4ZXBC

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
187
Chain Sequence
QVQLQQSGPELVKPGALVKISCKASGYTFTNYDIHWVKQRPGQGLEWIGWIYPGDGSTKYNEKFKGKATLTADKSSSTAYMHLSEKSAVYFCAREWAYWGQGTLVTVSAAKTTAPSVYPLAPSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTCNVAHPASSTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone receptor/immune system
molecule keywords Fab 83-7 heavy chain
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 187
sequence length 209
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbC02
1HINL 3KLAB 3MRGA 2VAJA 4WU7A 3NH7L 2UVEA 1A3LL 3K1DA 3SDDB 3ZTNH 1YMHB 1KB5H 4KJYB 4JFXB 3RWDA 1HYSD 1CE1L 1FFNA 2VLKD 3QAZC 3I9GL 1MY5A 4UINH 3TZVB 2OL3H 3Q6GL 3ULUE 4LFHG 3EBAA 1VPOL 1RV6X 4EUPB 3FQXB 2NXZD 3VXSA 2HG5A 3N06B 5INCA 4UDTA 1HZHH 1I1YB 1QYGL 4V1DB 4R7DA 2VXQH 2NY1B 4PJXE 1I1AA 3JWOC 1CYGA 2M26A 2OCFD 2XRAL 4L4TD 4PD4J 4OCYL 4DJMA 2Z91A 4JFFB 2HTKC 4ZAKD 1L9NA 1S9WA 4M9OA 5DJZA 4P2QB 1LGVA 1WCBB 3QQ9C 4S2SB 3NIGF 4PJDF 1BIHA 5D96B 4RNRA 4IMKC 5IEKA 3GSXA 4OGAD 5KG9B 1EHNA 2W9EH 4RAUB 4X9HA 4OZHF 1U3HC 4DUXA 3P4NB 4J6RH 3S35H 2R9HC 2MQ0A 4OCRL 1DQLH 3MLZL 1SEBB 4B7IA 3EYVA 4DZBB 2WP3T 3DX9A 2AK4D 4D3CL 3ARDC 4LSQL 3RWGB 1JPFB 3O6LL 5I1DB 1DN2A 4NWTH 5B4MC 5GIRB 5TDNB 2FD6L 2ITCB 2QQKH 5DLMH 3ZYIA 3S4SB 3NACH 2R4SL 2YZ8A 1W72H 4Y19B 1MCQA 1UB5B 5C9JB 2HKFL 1IILE 2NY2B 5DD5L 4ACPA 1JV5B 4LIQL 3WNLA 1NJ9B 2BVTA 1A6AA 2AV1A 3ESVF 4Z8FL 1ZA6B 5ACMA 5I1CL 1HILB 1U3HA 4ZSOA 3B4NA 1F3RB 1QLFA 4JKPH 2Y36H 3GMLB 4ZUWB 1GIGL 3DO3A 4KROD 4JY6A 3UTTA 1MI5B 2ED7A 2FEEI 4OZIB 1CICC 1MCPH 1UB6B 1YN6A 1PYWB 3MBXH 3HCVB 2LAAA 3QP3A 3WNKA 1V05A 5GGUA 5IV2A 3NFPA 1T7YA 3VRIA 3SDCA 1LO4H 5AAWA 4M61B 3FQTA 3QUYD 3QUML 2Z92A 2ZNXA 5CHNA 2PXYC 4PY8J 1HEZB 3FRUB 3QZWG 4BQ9A 5FM5O 4XVUC 4UMGA 1NFDA 2OR9H 1MIMH 4HK3J 3JWDC 3RDTD 2BCKA 3O6MH 3S96A 3U4BL 3G6JE 1NGXB 3KPTA 2OQJB 3QPXL 3F7YB 1MWAB 2VDKL 4I18A 4MNGA 4RCAA 1H9VA 2COQA 3IKKA 3QCTH 2QSCL 4OFDA 1GGUA 4PPTA 4X6DF 4PD4K 3DTXB 1AKJD 2RB8A 4X9GA 5E99H 5IT2L 1SVZA 2Q3AA 1LEIB 2YKLL 4LQFL 1FYTB 3BH8B 4M43L 3GMQB 4GH7B 1ADQH 5MEQA 1B9ZA 1MJ8L 3BYTA 5DRWB 3QCVH 4NKDA 4J3UA 2BOCA 4B53A 1AO7D 4PGEA 2PXYA 1G7IB 4M1CC 2OJZH 4KDVA 1YA5A 4G6ML 4PJEA 2JJVA 3MV8B 2ZWLT 3SDAC 3CVHA 1OVZA 3QUKA 1H15B 1NPUA 3SKNB 1IEBB 1PG7L 3U0WL 3BGMA 2DQEL 1FLRL 5E6ID 3KDMB 5AEAA 1HHGB 4BSWB 4RX4D 1RIHH 2G5BA 4OD2A 1DQDH 2YD5A 1TTGA 3LN5A 2BHUA 3T1FB 4HH9B 3QAZB 4KZDL 1F8TL 3MNVB 3WIHA 3D25B 4L1DA 4ISVB 5HSFA 5AZ2H 4HIXL 4TNVF 4HX1A 5E2VH 4XP4H 1N5YL 3HA0A 1XF4A 2V17L 2YPKA 5JORA 3P4LA 2VR5A 5JHDA 2HT4C 5JHLH 2W07A 1F11B 2QQQA 3VXUB 3HG1E 4KDTC 2ILLA 5DZOA 2XY2A 1EFXD 4P9MH 2HJLA 4X6FA 4PRDA 1RUPH 3DX9B 4BELD 4QOKB 2O61A 5KSAD 5KOVC 4LCUA 1JF5A 3SDAA 3CSBA 2R29H 3PWPE 5KSBA 1T22A 5FUOH 3C5JA 3QUZC 2W9DH 3H9ZA 3MGOA 4OF6A 4WI9A 5GRUL 2EDQA 2A9NH 5HYFA 1YEKH 4J1UA 2DQFA 3UXFA 2EEBA 3V5KA 2DTSA 2RBLA 6FABH 1RZKC 1SBBA 1QNZL 3MUGA 4O2FB 1AGBB 3CAFA 4K3HA 1CR9L 1NC4B 4P57A 4GKZB 4JFDB 1J86A 5TFSH 1YN7A 5CCKL 1YN6B 4RZCA 5MP6L 4HMCA 4PRPE 1PY4A 4WW2F 2KDGA 4GRLC 1GAFL 4LAQH 4X6CB 4FG6D 4MNHB 1JPST 4PJFF 4HS8H 4XCCL 2VLJA 4AL8L 3ARDB 1NAKL 2ORBL 2F53B 2R2EA 2Z92B 4OFKA 2P44B 3SE8H 4H8WC 4GXVL 1KELH 3WSQL 5H2BA 2IGFL 4J7RA 3MLVL 4ESKA 4LCIL 3UEZA 1K9TA 2X4OB 5L88L 3S96B 3SO5A 1E4KC 1BFTA 5SWZE 4NZDA 4PFEA 4DUVA 3V8CA 5C0AE 5CBAB 4C83B 3Q5TA 5C2UB 1IARB 4KI5D 2X1WL 4XVJH 1CZ8H 4EXKA 3O0RH 1RJZA 2B2XH 4NZUL 1AQDA 4GRMB 1JGUL 1CICB 5KTEH 2JJUA 2OZ4A 4FQLL 4XNUL 4GRLA 1CLCA 1U93A 3MACL 3C6LC 4PJ5A 3H9YA 4PGEB 2X9YA 3KYMA 3CFBA 5T1MB 4JQIL 4S1RL 1DSFL 2YRPA 1YMMB 3BZ4A 5E9DD 1ZHKB 4PY7B 5FO9A 3UTSE 4APQC 4M8QA 4D8PB 4FOMA 1XF3B 1LDPH 5ALBL 1A9BA 1EH9A 2ZCHL 3BH9A 2RGSA 1QSFD 4JCLA 1CFVH 1U3ZA 2FJFA 1G7MA 3GIVB 4RGNC 4TYUA 5JA9A 5ILTH 2J8UA 3BP6A 3T0ED 4RWYL 4OLWH 5DEGB 5CJXC 3MUZ1 1JYNA 3PNWB 4UDUB 1JIBA 1EAPB 3PDGA 5IB2A 3M1BA 4C56A 1FBIH 3GNMH 4NGHL 4PRID 5GS1B 1C7SA 3FFCE 4IS6B 4D94A 3VW3L 2JB6B 4MGXA 3M07A 3KHQA 3HNSL 3V4VL 2D03L 1NSNL 3LRSB 3RU8H 4LSVL 3Q5OA 5DUBA 1LWRA 3GSNB 3DGGA 2GK0B 3FB5B 3OQ3B 2HFFB 3GMOB 4OM0H 3SEPA 3O3AB 4N90E 2WBJD 1OAXL 4Z7OF 2DLHA 4C59B 4OZHE 3H8NA 4OI8A 1AI1H 5HYJA 1FO0L 2V7NB 4BH7A 4KJQD 2MCPL 3RUGF 3THML 2VXSL 1GGYA 3QEQB 3DXAA 5CJXA 2XN9B 2DQFB 5DJXB 4YQXH 2X4UA 3MRCA 2EYRA 4G6AD 4OLUH 1IQDA 4W81A 3U7YL 4DK3A 3U1SL 4QXTA 4P57B 1YYLL 4QTIH 5CZKA 4OIIH 1CFBA 3N9GH 2R0KH 1Q94B 4P5TC 2RQ8A 5EIIB 7CGTA 1ZSDB 4UT7H 1YZZA 4OF5A 1UADC 1I7TA 5JXAL 2VLJB 3QH3B 2PW1A 3TESA 2ID5A 5TDOA 2VLKE 4XCYA 3HS0B 4O58L 4LKXB 2PN5A 4Q6IC 3QUZB 4OLZH 4OLYL 3T3PF 1QFOA 5IHUL 5ICXA 1OLZA 1PZUB 1NCCH 1K4DB 3QA3A 4HKZA 2SEBA 4NO5A 2R0WH 3ABZA 1IZKA 1MJJB 4XPTH 5GS0L 4YFEA 3SDXB 3JV0A 3M45A 5CZXC 4HGWA 3WFEL 2E6QA 2R2BA 4HJ0D 5ADOH 3EHBD 1T20A 5FOBA 1OGAD 1BGXL 2FX9H 5IQ9B 4UBDD 5GS2D 2AQ2A 2DJSA 3IJHA 1GC1C 3UBXA 3F58H 1I8LA 4P5TA 4WU5A 4XP1L 1MFNA 4GRLB 4LSPH 1O0VA 3WS6C 3W9EB 5GS0D 3H9HB 1WZ1H 3JXAA 5M94B 1IL1B 3ZZ1A 1IEAA 1XGUB 1BVLB 1MCOL 1JHTB 3BP5A 5MEND 4KJPC 1TQCC 5T1LA 2A2QT 4Z7VF 5KVGH 4L4VD 1DJSA 1TETL 2G75B 5IKCA 3TO2B 1OTUC 2HJFA 3L3HA 4C57C 3TO4A 4LNRA 5DWUL 2VQ1B 1JWMA 5SV4A 3LEYL 2AK4E 5JPMB 1PKQA 1RZIB 4LMQI 3FO0L 4L9DA 1YEIL 2DI8A 2XA8H 5EO0B 5JW3H 4Z95H 1OARL 3GSRB 3P4OA 1E6JH 3G5ZA 2WQRA 4FTVB 1PX3A 3IAGC 3MA9H 1S7XA 4QNPE 3WDJA 2FZ3B 4K8RL 2YSSA 5CEXA 3LSOB 3C6LB 3GMRA 2HVKA 4AM0A 1A6TA 3FT3B 4ELMF 2FR4A 1TMCB 4GJTB 2E9WA 3WLWD 3ULUH 1RHHB 4XCFL 3R0MA 4LEXH 4APQB 4WWKB 2XWBA 3WDIA 5AUMB 1F6LL 4GRWE 1U3YA 3MV01 4RGNB 3OB0K 3DURA 2CDFA 4R4BB 1EO5A 2AEIT 5H35B 3HFML 1G9NH 1NGPL 1VFBB 1WEJH 1DUZA 5AWNL 5EG6C 3QQ4A 1B90A 1RIUH 2D7NA 3NVQA 4GXUM 3QEUA 4K7PY 3CD4A 4X0KA 3RWIA 2HA1A 2AGJL 5F7LB 1Q72H 5DMIH 3O3EB 1ZVSB 2N7BA 3HRZA 3MO1A 1T0MA 5I76B 4KMQA 4FQJH 3OKMA 4OZFG 4WI7A 1NCWH 15C8H 1S7QB 1UYWH 3LEVH 3AREC 4MQTB 1IGJB 43C9A 1X9QA 2PW1B 1L7IH 1AGCB 1ZHNB 1VHPA 3BSZH 1N8ZA 5IHZB 1J0HA 1BM3L 2W0PA 3VCLA 4QGYA 5GRVK 4HUVB 3BQUC 2XPGB 1I7ZB 3QDME 3QIBC 5JDSA 3U2SA 5DRXA 1JI1A 2AJUH 2QQLL 1HIMH 1AO7E 1VKXA 1ZLSL 1EZVX 4WUUE 3VWKB 5CKGA 2ED9A 2VTFA 1ZVHA 5IBLD 5HHOA 3VDAA 4ODHH 2YEZA 5DVLA 4K9EH 4X4ME 1K3IA 3B2VH 1ZLVK 1WAAF 4X7CC 4YAQA 4OBRA 5IB1A 1IC7L 4PJBF 1F3DH 5C0ND 1HSAB 2VMFA 1X5XA 3PE9A 3T1WA 4GW1B 3I2CH 4NQED 1X5JA 5E8PA 1P7HL 3BGFC 1E6OL 4KH2A 1XCTA 4F7MA 1WT5C 4WJ5A 4HULB 5AZEH 3QXWA 2B1AL 4KQ3H 4Q6IB 5L8LB 2DLFH 4WI4A 3UDWA 5C0BB 2BNQB 5GZOD 4R2GC 3U48A 3C2AL 2VJXA 2P5WE 1BQUA 2WMPA 4GKSA 4JY4A 2R23A 4K3DH 4XH2A 4JM2C 1OAQH 3GMNA 3ARYA 2I07B 4GG8A 2ARWA 3KPQB 5JR1L 5ESAA 4LNRB 4ZG1A 1JWMB 4NKMA 3OKKB 1XIWD 1GSMA 1YECH 1HI6A 1YPZB 5HYQB 2YMXH 3IDMB 4KY1L 3BWAA 1UXSB 2BY3A 4Z77B 3A6CH 1J5OH 3RL1A 3LVEA 2HVJA 4TSAH 3VI3E 3QWOA 4HIIB 4FQ2H 4GUPA 2CKBB 1HHKB 1A6WH 2AERT 3MYJB 4ODVH 3T04D 3QNZB 3ROLA 3FO9B 5T5NG 5ITBL 2ZOKB 4JFZL 4AK1A 1JGEB 4CADB 4JO2H 1FVEA 3ARBA 2ZCLL 4F58L 3JUYA 1TQCB 3UJIH 3HE7C 3K8LA 4NZRL 1FFPB 2F54D 4YHPB 5DURB 1G1YA 3VE0B 3BEVA 3DECA 3TPUA 3P77A 2IAMD 1T03L 4QRUA 1OPGH 4GQPH 2WBWB 3RRQA 4ZUTB 3BUYA 5INDB 2OL3A 1HH6A 4ZTPH 4I77L 2OTWB 4YE4H 4I2XA 4EDXA 4CVZA 1OAYH 1HSBA 2Q76A 1FZKA 3FQWB 3FB7A 4H0GA 3VFRB 2G9HA 1PEWA 4I8DA 1CL7I 4OZGA 1KLGA 4PJ7A 4AZ8A 3QRFM 2EDWA 3IFNH 4HLJA 1AQKH 2EYTB 4HEME 3B9KD 3PGDA 4KI5E 4NP4H 1YEEH 3MV9D 3CZFA 1EHLL 2ZCKL 1GGIH 1ZGLA 3T8XA 3QYCA 4Y4KC 3SDYH 3B5GA 3AS1A 4NQXB 3VCLB 2MQ3A 2HFGH 1BF8A 1ONQB 3TH4T 4JQXC 4OV6F 5IVXE 1BZ7B 4AIXA 1D5BA 4Y5VA 5FO8A 2OXHA 2I27N 5BQ7B 5DMGD 2NNAB 4NJAL 3C09C 2A77L 5A40E 4PJCE 4YBLC 2BXZA 1KC5L 1EVTC 1L6ZA 4XXCA 3REVA 1RJLB 5C07A 3BIAX 3T0EE 3AREB 4B0MM 3UPAA 1JCKA 5E24E 3ARSA 1IGML 5B22A 4Y4KA 1FGNH 2R1XB 1N6UA 4ZMAT 3JTSA 4R7NB 2Y06H 1W72A 4PRIE 4JQXA 5CP7A 4ZXBC 5GJTL 5J3HC 3BQUB 3QIBB 2YUVA 1DQMH 4XPBL 3QXDB 3B6SA 4L3ED 1KJMA 3ZO0A 4K23L 5A2KH 1XGQB 3EFFA 5D7SH 5IQ7H 2IH1B 4JZNA 5C7XL 2ESVB 1E4XH 2IG2L 1U8KB 5C0DB 2D0FA 1XZ0B 3RFZC 3N85L 4NHCH 3UO1L 4W6YB 1GGBL 1NCNA 4JN2A 4RIRB 3MBEA 5TPWH 3K80A 1Z6JT 1SEQH 2OP4H 4L29A 1U3JA 2E27H 5DT1H 5GSRB 4TUOB 2FX8L 3VG0L 3FOLB 5IFAH 3H3PL 2YUWA 1YDPB 5SWQA 3BGFB 1V3KA 1ZWIB 3HPLA 4OBSA 1QRND 3MOAL 1G9MH 5IMLA 4XNYH 4DW2H 3NFNB 4LSSH 4OCSH 1R3LA 4X7EC 4ZXBA 4JFPA 5IJKC 1P2CA 3Q3GA 4PG9A 1MAML 3EFDH 5GJSH 5LJYH 1ND0B 4GG6A 4YDVA 1KFAH 1F6AB 4JM2B 4UQ2B 1QFUH 4LLDA 5GRXG 4LGRB 4U3CA 2IJ0C 3BN9C 1FNGB 4F33B 4S1SL 1KB5B 1TVBB 5JXEC 1I9RL 2FECI 2GSIA 1F4WL 2APVA 4OQTL 5C09A 4FNLL 5ID1A 4ELME 3LMJH 4F9LC 1I9IL 1NBQA 4ZFOA 1A6UL 3MFFB 1MFBH 4P0DA 2Y5EA 3MCLH 3MJ8A 5TDPB 1CVSC 5EOTA 4KMTH 1ADQA 3FQNB 1R5IA 1HSBB 2Q76B 4KUCD 3FB7B 1QSED 3MRRB 4JGMA 2NX5B 5I8EB 3N1GC 4RMRA 4QRSA 1A1NB 3VWJC 2FATH 1A4JB 4NZJA 3HR5A 1LNUB 2AVGA 1OGAE 5IJKA 2X4QA 3RGVD 1TNNA 4W6WB 4OQ1A 1BEYH 2PCPA 1TCRA 3HE7B 2CMRL 2R56H 1P7QB 3PP3H 1D9KD 3W39B 1VGKA 3TBVA 2YPVH 4XZUB 4JKKA 3BW9B 1ES0B 3TBSA 4ONGH 3ZSTA 4YHML 2XOTA 3IDGA 4M6NH 4JG0L 1N5AA 1S7SB 3PWLB 4HKBA 5I0DA 3MJ7B 3OR6B 4HH8A 1UJTA 2X40A 4Q0XL 3PHOB 5CUSH 5LWYL 3KPRB 1MFAL 4P9HH 4X5WA 1LP9B 4KKAD 5MENE 1BBDL 4Z0BL 4EOWH 4MDJA 5B39A 3SE3C 3TN0D 1HNFA 4PRHD 3F6LA 4AH2A 3HNTL 2X4PA 4WEUD 4L4VE 3CDGB 2O5YL 3OHXB 3V4UH 1UT9A 4NN7C 5EUOE 3EDJA 4Q9RL 2DM7A 5IHBA 2BSED 2F5AH 4JREC 4DGVH 3NZHL 1M6OA 2B20A 4UZGA 1PLGH 1A7RL 3PQYB 5I1KH 4Y4FA 3TT1L 4MZ3A 1CD1B 3MLSL 5DEZA 4ELKA 2X05A 1TZGH 2V7HB 1P4LA 4XRCB 4ETYA 4NO3A 3B2UC 4Z7UA 4KTYA 1KJ2A 3GM8A 3MRJA 4LSRL 3V5HA 4LCWD 3NGBC 3ZL4L 1S7WB 1FG2A 1RUAL 3DOSA 3O4LB 3HC0A 4WTZA 1GVIA 4PG2A 3TFKC 3C09B 3OB8A 5BZDA 2DLEA 4WO4B 3S36H 5IGXH 4OZFB 3P9MA 1J88A 1HINH 3D0LB 1KJVA 3D0VA 3SE3A 5T3XL 1A3LH 2P8PA 2CDEA 3EJYC 3TNMA 1KGCD 2WANA 3I9GH 4I4WA 1DVFD 1EAJA 3BP7A 4UU9B 4PGJA 3Q6GH 4NRYA 1M7IB 1IVLA 4OCWL 4YIQA 1ZHLB 5FGCE 1VPOH 3OJMB 1RZ8A 3LH2L 4FQXD 4YO0A 5DJAA 1R3LB 4KKLC 3GSOB 3LKSA 5IB4A 1F4HA 4JFPB 2GJ6B 5HPOA 1GXEA 1NEUA 1DANU 2NLJB 5EU6B 3T3ME 5T3XD 3GKWL 5EC1A 2E9BA 4DCQA 1AHWA 1G7QA 1I8KB 5J8OA 2XRAH 3RVWC 4LLDB 4XC1H 4CVUA 2N1KA 5M7QA 4NKOB 1KTDA 1D5XB 1NH6A 4OCYH 4WW1A 4IRJB 2IQAA 1U8IB 4X6BB 1DQJA 3OKEA 2E9IA 2IANB 3VFPA 4V2BA 4KFZC 2UYLB 3SO3C 2BVEA 2V2WB 1QLRA 1CDJA 1G7HA 3V6FA 4Q9QL 2GKIA 3MSPA 3P4MA 1KLFA 5D7IE 2D2OA 2ADJA 2ZJSL 4OCRH 1KTKE 2YK1L 2O5ZL 3MLZH 5D7LD 2VN4A 2DWEB 2H32A 4FFWC 4N8PA 4YK4B 4Z76B 4KGJA 5CGYC 4EN3D 1BF2A 1LEGB 4D3CH 4WHYH 4LSQH 2PW2B 1VEMA 3O6LH 2CUIA 4GRWH 3QJHB 4WCYL 4Y1AE 4MSWB 3I84A 4NOBA 2FD6H 4N68A 1J0ZA 3QIWD 4NQEE 2R4SH 1RJYA 2O26U 1FFRA 1T1ZB 1MHPL 3ZKND 5DD5H 2C4FU 4LIQH 1KIPA 2BY0A 2MPAH 4Z8FH 5B39B 5I1CH 3DX8A 5FKAA 5C9KA 3D3VA 3BRFA 4Z7WA 1CG9A 1UA6H 4TOYL 3VWJB 1OT1A 4J3TA 2HRLA 1KTRL 4UILL 5A16B 5DK0B 5DJ2A 1GIGH 3QWQB 4PJGF 5F3BB 3V0AC 2BHZA 4MJID 4D9LL 2VE6A 4P23C 5LAXA 3DPBA 3L3IA 1Y18A 4XTRC 5E2WL 5IJVA 1WISA 4IHOA 4Y5YA 4Y8DC 2UUDH 5FM4A 2OM5A 3C5ZC 1AR1C 3DRQB 4MD0A 2CLVB 5DZNA 2VZ3A 4W4OC 4ZNCD 3MREB 4BZYA 3QWRA 2AEQL 3U4BH 3GKZA 1PW3A 3QPXH 3FB6A 1K8DB 3QDJE 2VDKH 1U8HA 2J6EA 1FZMA 5FA4B 1INDL 2HT2C 2QSCH 1PBYA 4NQCB 4NN7B 3L3DB 1T1XA 1C8PA 4JREB 1YUHA 2GTWB 5MHSD 3HE6D 2DLGA 1EJ6A 5HGGS 5IT2H 2VLLB 1C5DB 2YKLH 1N26A 4ONOA 2YZ1A 5LXGH 1ZANL 4LQFH 4P23A 4M43H 4LLQA 3NCJL 4PJIF 1MJ8H 2P8LA 4X9IA 1NFKA 1S7UA 5FO7A 2YPLA 1JYWA 5TE7L 1JBJA 4ZS7H 1II4E 4Y2DA 3MJ9A 2VLRD 2H9GA 1JWSA 2EDBA 1IM9A 1U9KA 1A6ZB 4G6MH 5BRZD 3QFJA 3KNBA 4HCRA 3IRZA 2BY2A 3T77A 3KLHD 4MAYD 1E27A 3ZTJH 3U0WH 1PG7H 4M6OL 5CBEB 1FLRH 3Q48A 4KRNA 2OXGA 3BKCL 4KQ4L 1Z2KA 3QXAB 5I2IB 4KK8D 2EDTA 1JNHB 3E6FB 3CFJB 1IQWL 1QLRB 4KZDH 1F8TH 2F74A 5M95B 2NZIA 1E4JA 4N0FB 4HIXH 1AGEB 1AGFB 1N5YH 3WL9A 1JNLL 2V17H 3P4MB 3ULUC 1U8OA 3D39A 1SJHB 4E41D 5HGDA 1QR4A 2OTUB 1BHGA 4UT6L 2GUOB 4JO3L 3BRDA 1CIUA 1CF8L 1LQSR 1FCCA 3CUPA 3NIFE 4QRQB 3TVMC 1U95A 4JRXD 2FSEA 1IMHC 1ZT1A 2H45A 3HUJB 4XP5L 1G9NC 5ETUB 2JCCE 1PQZA 3L3KB 4LLWA 1ZVYA 1B6UA 4D0BA 5BS0A 2QTEA 1EBAA 1ACYL 1HN1A 1RK0A 4NT6B 3ARVA 3OXSB 3V2AR 5DHYB 3VGAC 4F9PA 1C16A 1UZ8A 2P5EA 5GRUH 3MCG1 4XVTL 3SO3B 1F4AA 3O3BA 3WUZA 3VGEA 4U1SA 1QP1A 1QNZH 3RY6C 1OAKL 4L3EE 3D3VB 2NY4D 5GSVB 1CR9H 4JFEA 4ETQB 1MCFA 2UWEB 3QPQC 4PJHE 4N8CL 2EKSA 5CCKH 2NPLX 5HPMA 1J8HB 4CU7A 2P46B 4IRZL 1GAFH 1A1OB 4ZTOH 3TVMA 4HC1L 3TBWB 1CE6B 4XCCH 4QRRA 5IJVB 4AL8H 5F7EL 2ORBH 4GXVH 4IM8A 3WSQH 4M62L 2IGFH 4FN0A 1DN0B 3MLVH 2QEJA 4LCIH 3IXTA 5L88H 1CDCA 4LSTL 1R5VA 5EO9B 3T4YA 4K9EC 3MLTA 5IW3A 4PLKC 4M7JL 1D5ZB 2EIZB 3EUUA 3GI8L 2FL5A 1G6RL 2Z8VC 1C12B 4NZUH 4N9GA 1JGUH 4X7FC 3V0VB 4FQLH 3O9WD 1JF6A 4XNUH 4FXLA 4WGVB 5F71A 1UJ3C 5EC2B 5GGRB 1Z5LB 5BZWA 4PBWD 2A0LC 5D1ZA 1P1ZB 2EH7L 4R96B 4JQIH 4S1RH 3C5ZB 1DSFH 1QSEE 2VQTA 1XR8B 4NO0A 4BFIB 5IM7B 3SKUD 4IIQB 3WJJC 1K6QL 3LKPA 5ALBH 1TJGL 2ZCHH 3BPOC 3MRFB 4OFYA 5ANMB 3LD8B 4K07A 4N0UA 3BZEB 2CDGB 4RWYH 5DUPL 5K9QG 1JFQH 1P9MC 2ICWB 3GB7A 5HDOA 4P2OD 4HV8B 4XXDA 5ESVA 4XWGL 4NGHH 1KPRA 2VZTA 5HHNA 4N0CD 2QADB 3VW3H 3T08A 1UJ3A 2GEEA 1KIRB 4FXGA 3HNSH 3V4VH 1JUFB 2D7OA 2D03H 4PTTB 4Y4HC 1NSNH 3VFUA 1CD8A 4DOHE 4PRHE 1T21B 1ZK9A 2FSEB 3GSQA 1A8JH 5TJWK 3G6JA 1OAXH 1C08A 4D2NA 4MJ4A 4A2MA 2IALB 3GMPB 1FO0H 4LK4A 3RL2A 2MCPH 2ZUQC 1QACA 4IOIA 3THMH 2VXSH 4Z0XB 3I6KA 2YUZA 3O3BB 2XI9A 4LCWE 5IEHA 4JZJC 2AXGB 5BVPL 3U7YH 4R26L 2NTSP 3U1SH 1MUJB 3A6BL 1WIUA 1YYLH 3V6OE 4K3GA 2VZOA 4LOUC 2ADIB 2QLVB 3WIHL 3HMXH 4P99A 5FA3B 3TVMB 1NQBA 1VFOA 4PJXB 5JXAH 2WNGA 3AU1A 1T7XA 2OTPA 4O58H 4AIZA 5GS2H 5FYKU 3EGSA 4PJ9A 5CILL 2BNRB 5C0EA 4OLYH 3GJFA 4MD5A 5IHUH 3VGAB 2VERN 1V3MA 4QEGA 4TSCL 3TYGL 3D69B 2DWDA 5GS0H 4MXVE 3WFEH 4X6CF 3I02B 4LVEA 2VH5H 3MA7A 1BGXH 3RZCA 4FMKA 2ADGB 4K2UL 3JTTB 3UP1A 4KJWC 1NFDF 5HHVL 2Z31D 1UCTA 4I1NB 2CRYA 4P5MB 3L5XL 2A6IB 2IBZX 5FK9B 5DMYA 1DEEA 2EDDA 3EYQD 5KW9L 2VDML 3SJVE 5CWSB 5F9WC 3L3JB 2RCSL 3LRHA 4QRTB 4PTUA 4BQBA 4JHAL 4NO0B 4YGAB 2OI9C 1MCOH 2PF6A 3PABB 4JY5L 2I9LB 1KTLB 3LKPB 1T66C 5L9DL 4ZS6C 1IRAY 1DR9A 3BAEL 5D7LE 3DV6B 1A14L 3MGTA 1TETH 4LEOB 1A3QA 3GUTB 3HAEH 1SJEB 3IFOA 4KK6D 5SX4I 4K3JL 3BI9X 2Z93A 2V9RA 3FO0H 1YEIH 3GB7B 3QFDB 1OARH 1XGPB 2BRRL 3DMMC 3OG6B 4NC2B 3VXPB 4PJEF 3FTGA 4PRPA 1G9MC 3QDGD 4EJ1C 4TPRL 1NKOA 3QZWA 4W68A 4K8RH 2VSCA 3LQAC 2W60B 1A6VL 2Y5TB 1HCVA 1X6LA 4XCFH 3MLYL 2OZ4L 4NWUL 1JPGB 3VXRA 5C0JA 3LEXB 4MQ7B 3BPOB 3P30L 2CXKA 5T1KB 5CLWA 3L7FB 5ICYB 2LFGA 4MJIE 3BMVA 2VR4A 5DA0B 5SWZA 3KPSD 2DYPA 3OTTA 1JZ4A 3HFMH 1ZGLP 1NGPH 1LO5B 3FB8A 1CS6A 5AWNH 4XNXL 2UY7A 3V6ZB 2XKNA 1WITA 4P3DB 1RULL 4HSQA 3ULVL 3WFZA 5I16A 3IU4L 3N1FC 4HK3N 5E94B 4JPIB 3IJYA 5HHQB 2HWZH 5CD5D 2LV4A 4XBEL 5E6ZA 1YNLL 2CSPA 4PJ5D 4EKXA 1JVKA 3NA9L 4QTHA 3AC0A 1NGZA 1QA9A 2EDKA 4Y4HB 2IPUK 1MCWW 1T5XA 2P7TA 1CCZA 3T0DA 3ULVD 4ODBD 2OMNA 1XH3B 3HPJA 3AU1B 5DRNB 5CEZL 2EO1A 5MHSE 1KCSL 2NQCA 1BM3H 1HDMB 2FJHA 2ITDB 4Y89A 3JV6A 4NRZA 1YEDA 2I5YL 1D7FA 1AP2B 3HZVB 2ZUQB 3PV7A 3EDDA 4FQCH 4P9HC 2QQLH 4G9FD 4N5ED 4C56D 4PJAB 2VLRE 4JZJB 4PGCB 1R3JB 1N3NB 2H2SD 1WZLA 5CEZD 4NQDD 3K4ZA 2BVPA 5CSGA 4UAOC 1IC7H 4J4PC 3TJEL 3HG1B 4DN3L 1ZTXL 1CGYA 3F7RA 1BQHA 4G43A 4ZPTB 2PYEB 4JHWH 3NBNA 1G0XA 2QQNL 4FA8A 1E6OH 3SDXF 3ELAT 2AV7B 4XAKD 1OSZA 5I1HL 1HYSC 5K9QI 2B1AH 3VH8B 4PTUB 5HYJD 1P4IL 1R0AL 3BFOA 3PWPB 3VFNB 4FMFA 3RY5A 3DHJA 3C2AH 1EA9C 2GT9B 5DQJA 1NBYB 1N64L 1RU9L 4G3YL 4YHOL 4NPYB 4L8DA 1BFOB 4E41E 1MEXL 2NXZC 1OWRM 2J12B 1JZ5A 2AQ1A 5JR1H 1I7UA 3U36A 2ZOLA 3WIIL 4JRXE 4U1KA 2FEDD 5I6XC 4PB0L 2PTTA 1I3RA 4KY1H 2JJSA 1WFNA 2A9MH 4J4PA 1QFHA 4OF0A 1DCLA 1OB1A 4WI8A 4ODUA 2JIXB 3EYOA 4YX2L 4XC3L 3QIUB 4ZAKC 1U91B 3D5OF 2PO6C 3ARFC 4X5XA 12E8L 3VMNA 2HAZA 5HD8D 1UM4L 5F9WB 3REWA 2VLKA 4OGAC 5D2LA 2HLFC 5MI0C 3U0TA 4JFZH 3WE6A 3WN5C 2OI9B 1AC6A 3MZGB 2WLZA 2D7TL 1QFWM 1N59B 1IAIM 1OT2A 2ZCLH 4ORGA 4P4KB 5J56B 3ZYOA 4LASL 1GGTA 5T5FH 1KPVB 5EWIL 1Q9WA 3LB6D 4ZD3L 4ODWB 3X13B 2NTFB 5JOFA 3VG9C 3EKCA 4I0PA 1CLYH 1S9XB 1U58B 3VFGL 5I0ZA 5C0AB 3HZYA 5ITFA 3J8F7 1DBAL 1J87A 2EDFA 5J57B 1T03H 1MLBB 1SYVA 5CP3H 3ARTA 3SGEI 4L4TA 3K2MC 3RWJA 4QHNB 3DMMB 1DQTA 1J0YA 3DUSB 3HI1A 4I77H 5KAQF 5FUZL 4OIBA 4RBPH 3TA3D 5DA4A 1RZ7L 3S37L 2BSRA 4QTHB 1KSRA 4WNQA 5FM8A 5F7NC 4Z5RB 1MCNA 3WN5A 5FAAA 1UCBL 2AEPL 2JLLA 4H5SA 3IAPA 2X41A 4HLZH 1LEKA 3UTSB 1A47A 4NRXA 1DBJL 1HQRB 3WLBB 1EHLH 2ZCKH 3NA4A 4KROC 2VISB 3TO4D 4G6JL 2XQYG 3HLAA 4K55A 5BXFA 3MLRH 1OL0A 2AK4A 4Z9KB 1U8LA 3QUYC 1XF1A 4EI6B 4NJAH 5HHPA 2A77H 3QO0B 3CVIH 1L7TL 1JTTA 1P7KA 2H8PA 1KC5H 2CD0A 1J10A 2YS4A 3HRPA 3FFCB 4DZ8A 3RDTC 1QLEL 1QQDA 2OYPA 1OQOA 1UGNA 3QO1B 2NY5H 4X5LA 4NO2A 1NL0L 2LAGB 4HDIA 4HHAB 2YUXA 3JV4A 1JK8B 1IGMH 1DLHA 1EV2E 3NCEB 4JQVA 3RBSA 1ZS8A 4L1HA 4OZHB 5GJTH 2Q7NA 5LGKA 2W65B 5F93C 1V3JA 4XPBH 3ILQC 3QUYA 1NFDE 3O81A 4KHXL 1MJ7L 4F2MB 3LQZA 5C7XH 4K7FB 3G6AB 3VFMA 4EVNB 3N85H 3UO1H 1GGBH 2DQUL 4LHUD 2DQHL 4UAOB 3RVVD 4LLAA 2W0FB 5IP4A 4X8JB 1KJ3L 5F1KC 2FX8H 5E6IC 3VG0H 2DQTL 3H3PH 5GGSA 5A2FA 3PGCB 2F58L 1AIFA 3MOAH 1XMWA 1AXIB 2D3VA 1AKJA 4H0IA 2JB5L 4RQQA 1JGVL 5IW6B 4JFQB 5MERA 3EYFB 2Q6WB 1YPZF 1KN2L 5D71L 4BH8A 1BFSA 4HUWA 1Q9WB 2NXZB 3LV3B 1TJIH 1K2DA 4O2CB 1AO7A 5HHOD 3U82B 1FQ9C 3CCHB 4S1SH 1QFWI 1I9RH 1IAII 5I6XB 1F4WH 2VABB 4OQTH 4FNLH 4XNMB 2EEAA 5KSAC 2Y07L 4X4MA 3SGKA 1I9IH 3W9DA 1DE4A 2FBJL 3ES6B 2LVCA 4P2CG 3WXVL 3PDOB 2Q7YB 3LPGA 4ZAKB 1GZPA 3BKJL 5H94B 2PO6B 4RX4A 2BSRB 3ARFB 3FKUS 4EEEA 2YBRA 4EZMA 2OBGA 2EDJA 2CLZA 5MI0B 1TZHB 1Z3GL 4CJ1A 5SX4H 2OX5A 3WN5B 1NUDA 4KWUA 1KG0A 1OLLA 5HI3D 5JHDE 4H1LH 1CT8A 2HMIC 3VFWB 4M8VA 4PRNB 3IAQA 2CMRH 1X4YA 3NMEA 1JZ2A 4U1LA 4HUUB 3VG9B 3KWWB 1JRHI 1V3LA 4F7CA 4YHMH 3QQ3A 3ARXA 5JIKA 4F8TA 1KPUA 4XNQA 4FG6C 1MFDL 4JG0H 4HWZA 3G08B 5KSBE 1J18A 2VZVA 4POZC 4YLQT 2DQDL 5JUEL 5IVOA 4Q0XH 5LWYH 1MFAH 4QYOB 4LCYB 1BBDH 4Z0BH 4EI5D 1QR1B 3OX8B 2XACC 3G6DL 5EBWA 4RFNC 4J2XA 5LVEA 3SGJC 3HNTH 3S5LA 1F4XH 2O5YH 1VERA 3ARBD 5DK2B 4Q9RH 3NZHH 3D85D 4NO2B 1A7RH 2R15A 3TT1H 4UIMB 4KI5C 1MCCA 3MLSH 4R4FL 3NFSL 1INQB 3ZDXE 4KROB 5C2BH 4JDZB 1RURL 3F7VA 3OR7A 4LGSB 1FIEA 4LSRH 2YC1B 2D7PA 1BZ9B 3ZL4H 3EOAB 5DD3L 3OB0H 1IGCL 1QD0A 1RUAH 1I1RA 5EU5B 3HI5L 3QUYB 1JPTL 4G8EB 2ARJB 1WBXA 3OKDA 4DAGL 5J6GA 1KNOA 1RPQA 1MCSA 3SKJL 3BOVA 3RDTB 3FZUD 2J2ZA 5T3XH 3AY4C 3TBYA 3UAJD 3WO3B 3KPSE 3I3BA 1I8MB 3SCMD 5D70L 3T0EC 4BFBD 3HTLX 4OCWH 1DQLL 3QUMB 3L3GB 4JFOB 1I85A 4XWOD 1UVQB 5DHVA 5IOPA 3MUY1 3LH2H 4YEFA 3KPLB 3U9UB 1ED3A 1WV7T 1K8IB 5TQ0L 4PJ5E 5IVXA 3QDMB 2WLYA 2FBOJ 4ONHA 3G5YB 4OFIA 5L2JA 3IXAB 3QB7C 3CFKA 3BD4A 4KV5F 4MX7B 4UNUA 3NACL 5HGAB 1CFQB 4KK5D 4WUUB 4LPWA 4LF3A 1BLNB 1PGRB 1W72L 3D48R 1F3DJ 3CZJA 3MGAA 2YA1A 4KI1A 4WW2B 5E9DA 3ULVE 4PV9B 4CVWA 1VFUA 1KIQB 5F89A 1KN4L 1MH5A 3AY4A 3JVGA 1QSFA 5C07D 2J8UE 5HBBA 1S7RB 3NCMA 5E6IB 4PP2A 4KJQC 2MTPA 3T0EA 2I26N 4OUUB 1XF5B 4JM2F 3RWCB 4Q9QH 1MCPL 4C56E 5HYEA 5D9SA 3W0WD 3T4AB 2ZJSH 1IGFL 2YK1H 2O5ZH 4G6AC 4P3CL 2L0DA 4L8BB 5CEZE 4JDVB 5F1OB 1UXWB 1T3FA 4M5YL 2AXJA 4PGBB 2P5WB 3WEXB 5FYJU 4U1LB 4Q58C 5LGHL 3VRLF 3IJSA 1T5WB 1EFXB 4QGTA 4WCYH 5C08D 1TXKA 5T3ZL 5JMOC 4OZGF 1Q9LB 1OD9A 2RFXB 4ZFFA 4XAKE 3KPOB 5DK3A 5KSAB 1J7VR 3FAXA 1MHPH 1L6XA 5HYJE 3IVKA 4L8CA 2WBJA 3IDNA 2JELL 3DXAE 3MV11 1RZJL 5BO1L 5B8CC 2X10A 3QI9A 3K0WA 4TOYH 4KRPB 4PGDB 4R0LB 4BFEA 3OZ9L 4J3XA 4UILH 2OSLA 5T3ZD 2KPNA 4QT5B 4HJ0C 3IDUA 4PUBL 3ZKMC 3EHBC 1EK3A 2LU4A 5E4EC 3SKOA 4D9LH 5L2KD 2WBKA 3STZA 4UBDC 5EBMB 5SWSA 3GSWA 1N2RB 4MB5A 5E2WH 4AMKL 1LP9F 3RKPA 1FO0A 1ZT4A 2IPKA 4EIZC 3O6FC 2VSDA 4H0HB 5CSZB 5BV7H 3KR3H 3RWEA 5K59F 1JNJA 1IGIL 2XWTA 4PBVC 2AEQH 3TYFB 3FQUA 4JRYD 4YC2C 2B1HL 1RUQL 4RFNB 1EEZB 3UCRA 1INDH 3AS2A 3HMXA 4HIHA 5ICZA 3F12B 2VDRH 3BMWA 4RMSA 1IFHL 3WIFA 1QSZA 5E2VL 3V7AG 4XP4L 5KVDL 3FHAA 4U1JA 2WM0A 4XCEA 1ZANH 2BVOB 2XZCL 4U6HA 3FOMB 3I75A 3LDBC 3NCJH 1JTPA 3CLEL 3WO4B 1XEDA 1KACB 3L3OA 4BSVA 2A6DB 4H26A 4MA3B 5JW4R 5IVXB 1JGDB 1YEFL 3MMEA 5JW5A 1NC2D 1W0WA 1FL6A 4CMMB 4PRBA 5C0IB 3VJ6B 5F7WC 5DJ6A 1L9MA 3MOBL 3WLWC 1KJ2L 2VIRA 3C9NB 4M6OH 5JLZA 5FDYA 4PJCB 1B0RB 2ZUUA 3BKCH 4KQ4H 4IRSC 4F3FB 4ZO9A 4X7TB 4X98B 5FYJL 4JJ5A 3MV7D 4O2EA 1IQWH 4Y4FD 3ECBA 1U8QB 1P84J 4DKDC 4K8RC 4GG6F 7FABL 2P1YA 2A38A 4Y5XA 2DICA 1JNLH 2VQUA 5ID0B 4U6YB 1YY9D 1BD2B 2P45B 1NFIA 4PRIB 5I1LB 1T3FB 4JO3H 3QEHA 2B8OT 5FYJD 3GMMA 1T1WB 1CF8H 4K3EL 3K4DA 1TZIB 3CC5B 1DBML 2LQRA 3HAEA 4XP5H 2ENYA 3I6GB 3AAZB 1ACYH 5EH1A 4ZFFB 4XPHH 3SDDD 5IVZB 1KT2B 3IVKB 2E8YA 4PREA 5IIEB 5DHXB 5E70A 4XVTH 4MD4B 4RWHA 1GPOL 2MHAA 1G0DA 1OAKH 3FN0L 4JR9L 1IGYA 1M7DA 1T0PB 3L95B 4Z7VB 2R4RH 4N8CH 1CD0A 4MMXC 1QFWH 4WDIB 5EUKA 4YDJA 4KK9D 2XNAA 1OD7A 4JHBA 5IBLC 2YD4A 4P46C 4V1DD 5I1JL 2NY1D 3DVNB 4IRZH 1HHHA 1EIBA 4D0CA 4G80A 1J1OL 4HC1H 1NMBL 5E7FA 3TPKA 4NUJB 3RJQB 5C0NC 3K1KC 4JFFD 2WWMD 3FO2A 4XMLL 3RZWA 4MDIA 4C4KT 3RWEB 5K9JL 4M62H 5DS8B 3S35X 4ELMB 1RIVL 2NYYD 5GZND 4LSTH 1G7PA 2HJKB 3L5IA 4I48B 5GZOC 2DIBA 4P5KB 5B8CB 2WINA 3B83A 3ZE2F 4Z7UF 3QUXA 3GI8H 4HIHB 2DJ4A 3SPVA 2VITB 2DM3A 5HHOE 1G6RH 2AJXL 5J11B 5C92A 5D7IA 3WIFB 3NZ8A 4L8SB 5E4EB 4M6ML 5IMKB 1OGAB 4TUKL 5I17A 4XCEB 3DARA 5FCUL 1XR9A 3CDYA 1WBYB 2H26B 3DUUB 4ZUVB 5DJCA 5IBUG 5C3LD 3HZKA 2HFEA 1DTUA 4R4ND 3VXOB 4YEEA 2EH7H 3O6FB 4H26B 1P84K 1IKNA 2X6MA 5JIPA 1NLBL 4E0RB 3V79C 5DD6A 4NQEA 3PWVB 2IBGA 1W0WB 3ZDYE 5DJ6B 1K6QH 4LSUL 1AI1L 3TBTB 3MRNB 5E5MA 4OI7A 4G7VH 1X7QB 2D4DA 1H8NA 4OI9A 1GOGA 4M3JA 4JE4B 4YC2B 5MENB 3PL6D 4UUJA 1U8NA 4HWBL 2ZUYA 4GW5B 5DUPH 5KSVA 3PWNA 5EZOL 4HS3B 2GCYA 4L4VB 3RWHA 5C0FA 3ECBB 1NGWB 5EUOB 3WUWG 1ITCA 3M8OL 5DR5L 1KUMA 4XWGH 3BZFB 1QBBA 1XIWA 4WHTB 2J6EL 2EXWC 3LDBB 1I4FA 5ESQA 3E6HB 1IGTA 5D7JA 3QNXA 4PB9L 4R97C 3QXVA 1U8PA 5H37G 3HAEB 2C1OB 4NC0B 5HVWA 4X6EB 3MJ9L 2XKSA 3B9KC 5CIPH 4GLRI 4YWGL 4QF1B 4IRSB 2NY3C 1LMKA 2ZNWA 4HCRL 4QY8B 4WRLA 4HKXB 2F54A 1BBJA 5F7YC 5K9OA 5BVPH 4WTXA 5TH2B 1FYTD 3F65A 1Q9KA 2IAMA 4R26H 3A6BH 3NN8A 2YPLD 4IDJL 4ZUUB 2IH3B 4Y2DD 1NAMB 1DQQB 1A4KB 3Q1SL 4YUEL 4CVXA 3WIHH 1IM9D 4PJ7E 3QFJD 5J9PB 1VADB 3WHXA 1RFDL 3VFTA 4YJZL 1TCMA 4JLRA 2PETA 3GHBH 1VFAB 2MNUA 1YY8A 4X4XA 3PP3K 5AD0B 2FEEL 1FYHB 2FIKA 1LD9A 4PY8I 3IFPB 5CP3A 5CILH 1UM5L 2UWEF 4CDGC 5DMKA 3MV9A 4TVSa 5KVGL 5J12C 1MHCB 5E2TL 4TSCH 3TYGH 2E7LA 3V6BR 1JF1B 2NW2A 5E00A 3L5WA 4QCIB 1ZE3C 1CDIA 4K2UH 1T04B 1D5IL 4LHJB 2BMKA 4YHLL 1U8JA 1W8OA 4LPTA 3VXUD 1YNTA 3BEWA 3DYMA 1S9YB 5FEBA 5HHVH 1QO3A 4P46B 1UH4A 5HDBE 2Z8RA 1WC7A 1AD9B 2AKRB 3L5XH 4MXQD 3AXLB 2Y6SC 3G5XA 5C07E 5KW9H 3TF7C 2D0GA 2VDMH 1BIIA 5BS0D 1NDGA 2RCSH 3O2WL 2HTKD 4Y1AB 4DVBA 4JHAH 5IB5A 4JY5H 4I5BB 4A6YB 4UT9L 4NQEB 1D6VH 5JA8B 2P5ED 3W0WE 1MRFL 3BD3A 4Q2ZA 5L9DH 3OAYH 3L6FB 3BAEH 3VI4F 3MTRA 1CGXA 1A14H 1ORQB 1DP0A 2BOBB 1NC4D 3DX7B 2R9HD 4JFDD 4L3EA 5CD3A 5KSVB 4ODXB 4K3JH 1I8IB 1UWXH 4NBYB 2BRRH 5C08E 4KUZL 1CU4H 5CEYB 4OT1L 4JZOB 5I66A 4TPRH 4BSJA 4XGZB 4MB4A 3LKRB 4M7ZC 4QLRA 3OSKA 1UWGL 1A6VH 5F9JB 4XPFL 4MB3A 3GSUB 4DQOL 3MLYH 1ZLUH 2OZ4H 4NWUH 1L7IL 2NY0C 4X9FA 3C5SB 2PYFB 2ADFH 1QRNA 3AMKA 5T3ZE 1JN6A 3D18A 3P30H 2RJMA 4XCNA 1FZJB 1KENL 1JE6A 4EUPG 2YOCA 5L2KE 3RIFF 2HTLC 2AJUL 2ZG1A 3RGVC 5FUCE 5TF1H 3QDJB 4XNXH 3VRJB 4MJ6A 3BN3B 4WI6A 1RULH 4Z78B 2CRZA 2Y7QA 2X1PA 3ULVH 1CICD 1BBJB 3IU4H 3X14A 5C09E 4P2RB 5D8JL 3AVEA 3MRLA 2C4XA 2IEPA 3TWCL 2YWYA 3NA9H 1BVKB 1OOAA 5E56A 4JRYE 1M71A 1YMMD 3MUHL 1KIUA 4KKAC 3RAJH 3BP4A 4R97B 5E2UL 3SE4C 1ORSA 4OFYD 2ENSA 3MROA 1AXSB 4Q7DA 4UNTA 4LLYB 3OGCA 5JOPE 4N0RA 5CEZH 4WUKL 1KCSH 1FGVL 3WJLA 1EO8L 2OJEB 3B9KB 4K3DL 2I5YH 2X4NB 3ULUF 1FPTL 3U4EA 1B4RA 4HJGA 2VO5A 3GSNL 2NY3B 2MKWA 5E8OA 1EDQA 2GJZA 4FZ8L 2X4RB 1D9KA 2D0HA 3DX6A 4YR6A 3X11B 1XGTB 2NY6C 3TEUA 4YDKL 5DVKA 4G8FA 4EBQL 3IGAB 4PJXF 6CGTA 3S8WA 2BMKB 1MSPA 4L3CB 1J5OL 3V6OC 3S4SG 1XF2A 1IAOB 1Z9LA 4FXKB 3UZQA 2Y4SA 4M1CD 3TCLB 4FQQA 3TJEH 3TM6A 4DN3H 1FN4A 4AY0A 5E0QA 4HGMA 3TN0A 2YD3A 4PRHA 4BKLA 1CTNA 2DKMA 2QQNH 3MV7E 4JO2L 1K85A 8CGTA 1SY6L 4U1IA 4JG1L 5I1HH 2C5DC 3ESUF 2JCCB 3O8XC 1P4IH 3CU1A 1DVFC 3KXFA 1CFNB 5HGBB 1R0AH 4HUNB 2C4FT 2UUDK 5DEFA 3CFDA 2CUHA 2ATPA 5J12B 2B7DT 2IADB 1N64H 1RU9H 2XN9D 1INEL 4G3YH 4LFHD 1HHJB 5DJYA 4Q2ZB 4YHOH 3TNNA 1AC0A 1B3JA 3LN4A 1MEXH 1YQ2A 4FQXC 1UH2A 5CMAA 3DV4B 4MLIA 4ZUSB 4LCWA 5DJ8B 5FYJE 5IK3B 2Q1EA 3ZYJA 3EDEA 3WIIH 2YD1A 5DO2C 5CD3B 5IB3B 3O45A 4NIKB 4MS8C 5SV3A 4PB0H 5F1NA 1T1YA 4PJHB 4QWWC 4HFWB 2CK0L 4OKVB 1TVHA 1RZKL 3H0TA 3I6LE 3VA6A 4XC3H 2F8XC 1TQBC 3ARGC 4I0KA 3FONA 12E8H 5EN2A 1UM4H 4PJ9D 3UJJL 5DGRA 1K4CB 3BESR 4PR5B 5E1AA 1HXYB 3QUZD 1GGIL 4GO6B 4LRIC 1EVUA 3SDYL 4H88L 5IROC 4LASH 5EWIH 4JM4L 4QKXB 4Q9CA 4ZD3H 4P4RB 1BECA 4V1DE 4N8VA 3VFGH 4NNPL 1O7VA 4DVRH 3FO1A 1DBAH 4MJ6B 4EN3C 3RVTC 1EJOL 4ZQKB 1HQ4A 5IBUB 3VXMD 1ULVA 5FUZH 3MNWB 3MRLB 1J0KA 3QIWC 1OGTA 2C7UA 5BMFL 3M17A 3CPLA 3WMSA 1RZ7H 1FNEB 3S37H 5BVJB 3G6JF 4M7ZB 3ZKNC 3MRKA 3PP4L 5KS9A 3HKFA 3IU3A 4MNQB 1DBKL 2AJZB 3BXNA 4JGJA 2NY0B 2AEPH 1QSEB 2AJ3B 5IROA 4EDWL 1DBJH 5GGSY 2Y06L 2HKHL 1NBVL 3PJSB 1YEGH 1CGUA 2E8ZA 4Z18A 4ALAL 2Z35B 4G6JH 3RGVB 1MCJA 3QULA 3WUWB 4LLUA 3AUVA 1K3ZA 3DIFB 4JDTL 3GJEA 1U92A 2IWGA 1UEYA 4FTVD 4U2YA 1L7TH 5E95B 3K46A 3RHWK 3C08L 1Y0LA 3QIWA 4GKNB 1MQ8A 1E28A 1FNAA 3VXTB 5D1XC 4CDHA 2GFBB 5HYSB 4CRPA 3C6LD 2OP4L 2FO1A 3ULSA 1QLEH 1MLCA 3GBLA 4H1LB 1SMOA 5B38A 5C0GB 4Z7WE 4APQD 3PG2A 4WWKD 4TUJB 4YHNB 4DOHB 1NL0H 4KTEL 4XNYL 5DJ0A 5JNYA 5ISZB 5JIIA 4QRPB 3KYAA 4PJDA 4F57L 4KRLB 5EO1A 1PEZA 4WV1C 4WI3A 3VXQA 1S8DA 3ZMRA 1H0DA 5DJYB 2AAVA 2QL1A 2VAAA 1T4KB 4G8GB 5DJDB 1R3KA 4WFFD 2BXYA 3QDHA 1D5MB 1H8OA 1NBZA 1P69B 2NY6B 4KHXH 1MJ7H 1DLFL 1G7JA 2DMKA 3LMJL 3HNVL 4MQXC 5IMOB 3DI2B 4J8RA 3ZE0E 4Z7NE 2DQUH 1BOYA 4KMTL 2DQHH 2Z9TA 1X6NA 3KLHC 4MAYC 4S10A 4JKLA 4F15B 4NCC1 5JO5B 4AG4L 1NDMA 1AGDA 2F58H 1UQSA 3ALPA 5IW1B 4HIEA 2DQGL 1V7ML 1F4YL 3O8XB 3P0GB 1DVFB 2JB5H 3HE6A 3A0OA 1JGVH 1XGRA 5J13C 2L4OA 2YPLE 2WQ8A 2JK5B 5D71H 5D1QD 5C8JB 3OXRB 3QEGL 5CFHA 4G42A 4FQXB 5DI8A 3FRPA 4PJGB 3VWKD 4FP8L 3UTZA 1LILA 1MFCL 2VLRA 1NEZA 3QFJE 2F8OA 1A9EB 2V2XA 4LP5A 1PZ5B 3TT3L 2WIIA 3RY4A 4MA7L 3ZHDA 5BRZA 1Q9OB 1OY3B 4TULL 2Y07H 1UENA 1PSKL 2FBJH 3SGDH 4YFDB 3WXVH 3TIDB 1OGTB 4JHZA 3BKJH 1TQBB 1HYRC 3ARGB 3GSVA 3L1OL 2I9TA 5IMMB 3SJVB 1MVUA 3BO8B 1Z3GH 2CIKB 5MEPB 3D39E 2BSTB 1HWGB 1UZ6E 3V9FA 1GYAA 1FCGA 2C3VA 4XX1G 4X6DA 5CZXD 4E41A 3IF1B 5D7LB 1ZEAL 1QEWA 2D31B 4NUGL 5F7DB 1RVFL 1I1AC 4NSKA 5JMRA 4AENB 1MFDH 4EN3B 4JRXA 1WK0A 4PJIB 2P42B 2DIJA 5BS0E 2C3WA 2A74B 2DQDH 2XZAL 5JUEH 4HFUL 3PHQA 2P5EE 3X3GL 2RIKA 2XXMB 5FDWB 5IFJB 3G6DH 1FORH 1OP5H 2EE2A 5B38B 2IF7A 4M93C 1FV1B 4YGVB 5J6HA 4JFEE 4KVNL 3UTPE 4KJPD 5CJQL 1EZVY 2X1OA 5I1GL 2A73A 2ICEB 3C6SA 4R3SA 1FJ1A 4OV5A 3L7EA 4R4FH 3NFSH 1MVFA 3NTCL 4I0PD 4DKEL 3U0PB 1KLUA 2X7LA 1VB9A 1RURH 5DURD 5E8NA 4ZPVB 5EZLB 4MJIB 3NPSC 5FF6A 4Y16B 2EC9U 4QRRE 4LHQB 1J0IA 1SQ2N 1S8DB 4XC1L 5DD3H 5EU3B 1BOGA 4E5XB 1IGCH 3NIDE 3S3JA 2XWJB 1IAMA 4KAQL 3HI5H 1JPTH 1TTFA 3IDIB 1SHMA 3AROA 4OZ4A 4DAGH 5EFIB 5D1XB 4J8RB 3SKJH 3TJHC 3WCYA 4OLEA 3FQRA 5HJ3A 1A2YB 4ZOCA 1RK1B 3U9PH 1HHIA 3N1QC 1WICA 4HC1A 3EOBA 5D70H 5J1SC 3CFCL 4PV8A 1RZGB 4NZTL 4D0DA 3BHBB 1LE9A 4N1HB 2V9QA 1WTLA 5CJ5A 4MA1C 4WV1B 5J1AB 4HS6A 3SDCC 3K7UA 3O9WA 4N0CC 5DDHA 5TQ0H 2Z8SA 3C60B 2A83A 1I7RA 2H6PB 1LE5B 3QR2A 1YMME 2AXFA 1LK2A 2VLRB 5MEOB 3MRDA 3IRPX 1G6RA 2BVQB 4U1NB 3FCTA 1KEGL 25C8H 4LPYA 2MPAL 4PJFA 2HT3D 4N0UE 3C8DA 1KN4H 1Q0XL 4L3AA 2R1YA 3GIZH 4MAYB 5F44A 4BQ6A 1YYML 1TLKA 3MRIB 3O3DA 4I18C 4G6KL 3ARED 5GRJL 4IMLB 2V2TA 1UA6L 3MRMA 4U6VL 4F7TA 2NW3B 1WVZA 3V5DB 3CIQA 4UB0L 3X3FL 5IFHH 3LKQB 5E5RB 2WAHA 3KPPB 1MVUB 4JCMA 4ZOAA 4P2OA 2H2PC 1IGFH 2DBLH 3BQUD 2E7MA 4P3CH 4NCC2 3QIBD 5J13B 1H8SA 4M5YH 1FVCA 1OF2B 3O11B 1CL7L 1IBGL 5LGHH 4ZYKA 2P43B 4JO1L 2CLRB 5CZVL 5T3ZH 5DD1L 3RP1A 3WS3A 4RAHA 4HK0B 5FKPB 2E9JA 4C55A 5KAQG 4JANB 1WFOA 3MRGB 3R1GL 2JELH 4WU7B 5FIEA 1NGQL 5C0RL 1RZJH 3RWDB 5BO1H 5D6CA 1F00I 1FFNB 3H9SA 4CGTA 3PF2A 4E9LA 1CFSA 4U1GC 3OZ9H 4HAFA 1MPAH 5J6HB 2BNUA 1MIEL 5LXGL 1A64A 2IPTH 5E8EA 4PUBH 4JAMA 1BJ8A 5AG9A 4YPGA 5AYQA 2HG5B 3VXSB 4ZS7L 1G7LA 5INCB 1KLUB 4N1CA 2GSGA 4UDTB 4CN1A 5CIPA 1FFOA 4AMKH 3HI6L 4R7DB 5K9KA 1I1AB 1X5AA 4QNPF 3I3DA 1VEOA 4LCCA 3EYQC 1IGIH 1XCQA 5T33H 3KPNA 2MWCA 2Z91B 3TC9A 1S9WB 4X9BA 5DJZB 1HKFA 2VDQL 2BSSA 4GRWF 2B1HH 4RNRB 1RUQH 5F88A 5IEKB 2Q3ZA 3GSXB 3FT2A 2EDOA 1W0VA 4M93B 2EEDA 1IFHH 2ZSVA 3SQBA 5KVDH 3NAAL 3EOBB 4LPXA 4KK6C 3MQIA 1T80A 3EO1A 3HE7D 3H3BC 3RUGA 4HUXA 2XZCH 1P7QD 4D0DB 3VXME 3EYVB 3CLEH 1C1EL 5IG7A 2Z31A 3NPSB 3UBXG 3LCYA 2BZDA 2Q8BL 1L0YA 1WBZA 4RGOL 1YEFH 3IDJA 5I74C 2GIYA 5DFVC 3PV6A 4HGKC 3MOBH 1KJ2H 5D7KD 5E08L 2DL2A 2FGZA 3AM8A 4NKIL 5J06A 2KKQA 5FYJH 1A6AB 2AV1B 1U3HB 4ZSOB 4FQHA 1QLFB 3WFCL 1FL3A 3PQYD 4K94L 4X83A 2J4WL 2CGRH 1MHHA 4Z6AT 3S6CA 1NUFA 7FABH 1S78C 2FWOA 5CINL 4JY6B 3UTTB 2FECL 2YHGA 4PJ8D 1I9EA 4NJ9L 5EA0L 4DUWA 3JWNC 1S5HA 4FTVE 3ZHLA 4ZDHA 2B5IC 4KXZH 4MA1B 5GGUB 3NFPB 3RTQA 5IV2B 3S36X 4CNIA 3VRIB 4ZTOL 3SDCB 3QDGA 2V5YA 4D9RD 5EPMB 3FQTB 2A6KA 1A7OH 5TGBA 1A02N 3B9VA 2QJDA 3O4LD 5CHNB 4K3EH 4HG4J 4L9LA 1DBMH 3L5HA 4WO4D 1NFDB 3VXRE 4PLJC 2G2RA 2VWEE 2D4FA 3JSSA 5TE4L 2DJUA 2BCKB 4NDMA 3ULVC 4OLVL 2EH8L 1ZLWH 1RSFA 1VESA 4I18B 4MNGB 2XFXA 2W0KA 3IS0X 1F42A 2GJJA 3KPSA 1GPOH 4RBPK 5D6CB 1ZXQA 3FN0H 4JR9H 4BZ1L 4XPGL 4WFFE 4N5EC 2W0LA 5D5MA 5F9AC 4CMHC 1MF2L 2GJ6D 1D6EA 5EU6D 5MEQB 2H2SC 3CX2A 4NKDB 4YPGB 5I1JH 3VFVA 1BWMA 1I3VA 2BOCB 2PXYB 3U79A 4ZO7A 1J1OH 4G9DA 3MRBA 1EERB 1NMBH 2J5LC 4PJEB 4IRJD 3VI3F 1F3JA 3CVHB 4XMLH 2H32H 5K9JH 1OW0C 2IAND 3QUKB 4O51A 3KPNB 4P2YA 4TTDD 3BGMB 1NCDL 1RIVH 2X70A 5I1EL 3RNKA 3DRTA 2DI7A 2G5BB 4OD2B 2DB8A 1CXHA 1XAUA 1JFQL 3TCXA 3LN5B 4TVPL 2JJTA 3RPIA 4U1GB 4G9FA 2AJXH 1T7VA 2VXTL 4HX1B 4NQTA 3DO7A 2KBGA 3QCUL 2ZSVB 4XBPA 1XF4B 2YPKB 4LMQE 5JORB 2Q8AL 2LE9A 3ARZA 4M6MH 3RHWF 5JHDB 4TUKH 4DK6A 4NQDA 5FCUH 1A7QL 3MLWL 2HJLB 4X6FB 4PRDB 5HY9A 3CH1A 5JXED 3VD3A 1XGYL 4NFDA 4TVPD 2O61B 3SDAB 2QHRL 4LCUB 4HF5L 3STLA 1NLBH 1R24A 1T83A 4EIGB 1OW0A 1J0JA 5HD8C 2PKDA 5KSBB 1T22B 4C4KO 3C5JB 4LSUH 2P4AB 3DSFL 3H7BA 3H6JA 3MGOB 4NNXA 4KI5F 3QI9D 4M02A 4OF3A 1TFHA 4J1UB 3LZFL 1CIDA 3LPFA 1U42A 4HWBH 3V5KB 4UQ3A 5FV1L 2EYSA 4HG4K 3KLSA 3MUGB 3LB6C 1RQ5A 5EZOH 1CLOL 3VXNA 3WFDL 5JPNA 5IVXF 2R1WA 1H3TA 1QTYT 1MHHB 3M8OH 5DR5H 1YN7B 5SWSD 3UPRA 3QNYA 1OAZL 1GZQA 1MWAH 4YNYA 2J6EH 4RZCB 3HMXL 1I8LC 5I8CA 4JKMA 4PJCF 1CXKA 2DDQL 3TA3C 4ZFZA 3GGWA 4PB9H 5D2LE 5I74B 2R2EB 5TE6L 4HIJA 1Z9SA 5H2BB 2Z4QA 4YHIA 3MJ9H 3RX5A 4YWGH 1DDHA 3PIQA 1Y6KR 4L5FL 5TF0A 3BDYL 3RNQA 5D2NA 4HCRH 3T65A 2VH5L 3SKMA 3TO4C 3EZ8A 5EB9A 4L4TE 1RJZB 5L6YL 1AQDB 4N0YH 3OF6D 1CGSL 3Q6FA 4NQUA 4IDJH 2X4TA 3B2UD 2UZXB 3Q1SH 4YUEH 1U93B 2WV3A 3V52L 3TA3A 1SYSA 5H8DA 1FNLA 1PG7X 3B3IA 4DGIH 4PJ5B 2I24N 1RFDH 3KYMB 3CFBB 5LGJA 3O41A 3BZ4B 3CFEA 5FO9B 1CXLA 4M8QB 3VFOA 4AT6A 1A9BB 1UM5H 2YD2A 3BH9B 4N9OB 4DEPC 2HN7A 3KJ4C 2FX7L 1T89A 2FJFB 3WNOA 1G7MB 5E2TH 1HOCA 4W6XB 5TQ2L 3JWOH 2J8UB 3BP6B 1MELA 1UFUA 1X5IA 2LU3A 5EU4A 3UBXI 5IB2B 3M1BB 1M1SA 1GHFL 1D5IH 4YHLH 4C56B 4CMHB 3QHTC 4U0QB 4LVHC 4LP4A 5B3JE 2UZYB 3MLUH 3D2UD 2IPUG 4OB5L 2BVYA 5DUBB 5FB8A 3RVVC 3U83A 2J5LB 3DGGB 3O2WH 1AY1L 4QHLA 4UT9H 4H25A 4PRAA 3UC0H 2GTZA 1MRFH 3HC3L 4M7LT 2MCG1 4C54A 5HYJB 2A6JA 4RFEA 4BH7B 4LIQE 5B3NA 4NNYA 3DXAB 3HZMA 3W11C 1WZMA 1IEHA 2GAZA 2X4UB 3MRCB 1MNUL 2EYRB 1NUNB 1IQDB 3ZDZE 4CBPA 1QOKA 1J8HD 4QXTB 3BD5A 3DHMA 3OJDA 2HWZL 4KUZH 4FFVD 4FFWD 4OT1H 3QNYB 4E42A 1FSKC 1NLDL 1HXMA 4M6AA 3VGBA 4LHUA 2B4CL 1MHEA 2CIIA 3VDBA 1UWGH 1A7NL 3IETA 4XPFH 1I7TB 4XMPL 1ZMYA 5I8KL 2P8MA 4DQOH 4RAVA 5TDOB 1KEMH 5F8RC 2AJVL 4XCYB 5F7MC 4UI2A 5EUOF 3UDWC 1QBML 3JUZA 1NGYA 1F58H 2P24A 1KENH 5ICXB 4YXHL 1F02I 5HI3C 4FQCL 3QA3B 4HKZB 3QUXD 2SEBB 4NO5B 1A1MA 3T2OA 3IT8D 4ODSL 3QHFL 1FL5A 3U46A 4HGWB 3V0WL 2R2BB 1T20B 5FOBB 4HMDA 2Q86A 1DUYA 5D8JH 3LHPL 3IJHB 3LKNA 1OAUH 3UBXB 3Q6FB 1UACL 4AEHH 4UV4L 3TWCH 2FB4L 4P5TB 4WU5B 1LHZA 4U3HA 5ALCL 5I1IL 3C5ZD 4JHWL 2OR7A 3HMWH 4JVWA 4EI5C 2GYSA 1P5VA 5KJRL 5E2UH 1XT5A 3N0PB 1IEAB 5FHAH 3BP5B 1FNSH 4WUKH 3ARBC 1FGVH 3BGAA 1EO8H 4U6XA 1BPVA 4AT6B 4W4NA 5T1LB 1PAMA 1FPTH 3AB0C 2ZPKL 2R0LL 3GSNH 3EZJB 3UYRL 4FZ8H 5IF0A 1ZT7A 3ROOA 5IKCB 2HJFB 3L3HB 3TO4B 1BWWA 3T3MF 3O2DL 1PKQB 5IBTL 4YDKH 5C0CA 4EBQH 2QADD 4OUOA 4ERSL 3PDDA 1PX4A 2A9ML 3P4OB 3QRGL 5D7JD 2R0ZL 3G5ZB 3R06A 1JZ3A 1FZOA 5EORL 5D7KE 1S7XB 2YSSB 1KBGL 5CEXB 5JW4M 4EI5A 4AM0B 3GMRB 2HVKB 1S7TA 1A6TB 2Z0BA 3MR9A 4QHMA 2FR4B 5J89A 3BVNA 3FZUC 3W5NA 5B39G 1SY6H 4JPKL 4JG1H 2XWBB 3BIKA 4LL9A 1YEHH 4G6FD 1NCBH 3D85A 2FO4A 4NHUA 1QKZL 3SCMC 8FABA 4CW1A 5BJTA 4MJ2A 5T5FL 4DEPB 3KJ4B 5D7IF 3O2VL 4YHKL 2YD7A 3DURB 3MCKA 1INEH 1CLYL 2CDFB 3RKDC 2QKIA 5IR1A 1MOEA 2YR3A 1DUZB 4Y5VC 3QQ4B 1N4XL 4D9RE 3QEUB 2YD9A 5LG1A 2DOCA 4X0KB 3RWIB 3GJFH 1SM3L 4ZO8A 4N5UA 1EXUA 4LDOB 5ERWA 3E0GA 3TIEA 3QJFA 4LVHB 5DYOA 1EMTL 4NFCA 4HWUA 2CK0H 3HRZB 3WFHA 4WTZG 4O4YL 1RZKH 4XXCC 1N7ML 1T0MB 3MO1B 5CS7A 3UJTL 3OKMB 5EZJA 2DQCL 5CGTA 3CLFL 1X5LA 2IQ9L 1VFMA 3ZYZA 4GW4A 1PJ9A 3PWUA 3UJJH 4I3GA 43C9B 2FDBP 4G8IA 2BNRD 1ETZA 3R8QA 3SCMA 2AI0H 3UTQA 1N8ZB 4H88H 2YXMA 3OBAA 4WY7L 1MREL 4JM4H 4DFHA 3U2SB 5JDSB 3B9AA 5EU6E 4HWNA 2AJYL 3MLRL 5DRXB 9CGTA 2VB5A 5BW7A 4NNPH 4H8WH 1VKXB 5LQBH 1EHXA 3QPQD 3L9RA 4PP1D 1QBLL 1EJOH 3CVIL 4P48A 5E9DE 1BFVL 5CLTA 3KPMA 5HHOB 3QDAA 1OTTC 5KBNC 1H3GA 2YEZB 1HCFX 3MBEC 1QSFE 5BMFH 3HHRB 4YAQB 5IB1B 2NY5L 1IAKA 1O5DT 1FAIL 3PP4H 2HFTA 3BT2L 1DBKH 4ORZC 5E8PB 4ZNEA 5KSUA 1XCTB 2D9QB 4F7MB 4WJ5B 3VFSA 5DC9B 2ZP0T 4WFHD 4EDWH 3W0WA 1J1XL 4Q9BA 5EOQL 3WHE0 4ENED 1GOFA 2HKHH 2QR0A 1NBVH 3G04A 4LDLB 4U6XB 1Y6MR 3TH2T 4GKSB 4JY4B 4PLKD 3EO0A 5D6DA 4ALAH 2R23B 3RBGA 3K2UL 1B88A 2ZSWA 4XH2B 4JFYA 5I18H 3GMNB 4MJ5A 4GG8B 3X12A 1ZT7B 4OGYL 2DIAA 4JDTH 4X4YA 5J1TC 3FL7A 5L7XL 5ESAB 1S9VA 1RZJC 4NKMB 4TVPE 5C08A 1HI6B 4NN5C 4WIQA 3C08H 3BWAB 2B39A 1HH9A 4ONFL 3QG6A 3MJGX 3RL1B 2A0LD 3FFDA 2HVJB 3P0VL 1PY9A 3QWOB 3T0BA 1W8NA 3C8KA 4GUPB 1T0NA 1BX2A 4KTEH 3ROLB 1N0XL 4UOW0 1FVEB 3KYOA 3K8MA 4R2GB 1P6AB 4F57H 3ARBB 1P5UA 4NN6C 5SWSE 5L2KA 1TJIL 3AB0B 4QHKJ 5F97E 1REIA 3BEVB 2BK8A 2C9AA 3TPUB 2IBZY 1LO0L 1WWWX 3P77B 4QRUB 1DLFH 3MNZA 3G5VA 3NIFF 3BUYB 1KV3A 3HNVH 4XBGA 4F7PA 2OL3B 1DFBL 1HH6B 2H3NA 2HLAA 4I2XB 4Y4HD 2JCCF 4EDXB 4CVZB 5DVMA 3V95A 1FZKB 1IM3A 3CSYA 4JRYA 2G9HB 3RI5K 4OZGB 4AG4H 1KLGB 4PJ7B 4Z7QE 1CFTA 1I1FA 2R2HA 3FT4A 2DQGH 3DBXA 4HPYL 2VN7A 3U6RA 1V7MH 3PGDB 4MVBD 4Y4FC 3IKCA 1F4YH 3CZFB 5KANG 1ZGLB 3OKLA 3T8XB 2VUOA 4PJHF 3N1MC 1PDKA 3QEGH 4NQVA 1D5BB 4Y5VB 1YY9C 4FP8H 5ACZA 5FO8B 5SX5H 1MFCH 4Y7MA 2KL6A 2R8SL 3TT3H 4PG2C 4GBXA 2D7MA 1NC2A 4FFZL 4MA7H 1HK6A 3BPCA 1UKSA 4TULH 4MCYA 1PSKH 4LLMA 4O5LL 1ZA3A 4LDEB 1Z0NA 5EBLA 2XQBL 2PYED 3REVB 1F4XL 3L1OH 3SDDC 2FJGA 4S1DC 3CXHJ 5C07B 3MV7A 3KXFD 4HZLA 1GC1H 3F5WA 2QBWA 3ILPA 5C2BL 4Y4KB 4NCDA 3JTSB 1W72B 5CP7B 2WK2A 32C2A 2CKBH 1ZEAH 3B6SB 1KJMB 5GPRA 1AHWC 4NUGH 5I8OL 1RVFH 3EFFB 3RVUC 3U7WL 2ARJQ 3PWJA 3HUJE 2GITA 5F3HA 3OWEA 4JZNB 1ODAA 3DETD 4KJWD 4XAWL 4YBLB 4KUCF 4OKDA 4IDLA 1U8MA 2JIXD 3KLAA 2XZAH 3QIUD 4HFUH 4JN2B 3MBEB 3X3GH 3SDDA 1YMHA 4KJYA 4JFXA 4M48L 3GHEL 4L29B 1TNMA 1KYOJ 5SWQB 3WKNA 3TZVA 4KVNH 3HPLB 5IMLB 5CJQH 3GK8L 1BX2B 4P4KD 1T66D 5I1GH 2DQIL 4EUPA 3FQXA 3VD7A 3NTCH 3KYOB 1J8HE 2AW2A 4ZXBB 4DKEH 3LQAL 1P2CB 3Q3GB 4GXUN 4RRPG 1BJ1J 3PXJA 4PG9B 5HDQL 1I1YA 5C0AD 4GG6B 3OJ2C 4YDVB 5L2KB 4V1DA 1MRCL 2B0SL 2VC2L 3DVIA 3DMMD 3PHSA 3QXUA 2A1WL 4KAQH 4GAYA 4R4NC 3BJ91 4JFFA 2GSIB 4M7KL 5C09B 4OIAA 4NN5B 5ID1B 2EE6A 1VACA 1A7PL 3O6KL 4ZFOB 4P2QA 1WCBA 4S2SA 3MJ8B 5EOTB 4FABL 1T2XA 1R5IB 4X7SL 5E8DL 3MC0A 5KG9A 1I3GL 4RAUA 3B9EA 4QRSB 3V4PL 3P4NA 3UTSD 3PL6C 3HR5B 4R90L 3CFCH 4H20L 4NZTH 2X4QB 5EZIL 2CO6B 1SEBA 5FGBA 4B5EA 2PCPB 1TCRB 2DS4A 4DZBA 5ENWA 3ZKSD 5A2LH 1VGKB 3TBVB 5E03A 5C3TA 3RWGA 2E6JA 4Y5YC 2H1PL 1JPFA 3TBSB 3CXHK 5I1DA 5GIRA 5TDNA 3IDGB 2ITCA 3OAYK 1N5AB 4HKBB 3S4SA 3FFCD 4Y19A 1UB5A 5C9JA 4NBZB 5ANME 1KEGH 1JV5A 5K33A 1KCUL 1NJ9A 4X5WB 4LLMB 1Q0XH 4MDJB 1YYMH 1UWXK 1ZA6A 3OJVC 4G6KH 1HILA 5GRJH 4AH2B 3PL6A 2X4PB 4KKBD 4U6VH 4KHTH 4J12A 4UB0H 3GMLA 3X3FH 4IOFD 4KVCL 1MI5A 1M6OB 4OZIA 1C5BL 2KZWA 1UB6A 1X5GA 2ERJC 1PYWA 4MXVF 4Y4FB 3HCVA 2Y72A 4ELKB 1P4LB 4NO3B 1O7SA 1ZLUK 4Z7UB 4CJ0A 1UM6L 4M61A 1KJ2B 3MRJB 3V5HB 2YXFA 4Y2DC 5GGVL 1CL7H 1KYOK 5BV7L 1IBGH 1HEZA 2FRGP 3KR3L 1FG2B 4HWBA 5E2JA 4JO1H 5CZVH 3HC0B 4YXLL 3PWJB 5DD1H 5BZDB 1L0QA 4F8QA 4DGYL 1F5WA 1NGXA 3QQNA 2OQJA 3P9MB 4MAUL 4BUHA 1KJVB 3D0VB 2QHLA 1MWAA 3R1GH 5ADPL 1NGQH 2P8PB 3EIFA 5C0RH 2F54E 2VDRL 2CDEB 4GMTL 3TNMB 3LS5L 5HHMD 2AABL 4I4WB 3DTXA 3BP7B 1MRDL 3GI9H 4NRYB 1MIEH 1LEIA 4YIQB 3MLPA 1FYTA 1EFQA 3BH8A 1RZ8B 3GMQA 1QZ1A 4YO0B 5DJAB 1LDSA 5DRWA 3RWFA 3LKSB 3SY0A 5IB4B 4WI5A 3NGBB 3HI6H 5EC1B 1G7IA 4DCQB 1Z9MA 1AHWB 4DKAA 1G7QB 3MV8A 1QFPA 2EDLA 4MXQC 4FQ1L 4RMTA 4X80L 1KTDB 3OPZL 4WW1B 4GAYB 1H15A 2IQAB 3SKNA 3MV9E 1IEBA 4JKWA 2BNRE 1DQJB 3OKEB 2PO6D 1VACB 1OQXA 3KDMA 1HHGA 3VFPB 2VDQH 5D93C 4BSWA 4F9PC 3ARFD 2ZG3A 5KANI 3T1FA 1G7HB 2HLFD 4HH9A 3MNVA 3D25A 3V6FB 4ISVA 3PGFL 2ZUWA 3NAAH 2ADJB 4F7EA 1A0QL 3GFUA 1F11A 3VXUA 4HMEA 1C1EH 2H32B 3SHSA 5ENWB 3OKNA 2Q8BH 4RGOH 4QOKA 1JZ6A 1FVDA 3ALWA 2X4SA 4HD9A 2O5XL 4O9HL 4XPHL 1RJYB 1L0XA 5GXBB 5E08H 4WFHE 5E7BA 3VH8G 2NY7L 4TNWK 4NKIH 2ICWI 1KIPB 4IMKA 1AR2A 4X4ZA 4HT1L 1BZQK 1X4XA 3DX8B 5FKAB 4O2FA 1AGBA 4Z7WB 1CG9B 4XPAL 3WFCH 5C70A 3PL6B 2NMSA 4K94H 2J4WH 1NC4A 4GKZA 4OZFH 4JFDA 2R4RL 5DJ2B 1QFWL 5CINH 3Q2CA 1IAIL 4NJ9H 5EA0H 4G5ZL 1A22B 2VE6B 1B6DA 5A1AA 1CBVL 4HZAA 2X89A 4B7LA 5LAXB 4YZFE 3L3IB 4X6CA 1RZFL 1Y18B 1WLHA 1CQKA 4MNHA 4M1DL 5E4IA 1EEYA 3D9AL 4LRNH 3ARDA 1J1PL 1QVOA 4IHOB 4Y5YB 5D1ZC 2F53A 5DHVH 4MD0B 4QXUL 1QRNE 4FQIH 3ZHKA 5TE4H 4OLVH 2X4OA 2EH8H 3EJJX 3KYKL 5FECA 2FLBT 3FB6B 3F7QA 5CBAA 1U8HB 1FZMB 2R69L 2FH8A 4C83A 4ZOBA 1JRHL 1T1XB 1X4ZA 1YUHB 4BZ1H 4GRMA 4XPGH 1OP3K 1CICA 2ERJB 3T0WA 3BX7C 1MF2H 5GS1C 4P23B 3RVXC 4LLQB 4S0TD 3QDMD 2P8LB 1S7UB 5FO7B 2YPLB 3ILQD 3RWFB 2J8OA 3H2WA 3SY0B 4Y2DB 1X5YA 1SJXA 5A3IC 2H9GB 1JWSB 5T1MA 4WUUD 3EDFA 4U0RC 5DZLA 1YMMA 2G60L 1IM9B 1ZHKA 4PY7A 3QFJB 4D8PA 3KNBB 1XF3A 3OAZH 1G6VK 3T77B 1PKOA 2CRIA 4G7VL 1E27B 3BDBA 1CD9B 4BFGA 1NCDH 3GIVA 1S7VA 5I1EH 1CI5A 4MQSB 1NCAL 3KAAA 5DEGA 1N6QL 1BQSA 1BP3B 3PNWA 4PJAE 4UDUA 3WFBL 4TVPH 5F7FA 2F74B 3GRWA 1EAPA 4XB8A 2VXTH 3QCUH 3WL9B 5GS1A 4FZEL 1U8OB 4IS6A 2Q8AH 2JB6A 3D39B 4RMVA 2P5WD 5HGDB 4F7EB 1B0GA 3KLDA 5FXCH 3LRSA 1A7QH 3MLWH 1IC4L 1JGLH 3S3PA 1J12A 5AYUL 3CUPB 5IESL 1U95B 3GSNA 3OKNB 2PYEE 3IYLW 3LOWA 1XGYH 2GK0A 1ZT1B 3FB5A 2QHRH 4HF5H 1FVDB 1IC1A 2DF3A 4YDIL 2HFFA 1PQZB 2X4SB 3GMOA 3KXFE 3O3AA 2CJUH 4LLWB 2L7UA 1BQHG 4PJ9C 2BDNL 4D0BB 5BS0B 3DSFH 1RK0B 2V7NA 4GAGL 2X2YA 3H9SD 3MODL 5D93B 1WWBX 1C16B 1RI8A 1UZ8B 2P5EB 3QEQA 1OWWA 3LZFH 1HKLL 2WUCL 2XN9A 4KRPD 4U1SB 4BA8A 5DJXA 1CLOH 3WHE1 3WFDH 5DMJB 4JFEB 3RZCC 4TN9A 4S11A 2HMID 1MCWM 1SY6A 2EKSB 2I60L 1OAZH 2PNDA 5GRYA 5HPMB 1EUTA 4KDTA 1Q94A 3KHOA 4UIKL 5EIIA 4YFLF 1ZSDA 2DDQH 1TITA 4QRRB 3RI5F 1KGCE 1EEYB 3GHBL 3QH3A 4POZD 5TE6H 2WIMA 1QVOB 5LKNA 3HS0A 3TV3L 4LKXA 4YBHA 3QUZA 3IXTB 3ZE1E 1R5VB 1FH5L 3MJ6A 2XZQL 1K4DA 4L5FH 5AG8A 3BDYH 3T4YB 5FECB 4UOW1 1MJJA 3MLTB 3N1PC 3SDXA 5T3XE 4XI5D 3ORJA 2FHFA 4HBQA 2FL5B 5KVEL 5IQ9A 5L6YH 1CGSH 5C71A 4N9GB 1CGWA 5CKAA 4O02L 1R3HA 2EIEA 3B8YA 3VXMA 5HI5D 5D4QA 3V52H 5KS9E 3DGCR 3H42L 4KMLB 5BZWB 2FGWL 2IFFH 3W9EA 3H9HA 5D1ZB 1IL1A 4KTDL 3A6OA 1XGUA 1BVLA 1D6VL 1JHTA 2YN5A 4WWKC 5T1DH 4OD1L 2VWEC 3S88L 5I19L 2FX7H 1E4KA 4HUMB 1Q38A 1NMAL 4Q97A 1S7VB 4IOSD 4N0UB 2G75A 5TQ2H 2XTLA 3TO2A 1CWVA 4GSDL 3W2DL 2VQ1A 5JPMA 1RZIA 2DBJA 5EO0A 2EO9A 1GHFH 3GSRA 3RTQD 4XXDB 1CU4L 1MAJA 3CH8A 5ESVB 5HHNB 1OP5K 1KPRB 3LY6A 4PS4L 1BD2D 1QSVA 5KZCD 4FTVA 1UJ3B 3ME0A 4FXGB 5EOCJ 2FZ3A 1B0GB 3C6LA 3LSOA 3FT3A 4OB5H 4ZO6A 3VFUB 1T6WA 4U0RB 1RHHA 2X9XA 4JPWL 1NCTA 2ADFL 3EYSL 4APQA 4WWKA 3GSQB 5AUMA 1AY1H 3NIGE 35C8L 4PJDE 4J3VA 3G6JB 1I9JH 4URTB 1C08B 3HC3H 1TTUA 5CJOL 4WHYG 3RL2B 4R4BA 1WF5A 5TF1L 5H35A 4IOIB 1VFBA 4YH6A 3I6KB 5D1QC 5IEHB 1MNUH 4OCXL 5FYKL 5JZ7D 3VWKC 2VDNL 3VGFA 3O3EA 4Y8AA 1ZVSA 5KSBF 4AQ1B 1NLDH 5I76A 2EC9T 2ATKA 2B4CH 3RAJL 5K93A 3DVGA 1S7QA 2XA3A 4RDQF 1A7NH 5HXMA 2UY6A 1MCDA 1IGJA 4XMPH 5I8KH 5HHME 1E4XI 2AJVH 5FYKD 4AIZB 1AGCA 1FIGL 1QPPA 1ZHNA 1YEJH 5IHZA 1UG9A 2IMNA 2NXYD 3EGSB 4PJ9B 1QBMH 1SMAA 3WNNA 4QO1A 5C0EB 5HHXL 1GL4B 3GJFB 4MD5B 4HUVA 4HKJA 2XPGA 1I7ZA 2V5RA 4YXHH 2ZUSA 3DROA 4GQ9L 4PIRF 5D1QA 2DWDB 4BM7A 3ZDXF 2F8VA 4ODSH 5DVOA 3QHFH 2CRMA 3V0WH 3VWKA 3MA7B 3ZKMD 1X5KA 3RZCB 4TRPL 5BRZE 3BKYL 3LHPH 4CU6A 2JJSC 1XFPA 1WFTA 1UACH 3VMOA 4UV4H 4YXKL 1R3HB 2UVFA 2FB4H 3VXMB 3DSNA 1NUGA 1HSAA 5ALCH 3O6FD 5I1IH 5I75C 5GISH 2O93L 1KXQE 1DEEB 4GW1A 3EO9L