4ZXBC

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
187
Chain Sequence
QVQLQQSGPELVKPGALVKISCKASGYTFTNYDIHWVKQRPGQGLEWIGWIYPGDGSTKYNEKFKGKATLTADKSSSTAYMHLSEKSAVYFCAREWAYWGQGTLVTVSAAKTTAPSVYPLAPSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTCNVAHPASSTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone receptor/immune system
molecule keywords Fab 83-7 heavy chain
total genus 34
structure length 187
sequence length 209
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbC02
3BEWA 3T0EE 3T08A 5GRVL 3U9PH 1MCLA 3TT1L 2UY7A 3TZVD 4PP2A 3MJ8A 3SDYH 4PJXF 4L9LA 4E0RA 4TPRH 1BQLL 1UJTA 4UV7H 4M02A 1INEH 5DR5L 3W0WA 3STLB 2XTLA 1GGBH 5E4IA 1FLRH 1A6ZB 4D2NA 4EDXA 3OKLB 4P3DB 4JFYB 4AL8H 3QDJA 5DD1H 5MERA 1MH5B 3CDCA 4H1LB 2J2ZA 4PD4K 1OTSD 5ITFA 5DWUL 3CZFA 2H32H 1UWEH 4IRSD 1JGLH 3UTQB 1H3UA 1QBBA 5HJ3B 1I9IL 2P49B 1LO4L 4P2RE 3KPPA 4RAHA 1FFQA 1U6AL 4ZFGL 3TZVB 4K7FB 4UMGA 4D8PB 4WEMB 1B6UA 1FNGA 2H32A 5DD3L 5E00B 3BZFA 3BT2H 2WZPD 1QSVA 3DHMA 1VENA 1AQKL 1F42A 1REIA 4X6EA 1QRND 5D5MA 4C4KT 1KBGH 1KEML 2ADGB 1LO0L 3GSVB 2YPVH 5KANG 3SEPA 4JAMA 5AAMA 1GAFL 5LBSL 2YK1L 5I30L 3GBML 1UEYA 3SQOL 1HCVA 1YJDH 3QWOA 1I3RA 1DVFA 4PV8B 3MLVH 4P4KB 4ISVA 4ZMAT 1TVHB 3Q0HA 4HEME 5DZOA 1LO3H 1PX3A 1VFUA 1ZEAH 2ADJA 2F53A 5C0ND 3TYGH 5AWNH 2AKRA 3O8XB 4DAGH 5EU7E 5IW6B 1NGZA 3ES6B 3R8QA 1S7XB 1UKSA 5FO9B 2VR5A 3UTTA 3B8SA 3ARTA 1LDPH 1MJUH 2H2PC 4LARL 3OGOE 1N59A 2E7BA 4M6AA 4HZLA 2L0DA 3DGGA 4XPAL 5D70L 5F7HA 3OL2A 1WFNA 5D9SA 3PWPD 1H5BB 1JNHB 1L9NA 1T3FB 1A6TB 4C55A 4YXHL 4NKIH 5I1IH 2BMKA 1YEDA 4KK9C 4OF0A 2EC8A 4Z78A 5AYUL 3I75A 2F74A 3GBNH 1IZKA 1T83A 3ISWA 1ZLSH 3DSNA 4R96B 4MXVF 1MWAL 4Z18A 1MUJA 3QPQD 3I9GH 4IDJL 4QRSA 1BZ9A 1IGCL 5IVXA 1CLZH 3GM8A 5C6TH 2E9BA 4RMVA 3VD4A 2Y4SA 5TH2B 4NT6A 1P1ZA 4JN1H 4UDUA 2V5RA 1P7HL 2YWZA 2Q20A 4JRXE 1NMBL 4GLRH 3MFGB 2YKLL 3QYCA 4OLYH 2C26A 4JFDD 3X3FH 4LLAA 3LEYL 5E8PA 1S7SB 5AYQA 4NN5B 4LBEB 2D03L 4DVBB 4NKIL 2H2PD 4OAWA 5E8NB 2ICCA 5JQHC 4N68A 4KC3B 2FGWH 5J11B 1MLCA 1NDMB 4TNVF 2GT9B 5IMKB 1IGTB 4G9DB 4QTHA 2ORBL 3RGHA 4Z95L 4KXZH 4U1IB 1JGDB 2YPLE 4K9EC 1EMTL 2QSCL 3O11B 5JIKA 3ZE1E 1OPGH 1MREL 3C9NA 3O3DA 5IK3A 4HKJA 2R1XB 4GW5B 2R2EB 3MGOA 5IW3A 3RPKA 4BSJA 1DEDA 5D5MF 3WXVL 2DIAA 3LKOA 4Z8FL 1KNOB 1D6EA 3JV6A 1FG2B 3EO1A 3KLAA 2RGSA 1E6JL 2IPUK 2X2YA 3SKMB 4GMSL 3W82A 2FH8A 3CX5K 3WFDL 1F90L 3V4UL 2BDNL 5E8PB 4L4VA 1U3HA 2BVOB 1MCWW 4I9WE 4KQ3H 3TBVB 1RFDH 3KPQB 1EEZA 3ZYZA 1L7IL 2JJWA 1EAJA 2YA1A 5I1IL 1KJ3H 2V7HA 3MA7A 3A6BH 1KEMH 3HC3L 3T2PA 3BUYA 1B4JH 1U3YA 3QDMD 4WCYH 3RX8A 5DK2B 4A2MA 1YNLL 3WJLC 2F5AL 4OLUL 2VUYA 3VFSA 2DI8A 1HHIA 4ZQKB 2ARJA 3V6FB 2Z31D 2NY3C 3QIUD 5GISL 3X3GH 2JIXB 3RDTC 2Q86A 2RJMA 1P4LA 4FN0A 4DAGL 4RBPK 1CBVL 3BZDA 4S1QH 2VZ1A 3H9SE 1UVQA 4JFQB 3GSRB 2HFFB 3RTQB 3C5ZD 2DTMH 3EW3B 4KKAD 1YZZA 4OT1H 3ZHKA 3V4PL 4YFDB 1KCSH 5EUOB 5GRUL 2I25N 3OBAA 1OCWH 3RVVD 4RGNC 1WTLA 4ACPA 2A1WL 3WFHB 1K8IA 5DUPH 3PWPA 2Z31B 5H35B 4QYOA 4M7LH 4LAQL 1AQKH 3R0NA 4PY8J 1JF5A 2CMRL 5ESQA 5DD3H 3MRPA 1Y6NR 2AJZA 2XZQH 2IANB 4ONHB 32C2A 4I77H 5HYJE 4OLVL 3KWWB 4OCWL 2A73B 4PY7A 3OX8A 1F4HA 1Y18A 2A83A 3EYQD 4OJFH 4AH2A 1KLGA 3GB7A 4NHCL 4KQ4L 4GKNB 4FQXB 3FQWB 2A6IA 1T4KB 1OLZA 4F2MA 4AEFA 3HE6D 3TO4D 4U05A 4NUGH 4PIRF 5C92A 1RV6X 4K3EL 1DVFD 1G6RB 4PJHA 3LRSB 3MBEA 3S4SB 2PTVA 1JP5A 4LQFL 4X5WA 2GJ6B 4OLZL 3BKJH 4ONGL 3VXRD 5ENWB 2EXWC 5HGGS 5EIVA 2F5BL 4MCZA 5JMRA 5J56B 1SJHA 3U48A 4C56A 1TPXC 5HJ3A 3RRQA 4R0LC 3C6SA 3B9VA 4RGOL 3R4DA 5D7IA 5SX5H 4I3SL 4U1KB 3K8KA 4I2XA 3GHBL 3HPJB 3CFJA 1L0QA 5E9DD 3MOAH 1CIDA 1PY4A 4KZDH 3HZVB 5EBLB 5HHNB 1SEBB 2UZIH 1IM3B 3QEHA 3P77B 4Z7NF 3QUXD 3ZKXC 3VXSB 2XRAH 5I1EH 1W0YT 2FL5A 2Q3AA 1FNHA 1XZ0B 2QQNL 3NVQA 3FZUC 3IXAA 4GAGL 5C09A 4Z7OF 1U8NB 5BS0B 5FGRA 5MENB 4QF1A 1G0DA 3WDIA 3FN0H 4WJ5B 1GGIL 3RGVC 4BQ6A 4NO5A 2QADB 3C2SA 3LQAL 4LLVA 4HXAH 3S5LG 4DN4L 4NDMA 1T2JA 5C0AE 1E4XI 3T3ME 1ITBB 4PJ9D 5E0QA 2K7PA 1YNKL 5B8CA 5F6HI 5I1HH 5JW4R 4LFHG 3JV6B 1JHKH 2D0GA 3QUZC 5TE6L 3VJ6B 2OL3A 3UC0L 2YUXA 1KB9J 3VRJA 4MX7A 1RULH 1U8IA 3CFKA 1G84A 1CL7H 4UIKL 4G6JL 4OUOA 3STZB 1IC7H 3QA3A 3DRTB 3QNYB 5E94B 3I3EA 2HLFD 5K9KA 5C6PB 1FL3B 1YEFH 4O51B 1A6AA 3DUSB 4KHXL 1DBML 3QQNA 5L6YL 3OWEA 5AUMB 3ROLB 3UYRH 4G9FA 1FZOA 4DGYL 4OTXH 1PDKA 1VGKA 2RBLA 3R0MA 4QOKA 4B7LA 1JNNH 5D2LB 3SQOH 5CSBA 4XMLL 3BH9A 4IOIA 5E2TL 2B20A 2CDEB 1WBYB 1INQA 4D0CB 2X42A 5C08D 1GGUA 4P2CG 1UKQA 3QFDB 4I0PC 4LEOB 5DO2D 2VLRB 1KJVB 2DBJA 1D5XA 5GQBA 4Q9QL 3P11L 3MUGA 4KPHL 1MIEL 3HAEG 5HHOA 3EFFB 2RCSH 1OF2A 5HY9A 2GSGA 4HULB 3VRLE 4PP1C 5E2WL 5FEBA 3ULVC 4HFUH 1U2CA 4CADA 1JGLL 3BVNB 4RNRB 1YDPB 4HC1A 4ONGH 1V7NH 1WLHA 1NFIA 3ZKQD 5T1LB 3TVMD 1NAKL 1J1PH 4XHQA 3IXTA 3TWCL 1QEWA 1FL6A 1YJDL 3WFEH 1IZJA 3TBWA 5D9SB 3DVNA 4UV7L 2DQFB 4ELMB 5EC1A 3ARRA 1C8PA 4LRNH 5DRWB 5F9OH 4XH2A 1IQDA 1MRFH 1CFTA 3PWUB 1RURH 4FOMA 1R3LA 1U8KB 4F7EA 3D18A 5GS0D 4DZ8A 4ZPTA 3UPRA 1N26A 1PKQB 4Z7WA 4GG6B 4AZ8A 4D3CL 4GXUN 2I9TA 4JFPA 5INDA 5HHPA 2AKRB 3O8XA 2D3VA 3IT8D 2FZ3B 2LU7A 4X6FB 3QI9D 1IAIL 3H0TA 3V0AC 2FHFA 1JHLL 4JFZL 2ZUVA 2WQ8A 4CVXB 4YH6A 2V2TA 4LGRB 4M6OH 5CEXA 2NYYC 1RZGB 3KHQA 1G0YR 3MMEA 4K3JL 4QCIA 4KFZC 4ZFFA 4H5SB 4ZNEA 2X09A 5DJZA 4U1SB 2L7UA 4R2GB 3K8LA 1QSEA 3BOVA 2A77L 3LQMA 4F7CB 3D3VA 2IG2H 3VXQA 1A1MB 5F9DC 4ZUSA 3MR9A 3W39A 1RMFL 1ZHKA 2EYTB 3UTTE 4MLSA 5E99L 1N3NA 2FEDD 1FCGA 1MREH 1INDL 2NTFB 2X1WL 2BCKB 1F00I 1P4IL 5EU3A 3P11H 5CP7A 1LEGA 3TBVA 4M7LT 5I1HL 5IG7A 4HDIA 3SCMD 3RVTC 4LPCA 3O2VL 1BP3B 1PZUB 5DD6A 2HYMA 1AGDB 5K59E 2CLRB 1RFDL 2AABL 2C4FU 4X80H 3TA3C 3C8HA 1HQRB 3SY0A 3BDXA 2NXZC 3HR5B 3V0WL 2M26A 4Y19B 1SY6H 4H0HB 1IAOB 2FJGA 4MAYB 4YGVB 4ZOBA 2BVEA 3S4SG 5K9JL 2CRIA 4UOW0 3WKMH 3D3VD 1S7RB 5EU6B 2VLRE 2N56A 2PYED 3MV7D 4ZO8A 1CLYH 4DEPB 4HLZH 2VXTH 2WV3A 4ODSL 4JCMA 1PG7W 2FLRT 1EBAA 2XI9A 2LTQB 1I4FB 3VFNA 4FQJL 4XHJD 1IFHH 4MNQA 5CJQH 2ICWJ 3GMPA 1T7XA 3MRNA 4X8JA 5DI8B 2BNQA 4YR6A 5I1JH 3QRFM 3MACH 1MPAH 4TUJB 5I16B 4MA3A 4Q97A 1MFBL 1HCFX 4EI5A 1BGXH 4I5BA 3N50A 1MF2L 1V7ML 4TNWK 4AY0A 4QXGH 2XTJD 2W0FB 3CH8A 4XAKD 4RAUA 1BVKA 4GAYA 2Q6WA 1CDHA 5CZVH 5I1AB 2R8SL 5HDLA 2HA1A 3MV11 4Y8AA 3QIBD 4MDJB 4LU5H 1KSRA 2E8YA 4JZJC 4YGAB 4IIQB 5BZWB 4NZUL 2APBA 1U91A 1LP9E 2AJZB 4IRZH 4C56D 4J3VA 4KJPD 3BSZL 1U8LA 2DKSA 3WNOA 2DL2A 1AI1L 1FNEB 4NKDB 1YECH 1CFSB 4X5WB 3ES6A 4KI1A 4YEFA 3EOAA 2B2XH 1IAIH 5LAXB 4QRSB 4JPWH 3MLWH 2EO9A 3U6RA 1SBSH 2D0HA 1BFVL 3L3OA 3TNMB 1QLFB 3V4VL 1IL1B 5GSRA 4CL7A 5JW3L 2CMRH 2D7OA 5MEOA 3PJSA 1ZTXL 1S8DA 5TE7H 3X14A 1KCRH 4KJQC 3FJTA 3TCLB 4FQLH 3HR5A 3LAFA 2VC2L 4W68A 5SX5K 4Y4FB 5D6DC 5C6WH 1CGSH 3SGEI 4KHTL 5C0RH 4U1NB 3MOBH 4LGSB 3RY5A 3EHBC 3PABB 4X6CB 1TQBC 1QFOA 4NHCH 2APXA 1MFAL 2NQCA 3O6ML 3TH2T 4QF1B 1AQDB 1JF6A 1YA5A 3IDNB 2C3XA 3V4VH 3RX7A 4YHKH 1CIUA 1IKNC 4CAGA 1YEIH 2P46B 4NWUH 3VRIB 3VW3H 2MHAB 2E8ZA 3NCCB 1VHPA 1U8NA 4IHOB 4N0UA 5H94B 4BSWB 3QFJA 2WUBH 2HJKA 4MXWH 3SGKC 3THMH 1RZJC 1LEKA 4K3GA 2HT2D 2AEPL 4BK5A 3CVHH 5SWQB 4QRRB 4FQ1L 3VXUA 5JNYA 1X5ZA 4JGUA 4V1DA 5EPMA 1I1CA 2OQJA 3MSPA 5CKGA 4D9RE 5KSBB 1ADQA 1TPXB 1QG3A 2EDWA 1GGBL 3RWEA 1QR4A 1G6RL 2EDTA 3EOBA 3MV9D 5IHZA 4LP5A 4UIKH 3DVNB 5GGVL 5JW3H 3SBWA 2DD8L 3WFBL 4M6NL 1WAAF 4JLRA 4M3KB 4WFFE 2YMXL 4PJBE 4CMMB 3MLSL 1L7TL 1EZVX 2JJSA 1YN7B 2EIDA 3WIHL 3CDFA 4HKXA 4ZNEE 5E1AB 3B5GA 4HZAA 5DA4A 5J0BA 5K9QI 3IJYB 5MEOB 2CDFA 4OCSL 4FQIL 5HGBA 1UJ3C 4OF6A 3TCLA 2BVPA 5C0FA 1TQBB 2J88L 3V5DB 5EIIB 2DQCH 1M6OA 1G9NC 3A67L 4DOHB 1EZVY 1UA6L 2NY0C 2SEBB 3ILPB 1PJ9A 1L0XA 5EZIL 5SV4A 5I74C 4P5MA 3FB5A 1JNLH 3OKKB 4DK6A 3MGTA 4Y16C 5GRYA 4Y19E 3OG6B 4JGJA 1QFUH 3JWDH 1MWAH 4QLRA 1Q1JH 4C56B 2EXYD 5CWSA 2H1PL 4QT5A 4OSUL 4BFGA 1JWSA 3OKOA 5J12C 1BECA 3TCXA 4WEBH 5DLML 3OPZH 3CFCH 4P23A 3PWPB 1C12B 2FIRT 5F1OB 3WLBA 1F58H 3HS0A 3BN9C 4YAQB 1QLRB 3A6CL 1S9YA 3IDIB 2X4QA 4G6KH 3WHXA 4N9OB 1I7RA 2JCCA 3LPGA 5I6XB 5F6HJ 3IFLL 1QBAA 4HBCL 3RWDB 3VWKA 4NCC2 5L2KD 3N9GH 2D7TH 1LEIB 5FYJU 4QYOB 5DHVB 1D5MB 3RY4A 5IT2L 1WWAX 2XZCH 1SHMA 3LEVL 3GI9H 2W65A 1J5OH 2R56L 2H45A 5FUZL 5F3HB 3QZWG 3U4BL 2OTUB 5IVNA 2F8VA 3KHOA 5FKPA 1JHTB 4JVUA 4HXBH 4KROC 5J06A 1OW0A 4HH8A 5DK0B 2I5YH 3O6LL 4NN6C 1A9EB 4Y16B 1MWAA 2EH8H 4MD0A 5D7LD 3VFGL 3MR9B 3AUVA 3HNVL 5DRZB 2AXJA 5CGMA 2O5XL 3QWRD 2IAMC 2J5LB 2VE6B 4U6TA 2JELH 2EDKA 4WNQA 5KSBE 4HKJB 1V3LA 3K4AA 4FNLH 4RFOL 5DRXB 2GW5A 1I9EA 2OX5A 5T1DH 1KFAH 2Z8VC 4IMKA 2ITDA 3VFRB 5IJVB 4TOYL 2OP4L 3U46B 1R3JA 4QRPB 5M94B 1U42A 2FZ3A 1I1RA 3MODL 3RVWC 1MFCH 5LG1A 4D9LH 4KK6D 5C0IA 3MXVL 1U3HB 1IILE 2BVOA 3TVMC 1T21A 2G60H 3HZKB 5BS0A 2XWBA 4K94L 5MENA 1EAPA 1ZSDB 4Y4KD 5FB8B 5DFVD 1CGUA 4O2FA 2NX5D 2BHZA 2J12B 1J11A 3BDBA 5TQ0L 1A6ZA 4NWUL 5C09E 1AXSB 4HWNA 1IM3A 1K2DB 4BA8A 5HD8C 2YA2A 1MCSA 4R90L 3ARFC 2GJJA 3EGSB 3UBXB 2HLAB 2P43B 2ARJQ 4JFHE 1KJ2A 3TNMA 3PQYB 4YUEH 4PRPA 3S6CA 2NY1C 1P7QA 5DEGB 5DGQA 5F1KC 3FO2B 4GMTH 3QEGH 1WCBB 2XY1A 3ARDD 2PO6A 1S7SA 3BXNA 4NN6B 4AL8L 5HVHC 2D9CA 5EB9A 3E6HB 4DCQB 4O58H 5J13C 1KIRA 3KJ6L 3J7HA 3IJSB 1JYNA 2CK2A 5KJRH 2GK2A 3VMPA 3AREB 3NBNA 1CLOL 1KCRL 1HDMA 5JIIA 5MHSD 5EBWA 3BO8A 3MLRL 1JYXA 3TZVC 2HFGH 3KLDA 3ZHDA 2EECA 5BQ7B 4HGMA 2VXUL 2ADIB 3L5IA 5CEZL 1KPRA 1UM6L 2LABA 4Q6IC 4ISVB 1ACYL 4KUCD 4IIQA 2XXMB 4E41B 5ICYB 1IFHL 1EUUA 4GKNA 5HBBA 3NPZB 15C8H 2GSIB 1ZLWK 2QV2A 4F80A 4YEEA 1VKXB 3MBXL 4NKMB 3SDCA 5DUBB 3F12A 5HY9B 3GI9L 4UV4L 1G7HB 1R3IL 3FT2B 1A7RL 4WV1B 4AH2B 6CGTA 2KZ1B 3DI2B 2Y23A 3OMZA 2W59A 3BI9X 4AEIH 1CD1B 1EUTA 1R3HB 3QUYB 5EORH 4U7SA 5FOJA 2FBOJ 4HX1A 4ZUUB 1QBMH 2CDEA 2NY1B 2VH5L 3MV7A 4OCRH 2AABH 4JB9H 5JHDB 1BGXL 1DQJA 1P6FA 4ZS6C 4Z95H 4XWGH 1Z0NA 4LSTL 3QNXA 5AEAA 3HMXH 2AJ3A 1BQHG 4P9HL 2CRYA 4M5YH 5IBTL 5F71A 5CEZD 1H5BC 1PGRB 1K3ZA 3CFEB 4JZOB 2QQLH 5CSZA 2XA8L 2A0LD 5CJ5A 3G6AB 1AHWB 5JQ6L 1AGBA 1DUZA 3UTPE 4OFYA 3VI4F 3ARWA 2B8OT 2ZPKL 1CDUA 3EJJX 2NTFA 4WHDA 4C54A 1JZ5A 4ZG1A 3SJVE 4O58L 1M71A 4I48B 5BVPH 3MUY1 3MLXH 3JTTA 1DE4A 3S37H 3GM0A 4TRPL 4OCXH 1KLFA 3RA7L 5ITBH 2GKIA 3JUYA 3PGFL 4XHJC 3E1F1 1N4XL 4MAUL 3UEZA 3OHXB 4U1LB 1T04B 2G75B 1DTUA 1RI8A 2C7UA 3VXMD 1UM6H 2VQ1B 3PL6B 4JM2B 4PJAE 3E6FA 1NBYB 1ZHBA 3T1WA 5C2BH 4IJ3B 1UCBH 5ENWA 1MQKL 3PGDA 4RAVA 4UTAL 4UNVA 3HRZB 5DUBA 1NCTA 3R06B 2NZIA 5FECB 1I9JH 2AXFA 2ICEB 2AK4D 3RZCC 5GGSA 1EO8H 2IQ9H 4JZNB 4R26H 3U0WL 5HXMA 4NPYA 1A7QH 1NEUA 3V6OA 2XPGB 1C16A 2Q1EA 3ARGA 3MRKB 3I50L 4M48L 4OFKA 4M6OL 3U36A 1RK0A 1TZHA 3FFCA 1G9NH 2ESVA 1QP1A 2ZCLH 4PJDF 1MY7A 3V52L 1DBBH 1BQLH 5CGYC 1N64H 4HJGB 1KENL 5DQ9B 3NCEB 1ND0A 3QIUB 2O5ZH 4MNGA 5HI3C 1URLA 4JFFE 4B41A 5HYEA 2NNAB 4X6CE 2ZJSH 1F6FB 1AXTH 2Q76A 1LK2B 2J3SA 4Q9QH 5JPNB 1U93B 2APVA 2VQTA 5ICZA 1MCBA 3MUZ1 4MXQC 1BAFH 4M7JH 2GY5A 5IB1B 4OM0L 5BXFA 4LNRB 1P7QD 4MSWB 4LSRH 4ODVL 1J1OH 4HKZB 5EC2A 2DQHH 4KH2A 4UBDD 4M48H 2QLVB 1WJ3A 3SQBA 4I3RL 1AFVL 2EDRA 1QVOB 3VDCA 1V3JA 3W5MA 3OV6A 2ADGA 1C12A 1YEGH 1ZA3B 2ZWLT 1INEL 2OK0L 3QP3A 2R2CA 1OARH 4Y1AA 3VFVB 3WS3B 4EIZC 4PY8I 2QSVA 2Q8AH 3O2WH 4NNYB 4LLDA 2FSEA 2BNUA 3KYKL 3I2CH 1QKZL 3QI9B 4UINL 1YQVL 1A4KB 3FT3B 1HOCB 3CD4A 4RX4A 1T89A 4NBYB 5IBUB 5EOQH 1BBDL 1RJLB 2PXYD 2R9HD 1LEKB 1UENA 1EXUB 2VB5A 3DSFH 3FOMB 5D1ZA 4Q9CA 3LS4L 2GITA 1DANT 5DJYA 4OCYL 3VXUD 5I1KL 4JFED 2WUCH 4XXCC 1NGYA 3HUJF 4NQDA 1AD9A 4O9HH 3ZDZE 1BEYH 1JWUA 5FHBL 2CIIB 3QFJD 2J8OA 4KTEL 4Y16D 4NBXB 4QRRD 4Z0BH 4YPGB 43C9A 3UBXG 5C0EB 1N5AB 3A67H 4JY5L 3ESVF 4U1JB 5H37H 4FG6D 3LKPB 3MV9B 5C09D 3CC5B 2DWEA 1S78C 3SDXF 4C56E 2BVTA 4KKBD 5DJ6A 1XF5A 3GMMB 4EZMA 5ADPL 5SX4I 2F8XC 1AO7D 3PG2A 3QRGH 2H1PH 4J3OC 2YEZA 5GGRA 1CFQA 1QNZL 1SYSA 4JR9L 3IAQA 1XH3A 2R0KH 1CTNA 4JJHA 1RHFA 4QTHB 5GSVB 3ZT5A 4LRIC 2Z4QA 3GSUB 3QI9C 1CT8A 4XT1C 1FGVH 4XPGH 4NQXA 4EJ1C 2OL3L 4QRUA 2IAMA 1I85C 1RUKH 2AVGA 4X4XA 4LCYB 5GRWA 1N7MH 4GMTL 3KPSA 4X98B 3FQRB 3UJTL 1EGJL 4KZDL 2VNCA 3RDTA 1AO7B 1U8LB 2WIMA 2BNRA 1YMMA 1VEPA 3QIWA 5GRXG 1QKZH 1T0NA 2XN9D 3QXUA 4QHUA 3S5LA 4H20L 4Z7VE 2ZCHH 1OSZA 2C3WA 5F7LB 4KKBC 3S96A 1NCUA 3SJVD 1HH9A 1A6TA 3FZUD 1CDBA 5CSZB 3X11A 4ZUTB 3U30B 2Y06H 1CGWA 4UNTA 4ZO9A 2R1WA 4E41A 3EYOA 1T89C 3PDGA 2GCYB 2DDQH 1ZK9A 3MUGB 4JHBA 3G6DH 1HHKA 2EEDA 1J86A 1XEDA 2OCFD 4S2SA 4X6DA 1TETL 2PW1A 2YPVL 2G5BA 3RGVA 3RIFK 3MREB 4PJCB 4TYUA 2Z8WC 5D7SL 1R3KB 3DUHA 3LKNB 4R2GD 5C0CE 4LCWE 1MIML 5E7BA 3RKPA 5FYJD 3AM8C 2W0KA 4M5ZH 5H2BA 3ABZA 2BFVH 3BZ4A 2CUIA 1BJ8A 2YBRA 1NDGA 3NGBC 3LN9A 1SEQH 2DLGA 3ZE0E 3QG7L 3A6BL 1JGUL 4P0DA 1JPFA 4QRRA 3KYNA 4Q74A 3U0TB 2RHEA 4YDIH 2G60L 3QXWA 5LCVL 3VXSA 4LK4A 5F1IB 2FBJL 1WBXB 2A9ML 2WBJD 1YMHB 1QRNA 4Q6IA 2H41A 1A02N 5GHWL 1MAMH 4FFYH 1OGAA 1VA9A 1I1AC 1M1SA 1HXMA 1W8NA 2PCPB 5IOPB 3DTXA 5DJCB 3SDAD 5EH1A 2B0SL 3DVGA 4TVSa 2DQEL 2EEBA 2OMBA 2PTTB 1I8IA 3TC9A 4BQ8A 3K81A 1T22B 4FQHA 1G7IA 4M61A 4ZFFB 4JPWL 4XBPA 3CH1B 2QKIA 2DTSA 3IDJA 2NZ9D 3F58L 4I48A 4FTVA 4KRPB 4WV1C 5CKAA 2YPLD 1AJ7H 2HJKB 1MLCB 5IVXE 4R8WL 3GGWB 5I9QC 1P5VA 3GI8H 2EC9T 2O26U 2WMPA 4GBXC 2CKNA 1KYOJ 2AP2A 2XZAL 5FHBH 3EJZD 2VAJA 5IB3A 1E4XH 1TZIA 4RFEB 1X4XA 1EGJA 4BM7A 5BJTB 3FFDA 4NZDA 5DEZA 3RNKB 2E9WA 5CILL 3MREA 5IQ9B 2UWEB 3O8XD 4XNQB 3LQZB 2UWEF 4AK1A 4R4FH 5C0AB 2YPLB 3ARZA 3ALWA 4NO3A 2DYPA 1H3XA 3MLPA 3HZMA 5FDWA 1FYTD 3C2AH 2VLKD 3EIFA 4MQ7A 1FIGL 1JPFB 4PRIB 1T1YA 3H9SA 3MLYH 2FECL 3MLSH 3TN0B 5MI0B 1KLGB 3CIQA 1VKXA 3TA3B 3GSWB 3DMMD 4P2YA 4J3XA 3ZTJG 5EIIA 1JK8A 2EEAA 5J6GB 1T4KA 5E8DH 2X4NA 3UTSB 5TE4H 3GRWH 3S3JA 3DV4A 1ZA6B 1RUAH 5CIPB 1TCMA 3O6FA 3WLWC 1Q9LA 3BD3A 3L3JA 4YR6B 5DI8A 5FM4A 2H26B 4GUPA 3QIWB 4IRSC 4GKZA 1S7XA 5FO9A 2APWA 5FUOL 1CDYA 4P4KC 3MRMB 3UTSE 1FLTX 3B9DA 1ZVYA 4U6YB 4G8EB 3E8UH 4GH7B 2P8PA 3O2VH 5IW6A 1I1YA 4Z0XA 3K4DA 3T65A 1SMOA 5I76B 1D5BB 4NQVA 4WTXA 3KXFD 1JK8B 2P44B 2BFVL 3VH8B 4HEPG 2VDRL 3BXNB 5GGQL 4KDVA 2YRLA 5A2LH 3HNSL 5EOCJ 4QHKI 5JIPA 4KKNA 4JFDB 3SE9L 3K2MC 3QAZC 5C0BD 4PB9L 5CAYB 5J3HD 4YAQA 1P9MA 5I73B 2VUOA 3QQ3B 2X40A 5JOEA 4NQEB 2IEPA 1TETH 3P9LB 4ODWB 1CFQB 3D0LA 4IIQC 5EBWB 4ZFOA 2VXSH 1BJ1H 4EUPG 5F88B 3O9WB 2DQHL 2VLJE 4A6YA 4XVUC 3L9RA 3VCLA 3O3BA 3QUKA 2QTEA 4JHWH 4HAFA 1JE6A 4RFOH 4XNQA 1RK1A 4NQTA 1JTPA 4OGXL 5FCUL 2ERJB 5K93A 3MRIA 4M9OA 4C83A 4RMUA 1YEIL 1AGFA 3ARBB 1G1CA 3QIWC 5BRZD 1HK6A 1DE4B 4XNYL 4RAVB 3RP1A 5KG9B 4LDEB 4DUXA 1M4KA 2V5SA 4JJ5B 5SWSE 2YN5A 5IR1B 1EGJH 4MX7B 1CVRA 4LLWB 3L3KB 3FKUS 3BZEB 5DRXA 3K2UL 4JPVL 4JANA 3CPLB 4JY6B 5T3XL 3JVGC 1ZVHA 3QI9A 3S88H 3LN5A 4OZIE 2AJXH 3G08A 4QXUH 4WNQB 3MV8E 4WO4A 1DJSA 2CK0L 2BMKB 1T22A 2JK5A 1XF1A 2OZ4H 4LVNB 5KSVA 1ONQA 2K3TA 3HMXA 4HG4J 4L8DB 4GO6B 3JTTB 4J6RH 2Y5TA 5I73C 5HHXL 1JGEB 1DCLA 3BPCA 3LSOA 3UYOD 3S9DB 3AC0A 4X4YA 1GCFA 4OUUB 1SBSL 5ID0B 2IBGA 1T66D 5DHVA 4ZTOL 3MRLB 3T4AB 4OQTH 4OZGE 3U0PB 4IRJB 5C9JA 3B43A 4LCWB 1VFOA 3FOMA 3F12B 2CDGA 5CD5D 4XMLH 5E2TH 5K59F 3MV01 1AP2A 4ZO6A 3Q2CA 1H3GA 5JW5A 3V79C 4B0MM 2GTZB 2A9NL 5D7JC 1JL8A 1MHEB 1CDGA 1MI5A 2JF1A 4PJIF 1S5HB 3B4NA 4YZFF 3DGGB 4Z7UF 5B3JF 4FP8H 3PP3H 5IHLB 2X1QA 1OP3H 5H35A 3W2DL 1G1YA 4TULL 1JMXA 5I75C 4RISL 3U4AA 2MWCA 4S2SB 4GQ9L 2EE2A 4IS6B 5IGXH 3UTSA 3B83A 2Z31C 3FB5B 1BLNA 5CEZH 2XN9E 1S8DB 2ADFH 1IGYB 2DOCA 3KR3L 4X7TB 1I3RB 2QQQA 2HFGL 4OKVA 5FYLE 4OCRL 2NXYB 4XNZC 4NGHH 8FABB 2Z4QB 2VIRA 1I8KB 2IANE 4V2CB 4XX1G 4LSVH 1RMFH 3ZTNH 4JREB 4HUXA 1IC1A 3GB7B 1AR1C 1QLEL 4BZ1L 4FQXC 4TUJA 4NO0A 2R4RL 4S1SL 3LKRB 1N8ZA 4XC1H 4WHTB 5ISZA 1XGQA 3DX9B 5HSFA 2XRAL 5I1EL 3EYSL 3V95A 1UM5H 4Y2DA 2EDQA 4DK3A 3DHJA 5D1XC 4F7TA 3AFLA 3H7BB 4JFOB 4X80L 5E1AA 5L88L 4I8DA 2E5EA 2C7UB 4OCSH 1Y6MR 1KGCE 3FN3A 4HIIB 5IQ9A 2D4DA 1J8HA 2X4UA 1LO0H 3GSXA 1F4YH 4ZAKD 3FQNB 3B9AA 3L5JA 4X9FA 3TP4A 3GK8H 3BPLC 4POUB 5E56A 5I18L 1DQLH 1OY3B 4ALAL 5I8EB 4L4JA 5FGCB 5D96B 4PGEA 2YEZB 3MJ7A 4KVCL 4AG4H 2KPNA 1G9MC 2C3VA 4N0YL 3VGAC 2PKDA 4WWKA 4XVTH 1NC2B 1UWEL 4OFIA 4X6FA 2DWEB 1HQRA 3TPKA 2EDXA 1GHFH 3DVIA 5EULV 1A9EA 3P4LA 3ARBA 1P53A 4D94A 3ZKXB 1KC5L 1N6UA 3GSXB 3KPPB 3UCRA 3OAUL 4LLMA 4LSUH 2Y07H 3T8XA 4PJ8D 2F54B 2Z93B 4FQLL 4FMKA 1OP5H 5D93B 4KKCC 1NMAH 2ED8A 3QDMB 4O00A 4XNYH 2Y36H 4NNYA 4YDLB 1H8NA 1HEZA 4JRWA 1ZMYA 1OSPL 3IKCA 1R0AH 3KG5A 1OGAE 3OF6D 2A6KB 1A3LL 1KNOA 1RZ7L 4XC3H 4V1DE 4YFLF 1X5IA 1K9TA 4QRPD 2XWJA 2C3GA 1EXUA 4EVNB 4DFHA 5C08E 5EO0A 4U6XA 1MCCA 3Q48A 2NY6D 3QNXB 2CLVA 1B0GA 3B9KA 4WUUD 1IKFL 4WU5A 1A7QL 3W9DA 4XI5D 4OLWH 4EI6B 1EO8L 4XCEA 5EUKB 2B1HH 2YD8A 4H88L 4Y8DC 3VFVA 1CFTB 2FHCA 1JPGA 1RD6A 1IEHA 1JWSB 5D96C 3GRWL 1I1AD 1PKQA 5GZND 5B39G 4MNHA 3WKNA 2VMFA 1PVHA 1K4CA 4NJ9L 2F15A 1YNTA 4P23B 5DS8A 1ND0B 2NY5C 1OPGL 2O5XH 1H8SA 4YC2C 5HDOA 5C0CB 1LNUB 3BIKB 3RI5K 4HUVA 5I1GH 1PX4A 4F57L 2RQ8A 1P6AB 5DUMH 2HAZA 1X5HA 3PDOA 1TJHH 1JUFA 2WIIB 4OF5A 2GTZA 5I9QB 1DFBL 3UJIH 3FAWA 3LIZL 5DF0A 4FTVE 3OR6A 1OSZB 4P2QA 2GAZA 3UZQA 3FCTB 5ADOH 4XCYA 2ZCKH 3RUGF 3ARDC 4OZFA 5FUOH 1NAMB 1RJCA 4LCCA 4OB5L 3U82B 1XH3B 1J8HE 4O2EB 4ODUA 4XP9H 5HVHB 2HG5A 3H3KA 1UZ6E 4JM2A 4JPIA 4G3YL 2XFXA 5I1KH 2XV6B 4I13B 5CGYD 2B39A 3MRFB 1KCUH 4PGZA 4X4XB 1FE8L 1CDCA 3HMWH 5F93C 4NQSB 4FXGB 4GKOA 4WWID 5HYSB 1WFTA 1FFPA 4Y4KC 2XQYK 3ROLA 2CRMA 4KTDH 5JXAL 1DQQB 4Y5YA 1A0QL 3CLFH 3DIFB 5FO7A 3GSRA 4LRIA 1RUQL 1RIVH 2IBBA 4ELKA 3I6GB 4HKBB 4NSKB 5D72L 1D6EB 4LCIH 2ESVE 2YMXH 1EEYA 4JO4L 4DKEL 3BE1L 1PY9A 1MOEA 5IEKA 5F7EH 2DLFH 4JE4B 3HZVA 4Z77A 1Q0YH 3OKEA 5BVJA 1NCCL 4M9PA 3UO1H 2EIZA 5ANMB 1G7IB 4M61B 1FZMA 1RZ8B 4TVPD 1FN4A 4U6VH 1NH6A 3BZ4B 5ETUB 1EVTC 2UWEE 1U8MB 1S9VB 4W6XB 1DFBH 1F6AB 5E03A 3D3VB 4XC3L 3RQ3A 5L0QB 2CIIA 1A3LH 1WWCA 2NY2D 2VL5A 3Q1SH 4ZFOB 3O6FC 4LVHB 4HWUA 3UZVB 1J0IA 2BOBA 5C71A 3LRSA 1U8JB 1G7HA 3MRCA 5D2NB 3ULUH 4OD1L 5HHXH 1MRFL 1FYTB 4PLOB 2BERA 2K9UA 3U7WH 3WYRA 2V9TA 5IG7B 4U3HA 1NANI 5F89A 2WP3O 3UXFA 4KTYA 4KZEL 1NUGA 3KJ6H 3RFZC 1J9CT 2FSEB 3ZDXE 3BP6A 4XMPL 2LV4A 1EHNA 1I8LA 4MMXC 3F7QA 5KS9A 1K3IA 4D0BB 4NO5B 4HUMB 1T0MB 4TQEH 4PRIA 3MRMA 4JM2D 3G5XA 4JDTH 3HB3D 4MJ2A 3SKOA 2WWKT 3K46A 3SDYL 5D1QC 1KG0A 4QY8B 1D9KB 1U8QB 3DV6B 3OKOB 2JIXD 4XAWL 3PL6C 4LSDA 4JRXB 4RFNB 3L3JB 3RJDA 1OGTA 3BPNC 4WU5B 4PJ5A 1NGQH 2BRRH 4QNPF 5KS9F 4UB0L 2BK8A 4ZD3H 2LE9A 1TZIB 4GAYB 1YYML 2D7NA 3ROOB 4JHWL 3W11C 3CZJA 1T2QH 3GJFH 4MDJA 5H8DA 3U4BH 5BV7H 4EI5B 5C0BB 1IGYA 3RWIB 3IVKB 1RIHL 3NZHH 4RSVA 4TRPH 4OGAD 2DDQL 2OS7A 4MA8L 3H9YA 1IM9B 2LU4A 4NQED 2ZKHL 4P2OD 5EO1A 1OM3L 4M93B 4F7MA 3LZFH 3N9GL 3QFDA 4KKAC 4LEOA 4FNLL 2FWOB 4L8CA 3BMVA 4X4YB 3G5ZB 3H3BC 4Y7MA 5FA4B 5JXEA 4HS6B 1B4RA 3ZTNL 3B8YA 1N5YH 1QA9B 5B22A 4MHHI 1F3JB 2B4CL 1DN2A 3ULUL 4PRHB 5IKCA 1A1NB 1RPQA 3CNKA 3S34H 5D2LA 2X89D 3WEXB 5HI4D 1QPPA 1BOYA 3NCFB 2EE9A 2YD4A 1NMCB 1J05B 3MCLL 3GSWA 3WL9B 2DM3A 1QSED 1NFDE 3K1KC 2A74B 1ZLVH 3SKNA 4KK8C 3UYRL 1E4KA 3EO9H 3JV0A 5B8CB 2AEIT 2VSCA 4KGLA 4GAGH 2QHRL 2KKQA 4KJPC 3VXRE 1TVDA 3O41A 4RMSA 2HKFL 4K07A 4NGHL 5GZOD 2XWBB 4YE4L 5GGRY 1BD2D 4N5ED 3W0WE 1HKFA 1GGYA 4K71B 2ATPB 3F7RA 1MCJA 4WW2F 3X12A 3PABA 2UYLB 2OTUA 3MX0A 4J3UA 4PUBH 1IT9H 2W9DL 2NY7L 4FQJH 1T1XB 4N0UB 5H94A 2DQUH 5A16A 3CVIH 3WDJA 1OOAA 4HS8H 1ZT7A 4Z0BL 4OV5B 3OR6B 2JB5H 2LVCA 5DA0B 1P2CB 1QSFA 4L4TD 1ORQB 1G7QA 5D7JD 5B38A 1JFQH 4S1DC 2KL6A 3LZFL 1F6AA 4NWTL 5I15L 3C60D 5SWZE 1YEGL 2MKLC 4UBDC 5K9OA 5EZIH 2C4XA 4CNIA 1II4E 5DHYA 2BNUB 1J8HB 2CPCA 2ZUQC 2I9TB 1XGPB 3JV5A 1FFRA 1E4WH 5J89A 2YK1H 4WI3A 4PJDB 3MOAL 1W0WB 1RZKC 2XXCB 3SE3A 1FBIL 2ZOKA 2V2WA 1MELA 3H9HB 3BQUD 4KXZI 4FXKA 1QRNB 4UOW1 1TVHA 2BXZA 1CDIA 5JO5B 4EN3D 5F1NA 2OJEA 3KPOA 5ALBH 1LDPL 3KYMA 1LD9A 2EH7L 1A1OB 4LAQH 1I8KA 4J12A 5KBNC 1JPSH 1Z9LA 2NY6B 1WTGT 4G9FD 3LKQB 4BK4A 3VXOB 5E8NA 3IFNH 4QXTA 5IVXF 4DWHA 1U8KA 4F7EB 3HAEA 2ZKHH 3GHEL 4XVJH 3P30L 2V2XB 4F3FA 4GS7C 2BVPB 4ZSOA 4M3JA 1NAKH 2DQFA 4ELMA 3BIKA 5CIPH 4LDLB 1T3FA 3VFNB 2WNGA 3TNNA 3DI3B 4L8BB 3O3EB 2V17L 2NW3B 4X8JB 2IGFL 1GC1C 3WN5A 2Z91A 5C0JA 3SDCD 3QHFL 2R2HA 3C60A 1Q9OB 4LCCB 4L1DA 1BVKB 3FRPA 1VEMA 4UNUA 2MQ0A 3IRPX 3AGVA 4P49A 3MPCA 4LPWA 2Z35B 3QUMH 3RVTD 4MAUH 4X7CC 4XWOD 2IQAA 5FYLL 1AP2B 3W9DB 2IH3A 1HE7A 2DRUA 3QCTH 1N7ML 5C0CA 4R4BA 1CF8L 1BVLB 2FEEL 5GGUB 5GZNC 3EOTH 4ZQKA 5IQ7L 1RUKL 5E6YA 4PFEA 2OL3H 5T1DL 1Y6KR 1FNSH 1Z0MA 2D7QA 3CU7A 3MRNB 3N85L 1N5AA 5DD6B 2BNRB 4W4OA 4J4PA 2MHAA 3D2UA 1KLUB 1EERB 2M1KA 1G7JB 2F54E 5E95B 3W9EA 5HHQA 3RWFA 4UTAH 3CDGB 3ZDYE 4BH7B 3NABH 1YQ2A 2A6DA 3PV6B 3SGDH 1NJ9A 2NY3B 3V8OA 3O9WA 4GS7B 1JF1A 1ZS8B 4OQ1A 3MNVA 1JPTH 2CO6B 4PUBL 3BKYL 4L3EA 4WI2A 1RUML 2VLKE 2GQHA 2FIKA 4ZXBC 3SOBL 1OB1B 5DK3A 3PGFH 1QR1A 3HC4L 2YRZA 4NFDA 3G6JB 1KUMA 4HXAL 1NBVL 5SV3A 4DN4H 3E3QC 4JJ5A 4YZFE 3VXNB 3LRHA 3GMLB 4YDKH 1RHHA 3BUYB 2V5MA 2K7QA 3BWAB 1N0XH 4JQIH 3SDAB 1OTUC 1Q72L 4RZCA 1W0VA 1ZT1A 3X14B 1PYWA 1NAML 5CP3A 1QO3A 4LEXL 3Q5OA 1HSBB 4KDWA 1KYOK 3L3HB 5I8CB 2A6DB 3TPUB 3ZO0A 4G6JH 1HSAB 4QRRE 1T1WA 5KSAB 4HWZA 4BH8A 2UZXB 3V9FA 3OJDA 4QXGL 1NLBL 1WVZA 3MJ9H 1E4JA 1U3HC 4LCUA 1IT9L 1JWUB 5E6ID 4ELME 4ZTOH 3CMOH 4HLZG 5DT1H 4NFBA 4B7IA 1U93A 4X6DE 4P3CH 4XCYB 1JRHI 2GYSA 2NY5L 1SJEB 5J9PA 2OI9C 4W6YB 2PO6B 2B7DT 4OKVB 5BO1L 3QDGA 3UYPA 2X9XA 5DD5H 1J88A 1KJMB 1QQDA 5AWNL 3RL2A 1A2YB 5IFAH 1DSFL 3PQYA 1JZ4A 1W72B 4WENB 4U1HA 3PWPE 1N59B 3AREA 4LCUB 4BKLB 1GC1H 4JRXD 4JO3H 5EDXA 1AKJD 4Y2DB 3ORJA 4G8FB 5EC1B 3H42H 4AQ1B 4DCQA 1UGNA 1IM9A 3V6OC 4QOKB 1Q0XH 5CINL 1BAFL 5A2FA 1F3DJ 1TZHB 4O2EA 3I02A 1EPFA 1K4CB 1YYLL 5T1KD 1INQB 4QXTB 4D0BA 3QO0A 5AG8A 1M6OB 3H9SD 1M7DA 2BVQB 1FFOA 1B0GB 3QQ4A 1U3JA 1HYSD 5KSBA 1QSFE 3PWNA 4Z7QF 4M1GH 2XWJB 4HMDA 3P3YA 4YJZL 5EZOL 3BX7C 3VMOA 3CXHJ 1RHHB 3RZWA 5EO0B 1I75A 2UUDK 4NM8L 4KGJA 4YDJB 4WRLA 4P59L 4HUUA 4NHUA 3V0VA 2BSRA 1A6VL 1MCDA 3RVVC 3OF6A 5EWIH 5D1QB 4HWZB 5ESVA 5DSCA 5EOCH 3OHXA 4FXLA 1D9KC 2BP3A 2DQIL 2OI9B 1YYMH 1IGJB 4F58L 1X6NA 3HC0B 3QUZB 3FMGL 5TDPB 4NZTL 5ANMA 5I18H 4Q9BA 3MNWB 1L4IA 3G6AA 4HF5L 4TUOB 5CEYB 1F4YL 3VXUB 3ET9F 2QQKH 4XB8A 3RWCB 5IMLB 4YX2H 4PTUB 1C1EH 3W81A 5A16B 1BX2B 3Q6GL 4ZODA 1M7IB 4I18B 4M00A 4RWYH 5B3JE 1C7TA 3C08L 3T0VA 1CBVH 3WFCL 4HFUL 2RIKA 4PRHA 3R1GH 1XR8B 3NCJH 3PXJA 2R0KL 2VDNL 4XP1L 1KT2A 1Z5LB 1HXYB 3EAKA 4LBEA 3DX8B 4XCCH 1Q94B 2EXYC 3L7EB 5GGQH 5JOFB 4K8RD 2D7MA 1NMCC 3MLTA 1YNLH 1EEQA 4HQQL 1LVEA 1L9MA 3LV3B 5HYJB 1B4JL 2GI7A 3C5JA 3O3DB 4NBZB 2E9IA 2EDFA 4ETYA 3N1QC 5C3LD 4JFEE 4H1LG 3O4LA 1FC1A 1NAMA 5IEHB 4QKXB 3QNZA 1MCPH 2GHWB 4M8VA 5F21B 5B8CC 1M7XA 1HNGA 4PJAA 1RZKH 4I4WA 4RWHA 3WNPA 1HHJB 1MLBB 3SDDD 5ALCL 3PJSB 3BP5A 4RA3A 4FQQA 3KPOB 5IT2H 2P8LB 1KELL 3JWOL 4LEXH 4Q2ZB 5MEPB 4AM0A 1UC6A 1ZE3C 1NCBL 1L0YA 4MWFA 2RFXB 3P0YH 3EFFA 3SHSA 5FA4A 1QPXA 4K71C 5JO5A 5T5FH 3ULUD 4U6YA 1EHAA 5KZCD 5DC0A 2EDEA 3KWWA 2BVUA 4HS8L 4UT7H 1EV2E 3RUGB 3BPOB 4G6KL 3VFMA 5DS8B 2AI0L 2VLJA 4FQ2H 3T4YA 4LHJB 4PJFA 5IM7B 5K9OB 4P46D 4OQTL 3HZKA 1TJHL 12E8H 3D1MC 3TBYA 1ES0A 1MI5D 4M1DL 3CFBA 3VFTB 5JUEH 2JCCF 4LNRA 5I16A 2XYCA 1CLYL 3CX2A 3SGKA 3ZL4L 2BHUA 5DZNA 1UVQB 2VAAB 3MRDA 4F33A 3CFIC 5FDWB 4YK4B 5BW7A 4XP9L 3LS4H 1T80A 1X5LA 1TLKA 3GI8L 5DHVH 1X5JA 4I9WD 5EZLA 3ZT7A 5CJOH 3ALPA 2ESVD 4MNQE 4DW2L 5HHOE 3QO1B 3SKUD 5JORA 1WF5A 5CIPA 1Z9SA 2VKWA 1P84J 5JW4M 4S0SD 5ILTH 1U8MA 2XPGA 5IMOA 3UPCA 2X41A 1MVUB 1UWXH 1VGEH 5D6DA 1EEUA 5LWYL 3LB6C 3BP7B 4OLXH 3D0VB 1A7NL 2B0SH 5D5MB 1TZGH 1MFDH 5E99H 4ENED 1MFAH 3O6MH 2VABB 2VDNH 1NFDF 2VDKL 5KAQF 4LHUD 3WE6A 4LSPH 4JDVA 4WY7L 1WSST 2ATPA 3OAUH 2YZ1A 3WS6A 1W72H 3WSQH 3VXMA 3MJ8B 2XICA 4CU7A 4U33A 3QO1A 1XCQB 2DKMA 4L8DA 4NN7B 2OXGA 4MQXC 2LTQC 4LSRL 4ODVH 2AEPH 5L8KB 1AO7E 4NQCA 1Q9KA 3NTCH 4U1JA 3MV8A 3SGJA 1HIML 3EYVB 4TTGA 5JIHA 3PGCB 4DVBA 4L4TA 3VFUB 5EO9B 4WTZA 2MSPA 1W8OA 4XGZB 4X6DF 1R0AL 1FN4B 2PXYA 1ZA3A 6FABH 5FGBC 2ILLA 5IK3B 1QEWB 5F9WC 3V7AE 1AC0A 3SPVB 3LKOB 1MCEA 4NP4L 2X4QB 4TSCH 2NZ9C 3EFDL 2P5EB 5ID1B 5TPWL 2Y07L 4P2QE 5ABDE 2C4FT 2VN4A 4D9LL 1NL0H 5J1AA 1MCFA 2C1OB 1UXSA 2EKJA 1A3QA 1GOGA 1X3DA 1J8KA 4E5XA 2NLJA 1ACZA 3LCYA 4HWBL 2YHGA 4L8BA 3NIDE 2IWGA 3MLZH 4PJCE 3NCMA 4P3WA 3A0OA 1JTOA 4MB4A 1FSKB 3IDGB 4PBVC 1CQYA 1E27A 2NY2C 4HS6A 1MIEH 1WAAE 3HAEB 4PRHE 4ZXBB 5LWYH 1T0MA 4DKAA 4DTGL 4M1DH 3QDGB 2MFNA 5J11C 12E8L 4MJ5A 5ACLA 1DQDL 2W92A 1T5WB 3QWOB 1YDPA 1DBAL 3GMNB 4ZFZA 3WIIH 2EYSA 4YXKL 1AI1H 3A6OA 3MJ9L 3UDWA 7FABL 1I7RB 2JCCB 3ZKMD 3MRGA 3F5WB 4R7DB 4HT1H 1MHHB 1IAIM 5BVPL 4Z7VB 4PG9A 2CO7B 3MRLA 3T4AA 3QG6B 3CGTA 3U30C 5JHDE 1RIUH 2CDGB 2WUCL 1A14H 2E7HA 4HIEA 2OJZH 4JO2H 5F8QC 4KUCF 3TV3H 3UTOA 1XGUB 3SN6N 5IB5B 4NRXB 2VJXA 3KPQA 2DM7A 4YHYB 3WD5H 4M1CC 3AY4A 4M4RA 2AEQH 4PREB 2GEEA 1DBAH 4GXVH 3NZ8A 3B6SA 5J8OA 2DB8A 1C5BH 2YZ8A 3ZE2F 2CLVB 4WDIB 4HV8A 4OSUH 2C3VB 3TLRA 5CZXD 4JY4A 5IB3B 5GS0L 3JWDL 4JVWA 3QJHB 2H32B 3S7GA 3N0PB 4F37K 2NY2B 5IEHA 3E2HC 2IC2A 3QUYD 3LN4B 1NJ9B 2VSDA 1WICA 4JRYA 5K9JH 3JV4A 3HUJB 2F58H 4P5TB 1J1XH 2H3NB 4RGNE 4MA8H 1UA6H 5IV2B 4ZOAA 4ELKB 4LLDB 4NKOB 3MV7B 1GAFH 5LBSH 5I30H 3IDMA 4X0KA 1QD0A 2PUQT 3HUJE 3EFDH 5C0EA 3FHAA 3U7YL 2ZSWA 4Y4KB 4P9ML 4P4RA 1MH5A 3DTXB 3DXAE 5TF1H 2OQJB 4HGWA 2R2EA 4JFOA 1U2HA 4JKPL 1N6QH 4NNXB 2VERN 4QRTA 3QQ9C 4JPIB 4F58H 3FB8A 3QXVA 2IH3B 4F3FB 4OGXH 5DUPL 1CWVA 1QHOA 4JM4H 3ARUA 4PJBA 3DMMB 4WVRA 1CICB 5GHWH 5LAXA 5GRUH 2HJLA 1F3RB 1TTGA 2F74B 3TN0D 5JDSA 1U8HA 4OGZA 2B5IB 1XGRA 2NW3A 4F8TA 4P4KD 1KV3A 1V5JA 3HC0A 3GHEH 3MYJA 4XVJL 4X99A 1HOCA 1YNTB 5D7IE 1UG9A 3VA6A 4NQVB 3CSPA 3KYOB 3NA9L 1U8OB 4G9FE 2YN3A 1NGQL 3X13A 25C8L 4K23L 1LGVA 4NT6B 5L0QC 1N6QL 4HIJB 4G6FD 1K8IB 2PTUA 4K3DH 4YIQA 3CCHA 3GSNA 2Q6WB 1J0ZA 4P5KA 5DMJB 1HYSC 2JJTA 1MIMH 1U6AH 1YPZA 4DGIH 4YO0B 5EC2B 1FFNA 1PYWB 2BY2A 2H2SD 5FECA 4WHCA 1Y18B 3DO3A 3LS5H 4X7EC 4Y19A 1L6XA 3EYUL 3DPBA 4OCNC 4TQEL 4LCWA 2CKBB 1ES0B 5CJXA 1D9KA 1EK3A 1R3KA 1JN6B 4XRCB 4OF3A 1DLHB 2AW2A 2OSLB 4Y4FD 3C5ZC 3X13B 1AE6L 3L7EA 3H7LA 5DJDA 1VADB 4YIQB 5C70A 3MRJA 1JF1B 1MI5B 1EO7A 1ZS8A 4X8XA 3KPNB 4NQCB 1UB6B 2CXGA 4YPJA 2IAMB 2J5LC 4BQ9A 4XBEH 5HHQB 5JHDD 3ZKNC 2X05A 3ALXA 3VXQB 1X5YA 5I71B 5KANI 4L3CB 1KJ3L 4NUJA 1KTKE 3EDKA 1GIGL 3FB6B 3KPLB 4FTVD 5M95B 1SJEA 5J9PB 5FM8A 1AGBB 1P84K 2DI9A 4TULH 5E5MB 4QHUB 4UT7L 1A6WH 5F7MC 1XCTA 5EU3B 4GLRI 4N9GB 1K8DA 4MQSB 4DGYH 3TV3L 5JTWA 1HZHH 1AO7A 5IFAL 4HKXB 4RDQF 4CKVX 4PRHD 4LU5L 1E4XL 1AGEA 2GJZA 1BJ1J 5EU7C 3U79A 1B9ZA 3RI5F 2QKIB 1GSMA 3GJFB 3ZL4H 2F8OA 4YLQT 4URTB 3W9EB 3UC0H 3O2DA 2BY0A 4A6YB 4U0QB 3C6LA 2FJFA 1R5IB 2IF7A 2WBJA 4A2LA 1CFBA 3HG1E 4KI5E 4MJIE 3STLA 3V6OE 3W11D 2QJDA 3PIQA 1F58L 1AGCB 4KRPD 1X5XA 4D9RD 3WO4B 1K4DA 4XWGL 4N9GA 1LO2L 1E0OB 4XNMB 3PGDB 1NLBH 2E7LC 2H8PA 4RBPH 3RIFF 2ZOLA 1UACL 3GMRA 1GXEA 4I0KA 5HGAB 1RJYA 2AJYH 1QLRA 1WGOA 5GJTL 5C8JB 4MCZB 1CR9L 1D3CA 3MCKA 4PJ5E 1NDGB 3EDFA 4HC1H 2AJSH 4P2OC 4PJIE 3P0GB 2C9AA 7FABH 3OKYA 3BD5A 1B0RB 1U58B 4Q6IB 4LPTA 5KZCB 3D5OF 3T09A 1JGUH 4JN2A 1EFXB 4Y1AD 1UH4A 4JO1H 3PWJA 2DWDA 2NY4D 1DL7H 3E6HA 5CLTA 1I8LC 5IMMB 4LSSL 4XPFH 5GS2D 4M6NH 2XZQL 2GK0B 1LE9B 4P9HC 4U6HA 4DVRL 2ATKB 3CFDB 2Y36L 4BFBD 1MCWM 3EBAA 4A6YH 5TJWK 3JXAA 1HIMH 2IG2L 3N06B 2NYYD 3QNZB 4XVSL 1P69B 2A77H 2XN9A 4OZGB 1AH1A 1G7LA 3QUYC 1X4YA 4WTZG 2A83B 4NC1E 1KPRB 1NSNL 1A4JA 4PRAB 3IRZA 5JXEC 4Y5XB 1DEEA 4JN2B 2Q8BL 4CDHA 4NC2B 1BIIB 1XF4A 4PB0H 1IVLA 1WBZA 3I6KA 5IJKC 3REWB 1WCQA 3EJZC 5KS9B 4DGIL 2CUHA 2XIDA 1NQBA 5F9WB 4JHAL 4YHZH 4YBQD 4G9FB 5DO2C 2VXQH 5IUSA 2UWEA 2IMNA 4BFIA 2EH8L 3IF1B 2J8UE 5LGJB 3BVNA 4RNRA 5EA0H 1N64L 2AJVL 1XIWA 4NM4H 2A1WH 4PJAB 3V52H 2CLZA 5INCB 1AIFB 2PW2A 1E4WL 5TFSH 3T77B 1T1YB 5GGRB 3LEVH 3AU1B 1CR9H 2VZTA 4TOYH 1JPST 1MVUA 4J23A 4K7PL 5CJXC 2DYPB 1IEAB 4S1SH 3IFPB 1NCCH 3F7VA 2ZG3A 1HEZB 4MQTB 3WUWB 2ZPKH 1NC2D 5F7YC 3GUTB 4NNPH 5C0NC 4UUJA 4NRYA 2OTPA 3QUKB 5ETUA 4NPYB 4CN4A 4DKEH 3O8XC 2IPTL 5D1QA 2DQUL 2XKNB 2ADFL 3OXSB 1EJ6A 4X9BA 1SM3L 4RFEA 5HDQL 3E3QE 4WFGE 5H37G 1OAZH 3VMNA 3QQ3A 5CEXB 4U2ZA 4P5TD 2RAMA 3BEWB 3BIAX 3PE9A 3VGDA 1T5XB 2XQBL 1KPVA 4ODSH 4B5EA 1QSEE 5IHUH 5F1IA 1H8OA 4MS8D 1WC7B 2EDHA 5I8EA 1XF2B 4U1LA 1UH3A 2J4WH 3MNZB 5EBMB 4MYWB 3BMWA 4HPYL 3QH3A 3U4EB 4UILL 1IBGL 4WEUD 4J4PD 3T0EA 1BWWA 4BZ1H 1WISA 4NRZA 2R2HB 3C60B 3ZKSD 1HXMB 2DLFL 2VLLA 3DETC 3P40A 2L7JA 4YBHA 3GIZH 2F53E 2PW1B 5DVNA 5IFJB 1MAKA 1VEOA 4FQPA 1NBVH 5I1DB 4YWGH 4NO0B 2N7AA 1QBLL 3IS0X 3VDBA 3HI1B 3S3PA 1J18A 3HMXL 2A0LC 4P9HH 1PKQE 3AROA 5GGUA 1XFPA 2KH2B 4E41E 5HI4C 5DJAA 4QHMB 5LGKA 4TUKL 4LOUD 4G8GD 4BUHA 4ZUTA 3OKDB 4J8RA 1FL5A 3HI6L 1MHHA 3T65B 1IEBA 5J3HC 5B4MC 2N7BA 1CLZL 1Y0LB 2ITCA 1KIUA 3VH8A 1IGCH 4K7PH 2WQRA 4HPOL 4ONHA 3I9GL 3OGCA 1T5WA 5JPNA 3DSFL 5FUCC 2XWTA 2P8PB 4NQUA 2Z91B 1FAKT 3EYUH 2ADJB 5DMGC 2Y7QA 4YHNB 3BGFB 4EI6A 5F7FA 2DQTL 4X6CF 4ZPVB 3ARGD 3HB3C 3TJHD 1JPGB 4PG9B 3ULSB 1RVFL 2XA3A 3LHPL 4G8GA 1U8HB 4KAQH 3SDCB 1LO5B 4J8RB 4Q7DA 4O51A 6FABL 2HFEB 1JGVH 2BC4A 5EN2B 3MLRH 2Q8AL 4ZFOL 1CICC 1KPVB 4K8RC 3ECBB 4XXDA 1AE6H 1XF2A 1ZGLA 3MOBL 4LLUB 2GJ6D 3HZYB 1XF5B 3GMMA 5F1NB 4KHTH 4XP4L 4Z7UB 1C08A 3RWHA 1ZHNB 5CD5C 5GXBB 5GGTL 4MXVE 4M43H 2HVKA 1V7NL 3D9AL 4KJYA 4NQCD 3O6KH 4JFZH 4Z7OE 3N1PC 2YUZA 1IC5H 1J12A 2CKBH 3QHZH 4AIZA 2Y06L 1FFPB 1CT8B 2P48B 4M1GL 3TYFA 1A6PA 4XCNB 3HE6C 3NIDF 1NC2A 4JRYE 3UTZB 4LASL 1MCRA 1QSEB 3LD8C 4I77L 4WO4B 4PRPE 4CVZA 4NQDE 1I7UA 3V0VB 1RZFL 1UH2A 1JWMA 3QA3B 2APFA 1EJOL 4PGDA 2C1PA 1FVDA 3BGFC 1CVSC 2VABA 3DIFA 2IPKB 2DQIH 4R3SB 1MFEL 3C9NB 1AXSA 4NQEA 4OQTA 5F6IC 3I6GA 1GH7A 1YY9C 2R56H 3BP7A 4R97C 3RBGA 3L3OB 5EUOF 1F45A 5I0ZA 2FATH 4HPOH 1I7ZA 3ZZ1A 4L3CA 3I02B 3IFNL 1UB6A 2HH0L 4GKSB 1JPSL 3ARVA 5TDNB 1OGAB 1TQCB 4NRXA 1FZKA 3RPIA 3T1FA 3U9PL 3ULSA 1E28B 1CD0A 2PCPA 5IOPA 4HUWB 3LQAC 5C2BL 1OAUH 1HHKB 4XNXH 1XIWD 3PHQB 2BOCA 3Q1SL 3QUXA 1KTDA 4WCYL 3CLFL 3VFWA 5ILTL 3P9MB 3Q5YA 1J0KA 5JHLL 2R0ZL 1AC6A 1N4XH 3VXUE 4HV8B 4QNPE 2X89A 4PJXA 1MJ7L 4LLYB 2BSRB 1F4WL 3X17A 4HSQA 3JWOC 4OZIB 4ONOA 3QFJE 3QG6A 1IAII 2X1OA 1ZLUK 2HRPL 5D2NC 5JW4Q 4FP8L 3HE6B 2JJSC 2DM4A 3QXDB 2FGZA 5A2KH 3P4OA 1I3VA 1YY9D 2DLIA 4MQXD 1T0NB 5DC4B 5DQDH 4PRBB 3UO1L 1BBJB 2YD7A 2QQNH 4APQD 3G5YB 5MP6H 2F19L 3S96B 1IQDB 1SY6L 5DJDB 3RX5A 3BQUB 3TVMA 4OCMC 1CD8A 5FKAA 3DX6A 4G8GE 4ONFL 1ADQL 5E2VH 1A4JB 4KROB 2WAHA 3EYFB 3NGBB 3ZTJH 1DBKH 4JDZB 4RMWA 1X7QB 1H15B 3MBED 1AKJA 2F53B 2AV7A 3PNWB 3NCYS 2F54A 4Q2ZA 2QADC 4EVNA 1KN2H 1NFIB 1JIBA 1CICA 2ITCB 3PP4L 4RGOH 4ZFZB 3DRTA 2AXFB 3CXDH 1HNFA 4RFNC 5T5FL 1WZKA 1CLOH 2FB4L 4OFVA 5MP6L 1WZ1H 3T4YB 2JJTC 5IVZA 4QT5B 4FTVB 1D6VL 5DFTA 3EO9L 1Z9OA 1Q38A 4LQFH 3P2TA 4G5ZL 1YMME 4HJ0C 3NFPB 2NY4C 3FO9A 1FYHB 4DZBA 2JK5B 3HKFA 3UMTA 2FCBA 1BZQK 1EHLL 5SWZD 5DQJB 4O2FB 3VWKC 4ZO7A 4I3SH 2W0LA 5EU5B 4L3AA 1HHJA 2COQA 2YUVA 4D3CH 2OYPA 3MJ7B 1MFNA 4JFQA 3FB8B 3MMEB 1BF2A 1FGNH 4KRNA 1MY5A 4XAWH 1I1FA 2DQEH 4GRMB 5KG9A 4JHAH 1CXFA 3UBXA 4LIQL 5BRZB 4KU1A 5E6IA 2DJUA 4NNPL 4KV5E 4GAJL 5IR1A 4OZ4B 2BNRD 2P42B 5DEFA 1BWMA 4CMHB 4PBXA 1YEHL 5F7NC 3BN3B 5HPMB 2VITA 1MFCL 4WHYH 3VRIA 3QDME 3F7YA 4YK4C 1AGCA 5KSUB 1AFVH 2L4OA 5TFSL 5DK0A 4XMPH 2M2DA 1NCWH 5FUCE 3TO2A 5JHDA 3BDYL 1XT5A 3AREC 3PWLA 5E7FA 4JM4L 3THML 5FYLH 3MRJB 2AJVH 4PB9H 1X7QA 4V1DB 2JELL 3G6JF 1A7NH 4FZ8L 4Y4FA 2CLZB 3S35L 5CZXC 1RURL 5D5ME 2EO1A 5ERWA 4HD9A 3QDHA 4P9MH 4PJ7F 5FCUH 3IAGC 4ZXBD 2I07A 3CLEH 4KK8D 4APQA 5M7QA 2WBJC 2ZNXA 5CJOL 4IRSB 3WDHA 2F54D 4PREA 1LK2A 2DN7A 5EU6D 5BMFH 3HCVA 4HHAA 5EOTA 3SJVB 3WFDH 3D2UD 4HG4K 2YWYA 2HJFA 5DURB 3L5WB 1FYTE 3RVWD 3GJEB 3P30H 2AK1L 4K9EL 4KHXH 4ERSL 3DBXA 5F3HA 1KXQE 3VFWB 2V7NA 5DD5L 3U6RB 1D9KD 4S0TD 5T1MB 2DLHA 2R0WL 2ZUQB 3Q3GA 1VFAB 3L95B 4K8RH 5DFVC 4OLUH 1U58A 1BQSA 4KPHH 3K3QA 5IVOA 1Q9LB 5FAAA 3RVUC 1DBJH 2JKXA 3ARSA 3HRPA 3E8UL 1KTLA 1NEZB 4G42A 4U0RC 2EYRB 4LNVA 4S10A 5SWSA 5GGSB 3T2NH 4MHHG 1JV5B 3V4UH 1FE8H 3HI1A 5I8OH 1YPZB 4X9GA 3TIEB 3ELAT 5ELIA 4NZUH 2OR9H 4WWKD 1SJVA 3QISA 1AKJB 4UDTB 1PBYA 4XGZA 1QOKA 1GOHA 1KG0B 1ULVA 2NXZB 3UTTD 1MJ8H 1OL0A 2XQYG 3RIAK 5IHUL 4JO4H 2WBJB 1RUPH 3P73A 1MHCB 1K6QH 3LH2L 4ZAKA 2X4TB 5L7XL 1EAPB 1ZSDA 4JM2C 4ORGA 3RTQC 2J8UF 1KOAA 5K9KB 3JWDC 1ZOXA 3CSYA 4EDXB 3IU4L 2G2RB 3M07A 4NYLB 3WN5C 1D5ZB 2DM2A 3U9UA 2DD8H 3WFBH 1W0VB 3PHOA 3FN0L 2Q7YA 1GYAA 3PL6D 4PJ7A 3VI3F 4KMTL 4LLYA 4J6RL 4CVZB 1GGTA 1J05A 5J4MA 1OARL 4F15B 4N8PA 2X1XR 2ZOKB 3O3UN 1JWMB 3U0PA 5F72S 2JB6A 1C5CL 4OFYD 3VGGA 4EUPA 3VD5A 3NZ8B 4K9EH 1HZHL 4LHUA 1S7UA 1ZGLM 3UTZA 4AIXA 4MAYD 1Q9KB 1K5NB 3NCYP 5ALCH 1A1NA 1WITA 4MJIA 2BHYA 1RZKL 3GBMH 1BD2A 4YHYC 3CLEL 1A1MA 3GUTA 4KUZH 4WO4D 5ESVB 2VLME 5ACZB 4L8CB 1K85A 2KZWA 2BRRL 4ORZC 2D4FA 3LN5B 2GJ6A 1X6LA 2DKUA 2VITB 3M8OH 1UCTA 1UKTA 3KYNB 3U0TA 3L7FA 3NMEA 4GKZB 4PGBA 4YHZL 4LLUA 4PRIE 3W0WB 4TSAH 3C8KB 1T1XA 2MJWA 1T0PB 4L9DA 5D7JB 1AIFA 2ENYA 2PW2B 5J57B 5DJ8B 2HH0H 5IMOB 3TBTA 5FOBB 1J10A 4HKZA 3QULA 2EKSA 3GKWH 2EIEA 2VLKB 1RZJH 3I6LD 5KW9L 4JZOA 1F13A 1HH9B 4U7KA 4L3EE 5I75B 4WW1A 4C59B 3D3VE 1CD9B 1Z2KA 1BZ7B 4QY8A 1UWGH 5FXCH 5B38G 4XVSH 3MXWL 4DZBB 5F9AC 1EJOH 2GCYA 4UB0H 5E6ZA 1BIIA 1XF4B 1CD1A 2VDLH 1QFWM 4OD1H 5GS1C 5KSAC 4PG2C 2ZSVA 4JM2F 3D6GA 5D8JH 4CVXA 1QRKA 2VDRH 5HYQB 4P99A 1YPZF 2YA0A 5IESH 5HHPB 1C5DB 2GAZB 1S7TA 4Z7WE 3O6KL 1CZ8H 1ORSB 1ZV5A 4J3WA 5D6CA 1WC7A 1G7MB 3LMJH 5ICZB 1BHGA 3IDXL 2V9QA 3VXOA 5HYFA 3MRBA 1TJGL 1LQSR 5IFJA 4HGKC 3H3PL 5IBLD 3CCHB 3GSNB 2KQMA 1UYWH 2NMSA 3DUUB 3KPSB 1I1YB 4Z0XB 1K4DB 1W0WA 4KVNL 1T7YA 1I3GH 4HUWA 4WU7B 4KVCH 3RDTB 2FB4H 3MCG1 4PLKC 1IAMA 3MZTA 1FG9C 2XKNA 1MFDL 3BHBA 4HIHB 4JZNA 4Z76A 1I4FA 2VKXA 1N2RB 1S78D 3GMOA 4WI8A 1HINL 1E4KC 4XPTL 5D1QD 4NRYB 4J3TA 4GG6F 2RB8A 3FB7B 4KY1H 1MVFA 3FTGA 3CMOL 3V5DA 5EUOA 4I5BB 4HS3A 1CS6A 3ILPA 3LEYH 5J6GA 4LSTH 5DJ8A 5DYOA 3VFRA 2AJUH 2IPKA 1NCNA 4JY5H 4JFDE 3CK0H 2VLKA 3WXWL 4AENB 5ESQB 3WE6B 1I1FB 5F89B 4XCFH 1GZPA 3V7AG 1WWWX 2OXHA 1DSFH 5FB8A 3MNVB 1T20B 3AS0A 4LP4A 3WFZA 4WFGD 4ZAKB 2XT1B 1T2XA 4PGCA 1NPUA 3WUWA 1V3KA 3QEQB 2J6EL 4LMQI 3BP4B 1QUNA 5EU6A 5JMOC 1TIUA 5E9DB 3GSQA 4U1NA 4MCYA 2VLLB 2FR4B 1KB5A 5DSCB 4H8WH 3MJGX 2YD9A 4U49A 4OM1H 1O5DT 3M17B 4GRLB 4AEHH 5TGBA 4RDQG 5IGXL 5BOZG 3HPLB 4EBQL 4JANB 3WIHH 3RVUD 4LHUB 5T3ZD 3VE0B 3EYQC 1IC4H 1DLHA 2IJ0C 2J7LA 2HTLD 3HMWL 3ECBA 1FG2A 3S35X 2HTKD 2UY6A 1OTTC 4O4YH 4PGDB 3NPSB 1LEGB 1YC7A 4BSWA 1OHQA 3FQXA 5SWSD 1JCKA 5IROC 5DMYA 3VXME 1EHXA 1IGTA 2OZ4L 4G9DA 5IEKB 2MQ3A 1M7DB 4HPYH 3DARA 5I1LB 1XGTB 3LKSB 1N0XL 4JQIL 5E9DA 1TNNA 2HMID 1KELH 1S3KL 1EEZB 4PJEA 5A2IH 4X5LA 5B21A 2P5WD 4OB5H 1NEZG 4DUVA 3NCBB 2MOVA 5CBEB 3LVEA 1X9QA 3MBXH 2ZCKL 1NL0L 5CWSB 4KKLD 1IGIH 4X6CA 5TPWH 5LCVH 2FYYB 4DKDC 1JHLH 4ETQA 3O2DL 3BJLA 3GKZA 1E27B 1SEQL 4KROD 4NKDA 1FDLL 1N8ZB 4ZUVB 1A2YA 2R1YB 2VDOL 3VXRA 1XGYH 4NZTH 1NKOA 4IEFB 4WFED 4ZFGH 1ZGLB 4G7VH 3RAJL 3CSYB 3W5NA 2UVFA 5IB2B 4ELMF 3TO4A 2NXYD 4PRPD 2MQCA 1LO3L 1ZEAL 1FNSL 4XMKH 2R29L 1A9BB 3Q6GH 5GGTH 5A43C 4MVBD 2OP4H 2FX8L 1A6VH 4K3EH 3VRLF 3FN9A 4Q58C 5AAWA 1G0XA 3IS1X 3VGHA 1YMMB 2PN5A 1VFBB 4AIOA 2W60A 4P2OB 5FYLD 1JGEA 2WWMD 3PIQB 2E3VA 1OAKL 2Y7QB 3BEVA 1FZKB 3RPIB 3T1FB 3HI5H 1OTUD 4L29A 4MA1C 4JFXA 1S7WB 1HSBA 2EH7H 2QL1A 1CN4A 2DLTA 2E9JA 2HJFB 4BH8B 3BPOC 3QUMB 3QH3B 4U3CA 3U4EA 4PRPB 4KK5D 5JNYB 4F2MB 4JZJA 2O5ZL 3HA0A 2R1WB 1A1OA 1R5VB 5LGHL 4RQQB 3O45A 3ZE0F 1LHZA 1UXWB 4BELD 4KRPC 2X10A 1DBBL 2UVEA 3HCVB 2BX5A 4HHAB 4OFDA 4PRNB 5B4MD 3SJVA 2H6PB 5C1MB 2CXKA 5ACMA 3MLTB 2D0FA 5AZEL 1U8JA 1BPVA 1MCHA 2W9LA 2NY1D 4JAMB 4FFVC 1TVBA 1I7TB 4GMSH 2NXZD 3EYSH 3KPRB 3D69A 1TJIL 1YN6B 1YEFL 4OBSA 4BH7A 1I9JL 3CSBA 2YD3A 4NKQB 1NLDH 2OTWB 5E2WH 4GG6E 3SE9H 3FT4B 1S5IL 2GITB 4X7FC 4XPFL 5E8EB 5GPRA 1IGJA 1LO2H 2F5AH 1ED3A 1U3HD 2EIZB 3CZFB 3UTQA 4KDTC 4KK9D 3L3DA 1LK3H 1PZ5A 4R9HA 1J0HA 2XACC 4JFHD 1WBXA 5FF6A 3REVA 4HCRH 1T20A 1XF3B 2AI0H 2ZOLB 1QSZA 1YJDC 1ITCA 5ICXB 4MA1B 3BRFA 2X70A 3MO1A 4G80A 4WDIA 3CFJB 4UTBH 3G9VA 5DJ6B 1E6JH 4HFWB 4XC1L 3VXPA 3ZYIA 5E8OB 4Z7WB 1LO5A 3BIBX 4Q6YA 1XR9A 5DQDL 1W2KT 1OT2A 1TNMA 2EICA 2Q3ZA 2X5PA 3GRWA 1QLFA 3D2UB 1DQTA 5TDPA 4JR9H 3BKMH 1QFWL 2BVQA 1S9YB 3IDIA 5I66A 1CL7L 4PJCA 1A6WL 3RWFB 2X4TA 1JHTA 5MERB 2J8UA 5I19H 1AXIB 2J88H 4OIAA 3FL7A 3IU4H 2XNAA 4QHLA 5CFHA 1U8OA 1CK0H 5EO1B 3WN5B 1MRCL 1UADC 1IRAY 4QWWC 3HG1D 4KI5D 1C08B 3RWHB 3SGEH 3SGDI 4W70A 3VFPA 3PHOB 4MZ2A 3P4MB 4HUUB 1DBKL 4Y19D 4UAOC 4Z6AT 5C0GB 5FHAH 5IF0A 3ARGB 4O5LH 4PJFF 4U4BA 5GGVH 2AK4B 2GT9A 1QFUL 4TVPL 1UJ3A 1UXSB 1AY1L 5D7LE 1NLDL 2QR0B 3TN0A 4UIMB 1IBGH 5HVGB 3VFMB 5DRNA 3T2OA 4JRXA 4AT6B 5HGBB 3NIGE 5IM7A 5F7DA 5LXGH 5JDJA 4K3JH 2HRPH 4PJ5B 2BJMH 4LL9A 3EO0A 2ICES 1YEEH 4LAJH 4GG8B 4LPUA 3BPCB 3LSOB 2RFXA 3LS5L 4RIRB 1D5XB 1CZ8L 1VADA 2ERJC 2V7NB 3OKKA 2IFFL 2DMKA 3I84A 3UPAA 4ODTH 3G5YA 5HDQH 3FFDB 3UTTB 4G7YH 4AMKH 5DTFB 5E9DE 5ECJE 1AXTL 5FKAB 3R06A 4GW4B 4IMKC 3GSUA 1RU9H 4WI6A 3DV4B 3TBTB 2ZG1A 4GRWF 4QRPA 3VD3A 5ICXA 2NX5E 1U8IB 3CFKB 4LRNL 5DC9B 1JVKA 5F7KC 3MXWH 5AZ2L 3C08H 4CMMA 1TJIH 4Q9RH 1YEJL 1KCSL 4RGNB 5HHOB 1Q94A 3BWUC 1PW3A 5IB4B 3WCYA 5BMFL 2VL5B 2DTML 2P5WA 2FBJH 4TUOA 3GSNH 4LVNC 3VH8G 3DRQB 1OP5K 1QO3B 4YDIL 2BVYA 2QHLA 3I3DA 4LHQB 2D31B 4HF5H 4PV8A 3RNKA 3VCLB 1OP9A 1CGTA 4P57B 3QSKB 5IB5A 1ZWIA 5CD3B 3RWCA 1GZPB 5DJYB 4Z5RB 3B2VL 3DWTA 3O41B 4ODWA 4PTUA 4MJ4A 2BNQD 2AV1B 5GGVY 5J1SC 2V17H 5EBLA 1FO0H 2AAVA 5HHNA 3S36L 3D9AH 1D5ZA 1ZLUH 1MWAB 4MD0B 5FCSH 5DK2A 1GOFA 3QEHB 4NUJB 4IRJD 1GC1L 4PJ7B 4U6VL 2ZUXA 5LGJA 5E2UL 3FTGB 2DQGH 4OCLC 1FCCA 4R26L 3TM6A 4L8SC 4XVUD 1NCDH 2PYEA 3NAAL 4KZEH 1S7VA 3GO1L 2R15A 4OIIH 4OKDA 4H26A 5CZVL 5KVFH 4JQXC 3ARYA 5DD0L 3K80A 5KSAD 2BSTB 3B9KC 5BZDB 5IV2A 5JUEL 3V6BR 2HWZL 4N90D 3T0XA 4XPHL 4L29B 1HDMB 3LD8B 4AMKL 1OAQH 3UJJL 1WEJL 5FA3B 5C0AD 5GJSH 1D5MA 3O3EA 5FYKD 3FRUA 5KSBF 3MLWL 3O3BB 2FHBA 1P1ZB 4KTDL 5JXAH 3HZYA 2H2SC 3LH2H 1KB9K 3OJVC 4WGWB 2O61B 4R4FL 3FQUB 4D9QD 8FABA 1UQSB 1NMBH 5C7XH 1MAJA 3BH8B 4YHPA 5FUZH 1KPUB 1FH5H 2GSIA 1U92A 2XTJB 1ETZB 1QFWH 5IKCB 3P0YL 5AD0A 4FXKB 3WIFA 3RUGA 1RIUL 2KQNA 2OR9L 1FPTH 3DV6A 2LFGA 4WU7A 1H5BA 3BKCL 2VLJB 3D39D 3VFPB 35C8L 4KRMB 43CAB 4XH2B 3CVHB 5FA3A 1FNLA 4PJ5D 5L2KB 1IC4L 1FVEB 2R69L 1JZ2A 1EMTH 2QSCH 2AJUL 4U1MA 4PJ9C 1F4WH 3PP4H 4MDIB 3Q3GB 15C8L 3Q6FA 5CP3H 1JHKL 5TE6H 1A3RL 1KN2L 4YXHH 2HT2C 3I3BA 5LVEA 4L8SB 4ZSOB 3NH7L 2O5YH 2DF3A 3IKKA 3S34L 3T0ED 3RWIA 3IVKA 2C1OA 1L7TH 1KTLB 1OF2B 1NCAH 3LB6D 2IPTH 2WINA 1DN0A 4OD2B 5D7JA 3KAAA 2BSSB 1RAMA 3OX8B 3GSVA 3B9KB 3QDGE 2EYSB 2OL3B 1D5BA 2F19H 1FPTL 4O9HL 3OAZH 3GO1H 5EO9A 4KRLB 4ZUVA 3ME0A 5I8OL 2OBGA 4D8PA 4PJEF 5JZ7D 4OZHE 2FJFB 3BZFB 4PJGF 5IQ7H 4OFPA 3K2UH 4JPVH 3OAYK 1PSKL 3QUXB 4EKXA 4EN3C 3CVHL 3LIZH 1CXKA 3OZ9H 5D93C 5FM5O 4MXWL 4RZCB 4MJIB 4UT9H 5JHLH 4L4VE 3AAZA 1G7QB 5I74B 3LY6A 1YQVH 2PF6A 1XCQA 2E7CA 4FQCL 5DVKA 3HUJA 4PJBF 5J13B 4PJXE 4Q0XH 3D69B 4R3SA 3SY0B 5IMLA 4PJ9B 3PDDA 3BESR 2VZSA 2ZCLL 5HHME 1P5UA 5AG9A 1NCDL 2X6MA 5FFLA 3SDXA 2D9QB 2HT3C 3FHQA 1J1PL 5SWZB 1RIHH 3NZHL 2AXGB 4M7ZC 4PP1D 4U7MA 4HH9B 3LKNA 1PLGL 4FXGA 1FLRL 4NM4L 4OAWB 5D7KD 1B0WA 1DDHB 5I6XC 2EYTA 3ZDYF 2YD5A 4NKOA 4YPGA 3BP4A 1VACA 5GISH 4R7NA 5E24E 2ICWA 2ZCHL 4PR5A 4UUJB 3RUGE 3KPRA 4S11A 1CE1H 4KJYB 4PRNA 3H7BA 3CUPB 5TF1L 3RNQA 2WINB 4I3GA 3LN4A 2XN9B 1LO4H 5D6CB 5TDOB 4EN3B 2DI7A 5FDYA 1WQVT 3EUUA 3SE8L 1ZHLB 1X5GA 3DXAB 3QO0B 5IIEB 1KC5H 3FQNA 4FQQB 5D7IB 3UBXI 5D7LA 1KIQB 2C5DC 1ORSA 3MRIB 3NA4A 3I75B 1MSPA 5DJCA 4NWTH 1WZLA 4KWUA 2WWMC 3CJJA 3TBSB 5I2IB 4Z76B 1AY1H 1P7KA 5K33A 2QSQA 5JLZA 2AS5M 3DX9A 5F7EL 4TVPH 1H15A 5C08A 5DDHB 2ZUTA 1GZQB 2DQDL 2HP4A 3O0RH 1NCAL 5J1TC 4ZPVA 1KJMA 1QQDB 3U36B 3IXTB 4M03A 1UEMA 5BOPA 3MACL 2P5EE 5C9KA 2CD0A 3NH7H 3O6LH 3HAEH 3RHWF 3MBEB 3S4SA 5DRNB 2I60H 2JJUA 3UROR 1B3JA 1A8JH 4WUUB 4GQ9H 4OBRA 1Q0XL 2N4IA 4BZYA 4DQOH 3DMMA 1CK0L 4ZTPH 1UM4H 1SMAA 5KTEH 4YWGL 5L88H 2R4SL 1ZT4B 4HFWA 2W0FA 1JYWA 4OZGA 2HLFC 2GK0A 1LE9A 3QZWA 3CMGA 2Q86B 2VOTA 3L95A 4WUUE 3IJYA 4DEPC 3DETD 3WKML 1M05B 3G5XB 3ARFB 2R8SH 4L5FH 1NGZB 4Z8FH 3P0VL 1CXLA 4AQOA 3IDGA 1RULL 2EZ0C 3TEUA 1HKLL 4RA0C 5C0DB 1QYGL 4E41D 5JPMB 4HLJA 3P4OB 4PRDA 3KPRD 4UAOB 1RIVL 3F58H 4YHLH 2A2QT 3AVEA 4DQOL 2YOCA 3BRDA 1IAKA 1RUMH 2XKSA 4QRQB 1ZT1B 4CJ1A 4MXQD 4XPAH 5D70H 4LPVA 3C09B 4DN3L 1Q9WB 4NQCE 1HINH 4XPTH 3FQXB 1F8TL 1MJUL 1T03L 1VCAA 3W2DH 2EDYA 5C0FB 1CI5A 5CD3A 5HPMA 2O61A 3FOLB 3FB6A 3KPLA 3X12B 4JO2L 4Y5VA 2B1AL 3C5JB 2H6PA 3S97C 3QPQC 3AB0C 5BS0D 5MEND 2GJ6E 3RKDD 5HYSG 4Y5YC 3WJLA 4XCFL 2J4WL 2ARWA 1TJGH 3PWLB 4PS4H 5CJBA 4Y89A 1SY6A 4GFTB 3FQTA 1NGWB 4HWEH 1FZMB 2ZP0T 4U1SA 1NC4A 1FO0L 3S36H 5KVGH 3ARBD 1KCLA 1FVCA 4X7SL 1NGXB 1DLFL 1DQDH 4JFXB 3F7VB 2HVKB 1S7VB 4NN5C 4RRPA 2XFXB 1JPTL 1GPOH 4JG1L 3SKJL 7CGTA 1OWWA 3TBWB 1JI2A 3O4LE 2EE6A 1J0JA 4HJJL 2Y1VA 4PLJD 2EC9U 4GRWE 5D1ZD