2X1WL

Crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
204
structure length
196
Chain Sequence
SPFIASHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKSYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/signaling protein
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR C
publication title Structural Determinants of Growth Factor Binding and Specificity by Vegf Receptor 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 196
sequence length 204
chains with identical sequence M, N, O
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1wL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1wL01
5SWSE 2H26B 1QFUL 1BEYH 4K07A 5CUSH 3UCRA 1PSKL 2E9IA 4GH7B 5BV7C 3SEPA 2ZOLB 4G9FB 1PZ5B 4G6FD 1A1MA 3S3SA 4EZMA 1YEFH 1N6UA 1EHNA 1NGYA 2E6PA 5BJTA 1MVUA 4XCCL 4KDVA 1RU9H 3ISWA 4HKBA 5E56A 5HBBA 5KVGL 3ZT5A 1Z5LA 3EFDL 3T1FB 4QRPD 4OLEA 1JPTH 4NQUA 3ARYA 4R8WH 4M5ZL 4RFNB 3VDAA 3N1MC 2HTLC 1R24A 5DYOA 3WDJA 1ZLSH 1JK8A 3THMH 4Z7OE 1SJHB 4LSRL 1X5HA 3U83A 5IEHA 1R3HB 4PB9L 5DWUH 3EDDA 3OAZK 1MCFA 5ALBH 4KQ4H 4Y5XC 4QRRD 5DHVA 1RJLB 1P4IH 1KG0B 1CFNA 1VPOH 4N68A 3MUGB 1OT2A 1DP0A 1OL0A 4LCCC 4Z5RB 2FL5B 3U0PA 3CSGA 1EHXA 4XX1G 1IGMH 1K85A 4P3CH 3O4OB 4KXZI 4CVZB 4XVJL 1GAFH 3UDWA 5LQBL 4JPKL 1IAIH 3CDCA 2EO9A 3SQOH 2NY3C 2MHAA 1JYWA 4ZG1A 2BNRB 2WINB 4HPOL 4TUKL 1QNZL 1RUAL 2ZCHH 2AQ2A 5D7KE 1TDQA 2VL5B 2X6MA 5KTEL 2D7QA 4P5KA 5AEAA 1I8LC 3U0WL 1EMTL 2ORBH 1ORSB 4HKZB 4PRIB 2O5XH 1QYGH 2V6HA 4XVTL 5F7KC 4GBXB 2EEDA 3KLHC 3SE4A 5BOPA 1P69B 4ZODA 1G7IB 5CLTA 3O3DB 5J8OA 5BS0B 2I60H 4WFHD 4MJIB 3RP1A 4AQOA 2F58H 3EJYC 4TNVF 4X7EC 4YHKL 5MERB 4C4KT 1N5YH 1NCCH 2E9WA 2WW8A 1MHEA 5CEZD 3AREA 3EOTL 4XP6L 1AR2A 2Z9TA 2P48B 1TQCC 1WBZA 3QPXL 4U49A 4YHNB 3SKJL 3BZ4B 3NA9L 4MJ6B 3BOVA 4CN4A 5EUKA 5F21B 5AZEH 1AH1A 2VDML 1IT9L 3R0MA 1NDGA 2D2OA 4JZJA 3ZKMD 4OF6A 2H8PA 4FFYL 4WW2C 5EU3B 4MXQC 3GMMB 2VLMD 2AK1H 4MVBC 2Q7YB 3P73A 2CMRL 4MNGE 4QHNA 4QXTB 5MENE 1AJ7L 1LO3H 1ZT7B 1ZWIA 1A5FH 1IJ9A 3GGWA 4KAQL 1KJ2H 1QQDB 1IQWH 2OR9H 3OG6B 2DQTH 5J6HA 1CT8A 2YD1A 3GUTB 4HJGB 4UB0L 1DBKH 2GK0A 1J10A 4HBCL 1AO7A 1BX2A 4Y4KB 2OYPA 4AENB 2EC8A 1NUNB 1T4KA 2WK2A 3G9AB 3MRGA 4XP1L 1OCWL 1U8KA 4L4JA 4TTDC 2V5SA 4G3YL 5KBNC 1H3UA 1G7JB 2GCYA 1WAAA 4M7JH 4JQXC 5GGVL 3JBG7 3ZDXE 1YYLH 1FL5A 2R1WB 3HE7C 1D5ZB 1KBGH 3DMMA 3K4DA 4YQXL 1IL1B 3LEVH 4LCWB 1S9XA 3VXUA 1IC4H 5BZDB 2X09A 4OCRL 3U48A 1FJ1A 4J2XA 5MP6H 1C08A 5IW6A 3VGAB 4XMPH 4OCNC 3ARBD 1NDMA 2QQNH 1MCPL 2PCPA 5C8JB 5IMKB 4WDIA 2UVFA 5FM5M 5F1SA 4YNYA 1MJJA 3GSQB 3SDAD 4EQ3A 4F7CA 4QCIA 3LRHA 3FFCB 4JRXB 4RGOL 2CR6A 3UTTE 3K4AA 1JWMB 5T1LA 3Q5TA 3C5SA 3QEQB 3CJJA 3UP1A 5KN5B 4MWFA 3MOBL 1OOAA 3CC5A 5KZCD 4W81A 3QQ4B 2H41A 1BVLB 4X6FB 4KJQC 1CGTA 1CQKA 2AXFB 1XCQA 5EORL 4CN1A 3SPVA 1IGTB 1YY8A 4MHHG 4Z7QF 2FHBA 4I77H 5CINL 1NCDL 1I8IA 1CICA 2PO6C 4KKBD 1OGAD 4L29B 4OFYA 4QOKA 1XEDA 2XN9B 4PJXF 2YZ8A 3O6FB 4BFIA 2NW2A 2YK1L 4C57C 2XZAL 5CZVL 3GO1H 1JZ3A 2P44B 4UV4L 4P3DA 4LHQB 2VDKH 5D1XB 4BM7A 4NM8L 2UY6A 2XTJD 4PY7A 3TP4A 1MCEA 3BD5A 1TJGH 5C1MB 4KVCL 2C4FT 1L6ZA 1FQ9C 1NLBL 4GMSH 4AT6A 5C2BH 5D1ZA 5GRUL 2O5ZH 1JRHL 5KSUA 4S1SH 2MCG1 3MLUH 3RAJH 1TZHA 4TPRH 4H88H 1LEKA 2LABA 4PY8J 4X99A 5H35B 5E4IA 3VXTB 5J1SC 2FR4B 1SY6H 5D1QB 1EEYB 2DQEL 1EEUA 3MLYH 1SMAA 3VFUB 2BRQA 3NFNA 2R1XA 5HI4C 2PTTA 1A3LL 3GIZH 3I6KA 5FHAL 1NCBH 3WN5B 2FX8L 3FHQA 5C09D 3GSOA 4YHZH 1J05B 2WBWB 1FLTX 3L1OH 3ARZA 1PQZB 3TV3L 4E41A 3D3VB 2QSVA 2APFA 4PB0H 4ZXBA 2YPVL 3JV0A 4EJ1C 4Y16C 5E9DD 5IMLB 3FQWB 4PJDF 5HDQH 5C08A 4D0BA 5FYLD 4M00A 1J1PH 2OS7A 3W5MA 4ZUVA 3RWGA 1TJHH 4BQBA 2O5YH 5IIEB 1MLBA 5ID1A 1ODAA 4RBPH 1LMKA 2ZSWA 1PKQB 2VE6B 5D93B 5GS0D 2ZJSL 2NX5B 5EFIA 1SEQL 2J6EA 3M07A 1IM9A 3FO9B 4ETYA 1BQHA 5GGTH 4G5ZH 5C9JA 2DJSA 1BJMA 4GRLB 3KXFD 4TRPL 4NJ9L 2OL3H 3CSYB 3HNSH 2APXA 4O02L 4JB9L 4JFZL 3BN3B 4MJ4A 2VH5H 1VADB 2FBOJ 5IFHH 1UH2A 2ZCLH 3SO3B 3NTCH 3FOLA 1VESA 1WIUA 3KG5A 1FNEB 4J23A 3HNVL 1PX4A 5KSBB 3P30H 2V5TA 1ZVSA 1KB5A 4A2LA 4G8GB 3HUJA 3SKOB 3ZYIA 1ZHLA 5I1LB 2YA1A 3A6OA 1TXKA 5EB9A 4M61B 3BWAA 4FQQA 2HJKA 2XACC 2DTML 2BY3A 2VTFA 1KIUA 3OR6B 3TBVB 1J0ZA 4AEEA 2FD6H 3QHZL 3HZYB 2V5MA 4MQTB 3OAUH 3R0NA 5AYUH 4GRWB 3LKQA 4R4BA 3N06B 4U0QB 3GM8A 4QHMB 5FECA 2AI0H 5HYEA 4HMDA 4LVHB 5DC0A 3VFWB 4RWYH 1WWBX 4YHPB 2XKSA 3SQBA 1QLRB 8CGTA 4Y5VB 4P2CG 4B5EA 3FT4A 1FN4B 1QVOA 4WFFE 3BDXA 1JUFA 3GSXB 4WY7H 4S2SB 3B9KA 1X4ZA 3B2VH 4HS6A 2PXYB 1XR9A 5T1KD 4C56E 2DLTA 3DX8B 3VRJA 1I1CA 1F5WA 5DJDA 5DVOA 2HG5A 1T1YB 1KIPB 5D71H 1U9KA 4PJXE 1ZS8B 1ZV5A 1PEZA 3CPLB 3EDFA 1Q9KB 3M8OH 1FNAA 1Z2KA 4NHUB 4ERSH 2AAVA 1H8SA 1A6ZA 5FO7A 4G6JH 5DUBA 1FAKT 1CE1H 4OV5B 4KK9D 5FV2A 1UH4A 4QRRE 3DGGB 5C0AE 2ATKA 3ARGC 1HCFX 3BIKA 4G43B 4I0PB 3KDMA 2H9GA 1YYML 2DM4A 2OQJB 3EFFA 4KRPB 1S7RA 2H2SD 3GSRB 2IH1A 4DZBB 3ZKMC 4PGDA 4Y2DA 2OCFD 1JGDA 5D2LB 3HC3L 2OK0H 4QXUL 2EIEA 3QPQC 5T5FL 4AIXA 3PG2A 1NBYB 2VXUL 5FDYA 1B0GB 1TLKA 3W0WA 4GXVH 4LL9A 2XZQH 3PDOA 4P2OB 2JIXA 2R0LH 4JHBA 5C3LD 3ZKSD 5FDWA 3A0OA 2X4UA 3MA9H 2OZ4A 3JV6B 2GK2A 5F7EL 3OMZA 3DO7B 1MRCL 3G04B 1NJ9A 2ZCKL 2AQ3A 1MRFH 2GTZB 3S35L 4WFHE 1OARL 5ADOH 4PJDE 4XCYA 4ZD3L 4JFFA 1FO0A 4QGTA 3QXAB 2W0FB 1FVEB 5CEZE 5C0DB 3DVGB 3RDTA 4NO3B 3DTXA 3KPQA 2GFBB 3WLBB 5D4QA 2D0FA 2VR5A 2XWTA 4H1LA 3OAYH 3CZJA 1QSEA 3RRQA 2D7TL 2J8UA 4PJCF 5D7IA 1N7ML 4WTZG 4KUZH 3ARBC 3JXAA 1NMCB 1FL6B 1OAKL 4KDTC 5BXFB 2OSLB 3B9VA 1I8KB 5HGBB 3SDAC 4FQ1H 1DQMH 3QCUL 1YNTB 4HHAB 4PUBL 4PJFB 5F1NB 5HVHB 2XXMB 4WVRA 3H9SD 3RU8H 3O2DA 3KYNA 4FXKA 1TENA 4LIQH 1FGVL 4OAWB 4BFGA 1NGWB 1U8LA 2QTEA 4ODTH 2IFFH 3R06A 4F7EB 3CLFH 5E1HB 5IFAH 5H94A 3HNTL 2H3NB 3G6JF 4JKPH 4MB5A 2P24A 3STZB 2VOTA 2YPLA 2LTQB 4KKBC 2OJZH 2UYLA 1A8JH 3L6FA 4I48A 2BJMH 3OF6A 1AC0A 1YEKH 4M93C 1HSAA 4K94C 5CWSB 5I1GH 4DK3A 3KPSD 5C0CE 2R15A 1EO7A 2WWKT 3DSNA 2I25N 3G08B 4PJ9A 4IMLA 1DQDL 3NFPB 3MODH 4N0FA 2W59A 5FM5O 3T0EB 4W4NA 2Z8RA 3NH7H 4P2RD 5EWIL 2FATH 3NCFB 1B4JL 1XGUA 1U91B 5D7LB 5KAQG 3WBDA 1QD0A 1U58A 3K1DA 3EYUL 1S7TB 3X3FH 3P9MB 3GRWL 3GSVA 1FP5A 4UOW1 4PJ8D 1EIBA 3EIFA 3D85A 1VEOA 2ZUTA 3Q3GA 4OCWH 5D8JH 5C0IB 3IFOB 5JORB 5AG9A 2B4CC 4GW5A 5FYKE 4NOFA 4KHXH 4PJGA 5GS2D 3P9LA 2BSSB 4HLZG 3U4BL 4Y4HB 3OAZH 2QSCL 3DUSA 5TDOB 3T77A 4XTRC 4ENEC 5I75B 5IJKA 1BFTA 1UM4L 5L8LB 3IS1X 2DTSA 3QUXA 1M05B 3ULSB 4POUB 4LHUA 1K3ZA 1LILA 4U7MA 5D5MB 3LEYL 3LSOA 4Y5YA 1IC1A 3WFEL 1OGAE 4EDXB 3ILPB 4KRLB 1EHLL 4EKXA 1DBJL 3N0PB 2E9BA 4N0UE 2FO4B 5CILL 3CFJA 2NY5L 4WI2A 1HH6B 1WVZA 4KROD 2VLKB 3D18A 5SX4H 1GC1C 3H3KA 2JJSC 2BNQD 4U05A 2IPTH 1JP5A 3VFMA 1A9BB 4XRCB 3LQMA 4XXDB 3QFJD 5HSFA 5L7XL 4DFHA 3G6DL 3RVWD 2KZ1B 5GS0C 5A43C 1QRND 3IJYB 4YHMH 5I17B 2B1HL 2W38A 4PRDB 3K8LA 2VIRA 1XF2A 4M6NL 4L3AA 4ZFGH 1UT9A 3IXAB 4HDIB 3OL2A 5DD5H 1T80A 1HHJB 3GBMH 4NBZB 3INUL 3KVQA 1SBSL 2JKXA 3MJGX 5CBEA 3PL6D 4JDVA 3TC9A 5ISZD 1IEHA 3BN9D 1G9ML 4QXGH 1UFUA 3LKOB 3O9WB 4RMQA 4Y7MA 4YWGL 3O0RL 3GK8L 1NBZA 4ODXA 3BRFA 1RZIB 5E99L 5MEPA 3DJ9A 3N1PC 5FF6B 5J7CC 2QHRH 1KCLA 3MV9D 3UJIH 4B41A 4LU5L 4OF5A 2QHLA 5F6HJ 1NAML 3PWLB 3C60D 5GGUA 4K7PL 1S7XA 4BSVA 4MX7B 1EO8H 4GRMB 4KWUA 5L9DL 1EFXA 1BECA 2EH7L 3RNQA 1CXIA 1E28A 1TMCB 2VZTA 5E03A 1UB5B 3DXAD 2VLLA 1H0DB 2Z31D 4LCUB 3V4UL 4WFGD 4HV8B 3M1BB 4R2GD 3FB5A 3HS0A 2X89D 1IARB 1T2JA 4FZ8L 3IFLL 3OKMA 4KQ3L 4UU9B 1CVSC 3NFSL 5ETUB 3O3BB 5GRVK 5F7YC 3SCMA 3TO4D 3S34L 3P0YH 2ITDB 3FB7B 4R3SB 1KLGB 4WHTA 1N6VA 2GY7B 1MREH 1WCBA 5JIIA 3MLVH 35C8H 4LDEB 3ARSA 1FG2A 3AUVA 3QUZC 5T33L 3MLRH 3KGRA 3W9EA 4DUVA 1MRDH 1A1MB 2FECL 2VRAA 3CXHK 4HPYH 2B7DT 4RWHA 1NGYB 2I26N 5BJTB 1MVUB 2X42A 4NFCA 4NN5C 4HKBB 4A6YL 5HVGB 1T0NA 5FUOL 1Z5LB 1JFQH 2GJZA 1PEWA 2DQHL 1CLOL 2V2WB 5L8KB 1HE7A 3U2SB 1NFKA 1NANH 5KW9L 2CIIA 1IBGL 2H2SC 5DMJB 3QWRD 1R24B 4U1GB 1D5IL 5DYOB 3WNNA 2X70A 1QPXA 4W6WB 3LQZA 3MUJA 3HZKA 2RHEA 4UIKH 4QY8A 1JK8B 1F2QA 4PR5A 1RJYA 1L9MA 4OKVA 4Z8FL 1Q38A 3HE7A 1P84J 1TTGA 3BMWA 4PBXA 1BIHA 1QLEH 4CVUA 3ZKXB 2F8XC 4S1QL 5IEHB 5BW7A 4HG4J 5EH1A 4NQCD 5DHVB 3KPTA 5JA8B 1CFNB 4N0YL 4HF5L 1HOCA 3CUPA 3PJSA 3QDMD 3HI6L 1D9KC 3UZEA 1A7RL 3WFBH 6CGTA 4K23H 4NM4H 5E2WL 1CXHA 3U0PB 3VFGH 1GSMA 1PG7H 3NGBC 3NABH 3O8XD 3FB6A 1ETZA 1RIVH 3WUZA 2G5BA 3ROOA 3IU3A 1X5AA 1A6UL 1DUYA 5E94A 3IFNL 3J8F7 5GZOC 2KL6A 5ALCL 4XC3H 5D6DA 3GJEB 3HTLX 2BVOA 3DARA 5EZIH 3C08L 2FLRT 3DRTA 3MBEA 5DD3L 5C0GA 3P40A 4G6MH 3SE9L 2X1OA 5DRXA 3L3OB 1A7OL 5EIIA 1URLA 5CAYB 3EZJB 4O00A 4JDTL 5AD0A 1HYSD 4E5XA 3QSKB 4Q9QL 5HI3D 1ZHNA 2EZ0C 5H37G 5F9OL 3QUKA 1ZGLA 5JW3L 5EZOL 1IGIL 4K8RH 1T89C 1CGXA 1MCWW 2GI7A 4MNQE 3W9DA 1MHEB 1DDHA 3AREB 1IC7H 1JHKL 1RVFH 5E8EA 2Q3AA 3KPNB 1WBZB 3MJ9A 4MNHA 5KVFH 4LPYA 2B20A 5EUKB 1QFOA 1VACA 2M1KA 2QQLL 1NDGB 4JZJB 2H8PB 5TE6H 3HMXA 1C8PA 4KZEL 1YNKH 5EU4A 3P73B 3AB0B 2AXHA 3J7HA 4NUGH 4QHNB 4F9LC 2XPGA 1ZWIB 3GGWB 4W68A 4EOWH 3H7BA 1JPTL 4ZOAA 2DMKA 4RGND 1ZVHA 5J6HB 1CT8B 5C0BA 1MVFA 5JIHA 1CD1A 4YXLH 2GK0B 3F62A 1AO7B 1BX2B 4ODSH 4APQD 4PJ8C 3F7PC 1T4KB 4Y16A 3MRGB 2WZPD 5DO2C 5CIPA 5HDLA 1QACA 1MUJA 3OKNA 2PYFA 1FNHA 5ACLA 3BH9B 1MWAA 2GCYB 3BQUD 1S7UB 4LLQA 4XMLL 1S78D 1UJTA 1FL5B 2MCPL 3DMMB 3PWUA 4RAHA 3LRSA 5TPWH 4IRSC 5D2NB 3QCVL 4QRPA 3ECBA 4FNLH 5I8KL 4H20H 1ZEAH 5I15H 4JG0L 4DTGH 3UAJC 1S9XB 3VXUB 4G7VL 3V5DA 1FJ1B 3K3QA 1C08B 3FHAA 5IW6B 3RZCB 3OKEB 2PCPB 4DN3L 2Z93B 2VISB 4UZGA 4WDIB 5CD5D 3KPSE 4YNYB 4AEIL 1MJJB 1FHGA 3V4VL 4F7CB 4QCIB 5C3TA 4NWUH 4KROC 3BZFA 2ZCHL 5T1LB 3C6SB 5LGJA 1IZKA 2Q87A 4MWFB 4YDLB 4ZNEE 1J12A 3CC5B 4XT1C 2ORBL 4M6MH 1J8HD 4PD4K 1EUUA 3RVWC 2GAZA 3SPVB 1YY8B 2FBJL 5IFJA 1MCOH 1I8IB 5MEOA 5L8JB 1UVQB 4BQ9A 3LH2H 4KHTH 4QOKB 2Q6WA 2J8OA 2JJWA 4R90H 4BFIB 2C1OA 5CZXC 2NW2B 3BE1H 4L8CA 1OSPH 4J3TA 3IF1A 1M6OA 2COQA 4UUJA 3PL6C 4P3DB 5DK0A 3BN9C 4QRTA 4X5XA 1CR9L 1UB6A 4LAJH 4PY7B 1YN7A 4O5LH 4GAJH 3IVKA 3VCLA 1JRHI 4PJEE 4UINH 4EDWH 4OFIA 2AV1A 4OZGF 5AAMA 2JELL 4AT6B 5D1ZB 2IQ9H 2P5EA 3BPOB 3IGAB 2HLAA 4PJ5E 5KSUB 1TZHB 3LEXB 1A1NA 4RGMC 1LEKB 3GNMH 3QXDA 3C60C 2KUTA 2X1XR 5FFLA 4X99B 4Q0XL 5B21A 1LO3L 3S8WA 4NDMA 2CDEA 3SKMA 3K2UL 1GCFA 2YA2A 3BAEL 1IQWL 1DFBL 4L3EB 4PRAA 5DR5H 4PJDA 5IVXA 5I9QB 1JYNA 4RMSA 3C2SA 1OSZA 4HBQA 4WV1C 3LB6D 1GZPB 4F33A 2R1XB 2WP3O 4FG6D 4XB7A 2BNUA 2PTTB 2Z31C 1DBKL 2BNQE 4ETQA 4IRJC 1NAKH 5JQHC 2A0LD 3I6KB 1UKSA 3V6ZA 4JFPA 4LVNB 4CKVX 4OBRA 4IDJL 3GSOB 4MD0A 4ZYKA 1CL7H 3RZWA 2VO5A 3DPBA 3TO4C 1MCSA 5INDA 3V5HB 3S3PA 4EIGB 3A6BH 1VA9A 5FUZH 3VI4F 2OP4H 3RWDA 4ZXBB 1G6RH 3LEVL 4QTHA 5C08B 2AXGA 2MPAL 3UJJL 3U30C 4ZUVB 4F15C 3RWGB 3VFTA 1MLBB 3WL9A 5ID1B 4HIEA 1TETH 3MBXH 2ZSWB 3BJLA 5IWLC 2GUOA 2CKBH 2Z4QB 1WBXA 1UACH 4HEPG 1VFUA 1X4YA 4OZ4A 2NY4B 5EBWA 5EFIB 1KXQE 1GRWA 5F7NC 3T65B 5J11B 5HHPA 2JCCE 1IM9B 3C09C 1HQRA 1BQHB 1FE8H 2DI9A 4OT1H 5E2UL 1MIMH 5C9JB 4XAWL 1RIHL 3T0DA 1BFVL 2B39A 1Q8MA 4HK0A 1F58L 3QT2A 2EIZA 3FOLB 1CDGA 4PRHE 3VRLE 1B90A 3MFFA 1YY9D 1FCGA 5IHBA 4JM2D 3QH3B 4GKOA 1ZVSB 4WFGE 1KB5B 1MFAL 2CJUH 4JGUA 3QHFH 1WT5A 1ZHLB 2QADD 5FOBA 2EC9T 1G7PA 3QQ3B 3SDCC 2P47B 3BWAB 3HG1D 4FQQB 4YUEL 1KSRA 2DJ4A 2IG2L 4K9EH 2CO6B 4ELKB 3SDAA 5JPNA 3LHPL 1W8OA 2M2DA 1LK3L 1FGNL 3O8XC 3LKQB 1I7TA 2XICA 4R4BB 3MJ8B 3E2HC 2EDLA 4I9WD 4Z7UE 2A6KB 5FECB 4O58L 2KKQA 4M48H 4Y19B 1F97A 3RAJL 3TVMC 3Q2CA 3P0VL 3FT4B 4JN1L 4LNVA 1QVOB 1CFVH 1RUML 4MXWL 5I8OH 3KPRE 2X4SA 1JUFB 3T0BA 4X6EB 2P4AB 1E6JH 4GFTB 3VXMD 4HS6B 5INCB 2YZ1A 4I18A 2FCBA 1WQVT 7CGTA 2Y25A 4Q9BA 5IVNA 1P4LB 5DJDB 2I9TA 4RQQA 2HG5B 2X2YA 2QQKH 1VENA 4Q2ZA 1GPOL 5HI3C 4KXZH 2K7QA 2K7PA 1CDIA 1A6ZB 5FO7B 2EDBA 2JK5A 2RQ8A 4NN7B 5DUBB 1OW0C 1NGQL 4TNWK 4OQ1A 4CDHA 3UBXA 3LZFL 3HHRB 1UENA 3GMRA 3H42L 1NEZG 3AFLA 3BGMA 2ATKB 4K7FA 1LO0H 1N4XH 2EDRA 3QUMH 1CFSA 4NGHH 3BIKB 1M71A 1ZOXA 4HIHA 3RI5K 5DXWA 3EFFB 3WFCL 2IPUK 1S7RB 3BHBB 5GHWL 1GZQB 1YMMD 4LARL 1DVFD 4PGDB 5GGRB 1NUFA 4OQTA 5EOCH 4Y2DB 1JGDB 3VXRD 2VXSH 3MZTA 2PW1A 1ZMYA 4KKCC 3E1F1 5KVEL 5CFHA 5EIQA 5C09A 4TVSa 2EXYC 4RGNC 3TPUA 4JPVH 4KKNA 2HKHH 1WCQA 2WUBL 1C5CL 3W0WB 2OXHA 1JNLH 4XPHH 3PDOB 3QI9C 1K8DA 2B5IC 1VKXA 2JIXB 2ZCLL 1YEJL 5FV1L 1I7UA 5DJXA 3WHXB 2WBKA 4PJCA 5E9DA 5FDWB 1Y0LA 2X4UB 1MELA 1WITA 3P30L 1JGEA 1F4XH 4FFVC 2JJSA 1NJ9B 1CXKA 1X5FA 2L0DA 1X4XA 3BQUC 4I1NB 3VI4E 3NCBB 2AERT 4OI9A 3WIHL 4XCYB 4JFFB 1FO0B 3KR3H 4W4OC 4OCYH 3MUHL 1QZ1A 1QTYT 4FQXC 5JW5A 3LY6A 6FABH 4J4PC 3QA3A 4UTAH 3RDTB 3KXFA 3KPQB 4X8JA 4HH8A 3G6JA 3H9HA 4PG9B 2UZIL 3HPLA 2XWTB 4H1LB 2F53B 2HKFL 1QSEB 2A77L 1MFDH 1T03H 1S9YA 2J8UB 4OZHF 5D7IB 3WKMH 3F58L 3TBWA 5JA9A 1K4DA 3M45A 5CD5C 3MUZ1 5C6TH 5D72L 3VWKA 4NO2A 1INEH 1YNLL 4C54A 1SVZA 1OWRM 5IHUL 3KYNB 4FXKB 3B2VL 5GIRA 4RGNE 3MXWH 1U8LB 2D03H 4OB5H 4HC1A 1DBAH 3R06B 5H94B 1TTFA 5IESH 3BIAX 5HGGS 1D6VH 1X5XA 2CQVA 2P24B 4YHIA 5DJ8A 2YPLB 4JFED 3RWCA 1MCQA 2EICA 2UYLB 4XMKL 1YEIL 3M8OL 3L6FB 4XWGH 5T3XE 4I48B 5CLWA 2BC4A 4ERSL 3HFMH 1HSAB 1TVHA 4V1DE 1CE1L 5J4MA 1B9ZA 3AU1B 1AGDA 4JM2F 4PJ9B 2FIKB 1VFMA 3RY5A 4N0FB 2YMXH 1ZKAA 3MRFB 2EH8H 4HT1L 4OIIH 4KZDH 3I3BA 3F65A 2VDQH 1TQBC 2NY0C 3QDHA 2R23A 3QIWD 3B4NA 4F57L 1A6VH 3TJEH 1AI1H 3VD3A 4M7LH 1U58B 2DL2A 4IRZL 3KPMB 1WZKA 5DUMH 2X9WA 5BZWA 1CK0L 1ZK9A 1LO2L 2CPCA 4YDIH 3TGXA 1WTGT 5IOPA 2P5WE 5TQ0H 3RX5A 5FYKL 1A2YB 3D85B 1Q0YL 1VGEL 1IC5H 3Q3GB 5BV7B 4Q58C 5J89A 4GW5B 2R1YA 2Y4SA 3LB6C 3WUWA 1VHPA 2AEQL 3P9LB 1OGTA 2R4RH 4JY5H 2YSSA 2A0LC 3T77B 3KYKL 3G5XB 1J8HE 3QUXB 15C8L 5BRZE 4LHUB 3S3JA 2BVUA 4K94L 1EEZA 3EHBD 1CQYA 2VC2H 4Y5YB 1GGUA 3PWPD 3CFKA 3E6FA 1MRFL 4HX1A 1MPAH 2XG4A 4B53A 1LHZA 3CFJB 2ZUUA 3PIQA 1WFOA 3KLSA 4H25A 5IBLD 4MB3A 3MO1A 1RUQH 3D18B 2ZKHL 5HI5C 3D6GA 1N26A 2FWOA 3RPKA 3OHXB 3VFMB 3LKPA 3Q1SL 1GGIL 2MKLC 3SHSA 2NY7H 3S98A 4RFNC 1ZAGA 4FOMA 3GKWL 4PGBA 2MFNA 3MRHA 3VW3L 2VIRB 4NFDA 5DMKA 4AM0A 1XF2B 3AAZA 3L3DA 3LAFA 5CHNB 4MGXA 3C8DA 5IT2H 1W72A 4MNGB 3GJFK 3JWDC 3QISA 43CAA 5TJWK 4LIQL 1QRKA 5F72S 2NY3B 5K59E 1N0LA 4XPAL 4JDVB 3WJJA 5IP4A 3WEXA 1YY9C 4JKPL 4JM2C 1CXEA 4YGVA 4OUOA 3IT8D 3I02A 2QADC 1NBZB 4XP5H 3CVHA 5MEPB 1OAQH 4GQ9L 2F5BL 1T83C 5HYJE 1RULL 1T3FA 3O4OC 1CBVH 5GGUB 1S7XB 4BSVB 4ZTPL 1N8ZB 3FTGB 4B7LA 4G9FE 4OD1H 3RNQB 3H9SA 5FM4A 4PP2A 2KQNA 3FZUD 2VLLB 3BKML 3B8YA 5GS0L 1CVRA 1G9NH 4ZOCA 3L5HA 1YN6A 3HPJA 4MD5A 5E7BA 3MNWA 4N0CD 1J7VR 3H2WA 3L3GA 1OAXH 2EDOA 3BEVA 2XWJA 3AS1A 2VDNH 5D8JL 3H9YA 4UT9L 4NQDD 4Z7NE 4GBXC 3O6MH 2B0SH 2F54A 2XQYG 3L7EA 3RWJB 3KPSA 4J7RA 1ED3A 5T3ZH 1ZVYA 4WHTB 3TN0D 1EGJL 5HGDA 1WCBB 1FC1A 3L5XL 4PTTA 2FECI 3MRRA 5E2VH 1LVEA 3KJ4C 4ZNEA 3D5OF 4HAGA 4OSUH 3C5ZA 1FG2B 1CI5A 4P2RA 3HMWH 4MQ7A 3W9EB 5CCKH 1V7MH 3VRIA 3KS0H 2DQIH 2JB5H 2D0HA 3MOAL 3I3EA 4JLRA 4R26L 3WFDH 5FCSH 1T0NB 3HG1E 2J2ZA 2K1MA 4PJ8A 1T0PB 4XNQA 5A2LH 2GJZB 2WIMA 1KFAL 4P23D 5T5NF 4PREA 2CRMA 2CIIB 4QHUA 3OPZH 1I9IH 3LQZB 3HZKB 4DCQB 4QY8B 4DGVH 4PR5B 1IEBA 4TQEL 1RJYB 2RJMA 4K71C 4OKVB 4I9WE 5B4MC 3IDYC 2YD6A 1UM6L 3HE7B 1J88A 3LD8B 4PGZA 2BNRE 5FB8A 4I3SL 3ARTA 1BQHG 1YA5A 4U1JA 3WLWD 1MQKH 1QFHA 3DI2B 1J87A 5HPMA 4PRIE 1MEXH 1PBYA 4RMUA 1AGFA 1HOCB 3VXME 3CUPB 3PJSB 3OB0K 3K7UA 4KI5D 4X0KA 3TH2T 1A0QH 1U2HA 1WICA 1UEYA 1I7ZA 4XPTL 5BS0E 3TIEA 3FB6B 1M7IA 1ETZB 4OI8A 4MJIE 1MHPL 2G5BB 3DWTA 3T09A 3ROOB 4PGEA 2BNQA 1DUYB 1RHFA 5E94B 2HT4C 3GHBH 2GITA 3QFJA 1DSFH 3RWIA 1LEIB 2BVOB 3SOBH 3DRTB 1GOFA 1QRNA 5C0GB 3WHE1 4ZMAT 2R2HA 4UMGA 3VGAC 1HHIB 4F3FA 1HZHL 5J1AA 4NRXB 3OZ9L 5J1TC 3RJQB 5DRXB 2H2PD 3UTQB 5EIIB 2BOBA 4UT7L 1UYWH 1ONQA 4OCSH 5AD0B 2VLRD 3BKYL 3EO1A 1HHGA 1YMME 3QDAA 3VGDA 3PL6A 1TNMA 5ISZA 4QO1A 2AGJL 4GT7A 5I1JH 1BP3B 2D7PA 2FHCA 4M7LT 1ZHNB 1RY7B 2E3VA 1ZGLB 4FQHB 5EU6D 3QXWA 5IGXL 5CJXC 2YD9A 1JBJA 3MV9A 2ICEA 3W9DB 4KY1H 1DDHB 2GY5A 1KCVL 3WCYA 1E4KA 5E8EB 2A6DA 5L2KD 4EBQL 2AJSH 2H1PH 3O6FC 4MNHB 1S7WA 1VACB 4YJZL 5JPMA 1RUKH 5JOPE 4XXCC 2YKLL 2R29H 3DXAA 1U93A 5D1XC 1FVDA 2ICWI 4YZFE 2Z31A 5EU4B 4WEMB 1FH5H 3BKJL 1Z6JT 4JO2H 4AK1A 4HCRA 4M1DH 2XPGB 4LCWE 1DLFH 2X89A 3H7BB 2LU7A 1GGTA 2AJYL 3QIWC 2D4DA 4BSWA 3S36L 3TO4A 5C0BB 1NMBH 3DSFH 2VAAA 1CD1B 2NZ9D 3QJFA 1T22A 2UWEF 5IROC 3CFCL 3P77A 5CJOL 5I1KL 2R4SL 4OGAD 1JI2A 3NZ8A 3EYOA 1RI8A 1NCNA 2M26A 4Y16B 1HNFA 3FCTA 2XIDA 1OLLA 3FFCE 2AABL 4JRXE 1U3HD 5I16A 1AXSA 4JPIA 1MUJB 1FFRA 3OKNB 3SO5A 4O9HL 4LLUA 1MWAB 3MYJA 1JGVL 4QHKI 4G6FB 5D70H 3S88H 5IWLA 4X4MA 4NHCL 1JPSH 5HHQA 3HKFA 4R7DA 4H0GA 3REVA 5MHSE 3PWUB 5L2JA 3S96A 4JJ5A 3D2UD 4K23L 4K8RD 4QRPB 5ICYA 3CH1A 3ECBB 3NZHH 3BO8B 2XN9E 3QWRA 2OJEA 3RL1A 4U1IA 3OJDA 3V5DB 4ZFZB 4GRWH 1AFVL 3W39A 1UG9A 5IK3B 4PJXB 2A38A 2QSQA 1A14L 2VQTA 3VDBA 4M8VA 4G6ML 1O7SA 2E6QA 5EC1A 3V6FA 1A7NL 4KJWC 1KJMA 3K1KC 1HILA 3BZFB 1AR1D 4NQCA 1OAYH 3TT1H 5LGJB 4QRRB 2HA1A 1WWWX 5DK3A 4EI5D 1KIQA 4GRLC 3QDMA 1RZKH 4OZGA 3V0WL 2GAZB 3BEWA 1CIDA 1YEEH 2R0KH 1CFBA 5IFJB 3LOWA 3GMOA 3O8XA 4L4TD 5ELIA 3SO3C 4M8QA 1EJOH 1KTLA 1CLYH 4JO4H 2C1OB 2FZ3A 5F7DA 4L8CB 5EA0H 5LXGL 4WFED 5I2IA 3GDBA 3IF1B 1M6OB 3BP6B 1OF2A 4UUJB 1U42A 5DK0B 4UDTA 4QRTB 4X5XB 3RHWK 1UB6B 5FYKU 1K4CA 4JFYA 1MJ8L 1YN7B 3D9AH 4I0CC 5HGHA 3IVKB 3MNZA 4RA3A 3RY6C 5C2UB 4HUUB 4Z95H 4KI5F 1HHKA 2AV1B 3MV8D 2HMID 1NMAH 2Q1EA 3D3VE 2ADGA 1EA9C 5HHVL 1YNKL 2HLAB 3BP7A 4Z7WA 4TSCH 5E08H 1A1NB 2XZCL 3PWPE 3QXDB 4NUGL 3EO0B 2PR4H 3DNKA 4NDMB 2CDEB 3FONB 4EXPX 3DX6A 4G42A 3SKMB 2XQYK 2N4IA 1X5ZA 4PRAB 4PJDB 2VDRL 5CD3A 3CFEA 5I18L 1IAOA 1KXVC 4L4VD 3FZUC 5ESAA 1U8NA 3SDXF 3U4EA 4F33B 2F19L 4BSJA 2BNUB 3EYQC 2NTSP 2Q86A 3G9VA 4ETQB 3TIDB 2ADJA 4OM1L 3UYRL 1IKNC 1PYWA 4ODSL 3B83A 4CU7A 4N0CC 3V6ZB 3IYLW 4OLXH 5HHNA 4MD0B 2V9TA 4ZYKB 4LLMB 4V2BA 5TDNA 1DQQA 3MCG1 3EW3B 5INDB 1RIUH 1NCTA 2ED8A 5DUPH 3QDGD 4MA8H 5KSBE 3RWDB 2L4OA 4RNRA 5CP3H 1DZBA 4JHAL 5IHZA 4QTHB 2AXGB 1PZUB 2YUZA 3L7FA 1D5MA 4LHUG 5CGYD 5E8DH 1WZLA 2AVGA 3WL9B 5EIVA 4RAUA 2WIIA 4HIIA 4OZ4B 5EBWB 3VWJD 4APQA 5DJ2A 3X13A 4YH6A 5HHPB 4HWBL 1HQRB 3VG9B 1ES0A 3IDXL 1WK0A 5DLMH 5AZ2H 2QKIA 1CDBA 4FQLH 1JPGB 1WFNA 3BQUA 2R56L 1BJ1H 1QFUH 4JZOA 4S1DC 5LCVL 3QO1A 1OTSC 1PSKH 3JZ7A 2EIZB 4W4OA 4WO4D 3QB7C 1T2QH 4XCCH 2XFXA 3WNOA 1T6VN 4WUUD 4ZUTA 4MDIA 1MCOL 1ZTXL 3MC0A 5KVGH 5FOBB 3WLWC 1BD2A 1G7PB 3EFDH 3MRIA 5A3IC 4KK6D 4R90L 2BZDA 3MRKA 3ARBB 2YC1A 3WXVL 4NQDE 3NCCB 2NR6D 3H3PL 1JPFA 1DANT 3SDAB 1J11A 1R5IA 2RIKA 5JPNB 1GOGA 4JHWL 2XQBH 2Q76A 1I7TB 3QIBA 4LSRH 5F7MC 3RVVD 2WV3A 2XKUA 2HAZA 1TVBA 2N7AA 1KJ2A 2AV7A 4PB9H 4TSAL 5KZCB 4OM0L 3HC0A 4NQTA 2IQ9L 1N6QL 3VGEA 5JW4M 2VXTL 3B6SA 5J3HD 3GNML 4U6XA 1L6XA 1KPRA 3JVGA 3PHOA 3QIUD 2X4SB 2NTFA 1P2CA 1OGAB 3LQAH 1NMCC 2J88L 3P4NA 3ULUE 3S7GA 5D2LE 4I18B 4UTBL 3P2TA 1U8HA 1X3DA 1II4E 2QSTA 4JPKH 2HFGH 4RQQB 4D0CA 1TPXC 2XTJB 4FZEL 4Q2ZB 3S97C 4IIQA 4LQFL 9CGTA 3PWVA 3BSZL 3CDFA 2DM7A 1WEJL 4HPOH 2JK5B 4TUKH 4IOIA 4MJ2A 4O2EA 1PD6A 1QNZH 4KU1A 1RUAH 3UBXB 1IM3A 4JFQA 1MCRA 5KTEH 3DIFA 4KMTL 3U0WH 4K7FB 1JTOA 1VB9A 3BGMB 5F3HA 1EMTH 5FUZL 1CFSB 1M71B 4HIHB 1NFDF 1AGEA 2JJTC 3HC4L 4XVTH 5ABDE 2GJ6D 1DEEA 2HVKA 3O6KL 2CUHA 5C0JB 2VUYA 1WLHA 2PW1B 2P43B 3L3KA 4NT6A 3K80A 1FE8L 4XP6H 2FEDD 5C09B 1F6AA 3SDXE 1QSZA 3D0VA 2XNAA 3TPUB 2AW2A 3QPXH 1KB9J 1MI5D 4TVPD 3SKJH 3NA9H 4X8XA 1K8DB 2VDMH 4MS8D 1IT9H 2EE2A 5JDSA 4YFLI 1VKXB 1FV1B 4CADA 5F9WB 5JW4N 1I7UB 4FFYH 3TBYA 5DJXB 4HZAA 4OZHA 5E9DB 4EXKA 3U79A 1Y0LB 3GJFH 4AYFA 1HNGA 2VLRE 4PJFE 4WNQA 2CMRH 4P4KD 5C0FA 3MRPA 4X98A 1UJ3A 1HKLL 1WSST 1YEDB 4XVSL 1QBML 4Y4HC 5BO1L 3M17A 4PP1D 1BQLL 4KAQH 5EU6E 1AGCA 1NGZA 4PRPA 3JTTA 1JHLH 2XA8L 1I9EA 4UB0H 4JJHA 5JW5B 4LRIA 4MXVF 1MLCB 4HBCH 3QA3B 3KXFB 4FQIL 4X8JB 5L2KE 3G6JB 3H9HB 1DBML 4QF1A 4XP1H 1KYOJ 4LCIL 1OCWH 4YE4L 4LLYA 1MAMH 5IEKA 1SY6A 3EKCA 3TBWB 1K4DB 2BK8A 32C2A 1I3RB 2YA0A 5GGVH 4JM2A 1AIFA 2C5DC 2EDEA 3CVIL 4F2MB 1A6WL 2A2QT 5I8OL 4YQXH 5D7LE 1X5LA 3H7LA 1RHHB 2W1NA 3D39D 5FO9A 2APTA 2VN4A 5GGQL 1N0XL 4U1LA 4EI5C 5GIRB 1CICD 4LBEA 4OCRH 1WZ1L 1PKOA 5T3XL 1J0KA 5DMIH 1DLHA 2E8ZA 4NWTL 4YHIB 5DJ8B 3U46A 2VZUA 3RWCB 1R3JA 2VXVL 4GAGL 2BC4B 4F7MA 1ZGLM 2WWMD 2FDBP 2OBGA 2DKMA 4RGOH 1AGDB 4LRNH 4S1RL 3VXSA 1D5BA 2IGFL 3MOBH 4GUPA 1I1AD 7FABL 4P9ML 3EYVB 2A6IA 4NZTL 1QR4A 3UPAA 3V8CA 5F8QC 1T6WA 5EORH 1H3PL 3VXMA 2DQCL 5CINH 2UUDK 5GGTA 1NCDH 3HR5B 5T1KB 4NYLB 4C4KO 4YXKH 5BZWB 2OL3A 1EUTA 5IOPB 2W92A 2VLKE 2YK1H 3PP3H 1UADC 2XZAH 5CZVH 1VERA 1XGRA 4UV4H 2DBLL 4XNYL 2VDOL 3FB8A 5J9PA 4JKMA 3GB7A 1LO5A 4NN5B 4KVCH 4KFZC 2GKIA 4P3WA 1XF4A 1NLBH 2YSSB 4ONGL 5GRUH 4QT5B 4PY8I 3GSNL 2ZPKL 1JRHH 4E41D 4XHJD 4Y1AD 3OB0H 1F4XL 3UO1H 3FMGH 3T4AA 3SN6N 1DVFA 4R0LA 3MQIA 3CFKB 3E6FB 1I3VA 4HX1B 2E7LA 2DQEH 3T2NL 1NFDE 5IQ9A 2EC9U 3VXRA 2PNDA 3N1QC 5JMRA 3EUUA 4MA3A 4OCYL 4XNUL 4WFEE 3PIQB 4H25B 5M7QA 1A3LH 3P4MA 1U3JA 1KENL 1OY3B 3MO1B 1ITBB 4XBPA 2EYTA 2FWOB 5DHXB 4FS0A 5D96C 4XZUA 4KPHL 2BERA 5EO9A 3ZE2F 2FX8H 3LKPB 4N8CH 1YQ2A 1T03L 1F6LL 1T66D 4X6CF 3WKML 3KNBA 2VLJA 1MCJA 3MXVL 3RGVA 3I50H 3MRHB 4I2XA 3TV3H 4AM0B 5DMKB 5ADPL 2IWGA 2R39A 3HRPA 4LMQE 2JJVA 3UPRA 2GTWA 3AAZB 3L3DB 1D3CA 2YPVH 1INEL 1W72B 1EAJA 1JGLL 43CAB 3ZKXC 3QRGL 1PG7X 1KELL 4BH7A 4M3KB 2DQJL 4LSPL 5TE4L 4AG4L 3KHQA 4OB5L 4L4VE 1JZ5A 3WEXB 3NCMA 3VXPA 1IGYB 3I9GL 4WO4C 3P4OA 4YGVB 4M7KL 1D6VL 3MJ7A 1ZA6A 2ZJSH 2V9RA 1SEQH 3CVHB 3SGEH 3IJSA 4HGWA 1IGCL 4TRPH 4NJ9H 4WRLA 4MXVE 1NLDL 1JMZA 1T3FB 5CBAB 1HI6A 4JB9H 3UDWC 4JFZH 1U8MA 3QDGE 1U92B 4GO6B 4IMKA 1J0JA 4OIIL 3QUYD 4HKXA 3HNVH 2CLZA 3H9SB 4UOW0 5CJXA 3RVVC 1KLFA 4PP2B 3FFDA 4M7LL 1F02I 3IDGA 3B9KD 1LP9A 1YN6B 3HI5L 3HPJB 3MNWB 2DTMH 3L3GB 5DS8A 4R6UA 3BEVB 3IETA 2XWJB 3VU2A 2NY2D 3BDBA 3DYMA 3QIUC 1BWWA 4JFEA 4PRNA 4XXCA 3W2DH 5I1DA 3QHZH 5BVJA 4MCYB 1F3JA 1K9TA 1O7VA 3KPSB 1ED3B 4NUJA 2EDWA 3RVTD 2V7HB 5HGDB 1XAUA 1F4YL 5DRWA 4PTTB 4DQOL 3MRRB 1R3LA 4DKEH 3SDDA 1BBJA 4OBSA 1A1OA 4P2RB 3GI8L 4MQ7B 3V6OA 5C71A 4U1HA 4WUUE 2GSGA 3VRIB 3G6AA 1UWEL 3IDMA 4EQ2A 4JLRB 1JGUL 4LFHD 4PJ8B 4XNQB 1CTNA 2FEEL 2X4QA 4M6AA 1EAPA 5FXCH 5CKGA 1WBYA 4X4YA 4QHUB 4K9EC 1KJ3L 5I1IL 3OX8A 3LMJL 1FORL 1ZANL 1IEBB 4WHYG 1XCTA 3AS0A 3BP5A 1UXSA 2NY7L 5FB8B 1SJVA 5SWZD 1G7LA 1H15A 5DQ9A 4ODVL 4U6VL 4U1JB 4OZFH 2FEDC 5IW3A 4CJ0A 3VFVA 4NFBA 3VDCA 3KLAA 4OF7A 1BIIB 5HPMB 2UY7A 4BUGA 1YYMH 3PWPA 5JO5A 4L8SA 1AGFB 5CSBA 4MS8C 1UWGL 1BQUA 3BPCA 1A9EA 1I7ZB 5T3ZD 5FK9A 3HC3H 4KROB 3TIEB 1M7IB 4P4KC 4QXUH 4TSBH 3DMMC 4PGEB 4PP1C 2BNQB 2J7LA 4XP5L 1N59A 2VXUH 1KGCD 3QFJB 2GITB 3LN5A 3RWIB 3NOIA 1XIWD 3SKUD 3ET9F 4XC1H 1CLZL 3WS6C 1QRNB 2BSTB 2XG5A 1DBBL 1W0VA 4F3FB 3EGSA 5J1AB 2MWCA 4XBGA 4ELMF 1K8IA 4HUVA 1N64L 5GJTH 3IS0X 3JWOH 3UC0L 5JR1L 5IB1A 4IOSD 1F3DJ 2BOBB 5F7EH 1MRCH 4U7SA 4NBYB 3VFSA 2ZCKH 3EO1B 1G9NL 3PL6B 5KANG 2MQCA 1S7QA 4P99A 5ISZB 5ACZB 1OM3L 4LEXL 1C5BH 1OARH 4ZD3H 1ZT1A 5CMAB 5HJ3A 3RY6A 1MCHA 3FQTA 2ZG1A 3Q6GL 3EDJA 3MV9B 2ICEB 5E6ID 2D7MA 1U6AL 1CICC 4TVPE 4RGMB 1J1OH 3C60B 3NIGE 5E8OB 2AJZA 2UWEA 2D7TH 4JFHD 2C1PA 1N7MH 3O41A 2X4PB 4JQVA 4JVUA 1OAKH 3HAEB 2VZOA 1S7WB 3PP4L 1WAAE 5KOMC 4OSUL 5IKCA 1P7KA 3FOMA 1I85C 4WI6A 3HUJF 4ZO9A 2HT3C 4RRPA 2VKWA 3DXAB 1U93B 2WWMC 3H6JA 3U82B 3QCUH 1FVDB 4PUBH 1KTDA 2Z31B 1C7TA 4ZUSA 4R2GB 3TLRA 3QYCA 4RDQF 1MQ8A 3DBXA 5EU5A 4PV9A 1NGXA 3BPOC 4MAYD 3HNTH 4R7NB 4BSWB 3TO4B 4O2CB 2O61A 2DLFL 2VAAB 3RX7A 3P77B 2X05A 3TN0A 3NZ8B 3EYOB 4KGJA 1XGPA 5ID0A 2HRLA 4X9GA 4Y0GA 3FCTB 1VFBA 2IBZY 1RZ8A 5I16B 1AXSB 4JPIB 5D6CA 3ROLA 3STBA 1DJSA 1DQDH 1JN6A 4F15B 4LK4A 1FL3A 5J06A 2YPKA 5JOFA 3K81A 4YAQB 5DVNA 2WQRA 3PNWA 5EWIH 4EN3A 1AD0A 5JXAL 4YXHL 1B4JH 3REVB 5L2JB 2QEJA 3S96B 3C09B 4P23A 5ICYB 2Y72A 3CH1B 3EYUH 4ZUUA 4QOKE 3GRWH 3TCLB 2OJEB 4LKCB 1REIA 3RL1B 4U1IB 3OJDB 2HH0L 5HHMD 1U3ZA 4ZXBC 3W39B 1M7DB 4WGWB 4OZIF 1I1FA 4NIKB 5FGCB 2H6PA 2DAVA 4JPWH 1M7XA 1HK6A 5EC1B 4X6DF 3U4BH 3V6FB 2QSCH 1KJMB 1HILB 2HYMA 4NQCB 2NY4C 1UEMA 4HEME 1UM4H 1XGQA 4P5TD 3B9AA 3MA7A 5IW1A 5L0QC 1KIQB 4IOFD 3GBLA 1RJCA 3QDMB 4PLJD 1UYWL 4OZGB 3LEYH 1RZJC 5B3NA 5I19L 3EJZD 3WFEH 4PJAF 2Y06L 4X9HA 2RAMA 2XV6B 1EO5A 3GMOB 3O8XB 4YBQD 4N5ED 5JQ6L 1DBJH 3E2HB 4M8QB 4AMKL 5CILH 4U3XA 1KTLB 2VABA 1KN2L 1S7VA 1SEBB 4QKXB 3UX9B 2DWEB 5I2IB 1E4XL 4UDTB 1MCCA 2AJSL 1K4CB 1JZ6A 5L7XH 4QNPE 5HGHB 3G6DH 1EV2E 3MNZB 5I6XC 2CKNA 4R4FL 4GG6F 4C59B 1Z3GH 1HHKB 2B1HH 4XNZC 4BUHA 1G7QB 4M6NH 3PABA 4E41E 4EVNA 1EFXD 4Y1AE 4LEOA 4HUNB 3BP7B 2VLRA 4ORZC 5HYSA 1FH5L 1WF5A 3ALPA 3QJHA 5C08E 4JVPA 3INUH 3MGOA 1NQBA 1SBSH 1A64A 3DX6B 4G42B 2ADFL 2W0LA 4OIAA 4K3JL 4GOSA 5EU6A 5DI8B 1RMFL 2DS4A 1G9MH 5CD3B 3CFEB 3T2PA 5LKNA 3NAAL 1IAOB 4YX2L 5ESAB 3U4EB 1U8NB 1NMBL 2BRRL 3O0RH 3S5LA 5B38A 3DI3B 3GK8H 5DJYA 2Q86B 4FFZL 2ADJB 4YPGA 5E99H 2EEBA 3B9KC 5F6HI 1PYWB 3SY0A 5L2KA 3SCMD 2JJTA 4LU5H 1EBPA 1NAMH 2NY2C 5HHNB 4K7PH 1BPVA 3CX5J 5L9DH 5TDNB 3I2CL 2EH7H 4LOUD 1GOHA 4NZUL 4QHKJ 3HA0A 3HUJE 1F3DH 1HH9A 5IHZB 3V4UH 1KCSH 3L7FB 2L7UA 1Z9SA 4J1UA 5DJ0A 1D5MB 3NZHL 4RGNB 2Q8AL 4FZ8H 3IFLH 1YPZA 4RAUB 2KZWA 4YC2B 2WIIB 4KRNA 2C3VB 4UIMA 4KQ3H 3LV3B 3LPWA 4F8TA 1KTKE 3NFSH 4APQB 3X13B 4YLQT 2C3GA 1U3HA 4D94A 1ES0B 1DUZA 2Z0BA 3TEUA 3WJLA 2QKIB 4YHLL 3OBAA 3BQUB 3BPLC 1MFCL 1XH3B 2EXWD 4JZOB 3MRCB 5T33H 4RAVA 3QO1B 1TJIL 2Z8WC 1WIPA 3D2UA 4M1CD 5JDJA 3ARFD 2XFXB 2FJGA 1RSFA 4MDIB 4A6YH 1T7YA 1G6VK 1LD9B 1XGYL 5FUOH 2DQHH 3MRIB 1EJOL 3GEWB 1RZGA 3RVUC 3I75A 1IBGH 4UBDC 3MRKB 2YC1B 1D5IH 4JY4A 1Z9LA 2NCMA 1O0VA 4OIBA 5BCAA 5I73C 1FYTA 1R5IB 1YMHA 3MACL 5DT1L 1GXEA 2DI7A 4MCZA 5BVPH 1CYGA 2Q76B 1HXMA 1D6EA 4M6OL 4OGYL 5HDBE 1QA9B 1FFOA 3MBED 2YD8A 4S1QH 4X80L 1TVBB 1KJ2B 3ELAT 4EI5A 3HC0B 5D7SL 3I6GA 2R0WH 4X6DE 4CBPA 1J8HB 1XIWC 3ULUL 5E08L 1TIUA 4N0YH 4HF5H 3TA3B 3VH8G 4U6XB 2IBGA 5JOEA 2YWZA 2UUDH 3PHOB 4L4TA 3HI6H 2A9ML 3GSNB 1A7RH 2H32H 2NTFB 5E2WH 3U4AA 1P2CB 1ZLUK 3P4NB 1NFDA 5F44A 1AGBA 1DQTA 1GHFL 3CCHA 4HS3A 4PJAE 3HRZB 2FYYA 1U8HB 4WWKD 3IFNH 4HWZA 4NO5B 2IJ0C 5ALCH 4D0CB 1WGOA 4N0RA 4LF3A 3C08H 1TQBB 4PYGA 4IIQB 5SWZE 3W0WE 5DD3H 3PWVB 3OAYK 3MV8A 4MAUL 2G75A 4IOIB 4O2EB 3SE9H 1IM3B 1CG9B 3ARQA 5E6IC 5EOTA 1L0YA 5GPRA 4U31A 1UQSA 5CEYA 1A7OH 3DIFB 2X7LA 5F3HB 4MA8L 3GIVA 1LWRA 4JDTH 4J3UA 1AGEB 5JW4R 4Q9QH 5F9OH 4I4WB 1DEEB 4MQXC 4JFFE 2HVKB 5JW3H 5EZOH 4HSQA 1IGIH 5TF0A 2LV4A 3DUUA 4BFEA 4NKMA 5LGHL 4YDKL 4NT6B 2QV2A 5HGAA 5FKAA 1LNUA 3DV6A 4JY6A 1F6AB 1JHKH 5DLML 3D0VB 4PJBF 2XNAB 1BZ7A 1T7VA 1XF5A 5D7IE 1NH6A 1RV6X 4GLRI 5BQ7B 1OHQA 3WYRA 2QQLH 3QDGA 3C5JA 1AD9A 3S4SA 1NSNH 4XVUD 4YDVA 4NQSA 1UC6A 3RJDA 3TBYB 4OZHB 4D9RE 1UGNA 4KZEH 3G5VA 4WNQB 4X9FA 4C83A 1T2QL 4RX4D 5C0FB 4X98B 1UJ3B 4POYA 2FJHA 5DJZA 4YK4B 2RBLA 4X7TA 2DIJA 4NO0A 2Y07L 5IJKC 1CFQA 1J1XL 1AGCB 2PW2A 5FCUL 1P9MA 1NGZB 3QUXC 4TULH 2EDYA 3CIQA 3VWJA 1T5WA 4N8VA 4Y5YC 2HWZL 2YPLE 2XQBL 2DLIA 2BFVL 4QF1B 1T04A 4JFHE 2X41A 4LLYB 4JAMA 5IEKB 1VGKA 4Z7VF 1T7XA 32C2B 4OLYL 3MRNA 4FXLA 4WO4A 5EZLB 4XMLH 4IS6A 4RMTA 4JM2B 1AIFB 2YBRA 4WUUA 1U0QA 5C07A 2MCPH 4B0MM 1HQ4A 2QADB 4ZO7A 4TNWF 4BA8A 5ITFA 3LQAL 3QCVH 5GISH 5I8KH 4CW1A 3HG1B 5FO9B 1JNJA 4U1LB 1P6AB 1FBIL 2A1WL 4JG0H 1RUPH 3RI5F 4LBEB 4G7VH 4PLJC 1WC7A 2HFGL 3EJZC 5DA0B 2RR3A 5EZJA 3T4YA 3O45A 3U46B 4DN3H 4YBQC 4N5EC 4M1GH 5AAWA 3MMEA 3E6HA 4AEIH 1R3JB 4GQPH 3V4VH 4PJGE 4F7MB 3OXRA 1G6RA 4G6AD 4NNYA 3ZYOA 1U8OA 1KCUL 1D5BB 3ULVC 4GUPB 1T1XA 5L88L 4OJFL 2CKBA 2BCKA 1L7IL 2P5ED 2A6IB 3QIUA 3HAEG 2HFFA 3B8SA 1UA6L 4J3VA 3VXMB 2FBJH 1DL7L 1KCKA 4NPYB 3GBNL 4AIZA 3L9RA 1JWSA 3QXVA 2OL3B 4AEHL 4JFXA 4NNXA 3KJ4B 4XP9L 1XGRB 5E2JA 4HKJA 5TFSL 1Q72L 4WI4A 4PLNC 4NRYA 2DYPD 5CKAA 4S10A 3FB8B 5J9PB 1CR9H 1IILE 3GB7B 3QO0B 4HH9A 5GSVA 1LO5B 5KS9F 3QXUA 4ACPA 3VA2C 4GXUN 5ESQA 2JELH 3I6LE 4X9BA 1MCDA 3SCMC 4X6CA 1MCLA 1PLGL 1DQJA 4P9HC 3QULA 3DVFA 2GYSA 4Q0XH 3T4AB 1YMMB 2GJ6A 1DVFB 4R0LB 3K2UH 4K71B 1FG9C 3BAEH 3IDYB 1DFBH 5IUSA 2I5YL 4OGZA 5F7UA 3VXRB 5GS1C 5DDHA 2XWBA 1JHLL 4MA3B 1TCRA 2MQ0A 4NQXA 1ORQA 4KK8C 3ULVE 1X7QA 3O4LA 3F7QA 2FH8A 1MI5A 1DANU 1ADQL 5EO9B 5E5UB 1MAML 4IDJH 3ZDZF 4GS7B 3T04D 4BQCA 1F4WH 3IJHA 4RA0C 2CO7B 4I2XB 1AHWC 4LSQL 4P4KA 1A7QL 3UPRB 3F7VA 3LD8C 3LKRA 2EDHA 4YHOL 3KYAA 1QFWL 2MPAH 3ALXA 4KVNL 5DGRA 3UJJH 5BW7C 1FZOB 4JRYD 1MF2L 2FB4L 4EUPA 3WS6A 1VEMA 5K9JL 2C7UA 2NYYD 4WWID 3FRPA 3VXPB 2IMNA 4FFWD 3P4OB 4U1KB 5DMIL 5JXED 2X4RA 3MJ7B 1ZA6B 1YJDC 1Y18B 3T8XA 4LPCA 3QUMA 3IJSB 4HGWB 5E2UH 4L8BB 3PV6A 1C5DA 4OD2A 4XAWH 1RIHH 4LGSB 1BFVH 1HI6B 1QSFA 1FLRL 4LRNL 4YHYB 1U8MB 3IRZA 1F58H 3QG6B 5D6DC 4HKXB 5A1AA 2CLZB 3MBEC 2WBJA 3D39A 1I1YA 1Q0XL 4U6HB 1MFAH 1FNFA 2FX7L 4YXKL 2SEBA 2HFEA 3TJHD 3MLTA 2HP4A 4YUEH 1AQDA 3GHEL 2DDQH 5DS8B 1IFHL 2IG2H 3IETB 1C16A 4JFEB 1I85A 5AYQA 5I1DB 4XWOC 3LHPH 3GMQB 1LK3H 1I9RH 1FGNH 5K9QG 2AJVH 2XRAL 5HHOD 4NUJB 2R69L 5GSRA 2VWEC 1NBQA 5DRWB 4O58H 2XOTA 2FJFA 3KLDA 1I1AA 4G6KL 4KV5F 4JRWA 1T0MA 4PFEA 1R3KA 1BBJB 1A1OB 3QIWB 1KPUB 3P0VH 4JN1H 3QZWA 2B2XL 2FEEI 4U1HB 1RUMH 2GSGB 4MXWH 4LSVL 4RISL 3FMGL 3UO1L 4LPVA 5CJ5A 3G6AB 3IDMB 4G80A 1N3NA 4ZS6C 4UQ3A 1FNGB 4CNIB 5SV4A 1FDLL 3VGGA 2EO1A 2F74A 1A02N 1Q9LA 3F8UB 5CJQL 1EAPB 3MV7D 3TESA 1WBYB 4X4YB 3EAKA 5J0BA 3OX8B 2EEAA 1INQA 1GPOH 2LVEA 1HWGB 1XCTB 4QHLA 3KPPA 4N8CL 3BP5B 1UXSB 2EDFA 3QNZB 4HZLA 5F7HA 1DQLL 5EUOF 3VGBA 4L9DA 1NGQH 43C9A 3ZHLA 1G7LB 4P57A 1HHHA 3LZFH 1H15B 5DQ9B 3I50L 5I76A 4FA8A 2BSRA 3H42H 2HTKD 5FIEA 5IR1B 4Y1AA 1E0OB 2NY6D 1NGPL 1UCBL 3FAXA 3KLAB 2AXJA 4M5YL 1CTOA 3DO3A 1E6OL 3PWPB 5IVXF 3WFCH 5JO5B 5HVWA 2R8SL 1W0WB 4L8SB 5GHWH 4ELMA 3NIFF 3FO2A 3TA3A 5JZ7D 4ZO6A 3SGDI 1PAMA 2VYRE 1MHHA 4XVUC 5C0ND 4LARH 3BPCB 3PQYD 1A9EB 2VWEE 2CUIA 2P1YA 5HY9A 3VG0L 5KVEH 1N59B 2X5PA 1F13A 2R9HD 2WUBH 1C5CH 2FH6A 1W0VB 1QG3A 3EGSB 3X12A 5ITBL 1AXTL 1YEJH 4XBGB 1K8IB 4PIRF 5HYFA 4HUVB 3ZDZE 2AJXL 2VB5A 1HINL 2W0PA 5IB1B 4QGYA 5IBTL 1ERNA 3VFPA 3VWKD 1R3HA 4PJ7F 2DL9A 1S7QB 5CEZH 2DQDL 3NIDF 5DEGA 5DURD 3WIHH 4WEUD 1KG0A 1HWHB 2EKJA 5HJ3B 4TVPL 5C0BE 3FQTB 3W2DL 4HWNA 3RPIA 4ZTOL 4LP4A 2AEPL 2UZIH 1FZJB 5I1HL 2VL4A 2HKFH 3Q5YA 2AJZB 4PS4L 2A77H 2UWEB 4HWEL 2C1PB 4IJ3B 1A7PL 3F58H 3HCVA 3O41B 5IB4B 3WNKA 3QUYA 4DKEL 1OP5K 5IKCB 1P7KB 3FOMB 1MJ7L 3QEUB 4WTZA 4N9GA 5I1AA 4Q6IC 4N9OB 5D72H 5IVOA 1UM5L 4G6AC 2IF7A 4HXAL 1JYVA 1KTDB 1EH9A 1YNLH 4WHYH 3ZE1F 5IHUH 4QRPE 1SJXA 2RCSL 3UYPA 4Q6YA 2VL5A 4LPTA 1FRGL 3DBXB 5EU5B 4PV9B 4Z7QE 1NGXB 1J0HA 3IFPA 2DQUL 4OLWH 4NQDB 3SE8L 2O61B 4H26A 4U0RB 3ORJA 1B88A 4XMKH 1YEIH 3TN0B 3U6RA 3MV11 4DK6A 4G8EA 1XGPB 5ID0B 3OXSA 4OV6F 3U7YL 3MX0A 4UILL 4OZIA 1VFBB 1RZ8B 1P84K 5D6CB 2VZ1A 1JF1B 1JN6B 1YC7A 2IADA 4X6DA 1FL3B 4HT1H 2YPKB 1A3RL 4HG4K 2ZUXA 3PNWB 3IXTA 1AD0B 4F57H 5DF0A 4IRZH 4P23B 8FABA 3ZL4H 1CK0H 4M43L 1LO2H 4ZUUB 3VFRA 4PJAA 5GRWA 2Q7YA 3WHE0 4N1CA 5FYKH 1R0AH 4TSBL 3G5YA 1Q0YH 1VGEH 3GSWA 2BX5A 1I1FB 5I66A 1QQDA 3EYFB 2H6PB 2I07A 3LPGA 5SWZA 4XC1L 5FYJD 2AEQH 4KTEL 1IZJA 5AWNL 1EZVX 2E9JA 2R0ZL 5HHXL 3KYKH 4O51A 2P5EE 5E95B 5GJTL 1XGQB 3UTSD 3VG9C 15C8H 3JWOL 3MA7B 5IW1B 4GG6A 2XZZA 4GSDL 4K94H 1RK0A 4TYUA 1ZLUH 5J56B 3R1GH 5IB2A 5ICXA 4FQJL 3C2AL 1C5BL 5IVXE 4DKDC 4JANA 1P53A 3NCJL 1E4XI 2YRPA 4E0RA 1IAMA 2VABB 5I0DA 1D5ZA 2C4XA 1S7VB 1KCRL 1KUMA 5DRZA 2ZKHH 4WHDA 5KJRL 4YEEA 1WT5C 1XIWA 1FZMA 1F42A 5FO8A 3SDXB 1J1OL 5DVMA 3Q1SH 1GGIH 2LE9A 4FFWC 3FO1A 1M1SA 2W60A 4AH2A 1MFBL 5GRVL 3GKWH 2VLME 3VW3H 5A2KH 3PABB 2G60L 3VD5A 4EVNB 4P0DA 1S8DA 4LEOB 4Y88A 2B4CH 2HLFD 5JIKA 2VLRB 3CFDA 5GZND 5HYSB 5DJ6A 3QJHB 4U3CA 4FP8L 1TPXB 4Z0BL 1B2WH 3MGOB 3QEQA 3OJ2C 4XPAH 5EU6B 2J6EL 1JZ4A 2AKRA 4X6FA 4HFUL 4PJ7E 1LE5B 4OGXL 1RFDL 3UPCA 4DKFL 3B5TA 2E6JA 5E6IA 4X7SL 3S5LB 5B38B 1K3IA 5DJYB 2EE9A 2YRZA 4YPGB 2PYED 3TJHC 3HI1A 5L2KB 3BH8A 2F5BH 1JCKA 4GQ9H 5TF1H 4LPUA 2F54D 1RULH 4I18C 3MRBA 4PRBA 1Q1JL 4WTXA 4ZTPH 1J18A 1GC1H 1KB5L 1QPPA 1KACB 5C7XL 2XTJC 3MRQB 4JFDD 1Y6KR 3C5ZD 3LDBB 3K4ZA 2PETA 1G7HA 3BKMH 1E4JA 5GS0H 1HH9B 1EXUA 2CK0L 2OX5A 4LDLB 4MAYA 4J1UB 4Z18A 5DC9B 4UIMB 5H35A 5I8CA 4UT9H 5EC2A 1EEYA 2AJ3A 4POZD 5TGBA 1U3HB 1DUZB 4JPWL 1EGJH 3L5XH 2Z92B 3AVEA 4J6RH 5DK2B 3LS4L 2CLVA 1BLNA 4RAVB 2FSEA 2RFXA 3RHWF 4OLZL 3IU4L 3WN5A 3D2UB 4H5SA 2CGRL 3MOAH 2AEWA 4U6YA 4TOYL 4I5BA 2FJGB 3ZT7A 3DHJA 4R26H 2CLRB 5F9WC 1KFAH 1U95A 4DW2L 1RZGB 5IMLA 4DFIA 4JY4B 3VA6A 1SYVA 2XTJE 5C0NC 4D9LL 4TQEH 5KSAD 1YMHB 2EIDA 3TO2B 5IIEA 1UM6H 4MCZB 4LQ1A 1HXMB 1D6EB 1U8PA 2A9NL 4MZ2A 3VXNA 1K2DA 1PKQA 1FFOB 2VE6A 4I3SH 1JIBA 4P5TA 1Z3GL 4OTXH 3X17A 2PF6A 4EI5B 3I6GB 4AL8H 2YD5A 2HJFA 4ALAL 4DJMA 5FA3A 3MROA 4L4TB 1CCZA 4FABH 1NFDB 3MV7E 5SWSD 5IMMA 1CD0A 4XPTH 1FNEA 1MHPH 4HD9A 5CGMA 3G5ZA 4Z76A 3VWKC 1KEGL 2FYYB 3I3DA 3CLEL 4O4YL 2OTPA 5DJAA 3RWHA 3SKOA 5I1LA 3V6BR 4HWZB 5C09E 2G2RA 4LF3B 4ZAKD 2OMBA 5TE7L 3IKKA 3O2VL 1BVKA 3MV8B 4DVRL 5T5NG 1T1WA 1J5OL 2G75B 3MLWL 5GRJL 1F45A 4J8RA 2OZ4L 4PJBA 1HZHH 5DTFA 5EOTB 3OZ9H 3RBGA 1EK3A 1UQSB 4PJCE 5E9DE 2X7LB 1NBVL 2BVTA 2DM2A 3GIVB 4UT7H 3OWEA 1F8TH 5FYLE 1Z9MA 3BKYH 4LAQH 2ZP0T 1FO0L 5FHBH 1BBDL 2MMXA 1KCSL 3VFWA 4YIQA 2AGJH 4OD3H 1QLRA 1F4HA 4L4VB 3F5WA 4Y5VA 2ZNXA 2RB8A 3BISA 1FN4A 4HQQL 5IGXH 2VN7A 3GSUA 3ZZ1A 3VMOA 1WISA 3FQUA 3DUUB 4NKMB 3GSXA 3UTPD 5FA4A 3KXFE 5DJCA 2W9DL 3G6JE 4KKLD 5HGAB 1H8OA 5FKAB 4JHZA 1LNUB 3DV6B 2PXYA 4JY6B 4BZ2L 1KCVH 4EBQH 2OTWA 1BZ7B 3RA7L 1CD8A 1XF5B 3DURB 3PHQA 4L5FL 1KIPA 4Q9CA 1DE4A 1W72H 3QDGB 4NQED 3C5JB 3C9NA 3O2DL 1AD9B 2YKLH 3S4SB 5GS1A 3L5WA 3O2WL 4NQSB 4YDVB 3CPLA 4Z7VA 1Q9KA 4KTDL 4M7ZB 3I85A 3G5VB 4KK9C 4C83B 4OF0A 3BKJH 5I0ZA 4JREC 4OV5A 2FJHB 5DJZB 12E8L 1SYSA 5DD0H 5D96B 4X7TB 1JZ7A 2AJYH 1CFQB 5D7KD 2PW2B 4F80A 1RJZA 3VWJB 4UT6L 3S36H 1T5WB 4N8VB 2B1AH 3DYOA 2HTLD 4NC1C 4GMTL 1AHWA 1DCLA 4DZBA 4DEPC 1WIOA 3CFCH 1S3KL 5CJOH 3UEZA 5I1KH 2R4SH 3OGCA 5BVPL 3KWWA 1MY5A 5DEZA 1T04B 2AABH 2X1PA 5EULV 4JAMB 2Q8BL 1VGKB 4LLAA 1JHTA 4O9HH 5F9AC 3LKNA 1JGVH 3FQNA 1V05A 1EERB 2R0WL 3DV4A 1NBYA 4PLOB 4HWUA 3ARFA 1B0GA 2DMCA 4WO4B 4NHCH 2YBRB 4WUUB 1HQ4B 2A6JA 2IAMD 5DQDL 4P2OA 1SM3H 3BZEA 5ITFB 4XCFL 4OLVL 5EPMA 4XPGL 5BV7L 3HE6D 4GG8A 1I9JL 3SBWA 4N8PA 4UQ2A 2CIKA 1AFVH 1WC7B 4RSVA 2CUMA 5EZJB 3T4YB 1LQSR 3O45B 1OT1A 1FIGL 5MEND 3LVEA 1A14H 2MHAB 1IQDA 3MLSL 3WJJC 3OXRB 5CS7A 1G6RB 4NNYB 4ZFOA 1A7NH 1U8OB 4U3HA 3DVGA 4U1MA 4NO3A 4CMMA 5KS9A 4P5KB 1T1XB 3BESR 5IF0A 2HN7A 2BCKB 3QIUB 5F96H 1IEAA 4NC1E 2HFFB 3V0WH 1YUHA 4PYHA 2E7MA 5BXFA 4AIZB 3CD4A 4NC2B 4EI6A 4M62L 3KLHD 4JVWA 5HGBA 3B3IA 3QHTC 3GMPA 3QQ9D 1J9CT 4JFXB 4WWKA 5GS2H 4LASL 2ED7A 1PG7W 4NNXB 5LXGH 3MGAA 4HKJB 4BKLA 2X4NA 4NRYB 2MOVA 4OAWA 5FYJE 1QBAA 1MJ8H 4HH9B 4F7EA 2CSPA 5ESQB 3STZA 2DLEA 1NSNL 1I7RA 3N9GL 4X6CB 5HHVH 1DQJB 3RUGF 1INDL 1S9KC 1YECL 2XZCH 1BJ8A 4UAOC 4P5MA 1CDCA 3QWQB 2GJ6B 4HUMB 3UTTD 3ULVL 3C5ZC 1X5JA 4GKZA 1S9VA 4TULL 2VDRH 3E8UL 3T0EA 5DDHB 2XWBB 5DGQA 5I18H 4LKXA 2NY5C 1TCRB 4C55A 1V7NL 4NQXB 5IQ7L 2D7OA 1ORQB 2F19H 5BOZG 1X7QB 1HSBA 1AP2A 4OM1H 4QTIL 4LMQI 3UYRH 2WANA 5DRNA 1NCWH 1MI5B 1S7TA 5GS3A 4JG1L 5DVKA 2ADIA 1U8KB 4Z7OF 2X9XA 1E4WL 2Q3ZA 1JWUA 2Y36L 3IJHB 4POZC 1QFWI 1ACZA 1PX3A 4P4KB 3S9DB 4RX4A 3H9SE 2A83A 3F7VB 3LKRB 3MRDA 5ANMA 4LSDA 1H3VA 4JHAH 2UV3A 3X14A 5GISL 5IJVA 1MCNA 5IV2A 2F15A 4EUPB 1RUPL 4F58L 1BD2D 4NKOA 2C7UB 1KNOA 4P9HL 4ZDHA 3D87B 4K2UL 2X4RB 1XZ0A 1NDMB 2PYEE 1IKFH 3N85L 3T8XB 4M1GL 3VJ6A 4PJIF 2F54E 4HWBH 3HAEH 4EDXA 3IDXH 3PV6B 3AS2A 1AC6A 1C5DB 3VXQA 1S7SA 4MB4A 3QIBD 3ZTJG 1WWAX 3C5SB 2R56H 1OP5H 5CEXA 2AS5M 5KSAC 5LCVH 5L6YL 2ATPA 2R2EA 4P2RE 2DQGL 5ILTL 3CAFA 2WAHA 1XCQB 3D39B 1I1YB 4DGIH 5ENWA 3CFIC 4KJQD 3S35X 3DUHA 1ZTXH 2R2BA 3IJYA 1TVDA 2SEBB 1CICB 4AIOA 2V9QA 3MLTB 2PO6D 1AQDB 4K3DH 3B5GA 3WXVH 2DKSA 1C16B 1HHJA 4MZ3A 3H3PH 2P45B 5EN2A 4JHWH 4Q6IA 3GJFA 3FQRA 5FGSA 1ZLWK 5IB5A 4OFPA 3S5LG 3O9WA 1GL4B 2FJFB 4TSAH 4OM0H 1I1AB 3K8MA 4XI5D 1YJDL 4HUXA 5E8PA 1T0MB 1RZIA 2Y1VA 1N6QH 1R3KB 5EUOA 2VXTH 2J4WL 3QZWB 1E4KC 3VI3F 3BT2L 2KH2B 5T1DH 3S37X 4G80B 1N3NB 1CWVA 1KJVA 2J88H 2LU3A 4UQ3B 4X7CC 1MCWM 4NCDA 1Q9LB 4UTBH 3NFNB 5E2TL 2PKDA 3HZVA 3KHOA 5B3JF 1JNHA 4LLWA 5HI4D 2DYPA 3LIZL 2BHYA 4FZEH 3QFJE 4R2GC 1INQB 4ODBD 3M1BA 4X4ZA 3D25A 4QHLB 3KPPB 4LQFH 1QRNE 1FNLA 1P7QD 3BSZH 1WEJH 43C9B 4Z7WF 3MLZL 4P57B 3FQXA 1HHHB 4UU9A 1EPFA 3VE0A 1F4WL 5I76B 1IRAY 2BSRB 4FQPA 4E41B 4KMTH 3V9FA 4Y1AB 2ZUSA 2ITDA 3NN8A 3FB7A 4R3SA 4Z77A 1NEZA 3HC4H 3MZGB 4ELMB 4D0BB 3U36A 3ZDXF 3FO2B 3PGCA 3T2OA 4YBLC 5ISZE 3RUGE 1MHHB 3SGEI 5JHLL 3O6KH 4PJ7A 5HVFB 4PRPD 5FM8A 5HY9B 4NNPL 3MJ9L 3O6LH 1A3QA 3QNXA 3MV9E 2OI9C 5JNYA 4WFFD 2UZYB 4ODHH 5L0QB 5IG7A 5GXBB 3LPFA 3TWCL 2V2WA 4WW2F 3U2SA 1LO4L 5I74B 4C56D 3HMXL 4MJ5A 3RVXD 2VSDA 2GIYA 3X12B 3DXAE 3ZMRA 5F71A 2H45A 2FNBA 4GLRH 3ZHKA 1ZLVH 4H8WC 4JRYA 3HUJB 3VFPB 5BO1H 1HKLH 4XVSH 1QBMH 1M4KA 1BQLH 4P4RA 4K3EL 4B7IA 4F9PA 1HIMH 5DEGB 2HJKB 2DDQL 5JXEA 2XA8H 5C0AD 5I6XB 2EE3A 2IAMC 3UTPE 1G7MA 3QEGL 1YQVH 4XNZB 3RPIB 3HLAA 2HVJA 4FQIH 1I9RL 5DVLA 1DBMH 3HE6C 1MWAL 5HYQA 1A6PA 2AJVL 4LCIH 2IAND 4YE4H 1SJEA 1I8MA 1T21A 1ND0A 4PJIE 4NQEE 3HCVB 4LHJB 3QUYB 1CU4L 3VXSD 5IB3A 4Q74A 3GJEA 1A21A 2DJUA 4N9GB 5I1AB 4X4ME 3SJVD 5JHDD 4MA7L 3CVIH 4JQIL 1A6WH 2ED9A 1KTRL 4Q97A 2DLHA 3B9KB 5GGQH 4CAGA 1N0XH 1XR9B 3JV5A 3VRJB 3L3OA 3OG4B 2NY2B 1WZ1H 3IFPB 5T3XH 1HYSC 5J13B 2IFGA 4NWTH 4H26B 3KPOA 25C8L 4XCEA 4WUKL 5FGCE 5HHOA 3W81A 2XI9A 2YN5A 2QR0A 3DX7A 4CUCA 1JZ2A 3U6RB 1RD6A 2V17L 2VXVH 4G8EB 4GAGH 1QFWM 1MFEL 3QQ9C 4K7PX 3OXSB 4XPBL 4OZIB 1BM3L 3NMEA 4NQCE 4S1RH 2IGFH 2IADB 3NCYS 4X6DB 3O3AA 3ARPA 7FABH 4P9MH 3ARGD 3KDMB 2H9GB 4NZTH 3QDME 4OZGE 3IXTB 1X5YA 3KPNA 4FTVD 1H3PH 4ODWA 2DQCH 1C7SA 2IH1B 2ZUQC 3S4SG 3BMVA 4RMRA 1B6UA 5I30L 3VI3E 3MV7A 8FABB 1OAUL 3VFRB 4ZOEA 5I1CL 4PJAB 5DD1L 4XH2A 4M4RA 1H3TA 3JWNC 2VDPL 3BPLB 3G5YB 3C87A 3F6IA 3QPQD 1Z0MA 3GSWB 1EZVY 2DBLH 4XNYH 2VDOH 5I66B 5B3JE 1LK2A 2I07B 4N8VG 5SWZB 4PG2A 5GGSA 3JUYA 5IMOA 4YC2C 4RMWA 2VR4A 4OCXL 1B0RA 4ONGH 1ACYL 2VLJD 1X5IA 4APQC 4HIJA 4O51B 4JGMA 3GSNH 2ZPKH 3RGVD 3RBSA 3VGFA 4Z7WE 5EOQL 1NC2D 4P49A 4GG6B 1H3WM 3UZVB 1MNUL 1RK0B 4LVEA 4XPFL 5I73B 1VSCA 3BH9A 4CMHC 5C0CD 3PQYA 5IB2B 3T2NH 5ICXB 5CEZL 1S7UA 1JNNL 3BD4A 1S78C 1CN4A 4JANB 1FPTH 4E0RB 4XNUH 1V8HA 5DEFA 4OF8A 2HRPL 4BH8A 1KENH 1AQKL 1BZ9A 1F6FB 3MLXL 5DRZB 2JTDA 3DTXB 2D0GA 5D2NA 1XIWB 1FZMB 5FO8B 4KPHH 3ILQD 5A2JH 5LVEA 3FO1B 4U4BA 2W60B 3RZCA 4RCAA 4AH2B 3MXVH 2A73A 3RWFA 3OKEA 4ESKA 2Z93A 5ADPH 3BGFC 2VISA 1S8DB 4QXWA 3CU7A 1NCAL 3CFDB 3T0VA 3QIBC 1JGLH 5FYKD 1TCMA 4MA1C 5DJ6B 5I71C 5SV3A 3QRGH 3C6SA 4CDGC 1KELH 5TE4H 2DQJH 4LSPH 4AG4H 1I3GL 3I9GH 3B43A 2AKRB 4M7KH 4OLWL 4BELD 5CGTA 4OZFA 1OPGL 3DROA 5E6IB 3JVGC 1TZGL 1UH3A 2YUXA 2GEEA 2VXQH 1GJIA 3HI1B 1IGCH 3BH8B 1UVQA 1MOEA 3QXTA 1NLDH 1W0YT 2CRYA 3MRBB 4PRBB 3LCYA 5E4EB 4HW6A 4IMLB 4XNXL 3O81A 4QLRA 1HDMA 3QDJD 4P2QD 3SDDD 4IM8A 4WW1A 5TQ2L 1KULA 1F90L 3UMTA 4IIQC 2IPKA 1G7HB 1XGUB 4QWWD 4FQCL 3ZTNL 4XI5C 3QCTL 1SMOA 1BD2E 1EXUB 5H2BA 2ARJA 3ZL4L 3HI5H 4MAYB 4JFOA 3GSVB 4OCMC 4J3OC 3IGAA 1BF2A 3LEXA 4KC3B 1R0AL 4I8DA 4OI7A 4XBEL 2RGSA 3JWDH 5I8CB 2NNAA 1OP9A 5EC2B 2V2TA 4XP4L 4JCMA 2AJ3B 5TGBB 4U2YA 1P5UA 4L3EA 5B8CA 5B39A 4PJGB 4FG6C 1Q9OA 1GZPA 1F4YH 3DUSB 4DQOH 3U9UA 2DB8A 1EFQA 2CLVB 1BLNB 4XTRD 4ENED 2FSEB 3GI8H 2RFXB 1PY4A 1JL8A 1JVKA 4F37K 4WEBL 4KMQA 3LSOB 3BYYA 4H5SB 2OR8A 4JR9L 3R1GL 1UWEH 1NC4D 4U6YB 1CXFA 4I5BB 2Y5TA 1JGUH 3V5HA 1X6LA 3EYSH 4AEFA 4MMZC 5HHMB 2BVYA 1U95B 1KJ3H 4YFLF 4EUPG 5I1IH 1SYVB 1LE9A 2ESVD 1UJ3C 4CN6A 3LMJH 1FORH 4YK4C 1ZANH 3FRPG 5GGVY 1GGCH 4WI9A 4G8IA 3OJVC 1JJUA 1FSKB 1U8PB 3WS3A 3VXNB 5IHLB 1K2DB 2Z4QA 4ODVH 4P5TB 3T65A 5C6PB 4U6VH 4LRIC 5CSZA 3UTSA 1XFPA 3MR9A 4OUUA 1C1EH 3VFNA 2B4CL 3WD5H 2HJFB 4NZJA 4OQTL 1LDPL 5FA3B 3MROB 3RVXC 1IVLA 1WV7T 1B2WL 5HD8D 1UWGH 5ICZA 3C8HA 4LSUL 5H8DA 5CBEB 5IMMB 3G5ZB 3SGDH 4JO3L 4Z76B 2VNCA 3QH3A 4ODXB 2YD7A 5DJAB 3U7WL 3RWHB 2ZWLT 2XT1B 4OCLC 1GIGL 3QQ3A 1KF9B 3X3GL 3MGTA 2P42B 5TF1L 2G2RB 2ILLA 1CLZH 1SBBA 2ZZUT 3ARVA 1DBBH 4HUKB 3P4LA 1BVKB 1T1WB 4J8RB 5FYLL 1EFXB 1GC1L 1YZZA 4PJBB 5DTFB 2IALA 3GRWA 4ELKA 1CF8L 4U7KA 4OZHE 1N64H 1Y6NR 1E28B 2J3SA 3UC0H 5JR1H 1EBAA 3MJ8A 3BJ91 3RTQD 2A6KA 3BPNB 2W91A 4YIQB 5JIPA 4HLZH 1OM3H 3QZWG 4LEXH 1JZ8A 3FB5B 4Y19A 1J86A 3F5WB 4PRPE 3HS0B 4S0SD 4FXGA 4LSSL 1FAIH 1QEWA 4WU7A 3OKMB 3GSUB 5F1KC 4D3CL 3FQUB 3Q6GH 2PYEA 4DOHE 4ZS7L 3SCMB 1EVTC 4X6EA 5DJCB 5FA4B 4GJTB 1JV5A 5KG9A 1U6AH 3BWUC 5INCA 2NQCA 2X1QA 2ICES 2OTWB 2N1KA 3VFOA 4KRMB 5F88A 4X4XA 3PHQB 1P4LA 4J6RL 1XF1A 3PP4H 4JFDA 1DE4B 3EO9H 4R96A 3BKCL 3C9NB 5GS1B 5SX5K 3L5WB 3QUZD 4Z7VB 4G8FA 1LP9F 4HC1L 4F7TA 3H0TA 4EN3D 3DYPA 4R9HA 4NP4L 1NL0L 1SYSB 2FGZA 3O11A 3B5HA 3RIFK 4I3RL 3WNPA 4X5LA 5CP7A 1RJZB 3SKNA 4EIZC 2ERJB 1KIRA 2X70B 2YUWA 3BHBA 5GJSH 2DLGA 3PP3K 2DLFH 3IDNA 1X6NA 1GZQA 1AHWB 1DVFC 4KMLB 4R0LC 3TM6A 1VFAA 2IANE 3ARUA 3L5IA 2E7LC 1EEQA 3PGFH 2VKXA 3OGCB 1L0QA 3KWWB 5GGRA 3VMPA 5C0RL 1J0IA