2UYLB

Crystal structure of a monoclonal antibody directed against an antigenic determinant common to ogawa and inaba serotypes of vibrio cholerae o1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
213
Chain Sequence
QVQLEQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGHISPGSSSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCGREETVRASFGNWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MONOCLONAL ANTIBODY F-22-30
publication title Crystal Structure of a Monoclonal Antibody Directed Against an Antigenic Determinant Common to Ogawa and Inaba Serotypes of Vibrio Cholerae O1.
pubmed doi rcsb
total genus 43
structure length 213
sequence length 220
chains with identical sequence N, W, Y
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB02
2BY2A 3L5IA 4OCWL 3SDYL 1TZHB 2IBZX 4QYOB 4UOW1 5I15H 1BGXH 3P9MA 2YD4A 1P9MC 5HI3D 3G04B 1SJHB 2YKLL 1FP5A 1I1AD 1YEFL 2H41A 4LRIA 2V9TA 1KYOK 5C07A 4B53A 3TBWA 5F6IB 1QLRA 3R1GL 3MRIB 1HQ4B 1KNOA 4HUKB 5A2JH 3P0YL 2GJJA 5FOBA 2V5RA 5DRZB 4KMTH 3MRQA 4XGZB 5CLTA 2CR3A 4MQTB 5F8QC 3L3HA 3QDJB 4YBQC 2AJSH 4LSRL 1OT2A 5DMGD 4NQSB 3MSPA 3OX8B 3WDJA 1S9YB 5DD1H 4L3CB 2CQVA 1FZMB 4PJXE 5IBLC 2WWMD 5ITFA 1Z9SA 4GMTL 1ROWA 2AI0H 2VDLH 3C08L 2W07A 5KTEL 4OTXL 1ZHLA 5DUPH 1I7ZA 5IBUB 2XKNB 1FH5L 4H8WC 2R4SL 2WLYA 4Q9RH 4JO4L 2DMBA 2OTPA 5D1QD 2DJSA 2E9WA 5J6GB 2A6KB 2G5BA 5E2WL 1R3KA 4R7NB 4K9EH 5DRXA 1AI1H 4NM4L 4PJ9B 5DGRA 3C8KB 5CEZH 1Q38A 2E8ZA 2NY6B 1U42A 2C1OA 3Q2CA 3OXRB 5HHXL 3K2UL 4QRRD 4X7FC 3FN3A 1RUPL 4EVNB 3GSNL 4LCWB 5L2JB 4RNRA 4UT7H 1U92A 5IVOA 4B41A 2LU7A 1N59A 1BQSA 4GUPA 4BK4A 1PD6A 2CIKA 2FSEB 4NQDB 3U9PL 4X80L 1RMFL 5CJXA 3IAGC 3NPSC 5CP7A 4Z7VA 2PR4L 4R7DB 1VPOH 5EOQL 3BH8B 5F7DA 3IDYB 3KVQA 4QXTB 4X5LA 1D5IH 4RMTA 2I27N 1DBMH 4J8RA 3RWCA 3QZWA 5F21B 1PQZA 5F96H 1N6QH 3DX9A 1FVDA 5EU4A 4PJCB 4YHYB 4LKCB 2IAMD 4I77L 1UWGH 4ZFGH 4DKEH 4ZFOB 3MRDB 3BXNA 1ZS8B 5C1MB 3W2DH 3CMGA 5F7EH 2OM5A 4TUOA 1OWRM 5LGHH 1XR9B 2YWZA 4DWHA 1RVFL 4EIGB 3U36B 3CZJA 2NY2B 3S37L 4QHNB 3P9LB 1C5CH 5ID0B 3QISA 1SVCP 3GMOB 1RUKH 4Q7DA 2OR8A 4OGYH 5DMKB 4PLJD 1FNGA 5AAMA 2ZUSA 1A3LL 2A1WL 5EZLA 4YHZL 1UM6L 1ZSDB 2ZPKH 1W0VA 2VAAB 3QUXB 1FGNH 4UQ3A 3NGBB 4QY8B 2ZUQB 1NFKA 4R90L 4MNHB 1T66D 4UAOB 2DI9A 5D7LE 3SDXE 3KPOA 4YJZL 4GJTB 3WEXA 3MLUH 1MWAL 4AENB 4OQTH 3G9AB 2IPUK 2MTPA 2OP4H 1P2CB 5FB8A 5E24E 1E6OL 4NQVB 4ETQB 5IIEA 1ZLUK 2ZKHH 1NL0L 5DMIL 3W5NA 3D39B 3MFGB 1D5XA 1JPTL 2HTKC 4OLZH 4JHAL 4OLXL 2GJ6E 1CDYA 5DJ2B 3RWGB 4GMSL 1HXMA 3V0WL 3OXSA 1U8KA 5D6CA 2YBRA 1YEGH 1S7QB 4MXVE 3SGJC 4K9EC 4NRYB 5DQDH 5FF6B 4RMWA 5AYUL 4LRNL 5I18H 4NFDA 2PW1B 4HGKC 4MA8H 2EXYC 3W11C 4TTGA 5DJ6B 1YUHB 4XCNA 1IEAB 1CVSC 3WFEH 1NCWH 4LP5A 4UV4L 5JW5B 4J4PC 1FFQA 5CEXB 4G6ML 1T1YB 5DJXA 4ODSH 2ENSA 4CAGA 5J06A 5FM4A 4YX2H 2DQDH 5JOFA 1TTFA 3MODL 3QIUD 4GH7B 4P46A 4P23A 3I50L 5F3HA 3X14B 2WQRA 4NGHL 4APQD 3U2SA 5SWSD 1FYTD 4WFGD 3FN0L 3A0OA 4R3SB 4PJDA 5FA4A 4DAGH 4JQXA 4NJAH 1G9NL 4DGYL 2K1MA 1CTNA 2EO1A 5FDYA 5GJTL 4JY6A 1QYGH 3DETC 3OR6A 3S4SA 4YDLB 1FZKB 1XF5A 3WCYA 5JR1H 1FHGA 5ILTL 1AQDA 4L1DA 3UTSB 3BISA 5D2LF 1KCUL 2C26A 3M8OL 1MRCH 3BQUD 5F88B 5BMFL 5DUML 4YHIB 1IKNC 1A1MB 1X5AA 2FIKB 4JN1H 3HE7C 2RB8A 1BF2A 3KPLA 9CGTA 1T04B 4XWOD 3BEVA 5AG9A 3MA7A 1H5BA 4HUXB 4M6AA 5ISZD 3VI3F 1FYHB 1OPGL 4JDZB 4WUUE 4OFPA 5DO2D 1YQVH 3REWA 4URTB 5FHBL 3UC0H 2R1YA 1BBDL 4GAGH 5IHUH 2EDRA 1KG0A 3D9AL 4M48L 1KV3A 4KHTL 3VFSB 5JPNB 5E03A 3L5HA 4ZSOE 3HAEH 2X09A 3MCKA 4P49A 3ZKMC 1ULVA 3TO4B 4N1HB 4NQXB 4MJ6A 3GSNA 4YNYB 1NEZB 1NCAL 3JV6B 1ZT1B 4HMCA 3CFDA 2O61B 1E4WH 4GBXA 1EXUB 4QRTA 2V6HA 3QI9C 1IBGL 4O2CA 3WIHL 3MV8A 4Y4KC 3S8WA 5IT2H 4KTDH 1MCWW 1UZ8B 4O58H 3HZMB 4LF3B 3ECBA 2UZXB 1PEWA 5EPMB 1U8IB 2V17H 3LOWA 4P4RA 3UZQA 3RZCD 4G7YH 1KT2B 4X9HA 4ENEC 2VLLB 4KK5C 1VGEH 3EOAA 4XCCL 5KZCD 5HYJD 2J1KA 2H45A 2PXYD 4X6DB 2WP3O 4CVXA 3DECA 1FFOA 2YD5A 4Y2DC 4RGMB 1T21A 4YZFF 1AGFB 4EDXB 2CUMA 4X8XA 4NWUL 3GJFA 4D0DA 4CRPA 1NUDA 3QWRA 5DTFB 3VWKC 5MI0B 4OF7A 2H26A 4OZIB 2VTFA 2X40A 1BPVA 3DROB 2OI9C 1LO3L 4M93B 1E4XL 3TH4T 3WS3A 3DJ9A 4BFEA 4M7LL 3DXAA 5F97E 5GGTL 4JREB 1SHMA 2P24A 4HGWB 5FYKL 1A0QL 1AO7E 4IHOA 3ZYJA 4WCYH 1LEIB 2BRRL 1JHTA 3JV5A 2Y5TA 3ZZ1A 1BJ8A 4HWNA 1BOYA 3ULVH 4XC3H 4HS3B 4XBPA 4YLQT 4CBPA 4X6CA 5CCKL 3FTGB 1QO3B 2IWGA 3KPRD 4PGBB 3P4OB 2CDFA 1MFBL 2SEBB 4HIIB 4LBEA 1CDBA 5C0DB 1AQKL 5FUOL 4QLRA 1FYTE 1KPUB 3BH9A 1EJOL 1HHKA 1TPXC 3FO0H 1RPQA 2DB8A 4R9HA 1ZE3C 4ODXB 1N2RA 3PHOA 2EDJA 3BVNA 1UJ3B 4GT7A 3VGAB 3BT2L 5EA0L 2EDOA 3CVHB 3MBXH 5HBBA 3OGCB 3L1OL 4RIRB 3KWWA 1KPVA 2HKHL 1L0YA 3LIZH 4PJHF 4FZEL 4WFHE 2X1QA 1X44A 3AMKA 5CS7A 2FD6H 4IEFB 2V7NB 2HFGH 2YPLE 3QDMD 3RP1A 1AC6A 1PVHA 5KSVB 4ONGL 1J0KA 3VMPA 3N50A 2ZNWA 3JSSA 2WAHA 4HT1L 4O51A 3OF6A 1JZ6A 2DS4A 1LO5A 3IDMB 4HBCH 3LHPH 5I1JL 4LPXA 4RGND 2G9HB 5DC0A 2OXHA 5IESL 5KVMC 4ZXBB 1S7VB 1CG9A 1M6OA 2NXYC 5HVGB 3SDYH 2AK4A 2OJEA 3WN5C 1KTRL 4RFOL 1RY7B 5C70A 4H0HB 4KZEL 3T3PF 2YKLH 4U1SA 1YEFH 4ZUWB 2ESVD 4FFVD 3R1GH 4WIQA 3MCLL 4NO2A 2BNUA 3K46A 3P0YH 3LKSA 4M03A 2EKSB 5F7YC 4XI5D 3RWEB 4JY4B 5GHWL 5H35A 4NCC2 3S6CA 3OAUH 1PX3A 2ZJSL 3GM0A 2NW3A 4KTYA 1FNEA 4GMTH 5JXAL 3B2VL 4LP4A 1IC5H 3C08H 1JF5A 1H9VA 5IM7B 5MEND 2OJZH 5KTEH 1V7ML 4OTXH 4OFVA 1LWRA 4FQHA 5GRVL 3O9WC 2BZDA 5C08A 1ES0A 4BSVB 4MNQB 1R3LA 3GSQB 2F53A 3Q48A 1N5AA 4Z7VF 4I2XB 4HBQA 4HLZH 5J3HD 2PO6B 3VFWB 1OLZA 5GJSH 3DX6B 4KJYB 1F02I 2YN5A 1CFSB 1S78C 4NM4H 5CKGA 3TA3B 2WBJC 4MX7A 3GRWA 4AT6A 3VH8A 2QSQA 5DFTA 5IB2B 1CGSL 1AXIB 5HHXH 1FL6B 4OZGA 1UACL 3QRFM 1KJ3L 1RUPH 5I6XC 3ULVC 4RFNB 3TFKC 4QRUA 5DVOA 3ELAT 5B8CB 1MH5B 3OKNA 5JW4R 3HAEG 3U0WL 1I1AB 5BJTB 4X80H 1RMFH 4MXWL 4YEEA 3GNML 4PUBL 4EN3C 2AEQL 1HIML 4M3KB 5KANI 4IRSC 2PR4H 3EYFA 1MCDA 1FZOA 3T4YB 4PJGE 3CFJA 4TSCL 2V2XA 3TNMB 1RIUL 2K3TA 2XQYK 1T7XA 4OLEA 1A6TB 4KI5D 2C4FT 3KPRE 4D94A 1GH7A 2QADC 4DFIA 3RA7L 3EJZD 3D2UD 4OF8A 5DT1L 2ADJA 3BHBA 3SDAA 2CDGA 3ULVF 1JK8A 2FECL 2DD8L 3O45A 5FEBA 5KVFL 5IROA 3QZWG 4LVHB 5JNYB 4Z7UB 5F89B 5D1QB 1ND0A 4XMLL 1RVFH 2E7CA 3QHFL 4Y7MA 3STZB 4WHTA 3O3UN 3ARGA 3S37H 5JW4M 3S37X 2EIDA 3VGHA 3TVMC 5HGDA 5KSAA 5CWSB 1ZGLM 3ARDA 4XNXL 3C09B 4QRRB 5KJRH 5EBLA 2X4TB 4HUVA 3RTQB 3OHXB 5GGTA 2QHLA 1A3LH 2A1WH 2DQIL 1QG3A 2VQ1A 4P23C 4LGPB 4P5KA 4YHZH 1UM6H 3PWNB 4JY5H 1KFAL 5JDJA 5T3ZL 4P2RD 2HG5B 2YPVL 3RL1B 1DQML 1IMHC 4HS6A 4R90H 5IF0A 5E1AA 5D7IB 4LFHD 1EO7A 2AJXH 4L4TD 1JUFB 3QDAA 1MWAH 1NFIA 2LTQC 2NZIA 3PWUB 4KC3B 4UILH 4Y19A 1U95A 4AL8L 1YEJL 4X9IA 1E6OH 3CPLB 4JFFA 2IAMB 2M1KA 4L5FL 1NL0H 1U93A 3MRLB 3Q1SL 2W60B 3QXDB 3VXSD 3T1FA 4JM2A 3TT3H 3I6GA 2XTJD 3SCMC 4MAYA 5C7XL 4JHAH 4OLXH 4V1DD 4GMSH 3V0WH 1ODAA 2V5YA 3AAZA 2FECI 3BN3B 2F8OA 4YFDB 4GW1A 3PHQB 2P46B 5DHVH 4ZSOB 4PJDF 5AYUH 2P44B 3T04D 3V2AR 1VENA 2XNAB 2UYLB 5K9QG 1XF4B 2AKRB 1TCRA 2ZCHL 1WISA 2YD2A 4TQEL 3LN5A 3VXOB 3ZKXB 3CDFA 4Q58C 4XAWL 3KXFE 3WJLA 4LPWA 4AM0A 4K71C 4JPIA 2A6IA 1U8HB 1IGCL 5E6ZA 1TLKA 4LQ1A 4M61A 3RNQB 3CX5K 5EG6C 2FHFA 3SDDD 4YDKH 3T0VA 4S2SB 4DN4L 3MODH 5E4IA 4HEME 1E4KC 3CXDL 3IU3A 4NGHH 2YA1A 3FKUS 3UTQA 5D7JA 1HH6A 3FN0H 2R2HA 1P1ZB 2JJUA 4UIKL 1G9NH 4LSSL 4DGYH 1VKXB 3PGCB 4Y5YC 2FYYA 4D2NA 4P5MA 8CGTA 5GJTH 5GGSY 1PDKA 4HZAA 3HZKA 3VJ6A 1B0GA 5INCA 5A16B 1CIUA 1T7VA 4PYHA 5ILTH 1KCUH 1BD2A 2VAJA 2GTZA 3M8OH 2I9TA 3QEUB 4QEGA 5BMFH 5DUMH 4CJ0A 3RAJL 3IFLL 3ULSA 4Y16D 3QUYD 4M5YH 3B5TA 4L8CA 5EUKB 1OD9A 2VDKH 2FJFA 2WMPA 3PJSB 1FSKC 1LQSR 1XT5A 2IQAA 1SYVB 3O3AB 3D9AH 4M4RA 1NBQA 1QEWB 3F7RA 3IDIA 4KHTH 4WV1B 5IK3B 4OD2A 1CK0L 3BGMA 3FB6B 2HT3D 4HLZG 3ZSSA 1CICB 4LSQL 3DBXB 1NCAH 2PTTA 3NPZB 4M1CC 3GI8H 3UDWC 4XP6L 1D5BA 3QIUB 3DUUA 3R0NA 4OIIH 5I1CH 1FV1B 4P5TD 4DZ8B 4APQB 4I0CC 5SWSB 1FYTB 1IBGH 1II4E 3WIHH 4GRMB 4KKBD 2A74B 2OSLA 4MZ2A 3H9ZA 4JZJC 2IH3A 3B9DA 2XACC 2F5BL 4XBGA 4NKDB 4WWKD 1I1RA 1EHNA 4WFFE 4XCCH 1XGRB 3AREA 3BQUB 3L7FA 5I16B 5C3LD 3BZEB 1I7UA 1R0AH 4YFLI 4L4TE 1MCEA 3QXUA 4UBDD 4IDLA 2DQTH 1J0IA 2FEEI 1LE5A 1SY6L 1Q94A 5GGVY 5DJAA 3VFVB 2C3GA 4F7EA 4XHJC 3QQ3A 3DWTA 1C08B 4G43A 5CILL 4YGVB 4NWUH 2EDTA 1R5IB 4HX1A 3FRUB 3SDCA 3QEGL 1BJ1H 1D5ZB 4V1DE 1NC4D 1C5BL 3NCBB 4WVRA 5KVDH 4AIOA 4F7TB 1SEBA 1TJGL 5DI8A 4F7PA 1LO3H 3FQUB 1CU4L 2X4UB 1E4XH 2APWA 1TZGL 1JV5A 3MRHB 3GDBA 1JF6A 1RZKL 4N0FB 5FYKH 4ISVA 3SE9L 1ORSB 4K3JL 1T2XA 1H3GA 4Y4FD 5MEQA 5GGQL 1AIFB 3EFDL 1MFDL 5FO9A 1G9NC 5ESAB 4F2MB 5CCKH 1IT9H 4IRJC 5HHQA 1KTDB 4KVCL 3MRRA 1HNGA 5MEPB 3RZCB 1K3ZA 1AQKH 3R4DA 5FUOH 5FUCE 2NCMA 1WCBA 5TE7L 2C4XA 1EJOH 1G6RB 1GGIL 3FQNA 4YHNB 2C3HA 5KZCB 5HYJB 4M7KL 3U79A 5D70L 2IFGA 2PXYB 2ZOLA 3LVEA 3PXHA 2ED9A 4B0MM 3FFCE 1ZA6A 5JLZB 1LEGA 3N1QC 4JFOB 3FJTA 4Y5XC 4JJ5B 2ZSVB 2Z8RA 4JKPL 1QLFA 4WRLA 3Q6GL 4V2BA 5DHXB 3MRCB 1WFTA 5DYOA 4WW2C 2HKHH 5C0CA 1CDJA 4QOKA 4GKOA 1HNFA 3U6RA 4ONGH 4M6ML 5TH2A 2D9CA 4HT1H 1EERB 1FN4B 3RX5A 1IAKB 1LILA 1BVLB 4LKXB 3GK8L 2FGWL 2K7QA 4YXLL 2VC2H 2KZ1B 1U6AH 3Q6FA 5F7UA 1BBJA 2I25N 4RFOH 1E27A 3MRGA 1T20B 5IMOA 3ZHKA 4PJGB 2CRIA 4KZEH 5AYQA 2VB5A 4X98B 4X5XB 3CFBB 4E42A 3HC4L 3W9DB 3KPRB 4LLVA 5DWUL 4WW2F 4PLKD 3MCLH 1JWUA 3ZKQD 1F97A 2HJKA 5GHWH 4KUCF 3DSFL 1F42A 3REVA 2ZJSH 3VXRE 3H9HA 3F7YA 5EOCH 3FT3A 3L6FA 2OZ4L 4Z7WF 1ZOXA 5JXAH 3LRSA 5J13C 1G9MH 4KK6D 1U8QB 4D0BA 2H8PB 1CDGA 5DRWA 2BVYA 5TDNB 2XA8L 3OKLB 4H0IA 2VLJA 4ZD3L 2EICA 4ETYA 4MLSA 4U1LB 3HCVB 1UKSA 3C5ZD 3LKQB 3QDMB 5EUOF 3IAPA 2JCCE 2EDFA 5KSAC 3HC3L 4PV8A 5KVGL 1GIGL 4X99B 2WINA 1DN0B 5T1KB 4CDGC 5IQ7L 4RGNB 1T1ZB 1PW3A 2R69L 1CGSH 4XPHH 4MD4B 2HT4C 3WJJC 3ETBF 4GRLA 4C4KO 4MDIA 1UACH 1KJ3H 5DK2A 1FAIL 2YZ1A 3TCXA 4U7SA 1XGQA 2A6JB 4TNVK 4MXWH 3KYKL 4YBQD 5FYJU 3GNMH 1HIMH 1MAKA 3MV7A 4PY7B 4W68A 4HLJA 1S7UA 5IVXE 1RIUH 2Y6SC 3LKOB 5E7BA 1F11B 3QEQA 2DWDA 3HC0A 1D6EB 2Q7YB 1T5XB 3RA7H 3TZVC 3F58L 5MENB 5CJ8A 5L88L 1IGIH 1EZVY 3O3DA 4M6OL 1DBAH 2C3VB 3MBEB 2DD8H 1HQRA 5KVFH 2OQJA 4JANA 4ELME 3H7LA 1CGWA 3HPLA 3PDOB 4PRNA 4UIMA 4N8VB 3ZE2E 2AABL 5GS0H 3C2SA 3ZTNL 2LV4A 4D9LL 5IW1B 4U6YB 1TZHA 4QYOA 1UXWA 1EH9A 4XNXH 4BZYA 1RUQL 3ARTA 1YEKL 1LD9A 5F1KC 3DRTB 5B39B 1SJHA 3NFNB 5LWYL 4ZDHB 2BY1A 2L4OA 5IGXL 5JXEC 2B20A 3MRIA 3WHXB 1HQ4A 3LS4L 1KFAH 4OM1L 5T3ZH 1F00I 5L6YL 2YPVH 3QDJA 5JW4Q 4NQSA 4O2FB 2Y25A 3CSBA 5D1ZA 3OX8A 1S9YA 4L3CA 1FZMA 3WS6A 4RAUA 5GGRY 2Q20A 1A21A 3I2CL 2QKIB 3MJ8B 4AL8H 1YEJH 4L8SB 1H3WM 2BHUA 2UY7A 3D2UB 5FYLE 1NDGB 1YYMH 2P5WD 5DD6B 2XKNA 2V2WB 3HNTL 4L5FH 4PD4K 4TVPH 4QGYA 1B6DA 4ONOA 3VGGA 1P4IL 1QKZL 5C7XH 4P2YA 5J6GA 2DN7A 2A6KA 4JQIH 2VXUL 3HB3C 4PJ9A 5HDOA 1WC7B 3UXFA 3O4OB 1CWVA 3C8KA 4OJFH 5LVEA 3W82A 4C58B 5IJKA 1HHGB 2ZCHH 4XXCA 4QT5B 4FXKB 1VFBB 4KRPC 4EVNA 1ZV5A 2W9EL 2WIIB 5L2JA 1NCBL 5AUMB 2UUDK 1HSAB 2X1WL 4ZUSB 4NQDA 1IGCH 1U8PB 5ALBH 1AGDB 2R2EA 2E5EA 4BQ6A 3V5KB 4W4OC 1F5WA 1RIHL 2X4SB 3VFMB 4PJ7B 4R7DA 1NUFA 4P2RB 3KHOA 3TWCL 5A40E 1CD1B 3CXDH 4QXTA 3NTCL 2B1HL 2ICCA 3ILQC 3H6JA 1IL1B 4UIKH 1NAML 3LQAL 4L4TB 5KANG 3H7BB 4PJCA 4LKCA 3AREC 1IVLA 4HJGB 4U31A 5KVEH 1P6AB 2HTKD 4ZFOA 3RL2B 3MRDA 5E94B 4YIQB 1YN7B 1ZS8A 3VXSB 3MGAA 4KK8C 2UZYB 3DGCR 5CLWA 2D7MA 4Z7QE 4V1DB 3RAJH 4FQJL 1SEQL 1KIQB 5CJBA 5CEZD 3U36A 3WDIA 1OD7A 4QHNA 4M62H 3CAFA 2EXYD 3W11D 1VSCA 1IQDB 5ID0A 1JMZA 1KIUA 4MS8C 1LP9E 3GMOA 1SBBA 3B9VA 5D1XC 4NQEA 4J4PD 2ZCLL 2Y9RT 3PDGA 1HI6B 4ZUVB 1WT5A 1GOGA 1U3ZA 1XCTB 1ZSDA 4JHZA 3J8F7 1Z6JT 1B3JA 2VAAA 5GRWA 4LSQH 2V2TB 4EI5C 1C16B 2R15A 5IJVB 5JZ7C 4TUJA 3SDDB 4QY8A 1S7TB 4MNHA 3B8YA 1A14L 2Q8AL 4RQQB 4BFBD 1G0DA 2FJHB 1VESA 1W8NA 1VFAB 2VH5H 3P77B 1FIGL 4AENA 2R56L 3DETD 5E08L 4NQVA 4ETQA 4FS0A 1N0XH 3FFCB 2A83B 2F5BH 4OGXL 4JHBA 4PJAF 3HE7D 4XPTL 1OP3K 4K2UL 5C6PB 3PV7A 5T1MB 3RWGA 3GHBL 2DJ4A 4JR9L 1DANU 3GMQB 5D8JL 4JHWH 1DVFC 4HJJL 1S7QA 5FV1L 4NRYA 4UNTA 4YC2B 4OCRL 5FF6A 1SY6H 4OFIA 1K8DB 1KELL 4Y16B 3QUYB 4HUWB 3WNPA 4OI7A 1ADQH 2IPKA 4LDEB 1I8MB 5ANMB 3T0AA 3EO0B 1AGBA 3MA9L 5DJ6A 5CILH 4KVNH 1FO0B 1YUHA 3S3SA 1DQTA 3QEGH 4OQ1A 5GXBB 5FCSH 5C09D 1C5BH 5JW5A 1C1EL 5CEXA 4BFGA 2AXHA 4QXWA 4TN9A 1TJGH 1UA6L 3VG0L 1CU4H 1KJMB 2IBZY 5AZEL 5B3NA 5K33A 4XB7A 3X14A 1RZKH 2ICWI 3SE9H 1QNZL 4K3JH 4Y4KD 1U3HC 3O2WL 2QLVB 4P5TB 2ZG3A 1QRND 4Q97A 5CINL 2XKSA 4JRYD 5GGQH 2W9DL 4X4MA 1MFDH 3MV9E 4FG6C 1A6AB 3B83A 4PJIE 1N5YL 3OKEA 2R2BA 5T33L 3VXRB 1FZKA 4KK5D 4ENED 4KVCH 3SQOL 3UTSA 4RWYL 1L9MA 4KPHL 2IGFL 2HFFB 3ULUL 5F88A 2COQA 4X6FB 4YHIA 4X7TB 1A1MA 4WWKB 5LQBL 2YUVA 1GGIH 4Y2DD 1NCUA 2MOVA 5D70H 4HUXA 4XP5L 2J6EA 4JDZA 1OAUL 1MFAL 2L0DA 1MCQA 1XAUA 2D31B 1M1SA 3QDGE 2JCCB 3RKPA 4JKPH 1Z2KA 5CJ5A 3Q6GH 5TGBA 3VWKD 3VD9A 4NNYB 3VFSA 5JPNA 2R23B 4QF1A 1L6XA 1NC4B 1BFVL 1JPSL 4PJFA 4QTHB 1C8PA 3TO4A 4NQXA 3L3OB 1Z9OA 4YFLF 4M6MH 5EO9B 4ODHL 1NEZA 4G6JH 1P5VA 1ZT1A 4OZFB 3VDAA 4K94L 5C0BD 3GK8H 2FGWH 1F3JA 3V95A 3AY4A 3MRMB 3W39A 4Y4FB 1UZ8A 3MRNB 3VI3E 3HZMA 5L7XL 3W9EB 5E0QA 4LF3A 5IVXB 4H20L 5EPMA 1U8IA 5BV7B 1KT2A 4Z95L 4KQ4L 2VLLA 5DWUH 3K80A 3WFDL 3VXUE 4OKVB 4EJ1C 3EOYG 1IGFL 3KYOB 4WTZA 4ODUB 1MF2L 3NCYP 4RBPK 3SKJL 4X6DA 2Y36L 4PJEB 3DSFH 1CD8A 1MVUA 5SWZE 2MPAL 4ELMB 1AGFA 1WK0A 1NGYA 3DURB 1KYOJ 2VR9A 2OZ4H 1A64A 1OP3H 1XEDA 3D1MC 4NC1C 3GSXA 4FTVA 4GAFB 4OI8A 4HKBB 3DI2B 5DTFA 5F1IB 4MB5A 2E7MA 4K23L 2WZPD 2XA8H 4ZD3H 4LNVA 3BIKB 2DYPD 4HGWA 1GIGH 5MHSD 3GIVB 5GS1B 1RZKC 1ZLWH 1LEIA 2NXYD 5IQ7H 2QHRL 2XZCH 2DIAA 3ES6B 3IYLW 4P9ML 1NBYA 1BZ9A 1W8OA 4HS3A 1KIRB 4WO4C 3FTGA 1QO3A 5IR1A 5LGKA 4K55A 4DEPB 1TQCC 4YZFE 1JNNL 4PGBA 3VFTB 4HS8H 1ONQB 4MA3B 5GGRB 1UJTA 5D1ZC 5C0DA 5IEKB 5FIEA 1KPUA 4BUGA 4RCAA 5DJ8B 5C0AD 1EEZB 2YK1L 1RD6A 4AH2B 1B4RA 3U83A 1UJ3A 4K3HA 4OV5B 3O6FA 3CVHA 3MLWH 4CVUA 5DQJB 3WBDA 1Y0LB 2ADIB 2JIXD 3OGCA 2G5RA 3TH3T 3F58H 1FORL 2AK1H 3O9WD 4P2QA 5TDOB 3P30L 4LHJB 4GFTB 5L88H 1U58B 5HGGS 1RUML 2R39A 2E7BA 3ARSA 4S1QL 4PGEB 1FLRL 3HPJB 1SJVA 4ZFFB 3NBNA 1J5OL 4U1GC 1GAFL 1JNHA 3QFJE 3C5ZB 1TVHB 2AABH 2WBJD 5MP6L 3IDMA 3ZTNH 4P2CG 1MHHB 2G9HA 5JIKA 2Q3AA 4ZXBA 3HTLX 3ULVD 1S7VA 3TFKD 2YD3A 2DQGL 2HFEA 1D3CA 4JO2L 1RUQH 4I18C 3IDUA 1YEKH 3V4PL 4JDVB 4ZUWA 1ZGLP 3ARUA 1UB6B 5LWYH 4IS6B 4EN3D 5IGXH 4PTUA 4W6YB 4IRSD 3SE3C 5C07E 1H3TA 3BESR 4QRQB 3MOBL 4OM1H 2EKSA 3RWEA 4JY4A 1ED3B 4C59B 3C6LC 3RGVC 2W0LA 1FQ9C 2XY1A 3L3IB 5BZWB 3MRPB 3ZO0A 3PGFL 2Z31C 3VXMD 1QBLH 2QADD 1OSPL 4ZFZB 3FT2B 1G7QB 1K4CA 2YD6A 3I2CH 2VXSH 3SQBA 2YMXL 1DQDH 4UTBH 2FBJL 5F3BB 3DV6A 1FE8L 2NX5D 2CLZB 3HNTH 3UTPD 3RUGF 2F9BT 4BSVA 4MNQA 3GSQA 2Z93A 5J1SC 4I2XA 3V6OA 3QT2A 1P4IH 1UFUA 1NUGA 1QKZH 2PO6A 3MTRA 3NCMA 5DUBB 3VFWA 3PGDB 3DX6A 3AFLA 1KGCE 1CFSA 2VXUH 3FONB 3RPIB 3TA3A 3TVMD 5CJQL 1PG7L 2Z8SA 4PGZA 3FB7B 5E8OB 1WBXB 5IB2A 3RWDA 3I02B 3GJFK 1FL6A 2E6PA 5IW6B 3DLQR 1A6VL 2EDNA 4JLRB 3HMWL 5C2UB 4JAMB 2W9EH 4FRWA 1T7WA 4NFBA 4P23D 5DVKA 4NDMB 1MH5A 5B8CA 1A3RH 1I1AA 5BJTA 5E5UB 1OAXL 1I3VA 2O5ZL 3C9NB 1JYNA 3NPSB 1KCVL 1T1WA 3KYAA 4N8PA 1RIHH 4HWZB 5FKPB 3T4YA 4ZPTB 2BNQD 1OTTC 3JWOL 4Z7VE 5TE6H 1I8IB 4TOYH 4NHCH 3KGRA 1A6TA 4X6EB 4YPGB 2B1HH 3WO4C 4LPTA 4I0PC 1NAMH 1MCSA 3M45A 2RFXB 4M43H 4CL7A 1ZA3B 3SCMD 2VR4A 4JG1L 1OW0A 5C0AE 5JNYA 5C2BH 4HXAH 4NZRH 4Z7UA 3WUWA 2ITDB 5F89A 5C6TH 3DARA 1KCKA 5D1QA 1SEQH 3B9KC 1PEZA 4KV5F 1UCBH 3STZA 1QR4A 3D5OF 3T09A 1UWXK 1JVKA 3JTTB 4G6AC 3MC0A 4QRRA 2X4TA 3OHXA 1IAMA 4Y0GA 3IAQA 4I8DA 5J12C 3BW9B 2ADGB 1URLA 2WM0A 5E5MB 3FOLB 1KLGB 3GKWL 4C56D 3CCHA 1NGWA 3GHEL 3U7WL 4PJBF 3PWNA 3MV9B 3LDBC 1EMTL 2HG5A 3RL1A 1EEUA 4JFEA 4KAQL 4CDHA 2Q8AH 4LAQL 5D7IA 5FO7B 1NBZB 2J8HA 1FIGH 2JTDA 3PWUA 5HHME 2R56H 2AEPL 4WDIB 5E08H 1Q9LB 3JVGA 2IPTL 1UM5L 3CPLA 2IAMA 2J88L 4WI3A 5ICZB 3BKYH 1BEYL 4X5WB 3MRLA 4OGXH 1N6UA 1XF2B 4NQUA 2W60A 4U6HB 2XOTA 3DHMA 2C7UB 4K2UH 3GHBH 5D8JH 4O00A 4EEEA 3N1MC 4HJJH 5D71L 3PHQA 4OCRH 5E8NA 3EYSL 2XNAA 4GKSB 3VWJC 1KELH 1XF4A 2AKRA 1Q8MA 2NX5E 4F37F 3F7QA 2ZG1A 1A2YB 3UROR 3CDGB 1XZ0B 3ALXA 5D2LB 4WHYH 3VXOA 1NFDF 1U8HA 4HIJB 4LQFL 2FLRT 1UA6H 3DHJA 4M1CD 3BEWA 3FQWB 1T80A 4S2SA 3VG0H 3BPCA 4M8QB 1NSNH 5C86A 4O2EA 2W1NA 2YWYA 3BIBX 4JFXB 4EIZC 4GQ9L 5K59F 1VFMA 4LVNC 3NN8B 3O2WH 4IOIB 5CINH 3FT4B 5C0RL 4MD0B 2BVPB 1VKXA 2W9DH 3G6AB 3PGCA 1IEBB 3C8HA 1T83A 4PJDE 3S96B 1N5YH 1CLZL 1VEOA 4R26L 3MLVL 4PJFF 5T33H 2AJZB 4A2LA 3L3KA 5A16A 2X05A 3SQOH 4RWYH 1HCFX 2IGFH 3CFCL 3ULUH 1CI5A 3QEUA 3BKCH 3HE7B 2V7HB 4TNWF 5LQBH 3W5MA 3OJDA 4PBVC 4X9BA 1VEMA 3ARZA 5IUSA 1C7TA 4XP5H 4JFDD 5FCUL 3P11L 4XHJD 2IG2L 1OAUH 5EUKA 1MFAH 1MLBB 2Y07L 3PJSA 1KSRA 3DVNB 3NFSL 4FHBD 4M00A 1SYVA 3MXWL 3O3AA 1DE4B 4JZOB 4F9LA 1QEWA 4Q0XH 5IK3A 3MYZA 1CL7I 3UTZB 2DAVA 1MEXL 4ZO7A 2J8OA 3TJEL 1JPSH 3FB6A 3IS1X 3BYTA 1EHAA 4OLUL 2BVOB 1KACB 2GTWA 3WNNA 3C5SB 3AVEA 1I85A 3IGAA 1FIEA 4ZG1A 1KCLA 3DBXA 4ODHH 1SJEB 4PRPA 4NP4L 5F7MC 3RHWF 2A38A 4KMLB 3QIUA 5EZIH 2MWCA 4TRPH 1FV1A 3IU4L 3QI9B 3E8UH 4K94H 2QSVA 4CMHC 1S8DB 3BAEL 3TESA 4DZ8A 3LH2L 3FMGL 1X5LA 4APQA 4G8IB 5SWSA 4XT1C 1FYTA 4Y4KB 5D2NC 2APTA 3JUZA 4GRMA 2NR6C 5CZXC 4IRJD 2A74A 4JRYB 3MV8E 1KLUB 2B2XH 1S9VB 5GRJL 4H20H 3MRFB 2KL6A 3V79C 1OM3L 4J3UA 4Z95H 2Q87A 4NKDA 2XXCB 4KQ4H 3WFDH 1CF8L 1XGRA 3O0RL 3QXAA 3SOBL 3BQUA 3K8KA 1IGFH 5I16A 4E41D 3BZEA 1MF2H 2APBA 3SKJH 2Y36H 4HWUA 4OT1L 4Y2DB 3EYOB 3OKYA 2MPAH 1DBKL 5ISZA 3VFVA 2OR7A 2IALB 4QXUL 3ISWA 1C08A 3RY6A 4YGVA 1R5IA 3FRUA 2PTUA 1D5ZA 2KH2B 2Y5EA 1G84A 3VWKB 1BIHA 2XRAH 2F54D 2GW5A 3HNSL 4KUCD 4F7TA 4R97C 5LAXB 3KPQB 2OI9B 5I2IB 2PYED 1GC1L 3E3QE 2X4UA 2BMKB 3FQUA 2DM2A 3MRHA 1JZ3A 3DYPA 5J9PB 4MCZB 3R8BB 3PXJA 1ORSA 3KJ6L 1H15B 5C0BB 1IM9D 4OCYH 1KULA 1CR9H 4PJHB 3PABB 1KNOB 4P9MH 1AIFA 4MB4A 5CGYC 5ESAA 4F2MA 3NZHL 3BWUC 1JNNH 3SE4C 1KTDA 4X6CE 3V4VL 5E4EC 2F19L 5CJOL 5MEPA 3RZCA 2N1KA 4WI8A 3CMOH 4KH2A 2QQKL 5I17B 4XVJH 5IQ9B 3ULUC 1MI5A 3V0VB 1TPXB 4XPAH 1M4KA 1G6RA 5I1GL 1N0LA 4YHNA 5HYJA 4J2XA 4KRNA 1ZHLB 4IMKA 2YK1H 4J3SA 1YYLL 1TJIL 5HPOA 4MAUL 2NY1C 2RHEA 4JJ5A 2ZSVA 3IETB 4Q2ZB 2B1AL 5A3IC 5I1AB 3I9GL 4AQOA 3MRCA 1E28B 1FORH 1I8LA 3DVFA 1RJZB 3P30H 2DLFL 3TIEA 3TM6A 5LCVL 3EZ8A 5HHNB 4S1QH 1TNNA 3HAEB 1W2KT 1I4FB 1OP5K 5KSAD 1J5OH 1GAFH 1QLEL 1CE6B 3LPGA 1W72H 3RY5A 1X5ZA 5FYKD 1FN4A 1IAKA 3ULUF 4RNRB 2DYPB 2HT4D 1BVLA 4LKXA 4K94C 4OF3A 1N59B 4MA7L 4NIKB 2NXYB 3WN5B 2DQGH 1T20A 4PJGA 4GSDL 4X4YB 4JO2H 5CP7B 4YXHL 4Z7VB 1WVZA 2AK4E 3V4PH 1K2DB 2BOBB 3IJYB 4X5XA 4XX1E 3CFBA 1H8NA 2QSTA 3W9DA 2CLVB 3KPRA 3VFNB 1QSFD 3TJHC 3Q5YA 3MOBH 2JJVA 3NMEA 3QZWB 1FDLL 1SBSL 2Y6SD 3ZYIA 4NBYB 3DX9B 1D5MB 1HDMB 5GGVL 1XCQB 3QWOB 3EW3B 4P3DA 5C0AB 1D6VL 2XN9D 1OF2B 4NUJB 5HI5C 3IDGB 4NCDA 1OSPH 3TZVD 2NY0C 4F9PA 2Y4SA 3S35L 5I1EL 2YMXH 1IAOB 2FBJH 3SBWA 1U8QA 3GSWB 3O9WB 3FRPA 4G5ZL 5TDNA 1BOGB 2WW8A 4UV7H 1DCLA 3EOBB 4JO1H 1BAFL 3HCVA 4U1LA 1I3UA 3LY6A 3X3FL 5C08E 3LKQA 1BM3H 3QDMA 2F53E 1B4JL 3U1SL 4DTGL 2WBJB 4X99A 4HHAB 1DN0A 5I66B 1PG7H 3ARBC 1MQKH 3VW3L 1ZKAA 3FHQA 2R0LL 4U3HA 4JN2B 5I6XB 1WJ3A 1A6VH 5TQ0L 1W0VB 1Z5LB 2P5ED 2PYEE 4OZGE 3IS0X 4D9RE 2ZUTA 3WDHA 5JXED 4N8CL 4AMKL 5CD5C 1VEPA 2A6JA 2ESVA 1OAXH 1XH3B 4EN3B 2O5ZH 4IRSB 4XNQA 1KCVH 3WEXB 3QRGL 4PY7A 4UT9L 3B2UC 5DJDB 4AEHH 1U3JA 3JWOH 1AKJD 3LKOA 4B5EA 1UH2A 4WTXA 3R06B 2EE2A 4U1IB 1F11A 3MLXH 3QNXB 4IJ3C 3VXMB 4JEGB 2QADB 2X41A 1D6EA 2Q7YA 5IKCB 1CFQB 1T5XA 1FL3B 5MENA 2PW2A 2HT2C 5D6CB 2C3VA 2OL3L 4FXGA 2NX5B 2V9QA 5DSCB 2BVTA 1E6JH 3HB3D 4N8VA 1QSED 3OG6B 1G1YA 1WITA 4G3YL 2HH0L 4LPYA 2GHWB 1LE9B 2JB5L 4EI6A 4DUVA 4MJID 1MJUL 5IW1A 3T0EC 3TVMB 4KRPD 4U6YA 4G6FD 3U0TB 3WUWG 3UYOD 3BZFB 2XYCA 1S9KC 2G60L 3N9GL 5L8KB 5JOFB 4S0SD 5EC1B 3DRTA 1AY1L 2EEAA 3VFRA 5B39A 5E9DA 3OL2A 3NFNA 4P23B 3GKWH 4ZDHA 3PV6B 3U7WH 3U2SB 3WHXA 4NKQB 3E6HB 3VD4A 1WBYB 2DMCA 4PJDB 1J10A 1X5XA 1EMTH 5GGSA 1YMMD 5TQ2L 2A73B 4UOJA 2D7PA 4AEEA 3ILQD 4O2FA 1T83C 4KAQH 4UDUB 1FNHA 1FFPB 2BNQB 2YHGA 3OR6B 4CN6A 3VE0A 5BOZG 4ODWB 2LTQB 3ARED 4XWGL 3NIDF 1ZT4A 2QKIA 1Y6MR 5TE4L 3MJ8A 1MJJB 4WUKL 3TYGL 5FA3B 3D2UA 4AJ0A 1NDGA 1V5JA 4PG9B 5DD6A 3BEVB 2V2WA 4RWHA 1BEYH 4R96B 1AE6H 3AB0C 3BP4A 4KK8D 4JFFE 3SCMB 1H8OA 2ILLA 1S7XB 2VN4A 5FK9B 4XBEL 1PYWA 1KG0B 5D71H 1WC7A 3S5LG 2GQHA 5HD8C 3VMOA 4MS8D 3EYSH 3PF2A 1MPAL 4JO3L 4OCLC 5GISL 1HHGA 5C6WH 4YBLC 2EDLA 5D1XD 4QT5A 4FXKA 3QYCA 2DLTA 1JHKL 2WIIA 3GSNB 1I85C 1A4KA 4OKDA 2E9JA 4K71B 4Q6IA 4FQIL 1HSAA 1KJ2L 3T0DA 4ZUSA 2AXGB 4C56B 3RIFF 5LXGL 1U8PA 3BWAB 3K81A 4LQFH 4W6XB 1AGDA 4EI5D 5T3ZD 5JZ7D 2OX5A 4LOUD 3V5KA 1KCSH 4HWEL 1BVKB 2X4SA 3MV8B 4LVOC 4PJ7A 3VFMA 3VRLF 4P2RA 3O4LD 5GRYA 3CU1A 4GQ9H 1CD1A 3QG6A 3JWOC 3VD3A 3WFBL 1RIVL 2WUCH 1QA9B 1B0RA 2H32H 5DDHB 5C0RH 3EOAB 4L4TA 4Y5YB 3H7BA 1U8MB 4HJGA 4RRPA 1K8IA 4R26H 3MLVH 4TVPD 5FO8B 3MZGB 3RL2A 5E94A 3CFCH 4RMSA 5CUSL 2CDEA 1YN7A 3VXSA 4AK1A 1DVFD 4FP8H 3LMJH 1G9EA 1JPFA 3MJ7B 3OAYH 2EDEA 1FCCA 1N3NB 4V1DA 3AC0A 3O8XC 2UWEF 2IG2H 3SY0B 1JGVH 2HVJB 2H26B 1FSKB 1T1XB 1BLNB 1IQDA 3NFSH 1FZJB 4BSWB 4P2OC 4YUEH 3GMNB 4NRZB 2XPGB 3MJ9A 1QSEE 2YS4A 2P24B 1V05A 1HI6A 3WO3B 1MEXH 1NGQL 2X7LB 3NACH 1D9KD 4ZUVA 3UTTD 1RZ8B 3TJEH 1UT9A 3NFPB 4EDWL 5CHNB 4P3WA 4MA1C 2V2TA 3SDDA 1S7TA 5KW9L 1U3HD 3SGEH 2ZCKL 3IU4H 1HZHL 3BAEH 2FJHA 3FMGH 1VFAA 4FG6D 5T3XH 3P77A 2XWBB 5DVMA 4N5EC 1MWAB 5LKNA 2FATH 2WWKO 5I71C 1F8TL 5AWNH 5GRJH 3OQ3B 3X17A 1MHPL 5IEHB 3ILPB 2QSCL 1F2XK 1G7JA 4GRWE 1OM3H 1N2RB 5A2KH 3BVNB 4LLQB 5T1MA 3O0RH 3SOBH 4X9GA 1EBAA 2WBWB 3GMQA 4P3CL 4EBQL 5GRXG 2X1XR 4OT1H 4L8BB 2OL3A 4PRHD 5DHVB 4JCMA 4JFPB 1K8DA 1VB9A 4JFDB 4Y16A 3QUYA 4HUWA 5A2FA 1UWEL 4QXUH 1I8MA 5ANMA 2VZ3A 3EO0A 5E8DL 3WLBB 1I1FB 4JPVL 4O51B 3KYMB 2VL4A 1LO5B 1ERNA 3OB0H 3VI4F 1L7TL 5E1HB 2HLAB 4K3DL 4H5SB 1GC1H 2HVKB 4HQQL 2H1PL 4PY8J 1KJMA 3ZDZF 4LHQB 5D5MA 3KJ6H 4I0KA 5D9SB 1KBGL 2DQEL 4P5TA 1PZUB 4X7SL 3F65A 2W65B 2FH8A 1A6AA 2CRZA 2WANA 2AP2A 4IRJB 3WHE0 2X6MA 3FQTA 1GRWA 3NZHH 4FQ1L 3V4VH 4KI1A 3ZLQC 2F19H 2JLLA 2NY5H 2QQKH 4X6FA 1YZZA 2JJTA 4X7TA 4WWKA 2NZ9D 1V3LA 3RVTC 3H2WA 4R8WL 4E41B 1UKQA 1H3UA 3STLB 2MQ3A 1TJIH 3SBWC 3I6LE 1KC5H 2X4QB 5AZ2H 3HLAB 2D31A 4MAUH 4Y5XB 3ROOA 1ES0B 2HN7B 1XFPA 2F53B 3JWDH 2JCCA 5KBNC 3T2QA 3O2DL 3I9GH 4WW2B 4NNYA 4NZTL 3V7AG 1BFSA 1S7SB 4LSVL 2DLFH 2NXZC 2R23A 2X10A 3MLZL 4IOSD 5LCVH 1NC4A 5C0CE 3L3OA 1QLEH 4QOKE 2PYEB 5EO9A 3MZTA 4OZFA 12E8L 3CUPB 4NKIL 1WUNT 3HI5H 4Z7WB 3NIFE 1KB5L 1TTUA 4YHOL 4MA7H 3THML 2AJ3B 2D2OA 4KZDH 4WFED 4WO4D 3MRMA 3K1KC 4H26B 2FR4A 1IM9B 4Y4FA 3MRNA 4NO5B 2GUOA 3QIWA 4GSDH 4YE4L 1JI2A 4KGJA 4YXHH 1FL5A 1CFTB 5D1ZD 3C87A 5EUOB 3CFJB 3KPNB 1MUJB 7FABL 2I9LB 4OIAA 4OKVA 2VDRL 1Q1JH 1ZWIB 3BSZL 1SBSH 4ODUA 1QP1A 4NN6C 5ALCL 1INEL 4PJEA 3BGFC 2NPLX 2YN3A 1IC4L 3CDCA 2X70B 2KQNA 2AXFA 3EKCA 3ROLB 1TFHA 3O45B 3DURA 4P0DA 1F6LL 1T03L 1ITCA 5J13B 3S35H 3S35X 3BGAA 4HKBA 1HXYB 4I5BB 4G5ZH 2D0GA 2MMXA 1T2JA 4V2CB 1FPTL 1F4HA 4H88L 3X3FH 1YNKL 5KSAB 3UYRH 2VLJE 1GC1C 2X1PA 1EVUA 1B4JH 5E5RB 1OVZA 4ZUTB 3BIKA 4CU7A 3U1SH 4O4YH 3GIVA 5GS1A 1RU9H 4IDJH 1MIML 2VQ1B 1OTSC 3NH7H 4GLRI 2R0LH 3B43A 1YEDB 5TQ0H 3SEPA 4WW1B 5EU5B 5KG9A 3T2NL 4N8CH 1X3DA 5IMKA 1K3IA 3VFTA 4AMKH 5J89A 4MA3A 1ONQA 4HS6B 5GGRA 5DD1L 2D0FA 2FB4H 1QSFB 1F6AB 5IEKA 4DZBB 3C6LD 3RGVD 2NY5C 4U3CA 2AI0L 1GXEA 4YK4C 5DJ8A 1KJVB 1U95B 5DMYA 1EEZA 2Z31D 3MV7E 4AH2A 5BW7A 1WTLA 1FFNB 4Q9RL 4P99A 1T4KB 2XN9B 4F37K 3TZVB 1Y0LA 2ADIA 4OCSL 3MJ6A 4BSJA 1UZ6E 1M7IA 2E7HA 4GKNB 3QEQE 5TDOA 3T2PA 3KAAA 3VA6A 4OD3H 4K9EL 1U58A 2E9IA 5IHBA 4GW1B 4PGEA 1R6VA 3HPJA 4ZFFA 3MO1B 3C5ZA 1TVHA 3KYNA 1I75A 4NQED 1Z0NA 4UT7L 3QJHB 2HH0H 4KRLB 2JB5H 5I74C 3T65B 4DQOH 1MJUH 3AROA 4Q6IC 5SX5K 4JZNB 4N8VG 1P9MA 3N9GH 4PFEA 4BZ2H 4HAFA 4R2GC 2P5EB 4JDVA 1YPZF 4NBZB 1YN6A 3N1PC 1UB6A 4OD1L 4QCIB 4IS6A 3WSQH 1DBML 4BH8B 4WY7L 5F96L 1OTTD 4LLYB 3PP3K 1ED3A 1WFNA 1N26A 5BZWA 5L0QC 2BHYA 4I0PD 3MRPA 4ZFGL 2O5YL 1V7NL 3QCTH 1B0GB 3VJ6B 1AKJB 2BVQB 3MYJA 4HWBA 3D6GA 5KAQF 2DTML 3FT2A 2OMBA 1G7QA 4XWGH 4JRWA 2I9TB 1EAPB 5TE4H 3LPWA 5F3BA 2X5PA 3TYGH 2XTJC 1G7HB 2CLZA 3G6DH 4ZNCD 1XMWA 3TGXA 4Q9CA 1GHFL 1C5CL 4NHUB 3O2DA 5DUBA 1OQXA 2XI9A 3B9KD 3EAKA 3PGDA 4RAVB 4U2ZA 4I9WE 2IQAB 1RUKL 1QSEB 4DVRL 4OGYL 3FONA 1TVDA 1WTGT 2Z8WC 1I9EA 1HOCB 3FB7A 2WP3T 4G6AD 1MPAH 1WBXA 5GISH 3SGKC 3HNVL 3L7EB 3WFZA 3I02A 3BGMB 4MJIB 4NZJA 3SKOB 4JLRA 5ABDE 4G6FB 2ZUYA 4WGVB 4TVSa 3WIIL 1CGTA 1FGNL 2PTTB 4NDMA 4PS4H 5GSRB 1QHPA 4FQIH 1KJ2H 2M2DA 2P42B 4F15C 2FZ3B 5LXGH 5DXWA 1PKQA 3C9NA 3K4AA 5HVFB 3G5VB 4NQDE 3ET9F 1N7ML 4ACPA 4HWEH 2FCBA 3KPTA 4OQTL 5KAQG 4HWZA 5FKPA 3X12B 5F1SA 2OSLB 4BQ8A 4ZPTA 1YMMB 5I0DA 4LCUB 1HINL 4G6KH 1KIPA 3BO8A 3NA4A 2D4DA 3WFBH 1RIVH 1RV6X 5DURD 4OLZL 1MCCA 2RFXA 3AREB 1KTLB 3L7FB 1TVBB 1T7YA 2VZ1A 4GXVH 4MSWB 1EZVX 4Q9BA 1IZJA 4PJCE 1ZA3A 2P5WA 1EGJL 3GBML 1LE5B 2BOCB 1Q94B 5DJAB 3RI5K 1P5UA 3BP5B 3BX7C 4LFHG 2DBJA 4RA0C 2ITDA 4NQTA 2FL5B 5E2TL 4G43B 4KXZH 3VWJD 3WFEL 3KS0H 3VD7A 1GZQB 4LCYB 1SEBB 2R4RH 1WGOA 1PGRB 3JTTA 1MHCB 3EIFA 5D1XB 1FVEB 3RJDA 4PJAB 3UPAA 4YX2L 4DFHA 1QFWM 3BW9A 5IMMA 2ADGA 5E5MA 3ZE1F 3FOLA 4UINL 5F9JB 1NGQH 4NQEE 4XP1L 1QHOA 5FXCH 2Z0BA 3RDTC 2DM4A 4EDWH 4EI5B 4DAGL 4P4KC 2PTVA 3C2AL 2VKXA 5KW9H 2DM3A 3O4LB 1S7WB 2ZCKH 1QYGL 4M1GL 1HZHH 4LL9A 5M7QA 5JOPD 1VGKB 2NY3C 2D3VA 4IBLT 2X4RB 3VMNA 3K0WA 2M26A 7CGTA 1WCBB 4WDIA 1RZFL 5DR5H 1Q9LA 2CD0A 1FGVH 1MHPH 4XB8A 5ICZA 4X5WA 1U8JB 4U6HA 1LEGB 2R1WA 2C7UA 3G5YB 2C5DC 5C0JB 1I1YB 2ZNXA 4GAGL 4FTVD 1DVFB 1QLFB 1N8ZB 2GJZB 4P3CH 5D5MF 3SGJA 4EBQH 2VZVA 3GIZH 4MNGB 3NIGE 5LGJB 4GKSA 5GRZA 3S7GA 4QOKB 4M7ZC 3RRQA 2X1OA 5CSZB 5E8DH 1A2YA 5B38A 2E3VA 5D2LA 5K9KA 5TH2B 1DBJH 2VDMH 3WXWH 5I30L 1LGVA 3F12B 1E4WL 4J4PA 3OWEA 1L7TH 4HIJA 2RCSH 1GGUA 3F62A 3UTTB 1EK3A 3FQWA 3WE6B 4HQQH 3CDYA 4M8QA 4YWGL 4OBRA 4GG6A 1E27B 4JFXA 1JZ7A 3ZE0F 3QIWC 5CFHA 3AMLA 1U3HB 1JF1B 4JPWL 3NN8A 2NR6D 5CZXD 1FNFA 3PWPD 4E42B 1KBGH 2DQEH 4LLVB 4U4BA 1MOEA 4JGMA 3FT4A 1X4YA 1JWUB 4LHUD 4MD0A 2BVPA 4X7SH 5D7KD 2EDQA 3C6SB 3S96A 3V4UH 5I73C 4X4ME 4U6XA 2VKWA 2AJZA 5F71A 2CH8A 4LPVA 1WBZB 4LSPH 4O5LH 3LN4B 1MAJA 2EIEA 3VFPB 1IKNA 2EYTB 2APFA 2V7HA 3HE7A 3UTSE 2E7LC 2DQUL 1WEJH 4P2QD 2DICA 3DOSA 2R29L 2R1XA 5HY9A 1DN2A 1ZEAH 4GW5B 4PRHB 1P7HL 1MLBA 1VA9A 4YO0A 2JE8A 3DVNA 2BY3A 4RMVA 4MXQC 4A2MA 1OSZB 4OV6F 4JRXD 1DE4A 2HJFB 1R3JB 4JZOA 3SJVD 4NZTH 4XRCB 4LSVH 3UTZA 4X0KB 3W0WD 1P53A 2I5YH 4WCYL 2I60L 5C09A 5ITBL 4FQCL 1JRHL 5CSBA 2BVOA 3WD5L 3C5SA 1JZ5A 4JB9L 2WUBL 4PJFE 2IH1A 3ULVL 12E8H 1SJEA 4GLRH 4NKIH 5TF0A 1AH1A 4CGTA 3W81A 1KB5H 3SKNB 1S8DA 4YHOH 4G8IA 1FNLA 1EFQA 5CGYD 1RURL 3THMH 4Y4KA 1XGQB 4I13B 1QRNA 2B8OT 4OQTA 1QBML 3RWHB 4JRYA 1KLUA 1S9VA 3AS1A 3MRFA 4X4ZA 2DQHL 1UH3A 5BW7C 3ULUD 7FABH 3ESVF 4G8GD 1A7OL 3DGGB 3BSZH 5ECJE 3MBXL 4XAKE 4ZS6C 4Z78B 2VUOA 3EDKA 2AW2A 1INEH 5ALCH 1ORQB 4Y2DA 1JJUA 2NY1D 1AXSB 3EYOA 5C0IB 5TDPB 4X6DE 3IFNH 5ID1A 5A3ID 2IALA 2VLMD 1T03H 1LO2H 1ITBB 4PRNB 1INQB 4WNQA 3VWKA 4HBCL 4FTVE 3OKMA 3V6ZB 1UGNA 3IF1B 3KPQA 5LAXA 2DL9A 5I2IA 1FPTH 1SMAA 2X44D 4H88H 3CXHK 2BMKA 1YNKH 3D85D 2D4FA 4WENB 3DUHA 1AP2B 1UXWB 4OB5H 5J9PA 1LD9B 4MCZA 1JRHI 4HZLA 3EJYC 1H15A 5C0BA 1MIMH 4OF0A 1INDL 3PABA 4PJHA 4DKDC 3UJTH 1JGLH 1NANH 4WO4B 3BP6B 3KDMB 3LKNA 4ORGB 1TQCB 2DJUA 3T2NH 3TJHD 3FO9B 3GUTB 2CUHA 3MGOB 3OAUL 5J11C 5D1ZB 1JGEB 1QPXA 1OGAD 4RAUB 5I17A 5IQ9A 3A67L 4HH9B 4N9GB 3V0VA 4LARH 1IC5L 3FQRB 4L1HA 2OJZL 5HI5D 3X3GL 1JYVA 2NY0D 1FC2D 4O02L 4N68A 5K9QI 2O26U 3LEYH 3IETA 4Q2ZA 3CSYA 3LKRB 2BNRD 5I1AA 4OCSH 2VXQL 4OFKA 1E28A 5GJSL 2YEZB 1U9KA 1RJZA 4S1SH 2GFBB 3G08B 3JWNC 2HTLC 4P2QE 5HHNA 3HAEA 2AJVL 1I4FA 5DD3L 4U1GB 1JFQL 1MCIA 3VGAC 4G7VL 3FHAA 3QP3A 1RJCA 1CE6A 3HKFA 3ARBD 4N90E 5FECB 2DYPA 3O41A 3LPFA 3SJVE 2FJGB 2QR0A 1CIDA 1EIBA 4YHMH 2P4AB 3WN5A 4PJXF 2R2EB 1LDSA 1F4XL 3RU8L 2ZUUA 4I18B 1ZMYA 3RUGB 5CD5D 4X4YA 4JFED 3PG2A 3UJIL 3K8MA 1K2DA 2BOBA 3IJYA 3BUYB 3KPPA 5D93C 2CLVA 3VFNA 4OD1H 3B2UD 4WY7H 1WAAF 4HFUL 3VXQB 3C6LB 5D96C 3RGVB 1D5MA 1HDMA 1XCQA 3HE6C 3QWOA 5C0AA 2Z31B 4I3RH 1OF2A 2O5YH 1V7NH 4NUJA 3IDGA 5I9QC 2DTMH 2HT2D 2JK5A 2LU3A 4LMQE 3OMZA 1J0HA 4FNLH 5I8CA 2AV1B 1IAOA 2JIXA 3GSWA 3O9WA 2XXMB 4M5ZL 1BOGA 4GS7C 4KMQA 3HI1B 3EOBA 4LGRB 2VRAA 1GHFH 4MNQE 3IXTA 1NMBL 4F7MB 4I2XE 3V6OE 5KJRL 5FM8A 4DVRH 5C0FB 2WBJA 3T0ED 1IFHL 4HHAA 4NQEB 4XZUA 3GBNH 5D7SL 5I66A 5DMJB 4AYFA 5CEYB 4NQCD 3HNVH 1WZ1L 4JY5L 3GEWB 4JN2A 1Z5LA 2YUWA 2NY4C 3WIIH 2YXMA 4TUJB 4FQ2H 4WI7A 15C8H 1XH3A 4EN3A 5L2KD 3LZFH 1MHEB 4IRSA 2DOCA 2AJXL 1N7MH 5F9WC 3PIQB 4UILL 5DJDA 1GOHA 4YEFA 1HINH 3A6BL 3MUJA 1Q0XL 3WO4B 3CX2A 3R06A 4U1IA 4I0PB 5KSUB 1QACA 3QNXA 4KK9C 4U0QB 3VXMA 1JZ2A 5IKCA 3TT3L 4Y2OA 1CFQA 1FL3A 3QULB 3SPVA 3QUZC 4PJBB 3PWJA 1C5DB 1AR1C 2NX5A 1DLFL 5HHOD 1EGJH 3GBMH 4DGIH 5DSCA 5BS0D 2IPKB 1AGBB 5HD8D 5E2TH 2AS5M 3B9KB 4Z7UE 3K4ZA 2VN7A 1LE9A 3MACL 4X8JB 1U2CA 2BY0A 3UP1A 3TVMA 1NMCC 3WFHB 3U0TA 3RIAK 3SDXF 3K2MC 2ZUXA 3BZFA 4YDKL 4PRPD 5J12B 5EC1A 4U0RC 1CE1L 4QRRE 4M4PA 1KEGH 3Q5TA 1OT1A 1M7DA 4UINH 3PV6A 5ELIA 4XP1H 3VFOB 3E6HA 3LDBB 1WBYA 2GY5A 5JORB 4HXBL 2GIYA 5CSGA 3AM8C 1MCJA 2A73A 3C2AH 4LPCA 3OKEB 4UDUA 3NCYS 1FFPA 2BNQA 2R2BB 4JFEE 4M1GH 2YUZA 4MXVF 4HC1L 4IM8A 4ODWA 1G7IB 5D7IE 1NFDB 3AU1B 1MJJA 5DURB 2VZTA 1RZFH 1JBJA 1BJ1J 3FCTB 5FA3A 4PG9A 5ETUB 1QVOA 2YD1A 5AD0B 4R96A 2W0FA 2I07A 1ZANL 4M5YL 1CLOH 3FFDB 3TNNB 3U4BL 3SCMA 2VDKL 4HK3J 5FM5O 4GG6F 2FX8L 2NTFB 3BJLA 1S7XA 4OF6A 3O8XD 5FK9A 3HMXH 4QXGH 4ALAL 2ED8A 5TGBB 4U7KA 3VWJB 1MQ8A 4L4JA 4XMPL 3OAZK 3PUCA 3LAFA 4QF1B 4P2OD 3QSKB 4YDIL 4PJFB 4JFZH 1PZ5B 1WWCA 2H2PC 5EU6D 3GI8L 4J3OC 5I30H 4OIIL 1R3HB 5I1CL 2CXGA 1BFTA 2AXGA 4C56A 1IEHA 3BWAA 1LO0L 5HYSG 1F3JB 3V5HB 1CZ8L 1BVKA 4YWGH 5B38G 3W39B 1E4KA 2ADFH 3IRPX 5KS9F 4K8RL 4LVNB 4HCRL 4CN1A 5I1IL 1EO8L 4JPWH 1A7QL 1WIUA 4N5ED 5EZJA 1YY9D 1GYAA 1ACZA 1H3VA 1QA9A 5DDHA 1NAMB 4LIQE 1MI5D 3PHSA 1LEKB 4HAGA 4Y5YA 4EOWL 2VL5B 2YD8A 6CGTA 3X13A 1R0AL 1U8MA 4C4KT 2DQTL 1AHWC 3TEUA 2IAND 1MVUB 1ZTXL 5FO8A 2ERJC 1ZLUH 4PB9H 1S5HB 3UJJH 1NGYB 4DCQA 2YD9A 2DQUH 3S34H 1UQSB 3DUSB 3MJ7A 1ZLVK 1I7TB 1N3NA 3GSXB 4FTVB 2R29H 1AR2A 3K3QA 2ARJB 3EYUH 2Z4QB 3SY0A 2HVJA 5KVDL 4F80A 5EULV 3TF7C 1A22B 1T1XA 1BLNA 2F74A 3VGDA 5I19L 1MFNA 1FZJA 1W0WA 4BSWA 3BKJH 4LASL 4NPYB 5C0NC 3GMNA 3D0LA 4NRZA 2XPGA 4QRSB 2HKFL 2X7LA 1U8NB 3RVWC 1RZ8A 2DQCL 2I60H 3RBGA 1RZ7H 2ICWB 1JRHH 4FQCH 5ITBH 3NFPA 3EYVB 3WD5H 1BQHB 3LD8C 4OCXL 5CHNA 4JB9H 2WUBH 3UDWA 5I1LB 1NBYB 1QFWL 1BZ9B 5IHLB 1LDPL 1IT9L 5IR1B 4CMHB 4PRPE 5I1HL 5D2NB 1RURH 3DMMC 5JA9A 3PWPB 2XWBA 1MIEL 5DVNA 3S36L 2GCYB 1MWAA 1QBMH 4JQVC 5SWSE 4JZJA 2RAMA 4WFGE 2UWEE 1PFCA 4AIXA 1EBPA 5F6HI 3OBAA 2E6JA 4MLIA 5IEHA 5L8JB 3ILPA 2DQHH 4OGZA 1CXLA 4LLQA 3RVTD 1A7OH 1T7ZA 3O6FB 5BRZD 4L8BA 4P2QB 4NUGH 1MCPL 2CUIA 5DHVA 4FFZL 4JFPA 4JFDA 4HIHB 3QUML 1HYRC 4MB3A 5ISZE 3U7YH 4DOHE 3WLBA 1LO4L 1I1FA 2NXZD 1JNHB 4JRXB 2J7LA 3KYMA 1IJ9A 3SJVB 5B22A 4R97B 3W0WB 1MCBA 2HLAA 4JJHA 4H5SA 1YEEL 2VC2L 5D72L 1E4XI 1U6AL 2HVKA 3QNZB 3KPMB 4U1HB 4Z76B 3HHRB 1UXSB 1X4XA 2HFEB 4NO0D 1YJDL 2GT9B 2IADA 5D9SA 1J87A 5EU6E 1MSPA 1N64H 1INDH 4PTUB 2DIJA 1QFWI 3P40A 1V3JA 5SWQB 2UVFA 2W65A 4FFWC 2KPNA 4PBWD 4IRJA 4IOFC 3PQYD 3KG5A 5E4EB 4D8PB 2Z35B 4KTEL 5EOCL 4WI6A 4Z7OE 3A67H 5T5FH 1CXKA 3ARFC 1K4CB 2DWEB 1G9ML 4QNPE 4GAYA 2RR3A 4E41A 1MI5E 4PPTA 3WYRA 3STLA 3X3GH 4B50A 3DV6B 5HYJE 4O02H 2NY1B 2X4QA 3HLAA 4Y5XA 5C71A 4PREB 2HN7A 3WNLA 2Z93B 5D6DC 1OLLA 2VXQH 4BYHA 4WW2A 4LLUB 1S7SA 3N06B 1FRGH 5DC9B 4DKFH 2DQFA 2AJVH 2F54A 4U1JB 5DD3H 1JFQH 4G7VH 4XPHL 3RWDB 5A1AA 2WSKA 2PYEA 3CUPA 3D85B 5E9DD 4Z7WA 1RZJL 5TPWL 5SX4H 4QRPD 1OTSD 3FB5A 5EFIB 2AJ3A 4OSUL 3TV3L 1OAZL 3WIHA 1A9BB 4H26A 1IM9A 3ZT6A 1F4XH 3RU8H 4CVWA 1D7FA 3D25A 1T1WB 4NO5A 4NZDA 5HGHB 1TITA 3UJIH 1YEHL 3AS3A 1CFTA 5IVZB 3MNVB 5EUOA 4OI9A 3KPNA 1MUJA 4OFYD 2I9LA 1S7RB 4L9LC 4HFUH 1ZWIA 2W59A 1LNUA 3BDYL 2YD7A 1OGAB 5EBWB 1U3YA 2BXZA 2OYPA 1IGIL 4DJMA 4YGAB 1DBAL 2X70A 3ROLA 2NY0B 3TCLA 3BUTA 1A5FL 1NEUA 3WUWB 4KUZH 2CKBL 2BNRB 1RUAL 5GS0L 2IPUG 5BRZE 5L8LB 1HXYA 3HG1D 4NOFA 4I5BA 2EE6A 2ZWLT 4M5ZH 3KJ4C 4X7EC 1VFOA 3TPUB 2IJ0C 4HIXL 1NMBH 2BC4B 2Z92A 3IFOB 4ZUTA 5MERA 3QDME 5CZVL 1TNMA 4WU5B 1IFHH 3MQIA 5D7SH 3RVUC 3ARBB 1F3DJ 3CCHB 1NGWB 3WJJA 1F2QA 4CW1B 1WZ1H 4MQXC 4RGNE 2HAZA 4R2GD 1YEDA 4WW1A 5EU5A 4C54A 3M17A 4JFEB 2VE6B 3B9EA 4LEOB 1QSFA 5I76B 1F6AA 3WL9B 2NLJB 4DZBA 5E00B 4F7CB 2ESVE 4FQQB 3O3BB 4KJQC 5CIPH 2QQNL 1KJVA 1J86A 2OK0L 1YYML 1FFNA 4JKKA 3S5LB 3A6BH 1Q0XH 3CFEB 3GSOB 4CADB 4TVPL 1T4KA 2XN9A 3ZYZA 3TZVA 4GKNA 1KB9J 5GZOC 4A6YL 4JQIL 4Y1AD 3TP4A 1P4LB 5MENE 5CBEB 3WXVL 1DLFH 5E8NB 3AS0A 4OJFL 2EYRB 5HGBA 3L95A 2N56A 3MFFB 1EJ6A 3MO1A 4KGLA 4L29A 3C60A 3QJHA 1P4BL 3T65A 3MACH 3T0EB 4YH6A 3T8XB 1JHLL 3QFDB 4JZNA 5ALBL 4NQCB 5ERWA 2PYFB 3J7HA 3BEWB 1IC1A 3BPCB 5C0GA 4O2EB 2P5EA 5EBMA 2PNDA 1CE1H 4NNXB 2D0HA 5JXEA 4QCIA 2IBGA 5E9DE 5IHZB 3P9WB 4L3ED 4BH8A 1I1CA 4LCWD 5L2KB 1X5HA 3NABH 4LLYA 4HXBH 1MELA 3E6FB 3D48R 4GXUN 2VLKD 3IJSB 4XVUC 2QJDA 5KVEL 1AKJA 2BVQA 3L3KB 4HC1H 2J5LC 5T1LD 1F13A 2ID5A 1EAPA 1QFUL 5C9JB 4AIZB 3OJDB 2PN5A 4S1RL 4BJLA 4KI5E 1F58H 5I1KL 1G7HA 3AB0B 2AXJA 1TQBC 1ZANH 4HUMB 4L4VD 3MPCA 3U4BH 4M62L 5HHOB 4NHUA 2FX8H 4EUPH 2YA2A 3QHZL 4RAVA 3D3VD 2B7DT 1P7QD 1QSEA 2XY2A 4M02A 4ALAH 3SGDI 2DI7A 4MYWB 3UBXG 1HOCA 3O2VL 1X6LA 4XMPH 4YBLB 4IRZH 3L7EA 3QWQB 4MJIA 3SKOA 4YDIH 1B90A 4CKVX 2GTWB 1J7VR 4Y4HC 3IGAB 5EN2B 4PRPB 5GSRA 4RFEB 3RDTD 4ORZC 3LN9A 1RK0B 2FZ3A 4P4KD 1LO0H 5J56B 4LU5L 4W4OA 2LVCA 3G5VA 4LVOB 2VH5L 3O3EA 43CAB 1CZ8H 2UWEB 1FO0H 4UI2A 3X12A 1YMMA 3FL7A 4LCUA 4OLWL 4PJ7E 1N0XL 4K8RH 4P2RE 4HCRH 5I1IH 2DQJL 1EO8H 1A7QH 2NY3D 1MRDL 4QTIL 4WEMB 3MOAL 3KLHC 4EOWH 3QXAB 4GKZB 4S11A 1KTLA 2PUQT 1TVBA 5EU3B 4MSWA 1BJMA 2LABA 4JHWL 4ZUUB 1ZTXH 5BVJA 2BOCA 2FEDC 5ISZB 3BP5A 4DOHB 1FLTX 2VWEC 1YMHB 1ADQL 3AGVA 2RGSA 1YNTA 2FL5A 1AGEB 3VXSE 3O8XB 1T0MA 4KVNL 2XTJE 1YC8A 4D9QD 3DO7B 4OAWB 1GZQA 4LCYA 5I19H 4P2OB 1MHCA 5D1XA 1FVEA 4LASH 4PJAA 3IDXL 3HI6L 1V8HA 2HKFH 5EU6B 5F9JA 1ZVYA 4LGSB 1T22B 4K07A 1CGXA 2DQCH 4C55A 4ZNEE 4MA1B 5HHPB 4OCXH 1TZIB 3EOTH 4EI5A 2CJUL 2HFTA 3QIWD 1QFWH 4B7LA 1HH9B 1LDPH 3O4LA 1S7WA 4FA8A 5I1HH 5D4QA 1RAMA 1OAYH 3LQMA 1VGKA 1MIEH 3S36H 2X4RA 3S36X 4BA8A 5I71B 5IFHL 5HYQB 5DQ9A 1MI5B 3L9RB 1SM3L 2ENYA 5B3JE 4PGCB 1U8JA 1NLDH 4JKWA 4KROC 2IANB 1DANT 4UUJB 3G5YA 5C0JA 1I1YA 3I3DA 2IFFL 1DVFA 2GJZA 1N8ZA 2EDKA 5B4MC 2VR5A 3AUVA 4FABL 1MCPH 4MNGA 4OZHF 4MXQD 4FFZH 3TIEB 5LGJA 4XCEB 1PKOA 4CUCA 3FZUC 3QUMH 5CSZA 1GPOL 2PCPB 5B21A 1LO4H 3MLTB 5ANME 4G6JL 1LK3L 4BFIB 1XIWA 3F12A 2J2ZA 5HDQH 4CMMA 5J0BA 1JWMB 1D9KA 1YEEH 4PJ5D 1AXTH 3UTTA 5J57B 5D72H 3S3PA 3UPCA 3WE6A 4N9OB 3V6FB 5EO0B 1YJDH 2CSPA 5DEGB 1HK6A 5F72S 1U3HA 1JF1A 1SVZA 4K8RC 2BSRB 4EQ2A 1JN6A 1CVRA 1Z3GH 4ZO6A 2HJLB 3HRZA 5D5ME 3QXTA 2H32B 3RFZC 2UY6A 1CD0A 3C6SA 5DGQA 4POZC 2EEDA 1A7NL 5FOJA 1YDPB 3TBVB 2Q8BH 1WBZA 4P3DB 3LN4A 1KOAA 4KTEH 5CP3H 3MUY1 4ZS6D 3VFPA 1MRFH 2FDBP 2EYTA 5HJ3B 2FO4B 4X83A 5C92A 3QCUL 1ZXQA 3L5WA 1CYGA 5BRZB 4H1LH 1CGYA 4GW5A 4PRHA 1CBVH 2ZOKB 4RSVA 2XQYG 5JTWA 4M9OA 1OSZA 5ESQB 1UC6A 2HJFA 4E0RB 1R3JA 5FYLH 5DC4B 5DS8A 2EDXA 4XRCA 1H0DB 3WKML 4X0KA 2K7PA 1NGXB 5EDXA 4EUPG 4MMZC 4Z0XA 4D9QE 2XZCL 5JIIA 1UM4L 1R3IL 3G6JF 4NO3B 3EJYD 3RPKA 1RZJH 5TPWH 3SKNA 4NO0B 4HS8L 2CIIB 5E6IC 1X6NA 4OSUH 3TV3H 1OAZH 2ESVB 3GMMB 1J88A 3RWHA 4M8VA 4XNQB 3VFUB 1YEHH 5ENWB 3PQYB 5GZNC 2YRZA 2FWOB 5KSBF 3LQZB 3DGGA 3MLWL 2QL1A 1MCOL 3BDYH 4Z78A 4NN6B 1J0YA 4K3EL 1ORQA 3BGFB 2AK1L 4C57C 5DJYB 2PW2B 1AXSA 5C0IA 5TDPA 1S9XB 1SY6A 4NC2B 3GBLA 4PJEE 4FXGB 1B0WA 1ADQA 4FQXC 4XPBL 3DYOA 1UENA 2QEJA 2EIZA 2OTWA 1A5FH 2LE9A 1KN2L 4UT6L 2HTLD 1INQA 2CKBH 1RUAH 4BZ1L 1CT8B 2CXKA 3VRIB 3C60C 3QAZC 4N0CD 5DK0B 3DTXB 3V6ZA 3IF1A 4EI6B 4OM0L 1J1XL 5DJZA 4P57B 4AEIH 2XWJB 4WEUD 4HIXH 1AP2A 4XHQA 2CO6B 4MQ7A 2EC9T 4H8WH 5CZVH 2ARJQ 3VFRB 4YAQB 1YJDC 5E9DB 4J6RH 1IM3B 4QRPB 4Z18A 4F8QA 2R0KL 4I48B 2JJSC 3MR9B 3NCJL 4WO4A 3BP6A 3KDMA 3GFUA 4ORGA 5GGSB 4X4XB 3T3ME 3FO9A 3GUTA 4FN0A 2YA0A 3MGOA 3M1BB 2XWTA 3EO9L 1CDCA 1JGEA 5A43C 2KQMA 1QBLL 2VSDA 1QFPA 4NYLB 4OZ4B 3VE0B 4HH9A 4N9GA 1IGTB 4Z6AT 5EZOH 4YK4B 3HE6D 3RVXC 2VXSL 3FQRA 1ZT4B 2B39A 4W4NA 2VMFA 2B5IC 5TF1L 2QQNH 4ZAKC 1DQDL 1XGYL 4UTBL 3EHBC 4ZO8A 1IE5A 1G9MC 3ZE2F 1OWWA 2OK0H 4U3XA 4JDTL 4ODVH 3BP4B 4HKXB 1YPZB 4NT6B 3U30C 3LKRA 2YOCA 3ARVA 4QHKI 3GMRB 1ZLSL 1EPFA 2YEZA 4FOMA 4Y5VC 4A6YH 4PIRF 1PYWB 2GFBA 1DQQB 3G08A 3SGDH 3HG1B 2KBGA 2W0KA 2ICWJ 4K7PX 3WXVH 2R9HC 3VXNB 1BFOB 3MLPA 1G0YR 1YC7A 3EO1B 4POYA 3ALPA 4W6WB 4U1MB 4DN3H 5I74B 1A4KB 1XF1A 5FECA 4HK3N 1P4BH 3VFGL 5SV4A 1BQLL 1RZJC 2FJGA 4Q6IB 5DLML 1A3RL 1JHLH 4JVWA 2NY4D 3OZ9L 2O93L 3WNMA 4I18A 3RUGA 1OY3B 4R2GB 4YHKH 2VSCA 4GW4B 3BUYA 3RWFB 5FGBA 3QG6B 5TE6L 3SE3A 4TOYL 4NHCL 4LCCC 1OB1B 2E8YA 1NCNA 3VXQA 1B0RB 2XQBH 4OFDA 3C6LA 3RGVA 4JKLA 5D7LD 1Q9OB 4M43L 5L0QB 3V8CA 1DP0A 2Z31A 1K8IB 3OKKB 4KK9D 1WWAX 2H6PB 1BZQK 2H9GB 1DUZA 3QUZD 2OZ4A 1TTGA 5E2JA 2CDEB 1AR1D 5C2BL 4HXAL 4NZRL 1NPUA 1QFUH 5ICYB 2AV1A 1HHJB 4S1RH 5C6TL 2XTJB 1NC2D 1IGML 1JPFB 5I1KH 1VFUA 5I1DB 5GS0C 2GJ6D 3HI1A 3I85A 4Y1AB 1UCBL 2DI8A 2P8PB 5CD3B 4NFCA 3O6KL 4BQCA 4Q74A 4UDTA 3D69B 4F7MA 4J7RA 4XNUL 3BN9C 3QHZH 3CZFB 2Q7NA 5C0FA 4H1LG 3CH1B 5EC2B 1WAAE 4CU8A 3KR3L 5MEOB 3O2VH 4MWFB 2XZAL 5CEYA 4HK0A 4XH2B 5DJ0B 2AV7B 4KQ3L 4M1DH 2XG4A 4G9FD 2FLBT 4LOUC 1DEEB 4NOBA 2O5XH 1F6FB 3PL6C 4F15B 3IVKB 4XP4L 5TFSL 2DKUA 5CBAA 4LU5H 1MHEA 3V9FA 5DD0L 3RTQD 4L3EB 3PIQA 1PKQE 5GSVB 3LRHA 4Z7QF 4I1NB 4OLWH 1P84K 5CMAB 1OAKH 1T6WA 3LS5L 2VABB 4MJ2A 5EIIB 2DQJH 3BKYL 2VLKB 1HHHB 5E56A 1MRDH 3T08A 1G7JB 3I6KA 4I0PA 4QTIH 5GPRA 5KSUA 3QO1B 3BMWA 3MOAH 4GAJL 3FOMA 5T1LB 3QULA 4KKLC 4PJBA 1LP9F 1C5DA 4PG2C 3TBSB 2VNCA 4N5UA 2OL3B 3RZWA 4LLWA 2E9BA 3MRKB 5E99L 4L4VB 5CGMA 2P5WE 1BWMA 3T0BA 2XT1B 4WUUD 3IDJB 5E2UL 1TXKA 3B9KA 3D3VB 1P7QB 1A9EB 4X8JA 1DDHB 2LQRA 1AFVH 3GB7B 1XIWC 2H2PD 3WFHA 5F7WC 3CVIH 4LPUA 1D9KC 2P1YA 1NSNL 3IDXH 3TLRA 3HI6H 3SKMB 5GIRA 4W81A 2OTUB 5DA0B 3RDTB 1I3RB 2MCPL 3VFOA 5D5MB 2UUDH 4PRBB 4P4KB 4HFWB 2GAZB 3TN0C 2CJUH 3QHTC 5JORA 4EZMA 2JJWA 5F8RC 3I75B 3WNOA 3FQTB 3GMLB 5DFVC 1G7IA 2NY3B 5DEFB 1NFDA 3AU1A 3BKCL 5IFHH 3FCTA 1SM3H 4TTDC 5JW3L 5ETUA 1QR1B 5AD0A 4TULH 3B8SA 3FFDA 3TNNA 3ROOB 2NTFA 4MCYA 2IFFH 1N4XL 2DDQL 4FABH 4JGUA 3B4NA 4Q0XL 1CFBA 2AVGA 3VWJA 4LEXL 3MRJB 4TNVF 4M7ZB 2HRLA 4NZUL 5C0ND 1GPOH 1PZ5A 3OKDB 5CEZE 1F4WL 3QIBC 2BSTB 3RVWD 1J0JA 1LK3H 4PJIF 5EZIL 4TRPL 1R3HA 5D2LE 1KJ2B 3E8UL 3T2OA 3ARPA 4PJ8C 3V5HA 5IOPB 1AO7D 3PWVB 2FR4B 3HZYA 4N1EA 3INUL 2GUOB 3QIWB 2B2XL 1FL5B 4G9FE 4GG6E 3DMMD 1CICD 2A6DB 4FQLH 2I26N 1NAMA 3KNBA 1LEKA 1DLHB 3VCLA 2VL5A 5I73B 2X89D 1PY4A 3CXHJ 1A7NH 2Z9TA 3EZJB 2NZ9C 1S5HA 2AXFB 1F4AA 3QCUH 5KN5A 1UQSA 3DUSA 1I7TA 4KJWC 1NH6A 1MREH 2C9AA 2ARJA 4F33A 2Z4QA 2XRAL 4HIEB 3MLYL 4QHUB 5JHLL 1EEYB 5HYIA 4U2YA 4KDTC 5KS9E 3OPZL 4WFHD 2CLRB 4NPYA 4E5XB 4Z0BH 2YPLD 4QRSA 3WKMH 5HSFA 3F6IA 1U8NA 3H9YA 2VXTL 2ICWA 1ZGLA 3EYVA 2VYRE 1BQHA 4OCYL 2EC9U 1CR9L 5C09E 4PJ5B 1UM4H 1R3IH 5I1LA 2R8SH 5KG9B 4NRXB 4L8DA 1DBBL 3BPLC 3QPXL 1UKTA 5IMKB 4RX4D 3L3GB 3GRWL 3V7MA 5D2NA 4FFWD 3PWPA 2GCYA 3CMOL 4IOFD 1CLCA 4HJ0C 4XVJL 4LHUA 5K93A 4XPAL 1QRNE 4JRYE 1DQLH 2D03L 1RFDL 5T1DL 4KWUA 3ARFD 3EDJA 2G2RB 4O9HL 1G0XA 1MCOH 4M3JA 5FKAB 5HYEA 1M7IB 4K3EH 1IGYB 4D0CA 1A6PA 3EBAA 3ARQA 5ADOL 4NC0B 4HIHA 2XA3A 4KU1A 5BO1L 4XPBH 3TH2T 1UB5A 4Z5RB 1DSFL 1FG9C 1KN2H 4UT6H 5DJCA 3GJEB 4JRXA 4R0LC 5E8EA 1W72L 4BZ1H 1TETL 3KYNB 4LSDA 4TYUA 5M94B 2WK2A 3SJVA 5JMOC 1I3GL 1G7LA 3W0WA 4AY0A 3UCRA 3IFPB 4OM0H 1J1XH 4KKAC 4J1UB 3QNZA 4HD9A 5JMRA 3KPMA 4U1HA 4Z76A 4H25B 1UXSA 2EIBA 3E2HC 1FJ1A 1CN4A 2GT9A 2GITA 1YN6B 4XTRC 3OKOA 3NA9H 2YSSA 5FGBC 2R0KH 1HYSC 2C1PB 3NCJH 5C0BE 5SWQA 4BKLA 4PLOB 1A7PL 1LK2B 4PJHE 4JE4B 1R24B 3SE4A 5J11B 2OR9H 4PRAB 32C2B 4G8FB 4HGMA 4D8PA 3TBYB 3EO9H 4LRIC 2VLRA 2Z35A 1J1OL 3MYJB 1PBYA 2NYYC 4G8GA 3WFCL 2DWEA 3U48A 5TF1H 8FABB 1XGYH 4PJXB 3PP4H 4PP1C 4RBPH 3HR6A 4JDTH 1SMOA 4PREA 4UV7L 1MCNA 4JO1L 4FFYL 3C8DA 3T3PE 1BM3L 1ZHNB 1ZLSH 1OARL 4LLUA 4EXPX 1J18A 3PNWB 3Q5OA 1HE7A 2BSSB 5EWIL 4KHXL 5J1AB 4U1JA 2WLZA 1MQKL 1JTOA 2JELH 2R0WL 2DL2A 4DKAA 2XZQL 3D85A 3RVUD 3EGSA 2HWZL 4N0YL 4U1NB 3VFGH 1MAML 1BQLH 1KB5B 4MQXD 5EFIA 5DLMH 1A9BA 3OG4B 3OZ9H 1PKQB 5MHSE 2EKJA 3QDHA 5HGHA 3TO2B 3P4LA 5LJYH 3O81A 5GS3A 2VDOL 5IVZA 5T1KD 5D93B 3MNVA 1JTTA 4AEHL 1JZ4A 1KIPB 3S9DB 4YFEA 4HMDA 1S7RA 4KJQD 4OCWH 4DUXA 3BO8B 3MLXL 5ADPL 3MNZB 1OGAA 5D96B 5EBWA 3JV4B 5CJXC 4PB0L 3HE6B 3G9VA 4NN5C 5I8EB 5I9QB 1Z9MA 3WLWC 2P5WB 3UZEA 5GZOD 1WF5A 5INDB 2YUXA 1E6JL 2BNRA 1IGMH 2HRPL 4LSRH 4GS7B 3QB7C 1L7IL 2NW2B 2WWKT 3L3JB 1MFEL 3F5WB 3TPUA 3O6KH 1WZLA 1PAMA 4OF5A 2BFVL 2BC4A 4XNUH 4YHLL 3IFOA 3MBED 2EDHA 5J8OA 4WU5A 1FH5H 2R4SH 3ARBA 5IMMB 3KR3H 4XPFL 2XZAH 4JO4H 2XFXB 4KQ3H 4CW1A 3IJHB 2NY4B 4ONFL 3KXFD 5E2WH 3ZDYF 3ULVE 4OBSA 3VRJB 2P47B 2VE6A 3RBSA 4LEOA 2GKIA 4XP4H 5TFSH 4ZQKB 4BQBA 5IFJA 5I76A 3GM8A 3K2UH