5L88L

Afamin antibody fragment, n14 fab, l1- glycosilated, crystal form i, non-parsimonious model
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
215
structure length
215
Chain Sequence
DIVLTQTPAIMSASLGERVTMTCTANSSVSSNYFHWYQQKPGSSPKLWIYSTSNLASGVPTRFSGSGSGTSYSLTLSSMEAEDAATYYCHQYHRSPPTFGSGTKLKMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-afamin antibody N14, Fab fragment, heavy chain
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
molecule tags Immune system
total genus 58
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2016-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l88L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l88L01
1NAKL 1IAMA 4PJGA 3TVMB 5C2UB 4PJBB 5TPWH 5F7UA 1IM3A 5MENE 2PYEB 3U2SB 3IAGC 4QHUA 3QNXB 2JK5A 4KPHH 3PP3H 4I8DA 3LEXB 4GAYA 4L8BB 5IT2H 2W92A 1DFBH 5JW4R 4KHTH 2Z31A 1MIEH 2GQHA 4YH6A 1NFDA 5DJ6A 3B2VH 3MRHA 1JI2A 4PLOB 3VXSB 4JY6A 2ITDB 4MJ5A 1OD7A 4IRJD 1P4IL 4P5MB 5D9SA 4HIHA 3BWAB 4QRTB 1T0NB 3ZL4H 3FQNA 4OV6F 3SCMB 5L2KD 4QTHB 4UU9A 5C09B 4HZAA 2OBGA 1MEXL 1MLBB 3O6FB 4KZDH 2ZWLT 5JW4M 3QDMD 1XMWA 1K9TA 5HGHB 4W6XB 3OJ2C 2CK2A 4ZPTB 1CDUA 4OFVA 1JHLH 4RGOH 3RNKB 4KK9C 3D3VD 3STZA 1R3HA 3TT3L 3U7YL 4WO4B 3ARWA 5HYFA 4Q9RH 5DJ2A 4P57B 2NW3B 1KJVB 1JIBA 2DLTA 5I1AA 3JWDC 5HY9A 5HHNA 4YDLC 5TE4L 2OP4L 2YPKB 4X8JB 5T3XH 2ZSVA 5IV2B 1T2JA 3M8OH 5L2JA 3MR9B 2B1HH 1EEZA 1XT5A 4MA7H 1PZUB 1Z5LB 1IAKA 3EIFA 3CUPA 1U2CA 4LAJH 3VRIA 4JPWH 3RP1A 3FMGL 3VMNA 5I1LA 4OSUH 4LSQH 3NIFE 1LO0H 1E28B 3S37L 3TA3D 4QRSB 4HG4K 1CGSL 2NR6D 3V8CA 3GJFH 1U6AL 5KTEL 2VL4A 4FS0A 1ZEAH 2RB8A 2ERJB 1A6WH 5D1QD 4OZIA 3PIQA 3MXWL 5I30H 3E2HB 5KVEH 3WIHL 3BKCH 1OF2A 1A6AB 4S0SD 2ZPKH 1CICA 4OZ4B 2APTA 2Y07L 1NGZB 1EJOL 1U92B 2P5WA 3FQRB 5HDOA 3MRFA 4DK3A 2AQ2A 4JY4B 3PXJA 4MCYA 1PG7H 2BVQA 3BHBA 4P3DB 1F3JB 2F74A 3MV8E 5LXGL 2HFFA 3F7VB 4XP5H 5K33A 5D96C 3TNMB 3GIZL 4XP6L 3X11B 5IEKA 2YZ1A 1L7IL 5C0RH 3TZVD 1YN6B 5I8OH 5IMMB 3CPLA 3NH7L 5E0QA 3O3AA 3RQ3A 4R96A 2AEPL 3HNVH 1XIWC 1NAMA 4GUPA 4Y1AD 2J4WH 2XPGA 4KUCF 1KYOK 3WNKA 3UYRL 4U4BA 3S6CA 5A2LH 4G6KL 2VXUH 3C5JB 3NFSL 5JHLH 3VGEA 2AXFA 2QADC 4OZGB 3GKZA 3T0EE 2NXZC 2AXJA 4NBXB 5EB9A 1A7QL 3HFML 4XP4H 1I8KA 2KH2B 3PJSA 3SGJC 5FKPA 1C1EH 4Z7UB 1YQ2A 5FYLD 2BDNL 5C1MB 1HSAA 4PJ7E 4L9DA 4O2FB 5MEND 1OTTC 1DZBA 3D2UD 4QRRE 4G43B 3H9HB 4ELKB 5A3ID 2R2HB 1J10A 3O0RL 1G7QA 2F8OA 5GSRB 1P9MA 3BZEA 3W9DB 1U93B 3C6LA 4QT5A 4BSWA 1P6AB 1SMAA 2AAVA 4KK5D 3EKCA 1NMAL 4G6ML 3GSNA 5EFIA 4G8GE 4JCLA 2DWDA 5IB1A 3DRTA 1PSKH 3EJZC 1RURL 3LQMA 1A1MA 3RL1B 1MFNA 4NWTL 2FB4L 1HYRC 4N0CD 4PGBA 3RWJB 4UOW0 1URLA 3L3GB 2LFGA 1AHWB 2HJKA 4NQCB 1QACA 3C5SA 3VWKC 1I9EA 5ICYB 1LMKA 4EXPX 4XCNB 5D8JL 3AFLA 2WWKO 2R4SH 2Q87A 5JUEH 1NFDE 5CZXD 4MXVE 3L95A 3IF1B 4MNGA 1MCJA 3NGBB 2H2PC 1H15A 1Q9OA 1F13A 1OGAB 2EH8L 4Y5XB 5CEXA 3L3KB 5GRVK 2CXGA 3OXRA 2EZ0D 2NX5A 4M1CC 4PLJC 3Q5YA 2AK4B 5AYQA 5LVEA 1FCGA 4LSPH 4KK6C 4Y2DC 5AZ2L 3L5IA 2ADJB 1VA9A 4UT7H 1JF6A 4G42A 2GSGB 1XH3A 1P69B 3NN8B 2ZUWA 4AL8L 1J05A 4LCUA 2CRMA 4HW6A 3C5ZB 4L9LB 4P46D 3WNOA 1RZJH 4U1IA 3ZSTA 4O2CB 2VR9A 1FO0L 1AR1D 2A73B 4JAMB 5B21A 3L3OA 5BW7C 3FN3A 2C7UA 3MLRL 4S11A 4LSUH 1RU9L 1S78D 3H3KA 3DURB 4FXGB 3MV8D 3NTCL 4NNYB 4WI5A 1S9XA 4KKAD 1DBKL 1I9JL 3FO2B 3FAXA 1IFHH 2CK0H 4NQSB 1RZ7L 4BSJA 2VQ1A 4PP2A 4LK4A 4BZ1H 1DLHA 2DN7A 3RX8A 4C83B 4OI8A 3D85A 2JJVA 3EYOA 4L8DA 1NCTA 1KJ3H 4YJZL 4OZIE 3RGHA 3T0DA 5EPMA 3UTSE 3T0ED 4NZTL 1I1FB 1OTSD 3KPSA 5B38B 1AGFB 2Z91A 5F1IB 3F8UB 4PTTA 2X4TA 2VNCA 4PGCA 5IIEB 4P5TB 3DV6A 3TH4T 4Y19E 1MNUH 3KPLB 4QHNB 1FVEB 3GMQB 5GRZA 4KQ4L 4L5FL 1FNSL 5J57B 3RDTD 2GFBA 2Q7YB 2EECA 1EFXD 4QRRD 5KSBF 3ECBA 4HUVA 5HDQH 4X6BA 4GG6F 4PJCB 5ACZB 5IUSA 4WO4C 4X5XB 2NY6D 4XCCL 3GNML 1M6OA 2F5BH 1DLFL 3VI3F 1AIFA 2NY0B 3IDUA 2Y23A 2NYYC 4G8GD 1NKRA 4FMKA 4XPFL 2IH1B 5K9KB 4MWFB 5DJCB 4DK6A 2X6MA 4ZS6D 2F5AL 3BMVA 3GZKA 4GBXD 1EMTL 2UWEA 2ERJC 4DAGL 1INEH 3E2HC 3MOBH 1NGPL 1PG7W 5ALBL 2MOVA 4PJ5B 2FNBA 2X9WA 2Z31D 1A4JA 3QIUA 5CUSL 2QSCH 3LD8B 3MLUH 1I3GL 2J88H 5JLZB 2IAMB 3MC0A 4Y4FD 3CJJA 1PY9A 4FN0A 4NDMB 3TBYA 1TVHB 3RY6C 4Q6IA 3LB6D 1WC7A 2B1AH 2V9TA 1UH3A 4XNXH 4K2UL 1RZJC 2XNAB 2APFA 5CBAB 1SBSH 1HHKA 4N9GB 5KVDH 4ZFOA 4QOKB 2LVEA 2YUWA 3OAYH 1IGFH 4XRCB 4XP9H 1HH9B 1BECA 3K3QA 2VSCA 2X1WL 3UO1L 4OCXL 1M1SA 2LTQC 5IWLA 3KHOA 1C5DA 4JVPA 2G5BB 1KJ2L 2JKXA 2DTML 2SEBA 5IVZA 5DVNA 5ALCL 1RMFH 3DARA 1YMME 4OF6A 4MAYA 4MNGE 2WZPD 5D93B 2JELL 4KKLC 5F7DA 1MFDL 1JHKL 1S9VA 2AJXH 4WNQA 4LHUA 5IB3B 1IGCH 4LPCA 5JPNA 2H3NB 2XZQH 2AI0H 4FFZL 1H3PL 3F65A 4M48L 4E41E 2E7LA 5I1JL 3LOWA 2WINA 3U30B 3B9KA 5MEQA 2WANA 3UTSD 3ELAT 5F7EH 5F3BA 3PQYA 1CICD 3L7EA 3BE1L 4HS6B 3KYOB 1BQLL 1OSZB 5E2TL 1QRNB 4CVWA 1I8IA 1YEGH 3B8YA 2IADA 3MRMB 3NABH 4DGVH 1FAIL 4Y19D 2W60A 1RJZB 1S5HA 2H2SD 3ESVF 3OX8B 2R1YA 1S8DB 5C92A 2J8UE 3WUWA 5E00A 1T1YB 4F7EB 1ZGLP 4B50A 1KEGH 3S35X 1AHWC 4UDUB 3U36A 5KVGH 4ZFZB 3B8SA 5EU7C 1TPXB 1SYVA 2CR3A 3P4LA 5EC2B 4WVRA 4JANA 1N59A 3MA7A 2P5EE 4ZSOB 1EERB 5ERWA 1Q0YH 2WSKA 3TO4B 5J6GA 2FO4B 1JL8A 1BZ7A 3EOBB 5TF0A 5HHME 3QDJB 3HI6L 5JZ7C 1TCRA 3TLRA 5EOTB 4Y5XC 3QG7H 4ELMF 1CLZL 1QR4A 4GAJL 4ZO9A 5A2JH 3BT2H 1KSRA 3VFRA 2J8OA 5FGCE 1VGEH 1BOGB 1YY8A 2FHBA 5SX5K 1HKLH 4NC0B 3G04B 1U58B 1G7LB 1GAFH 1FC2D 1FZJA 3BKJL 4PB0L 1BJ1J 2WQRA 4JN2A 4MLSA 3RPIA 4AG4L 1NEZB 3RTQD 2VN7A 2UY7A 2VDML 3QXTA 2OQJA 1EEYB 1RY7B 1GXEA 3C5ZC 4L9LC 1J1OH 1KJMB 1OAZH 2HLAB 5GGSA 2V7HA 3U1SL 4ZTOH 4HWZA 5LAXB 4IIQA 2WUBH 3N1GC 4LBEA 1ED3B 3C6LD 3GRWH 3T65A 4OKDA 4BH7B 3BVNA 2FIKA 3IAPA 4LCCA 1HHGA 2X70B 4XPTH 4ZXBD 3BISA 2H8PB 4IOSD 3KPMA 2UVFA 4UTBH 3ROOB 4DUXA 5B39A 4PTUB 1NC2B 3TYFA 3KYKL 2ENYA 3FFCB 2GK2A 1YEJH 3WD5H 3ZTJH 4O58H 3PG2A 5DJDB 2EDXA 2UWEE 1LD9A 4X4YA 1UWEL 1QSFB 2VLKB 4F8TA 5ABDE 3WFCL 4X5WB 4LCWA 3FQUB 4KI5C 5EU5B 1AXSB 4JFFA 4NNXB 4PG9A 2FWOB 5I8CA 5ILTL 3NFPA 2XA8H 5KSVB 2BP3A 2GJ6A 4JM2A 1YMMD 5TH2A 5E8PB 3E0GA 4DGIL 3O4LA 4DN3H 1XF4A 1FDLL 3B9DA 1S7VA 4H1LA 4OGYL 1CZ8L 5EU3A 5HXMA 4N0UE 1F4HA 3VFTB 5ADOH 2HRPH 1CGTA 4N9OB 1LILA 1N8ZB 4E41D 4G7YH 1I7ZA 3UJJL 3R8BB 5DJZA 4OLYL 3MV11 1MRFH 1G7IB 3SO5A 1Q94A 2JJTC 4OIAA 1XF2A 4KY1L 5T1KB 4NP4L 3EYQC 2J6EL 2MCPL 2Z8RA 4GW4B 3TCXA 3BPNB 2ICWJ 5E2VH 2AERT 2DQUL 3LKOA 3MJ9L 3ZE1E 1YZZA 5E8OA 5IQ9A 1FN4B 1PGRB 2OZ4A 4XBGB 1PBYA 2NZIA 4FTVE 1A9BA 4PJDB 2XZCH 1X7QB 2P5ED 4X6DF 1B0RA 3D85D 3IXTB 4HCRH 3VRLE 15C8H 4NO2A 3K0WA 5HHMD 3LD8C 3TGXA 3FO0L 5JW3H 4S1RL 1YECL 2IAMC 5EIVA 1YMHB 35C8L 1OT2A 3TBWA 4JM4L 1S9YA 1B0GB 5DVMA 1DDHA 1IGTB 1GSMA 4PG2A 4KJQC 2I9LB 3WSQL 1A1OA 4Z76B 1U8LB 2F53B 5I17B 2GIYA 4XH2A 5IESL 1KB5L 2BMKB 3DO7B 1U8MB 2P8MB 3WS6C 1VFOA 4I0PA 4PJHE 4Z77B 4Y16C 2R4RH 3BAEL 3DUHA 3CX5J 3QUYA 3RVXC 5KJRH 2A6KB 4U1SA 1P4IH 3V7AG 4B5EA 1ORQB 1JGDA 5I1KL 3PABA 4PY8I 3GSOB 5KANG 1CFVL 3O3BB 2QKIB 2HN7A 2LU7A 3QJHB 2A1WL 4NHCH 2H1PL 1MEXH 2VXQL 2X7LB 1II4E 5IBTL 4JN1H 1I1YB 1UENA 4HPYL 5IMLB 1ZHLA 5J12B 5HYQB 1C5BH 3IJSB 4YFDB 1AD0A 3OKMA 1VESA 1ZLVH 1S7RA 3K2UH 3TT3H 3U7YH 3U30C 1MY7A 3WN5A 5EC1B 3QBTB 4PJBF 3GIVB 4QXTA 1FV1B 5I74B 3K4AA 2AP2A 1IM9B 2GJZB 5TE4H 3QIUD 2OP4H 3QUXB 2BSSB 2IF7A 3GEWB 4LF3A 2X4NA 3HC0A 1N64H 3FMGH 1NGWB 3QP3A 5CHNA 2CLVA 3ZKND 3F58H 3VE0B 2WK2A 3S37H 2H41A 3ARUA 2E27L 1CGSH 1NDMA 4LSVL 1U6AH 5KTEH 2F54A 3MNZB 3MXWH 3HMWH 4PUBH 4ZUTA 3WIHH 4HS3A 3X12A 2CKBL 3TO4C 5IVXF 2GK0B 3MRLA 1H0DA 2Y07H 4ODWA 1MVUB 4I3SL 5E8NA 3B5TA 2R1XA 1OAXL 1EJOH 1NKOA 2X4SA 1OAKL 3LH2L 3VFMA 5J0BA 3BQUA 5IB4B 1OARL 3ARFB 3O4OB 4JFFE 3FB6A 5KSBA 2VDPL 3TM6A 3MLPA 5KSAA 2GJ6E 4X4MA 1AP2A 4X6FA 3O3UN 5LXGH 2UZYB 2XTLA 3VH8A 1KPVB 4WUKL 2HVJA 3O4LE 4MAYD 3UAJD 1T7XA 2XI9A 3PWUB 4ZG1A 1S9KC 5E56A 3GIZH 4XP6H 1FO0B 1L7IH 3UTTB 4FTVD 1WCQA 4JO2L 2AEPH 4JFHE 1A8JH 2QJDA 2J7LA 4ETQB 5C0IB 1GCFA 3UYRH 4DWHA 4W68A 3NFSH 3O9WA 4FXLA 3MRPA 4QWWC 1KN4L 5I0DA 4HSQA 4Y5VA 4PJXE 5T5NF 3KR3L 2GHWB 5FV1L 4Q58C 1JTOA 4QCIA 1A7QH 3HFMH 5ID0B 5JORB 1Y6NR 4MXQC 2XA3A 3BZFB 1S7SB 2W9DH 3W5MA 2BX5A 2BDNH 3DX9B 1Z3GH 2ADFL 3E3QC 5JQ6L 3BZDA 3QWOA 4K3JL 3O0RH 1OB1A 3MACL 5MEOA 2AXHA 1NQBA 1TJGL 3ALXA 4JE4B 1X5HA 4RBPK 3GMLA 4ONHB 1OT1A 3VMPA 3S96A 4UOJA 3QEQB 4QRQB 2PTUA 1T6VN 4EI5A 3E6HB 3HZYB 5FB8B 2P24A 3BMWA 1NGYA 4YDJA 3TWCL 3OJDA 1NMAH 3RIFK 5D6CB 4XNQA 3RWCA 4OZGF 2EXWD 2X41A 3Q5TA 4FQ1L 4WTXA 3T77B 4Y4HA 1RURH 2FEDC 1VFUA 3CH8A 4PRPA 4NWTH 1MQ8A 2EYTB 4I2XB 4IMKA 4YC2B 3V6ZA 4AY0A 5C9JA 2PR4L 3DGGA 5HVFB 5LGJB 3BI9X 1Y0LB 4DEPB 4Z7UF 3WJJA 1UZ8B 3DYMA 4J7RA 1OAUL 3NZ8B 3ARBA 4Q7DA 4H8WL 2Q8BH 1FZMA 5TDOB 5D8JH 4R7DA 5EZOH 2VZ1A 2QQLL 5BV7L 3IDGB 4JY5L 4PRDA 1KIRA 3BEWA 2R1WA 4YGVA 3LN5B 2BVEA 4AEHH 3DX6B 2EH8H 1MCFA 1E6OH 4TNWF 3IT8D 4ZO8A 5A2KH 4YBQD 3BPNC 1UWGL 5AZ2H 5FYJE 3BD3A 3FO1B 2ICWA 2AJUH 3OR7B 5DJXB 1INQA 5GZOC 3IRZA 3BGFB 1S7WA 1MJ7L 1U8NA 5BS0B 1FGVL 4YBLB 3NCJL 2DQTL 3MV7B 1VFAB 4AL8H 3GBLA 1ZTXL 2ESVA 2EKJA 4Z7VF 2YOCA 1T4KB 3HPLB 4WUUA 1FO0H 1KV3A 1XCTA 4LCWD 1JPSH 4CADA 4QGYA 4JFFD 2CLZB 3O2VH 2VUOA 2GJ6D 2KUTA 4OTXL 5B8CA 4JM2D 3NTCH 5F88A 2M1KA 2DIAA 3O4LD 5HPMB 1MVFA 1DBKH 1I9JH 5I75B 5HGBB 2P42B 3B4NA 3N9GL 1KJ2B 1RZ7H 1NFIB 3OXSA 4CW1B 5DHYA 3VXUB 1RZKL 1YEHL 3DHJA 4N0RA 4PD4J 4JFHD 4LRIA 2JB6B 4ZDHA 4YHIB 4ELMA 3MCG1 3FB5B 4WEBL 1FVDB 2PXYB 1U3JA 2F54E 4JKLA 4HJJH 3T2NH 3C08L 3QRFM 3BP6A 5FUZL 4ETYA 4JHAL 2QR0A 1JF1A 4CVXB 4OUUA 3DWTA 4NZTH 1A5FL 3SKNB 4YHZL 5EBWB 2WIMA 4M1GH 2AEWA 4IBLT 4JFEE 1LP9A 3PWLA 1D3CA 4M7LT 3PHOA 4LP4A 5J13B 1P7HL 3WL9B 43CAA 5ISZA 3RHWF 1Q9LA 4P2OC 4KQ4H 4L5FH 1T66C 3Q0HA 1FNSH 4K71B 3VFOB 4JDTL 4HX1B 3A0OA 1CN4A 4NKOB 1JMZA 3MRNA 1DQJA 4BH8A 4J3OC 1HXYA 3RVVD 3VI3E 3MV9E 5CD3B 4XCCH 1XAUA 1DP0A 5CWSB 5I74C 2E7BA 3WLBA 4CNIB 3QUXC 5JR1L 3R0NA 2V5RA 3VFSB 1A22B 1F8TL 5L88L 1P6FA 1CG9A 4F7TA 5IW6B 4HUXB 5HGDB 4KI5F 5C08A 4MS8C 4CVZA 5DTFB 4MSWA 1OTUD 4DKEL 1XR8B 2F5AH 1J8KA 1EMTH 3MPCA 3UEZA 2H26A 4DAGH 4EUPA 4HKJB 2MQ3A 3BIAX 3MCLL 1NGPH 4XC1L 4ZUWB 4I0PD 5ALBH 4WW1A 3V8OA 4YDVA 5GGUA 1DEEB 1XGYL 1I3GH 2NTSP 3ZZ1A 2XTJE 3MFFB 3P77A 1FSKB 3MRCB 3RL2B 4POUB 2ZUQC 4PJCF 4I4WB 2CO7B 3ARFC 2E6JA 3O4OC 3SGJA 4QHKI 1K4CA 4OJFL 1J1XH 1QTYT 4OGXH 4UIKH 4ZOCA 3RZCA 5DMKA 4Z7OF 1GC1L 4PBWD 4AMKL 3R0MA 5I2IA 5EWIL 1P7QB 2HJLB 2V5YA 4N90E 5FYJD 4OGAC 1XZ0B 5F44A 1OP3K 2W07A 4JHWL 4PRPE 1X44A 5HYSA 1TZGL 3KLSA 3QDHA 3LSOB 4J4PC 5AWNH 2Y4SA 2I9TA 1WFUA 3P9MB 3TC9A 3UO1H 4OCXH 5DUML 2FZ3B 1T5WB 4OFKA 4P9ML 1JK8B 1KJ2H 3I3DA 1QEWB 3HI5H 5ALCH 1A4KA 4XI5D 3OJVC 2X4QA 2DD8H 4X6DA 2VDNL 3VDCA 2JELH 1S5IH 3MFGB 4M7KL 4OLUL 1ZT1A 1PZ5A 1SEBA 3V6FB 4GRMA 3UDWC 1UCTA 4KVCL 2O61A 3MLTB 5C07B 2CDGB 1I3VA 1R5VB 1TZHA 5I1JH 4DCQB 2F54D 5C2BH 1RJCA 3BE1H 1WV7T 5I71B 1BQLH 2I5YL 3VXNB 5CS7A 2DI8A 2V2XB 5GS3A 1R5WB 1FJ1B 3PV7A 3FT4B 2HVKA 4U6XA 4UAOB 4QNPF 1OP9A 4WUUE 4JFED 3OB8A 3W0WE 1FAIH 5DUPH 5GIRB 2OS7A 7CGTA 4R4BA 2Z35B 3CU1A 1NANI 1PJ9A 1J7VR 5GRVL 4Y2DA 3HI1A 3ARVA 1HN1A 1IARB 3O8XA 5FECA 1FYHB 2NLJB 3Q6FB 1B2WL 2RFXB 4R90H 1K5NA 2DMBA 3MV9D 1TVBB 4JO1H 3SQOL 3WO4C 2QQKH 3O9WD 4GQPH 1DE4B 5BW7A 2VLRE 3FKUS 3MUJA 1U9KA 2AV7A 2A6JA 5CZVL 4RFEB 1U8KB 5D7LB 1FVCB 3AXLB 4GAJH 5TF1H 4HBCH 2VIRB 1INDH 3TVMA 1NLBL 4PJBA 1LP9E 2BC4B 2PYEA 3U2SA 3QNXA 5DURD 1XGPB 4QXWA 3LEXA 4L8BA 1UACL 3BGFC 5ISZE 1TZIB 4PB0H 2CUHA 5L8KB 4AG4H 3PHQB 3VXRB 3VXSA 2ITDA 2XKUA 4P5MA 3BWAA 2XTJD 4QRTA 1T0NA 2VZTA 3U1SH 3BXNB 4D0CB 3FRPG 1PFCA 3SCMA 1KB5B 4QTHA 5C09A 1KB9K 3OPZH 1MLBA 3O6FA 4RSVA 1KLGA 5I75C 4N90D 1QSEB 5HGHA 3AVEA 3LKNB 4Y4HD 4WHCA 5HDBE 3KYKH 4U1HB 4ZPTA 5C08E 1KIQB 4PRPD 5D1XC 3RNKA 4JFPB 2CMRL 1F00I 4LDLB 4WO4A 4AEFA 1FFQA 1DVFD 1UWEH 4P57A 2NW3A 2ITCB 5ENWB 1KJVA 4XVJH 1MAKA 3WFCH 3E1F1 2PTTB 4LLVB 2EDJA 1BVKB 1DUZB 2YPKA 1WF5A 3ARBD 4X8JA 5IV2A 3MR9A 4FHBD 5ILTH 1NGXB 1Z5LA 2VKXA 3T3ME 4P99A 5H37G 1N5YH 1MCEA 2YA0A 4XXCC 4DGIH 4MD5B 3ZDZE 1MCCA 2E6QA 5JXED 1E28A 4NQDB 4LSSH 2YD5A 1N26A 1F90H 4QRSA 4DFIA 1TTFA 3HC4H 4I3RL 2Q8AL 3K2MC 4WWKC 1NDGB 3MNWB 4YX2L 1A7BA 3CC5B 1A6AA 3CH1B 4HJGB 4OZ4A 4OF0A 1L7TL 1R3JB 2VDKL 1NGZA 2AXGB 1CXEA 3UJJH 1U92A 3BYTA 5HGAB 4OLYH 3FQRA 3V5KB 1ZT4B 5LBSL 4BFGA 5D2NB 5DRWB 3P73B 4WUUD 1EVUA 4JY4A 5GJTL 1MLCB 3HKFA 4KY1H 3RY6A 3W0WD 3QXAB 4P3DA 1F3JA 4NP4H 2FO1A 2GY5A 3F7VA 3I75B 5GPRA 2B8OT 2CKBB 3VA2C 1JNNL 2MCPH 2HA1A 3TNMA 2NZ9C 3X11A 5IMMA 1YN6A 3PGCB 4P4KD 2DQUH 2Q3AA 2YZ8A 3KHQA 2UYLB 3OKKB 1BMGA 2A9ML 1WZLA 1YPZB 4WW2B 3C5JA 4UBDD 1Q9WB 4OZGA 5A43C 3CVHL 4HT1L 4U6YB 3PNWB 3FO0H 4XT1C 4S1RH 1YECH 3HRZB 3EYVB 2VLRD 35C8H 3NCBB 4OM0L 4JM4H 3DOSA 5DJ0B 1DEDA 4ISVB 4Z7UA 3I02B 5T3ZL 5J11B 4FQXB 4RAVB 1H3GA 1Z0MA 1IEBB 2DYPD 4PY7B 4O2FA 4YZFF 2IANB 4HMDA 4PJ9D 4G43A 5ISZD 3H9HA 5KANI 2YRLA 5IESH 4ODSL 2R0KL 2R2HA 2LAAA 4ELKA 4Q9QH 4FOMA 4M02A 3ZTNL 2W1NA 3HZVB 2OSLB 5GSRA 1A6TB 3MMEB 3TYGL 1CD9B 1MCWW 3BAEH 3W9DA 1U93A 4KMQA 1FNEB 4TSCL 1LWRA 4PJDF 5E8DL 3KAAA 4TQEL 4XMKL 2UY6A 1CFVH 3RL1A 4HWEL 2A1WH 4JCMA 2H1PH 4OCRH 1K4DB 3U83A 3RWJA 4LLWB 1CVRA 1NUFA 3P0VH 3MLVL 3L3GA 5C08D 4QTIL 4HPYH 1CD0A 4P3CH 1AHWA 2VZSA 5C6TL 3B5GA 5JOFB 2PYEE 4NQCA 3X14B 4HC1L 3GJFK 5ICYA 5BZDB 2IBZY 4XCNA 3CFJB 5B3JE 4OLZH 5F9WB 2ED7A 3QIWB 5I71C 3S97C 3AS0A 3CLFL 4J3XA 3IF1A 1V05A 5C0EB 4WHYH 1OGAA 1E4WL 4Y5XA 3L3KA 3ZE2F 3KLHC 4HUMB 1JMXA 3MCKB 2AK4A 1J86A 3PV6B 2D0FA 4GRLC 1I9IL 5C09E 4JR9L 1G9NC 2ADJA 5DA0B 3RZCD 4JPIB 2E27H 2FH6A 1A6UL 5BV7B 1WVZA 2BY1A 5C0AB 2GSGA 4LSVH 5C0BB 3NN8A 4LVEA 1UB6B 4RRPG 3M07A 3C5ZA 4L9LA 2CKBH 3CVIL 1C7TA 4O2CA 1I7TA 2WW8A 4DVRH 4I3SH 1B6DA 1OAXH 2A73A 1NSNL 4JAMA 4AEIH 3B43A 5JQHC 2GSIB 1A0QL 3BUYB 4RIRB 4Q6YA 1OAKH 3LH2H 5HDLA 1RVFL 5IJVB 1UM6H 3TT1L 1OARH 3DURA 4FXGA 5DDHB 4HK3J 3BN9C 4NNYA 3FO2A 4B53A 4OGZA 4NQSA 4OCLC 3FHQA 4WUKH 5FF6B 2WV3A 4C83A 4JQIL 1S3KL 3W11C 2D0GA 2VC2L 4LOUC 3SDCC 4Z7WB 5ANME 4U1MB 1QFUH 1KN4H 1I1FA 4G80B 5B38A 1AGFA 5F1IA 4QRPB 5IBLC 3BP5B 3KR3H 3AMLA 4C54A 3KPQB 5IIEA 5IKCB 4G6FB 1RHHB 4P5TA 4FQHB 4BK4A 4PJ8C 3CFKB 1T04B 1UT9A 5IJKC 4GO6B 3KPLA 4QHNA 5F1KC 1FVEA 3MRKB 2P8PB 3GMQA 3QR2A 3DVGB 2Q7YA 4KK6D 2FX9L 2DL9A 1DCLA 3U4BL 1JZ4A 4NZRL 4PJCA 5ACZA 3QYCA 3WFBL 5LCVL 3S3JA 4X5XA 3ZKXB 5DK3A 4X7TB 3MACH 3O8XD 1ZGLB 1TJGH 2CRZA 1UQSB 1SVZA 4NZDA 3VGAB 1JNHB 3C60C 5F70A 5FIEA 4JHZA 1FHGA 3VFUB 2FLBT 1JV5B 5K59F 5DZOA 1IAOB 5MI0B 4C59B 3TWCH 2IH1A 1A7NH 4RGMB 5K9KA 5HHQB 1VB9A 4FQ1H 4MWFA 5DJCA 4AM0B 2NMSA 5ESAB 1DBAL 1JWUB 5DR5H 3TVMD 4BFIB 2WIIB 4HLZH 2PYED 1YY9C 5JO5B 1ZA6B 4PJ5A 1OAUH 1LO2H 3CCHB 4EQ2A 2FGZA 4H8WH 5JLZA 4LVNB 3KS0H 2IAMA 4P2CG 2VRAA 1A7PL 5ETUB 5C8JB 3BJLA 4R2GD 5SWZB 2QQLH 5BV7H 1V8HA 1LEIB 4JY5H 3KYNB 4NDMA 1TVHA 3S4SB 3B2UD 3R1GL 5CBEB 5HHXH 3SCMD 3VXQB 1UM5L 5C09D 1UVQB 2PO6D 2XNAA 3MYJB 3O6FD 2XRAL 5CBAA 2E6PA 4TSAL 2FJHB 2B39A 1UWGH 4N9GA 4QOKA 4TRPL 3HE7B 5GZNC 5H94B 3GRWA 4ENED 4XRCA 1HH9A 1MJ7H 3D9AL 5IOPB 1FGVH 3RA7L 3S98A 3NCJH 2DQTH 2DDQL 5I1CH 1ZTXH 2G5BA 3V52L 3MUY1 4ESKA 1FORH 3S36L 1C7SA 2BFVH 4AK1A 5D7KE 5HGGS 2VISB 1CFNB 1OL0A 5J11C 3QFJB 4OTXH 1OGAE 1CGXA 1SJEB 2R2CA 3F7YB 3EYSH 2G5RA 5KZCD 2AK4E 3FFDB 5F9OL 5IB3A 1JGVH 2H3NA 1FNHA 3L5XH 3N9GH 1GIGL 2P45B 3VD5A 1YEHH 2W0LA 3EJJX 4WEBH 4XX1E 4HS6A 3NACL 3KYOA 1NCWL 3C08H 1OSZA 4HJ0C 1QRNA 5FUZH 5B4MC 1CXFA 2L4OA 4JHAH 4UZGA 1A5FH 1CGUA 5F21B 3WDJA 4YHZH 4XVTL 3MRMA 4YPJA 2WBJD 3NCCB 4UT9L 3TO2B 1RJZA 3OX8A 1S8DA 5IFJB 1U3HB 1T1YA 4F7EA 2EKSB 2FGWH 1MCNA 5DJYB 4JFQB 2CLRB 4JG1L 5AG9A 4ZUSB 3M1BB 4UDUA 4L3AA 4LQFL 4ZFZA 1LDPL 4JDTH 5EC2A 2R39A 3Q5OA 4ZSOA 1QNZL 1YUHB 3TO4A 2FO4A 2EIBA 3ZKSD 3EOBA 3WDIA 3QDJA 3QIWC 4EBQL 2P44B 5EOTA 4RX4D 3SDXE 2JTDA 1F6FB 2HG5B 3QCTH 5TFSL 1FLRH 1N7ML 1F8TH 1UCBH 3RX5A 1SBBA 5L88H 2QSVA 4HCRA 2Y5EA 2E5EA 1BOGA 4IHOB 1UXWB 4Z9KB 1Z2KA 5J1TC 3OTTA 3G04A 1U58A 4N8VG 1G7LA 4DKEH 5BV7C 4UQ2B 2FJFB 4XAKE 1L0XA 1NEZA 3G5XB 5EOCL 3LVEA 3SKJL 1EEYA 5JHDB 1EUUA 3OAYK 3OGOE 1KJMA 2HLAA 4G5ZL 3VU2A 4Y7MA 2XY1A 1XGYH 1XGQB 5LAXA 1ED3A 1DBJH 4Y8DC 5E5UB 3ZHDA 1YYML 4Y5YC 4BH7A 4LSDA 4WEMB 3RBGA 1KULA 4Q0XL 4M5YL 2X70A 4OJFH 2H8PA 5MP6H 5JW4N 2DQDL 5EO0B 3ROOA 1GC1H 4PTUA 1NC2A 5EWIH 3FFCA 1QA9B 3D25B 1VSCA 3MQIA 1QYGL 1O0VA 3FQNB 4QY8B 1FNFA 3W39B 4JHWH 5DJDA 3GDBA 2W9EL 1TZGH 4X7DC 1RUQL 4FZ8L 1QSFA 2VLKA 2WNGA 4X5WA 3FQUA 1XCQB 5EU5A 1AXSA 1XF5B 4JDVB 4LASL 4U1JB 1MFCL 4NNXA 3UJIL 2FWOA 1ND0B 4P9MH 3HE6C 4PJ5E 5D7KD 2HTLC 3ULVL 1I7UB 5KSVA 5C9KA 3K8KA 2QV2A 4KFZC 5DT1H 1BFTA 3QHTC 5CJXC 4XXDB 1J0ZA 5E8PA 1NBVH 3W2DL 4MYWB 4PJFB 2E9IA 3T1FB 5E08L 2BXZA 1OGAD 2UZXB 5I0ZA 1WWWX 1QFWI 1LE9B 2AK4D 3VFTA 1ZHKB 4JJHA 4M7KH 4OLUH 1EGJL 3RGVB 5TJWK 2EDQA 2PF6A 1N8ZA 4KC3B 5TDPB 4QOKE 1M05B 3G6JE 4IRSD 5LWYL 1G7IA 4QNPE 2AEQL 5I1EL 2OTPA 2BY3A 3TFKC 3AB0B 3JZ7A 5MI0C 5T1KA 2DM3A 5AEAA 3EO1B 3WIHA 3CGTA 4YQXL 1BBJB 3FOLB 1LGVA 3V4VL 4M62L 4GW4A 3BX7C 4K7PY 2NY3B 2KKQA 5DZLA 1OW0C 3AS2A 5F7NC 1FN4A 2NXYC 4XBGA 5KW9H 4PJDA 3GGWB 3SKOB 1X7QA 3NCYS 5IHUL 4YUEH 2VKWA 4ZTPH 3IXTA 3ULUL 2BNRB 3PGFH 4YHKL 4OZHB 3VFNA 3D6GA 4Y4KB 1IKFL 3SQOH 1YMHA 4RQQB 1B0GA 3GHBH 1NCDL 5CJ8A 1IGTA 4XHJC 2YD1A 1D9KB 1I8LC 3QAZC 2MQCA 4P23B 2I9LA 4LP5A 4TYUA 4R0LB 3KPOB 5CZVH 3S3PA 3IDMB 4P5TD 5DFVC 4YNYB 4I0CC 1YEIL 2HLFD 4Z76A 3CVHB 1U8LA 1NLBH 2F53A 5I17A 3BYYA 3HE7C 5FA3B 5IQ7L 5I73B 5K9JL 2EYSB 4XAKD 2BMKA 3DO7A 1U8MA 2P8MA 3EOTL 1UACH 1K3ZA 1FFOB 1XGUB 4Z77A 3QUZB 2Z92B 1BAFL 4ZSOE 2A6KA 3QDGE 1ORQA 4NM8H 3HPJB 3GSOA 3TJHD 3QDJE 3O3BA 2QKIA 4TUOB 4LMQE 3TN0B 2NY0D 3QJHA 4FQJH 3VFWB 1BIIB 2X1OA 4MQXC 2X7LA 2LAGB 2N1KA 5FGSA 1I1YA 4ODBD 5IMLA 1JPTH 1YN7B 5HYQA 3IJSA 4GXUM 2C4XA 3N1PC 3O2WL 1R24B 5A2FA 4O2EB 5EC1A 3FOMB 4JREB 5DC4B 2XICA 3GIVA 3GM8A 4RMUA 1FV1A 5DD0L 2X4PB 2ZOKB 1IM9A 4PJ5D 5GRJH 2R2BB 2Y6SD 2GJZA 3F62A 3QUXA 1ZVSB 2BSSA 1KLFA 3V5DB 4AQ1B 3VG0H 3TJEL 4D8PB 4IDJL 5L0QC 3IS1X 2A74B 2DIJA 3INUL 3DI2B 1NGWA 1RULH 4F9PA 1MWAL 1U3HC 3TEUA 2P8LB 3VE0A 5DRXB 4NQXB 1I1CA 1EUTA 4M93B 4I3RH 3RVWD 3MNZA 5BOZG 4QOKD 4YX2H 1X4YA 3ZDYF 2GK0A 2DQFB 1L7TH 2VDKH 1MVUA 4LPTA 1LO4L 4APQB 1QSFE 5ICXB 4JVUA 5LBSH 5KOVC 5IB4A 3RVXD 3ARFA 5J3HC 3JV6B 3ULSB 3OJMB 2YMXL 5GJTH 3ZT7A 2Y9RT 1ZK9A 1I85C 1KPVA 3PWUA 5C0CB 1K8DB 1FO0A 3CIQA 2AVGA 3UTTA 4HK0B 4RGNC 4N1EA 1TQBB 3SGEI 4V2BA 4ETQA 5C0IA 2A9MH 3MRQB 2CIIB 5JW5B 3PWJB 2EDRA 1XGRB 4HT1H 3ZDXF 3U82B 1BZ9B 1SMOA 2AW2A 4H25B 4G8FB 4PP2B 5ID0A 3PHSA 2MCG1 5JORA 3HB3C 5JDJA 1HYSC 3LS5L 3BZFA 2YK1L 1S7SA 5CJBA 1CDHA 5FUCC 2XN9B 3DVFA 1QFWL 3DX9A 5DMGC 1U36A 1TNNA 5FYKU 1FG9C 2L0DA 4U6VL 1FFNB 3G9VA 4U05A 4YDIL 1VEMA 4ODSH 3ZTNH 3HR5B 4BKLB 4G6AC 4ONHA 1OQOA 1UG9A 5GGRY 4H1LG 3TYGH 4QGTA 2VAJA 4M7JL 3QDGD 4UNUA 3QEQA 4QRQA 3CLEL 9CGTA 3E6HA 3HZYA 4TSCH 5FB8A 1EO8L 3QDJD 4HV8B 5GS0H 4JO4L 4LGPB 1YPZF 4BZYA 4XTRD 4OCWL 5D6CA 5E8DH 2D03L 2ZKHL 2VZUA 3MRJB 3T77A 3X13B 5GGSY 2NY4D 4FQIH 4HWEH 1X5XA 5DUBB 2EYTA 4I2XA 4NPYB 1EZVY 1NANH 5E9DE 3G9AB 1G9ML 5LGJA 2C3VB 1Y0LA 2ZJSL 3MLVH 5F89B 4QTIH 3LIZL 3VXTB 2YEZB 2F53E 5KS9F 1TTGA 4WEUD 1MCRA 1UZ8A 5J1SC 4HC1H 2DQEL 1HWHB 2ZG3A 3K4ZA 3NZ8A 3QJFB 5TDOA 4MA1B 5LJYH 3KPRB 2YD4A 2X89D 3IDGA 2C5DC 3LN5A 3AB0C 4XB7A 3DX6A 4WFGE 1PYWB 1E4WH 3DIFB 4U1LB 1PLGH 1GL4B 4F33B 4ZYKB 5KG9B 2MSPA 2EDDA 3QQ9C 1EHAA 1I9IH 2NY3C 4MXQD 2YSSB 2GUOB 4U1GB 3LEYH 3FO1A 3VWJB 1ES0B 3OR7A 5DJXA 1GGIH 1E6JH 4IRZL 1NC2D 3VGFA 1A6UH 4XNZB 5BS0A 2XZZA 3SBWC 3KYAA 3MV7A 2DQCL 1VFAA 5SX5H 1WIOA 4K3DL 3CVIH 3T08A 1QSFD 5IW1B 1T4KA 3HPLA 4R8WL 1P4BH 1LEGB 1J1PL 1E4KC 1NSNH 3S37X 2IQ9L 4B7LA 4WCYL 4FQ2L 1OVZA 3UP1A 1UB5B 4IDLA 5F7YC 2CLZA 3I2CL 1RVFH 5DEZA 3TT1H 3ETBF 2X1PA 4P23C 3OAZK 4UINL 4R0LC 4F37F 3L3JB 5HPMA 3WLWD 1EV2E 5HGBA 4S1SL 4DJMA 1KJ2A 4NM4H 1AQDB 1NFIA 3T0XA 4UV7L 4CW1A 5I73C 3VXUA 4XCFL 4LDEB 1BVZA 4MD4B 4JQIH 1S3KH 2DWEB 2JB6A 5SV3A 4NCDA 4YHIA 4ZNCD 3FB5A 1FVDA 2PXYA 3OQ3B 1Y18B 4XGZB 5IBUG 4UTAL 1GVIA 1ZANL 4B41A 3JWDL 12E8L 5K93A 5DQJB 4CVXA 2KPNA 1UKTA 1A2YB 3SKNA 5EOQL 5EBWA 3VMOA 4C56B 1TCMA 4HBQA 3MUHL 3TN0C 2MTPA 3MGTB 5T1KD 3PWVB 5CP3H 4XMPL 4JRXB 3WL9A 4OBSA 3JTTB 5HYJE 3SDAD 1KTKE 3AY4C 2KZWA 4N8PA 4LL9A 1UEMA 3VFOA 5GS0C 4HX1A 2YHGA 2PUQT 4FQLH 3VGGA 1ETZB 3BZ4B 4M8QB 1UXSB 3RX7A 3QPQD 4NKOA 4NZRH 3UTTE 3EZJB 4PRHB 3WFBH 1OAQL 4JREC 5LCVH 5TE7L 2W60B 3T3PE 5CD3A 1DBML 2AQ3A 5K59E 5CWSA 1HQRB 1PD6A 4CNIA 3ARXA 4UUJB 3VFSA 5CSZB 5F6HI 3F12B 5D7JB 2EIEA 1A7RL 2A83B 1QVOB 4Z8FL 3L3IB 2W38A 4HUXA 5IW6A 5HGDA 5E5RB 4Z7WF 5FYKH 4ZS7L 5DTFA 3O45B 5TQ2L 5E9DD 1KENL 2NQCA 1XF3B 1CBVL 1XR8A 1DBAH 4M93C 1AXIB 1H3XA 1U3YA 4XB8A 3QSKB 5F6IB 4F58L 4O5LL 2F53D 4HKJA 2XWJB 3QA3B 4ZUWA 3VH8G 1DEEA 1IILE 5M95B 4APQC 4HAGA 3MFFA 5CP7B 3DTXB 4KPHL 3MRCA 3RL2A 5GGRB 1T89C 4WFGD 4I4WA 2HT4D 4PRIE 1DFBL 4P2RE 4J3VA 4OB5L 4NC1C 3BH8B 2Y5TB 1UM5H 4BYHA 1P7QA 2HJLA 1XZ0A 2XRAH 4TSAH 2OL3H 2Y06L 3T0AA 1I1AD 3TPUB 1YEEL 3LSOA 4MNQB 3JWOL 5IB2B 2C3HA 3P9MA 3G6AB 2FZ3A 1T5WA 3C87A 2DDQH 2WWMD 1G84A 4CU8A 1JK8A 3V52H 5F71A 4KJWC 1QEWA 4FMFA 5DQ9B 2D2OA 1Y6KR 3KXFB 4NQEB 1JZ7A 3D1MC 4NGHL 5DD3L 1IM9D 4MD0B 5I1DB 4NO0B 4CU6A 1J87A 3EYUH 5HD8D 1K6QH 4EVNB 1GGCL 2A2QT 1B0WA 5T3XL 3V6FA 2O5ZH 3QZWB 5F9OH 2B1HL 3V6BR 5C0JB 1W8NA 4MA7L 3WNPA 3MLTA 5C07A 3AREB 2CDGA 3VG9B 1R5VA 3KJ6L 4KK8C 5EUKB 1T3FB 4DCQA 1FLTX 5E2UL 1LO0L 4XWOC 2JIXB 1QQDB 2ILLA 4PJAB 4FFWC 3ARGD 3DJ9A 2VDRL 4YDKH 3NACH 1NCWH 1TQCB 3QI9C 3VXNA 4NT6B 2V2XA 4K7FB 1R5WA 1FJ1A 3FT4A 1BQHB 4HZLB 4BSVB 5I30L 5DO2C 2EXYC 2DBJA 4XVTH 5GIRA 1R3KB 2E3VA 4UT9H 1Q1JH 3ARFD 2Z35A 5HYJD 2OI9C 4JO3L 4A2MA 2CRYA 4JG1H 4PR5B 2BJMH 1F4XL 4LQFH 4LLMB 3DUUB 1LDPH 4UNVA 2NLJA 3Q6FA 3UTTD 4RCAA 3VXUE 4JLRB 3CMOL 2RFXA 2R15A 1QNZH 1TVBA 5JIPA 4MA1C 1R6VA 3AUVA 3ZKQD 5I8OL 2VLJB 1QG3A 2JJSC 1DE4A 3GO1L 2HFTA 2J4WL 3HR6A 3CK0L 4RFEA 4W70A 1U8KA 1N2RB 3JWNC 5D7LA 1N7MH 1FVCA 3AXLA 4W6YB 2VITB 2VIRA 4MB5A 4Y2OA 2E7MA 4WI3A 2BC4A 4X9BA 1CCZA 1XGPA 4KDWA 4XP4L 1JGUH 1TZIA 2D4DA 2ZP0T 2NY5H 5EOCH 3PHQA 3SKJH 3VXRA 4F7PB 4S1DC 4KV5F 4G5ZH 3HG1E 3QULB 3L7FB 1ZVHA 3CFCH 4PRID 3BXNA 4D0CA 4P2RD 3WJLC 2NY2B 2DRUA 5HI3D 1YYMH 5IJKA 4M6NL 4Q0XH 2V5SA 4M5YH 3OMZA 4WI7A 1BD2E 3V5HB 2DQDH 1QSEA 3LKNA 4AJ0A 4U1HA 2H32B 1KIQA 3VXPB 4DQOH 4GS7C 1YYLL 4JFPA 3MJ8B 4HUWB 2W9EH 3EJYC 4P2YA 4FZ8H 2ITCA 5ENWA 4BQBA 1LO3L 4DW2L 2DKUA 2PTTA 5I6XC 5F7LB 4LLVA 1FYTB 2EIDA 4N1HB 3ZO0A 4QF1B 1BVKA 1DUZA 1MFCH 2D31B 5ESVB 3ULVH 1OD9A 1NGXA 2VDQH 1BX2B 2B4CL 4HG4J 2GITB 5FO7B 3W2DH 2XZAL 4MD5A 5E08H 1IC5L 4NQDA 1AKJB 2R4SL 5JUEL 4OV5B 4J23A 1HH6B 3SJVA 4NQVB 3ZKMD 1EGJH 3MNWA 1F2QA 3CC5A 3CH1A 2IQAB 1NCCL 4HJGA 1M71B 3OB0K 1J9CT 1R3JA 2AXGA 2M26A 4M9PA 4XCEB 4L29B 5HGAA 5DVLA 4LSPL 1MWAB 4AYFA 5LWYH 2MHAB 1ZT4A 4UT7L 3V5KA 2AEQH 5I1EH 5D2NA 4RAUB 1I3UA 5DRWA 4EUPG 3P73A 4YLQT 3ARDB 5D7JC 1MLCA 2WP3T 5EULV 3QXAA 1BFOB 1T2QL 4YQXH 3I75A 2CKBA 3V4VH 4Q97A 4M62H 3BDBA 5HHOE 1KYOJ 4IEFB 3GJEB 3PGCA 3V0WL 5JNYB 2UYLA 4PJFF 3OKKA 3GI9L 1ZT7B 1MCPL 4NO5B 5FAAA 3VXUD 1YPZA 4WW2A 5IHUH 1Q9WA 2D0HA 5IHZB 4GG6B 1I9RL 3ULUH 5C07E 2G75B 3CFBB 5I8KH 2ZG1A 4U6YA 3PNWA 3GSVB 2PXYD 3HRZA 3EYVA 4CMHC 1IKFH 3SPVB 5DGRA 3S9DB 3H8NA 2EDNA 2ZOLB 5HYSG 2XQYK 4GKNB 5DJ0A 1NCDH 2NY5C 4ISVA 4NFCA 1KJ3L 3I02A 4M3JA 1KCSH 1A14L 3U0PB 4FQXA 4RAVA 3OHXB 1IEBA 4PY7A 1RZIB 2VQTA 2IANA 1KIUA 2VDLH 4PJEF 3RFZC 1FZKB 3AU1B 5L2KB 5EBMB 3HZVA 2OSLA 1NUDA 5M94B 1A6TA 3MMEA 5C0ND 2XQYG 4MNHB 3HG1D 4YEEA 1FNEA 1ZMYA 2H32H 3SKUD 4D0DB 3JSSA 5HDQL 4WI8A 3OKOB 5F3HB 5DK0B 1E27A 4HK3N 3IKKA 4POZD 4RFOH 1BD2D 4OZHF 1K4DA 1FL5B 1MAML 3QO0B 1MHCB 4LLWA 5D7LE 4BZ2L 1MCQA 4X7FC 2YC1B 3T2OA 3ULVC 2NNAB 2NZ9D 5JOFA 4B0MM 3X14A 4RMSA 4PRNB 3O2WH 3TA3B 1KT2B 2EC9T 5BZDA 3DYPA 1FGNH 4HFWB 5T1MB 3CFJA 1P84K 2EYRB 2Y36L 2YXFA 3Q6GL 3LKQB 5CMAB 3C09B 3QIWA 2W0KA 5F7KC 5MERB 4PJIB 5C0EA 1B4JL 2AV1B 5T1LD 4YAQB 3UYPA 2BNQB 3TJEH 3FZUC 4IDJH 3MCKA 3PV6A 2E8YA 5FO9B 3INUH 3HZMB 4OM1L 1MWAH 3MLUL 5CILH 2J88L 3PL6D 1WT5C 5KAQG 4JPIA 3FCTB 1YDPB 5C0AA 1P7QD 1QSEE 5C0BA 2F19H 1C12B 1UB6A 1IJ9A 1BQUA 1YEFH 2NY1D 3QO1B 2B1AL 2GTWB 2IBBA 4X6EB 5HVWA 5B3NA 2XG5A 2GSIA 3BUYA 4RIRA 4TPRL 5KVDL 3NMEA 2Y72A 1YQVL 2FH8A 5IJVA 3SE3C 4V1DE 2QHRH 5DDHA 2VUYA 2YMXH 5F1OB 1W0VB 2EDOA 5FF6A 4NQDE 3LRSB 4NN5B 1OM3L 1CD1B 1OOAA 1QFOA 3UBXB 4N5EC 1OP3H 5MENB 5C07D 2VR5A 4DZBB 2FECI 4Z7WA 4U1MA 3D2UB 4G80A 2XACC 1IRAY 4QRPA 3BP5A 2AI0L 3RVUD 4P3WA 3KPQA 2NY2C 1E4XL 3AS3A 4U49A 5D6DC 5IKCA 1A02N 1RHHA 4FQHA 3CFKA 4ZPVB 1T04A 1MF2L 3NCMA 5D2NE 3EHBD 3OKDB 3LS5H 4ZNEE 3MRKA 3RZWA 2P8PA 1W8OA 4HFUL 3DVGA 2FDBP 1QFWH 2MKLC 3HNSL 1A6PA 2ZNWA 2OMNA 3GSQB 4U6VH 5FCSH 2GAZB 2HP4A 5IFHH 4YDIH 5DA4A 3CXDL 4RDQG 4RISL 4S1QL 3CMGA 4RMVA 4X7TA 1B9ZA 1IL1B 1MCDA 4WHTB 3HUJF 1ZGLA 1UQSA 2LU3A 3ARYA 1JNHA 4MA8L 4DUVA 1YPZE 4MJIE 3E8UH 3VFPB 3FTGB 4M7JH 1Q0XL 4OLEA 4FP8L 3CLEH 5KVGL 3VFUA 1JV5A 1S7UB 1IAOA 1EO8H 4JO4H 3TBSB 3BSZL 1IQWH 1Q0YL 2ZKHH 4NWUH 5HHQA 4AM0A 4S0TD 5D7LD 5ESAA 4WGVB 1JWUA 1OW0A 4ODUB 5TQ0H 5DD5L 4BFIA 2WIIA 1G9MH 2JCCE 2C1OB 5D5MF 4F9LA 5JMOC 4QHKJ 2IANE 1T83A 5JO5A 1IE5A 3BT2L 4PFEA 1ZA6A 2DQEH 3CCHA 4LEXL 3IETB 2W9LA 5ETUA 5D96B 1HKLL 5C8JA 5SWZA 1LEIA 1OP5H 3KYNA 3ARDC 1DQMH 1HEZB 3S4SA 4ZO6A 1ZHBB 2RIKA 1XIWB 5CBEA 2XQBL 3VXQA 1GRWA 1J1OL 4FNLH 1OAZL 1UVQA 1ODAA 2IPKB 2KQNA 2Z8VC 3MYJA 2QADB 2EDTA 3WNNA 4NUGL 2FJHA 1KACB 3T0BA 4ZTOL 2NXZB 3HE7A 3EYFB 5H94A 1QSED 2F8XC 1LVEA 25C8L 1P5UA 4IRZH 5IOPA 2Q76B 4JFOB 3V79C 4NRXB 3Q48A 1W72L 2DQCH 2MJWA 2PCPB 4NC2B 1SJVA 1BEYH 1P7KB 3QNYB 4K3DH 5EA0L 2IBGA 1H8NA 1ZE3C 3QDME 3SE4C 4R8WH 1F4YH 5L6YH 1J1PH 2ID5A 3WD5L 4V1DD 4WCYH 2VISA 4FQ2H 1GZPB 4L8SC 2J12B 4G6JH 1CFNA 3T0EB 3QFJA 1A6VH 2R0LL 4UINH 1SJEA 3FQWB 3F7YA 4MA3B 1TITA 3FFDA 4NQDD 4X0KB 4FRWA 4WHDA 1WISA 4S1SH 4HF5H 4UV7H 1J0HA 5DHVB 2NCMA 3LQAC 5IW3A 4DN3L 5H37H 4H0HB 5C0AE 1N4XL 1CFQB 3B83A 1EO7A 1C5CL 1EFXB 3JWDH 12E8H 3MUZ1 1ROWA 2HRPL 4M5ZH 3IDYC 4K8RD 5EOQH 4CJ1A 4OCYH 2HMID 1UJ3B 1RUAL 3TO2A 2VXVH 2IFFH 5IMKA 3VWKB 5IFJA 1U3HA 3BPLB 2EKSA 3MSPA 5SWSE 1HSBB 4KHXH 5E95B 5DJYA 4JFQA 2CLRA 4G8GB 4ZUSA 3M1BA 3GJFB 1SJHB 2APXA 3WHXB 3U4AA 1V5JA 3TA3C 1MI5B 1YUHA 4ZOEA 2NR6C 4GBXB 1OAQH 5TE7H 4EZMA 4MJID 5D1QC 1DBMH 5E2VL 1MOEA 1WFOA 1KCUL 1G9MC 1NGQL 1FAKT 5A2IH 1XGTB 1GGBL 1IKNC 4XX1G 4DN4L 1G1CA 2HG5A 1WCBB 2XZCL 4A6YL 4Z8FH 4IHOA 1UXWA 3RIAK 1I85A 4Y4FB 5JW3L 4ZS7H 1HI6B 5TQ2H 4FQXD 1CBVH 5IHBA 3LN9A 1WZ1L 4UQ2A 2FJFA 3NAAH 5KN5B 2XWBB 2IAND 4HGMA 3WKNA 3G5XA 4F58H 4O5LH 5JHDA 5IVNA 3RI5K 4ACPA 3SGEH 3TZVC 2DQGH 1KBGL 1N6UA 1XGQA 3FN0H 1JGLL 4JGMA 3CSBA 5I19L 4FQPA 4OB5H 4NUJB 3U4EB 5D1ZD 2R4RL 3VXOB 3PWNB 5EO0A 4M61B 4R4ND 5B38G 4TTGA 5KJRL 1QA9A 2GTZB 3D25A 5HI4D 4NN5C 4QY8A 3WXWH 3W39A 1UH4A 2Y06H 4LFHD 4NKMB 1WBXB 1YEEH 4NHCL 3JWOH 1ORSB 1XCQA 1KLGB 1XF5A 4JDVA 4JN1L 4U1JA 5IVXB 4WFEE 3QUKB 3QPXL 1ND0A 5A3IC 4OQ1A 1I7UA 5FXCH 4MJ2A 1C5BL 5GGVL 4XXDA 1JI1A 5DHVH 2EEBA 5FHAH 4NGHH 5DD3H 4PJFA 3X17A 3UTSB 3T1FA 3K2UL 2D7OA 5J1AB 2A77L 4KK5C 1LE9A 4C4KT 1IAIM 1ZHKA 4LSRH 2VLME 1GGCH 3HS0B 3RGVA 3UPAA 4Y19B 5C3TA 4FFYH 1SY6L 5TDPA 1M05A 1N64L 1FG2B 1MRCL 4YO0B 5C0AD 3KJ6H 4N0CC 3P30L 5DVOA 2HWZL 1Z9LA 5E2UH 3F58L 2FR4B 1SYSB 2VDRH 2EIZB 5CJ5A 3PWPB 3HMWL 3EO1A 3NIDF 3OWEA 4PUBL 1BBJA 3FOLA 5CZXC 1HIML 1RJLB 2VWEE 3WYRA 5SWSD 4FXKB 3WXVL 1ACYL 4JO3H 3QFJE 1F6AB 4EI6B 2EZ0C 1NCBL 2LV4A 4KQ3L 1GOFA 3GGWA 1F4XH 3SKOA 3C9NB 3RUGE 5TE6L 3SBWA 3BIBX 2BNRA 1Z9SA 3CMOH 1D5BB 4OZHA 4Y4KA 4RQQA 3N85H 3ULVF 2FD6L 3I6GB 3RTQB 4LHQB 3WFHB 4HXBL 3GO1H 3MX0A 4P46C 3QQNA 5I16B 1D9KA 3CK0H 4P23A 3NIGE 3KPOA 4PJAF 4R0LA 3IDMA 1AR1C 4G6FD 4YNYA 2FATL 2LTQB 2ZG2A 4J6RH 3CVHA 3RIFF 1UADC 4EIZC 4LCIH 5E5MB 2R9HD 1M7IB 1S78C 4OFPA 4OD3L 5D2LE 5FA3A 2EYSA 4JJ5B 1RI8A 4ZXBB 3IXAB 4KKAC 4XBEL 5C70A 3QQ4B 1FFOA 1XGUA 3QUZA 2Z92A 3CSPA 2W9DL 4PRBB 5C0FB 5EZLB 4YHNB 1Z3GL 5FOBB 2ARJB 1JPGB 4AH2B 4YBHA 3HPJA 2J2ZA 1HHJB 4TUOA 4C55A 2P47B 3TN0A 4H26B 3TFKD 3DVNB 3T0EC 3VFWA 1BIIA 3JWOC 1T7ZA 3FB7B 1OTSC 3IDNB 1T22B 4M6NH 1QBLL 2OTWB 3ZHLA 2MFNA 3O81A 3EUUA 1YMMB 1YN7A 2DF3A 2F8VA 1YYLH 1R24A 5C7XL 1BJ8A 4PYGA 3CSGA 3ULUF 4O2EA 3FOMA 5EU6E 3RDTC 2X4PA 1LO3H 2ZOKA 4WFED 4DW2H 1JVKA 4GMTH 2R2BA 3DETC 4E41B 1KFAH 1ZVSA 3V5DA 1DSFL 1C8PA 4Z7VB 3TV3H 5HSFA 2GY7B 4D8PA 4PJGE 2IBZX 2V7NB 1UKQA 2B4CH 1UJ3C 4L8CB 3T4AB 2A74A 4HC1A 4L3CB 1WEJH 2XZAH 2ADIB 2P8LA 1IC5H 3BPLC 2Q8BL 5BRZB 5DRXA 3F7PC 4NQXA 5EZOL 4F3FB 4E42B 3WHE1 2VLMD 3HMXL 4YHYB 3C2SA 4OLWH 5DFVD 4AEHL 3OAUL 4N8VB 5CKGA 2CUMA 4I0KA 4FQQB 4ZAKD 1E6OL 2J8UB 4IOIB 1NCCH 1B90A 4ZS6C 2DQFA 4GBXC 3FQTB 4APQA 2O26U 5TGBB 5ICXA 2CQVA 2AJUL 4OCMC 1U8IB 2P5EB 3MA9H 2EDLA 1T89A 1CGWA 1CDGA 1NEZG 5EOCJ 3JV6A 3KPTA 3ULSA 2Z31C 5HHMB 3X3FL 4LIQE 2XIDA 1T2QH 4LRNL 4Y4FC 3MLSH 3QFJD 1I7TB 5C0CA 1K8DA 1YC7A 3LB6C 1JPSL 3V0WH 4HK0A 4UV4L 2VZVA 3IDXL 2MNUA 5FGCB 3O2VL 4ZUUB 3V0AC 4EN3B 3GI9H 1MCPH 3MRQA 3I3EA 1BLNB 2CIIA 3RVTD 3PWJA 1I9RH 5JW5A 1XGRA 1BZ9A 5BZWB 4H25A 4G8FA 3U7WL 4ODHL 3S34L 3T2PA 3WCYA 2KZ1B 3ISWA 1KTDB 3IFPB 4I18B 1A14H 2XN9A 4KRPD 1PVHA 4HJJL 3T2NL 3C8KB 5HVHC 4J3SA 1T2XA 1FFNA 2AGJL 3EO9H 4M1GL 3H2WA 2P5WE 4YHPB 1T1ZB 4PV9B 3ZLQC 4OZFG 1AGBB 3HR5A 5CD5D 4BKLA 5CP3A 5GISL 2GKIA 1CGVA 5E6ZA 5I66B 1S7QB 2BNRE 2QQNH 4HV8A 5EG6C 1CICC 1QFPA 1PAMA 3MRJA 4WTZA 3X13A 2ARWA 5EBGA 2OMBA 3PDOB 3LRGA 3HZKB 4ZOAA 5DUBA 4NPYA 1MAMH 1WWAX 4BZ2H 4KWUA 2C3VA 2P43B 4Q9BA 2B20A 1YNKH 3PDDA 5F89A 3SGKC 3JV4B 3VXTA 3ZYOA 2YEZA 3EFDH 2H2SC 5SX4H 1PEZA 2B4CC 2RJMA 5EU6D 4N0UB 1IGJB 3QJFA 5DWUH 3Q6GH 2Y36H 4FQCL 3KPRA 5FFLA 1MFAL 4U2YA 5DI8B 5T3ZE 1V3JA 2JJSA 4JQVA 1PYWA 1B4JH 1WUNT 4NN7C 1MCKA 3DIFA 4N0FB 4U1LA 4F33A 4ZYKA 5KG9A 4K23L 1QPXA 2GUOA 2YSSA 4OM1H 3ZHKA 2YKLL 2B5IC 1CDBA 4PGJA 3VWJA 2DICA 1ES0A 5CIPB 1I4FB 3P0GB 2V9RA 2Y25A 3D87B 1J1XL 3VFVB 4OGXL 4UIKL 2AK1H 2IC2A 3FONB 3CSYB 1K2DB 4KRNA 3IDIB 5IW1A 1HOCB 4FTVB 1LEGA 1NCAL 4OD1H 3RTQC 1ZA3B 4TPRH 4KJPD 1UB5A 2LU4A 3WJLA 1AFVH 1YQVH 4JKMA 5AWNL 1ZHNB 3P11H 3L3JA 2MPAH 3ZE0E 1P9MC 4Y16B 2A6DB 1W72B 3MLXL 4P9HL 5DD6B 2X40A 3C6LC 4N0YH 4UIMB 1QLEL 2KBGA 4PJIF 1AQDA 3CD4A 1QLFB 5E6IB 1RD6A 1JNLH 4XC3H 4MD4A 3HI5L 4ZXBC 1OM3H 1JZ6A 5GGTL 1KPUB 2DWEA 3RGVD 4OFIA 1A3RL 4XGZA 1Y18A 2DD8L 4G8EB 3VI4F 4GRWB 4LGRB 3H3BC 5DQJA 1S5IL 2NX5E 1G7JB 3GUTB 3DMMB 4PJHB 1A2YA 4MB4A 4FABL 4C56A 1QLRB 1HHIB 1E4XH 3MGTA 5CEZE 3OKNB 1MF2H 3G6DL 3QCUL 3PWVA 4JRXA 4WI4A 1TFHA 3V6OA 3JTTA 4ORZC 5C2BL 1DN2A 2DQJL 4HFUH 1CF8L 1CDCA 1U41A 2HT3D 1FFRA 3HNSH 3HHRB 1ETZA 2P5WD 3BZ4A 4M8QA 1UGNA 1UXSA 2R69L 2B2XL 4GLRI 4PRHA 5DUPL 3CXDH 4RISH 4S1QH 1HQRA 3EOAB 4LLQB 4MA8H 3SN6N 5BXFB 2BNRD 3LHPL 1Q0XH 4Z5RB 4UUJA 1TDQA 4FP8H 5CSZA 4Y4KD 3F12A 3KLDA 2BHYA 5D7JA 4OD2B 1I7RB 1KCRH 2A83A 1QVOA 3L3IA 4OI7A 1IGMH 4R90L 3BSZH 2PYFB 2V2WB 2FYYB 4JO1L 1D9KD 3O45A 3QIBB 2QQKL 1XF3A 4KI1A 4YHYC 3BH9B 4Z7QE 1TMCB 2XN9E 5DD5H 5GS2D 2C1PB 4U3XA 4HGKC 3GMRB 2XWJA 1MJUH 3KPSE 3Q3GB 3QA3A 5L9DH 4A6YB 1MCLA 2UUDH 5TF1L 4HBCL 1INDL 4LEXH 3QUZD 1WFNA 1JZ2A 5CP7A 3DTXA 4TUJB 5T3ZD 1VADB 5CIPH 5GGRA 2OJEB 2XKNB 1MFBH 5DQDL 5I1HL 3BH8A 4NOBA 2Y5TA 4KAQL 2XQBH 5T1DH 3TN0D 3BW9B 1T80A 2CPCA 4MQSB 4NUGH 1WJ3A 4XP1L 4GXVL 1ZAGA 25C8H 3TPUA 4EN3C 4MNQA 3RWIB 5IB2A 3OPZL 3G6AA 3SE9L 4OFYA 1W72H 4M00A 3M45A 3U7AA 3BGMB 4P49A 5F96L 4XBPB 5I76B 5EA0H 4NNPL 5DQ9A 3NIFF 5DSCB 1U8HB 2BVYA 2JJWA 3KXFA 4NQEA 4RWHA 4MD0A 5I1DA 3KPRE 4NO0A 3QXUA 3TIEB 2CJUL 5JW4Q 1QFHA 4I18C 4PJXB 4GRWH 2R0LH 1ZLWK 3VDAA 4XVJL 1HNFA 3ALWA 4EVNA 3BOVA 3F6LA 5BVJB 3QZWA 4RMRA 5C0JA 3MLZL 4AQOA 3AREA 1N5YL 5EUKA 1T3FA 4X9IA 3FN9A 1B3JA 3P0YH 2JIXA 1QQDA 4LSSL 4NO3B 1F90L 1N4XH 4PJAA 5DK2B 4GT7A 5HJ3B 2LABA 2NX5D 5JPMB 1C5CH 1NBZB 2BZDA 3HC4L 2AKRB 32C2A 2HJFB 4NT6A 1F45A 4K7FA 1Q38A 2HT2D 5EORL 1BQHA 3QB7C 4HZLA 2X10A 1EGJA 4BSVA 2VJXA 3EAKA 5CEZD 4QXGL 1R3KA 4ODXB 1RUAH 5AG8A 3BRFA 3QIUC 1G9NL 5C0GB 3S88L 3JV0A 5J8OA 1FZOB 5FYJU 3QHFH 3EW3B 3OF6A 4PR5A 1Q8MA 4LLMA 5I8EB 3DUUA 3UC0L 3ZKNC 4ONGH 4JLRA 1T7VA 3JUYA 4K7PX 4X6CB 1CFSB 4AENB 3SY0B 4NZUL 4AIZB 4JFZL 2VLJA 3H7LA 2Q6WB 1U91B 1KCUH 1J11A 1NGQH 3SE3A 3SEPA 4MCZB 1GGBH 4DN4H 2AJZB 5HHVH 1N2RA 4A6YH 2RR3A 4X99B 2VITA 2CIKB 5A16B 4IOFD 3VFNB 2XN9D 4JRXE 3V6OE 1WZ1H 3PQYE 3K46A 4O51B 3KPSD 4KDTC 3UAJC 4MAYC 3GB7B 1NC4B 3LV3B 1M7XA 3QWRA 4F7PA 1YNLH 1TJHL 1FIGL 1KB9J 4KK8D 5IBUB 1KBGH 3WFEL 2P1YA 4PRHE 2I60L 1DANT 3QULA 3L7FA 2A9NL 4LCYB 4DVBB 5IR1B 3UTOA 3ZYJA 1JGLH 3LY6A 5D6DA 4Q9QL 4OI9A 1CR9L 5I19H 2CXKA 5CEYB 2E7LC 1NMBH 4JRYB 2R29L 2EXYD 3V5HA 1P2CB 1XR9B 5LG1A 3D5OF 1CFBA 2H32A 5E6IC 3VXPA 3JTSB 4WU5B 2XYCA 5J89A 2CUIA 1JYVA 1IC4L 3MJ8A 1D5IL 3PGDB 4MXVF 4HUWA 2DLHA 1HE7A 3MNVB 5EH1A 1YC8A 3K1DA 4OCRL 1FYTA 1KN2H 1P5VA 4QF1A 3DMMC 2E9WA 3P0VL 2D31A 3QPXH 3FB8B 5ESVA 3DO3A 4P3CL 4P2OB 5DS8B 5I1GL 2COQA 1BX2A 3KPRD 3ILQD 4C57C 4YFLI 5GGVH 2GITA 3BRDA 5DLMH 5FO7A 5GSVB 3H9SB 3T2QA 4BA8A 1LDSA 2ZUTA 1AKJA 4OLZL 4OV5A 2A77H 4MQTB 2YUVA 1HH6A 3L3DB 3LKPB 4LLYB 4NQVA 3M17B 1FNGB 3SO3C 2EXWC 43C9B 1RQ5A 3VWJD 3S36X 2IQAA 1M71A 1SY6H 2KDGA 5C0DB 1MRCH 3P30H 4XCEA 4L29A 2HWZH 2WLYA 4CL7A 1MWAA 1CYGA 2MHAA 4QKXB 1J0IA 1FL3B 4RAUA 4J1UB 1G6RL 3ARDA 3NZHH 4JFDB 3VD7A 3MV9B 1BFOA 3E6FB 1RIHH 2FEEI 3KXFE 1WIPA 2OK0H 1HIMH 3QIBC 4DVRL 1T6WA 3GJEA 4XPHL 3WXVH 1ACYH 4AEIL 4OZIF 5JNYA 1E4JA 5F1NB 1NCBH 3AAZB 3EBAA 1UM6L 4KQ3H 4LCWE 2QHLA 3V9FA 5A1AA 4YBQC 1ZT7A 2ZUQB 3RKPA 4NO5A 5TE6H 4LCCC 2HKHL 4R97C 5IHZA 4GG6A 2G75A 3CFBA 5DURB 5DRNB 2C3GA 3GSVA 4OIIL 3EGSB 1JWSB 3SPVA 4U7SA 4PJAE 3O41B 3NFNB 2FD6H 2ZOLA 1ITBB 1ZWIB 1IGIL 3LS4L 5AD0B 4BM7A 4GKNA 3SDDB 3LMJH 4HXBH 1GHFL 2VSDA 3CNKA 4LHUD 4C56D 4RAHA 3U0PA 5IF0B 4JQXA 3DBXB 2DJSA 3ME0A 3OHXA 3BIKB 1RZIA 2FATH 5IVOA 1QFUL 1A1NB 4JRXD 1FZKA 3AU1A 3B9KD 5L2KA 3OAZH 4OD3H 1FE8H 3PQYD 4TSBH 3WNLA 1A64A 5EBMA 4TTDD 4F57L 4JM2C 3CZFB 1SQ2N 4XBEH 1MCOH 4KJYB 3LDBC 1JFQL 2VQUA 4MNHA 4MDIB 4PRHD 3IU4L 1KC5L 1CGYA 2V6HA 4GAGH 4D0DA 1AH1A 2B7DT 1DVFB 4W4OC 3OKOA 5F3HA 5DK0A 5I15L 1HILB 1FL5A 3MTRA 3R06B 4U6TA 3QO0A 1MHCA 1QBLH 3MROB 2XXMB 2YC1A 2D7MA 3ULUE 2NNAA 5F8QC 2XFXB 4W6WB 3BGAA 1NUGA 1WTLA 4PRNA 3TA3A 1WWCA 1KT2A 2X44D 1A7NL 1EZVX 5C7XH 4HFWA 5T1MA 2EYRA 1CXHA 1T1XB 5DYOB 3LKQA 5CMAA 1K85A 4LMQI 3J7HA 2EH7L 1WQVT 5FGBC 5MERA 5DR5L 4PJIA 3S5LG 1DSFH 2AV1A 4EEEA 4YAQA 5DJ8B 2BNQA 3RVVC 4D9RE 3FAWA 5HI5D 4BK5A 4KKCD 5FO9A 1F02I 4K94C 2G60L 3HTLX 1LO2L 3HZMA 4HKZB 3IB4A 4PLKD 3VW3L 4KROD 3QEGL 3WO4B 3FCTA 3HMXH 1YDPA 3CFDB 3W0WB 5IROC 3OAUH 4TVSa 4D9LH 1C12A 4CKVX 1WTGT 5HHXL 3QO1A 3RY5A 4P4KB 2GTWA 4X6EA 4E5XB 2VAAB 4OFYD 2ZCLH 5FV2A 3RKDD 1D6EB 4ORGB 4L1DA 1Z0NA 1VCAA 2YPVH 3FRPA 4I0PC 3UX9B 2GI7A 4HIIB 3KXFD 4IMLB 4NO0D 4HH8A 3X3FH 1W0VA 5I1CL 4LRNH 1VEOA 4PIRF 2VLRB 1FORL 2BFVL 3PF2A 4DOHB 3LRSA 5ICZB 3O6KH 4UV4H 2W91A 1CD1A 3IDXH 3T04D 3UBXA 1H8OA 2DYPB 5MENA 4UT6L 3ARED 4DZBA 1REIA 4ALAH 3MLYL 4PJ9B 3EYSL 3D2UA 4ERSH 2B0SL 2JIXD 4KUCD 1JGVL 1T5XB 3L5XL 1UFUA 3U7WH 2J8UF 4ODHH 3S34H 5D1XB 4ZPVA 2C4FT 3OKDA 5LGKA 4HD9A 3WN5C 1CLYH 3FZUD 2IWGA 1U8OB 3G5ZB 2C9AA 4XI5C 3QCVH 2FSEB 5F6HJ 2VR4A 1CFTB 3GSQA 1F3DH 1HCVA 2GAZA 5GJSH 2AGJH 3UTQB 2K7PA 4Y89A 2N7AA 4UOW1 4DKDC 4WHTA 1IL1A 5E8EB 2BSRB 4R7NB 5KSBE 2FGWL 3VFPA 3FTGA 5GISH 3W81A 5AYUL 3H7BB 3R4DA 4X4ME 1GZQB 3VXMB 4GG6E 3RWFB 4PRAB 1S7UA 4ZOBA 3TBSA 4WWKB 3JV5A 4OF3A 2W65B 3CDCA 5BCAA 1RHFA 1IT9L 5F93C 4GFTB 4ODUA 4OKVB 3ULUD 3QEHB 3CDGB 4LKCB 4F2MB 2C1OA 5F7FA 1EHNA 1OLZA 3QCTL 4ONFH 1FLRL 1UCBL 4ZODA 4JZJB 3EDDA 2BY0A 3PXHA 3IETA 3GM0A 5F97E 4JG0L 4FQCH 5F9AC 1A3LL 1MFAH 1TVDA 1Q72L 4QXUL 1HEZA 4D9RD 1ZHBA 1XIWA 5DMJB 5FEBA 2IPKA 3O9WC 1GGTA 3B5HA 4K23H 3EDKA 4Y5VC 4TOYL 2YKLH 2Q86B 4N1CA 1CE1H 3QNZA 4GKZB 4CBPA 3EYFA 3L5WB 1OCWL 2C3XA 1DBJL 4Y8AA 1BBDH 3QUYD 4YR6B 5TDNB 2Q76A 4JFOA 1V7ML 1OSPL 4NRXA 4KKNA 4HLJA 5ESQB 5MP6L 2PCPA 4OQTL 3QNYA 1P7KA 2PN5A 3A6OA 2X2YA 1U8PB 2ENSA 4HAFA 4LAQH 1NCAH 3SDDC 1GZPA 3O6ML 4GW5B 3T0EA 3HNTL 1XEDA 2XTJC 3BEVB 5DD1L 2BNQE 3FQWA 4MA3A 5DFTA 4P9HH 1HKFA 3MLXH 4JB9H 4X0KA 1AKJD 1J88A 1QLEH 4YEFA 5DT1L 4WI2A 5DHVA 1NBVL 5CGYD 1CXKA 3KPNB 5GGTH 4OLVL 3BUTA 4M4RA 1CFQA 4Y4HC 2BRQA 1A3RH 2YUZA 1EFXA 4HUUB 3QFDA 2DJ4A 4IMKC 5EDXA 4JGUA 3CU7A 3FL7A 1DVFC 4FABH 1ITCA 4F8QA 4JRWA 1UJ3A 3ZE1F 5D7IB 2I27N 5JIIA 3VWKA 4HWBL 1VERA 3ARBC 1LO5B 3G6DH 4BELD 3QCUH 1SJXA 1JE6A 3OSKA 1HSBA 5I9QB 5L8LB 2DQJH 4G8GA 1CF8H 1JHTB 3B6SB 1IGYB 3GJFA 1SJHA 1IZJA 2ESVE 5JXEC 3WHXA 3V95A 3GSWB 1MI5A 2R69H 4OF8A 4OT1H 3BQUD 2B2XH 1MREH 4GBXA 4JFYB 4GRLB 1RK1B 5KSAD 3LHPH 3OB0H 4CAGA 1IC7L 1XGTA 2BK8A 5KW9L 1DQQB 4U0RB 1WCBA 5BQ7B 1QR1B 4YUEL 4GRWF 1HZHL 4ZTPL 1OP5K 3GMMB 3PGFL 5T33H 1ZSDB 1I1RA 4Y4FA 4R2GB 4PJHF 3T09A 1HI6A 4PP1D 4NSKB 3L1OL 3SDYL 4RFNC 4ELME 1KLUB 4MVBD 5EBLB 4QEGA 5KN5A 2XWBA 3HAEG 1RZ8B 4CN1A 3GHBL 2AABL 4GG8B 3ARRA 2A0LC 5B8CC 2PO6B 2YN3A 2VTFA 4P4KC 3T0WA 3GBMH 4XNYH 1G7HB 4JDZB 4KTDL 2X4OB 1Y6MR 4UBDC 4LRIC 5DQDH 5H2BB 4HGWB 3H9YA 4NUJA 5I1HH 4R4FH 3U4EA 3VXOA 4FG6D 3PWNA 4M61A 2BNUB 4KAQH 1NBYB 3SDCB 2GTZA 3FO9B 4HIXL 4XVUD 4MZ3A 3MO1B 1LE5B 4NM8L 5ITBL 2FLRT 1M7DB 1G0DA 4UILL 3QUML 1F6LL 4XP1H 4MLIA 4GXVH 3MGOB 2C4FU 4NKMA 1WBXA 4EI5D 4FQJL 1ORSA 4PJ8B 3V0VB 1KXVC 5KZCB 4PJ9C 4WV1B 3SE9H 4P9HC 4K55A 3K1KC 5IVXA 2QL1A 3QUKA 2WBKA 1RJYB 1JPTL 5F96H 2YPLB 4NNPH 2FX8H 5FO8B 3UTSA 4U3CA 5ANMB 1X5FA 5J1AA 2CJUH 2BNQD 2IFGA 5F9JB 1G0YR 1CT8B 1DTUA 2W0FB 1CVSC 3C60B 5GRJL 1MHEB 3HS0A 4PGDB 2WBJB 4Y19A 3SGKA 1T20B 3T8XB 3VG0L 3NBNA 2EEAA 3MLZH 2PKDA 4FFVD 5EZIL 5JOEA 1FG2A 4LGSB 4YO0A 5IK3B 4UQ3B 3MRIB 1RULL 1VKXB 1EIBA 3DSFH 1MQKL 4OLXL 3UCRA 2FR4A 1CIDA 3A6BL 1SYSA 2EIZA 3ET9F 2ZSWB 4JM2F 3SJVB 3UTZB 3PWPA 5FM5M 4WFFE 5EORH 3BJ91 1PX4A 1I3RB 1UZ6F 4QXGH 1RJLA 4R26L 4WY7L 1VENA 1NUNB 4FXKA 1N3NB 1G9NH 4XNUL 5FM5O 3S88H 1F6AA 3SHSA 4EI6A 1HQ4B 3S4SG 2ESVD 4X7CC 1G6RB 3C9NA 4JZJC 3UC0H 3FRUB 4G9FB 4PJXF 1EVTC 3RZCC 3CZJA 1D5BA 4KMTL 2ORBL 4M4PA 2VXTH 4DUWA 4NZUH 3I6GA 4JFZH 3RTQA 1LQSR 4X6DE 3WFHA 5I16A 5T3XE 1NCNA 3KLAB 1BHGA 3BO8B 4KK9D 3MJ7B 4POYA 1X5LA 3QT2A 4GKSB 5E5MA 5CSBA 1M7IA 2OTUB 4M7ZC 4JJ5A 4LU5L 2ICCA 5KSUB 4ZXBA 1CI5A 3IXAA 3QQ4A 5FOJA 1L9MA 4XZUB 4PRBA 2ADGB 5KS9B 5C0FA 1DUYB 1IEHA 5EZLA 1MI5E 1TJHH 4YHNA 1FIGH 2FJGB 1D5XB 5FOBA 1ZLSH 2ARJA 4URTB 1JPGA 4AH2A 5ID1B 3WFEH 2R0WL 5MHSE 1QOKA 2I60H 2A9NH 1NPUA 1EHLL 1HHJA 2FCBA 2D4FA 1J5OL 4H26A 3DVNA 4X6CF 1CR9H 4L4VB 3FB7A 3H0TB 3IDNA 1T22A 1OLLA 2R29H 2OTWA 4IS6B 2OJZL 5ITFB 1KG0B 4HIJB 2BOCB 1YMMA 5GS0L 2A38A 4MX7B 1FBIH 1IC4H 1D5IH 1E27B 1CK0L 4FQIL 4GLRH 3I84A 3EOYG 4JKKA 1NCUA 3H6JA 5EO1B 4E41A 1JZ5A 3N06B 4YWGL 4Z7VA 5I1GH 1NEUA 2V7NA 3O8XC 4L8CA 4PJBE 1G7PB 3T4AA 3QDAA 2X5PA 4L3CA 4IRSB 2ADIA 3I3BA 3D0VB 3IVKB 1XIWD 5BRZA 5I9QC 4F3FA 4E42A 4AZ8A 1MIMH 2CO6B 5IG7B 4RNRB 1JYWA 3VXSE 4NRYB 2QADD 4N8VA 2RAMA 4FQQA 2NXZD 3RWHB 1ULVA 2J8UA 3J8F7 4IOIA 1F11B 2FBJL 1PLGL 1TENA 1WFTA 3FQTA 1FCCA 3TVMC 2PTVA 5TGBA 3LEYL 1FNAA 3ZMRA 1GGIL 1U8IA 4Y88A 1E6JL 2BCKB 2P5EA 3QQ3B 4WFFD 5IVXE 4U0RC 1G6RH 4M7LH 2OR9L 4Q9CA 3OL2A 1VACB 1OTTD 1D5MB 2CGRL 5IM7B 4U33A 2IG2L 4R2GC 1WK0A 3SDXB 1NFKA 4P59H 2AJVL 1P4BL 4XPHH 4M6ML 1S9WB 3B2UC 5DHXB 3SCMC 4WI6A 1NH6A 1QBBA 4ZUUA 4F7MB 2G2RB 3QEUB 4EN3A 4Y5YB 5FCUL 4D3CL 2BOBB 2PO6C 4P4RB 4S10A 3O6FC 4EDWL 2HKHH 1BLNA 4YPGB 4A2LA 2NPLX 3GSUB 4ENEC 4NM4L 1RZGB 3EJZD 5BZWA 4OIIH 1LNUB 1F3RB 5CINH 5DMIH 3LS4H 1IGIH 5E94B 2YD7A 3DETD 2DQIL 5AAWA 1KTDA 5T3XD 1GHFH 4CU7A 3IFPA 3PWPE 1FP5A 3BKYL 4I18A 1PG7X 2QSTA 3C8KA 1MAJA 3D18B 3VWKD 2D7QA 4P5KB 1EO5A 3HE6B 5F1SA 1F4WH 2OXGA 3G5YB 4PV8B 3WDHA 4YHPA 4F57H 3DX8B 1IQDB 2RHEA 1T1ZA 4PV9A 4M6OL 1AGBA 4WV1C 2H2PD 4I48B 4Z6AT 1JFQH 4KH2A 1EPFA 1MI5D 1UWXK 4M1CD 3CXHK 4PLJD 5MHSD 5I66A 1S7QA 4YXLH 3IU4H 1KC5H 1U3ZA 4FQLL 2FBOJ 4Y2DD 3B3IB 4NKIH 5A40E 5AZEL 5I15H 2DI9A 3PDOA 3HZKA 1P4LB 2DJUA 1ZV5A 4BQCA 2WUCH 1FQ9C 2LE9A 3LKSB 2WBJC 3JV4A 1MCBA 2JJTA 3P3YA 2I26N 4HKBB 4OZGE 2ATKB 3BP7B 5HTSA 2DLFH 3ES6A 4N0UA 2WAHA 4KRLB 1FH5L 1IGJA 5FYKL 3CFIC 1DN0B 4OIBA 2EH7H 2FX7L 3OZ9H 1HNGA 1DQDL 4N68A 4Z7UE 4NCC1 5DI8A 5I18L 2NXYB 2Q1EA 1KCVH 3G6JB 2W0PA 3LZFL 1JGEB 4CMMB 4N0FA 3G08B 3MUGB 2G60H 1AXTH 5CKAA 3VW3H 3VXSD 3QEGH 5CIPA 1I4FA 4K9EH 4KDTA 4DKFL 3VFVA 2Z93B 3FONA 3CSYA 1K2DA 2BY2A 3QAZB 3RAJH 2Z9TA 1KOAA 1MH5B 3IDIA 1HOCA 3TPKA 4FTVA 4E0RB 2BERA 3A67L 1ZA3A 4X4ZA 1T7YA 2OL3L 3WS6A 4X83A 1T1WB 1ZHNA 4Z7VE 3DV4B 1QBMH 4Y16A 2A6DA 1W72A 4CDGC 5MEPB 5DD6A 1AD9B 5EU7E 4ZD3L 4NQCE 4UIMA 4WO4D 4EOWH 4EDXB 3MXVL 2XKSA 3DPBA 4Q2ZB 3DNKA 4WFHE 3GMPB 5FKAB 1QLFA 5E6IA 5BRZE 2XOTA 3KDMB 1L4IA 1KPUA 2O5XL 4LLUB 3U46B 3EYUL 4G8EA 3AGVA 4DTGL 1K6QL 2NYYD 5HHPB 4UT6H 3MLYH 3BESR 3WIIH 1G7JA 3GUTA 3DMMA 4PJHA 2O5ZL 2B0SH 3EFFB 1Z9OA 2HYMA 1PQZB 2BVOB 1J0YA 1QLRA 1UH2A 3OR6B 1H3WM 1HHIA 1T03H 5CJQL 1L0QA 1JPST 3PWPD 3OKNA 4TNVK 4TVPL 1OAYH 3QDGB 5CSGA 1NL0L 1EK3A 4RMQA 5INCB 4YDKL 3NGBC 3S8WA 2NY4B 1BOYA 1TETL 1Q1JL 5L0QB 4OAWB 4WJ5B