5L88L

Afamin antibody fragment, n14 fab, l1- glycosilated, crystal form i, non-parsimonious model
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
215
structure length
215
Chain Sequence
DIVLTQTPAIMSASLGERVTMTCTANSSVSSNYFHWYQQKPGSSPKLWIYSTSNLASGVPTRFSGSGSGTSYSLTLSSMEAEDAATYYCHQYHRSPPTFGSGTKLKMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Anti-afamin antibody N14, Fab fragment, heavy chain
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
total genus 58
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2016-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l88L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l88L01
3RPKA 3WJJA 2HMIC 4PG2A 3UBXG 2O26U 4R2GD 5T3ZD 1QNZL 2EDKA 4QRRD 1S7VA 5HHPB 3OG6B 3QUYC 3TEUA 3G5VB 2C3HA 3HTLX 1S9WB 3DX6A 3QHTC 1WGOA 1YECL 3OKDA 4H1LB 2X05A 4G6JH 4G9FE 4AIXA 3I2CL 4DKDC 4EUPA 2Y7QA 1S9XA 5GGQH 1F6FB 3QPQD 4LCWA 1T7XA 4J2XA 3QUMB 4UDUA 1KTDA 1AR1C 4ACPA 3QRGL 1QFWM 3KPLB 1WZKA 5F7DA 1FVEA 3DMMD 1ZANL 4QRSA 1S78D 3G9AB 3VU2A 1TJHL 3V0VB 2AABL 1S5HB 1T83C 1XGYH 3HG1A 3VFMB 5IESH 4Z6AT 1Z0MA 2Z92B 1MJ7H 3HFML 1XGQB 5ECJE 1QEWA 2F9BT 4N1CA 4XVJL 3V7AG 1MFEH 1P7KA 1A4KB 2N56A 2HH0H 3QFJE 4QCIB 3R0NA 4ETQA 1QBLL 2Q86A 2VISA 5TF0A 2CRZA 3O8XD 4F33A 2CKNA 4OZFB 4I3GA 4QRQA 1QSFA 4OJFH 2ICWB 1ODAA 4KQ3H 5KAQG 1BOGA 4BQ9A 1L7IL 3C8KA 4NQEA 5FGBA 5ANMB 2W9EH 5I74B 4Y4FD 5SX5H 3MV9D 12E8H 1VDGA 4GLRI 3B5HA 1EVTC 2CUIA 2VZ3A 4ZAKA 2NY4D 5I19L 1DUZB 2NY7H 1I4FA 1YNKL 4GS7B 3RUGB 4RX4A 2VO5A 3DLQR 2LU3A 1HK6A 2R8SL 5DA4A 3L9RA 4RAVB 4JFZL 4O02L 4KDVA 3V8CA 3JV5A 4PTTA 2XY1A 2XTJC 5T3XD 3S96B 1GGBH 4HJ0D 3KJ6L 4Q6IA 1IC5H 3DVNB 3MRJB 3HCVB 2DMBA 1DBKL 4RWHA 4LLUA 4PJCE 3AROA 5KSAD 3LN9A 4WY7L 4NFCA 5IR1B 4P9HH 1CQYA 3OL2A 4J12A 4JO3L 4M02A 2J8OA 1QZ1A 4P2RD 2VQTA 3H7BB 3ARXA 1RZIB 3T1FA 2FO1A 2ZSWB 3DYOA 1X5HA 3VD7A 2R4RL 4P59H 5FGCB 4MJIA 1EPFA 5FKAA 3SBWA 2X70A 5L2KE 1FDLH 4U1MA 5DZOA 3O9WC 3WD5H 3T0EA 3LKOB 3TO2B 1UXSB 5CINH 5D5MB 2CSPA 1KLUA 1S7QA 5C71A 4PB9H 2MMXA 2QR0A 3BUYA 2AK4E 4GKZB 1J1PH 1WAAE 2CMRH 3EFDH 3B43A 4TUJA 4UOJA 3MV7B 3MNVA 3OZ9H 5DGRA 1BGXH 2FD6H 3GZKA 2ENSA 2HKHH 2WIIA 2X1OA 4YHMH 4GKSB 1AE6L 5DUPL 4PRPD 1HXMA 2IADB 4GJTB 3GGWB 5GRWA 3W11C 2IALB 4CN1A 5F7WC 3PE9A 3BXNA 3F7YB 1TQCC 1RUAL 5EZOH 4LLQB 4GW1A 5CGTA 4QHLB 4NO3B 4JFFB 4XPHH 5I1DB 5BV7H 4PBWD 5T1KD 5GS3A 2NYYC 3OKKB 4RISH 4Y4HB 2NY6C 5EO0B 2X4TB 5ESVA 4U3HA 3G6DH 5GGVL 5MERB 4I0CC 1XF5A 4HJJL 5LBSL 4W4OA 1GZQB 3TIEB 4ONGH 2YD6A 2AJ3A 1RIHL 3L7FB 3HE6A 4OZHE 1YN6B 2C3GA 1I3VA 2GJZB 2RJMA 3WS6C 1I3GH 3H3BC 4U1JB 3KPMB 1PZ5A 2OI9B 3G5XB 3KYNB 3N9GH 1T89A 4X4YA 5D2LB 4R7DA 2A9MH 1EGJL 1B0GA 2NXZD 3O6KL 3PHQA 4XP6H 5IROC 2Y07L 5DQ9A 2JJWA 4K94C 3DVIA 3HZKA 2Q76B 3VJ6A 3CX2A 4O58H 3EYFB 1Z2KA 3CK0H 4HJGB 4OLWL 4Z5RB 2E7CA 1CE6A 3W81A 1T7VA 1IKNA 3VFWA 3EJYC 3I75B 4IOFD 3BKMH 5GRJH 3N85L 5JHDD 2ADIA 4LPXA 1T03H 1CF8L 3VXME 1NAKH 1UCTA 5E8DL 5IHZB 2EDXA 5D7IB 3UTTE 3LDBC 3P4OA 3LIZH 5FOBA 1RI8A 2VLJA 3E8UH 4GQPH 4PS4H 3DXAD 3Q5OA 3UP1A 1BJ1J 3FB5A 4PRDA 4MXVE 3C60B 2E6QA 1BVZA 3BZ4A 4QXGL 5J1AA 3UPRB 4DK3A 3MROB 3PWPA 2F53B 1KCVH 3GSUA 4YHKH 1BOYA 5FM5O 3ULUC 1F02I 2QQLL 4M03A 1FIEA 1CGXA 1JRHL 2CK0H 3ULVE 2N4IA 4KK9C 3C08L 2IH3A 4NHUA 1CTNA 4MAYB 5J89A 3HB3C 3HR5B 3TBWA 2J6EL 3SDYH 3CIQA 2VL5B 3FOLA 2BRRL 3OAUL 1FZKA 1R3JA 3DJ9A 3HNVL 4OCXH 5TE6L 2VXUH 5EU5A 5MEPB 5DTFB 1IGIH 4IHOB 1CDBA 1PG7W 3NIFE 4PR5B 1H3PH 1MFDH 4L3EA 2E9IA 4JDVB 4KK8C 4DGIH 1F58H 1U8PA 1KB5H 3BKYH 2H1PH 2FHFA 5DHYB 3PDGA 1QKZL 1EXUB 3LS5L 4UTBH 4FQ2H 1OLZA 5C6TL 1MJJB 2A6IA 1OTTC 2IQ9L 2P44B 1Z9OA 3IDNA 1J8HD 5I1HL 3H3PH 3K8LA 1G9NH 4RMUA 3L95A 1K5NB 4OT1H 1FGVL 1MPAH 5KOVC 3U30C 5JW5B 5J1TC 2PTTB 2HTKC 1WF5A 4R4BB 5E2WL 3TO4A 3QDMD 4X7TB 5D8JL 3QIUD 1FNSL 4LPUA 3WFCH 1MLCA 2VDNL 2MOVA 4X7EC 4H1LH 1ADQH 4Q0XH 3FQRA 5LWYL 3WHXA 3QIWA 5LG1A 2IFFH 2OLDA 3VI3F 2A6DB 4HEPG 2C1OB 4P2QB 1TZHB 5DMGD 4DVRL 3QUMH 2IAMD 4P5KA 1MHHB 3GBML 2B1AL 1QQDB 3LH2L 4LRNH 3ZT7A 3PGCA 3SGJA 1FZJB 1WVZA 5HHOD 1JF1B 1NSNL 1JUFA 3DECA 3FONA 3QEGL 1A8JH 2HT2D 3UBXA 3QNXA 4WHTB 1UVQB 4PRIB 1DQLL 3TH2T 4NQCB 1IGTB 2GJ6D 2YKLH 3LKRA 4NHCL 4L1DA 1NGYB 3L3KB 4OAWB 2X4QA 2IH1B 2X4PA 1ZVYA 4IM8A 3SO5A 4OZFH 1JGLL 4RCAA 4L8SA 5F9AC 3HUJB 1KG0A 2R0LL 3O4LD 2VR4A 1FLTX 4XAWL 3P77A 5J06A 3KWWB 3GNML 3FQWA 3ZTJG 5EZIL 4KJWC 4BZ2L 5F44A 5EN2A 4X5XA 5IM7B 1LNUB 5HHXH 2E3VA 3RFZC 5L8LB 4L4TE 2VDQH 3PDDA 3PIQB 3VW3H 4NWTL 5I1KL 1NFDB 4WW2F 3VI4F 4R2GB 3P11L 3MRBB 4OI8A 1G84A 3WE6B 2Z8VC 4JCLA 4QRRB 2PUQT 1MCDA 4Y2OA 1A14H 4BM7A 3G9VA 3RX5A 1MCRA 4NM8L 4U31A 1FNFA 3KXFE 5JOFB 3MRQB 1CXIA 4LIQE 4WCYH 2BSSA 4P57B 1YMME 5BXFB 5F7FA 2Q1EA 3ALPA 3BUTA 3BH9A 2FYYB 3PQYE 4GAYB 1HHIA 4PLJD 2V7HA 5ACZA 1LO4H 4NYLB 2NY5C 1FN4B 5GGTH 3OKOB 5EA0L 5FA3B 2WINA 5JPNA 3V52H 1JGEB 3DO7B 4TVPH 3FQNA 1JRHI 1ZA6B 2D7TH 1EHLL 4FQHA 3RY5A 5ILTH 4I2XE 4FTVA 4TRPH 4MNQD 1UM6L 4HUVB 2V2TA 2X4NB 4JFEA 3UYRL 3JTTA 2NNAA 3QDAA 1U8QB 4UIMA 3AY4A 5IQ7L 3PP3K 4S1SL 2NLJB 4Q74A 1T5XA 3QP3A 2FSEB 3WJJC 4PJEF 4PG2C 1DBML 3BZEA 2FB4H 4Y4FB 4ZSOE 3MV9B 4YZFF 4ZS7L 2ORBL 2WP3O 4UNVA 2RAMA 1U8KA 2AK1H 2NY4B 3V6BR 3GI9L 4QHMA 5T33L 2CD0A 2MJWA 4LLVB 1VEPA 3GSRA 3KPNA 1D9KC 5BVPH 3DSFL 5ABDE 3U82B 3REVB 4OFVA 4PJFE 5ENWA 3PHOA 3HZYB 1U8MB 1ZLUK 4GG8A 1VKXB 1JMZA 3MLTB 5C0RL 1BM3L 5DRWA 1KB5A 1X5ZA 2FWOA 3L3DA 4HZLA 1X5XA 2DQJH 5JOPE 5KSAB 1KTLA 4M3KB 2E7BA 1MREL 4UUJA 2XPGB 5LVEA 1JNHA 3FT2B 2H26B 4XNUH 4YDJB 4M6OL 5ADPL 2ESVE 3FO1B 3CD4A 4U6VH 2FL5A 3BP7B 5GGRY 4P2RB 2AI0H 5F1NA 1K8IA 4K3GA 3T2NL 1U8HA 3O2WH 2VN4A 4EIGB 4NRZA 5I66A 3H9SD 43C9A 1C5CH 5IMMA 1FYTB 4KRNA 4A6YH 1N26A 3ZTNH 1P4BH 2QSVA 1ADQA 2WLZA 4UT9H 2ZJSL 1Z5LA 4RFOH 1C16B 4KKAD 1BVKB 2BY3A 4HIJB 4WUKH 1NCTA 3QUMA 3T4YB 2FX9L 4GKOA 4I77H 1T1ZB 3ZTJH 2ARJA 1AGBB 1EJOL 1FV1A 4RGNC 3TN0A 3MJ7B 1ZKAA 2BSTB 5DUBB 2QL1A 3SGKA 4PYGA 3FQXA 2X41A 3AMKA 3OB0H 2YC1A 2LAAA 2IPUG 4HLZG 5BRZD 1N59A 3W39B 4O4YL 5CJ5A 3ZKQD 4PRPB 3GMMA 4L4VA 2V2WA 4C56B 1HSAB 3QUZA 3F6IA 1BPVA 2R0WH 4XP4H 4F7TB 3WO4C 1KCUL 2JIXD 3MNWA 4OZFA 3ZHKA 2VDKL 4WV1A 1JZ5A 3QI9D 1MCWW 4RQQA 2Q3AA 3NIGE 5GS1C 1SJVA 1G0DA 4WHYH 4KJQD 3RWHB 2EDLA 1MIEH 4LSPL 4ODWB 1KLGB 2XG5A 3RDTD 4NQSA 4NBYB 5FYJH 5DK3A 5IB3A 2Z9TA 1N6UA 5IMLB 1KELH 1A6TB 3VD5A 2BC4B 3RUGA 2YPLE 1NCAL 1K85A 1A02N 2EDQA 4Z0BL 3B4NA 3H42L 3SBWC 2VMFA 1MRFH 1MFCL 2DBJA 3QDGE 5FAAA 3SDAA 3TVMA 5KSBB 5IW6A 3H9YA 3OKLB 4Z7UF 2AGJH 1HOCA 5HSFA 3I6LE 2HJFB 1NMCB 1TVBB 1ZWIA 3FFCD 4G7YL 1WEJH 3FQUB 4JM4L 3QEUB 3S34H 2NW2B 3ARSA 3STBA 2NXZB 5KVFH 1NUFA 3MRJA 4KTEL 4OZIE 5I15L 4IIQB 3UTZB 1NFIA 1KXVC 2FJGB 2W9LA 3V0WH 4AY0A 5A1AA 5IR1A 2H3NB 1OGTB 3OR7B 1CLZL 4JM2B 5JHDB 3I50L 2PXYD 5IV2A 3F7VB 3D0VB 4RNRA 5T1MA 3S4SB 4OTXL 4R90H 2OCFD 4OUOA 1XGTB 3KLHC 2BVQA 1UXWB 1OAUH 1FNGB 4DFHA 3KPSE 1N5YH 4OFIA 4PJIF 1SJEB 2FGZA 2X2YA 3MLRH 4OF3A 2Z4QB 3BPCB 5FHAH 1GGUA 1EUTA 3VGHA 4KVNH 3AB0B 3DXAB 1RUQH 1J05B 3F12B 3HE7D 3QAZB 3JV0A 4DN4L 5IOPB 2WAHA 4GKZA 4LSVL 5IB2B 5D7JA 1CE1H 4PJAB 3MC0A 4W4OC 3GSOA 2W9DL 1KCRH 2ZKHL 1DQJA 4YXLH 1H3WM 3GKWL 1I8KA 1ZT7A 3CVIL 3FB8B 4N90D 2CIIB 2OXHA 1I9RH 4LK4A 1I8IB 4LSRH 1T89C 5JLZB 3OKYA 4G9DA 4K71B 4OFYA 5EUOB 3MODL 4MD4B 4LLQA 4RWYL 5IFJB 3QH3B 3NPZB 1I1CA 4TUOA 4WI5A 1WC7A 4K3DH 4U1KB 4LSTH 2I9LA 3K1KC 3OKKA 1IKNC 4Y4HA 1AQDA 3TV3L 3QUXA 4LOUD 5SWSE 1SM3H 1BF2A 5F71A 2DI8A 4BYHA 1RZFL 2HKFL 3OR6A 5DJCB 4BSVB 2IJ0C 1HKFA 3TIEA 5HHVL 3IF1B 1J8HB 5C0ND 1J0KA 3LV3B 3NABL 3QXVA 43CAB 1AO7D 2UUDK 5C08D 1UACH 4KK5C 3CPLB 4U1JA 3KPMA 5IJVB 2YN5A 3QDMB 3RNKB 4C83B 4P5TD 3QIUB 2HLAB 4P46D 4A6YA 4X6DB 1AKJA 3MJ8B 2YD3A 1LILA 1H3UA 3HPJA 1OARL 4JPKH 1AD0B 4OD3L 1N64H 4JKPH 3S98A 4XNMB 2VR5A 1P6AB 4RBPH 5IT2H 5MEQA 2IAMB 5E6YA 4HG4K 4ONFH 3UZEA 5D6CA 2WBJD 3SOBL 1AFVH 1CFQA 4KDTC 3WEXB 2H45A 5HHOB 3O4OB 4J3OC 3SDXB 4E9LA 1B90A 3QEQB 4RAHA 3NN8A 1A9BA 1IJ9A 1BBJB 1GC1H 3ECBB 3NH7H 4P0DA 3NOIA 2H32B 3EUUA 3HMWL 3S6CA 5D1QD 2GJ6B 1XGYL 4YBQD 2IQAB 5IESL 1I3RB 4JQIL 1MJ7L 1Q1JL 1XGRB 3FB6B 4ZPTB 5FGRA 1X9QA 2BHUA 2VZOA 1DSFH 1R3KB 1IC4L 3RVUD 2HH0L 2JJSC 3D85A 2CDEB 3O4LB 4P9HC 1H3TA 1MEXH 2XN9A 3ZDXE 4Z7VE 3BESR 4ZXBD 5K9QG 3U4EB 2XKSA 2XWBA 4U1LA 3ELAT 1RMFH 1HXYA 3MRLB 4OJFL 4DQOL 1BECA 3TM6A 5ISZD 4HUKB 4KQ3L 3TO4C 1NDGB 3RY6A 2H6PB 1VFBB 3QJHA 1TIUA 2YN3A 1TPXC 12E8L 3HI1A 4QXWA 1SBSH 1JL8A 2V5TA 3BQUD 3INUH 5MEPA 4KUZL 1NMBL 2WWMC 3QDHA 3QULB 4NQVB 5T3XH 4JN2A 4PR5A 2QV2A 3SGJC 3N1QC 1KULA 1A6AB 1TQBB 2HFGH 1NGPL 4NP4H 2JB6B 4Y89A 5I1AA 2UVFA 2OL3B 3RBGA 4DOHE 5C6PB 4X7FC 5C09E 5H94B 4CGTA 3KLSA 1Z3GH 1RZJH 5CUSL 1GRWA 3GB7B 3I6GB 3REWA 1R3IH 3WKMH 3GSQB 1JBJA 4QWWC 4L8SC 5D70H 2J5LC 2XIDA 3B3IA 2YD2A 3RKDD 5BV7C 1B6UA 4KDWA 1DDHA 3X12A 3IGAB 4OD1L 5K93A 1W72B 1CFTA 4DZ8B 2D03L 5DJDB 5SWZA 1TXKA 1JGDB 4XNYL 2YD7A 3R8QA 2EH8L 3WDJA 4RRPG 5BS0A 3MLUL 1J1PL 1B6DA 3VXMD 2OTWB 4ZFFA 4PJ7A 4Q97A 4NQCA 4HW6A 4HD9A 2WWKT 1BGXL 2FD6L 3ARBD 3OAZH 2WZPD 4YHML 4YAQB 4XMPL 2IMNA 4YNYA 1S3KH 3PABB 2X7LB 1EEYB 4X83A 3WFEH 3QA3B 4WJ5B 3HUJA 1MI5A 4PJ9D 3EYOA 1RY7B 1H0DB 1XZ0B 5SWQB 2BSED 1WFNA 3RRQA 3IKCA 4GAJH 1A47A 2XACC 3VI3E 1KF9B 1MCCA 2DMCA 3BMWA 4JDTH 2AJYH 1EHXA 3GMNB 3WXWH 4YBLC 4HIIB 5IVXA 3KPQB 2YD9A 3PIQA 3QNZB 1HI6B 2Z8SA 5MENE 1WIOA 1AP2A 3EJZC 1OSZB 3FCTA 3BPOC 4RMQA 4YXKH 3H9SB 5EIIA 5C9JB 4X6EA 2E6PA 4FZEL 4AQ1B 1CI5A 4ZDHB 3AY4C 3BZFB 4Q2ZB 2A9ML 2DBLH 4S0TD 2JELH 4GRWB 4DCQB 2E5EA 4GSDH 4YHYB 1YUHB 2EC9U 4PJEA 4DVBA 1JPSH 3MRGB 3CK0L 3B5TA 4GAYA 5DI8A 3MPCA 4YHNA 3MLSH 2B4CL 4IRJB 4HWNA 3C09B 5D7LE 1FHGA 4KVCL 3BKML 2R4SH 1QRNE 1IAIL 5IP4A 3DO7A 3VRJB 1NAKL 4JFQA 4NZJA 5MHSE 4U7MA 3ULUE 4OKDA 4XVUD 5JMRA 3RZCD 4V2CB 1FLRH 3EO1A 4ZD3H 3LIZL 2X4NA 2L0DA 5MI0C 4FNLH 5FK9B 5ERWA 3S35H 4PJ8D 3QI9B 5D2NE 3WXVH 2VAAB 5DD5L 3OX8A 4KUCD 4YPGA 1VADB 2P5EE 4LLWA 5E8PA 4JREC 3VXNA 1G9NC 4ZUUA 4WVRA 4P49A 1T1WB 5FCSH 2I24N 4YJZL 3RDTB 1MJUL 2CRYA 5AWNH 4B41A 5I1LA 1KCVL 4OGXH 1BIIB 4JDZB 1SEBA 3CZFA 2VITA 4X5LA 1IC7L 3SKMB 1RZKH 2E27L 2ZNWA 1KT2A 1XT5A 4Z7WA 2I25N 2OYPA 2DL2A 3S35X 1U93A 5E1HB 4D8PB 1FFPB 3UDWC 4TSAL 2XNAB 3GMPB 1F3JA 1FO0B 4L1HA 3FFCB 4WEUD 3SDYL 4FQCL 2C5DC 2AQ2A 2PCPA 1A3LH 1SHMA 2PW2A 2AJSH 3MLTA 4O5LH 3TN0C 5IBTH 5J6GB 4YHLL 2GTZA 4GKNB 3ZDZE 3CFBB 5E08L 3SGKC 3TBSB 4E42B 2FH6A 1LWRA 2A74B 3EDEA 3KS0H 5EU3B 2H26A 2IFGA 4YDJA 2H1PL 2R0ZH 4NO0D 4UTBL 2VE6B 1IQWH 4Y1AD 3BP7A 4EN3A 2PXYB 2C4XA 1EO8L 3U0PA 1FAIH 3GMOB 4FXGB 2XA8L 1Y18A 4MD5A 3H3PL 2Z91A 2D3VA 1FYTA 3TC9A 3V5DB 1U3YA 5I73C 4WUUE 2PTUA 1ZT1B 4JPIA 4RFNC 4HUUA 4P4KB 4TSBL 4LKCB 4R8WL 4YEEA 1UWGL 1C5BH 1ORQB 1C16A 4PGDB 4KROD 1T21A 4BSWB 3BN9C 4HULB 4PJGB 3HE7B 2Y23A 2ADJB 2LFGA 4Q0XL 3SE8H 3ULSA 1IKFH 4QLRA 1NC4D 2DQIH 1RUPH 4WGVB 3ARPA 3U9UB 2Y6SD 1GHFL 2W0FB 3HAEB 4GS7C 1ZGLA 1MRCL 4OLYL 3ZSTA 4BFBD 4RGMC 2HFEB 2DM3A 2UWEE 5HBBA 2VQ1A 4PJBB 3SDAC 3TNNA 3TVMC 3WLBA 4M9OA 4RMRA 2XRAL 3MLWH 1Q9KA 5E2JA 2NY0C 4JR9H 2EYSB 2VLKA 1K3ZA 2ZNXA 4C56A 1HSAA 4JZOA 3UYPA 4C55A 1NANI 5GGRA 1EEZA 3L6FA 3ETBF 1JWMA 3HRZA 5KSVB 2KL6A 1PEZA 1Q9OA 4TUKL 4IOSD 1U8LA 3X13A 2BSRB 3CCHA 1EAPA 4YHOL 4KH2A 4ODWA 4Y5YA 4LNVA 1JIBA 1UJ3B 5DURD 4Z78B 5D1XA 1NGWA 1EO7A 4P4RB 1XF2A 5IMKA 1VFOA 1ACZA 4UILH 3VWKA 1FSKB 4MXWH 1AY1H 1V7ML 1AO7B 3V6FB 5C08B 2Y25A 4PJIA 5HHXL 5C0FB 5I9QB 3LEXA 5HVHB 4Y5XA 3TFKC 4DZBA 1H8NA 4JRYA 4Y16D 2VDQL 3P3YA 3GJFK 5D7JC 4JAMA 4PD4J 1IAII 4F37F 3RHWF 2YSSB 3NVQA 1C08B 2BVUA 3D39D 5I8KL 4F9LA 4XCEB 3Q3GB 7FABH 4RZCB 1KENH 2H3NA 1A6UH 4GMTL 3OR7A 4JM2A 1X4ZA 5BCAA 7CGTA 5J0BA 4ZUSB 1YC8A 3O6FA 2XICA 3O11B 3D0VA 1CFBA 3X14A 5E7BA 4O2EB 5GZOC 3IAGC 3K4DA 1UXWA 4AEHH 4MA8H 4HHAB 1PQZA 4V1DA 3HC0B 4J3SA 5ADOL 4DN3H 2GKIA 4NUGL 2FJFB 1LO4L 5D1QB 4XMLL 4Y4HC 4XC1H 5JPMA 3MFFB 1ZLWH 4D9RE 4TVPL 5DJ0A 1NLDL 2EZ0C 1S7SA 5ILTL 4WFFD 3EW3B 4NPYB 2XFXB 5TH2B 5C0GB 2KQNA 2C9AA 1AH1A 4MMXC 5L0QB 1WFUA 5CEZD 4ZXBB 2QQNH 3WFHA 1AGEA 3SY0A 4NZUL 4XPGH 2OI9C 2VABA 5ISZB 1JF6A 1A3RH 4OSUL 1J7VR 5ICYA 3HZVB 3Q6FB 4UMGA 2QQKL 4G43A 1I7RB 3D9AH 2EE2A 3BJ91 2E7HA 4LLMB 4X6BA 3W9DA 5KVDH 4S11A 2APVA 2HFFB 1S7WB 4HKBB 2CKBB 4JFXB 1QFWI 4EQ2A 3BQUB 4RMTA 4JFHD 1TJIH 4HKZB 5E9DD 3MRMA 4Y2DA 1CDYA 3AREA 3V6ZA 4OQ1A 4NNPH 2OR9H 4RRPA 3T65B 2F8XC 1IAKA 3IDMB 4KWUA 1A7PH 3WMSA 1MFBL 4D0DA 5GXBB 1R5IB 3RU8L 2EYRA 1SVCP 4DUWA 1XGPB 1D5IL 2YPLD 2EIBA 2DQJL 2BVPB 3F58H 5IIEA 2AXFB 5IJVA 4XCYA 4FQ1H 2VIRA 4RGNE 4Z7NF 4OUUB 3I6LD 2AI0L 3I02A 3QZWB 5AZ2H 4B7IA 1HDMB 3IXAA 4K8RL 1IC1A 2VRAA 5JMOC 4WNQA 3LHPL 1DFBL 4K3EH 4A6YL 5DRZB 4UBDC 4UT9L 3ZMRA 1X5FA 4K9EL 1J0ZA 3RY6C 1Y0LB 3T3ME 1MHEB 1YJDL 5JR1H 2YD1A 3MBEB 5C0IA 3SDXA 2EIEA 3PGFH 1EFXA 4L8DB 3PWLB 1TVDA 1QVOB 4UV4L 3EYSH 2GTWB 3UO1H 2V2XA 2DLFL 1IGJA 4FG6D 3FB6A 1YC7A 4ZPTA 1S7XB 4R97B 4PP1C 4XVTL 2ZCKH 3N50A 3RWDA 1GPOL 4XXDA 5JXED 4LVHB 2QQQA 4PJ9B 5M94B 4CL7A 1OL0A 4FFWD 3TIDA 3U9PL 4KJYA 3MUZ1 3MUGA 2BMKB 1DLFL 4X6CF 4ELMA 3DUHA 4MXQC 4MA3B 2IAND 1I8LA 3F5WA 1AIFB 3QSKB 4D9LH 4JPVL 5T1LA 3M17A 1DBAH 2C3WA 5HDQH 3WFBH 1KN4H 3BGFC 3IFPA 2HLFD 1QR4A 4ODVH 5EPMA 5JA8B 2WANA 2GK0B 5FYJL 5EOQH 3P0YH 2F5BH 5D2LF 1KELL 3PHSA 3H7LA 4G8GA 2HJKA 1HINH 5D1ZA 3HNSH 2KQMA 3RNQB 1ES0A 3V6OA 1H3VA 5E2UH 3Q2CA 1IMHC 2ZUQB 3VFSB 3D2UD 2HMID 1CFVL 4CADB 5IFAH 3BD5A 1A6AA 4JG0H 4KXZH 3S34L 5EU4A 4J1UB 3TBTB 5KVFL 3QUYD 4HGWA 1EZVY 4HKJA 3KR3L 2EECA 1NH6A 5DR5L 4X0KA 1TTGA 2ZUXA 1I9EA 5CEYA 2OXGA 2JCCA 3V9FA 2PF6A 2HVJA 1BD2E 2NR6C 3NCYP 1AR1D 1J0IA 4RIRB 5FUCE 3FO0H 3AXLA 2NTFB 4KZEL 2QSTA 4N0YH 2DQHH 3BGAA 2GFBB 4S0SD 32C2B 2YEZB 3O6MH 3GJEB 1RJLA 1PKOA 5C07A 2VZSA 5CILL 1OGAE 3EYQD 2EKJA 5IEHB 3MJ9H 1OQXA 4D0CA 1O7VA 2EDHA 3F62A 3HAEH 2FLBT 4PJ8B 3MRHA 1WBXB 2LE9A 1FPTH 5BJTA 5IHUH 1XIWA 4MSWB 1OAYH 4EDXB 4H26B 2G75A 1WBZA 5GJSL 5TF1H 2HWZL 4KQ4L 3LSOB 4YFEA 3MSPA 2APFA 4LSQL 5C0DA 5DT1H 3VXSE 3LD8C 3SJVB 2VH5H 3DURB 1CGWA 5SWQA 1QACA 4RFEB 4POYA 2B2XH 3UEZA 4HFWA 1S78C 3DI3B 2EDEA 5EUKB 4MDIB 4X8XA 3TF7C 1HILA 3PJSB 4YIQB 1LDPL 5EZLB 1LEKA 2ED8A 4LARH 4AG4H 4JANB 2XTJD 2VWEC 3TJEL 4XX1G 4F57H 1GC1C 3GMQB 3T77A 4Y1AB 2DM2A 5HYSB 3D3VD 5DRNA 3W0WD 4ZOBA 1CN4A 5M95B 4BZ1H 5FECA 5ITFA 3DX8B 5E0QA 4QRUA 1MAJA 2NX5E 1UACL 4PJ5A 2OX5A 5CCKH 2Y06L 4KPHL 2VXQL 3WFDH 3WN5A 1U8NB 2H8PA 3H0TB 3M1BA 4KROB 1FNEA 1I85A 1IL1A 1ZK9A 5D9SA 1Q94A 4JFYA 3L3IB 5C0CE 1NLBL 2VOTA 4HX1B 3UC0L 1R3HA 4PRHE 5IB5B 2YUVA 3CFDB 4XPBL 3LB6C 2NY4C 3UPCA 4MAUL 2Q7YB 1FFNA 4IRJA 3O9WD 2RCSH 5IT2L 4WU7B 1AC6A 25C8L 4E0RB 1JK8A 4XGZA 3ZT6A 2WW8A 5FDWB 2RFXA 4JY6A 4TNVK 1JN6B 4Z0XB 4NQDA 5E4EC 3KPRE 3S37H 2WUCH 4MA7H 3HC3H 3F7PC 4JFDB 1Z6JT 3RA7L 1JWSB 5E8NB 4QXUL 1ZHBA 4IRSB 4QOKA 3CU7A 4WHCA 2KZWA 4P5MA 1T3FB 4QRPA 3FT4B 4W6YB 2G5BB 5DS8A 5JQ6H 4EN3C 1MRDH 1T1WA 4N0RA 1U8OB 3PGDA 3S37X 4LCIH 5DURB 1ND0B 4N8VB 3K3QA 3VFPB 1IM9A 1RZJC 4OLVH 2NYYD 1NKRA 2NY6D 1WZ1L 3WL9B 1BFVL 2UZXB 3RWEA 5FO8A 3NIDE 5INDA 2CKBH 1MUJB 3LY6A 4X98B 5ID0A 4D8PA 5FUOL 2XNAA 4GFTB 1RV6X 2FIKA 1R3LB 5J4MA 4Y16B 4GQ9H 3V4UH 3AAZA 1NC2A 4X9BA 4JRXA 4WWKD 5EBMB 2R1XB 5IHBA 4LCCB 1W0YT 3D39B 4NRYA 2YXMA 4G8IB 4YEFA 3NA4A 4FQQA 1K2DA 3BH8B 4YR6A 1KIPB 2R2BB 2J7LA 2XZAH 1AC0A 4MQ7A 4UDTB 1TZGL 5LGJA 3QQNA 1YEHL 5L88H 4F15C 2HRPL 2YRPA 4QXTA 1G9EA 2I60H 4D9QE 4HFUH 3OAYH 2V9TA 2VJXA 4JRWA 4XP1H 1SEQL 3CFCL 3KJ4B 4M7LT 4MNGE 5IVNA 1PD6A 3EJYD 2R1YA 4NKOB 4P4KA 1N0XL 5GZNC 1Z3GL 4BSWA 5DRXA 1R3IL 2Z35A 4OZGE 1BQHB 3WKML 3X17A 5DJ6B 3FKUS 3DHMA 1X5AA 1NEUA 3PWNB 5EBWB 2YS4A 1F4WH 3WNKA 3P73B 1WTGT 4I5BB 4P23D 5I17B 4H0HB 3OQ3B 1NGQH 3BX7C 5D1XC 3C2SA 3D69A 3MJ9A 3VWKC 1BEYH 3CFJB 4F9PC 2A6KA 4NQXB 3O3EA 1DANU 3QEHB 1OP3K 2DOCA 1K4DB 3WIFA 1LO0L 5HVWA 4HXBH 3ESVF 2MHAA 1NMCC 4ODHL 3MRIB 4UNUA 4Y5XC 5IW3A 2EYSA 4U1IA 5F3HA 1U9KA 2RB8A 3HPLA 5EBLB 5MHSD 3ZKMD 3ULUD 4ZUVA 3HLAA 5A2IH 5GISL 5GSRA 4IIQC 4OCWL 5IHLB 3AS2A 5DJ8A 1DL7H 1CD8A 2XA3A 2DQDL 4F9LC 3QQ4A 1ZVSB 5FXCH 2BSRA 5DLML 2FX7L 4JM2C 5FGSA 4OGYH 4IOFC 3HB3D 5E9DB 4X7DC 3Q5TA 3ZE2E 1RUKL 3O6FC 2NW3B 3T2OA 4N8PA 5D7SL 2R23B 5E99L 3CFKB 3B2VH 1DEDA 5L2JB 3TH4T 3CMOH 4F3FB 1MF2H 3D48R 3MR9B 4K3HA 4KK8D 2APXA 4L9LB 1SYSA 3ZL4L 5C0FA 3QIBB 2EDRA 4EQ3A 2HN7B 3DRQB 3WXWL 2RHEA 3QAZC 3VGAC 4B53A 4F58L 4NT6A 1OTTD 2OSLB 2DDQL 5DMKB 4MMZC 1MWAH 5B8CB 3BGMA 2HTKD 5AUMB 4RZCA 1XR9B 4NC0B 1IGCH 4HWEH 5GS0C 1GIGL 4N0CC 4ODUA 5TGBA 4G80B 4ZUSA 2F19H 2DKMA 2JELL 1YYML 4JZNB 1UM5H 1BZ9A 2VDPL 4LVEA 3L7EB 3NZ8B 4ZYKA 3V8OA 4PBVC 1R0AL 1RZKC 4OFDA 2BNRE 3TCLB 2FR4A 2J2ZA 2A2QT 1KB9K 3DYPA 1NCBL 2APWA 1QLEH 4EBQH 4Z9KB 4Y2DC 3AREC 3BE1H 3QPXH 4PLNC 3ZKXB 1JGUH 1MCBA 3MLZL 2WQ8A 1HEZB 1ZHKB 3KG5A 4HWBH 4DUXA 3E2HC 1C1EH 5ESAB 1JZ4A 4W6XB 3MV8A 2ED9A 3O0RL 1PKQB 4DTGL 1JWUA 3WXVL 4JZJB 4HT1H 4BJLA 5EU7E 1N5AA 4EDWL 2IANB 5TDOA 3CDCA 5GS0L 2PYEA 2X4UA 5DHVB 3L1OH 3GMRB 3HI5H 2HFFA 4HS6A 1CICA 1IGYA 1CXFA 2CKBA 4F8TA 3VA2C 4S2SA 3NACH 1N2RA 5DC0A 2A83A 4HAFA 2O5XL 1JYVA 2IAMC 2OR8A 4HKZA 3I84A 4HGKC 5C3TA 5I16B 3L5HA 3EOBA 1KTRL 1IGML 3D2UB 1G9MH 9CGTA 1MCJA 2CJUH 3RWFB 4PY7B 2X4SB 2AJSL 4FA8A 4PJHB 2ZCHH 5I1IL 4YFLI 3QUYB 5IBTL 5CJXA 2AAVA 3QCVH 5B39G 1INEL 3AS1A 3TWCH 3QQ9C 4ZFOB 5ANME 5ID1B 5GGUB 5EOCL 5HHNA 4LVNC 1UH2A 3LKNB 3AGVA 1V8HA 2A73B 3RUGE 1U6AL 2CH8A 1AXSA 1FAIL 1P7QA 1WWAX 2EYTB 4AT6B 4BSJA 1HDMA 4KJPD 4O51B 5HDBF 3CFEA 1K4CA 2CIKB 5GRUH 1JPFB 3U7WL 5CIPA 4YUEH 5DRZA 5FEBA 2GUOA 1MH5A 2R1WA 3LZFH 4HLJA 4EI6B 1I8LC 4L5FH 4X6CA 3P9WB 4WI2A 4KHTL 5C0JB 3FO9B 1YN7A 2EH7H 2DAVA 4HK3N 1OB1A 3U36A 5SX4I 4XCCH 1LP9B 5D1ZC 3IETA 5C7XH 2BOCB 3V6OC 1P84J 1QA9A 1G0YR 2R2HB 4KRPB 3PWVA 2A1WH 5FYKE 3WCYA 4JR9L 3WS3B 4TOYL 2R69H 1TQBC 5FGCE 3T8XB 1QOKA 1VGKB 4XHJD 1RQ5A 4JG1L 2GITB 4PGCB 4Z7NE 4Z7OE 3X3GH 4FXLA 1OP5H 3IJSA 1NCCL 2DQUH 3PP4H 5D5ME 5EOCJ 3G04B 2HFTA 1D5XB 1RJYB 1P4LA 3SGEI 4PLJC 3NZHH 1CT8B 1G7MA 4R4FL 5CBEA 3W9EA 4LCWD 1BFOA 1I1YB 2XTJB 3MV7E 3P0VH 5DD1L 1WBYA 5CBAA 3J8F7 4DGYH 1WZLA 4U33A 4WTWA 3NGBC 1X3DA 3D3VB 5K9QI 1GGCH 3W0WB 4UT6L 3HG1D 1AY1L 3LOWA 4JFPB 4AL8L 5JIPA 2GT9B 4YDIH 1Q72H 3S3SA 3WIHA 1C7TA 15C8H 5FO9A 4LU5L 3QQ3B 1MWAA 4CADA 2BFVL 5B22A 4JFFE 3MOQA 3MNZB 4QT5A 1OLLA 1GH7A 4KC3B 3MRCB 3SKJH 3CC5B 3UJTL 4OLEA 3HS0A 2J8UB 4LRIA 4I9WD 4P48A 1QSFD 3UTSA 3VRLE 1G1YA 1HCVA 5FKPB 1KENL 1G7PB 3DOSA 5IMOA 1NJ9A 2W0PA 3OJDB 2HVKB 4HMEA 4NQED 3H3KA 2J12B 4ZO7A 1U8JA 1KYOJ 4ORGA 1MHPH 3EYVB 3PP3H 4KKBD 4FFYL 4NSKB 1RUMH 4AEHL 4M6NH 3ROLB 5T5FL 4OCRL 3DPBA 4RX4D 3CSPA 3U7YL 5D2LE 4N0UB 4JFOA 4Y19A 1GL4B 3U46A 2I9TB 4KTDL 5JORA 4U1SB 1F13A 4MX7B 1L7TH 5I8OL 4URTB 4U1GB 1G1CA 3QO1A 2HT3D 2OJZH 4IEFB 4MSWA 1TQCB 5DYOB 3GO1L 5B3NA 2EDWA 3PG2A 4HK3J 3MMEB 4PUBH 4UIKL 4M00A 3EZJB 5C8JB 5FF6B 4JY5H 3VFOA 2W0LA 4U3CA 3LSOA 3B6SA 2AEQH 4DW2H 2C1PB 4BKLB 2NY6B 1N7MH 4PJDF 4XVSL 3S88H 1MAMH 2LQRA 1FP5A 1A3RL 5D7IE 1Q9LB 4Z8FL 1HNFA 1INDH 5DK2B 3C8HA 3SJVA 3T08A 4YHYC 1I85C 4HBQA 1TCRA 2ICEA 1LK3H 5GHWH 4XPAH 5KVDL 3N1PC 4MJID 1G7LA 3OWEA 4K7FB 4F7MA 4NFBA 3LVEA 1JNJA 4IRJC 4NO2A 4WWKB 3T0ED 4LSUH 3V0AC 1YY9C 3WIIL 1KPRB 3B9EA 3NCCB 3TNMB 2F53E 3V4VH 4N1EA 5HYJA 4NNPL 3FOMB 5BOPA 3BPLC 4HWZB 5E5MB 2Y36L 3FT3B 1JI1A 3MOBH 1A7PL 5TDPB 4HCRA 1RIVL 4Q9RL 1ZLSH 3BDYH 4NUJA 4R96B 3H9ZA 2O93L 2DJSA 1OAQH 1XR8A 1G7QA 5DF0A 1DVFA 1CGUA 1FG2A 2VLRA 1WITA 4MHHI 2LVCA 2YK1L 4ZOCA 1QLRA 1A22B 2FO4A 1IE5A 2VC2L 2YMXL 3L3IA 3KLHD 3FQTB 3ARRA 1WQVT 4ZTPH 1IAOA 4P23B 4UI2A 4QTHB 2Q8BH 4G6AD 4M5YL 5ETUA 3RAJH 3RGVA 3P4NB 4XMKL 3V5KA 3O3BB 5HPOA 1F8TH 3CUPA 3HMXH 4GG6F 4LNRB 1HH6B 4E0RA 3U1SH 5GGSB 1BQLH 5EU6A 4K2UH 4LGPB 1MHCA 1CK0L 1YPZB 3MXVL 4IMLB 1F4HA 4BFIA 3RIAF 2P8PA 2P48B 3LQZA 1QNZH 3AS3A 4Q58C 4JFDA 1OP9A 3HE6D 3WNNA 2W38A 5F9OL 4YX2H 4IRSA 1P5VA 4P2OA 3CXHK 1ZMYA 3UO1L 5J9PB 1OT2A 3I2CH 1TVHB 1JPGB 3T4AB 4P2QE 2PXYC 1AGCA 4OLUL 3DMMA 1T1XB 4TPRL 4N8VA 2APTA 2XZCL 4X8JA 1ZANH 4KMQA 3NFNB 1UKTA 2AABH 3WDHA 3VDAA 3WL9A 4P4KC 5D7KD 1YEFL 3HFMH 4S1RL 2L4OA 3LS4L 5HDQL 1KN4L 4PRIE 1UB5A 2CQVA 3B9KA 2DQCH 4OIIH 4ENEC 4TSCL 3MGTB 1BX2B 1QBLH 3G6JB 1GZPA 1FVDB 1UKQA 4GRWF 4KK5D 5JNYA 3RVWD 1F42A 2ITCA 2VLJD 3U30B 1HINL 4MJ6B 1G7JA 1WV7T 3JVGA 1G7IA 5AYQA 5F9DC 2VUYA 2C26A 2WM0A 2EKSA 3GMLA 1AD9A 3HUJE 1W0WB 1L7IH 1VHPA 2I07B 4NBZB 3VFUB 3VG9B 1IEHA 3B83A 1FFOA 1BVLA 2DMKA 3PWPD 5I19H 3EOAB 1YNKH 4GUPB 2X10A 3K4AA 1O0VA 2R8SH 1NFDE 1FCCA 2GAZA 4H25B 5EBWA 3LPGA 5T3ZE 1T20B 3FO0L 3IS1X 1UJ3C 4QRRE 4U1NA 3KJ6H 5HY9B 4CVXA 1DQDH 2WSKA 3E3QC 3MRFB 4NJAH 1FSKC 1U91A 1NUGA 3CFJA 2BVOA 4NQXA 4L3ED 5C0NC 5A43C 3QEHA 5E24E 3SN6N 5B39A 2P8LB 4JO3H 1FFRA 4ELKA 1T0MA 5DSCB 5I9QC 1QBAA 3SKNA 2Z8WC 3RL1A 4AIZA 4MDJB 2YA2A 2R4RH 5IBUG 5KJRL 4PJXF 5KSUA 1DUYA 1R5WA 1RFDL 4E41A 4G8FA 3BOVA 2VWEE 2AJVH 2RGSA 3TBVB 4G5ZL 2WK2A 3TO4D 1MY5A 2XG4A 1EJ6A 2P24A 2UUDH 1R24A 2QLVB 1UKSA 3QJFB 4OF8A 2YPKB 4B5EA 4HF5L 5DT1L 3QDJA 4QYOA 3SO3B 2YBRA 5DEGA 3QIWD 2XOTA 2VH5L 2GCYA 4DGVL 2WWMD 1P2CB 4X4XA 5F1KC 4X99B 3ZDYE 5DUPH 3QIBA 2OBGA 4AG4L 1IEBA 4JPWL 3MV9E 5CWSB 3RL2B 4F57L 1JHKL 1U95A 5DWUL 1WTLA 3WHE0 2AP2A 5GIRB 2BP3A 1RUAH 4I48A 5KN5B 3U0TB 4QY8A 5B8CA 5AD0B 5KW9L 5AUMA 3BKJH 5JDSA 4YC2C 5CCKL 3VGDA 2AEIT 2AJZA 2DI7A 3OB8A 5T3XE 2ITDA 4QWWD 3OXRB 3GBLA 4J3WA 2EDOA 5I1EL 1BJ1H 5I6XB 4JZNA 5F8QC 4LKXA 5GGVH 1B4JH 4FQXA 4PJBF 4HJJH 5GJTH 5FYLL 5LBSH 3HMXA 5GRXG 3TCLA 1RIHH 1CICC 3BQUC 3QXDA 4LASL 3MV11 4KMTH 3VXRA 3MYJA 4P2RE 1HH9B 3STLA 3O6LL 5EO1A 3OF6A 1FYTE 2Y07H 1X5GA 1S7VB 2EIDA 4OLWH 5CJXC 1P4IH 3K8MA 1PKQA 3MUJA 1TENA 3DX6B 3OKDB 1W8OA 5C70A 2P7TA 5F8RC 4EUPB 2Y7QB 5DJAA 1S9XB 4LEXL 2JJUA 5JQ6L 4LCWB 2BNUA 3GJFB 4HMDA 5E8DH 1KTDB 4O9HL 2DICA 2D0HA 2R29L 1W0VA 2FGWL 1OW0C 5F7DB 1NCDH 3W2DH 3BP4B 4QRSB 4OLVL 3T0WA 4PRPE 2BHYA 3GHBL 3R8BB 2C7UA 5IEKA 3HG1B 5DVKA 4C56E 5I16A 2F15A 2VKWA 1QEWB 1MFAH 4UNTA 3MBEC 3IAQA 1S5IL 1SMOA 2UVEA 1P7KB 4FTVD 3EJZD 1II4E 4PJCF 2CLRA 1J0JA 4J4PA 1QSEA 4OGZA 3V4UL 2MQCA 4ETQB 2VISB 2Q86B 3F65A 4JFED 4ODSL 4F33B 4NN7C 2ZZUT 4MLIA 1JRHH 1QSFB 1UYWL 4OF5A 4QRQB 5F7UA 3C08H 1BOGB 3TYGH 2XZAL 1PY9A 4NQEB 2ZWLT 1OAZH 5E94A 2J6EH 2VDMH 4P9ML 4OV6F 3OAUH 2BRRH 3U0WL 1QG3A 4ZAKB 5TE6H 1CL7I 1JPFA 1I4FB 5KSBE 5GPRA 3M45A 2X89A 4PTUA 3IFLH 3T3PE 1BP3B 1T22B 3SDCA 3L9RB 3MRKA 4PLOB 1WAAF 4FZ8L 1QKZH 3LS5H 1A9EA 4PTTB 1QSVA 5C6TH 2Z93B 4Q6IB 4HH9A 1RJCA 4QHNA 5I1HH 3IDUA 1GSMA 1FGVH 4LLUB 5HPMA 5JHDE 3O81A 1P84K 1DQML 5E2WH 5ELIA 5D8JH 4HXBL 1FNSH 4NDMB 2VDNH 3AMLA 5CZXC 1OQOA 5LWYH 2W0KA 2HJLA 4LDOB 4KKCC 1E27A 4QGTA 1SBBA 2VKXA 4DVRH 4H5SA 3DXAE 4XWGH 4LRIC 4MJIB 4ONHA 3GBMH 1RJYA 3ZE1F 1A6ZA 2B1AH 4NKIL 5DJZA 5FKAB 2X70B 3LH2H 1C7SA 5KS9A 2X9XA 3IRZA 1CT8A 3T0EB 2PO6A 4PJAE 4OGYL 1KLUB 1S7QB 2H2PD 4WWID 4YK4B 2QR0B 1NSNH 3BUYB 4OZHF 3TN0D 4TUJB 3DUUA 3B2VL 1DQLH 2EDDA 1JGVL 3MNVB 4J8RA 3LN4A 4NZRL 4MQTB 2WIIB 1A1NA 5I8EA 4LCYA 4U3XA 5EUOE 3QXUA 1S7UA 2ED7A 3K2MC 3ISWA 3GIZL 4X5WA 2CPCA 1JGLH 5C0AA 1KNOB 4L4VD 1G0XA 3QUZD 3MLVL 4XPTH 3BXNB 2R0LH 3M07A 4TNWK 3WIHL 3HKFA 2G2RA 1GYAA 4XAWH 3IFOA 4GW1B 4WDIB 1NAMH 5CP3H 1MWAL 2J8UA 4JE4B 4QEGA 2AQ3A 2X6MA 5EZIH 5F89A 2MCPL 4BZ2H 2BXZA 1A5FL 4M8QA 2HVKA 4XWOC 1JHLL 2R2CA 1FRGL 3OKEB 4ODBD 1QBBA 4PJDA 1J8HE 5A40E 4NWTH 1XF5B 1KXQE 3AM8A 3P11H 3CLFL 3GHEL 5IJKA 2AJ3B 3JWDL 3HE6B 1XF4B 3QDME 4MXVF 3SDAD 3TVMD 1CCZA 3R0MA 1G9MC 2I9TA 4NM8H 2F54A 4U1SA 3VWJB 1PZ5B 2NY0D 4X6DE 3EOTL 4L8CB 1LO5B 4R7DB 3ARZA 1B0GB 5DYOA 5T1DL 3CDYA 3PHQB 3QPXL 3KYMA 3O3AA 5HJ3A 5DQ9B 1R6VA 1MQKL 3HZKB 3M8OH 3VJ6B 3ULVF 1CZ8L 2PTVA 3T04D 3R1GH 1A7NL 4OLZL 2AEPL 5K9OA 3QT2A 5HHOE 3VFWB 1DVFC 3SDXE 5EA0H 2ADIB 5E03A 3P4MA 3QEQE 2OQJA 4R3SB 1EHLH 3OPZL 4N1HB 3C87A 5DJXA 1IFHL 3L1OL 2GJ6E 2Z31B 4MB4A 1UM6H 3P4OB 5F7HA 5SX5K 1CQKA 4TVPD 5FOBB 1BHGA 2H2SD 2DWDA 3RGVC 3UYRH 2VLJB 4YHPA 4BFGA 1AGFA 5F7EL 4QRTB 3TFKD 3FB5B 4PRDB 5IQ7H 4S1SH 3JV4A 3NFPA 3O4LE 3AUVA 5D7JD 4DAGH 3C2AH 4NBXB 3BZ4B 3H9HA 1DBMH 5J1AB 5F1IA 2E7LA 4QHUA 4LF3A 5H8DA 2EEBA 4ZS7H 1JYNA 3PWPB 1VENA 3GSUB 4M7ZC 1TNMA 3GI9H 1CDUA 4BK4A 4U6YA 2RQ8A 3VXUA 2J6EA 4IRSC 5TQ2L 4LP5A 4Y88A 3H6JA 4HCRL 1EK3A 2IH3B 4BELD 4OFYD 4UQ2A 5GZOD 1MCWM 3SDDA 3LKPA 1HZHL 1FZKB 1R3JB 1BM3H 4OB5L 4KUCF 3SPVA 5EU5B 1NUDA 1IAMA 1J9CT 3NTCL 4Y4HD 3UZVB 3QUXD 5CHNA 4L3EB 4N9OB 3ARGA 4NWUL 4YPJA 1U42A 4M6OH 4L5FL 5ADPH 2EZ0D 5B4MC 2FECL 2NY1C 3AVEA 3N1GC 4OLXL 4Y16C 2A6IB 5L6YL 3IDNB 1FH5L 2WWKO 3L95B 4R0LA 1UWXH 2AEWA 3JVGC 5IB4A 4WI8A 2BXYA 5C7XL 2ZJSH 3TO4B 1T0NA 4JHBA 4XNXL 1AJ7H 2A1WL 3T4AA 1TPXB 4LPVA 4DK6A 3O45A 1S8DA 2FX9H 1AKJD 4QF1A 3FQRB 1M6OA 4Y8AA 3ESUF 1EJOH 3WHXB 3GI8L 3QIWB 4EUPH 5F3BA 3FO2B 4M7JL 2AXGA 4HV8A 2DQUL 3GJFH 4NJ9L 3KJ4C 3E6HA 4MYWB 2ZPKH 4P5KB 5DQJA 2GY7B 4IS6A 5FYJU 1L6ZA 1YDPA 3MCLL 3PGCB 4X6FA 1M7DB 1PAMA 2O5ZL 2BNQA 1CTOA 3V5HA 4G42A 1JUFB 3FONB 1UH4A 3UBXB 1HKLL 3IAPA 1KCUH 3QNXB 3P30L 5B38G 3BEWA 1GGCL 5HXMA 2VDKH 4EVNA 4TYUA 3LKRB 2DLHA 2X4QB 4XBGA 2X4PB 3IKKA 4BQ6A 1W0WA 1ZT4A 1H9VA 3UMTA 1NAMA 5CP3A 4HGMA 4L8SB 3D85D 5FO7A 4PLKC 1OM3H 1ZVHA 2J5LB 2MKWA 5A2LH 5DVNA 4WO4A 2XN9D 3KPTA 4J7RA 3P77B 4NZTL 1OCWL 4Z0BH 2VQUA 3H42H 5FYJD 3FQWB 4UV7L 4PJXA 3I3EA 4D0BA 5J3HC 1CWVA 5EN2B 3W5NA 4X5XB 2A0LD 3WDIA 3VXQA 1I75A 8CGTA 3CAFA 4KI5C 4JM4H 3H9SE 2E7MA 3CDGA 4TN9A 5M7QA 5JO5A 1RUML 2AXHA 1JTTA 3U7AA 2XZQL 4TNVF 5C0BB 1RK1A 1H5BA 3WHE1 4GRWE 1CLZH 3QIBC 2P5WA 1CXEA 3QHFH 2BSSB 4RDQF 1BBDL 1T4KA 5E5UB 4CW1A 3CLEL 3QFDA 5HYQA 3PL6A 1F11A 1GOHA 3DTXA 4NZDA 4WI9A 5B8CC 3BH9B 5CSZA 3TBVA 4JY5L 3BRFA 1UG9A 2O61A 4MXQD 3ILQD 2V7HB 5ACZB 5DDHA 2D31A 4C59B 4G9FA 3BMVA 1FQ9C 5ICXA 1FL6A 4YBLB 4LSVH 3FQNB 4FQXC 4FQHB 3K1DA 2W9DH 4FTVB 2ZKHH 1KGCD 3OJMB 3BPOB 4OCLC 3GKWH 2BZDA 4EOWL 2V2TB 4JFEB 5SWZD 2NNAB 3VD9A 3BRDA 2ILLA 4UIMB 2NY2C 5BS0D 2DIJA 3OJ2C 1P6FA 2P45B 1CDIA 1MELA 4NNXA 1T5XB 4FG6C 3BZEB 2YRZA 3QFJA 4RWYH 5DMJB 1EMTL 4NQCD 3ZKXC 1DLHA 3CU1A 3SCMA 5I1JL 1NDMA 3K46A 5ITBL 1ZLSL 2FECI 3JV6A 4ZOEA 5LAXA 4QHMB 1OAQL 2W91A 3KPNB 3GSRB 1I9JH 3FFCE 2NR6D 3MO1A 4M43L 2FATH 3IFNH 1MI5D 3ROOA 5ENWB 5EZJA 5CJQL 4D94A 1RZFH 1M71A 5CEXA 2HKFH 5I71B 1XF3A 1B88A 1INQB 3C5SA 2VDRL 5HHVH 3T2QA 4X80L 4C57C 2MPAL 1MAKA 4AEEA 5DRWB 4G6ML 1KB5B 2FWOB 4OKVA 5E2TL 2FH8A 4HZLB 4OZ4A 1QFUL 4MWFA 4P5TA 5H35A 3C9NA 1KTLB 4UUJB 4JY4A 3RPIA 1JNHB 4JREB 3UX9B 2ZCLL 4K7PH 4NQUA 1P5UA 4PGEB 2FL5B 4ZS6C 5F1NB 1ONQA 1K8IB 3RWCA 1U8HB 4PFEA 1DANT 4OFPA 1UGNA 4NRZB 4J4PC 5I66B 43C9B 4K3JH 1OARH 3NIGF 4OD3H 5F1SA 5BZDA 1E0OB 4PJCA 5IMMB 4MNHA 3L3JA 4MB5A 4YX2L 2WBJA 4PJGE 1ED3A 5CS7A 1Z5LB 2ERJB 2W65B 3SOBH 4UQ3B 3TA3A 3GJFA 1Q0XH 4K7PX 4RDQG 2ARJB 4XBEL 1FV1B 3TN0B 3MREA 3BP4A 1UZ8A 4N90E 4PJBE 3RIFK 4OBSA 3HMWH 3FQXB 5L2KA 2YC1B 3S5LG 4X9FA 1CLCA 3D25A 4JQIH 1MNUL 1N59B 3SDCC 3EYQC 1Q1JH 1FE8L 4I13B 1P53A 3GMMB 2FZ3A 4OZIF 2AK4A 4L4VB 1E6OH 1WAAA 2V2WB 1IC4H 3S97C 3QUZB 2DQCL 4OIIL 5DC9B 4Y4KA 1ZE3C 3C6SA 3MNWB 4JO1L 2IGFL 5I73B 4WV1B 4RFNB 5E8EA 4DQOH 4HS8L 4RQQB 5E6IA 1ZTXL 2EEDA 4KRPC 3U83A 1E4WL 4FP8L 4NQSB 5HHMD 5EOTA 1WISA 5HYIA 5IB3B 3LB6D 1VSCA 3KLDA 1AO7E 5C08E 4U6HA 1T7YA 2OTUA 1QP1A 3L3OA 4KUZH 5EFIB 3VCLA 1NMBH 2CGRL 4J6RL 4MLSA 4TTDD 3A6CL 1PLGL 4RGMB 2PNDA 4P3CL 4HDIA 3SDAB 3TVMB 1T22A 3V4PH 4HUXA 3DBXA 5IW6B 2PO6C 3MGOA 1HOCB 2NY0B 1ZWIB 2Z93A 1NGPH 1DQDL 3IU3A 4NJAL 3UJJL 4KZDL 1O7SA 4BK5A 2LABA 4HIHA 2FBJL 1NFIB 5D6DC 4BQBA 5FM5M 3VFTA 5CUSH 2VSDA 2VNCA 4EN3D 4NDMA 2QHRL 3WNMA 5IV2B 2EXWC 2A77L 4RNRB 2Q6WA 5T1MB 4KKNA 2VDLH 4LIQH 3BT2L 2BVQB 1FYTD 1A6PA 3SKOA 1EVUA 4OD1H 3ALXA 4S10A 2AJVL 4KAQL 3QUKA 2D03H 4PJHF 5C2BL 2X1XR 3RJDA 4I3RL 3NCYS 4YHZL 2AXJA 4XNYH 3IVKB 1TJGL 4KKLC 3U6RA 1K8DA 2EH8H 3VXMA 4AYFA 4EKXA 4GBXA 1KPUA 3CH8A 3MLUH 3WNOA 5D7JB 2UY7A 4TULL 3QHZH 4E5XA 3UTTA 5ICZB 3GSOB 1CGSL 3AM8C 3DHJA 5CD3A 1DQJB 5IJKC 4BH8A 5ISZE 1QSZA 2X44D 1I8KB 1ZT7B 4CU8A 4GAGL 5TDNA 3RWGB 4XMPH 1KNOA 3PF2A 2VLKD 2IBGA 4C56D 4CNIA 3L3HA 5MEOA 4U1GC 4G9DB 1MVUA 3DIFA 2KKQA 4S1DC 5GGVY 2RBLA 4J3TA 4FXKA 4WDIA 1YYLH 1I8MA 1HIML 4OQTA 4TUOB 4H0GA 1WSST 1UEYA 1RSFA 2B7DT 3BKJL 1WC7B 5GZND 2I9LB 5A2KH 1FJ1A 4OV5A 3MBXL 1NANH 2B0SH 1AQDB 3PWJA 3QUXB 1AGDA 3RTQB 2ZOKA 3ORJA 3ZE1E 3Q48A 1LP9F 3OKEA 4LSSL 1B4JL 3CNKA 5D1XD 5DC4B 5GJTL 1F3DH 3OR6B 3ME0A 3VWKD 3GK8L 4JQXA 1KBGL 3PDOA 1SJHA 1XF4A 5CD5C 4FZEH 3TZVA 5B38A 3MRPB 4Q9QL 4WWKC 4KMTL 1BWWA 3VWJA 4YDKL 1JPTH 4M1CC 1REIA 4L8CA 1CG9A 1FCGA 1LO5A 4JRYD 3OB0K 1L6XA 4YBHA 2YUXA 3VRIA 3ZDXF 4MA1C 4Z7VF 1FBIL 3D18A 4A6YB 1AKJB 2E7LC 4NRXA 2BVEA 3HPJB 5GRZA 1RULL 4ZUTA 1HQRA 1P4IL 4DEPB 2B4CH 4EEEA 4JM2D 5MEQB 4KVCH 2Q7NA 3LCYA 4GOSA 1IAIH 4HG4J 3O6FD 5D6CB 1V3JA 4M61A 1CFQB 1FNAA 4HS3A 3RZCA 1F5WA 4R3SA 4YDVA 1CR9L 5HGAB 3SDDC 4Q9CA 2Z31A 4P23C 4HPYL 4V1DD 1A9BB 3NN8B 1T66D 1NCDL 3W2DL 4UB0L 4M93B 1ZHLA 1A4JA 3UAJC 1ACYH 3O2VL 4QRTA 1VFUA 3FHQA 5DD5H 3T2PA 3ARGC 1NBZA 3GSNA 5EORL 4M7LL 3KPPB 5E56A 5J6HA 1MFAL 4JHAL 1J12A 1EUUA 1HHHA 1CDCA 5I0DA 1MJUH 3D85B 3VFNA 5CJOL 1JHTA 5JW4N 5F88B 4JKKA 3ZKMC 2XN9B 4HIEA 4HQQL 1KJ2A 2XWBB 4U1LB 5GS0D 1CU4L 1U3HA 3HA0A 1B0RA 4N0CD 1HXYB 1IC7H 1N4XL 2E27H 2Q87A 5EB9A 5K9KA 4K07A 3TYGL 3QJHB 4TSAH 1J88A 4FQPA 1OAZL 3QG6A 4P2CG 5DD0H 2VDML 5F96L 4FQCH 3QXAA 3KPOA 3HI1B 1UJTA 1YNLL 5EWIL 1ZHNA 4YHLH 3VDBA 5E08H 3IFLL 4JN2B 4HBCH 3O41A 4Y2DD 5ALCL 4PRNA 2F5AH 3ARED 4LLDA 3MTRA 4L4TA 3BVNA 1QFWH 1EO8H 4ETYA 5IBLC 2XA8H 5TQ0L 2VN7A 5HI3C 5I1AB 3N1FC 4LAQL 5CJ8A 5E8OB 4ZNEE 1QHOA 1A7BA 3FB7A 3Q1SL 4J3XA 2NTSP 5CZKA 1KSRA 4TSBH 4R8WH 4B7LA 3KXFA 2DLEA 1UWGH 1VB9A 3REWB 5CAYB 1N0LA 4JQVA 3BGFB 3VG9C 3CFIC 3UPAA 2DYPB 1BFSA 1YMMA 1L9NA 1QFOA 3B3IB 5DVMA 4CN6A 4WO4C 3FO2A 1DDHB 3X12B 1GHFH 3PQYA 4XWGL 1MRCH 4OLYH 4DKAA 1RD6A 1CFTB 2GSIA 4HK0A 2IWGA 5SWZB 2Z0BA 1M7DA 2XRAH 2DS4A 5BS0B 5CKAA 3QEQD 4I2XA 4ZFFB 4PJ7B 1LK2A 2ZG1A 3JTSA 3QQ9D 1EFXD 2SEBB 4WW2B 1H5BC 4TUKH 1UZ6E 3SJVE 1U58A 1U2CA 4YNYB 1M4KA 4JB9H 4YHOH 2D7OA 4Q7DA 3TYFB 4XPTL 4ZOAA 1MI5B 2V7NA 4POUB 4ZSOA 1IVLA 3EYOB 1FYHB 1DBBH 5J56B 1T04A 1YPZF 5A16A 1NAML 3MCG1 2IBZY 3PL6C 1K9TA 3IKCB 4YXHL 4W4NA 1TETH 1V7MH 3HR6A 3HHRB 3EO9L 1OPGL 3T0AA 5IF0B 3A6OA 3ULUF 4Y1AE 5T1LD 4RBPK 4PJFA 5IVXB 3ZE0F 3SO3C 4MJ2A 2ZP0T 1AXTL 1FZMA 2PW1A 1AP2B 2ATKA 3FCTB 3LKSA 5CP7A 5D1ZD 5EIIB 5C0BA 5I8KH 4X6EB 4IOIA 4GMTH 2ICES 5AAWA 3QXWA 3ARTA 3ARFB 2C3VA 2ESVA 2EDBA 4I3SH 3LD8B 2ZSVA 1T2XA 3QR2A 3EAKA 1M05A 4KJPC 3M8OL 3IRPX 4PJEB 4DVBB 3R1GL 5DI8B 3VXOA 5ADOH 4YHNB 5AYUL 4O2FA 4NUGH 1BWMA 3G6JF 1CD1B 2F74A 3DRTA 1G6RA 4XMLH 4UU9A 3S7GA 2I5YL 3ZYOA 1EFQA 5I6XC 3GSWA 4JFDE 1TTUA 4JFQB 1NLDH 4JO4H 4M3JA 3ZDZF 4PG9A 3BIKA 4H8WL 3EO1B 1I3UA 1HN1A 5C07D 5E6ZA 5F6HI 4NIKB 3UZQA 5DFWH 1UA6H 4L3CA 5ERWB 2HP4A 4NZUH 3R4DA 4AM0A 5DZNA 3OX8B 2IG2H 3ARQA 1AHWA 4F2MB 4OSUH 4YPGB 4ALAL 4LLWB 5E8PB 4KV5E 1XIWD 3VXNB 4IRZL 4DAGL 3C2AL 1HSBA 1YEKL 4ZUUB 2QQKH 4CAGA 4JJ5A 3D5OF 2XWTA 1R5VA 5HHMB 4XHJC 2X1WL 5I1LB 2AQ1A 1CBVL 4FS0A 1SEBB 1VCAA 2W1NA 3CZFB 2LVEA 2BOBB 2VITB 3CGTA 1QUNA 4WTXA 1KT2B 4Z7WB 2JB5L 1U93B 5E4EB 1PG7L 1F3JB 5I1CL 1U2HA 1H8SA 2PCPB 5IQ9A 5HD8C 4LDEB 3KDMA 2PW2B 3EYUH 3D39E 1INQA 3BW9A 1MFBH 2UWEF 1QYGL 2R0KL 4HPOL 3RU8H 2GTZB 3MA7A 4APQB 1D5IH 1E28A 2JK5B 3QDGA 4MS8D 4TTGA 3HI6H 1CDHA 3D1MC 4FFZL 3I9GH 5GSVB 4PGEA 4EN3B 5DJYA 3U0PB 3PV6A 4OM1L 1Y18B 4YHIA 1UM4H 2IPTL 2R2EA 1FZOA 4K8RH 4MD5B 4OM0L 2XKNA 2Z91B 3LHPH 5MP6L 4PJ5D 4WHDA 1DFBH 4JPIB 2BY1A 4HUUB 4K9EH 1S7TA 5F7NC 1RZ8A 2W65A 1AJ7L 4UQ3A 1T21B 1YJDH 2YXFA 1A7QH 3ALWA 3OAZK 5FGBC 1IBGH 1TNNA 4P3DA 2BHZA 4M5ZH 4WFFE 1N3NA 3ULSB 1K6QL 1YNTA 2FIRT 4ZAKC 4KKBC 1PEWA 5CEZE 1OWRM 2G9HA 1YEDA 1WT5A 4IRJD 3KPSA 5IWLA 1ZGLB 2ZPKL 1BMGA 1YY9D 3MYZA 4PRAA 4ZODA 4UV4H 2VQ1B 1YEGH 5DUMH 3TNNB 3WLBB 4NQDD 2GQHA 2DLFH 1Q9KB 3U4AA 2VLKB 4XVTH 4HMCA 4F15B 4Z7UB 4JZOB 3STZA 4IDJH 4Q6IC 2HT3C 2V9QA 3IB4A 5GGRB 1GPOH 4YFLF 1EEZB 3IJYA 4F7PA 3L6FB 4N9GA 4JFHE 1JWMB 3HRZB 1X7QA 5E9DE 4QOKD 3U9PH 1Q9OB 4KI5E 1DLFH 3V79C 3VH8G 3H8NA 1RZGA 1U8LB 4QRPD 3X13B 3O3DA 3Q6GL 3CCHB 1I1FA 4JPVH 1EAPB 1J5OL 3FN9A 4Y5YB 3E6FA 1OM3L 5BO1L 1QO3A 5D1XB 1IM9D 1NGWB 3FN0L 3NA9L 1XF2B 5IMKB 5EFIA 3GRWA 3VWKB 4W68A 4GRMA 1KXTB 1A6VL 1IEAA 3T0EC 2BCKA 4PJIB 1IQDB 5SWSA 1CFVH 1OT1A 3LEXB 4XNQA 4Y5XB 3WSQL 4DZBB 4YK4C 4JRYB 3C6LA 3PWUA 2NXYB 4JAMB 1NC2D 4MJ5A 4JRXD 3KR3H 3TGXA 4NKMA 3OTTA 2X4RA 1E4XL 5DR5H 1VFAA 2BDNL 3VXPA 3CVHA 2UY6A 1HHKA 3S3PA 3O6FB 3X14B 1XMWA 3NAAH 4KZEH 3QHFL 2YD4A 5CMAA 1PQZB 4V1DB 1A7RL 4P4KD 4YFDB 3SEPA 4G6AC 2CDGA 2HG5B 3OHXA 2H9GA 5CILH 1LQSR 4KK6C 3IVKA 2D7MA 5F7LB 1L4IA 5JPMB 1T2QL 5J1SC 1E6JH 3VGAB 1PJ9A 2WIMA 3KNBB 4XHQA 5DJ0B 1BIHA 4ENED 3DVGA 3WUWG 2P1YA 2B20A 1OAKH 1S7SB 2A6JB 3ZHDA 1FC2D 5ICZA 1PKQE 2VXVH 4JQXC 4XTRC 1AR2A 3HE6C 5GJSH 2HWZH 1ZS8A 2IANE 4KQ4H 2B5IB 3TZVC 3WFHB 1SYVB 1AGEB 3RWGA 3SY0B 5H37G 3VWJC 2VABB 4A2MA 1LEIA 4LSQH 4XB8A 4Y5VB 1P1ZA 4LHJB 5ICYB 5CZVL 4DUVA 2W92A 2XKUA 4G43B 4X6BB 3W9DB 2ZUWA 1ZLVK 4Z7VA 4R7NA 4ZQKA 2AJXL 3N0PB 1S7RB 3T3MF 4A2LA 4NM4L 1I9JL 1LDPH 3RTQA 5GS2H 4OQTL 2ADGA 3MRMB 1S9YA 3JSSA 5DXWA 4Y2DB 3TJEH 2FATL 4PJHE 2Q8AH 2R56H 3AREB 3IFNL 1RHFA 3V6ZB 2DL9A 3ULVL 5HTSA 4LL9A 2F8VA 3L5WA 3BISA 1IAKB 5HYFA 2FJHA 2OMNA 4HLZH 5J12C 2Z31C 4D0DB 3LRHA 4JO2L 1ZSDA 2EYRB 3E2HB 2C4FT 3MRPA 3RVWC 3B9VA 2Y06H 4KPHH 4U6TA 2VXQH 5IIEB 1SQ2N 4XCYB 2VIRB 4QHKJ 4K7PL 5KTEL 5DZLA 5LGHL 4U0RB 1NLBH 2DB8A 1KEGL 3UC0H 3I02B 4OD2B 1GAFL 3BIAX 3IXAB 4XPBH 2X1PA 4K3JL 4AQOA 4MAUH 4WNQB 3MRNA 2QADD 5C09A 5FYLD 4XRCA 4PP2A 1EV2E 25C8H 1HHJA 4NKDA 1FL3A 3DROB 1Q0XL 3J7HA 5HGAA 5C0IB 1J1OH 1Z0NA 1LP9E 5ESQB 3LQAH 3RA7H 3BIBX 3VMPA 1EFXB 4QXUH 4Z7QE 5E1AA 1U8IA 5K9JH 2G5RA 4LVNB 2V2XB 1IGJB 3LQMA 3KPPA 2V5YA 3UROR 3EDJA 2ARWA 1E6OL 3IXTB 3RWDB 3GSNL 4XXDB 5F88A 4XCFH 5A3ID 3MV8D 3TIDB 4KJYB 1WZ1H 2XTJE 5TJWK 3MUGB 1BFVH 4ELMB 1UB6A 4TNWF 4GXUN 3F5WB 1E4XI 5FUOH 1KJ2L 4FQLL 5T1LB 3M17B 4L8BA 4JQVC 3IFPB 5EPMB 3D3VE 3GEWB 3W0WE 3IU4L 5IGXH 1D5MA 3WS6A 5BQ7A 3QIWC 1CICD 1NEZG 3L3GA 1I1AA 1KCKA 4G8GB 5D71L 1KC5H 4HUWA 2HJKB 5D1ZB 1ES0B 3V4PL 1FL5A 3G6AA 4AH2B 1BLNA 1TZGH 2ZUUA 3KLAA 4LBEA 1D7FA 2J8UE 1V3KA 1YEHH 5MENA 2HRPH 5EU4B 1ZLWK 4HGWB 4HKJB 4ZMAT 2J8HA 4RGOH 1SEQH 5IVZA 3CFCH 5E8OA 5CGYC 1J8KA 4XC3H 4X0KB 4QHKI 8FABB 1JI2A 1N0XH 4W81A 3ZYJA 3D0LA 5CEYB 5I1GH 2JCCB 2HVJB 1AQKL 2AJUL 1P7QD 4RAUA 4F7CA 1L0YA 2DYPA 3AXLB 3FZUD 2VDLL 4N0UE 4LIQL 3NGBB 1WCBA 5HGHA 3RIAK 3KYOA 1RJLB 3U48A 5C07B 5D7LA 1Z9SA 1QRNA 5CLWA 1LO0H 4LVOB 4D0CB 3MBED 3SE3A 4ODHH 3MRHB 2DQGH 4NFDA 1KIQA 3IT8D 5BJTB 1XIWB 3MRDA 3DV4B 3QHZL 5E2VL 3TT3L 4I18A 2Y1VA 1XF1A 4JJHA 2G75B 5GISH 4OCWH 4JVWA 2SEBA 4WW2A 1WBZB 2DQDH 3BAEL 4QTIH 5D2NA 1IARB 5DLMH 2FX7H 2P5EA 4NO5A 5I75C 3FJTA 5C0DB 3TYFA 1RUKH 1YEIH 5SX4H 1DQQA 5D7SH 2B4CC 3CMGA 4FQIL 5IFHH 1OVZA 5E99H 1YYLL 2DJ4A 1PYWA 2VLLA 2DWEA 1LO2H 4HFWB 2KPNA 4G8EA 5IF0A 1HILB 2B0SL 1LEKB 3ZL4H 4XZUB 1IILE 4MHHG 2QEJA 3R06A 3C5JA 4F58H 5E70A 2FX8L 3MLXH 4WI6A 3T77B 1CLYL 3HNTL 2DDQH 3SGEH 5DRNB 1MCOH 5FECB 5ITFB 1XCQA 1XH3A 4QRUB 4PJ5B 3LPWA 3WJLA 2N7BA 1GIGH 1JPTL 3IDJA 5AAMA 3ARFA 3VH8A 3WN5B 5CZXD 1AHWC 3KYAA 2H8PB 1VPOL 1D5ZA 1J86A 1YYMH 3CXDL 2CLVA 4KY1L 3M1BB 2VDPH 1VFMA 1CXHA 4KKCD 1FNEB 5D9SB 1IL1B 1Q94B 4JFYB 4X7CC 4YH6A 1R3HB 1JZ8A 3RX7A 1R0AH 2P4AB 2LU7A 4C4KT 3GSXA 3UTSD 3WLWC 1XGUA 3NIDF 2HRLA 1NCBH 1FFNB 3B2UC 4WUUA 1YPZE 3FRUA 1SY6A 1CD1A 2VDOL 3BWUC 4OF6A 1JK8B 4XGZB 5TE7L 2RFXB 4JY6B 5DGQA 4NQDB 1NUNB 2ATPA 3BPLB 2QKIB 5I71C 1G6RL 3TT1H 3ZE0E 35C8L 3MLZH 3O2DA 3UTQA 1FC1A 2FEDC 4Y19D 2DQEL 3CX5J 1HQ4A 2UWEA 3O0RH 1ZHBB 4DTGH 4QOKB 1ACYL 4GW5A 4P5MB 4F2MA 4EDWH 4QRPB 1S9VA 1F3DJ 4Y8DC 2JJVA 2W07A 5GS0H 5DS8B 4Z77B 1KJVA 3PGDB 4N5ED 3BD4A 4M48L 3A0OA 1IM9B 3JZ7A 4NKQB 1TZIB 1HWGB 2BOBA 2O5XH 3DWTA 4ERSL 1EEQA 2AKRB 4OZGF 4XWOD 2MQ0A 4UZGA 3ARDA 4N5UA 3RWEB 5FO8B 5INDB 5ID0B 2ERJC 4LLYA 1IGMH 3SJVD 3G6JE 2E6JA 4GXVL 4PIRF 2FIKB 5DD0L 4ZPVB 3CJJA 2H2PC 1EIBA 4I4WA 1WUNT 1DBJL 3WUWA 5I1IH 3AAZB 1NC2B 5LQBL 4U4BA 3RI5F 4JRXB 1WT5C 2VTFA 4APQA 5IWLC 1INEH 1WLHA 4I1NB 2JK5A 4HBCL 4NRYB 3P4LA 5IW1A 3BHBB 4FQQB 1K2DB 5EOCH 4YDLB 2F5AL 4YR6B 2B39A 3DX9A 5HYJD 4V2BA 5GSVA 4MQ7B 5LGJB 1QFWL 3LEYL 1U6AH 3T0VA 3QUZC 4QXTB 3U7WH 3EBAA 5KBNC 1NKOA 2R1YB 4WV1C 1DVFD 3ZE2F 2VLRD 2OM5A 4XNZC 5DRXB 2Z35B 1JTPA 3VD4A 1OF2A 5IVOA 1V7NL 4KHTH 1JNNH 5HGBA 3SGDI 2EXYC 3RGVD 3D69B 2QTEA 1NL0L 2A6KB 1MCNA 3O3EB 5EU6D 4U0QB 3EJJX 1UQSA 4NGHL 3WIFB 1GCFA 5JA9A 2MHAB 4NN5C 4GH7B 4LPTA 5I2IA 4U1IB 5F3HB 3CSBA 4TOYH 1P9MA 4Z7UA 3C6LC 3HPLB 4JG1H 4JFDD 4LHUG 1D9KA 4MD0B 4CVZA 4ZUVB 4HXAH 2J88L 1NCCH 5EC1A 5C1MB 3HLAB 5GSRB 2EIZB 3IDXH 1LD9A 5DJ8B 1QR1A 4IRSD 4XAKD 4P2OD 5FB8A 2CDFA 1IRAY 3NFSH 3QQ4B 3DSNA 2MSPA 4R4FH 3GSVB 1LEGA 2V5SA 4JB9L 5F9WC 5DD1H 4M6AA 2PR4H 1B3JA 4X4ME 1DBBL 5IK3A 3TH3T 2CRIA 3VXTA 4UT6H 1Z9MA 1TETL 4ZO8A 4AL8H 2H2SC 2B8OT 4LU5H 1LO3L 3GRWL 1SYSB 5B4MD 1IQDA 3MXWH 1F90H 2BFVH 2NY1D 2AV7A 3B9KD 2KUTA 4NT6B 4K55A 4R4ND 4GW4A 5BZWA 4OCYL 3UJTH 3KVQA 2KDGA 3BGMB 1IZKA 4ZFOL 2QADB 4GMSH 3RKPA 4ODUB 5TGBB 2DIAA 2VZ1A 5KVGL 1UC6A 5HVGB 4I3SL 1BZ9B 2HTLC 2OJEA 3CVHL 4FFYH 1Y6MR 3BWAA 3BEVB 2MTPA 4ZYKB 1EEUA 2EICA 3LN5A 1MJ8H 5T5FH 2H41A 4OCRH 2FR4B 5FUZL 3U7YH 1NEZA 3ZYIA 5KG9A 2D7NA 2HG5A 4EI5B 4X4ZA 1KB9J 2YZ1A 4KTDH 1U36A 3VFVA 3QUXC 3RTQC 4KU1A 4ISVA 5I8OH 1H3GA 1KEML 3KNBA 2CO7B 4PV9A 5I76B 3RIFF 4FN0A 3GO1H 4JO4L 2A6JA 1IGFL 3NMEA 2VL4A 3GDBA 3WUZA 5GS1A 4UIKH 3MZGB 3OKMA 3PNWA 2LU4A 4O2CA 1JE6A 5BMFL 1SYVA 4YC2B 3MV8B 1FGNL 1OTUC 1UA6L 4LCWE 1JWUB 4XVSH 2BRQA 3ILPA 3RUGF 4LDLB 3TBYA 2IG2L 1N5AB 4K8RC 4Z8FH 4Y5VA 1QPXA 4PLKD 3VA6A 4AZ8A 5TDOB 2B1HL 3BYYA 2PYEB 2X4UB 3H2WA 3BDBA 1Y6NR 3L5XL 3HG1E 4E41D 1KJ3L 4HS6B 4K9EC 1CICB 1IGYB 5K33A 4S2SB 4XCNA 1N2RB 3JBG7 4DEPC 2A83B 5F21B 5J3HD 1S7RA 1YJDC 3OAYK 3WIIH 3G5YA 4FMKA 4KI5D 3QDJD 2CXGA 3EOBB 2XTLA 3MA9L 4M7KL 1BAFL 3E0GA 2Y36H 4I9WE 3EYUL 1QSFE 4XH2A 2IF7A 1T5WA 1RIVH 3CH1A 2XI9A 4Q9RH 1RJZA 4CMMA 4JGUA 4M93C 1CGYA 3EFFA 1QLFA 4NQEE 1D5BA 3QIBD 4ZNCD 5L7XH 5F9JA 3DV6A 5HHNB 3HI6L 2YK1H 5HI4C 4Z7OF 1HYSC 2HA1A 4DWHA 3I9GL 4POZC 3QWQB 3I6KA 2ARJQ 2VC2H 2YMXH 4EIZC 4GRLA 2EDYA 1F6AA 1AXSB 4H1LG 1P7QB 4U1HA 4OD2A 1NCUA 5D5MF 1UM4L 4PREA 3CFEB 1K4CB 5A2JH 4M5YH 3IJHA 4UINL 5CIPB 4XMKH 2GUOB 1IM3A 1MH5B 2R1WB 3F7QA 3QG7L 1BD2A 1CK0H 3EGSA 3MXVH 1WWCA 3DROA 4FQXD 1A7QL 1KTKE 4X6CB 1IBGL 2A0LC 3BP6A 4M5ZL 3IDYC 1YN7B 4NCC1 4CDHA 1LE5B 1I1AC 3MUHL 5ESQA 4PYHA 3PV7A 2HAZA 1OB1B 4WW1A 5F9OH 3QCTL 4NN7B 3VXRD 1QBMH 3U36B 1OGAA 2NY2D 4BH7A 3IETB 1YEGL 5DUML 1QA9B 3PWVB 2XY2A 3OF6D 4OZFG 3QO0A 3B9AA 4OLUH 3IXTA 3QWRA 2VLMD 4MJIE 4BFEA 4IDJL 4TPRH 5D93B 3VRLF 3TPUA 3N06B 3IJSB 2XZCH 5H2BA 3T0EE 2UV3A 1Y6KR 1IT9L 4G7VH 5FA4A 1P4LB 1T80A 1YEFH 3ILQC 4NNYA 6FABL 4S1RH 1G7MB 3GM0A 5CBEB 1A1MA 3LS4H 3W9EB 1BFOB 3VXSA 5C2UB 1JJUA 1M1SA 1WBYB 3U4BL 5CBAB 4LAJH 4ZUWA 4TSCH 5C0EB 1JV5B 3E1F1 2VUOA 5IKCA 1L0QA 5DO2C 3HZMA 4B50A 1JPST 1DZBA 3WFZA 4AMKL 2EDJA 5FO9B 4AH2A 3TCXA 1F2QA 4ZS6D 3SE3C 1FG9C 2VR9A 1MWAB 1UWEH 3DARA 4J4PD 1QSED 4H88L 4QT5B 5DFTA 2XQBH 1NGXA 4I18C 4K94L 3HS0B 5AZEL 3LRGA 2NX5A 4KDTA 3UTSB 3V7MA 4WW2C 8FABA 5D7IF 5TE4H 4N0FB 1BZ7A 4R26L 5D2NC 1NJ9B 5IMOB 3IYLW 4U6XB 1U8JB 5JHLH 3NAAL 3EKCA 4ORGB 5C0CA 4PRHA 3P9MB 3IDGA 3LRSA 2YWYA 1X44A 1ZAGA 4UAOC 2X89D 2J3SA 4JFOB 4Y19B 3SDCD 1N8ZA 3U46B 5JORB 2OK0L 2JJSA 4GAFB 4M62H 1CL7H 3KPRA 1DN0A 1E6JL 2DI9A 1XCTB 3QO1B 4PPTA 3FTGA 3DV4A 2CXKA 2DD8L 1LE9A 1U92A 1GGTA 1OAKL 1FIGL 5KJRH 2VXVL 3BP5A 1RK0A 1RFDH 3ULUL 5E00A 4G5ZH 5D7KE 3DX7A 3VFOB 1MIML 5CGMA 3F8UB 3T09A 2DKSA 3B6SB 4KRPD 5I8CA 3WJLC 4N8CH 3EDDA 1C5DB 4L29A 5KZCB 5DK0A 3ARFC 4HF5H 3NCMA 1CFNA 4G3YH 2V17L 1TCRB 2ICEB 1HHGB 4DGVH 2VLJE 4I0PA 2Y5TA 4NN6B 1G7LB 5CSBA 3EDFA 2ZOLA 4F7MB 5B3JE 4NO2B 3SQOL 2PO6D 1CGVA 4XZUA 4JPWH 5ALBL 1A2YA 4WFHD 2Q8AL 2R56L 3PWPE 4FHBD 1JZ3A 1JHKH 5DWUH 3LQAC 5HYJB 4EXKA 2GSGA 3AFLA 5KW9H 2X4OA 4LHUA 4NUJB 4X7SL 4JN1L 3ZKSD 1XR8B 1G7QB 1CD9B 1DVFB 3JWNC 5C0AD 3OKNA 1FG2B 2VLRB 3GIVA 2EXWD 4NCDA 4MCYA 1A21A 5I1EH 3GM8A 1QLRB 4XPFL 1D6EB 1C12A 2FO4B 4LEOA 1V3LA 5FYLH 2R9HC 4JHZA 1IAOB 3EHBC 4L3EE 1CLOH 3NCJL 1MLBA 4MNGA 5ETUB 3RGVB 4LASH 3V5KB 4W70A 1X6NA 4PJ7F 1OP5K 3CUPB 4TTDC 5EO9A 1G7HA 4KKLD 3ARDC 5J7CC 4YO0A 4JLRA 5EU6B 4S1QH 1MHCB 4OZGA 2WUBL 4ZFZA 3O6LH 1SY6L 1YEJH 5HHQA 2QKIA 1MCSA 4BFIB 2P8PB 1J1OL 4YGVA 3GBNL 2E9BA 4CUCA 2VSCA 4FABH 3LQZB 1T1YA 4M7ZB 3UJIL 3LQAL 3CX5K 3HUJF 4CMHC 2UZIL 5C86A 5EC2B 3KYKL 4APQC 2F54D 3EO0A 3OSKA 1Q0YL 2GEEA 5K9JL 4P2OB 5L9DH 3VFRA 3O2DL 2YUWA 3CXHJ 1RURL 1D6VH 2GIYA 5DFVC 1LHZA 1KCSL 5DD6A 4WHYG 4S1DD 3QNYA 2L7UA 1Q9WA 4LEXH 3C5ZA 1AGCB 4O9HH 2R29H 3DMMB 3TLRA 4Z77A 2YWZA 2FGWH 5FYKH 4OCMC 1T0PB 5IVXF 3RY4A 4XCFL 4X8JB 3QB7C 4OGAC 3UTPD 1TZIA 4LPCA 2Z8RA 1JP5A 2AKRA 1NFDF 3GHBH 3D6GA 3B9DA 1QD0A 2EDNA 5F7YC 1KJMA 2K7PA 2YRLA 4TQEL 4G6KL 4WGWB 1GGIL 2WBWB 2XXCB 4ZPVA 1S5IH </