CAB 3REWB 2VZ3A 4KHTL 4MCZA 2VLJE 3MREA 3MJ7B 4PJ7E 3E2HB 3MR9B 3GIZL 3MFFA 2LAGB 1FV1B 1X5GA 2AQ1A 3V2AR 1PYWB 3QULB 4JANB 5LWYL 3AXLA 3QDME 5HI4C 5FXCH 2PW1B 4PPTA 4YHPA 4PY7B 4P9HC 1Q9KB 4LARH 3TBSA 4F2MA 1YMMD 1X5KA 4G9FD 4GRLB 4XAKD 4M48H 4N5UA 1OTTC 4Z7QE 1I1AA 1NCNA 2XNAB 4LSDA 4XWGL 5DJCA 5CKAA 5I71B 4ODXA 4H20L 1BM3L 4QWWD 4UDTB 5C2BH 4PJ8C 1EMTL 3I50H 5I75B 3IDYB 5EULV 2VLJB 1TPXC 4PJ7B 3VRJB 3QDGD 2H3NA 4MDJA 4F3FB 1CLZL 1DLFH 4PRNA 2FL5B 3D0VB 4K71B 3MRPA 5I1LA 2ICCA 3CK0H 3QDMB 1IVLA 1JWUB 3BWAA 4L4TA 5K9OA 3K2UL 4KV5E 4YJZL 2XG4A 2FWOB 1GOFA 3THMH 3PP3H 3UJTL 1JGUH 1UQSA 1T1YA 4K23H 3BQUB 1J18A 2V2TB 2DQFB 1KN4H 1F4YL 4M5YL 3NFPB 1OGTA 1NJ9A 1ZT4B 4N1HB 4JN2B 5ABDE 3IDMA 2UWEE 2H9GA 1FYTE 4P2YA 1GGUA 2A73A 1P2CB 2NY2B 5D7JD 1OARL 3IDIB 3MODH 4XPFL 4RGOL 1OAZH 4Z6AT 1XGQA 5ITBL 3QUZB 2F8OA 5F1SA 3DWTA 2O5ZL 4PV8B 1L4IA 2C1OA 15C8H 4UNTA 3GGWA 5T5NG 4M7LL 4TTDC 2XXMB 2W9EL 4OZGE 3ARED 3NBNA 1BECA 4U1HB 4I13B 3MLVH 4WU5B 1NFDA 1WT5A 2DQTL 2UWEB 3RTQB 2Y5TB 3OZ9L 4EVNB 3PQYD 1YEDA 4OQ1A 3UJIL 3WNOA 4XNMB 1FYTB 5L9DH 3IFOB 3PWVA 3ARGD 3C6LB 3B9KA 2Z93A 3ARBB 5IFHL 5IG7A 2A9NL 1VKXB 5D9SB 4NNXA 4GG8A 1F6AB 3QEHA 5H37H 5CJOL 3QFDB 1JIBA 1PQZB 2IQAB 3QIWD 4WUUD 3UTSD 1TQCC 2EE9A 4NSKA 1Z3GH 4KRLB 4TULL 4WDIB 1PZUB 4OZGB 3EDDA 4PRBB 4XPBL 3TN0C 3PL6C 4ZOBA 5DJ0B 3V7AE 1OVZA 3G9VA 3WO3B 5E2UH 3JV4B 3KR3L 2G60L 4QT5A 5DT1H 3TF7C 2QEJA 4LQFL 3KPRA 3ZTJG 1N6VA 5AZ2H 1IEAA 4YXKL 3Q48A 1JGEA 2O5YH 1Z9LA 5DJYB 1AXIB 3DYOA 5HHPB 4U2YA 5IROC 1Z5LB 1G0XA 2E27L 3QR2A 4F7MB 1R3JB 5EZLB 4E0RA 2E7LC 1MPAL 4Y4HB 4YHLH 4HGKC 4LCYB 2GTZA 5D96B 5GRVL 5EUOA 2HT4D 3FN9A 1FGVL 1JE6A 2VXTL 3QUMH 4NJAL 1JTPA 4YO0A 5F9OL 1NC4B 4WWKD 2P8MB 5AZEH 4PJAF 1YMME 4X5XA 1ZWIA 1WIPA 4M6AA 4XMKL 4IRSA 5JW5B 3M8OL 2GITB 4S1QL 4U4BA 3OKEA 3K8KA 3HNVH 1MLCA 4KRPB 3NH7H 5J8OA 3CMOL 1JN6B 3O9WD 4HS8L 1WUNT 2NMSA 3O6KH 2FLRT 4LHUA 1RZKL 3WDHA 1MSPA 2JF1A 1D6EB 3MLRH 35C8L 4JO2H 3JSSA 4YE4L 3F7YA 1HXMB 4YEEA 3CDGB 3CH8A 8CGTA 1T4KA 1YMMB 4Z78A 2C1PA 2H45A 3BZDA 3F58L 4I5BA 3IFLH 3QNZB 4HWZB 5IR1A 3T2QA 1DBJL 2EYSA 4WGVB 3ULUE 2WIMA 3ZDZF 4OCYL 3JWOC 4U33A 3HPLA 1HOCB 1TCMA 1SY6A 1D5ZA 2HFGL 1TJHL 3C8KA 2AV1B 1NGPL 25C8L 3AROA 1JI2A 2NY3B 4Z76B 4LLWA 3TV3H 4ERSL 5ACZA 1UGNA 2Z4QA 1B4JL 2HH0L 1DVFC 2JCCF 4RFOL 4UUJB 5TFSL 1FSKB 3ULVC 2X7LA 1R3LA 4ONOA 3VH8A 4FQHA 1N5YL 1QSED 3V4UL 4NO3B 3CX2A 4GBXC 4JO4L 2DKUA 1CN4A 3DOSA 4J7RA 3V8CA 3BSZL 2J6EH 1XGYH 2BVYA 4JKMA 2X4UA 2R2EA 3QEUA 1FJ1B 3IFNH 1FRGL 1U93A 2Y6SD 4GW4B 4MLSA 4RA0C 1B4RA 1BIIA 4FP8L 2BNUB 1VFBB 2YUXA 4OD2A 1G7IA 3MJ9A 2CRIA 3GSQB 5E5UB 5D7JB 1T5WB 5FF6A 3U2SB 5CWSB 2IBZY 4J3OC 2WBJB 2UZIH 4OLUL 1MCJA 4UBDD 2ADGA 2IAND 1X5AA 3RWEA 1A6PA 3OV6A 4WUUE 1G9ML 1I1CA 3UTSE 2JJSC 1DE4B 3WFHB 4TUOB 5HXMA 1KNOA 4JKPH 3REVB 5CILH 4F7EA 4LCCB 4NP4L 4BZ2L 1U8QA 1L6XA 2JB5L 1NCBH 5F9JB 4X6EB 2VDNH 3PE9A 2M8XA 3ALPA 3C6SA 1XT5A 4MJ5A 1JYNA 3KPOB 4CADB 1FGNL 4OAWB 3U0TA 3EFFB 1AD9A 5C92A 3PV6B 4CL7A 2G9HA 2PTUA 2EDTA 3T8XA 3AMLA 3PDOA 4HUXB 4B7IA 5KSBF 5EZJB 1WFOA 1RUQL 1IKNA 1LDPH 3MYJA 4P2OD 1OTSD 1TXKA 2R0WH 3K1KC 4BELD 3RVUD 8FABB 4J8RA 1HHIA 3BDYH 4WUUB 1D5IH 3V0AC 5HI5D 2E9IA 1TTGA 5F7LB 3HC3H 5GRUL 4P2RA 4MNGE 2X70A 4NQDD 3FN0H 1VENA 2D7TH 1IQDB 1IGML 3OAUH 3VD7A 1J86A 4Y5XC 1YJDH 3D18A 5D7LA 4GRMB 4OZHA 2IALB 5JW3L 4JHWH 4NIKB 3SGDI 3LV3B 4X6DF 4WU7A 4MXVE 4Z0XB 5IV2B 1A7OL 3VXQA 4QLRA 4KJYB 4DZBA 5GS0H 5F7UA 1DEDA 2X4TA 3VCLB 3MA7B 3L5XH 3P4LA 4GMTH 4J4PD 4EBQH 2DMKA 1FO0H 3TYGH 5EOTA 5FHBL 2R2BB 3V5KB 1VACB 1Y18A 3FOMB 2RQ8A 1GZQB 1KJ3L 1KLFA 4MNGB 4YDIH 4GRWF 5IJKA 4GH7B 3EO9L 4WWKB 2AJUL 4OFIA 2XKSA 1K6QH 4F15B 2X4RA 3MROB 4TN9A 3GSUA 4ZAKD 5IFAH 5E99L 3WLBB 4J3WA 1DP0A 2XZZA 4Y8AA 4HEPG 3O8XC 1LEGB 1NGWA 2P8LA 4KZDH 2VZVA 4NRXA 5B8CC 4KI5F 5EPMA 5J56B 4NQXB 2D4FA 4X4YA 1NAMA 5JIIA 2CK0H 4O4YL 4N8VA 5HHQB 4BQBA 5DD6A 4D8PB 1ZHLB 4K8RD 4MGXA 4C83A 3V5HA 4E42B 5DVMA 3O9WB 2F54E 1AGEA 2K7PA 3PJSB 4NUJA 1D6VH 2NY0B 4I0PD 2YWZA 3VMOA 2QQLL 1F11A 1BQHB 1MEXH 1DQDH 2CRZA 3CFDB 3BESR 1LEIA 4OCNC 5FIEA 3TO2B 2B2XL 2IG2H 1A7PH 2MWCA 5HY9B 1QSEE 4E41D 3H7LA 3SQOL 3ARFD 1ZHBA 2C4FU 3EOAA 4LGPB 4XCFL 1T6VN 3CJJA 1NGXB 2H32A 4OIBA 4HMDA 2IGFH 1K9TA 5BVJA 1QVOA 4NYLB 2F54B 3SKOB 2WUBH 4I3RH 4U1KB 5IEKA 4IDJL 1G0YR 4GG6F 4X4ME 5DC9B 2W65B 2WQ8A 1QSEB 3PHQA 4Z5RA 4MA3B 1PKOA 4JY5H 3H6JA 1KOAA 4JPWH 5DRNA 4RGNE 2IANE 1DQMH 1RVFH 3MRKA 3O6FC 5E7FA 2H6PA 1OLLA 4FFVD 3NZHH 2ICWI 4LVOB 1I3RB 4LSUL 3LN9A 2P24A 4N0UA 5I15H 1CR9L 1I8IB 1FFNB 5CAYB 3VXRD 3E2HC 4K94H 3DVGA 1KLUB 4FXLA 5TQ0H 4MD0B 4X7DC 1PW3A 3CFBA 1JGVH 3IJYB 4PJXF 3AY4A 5CMAB 4AIZA 1R5VA 4LBEB 2HWZH 1LK3H 5IBUB 2YRPA 1G6RB 1YEGL 4GS7B 2Z31B 4A6YH 5EN2B 3WMSA 4RGNB 2IANB 3WNPA 1TVBA 1ES0B 1U2HA 1NUFA 3BEWA 2OI9B 5C0BD 2X9XA 2W9DL 4ELMF 4OZIF 1X5YA 5I71C 3D39E 3MRJA 4JFEA 5KVMC 4NQDE 4P23C 2R0LL 2YZ1A 4H1LB 3CVIL 4LSPH 5I75C 3IDYC 3QI9C 1D3CA 4XP6L 3HA0A 5F9WB 4L4VA 3NTCH 4YDJB 4OF6A 4L29B 2BY2A 2VDKL 5B39B 3MRDA 3WS3A 3S3JA 3CX5K 2DM4A 4KRNA 3TJEL 3MACH 3STBA 5IMMB 1R3IL 4JZOB 4F80A 1KFAH 3FB5B 4P2OB 2BMKA 2YD4A 1QKZL 2QR0A 4R7NB 5HDOA 4MNQD 3BQUC 4PJFA 3CX5J 3HKFA 4J3UA 5FUOL 4YR6B 3D39B 1JK8B 2B0SH 4NQDB 2GQHA 4YUEL 2PETA 1HH6B 3ARPA 4U2ZA 1JHTA 3X11A 5MEOA 2RCSH 3U7WH 1MIMH 1N3NB 2D9QB 4YHIA 3MGTA 4M5ZH 5L0QC 3ES6A 1ADQH 5BRZA 4L8SA 1KIRA 3FMGL 4QRRA 5IFJB 1XF3A 1IGIL 3WO4B 3EDEA 4R2GD 1BFOB 3VD5A 4DTGL 5HGHB 3FHQA 1A7BA 1R5WA 3FQTA 1OCWL 5FM5M 5F9AC 2NY2C 1G7HB 5MEQB 4KK8C 3WD5H 1MELA 3ARXA 4F7PB 5BXFB 2AKRA 2CMRL 2GAZB 3KDMA 4GUPA 4PJGE 3QUZC 4J3VA 1CT8A 3TJHC 5JMOC 3MLYH 3GKWL 2HJKA 4YBLC 1D5BB 4JZJC 2EIDA 1JRHI 4XZUB 1WEJL 2QJDA 1MNUH 4ZAKB 2BSED 4QHMB 5L7XH 3HR6A 1NANI 1LNUA 2ZKHL 3BFOA 3D2UD 1UB5A 1JZ4A 4RNRB 3TT3L 4JFXA 1QPPA 1BEYL 3DSFL 2Q7YA 4JO1H 1FNSH 1SY6L 2A6KA 1EHXA 3BPNB 2X42A 3KJ6H 4NNYB 4LCIH 1ZS8B 5I1DB 3HAEG 3HZYB 3N85L 4OZ4A 5HYJB 4TYUA 4MD4A 1AGDB 1NCAL 1NUNB 4N68A 4M1CD 4I0PB 4PJGB 2K9UA 4XCCH 3VD9A 4PV9A 1N64L 1X3DA 4BSVA 2VDML 4PR5B 3ILPA 1E27B 1T04B 1WTGT 1AI1H 3RKDD 3H9ZA 1S7QB 1HSBB 1OM3L 1YEHH 2BVUA 4FTVD 1S9XA 3X3GH 4C59B 2LU4A 2XZCH 4NKMA 4NFCA 5D2LF 5CD5C 2Q6WB 2VISA 3BISA 1MFDH 5E8OB 5DUPL 3IU4L 4HD9A 4IIQA 3QT2A 4BZYA 1EERB 4ZS6D 1KT2B 2YS4A 1U3HD 5C1MB 4PP2A 1ZHKB 3RX5A 5J1SC 3HI1A 2HVKA 3CFEB 4W81A 1ZLUK 4D9LH 5DK2A 1S7UB 1M7DB 3A6CH 1W0VB 2UY7A 4EJ1C 4Y4HC 3QUMA 3PNWB 4U3CA 5D96C 3MJ9L 5IUSA 4TSBL 5TJWK 5HYFA 1O7SA 2JJVA 4QY8A 2A6DA 5F1IB 5GGVY 3V95A 5D6CB 1QLRB 2ADJA 2C4FT 1UCBL 4XNYH 2EDNA 2R2HB 5D7IE 1A14L 1X5XA 3WNLA 5F6IB 4N0FA 4K3GA 3EOBA 3QNXB 2OP4H 3S35L 1WBXB 4WFFD 5GGSY 5C0BE 1XIWA 5KS9A 3SOBL 2VZUA 4FNLH 4CDGC 2ARWA 1XR8B 3MLPA 1F58H 3ULSA 1RUPH 2ICEB 4MMZC 4OFPA 2IEPA 4NQSB 4WI9A 4KRPC 3FZUD 5K59E 3V0VA 3D48R 5F89B 4JN1L 3JTTA 2DD8H 4Y2DB 3HI5H 3L3OA 5I18H 4UNUA 1G7QA 5LBSL 2NX5E 4BK5A 2WUCH 3V5DB 5ITFA 4X0KA 5HHNB 5D7IB 2DQDL 3O4LD 4HPYH 4HAGA 4X7SL 3HC0B 4FXKB 1EK3A 3I2CH 2XZAL 5KVDL 4MNQE 5MP6L 5HJ3A 3SDDA 5C0BB 4LCWD 4DZ8B 3WXWH 2AI0L 2D7NA 1OT1A 4NDMB 3WFCH 3O2DH 1K3IA 3E0GA 4NO2B 4LGSB 2LU3A 1BJ8A 3QRGH 4CKVX 2NY3C 3MCLH 5EIIB 2DL9A 2Q8AH 2EEAA