2UYLB

Crystal structure of a monoclonal antibody directed against an antigenic determinant common to ogawa and inaba serotypes of vibrio cholerae o1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
213
Chain Sequence
QVQLEQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGHISPGSSSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCGREETVRASFGNWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY F-22-30
publication title Crystal Structure of a Monoclonal Antibody Directed Against an Antigenic Determinant Common to Ogawa and Inaba Serotypes of Vibrio Cholerae O1.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 213
sequence length 220
chains with identical sequence N, W, Y
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB02
4PR5A 3C5JB 5F7DA 1RQ5A 5DVOA 3SDYH 3KPMB 2VERN 1ZLUH 2OR9H 1KTLA 3WKMH 5D7IE 4MXWH 3IU3B 3SPVA 2BDNL 2Y5TA 1MCRA 3HE6B 3GKZA 3ARDC 3QUYB 4HIEA 4KAQH 3SOBH 3BH8A 4JFOA 5C6PB 2VDML 4ONOA 3X12B 1P6FA 2O5XH 2QL1A 4XBEH 3RVXC 4OF6A 5FCSH 4XAWH 4CKVX 5IGXL 3CU1A 1Q9LB 1B2WH 4AG4L 4ZG1A 4P2OA 2Q86B 4R0LC 1YY9C 5HBBA 3HCVA 3V8CA 3QO0B 4PB0H 3D3VE 3W0WB 3FQTA 3VXUA 4GW1A 4EQ2A 32C2B 3DV6B 5ITFB 3BWAA 3CFJB 2DF3A 5HYJA 5AYQA 1R3HA 5C0FB 1T4KB 1BLNB 2CLVB 4G6ML 3VWJC 4P4RA 3PGCB 1IJ9A 2HFTA 1EERB 3U2SA 1B4RA 3HG1A 4HWZA 2ED8A 2F54D 2DQEH 4XCEB 1INEL 1NLDH 3PE9A 3V7AE 2G5BB 1NBYB 2X41A 1GOHA 1DEEB 2BNRB 1LO3L 4AENA 1OAYL 3ROLA 1W72L 3LN4B 4K94C 1CGXA 2YA0A 3VJ6A 1RHFA 3C6LB 4GAGL 3HAEG 1FRGL 5T1LD 1P84K 2VLRA 1FORH 4JFFB 1PSKH 2R1WB 3U7YH 1WISA 4Y0GA 3WIHA 4OGYH 2NPLX 3QXVA 2DL2A 3RGHA 3QDAA 2HRLA 1G84A 2OL3B 4JREB 3GSNB 4XBGA 4LVOB 2QR0B 2ARJQ 3WUWA 2DMKA 4QRSA 1C5DA 1CICC 4OLYH 1KEML 3G6AB 4G8GA 3VG9C 1YN7B 5KAQG 4GXVH 1TQCC 4J7RA 1XT5A 3QQ9D 4LVEA 1EEYA 5T5NF 3RVWD 15C8L 4PJBE 5AZEL 1CXFA 1SYVA 4X80L 1B4JH 2HLFD 1TNMA 5B3NA 3GMQB 2EDEA 3U4BH 4BELD 4ZO9A 2G5RA 1OLZA 5DJZA 4PJAF 3NN8A 1A64A 3WHE0 2AS5M 4R97B 3MOBL 4NC1E 4YBLB 2E27H 3KPOA 1JL8A 4KROB 1LNUB 4QHMA 2XKUA 4HCRA 5L9DL 5IV2A 1CN4A 1VA9A 3TVMB 3TFKC 1YUHA 5I8EA 4HWBH 1FDLH 1O7SA 1UG9A 3CLEH 4LKXA 3CGTA 4H20H 1I3RA 1XZ0A 4K7PL 3JTSB 5A2IH 4PJHF 3MBXL 1HHHA 1FJ1B 4JFEE 3P73B 3QULA 4R7DB 2I9LA 2J2ZA 4DJMA 1T5WB 1PLGH 1SEQL 5E8OB 4AIZA 5C7XH 3OGCA 1KT2B 1OAKL 2HVJB 4ZS6D 1DANT 4NBXB 1P84J 2E7LC 4ODWA 4MQTB 4JFDE 5E7FA 3NPSC 3ZDXE 3DBXB 2VZOA 2I60L 4L3CB 4R4FH 2C3XA 3U79A 1A5FL 3C09B 2AK1L 1YEEH 4BFIB 1HXYB 2P44B 3BMVA 4JKWA 1ZANH 5C0GB 4HLZG 3RI5K 2P7TB 3CXDH 4HUKB 3JV0A 4NZTH 1NC4D 3DMMB 3HI5L 3L5XH 3O3AB 5EU7C 2HMIC 2BRRH 5MP6L 4PJ9A 2C1OB 2JJVA 1F6LL 3VFRB 4M9OA 2VLKE 2AV1A 4L4TA 1CL7H 4IOFC 3MV8E 1AIFA 5KVMC 3ZTJG 3H9SA 1UVQB 3T4YA 3MRDB 4IS6B 1HI6A 4K94L 1QVOA 5LXGH 1GGCH 1YJDH 5TDPA 5IFHL 4FP8H 4ZTPL 4PJ5B 4QTIL 2FHFA 3V0WL 1MFDH 3HS0A 5JDSA 4C83B 4YO0B 5EOQL 3VFTA 4DGVL 4E0RA 4GAJL 1A7NL 1C5BH 4G6FD 4XPTH 2AEQL 4WU7A 4J4PD 1ZHKB 2Q8BH 4N1HB 2A2QT 1EO5A 4QRPE 3QCVL 2BNQE 3FB7B 1QACA 4NZUH 4OZ4A 1U0QA 3GGWB 1XGPB 4D0CB 5SV4A 5DUMH 4AT6B 3CFBB 5D7LE 5CHNB 1OTTD 4S1RH 4J6RL 4P2RD 4WUUA 4CMMB 1IQDB 2OR8A 3CZFA 2XNAA 1UENA 1ACYL 2AJZA 2X1OA 2G2RB 4PJIB 3F5WB 5T5FH 2Z35A 2XTJE 4I18A 4DGYL 5FYLH 4KZDH 3EZ8A 5D7IF 2FHCA 2DDQH 3DXAB 3VXTB 5IB3A 4X7CC 3SDCB 4IJ3B 4JHWH 1HHGA 3T2OA 4POZD 5C07B 2FSEA 2L7JA 1BF8A 3ILQC 5EBWB 1KCSL 3G5ZA 5HDQL 3UTTD 1EBPA 1BZ7A 5H8DA 1XF1A 4XI5C 4FZEL 3L1OH 4OKDA 5I1AA 3IXTA 1OPGH 5BQ7A 4IRJD 2DQCH 4CGTA 4OD3L 3GKWH 5EC1A 4P5TC 4NKMB 3FONB 4S11A 4WO4B 4WTZG 1NGXB 3ARFB 1CE1L 2ZSVA 4MA8L 1N0XL 4AYFA 3WE6A 5C6TH 4DVBB 3P0GB 1QRNA 1OTUC 2FHBA 4KK6D 3HFML 3REVB 4G7VH 1CL7I 4IDJL 1O7VA 4NFCA 1IC7L 2JTDA 3TBWB 5IB2A 1J05A 3O0RL 5IESL 1U3ZA 5SWZB 3BI9X 3BW9A 4K3EL 1UWGH 4HKZB 4PG9B 5DD6A 3CMOH 3TA3B 4HPOH 1U36A 3MFFA 2FIKB 4YXHH 3SBWA 3IT8D 3EOAA 3GJEA 5SWSB 5D93B 4WFED 1P4IH 3W82A 3MJ6A 4NO0D 3CVHH 2Y5EA 4B50A 1KTRL 4OJFH 4E41E 5ANMB 2HLAB 1A3LH 4M5ZH 2AERT 3PV6B 1V5JA 4Q9RL 3X14A 3HZVB 3VH8G 1RJYB 4LDLB 5D7IA 1IC4H 1AKJD 4HK0A 1OSZB 3QXWA 4EVNB 4LVNC 4F7CA 4OQ1A 3QI9D 5E2UH 2NR6C 2BVOB 3NFSH 4DTGL 3RY6A 1G9MH 4GG6E 2I24N 4UT9H 3ARDD 1I9JH 4PV8B 2XQBL 2DJSA 5FA3B 5FAAA 3D3VA 3SDAA 1PAMA 3ARED 2CLRA 4QTHB 5E5MB 1VACB 4YNYB 2QADD 5TE6H 2FX9H 3GHBH 4AEIL 1JF1A 5C0CE 3WD5H 4P23C 2IAMA 4K9EL 3PQYB 4U1SA 4JN2B 2C9AA 5BJTB 3MV9D 3QRFM 4UV4H 2EDXA 5EOCL 3QH3B 5D6CB 3V4VH 4XH2A 3VWJD 4LHUG 3WS3B 2R9HC 1WK0A 3MO1A 3VCLA 3VGAB 5JXAL 2F5BH 1LDPL 3PGDB 4HT1L 1AGFA 3W9EA 4WDIB 5KSBF 1GC1L 4JGJA 4OF3A 5E2VL 4U1HA 5DEZA 4PPTA 5A2JH 3C60B 3CH8A 3FCTB 3L3JA 5C0DB 3ZDXF 4HGWB 1GZQB 2R29L 3QUZD 5DJ2A 1EV2E 4G5ZH 5KTEH 1QD0A 2WP3T 3DECA 1TZGL 5EZJB 3QEUB 1YEGH 3FQUA 4FQXD 2NY3C 2JIXB 3SDDA 1UB6B 5I1DA 4PTUA 5HGHB 1DSFL 1JWMA 2A83A 4JEGB 3W11D 1G7HB 1WZMA 5BW7A 43CAB 1F97A 4TN9A 4FQ1L 3JUZA 3LRSA 4Z0XB 5TJWK 3EYSL 3UEZA 4DUVA 5C0AD 4PJBA 5BVPH 3KPPB 5FUCE 3TBSB 1QFWH 3FMGL 2E3VA 4EI5B 3TBYB 4PP2B 4WNQB 4PD4K 4PRPE 3V6OC 3LCYA 4Z7WE 2WINB 4YK4C 1DZBA 3BPCB 2PW1B 1A6TA 3SE9L 3V9FA 4HCRH 4X5XB 1U42A 2YZ1A 4K3JH 4G80A 1D5XB 2G9HA 3QHZH 3HLAB 4GRWB 4KRPD 5CLWA 1X5GA 3KYMA 4UILL 4JPKL 2FH6A 5J7CC 5E08H 1OAUH 1U58B 1YYML 3VFWA 5TH2A 3BGAA 2HAZA 4G6AD 1LK2A 3L3KA 3S9DB 4I0PC 3E2HB 4G8IA 2BVPB 4GRMA 1L0YA 5ICZA 1WIUA 1KN2L 1NBZB 4JFEA 3E6HB 2YK1L 2RIKA 3ALXA 4PUBL 5DVKA 3MLTB 2ADJA 3MMEA 5TE4H 2BC4B 5IFAL 5GRJH 5FV2A 5ADPH 3QFJE 5ESVA 1INQA 4H25B 1A7RH 1J12A 4RFEB 4NM8L 5DFTA 5KSVA 1R3JB 1EMTH 2Y36L 2ZKHH 1OP9A 4WFGE 1IAIH 1JPTH 4R4BB 4OQTL 3DI3B 1E27B 3B9KB 5FYKU 3EAKA 2VDRH 3EO9H 1AHWB 2O93L 1WQVT 4PV9A 5FGCB 1FNGA 4JQXC 3BZFB 3OL2A 4L5FL 4MVBC 4TSAL 4KVNH 4PJXB 4XVTH 3MCKA 3F7VB 2CRZA 1H15A 3MLRL 3UCRA 4X5WB 5EFIB 4BJLA 4FQQA 3PWPB 2JK5B 1WFNA 2VDKH 4JZJB 2VLKA 2ADFH 1XR8A 4LU5L 2HMID 4AL8L 3MACL 4PGDB 5LAXB 5L0QB 1F4XL 2J1KA 1V3KA 1J0JA 3N1PC 1F6AA 2C3GA 4KUCF 1WWWX 1MF2H 3T1FB 1FYTE 5EPMA 1RZIA 1UB5A 4HHAA 3SDXE 1FFOB 1Q9OB 4ODTH 3C9NB 3WO3B 1HHKB 5C0RH 1XIWA 2J8HA 3QB7C 4XMLL 3G6DL 3LEXA 3O8XA 2DM4A 4QRPA 2GTWA 1RU9L 3WXWH 3CFCH 4MXQC 3HZMA 5DQDL 5F88B 4EN3B 5DURD 3IF1B 1QO3A 1I8MA 3CC5A 3F12A 3EYOB 2PCPA 3L3DA 3GO1H 4ODHH 5KVGH 4XVSL 2J12B 1OCWH 3U0WH 4HWNA 4XPAH 2GCYB 1I8KA 2DI8A 3ZLQC 5GGVY 3GSNL 4NT6B 4XAKE 2LAAA 3E0GA 4OLUH 2Q7NA 4UUJB 1BVLA 1BIIA 1C08B 4ZXBB 3U30C 4OM0H 5ICYA 1RIVL 3HB3C 5HGBB 4HC1L 1R6VA 5KZCB 3KR3H 5IEHA 4GG6F 4BSWA 3FL7A 4UT6H 3LKPA 2HTLC 5JZ7C 1RUMH 2CJUL 3ILQD 3QRGL 1FZKB 3WLBA 2OI9B 3S35H 3KJ4C 4P9ML 2VL5A 4XI5D 4NRXA 3OKDB 4OGXL 4UNTA 3RUGE 4G43A 1HZHH 5J1TC 5DMYA 5HI4C 3MUJA 4OCMC 4OZHF 2Y1VA 4P5TD 1QHOA 2IALA 3OWEA 3DURA 4HW6A 5IBLC 4DZ8A 3FRPG 4FFVC 3TESA 4LSRH 3T8XB 4MB5A 5IHUH 5MEPA 2NNAB 4IIQB 1OP5H 4HS3A 5D1XD 5DF0A 3NBNA 4JQVA 3N1GC 4ISVA 1W0WB 3GBML 1NCWL 3MNVA 3GBNH 3AFLA 3W9DA 5HHPB 1D5MA 1MCPL 1AGCB 4R90H 4Q6IC 3WNPA 1XGQA 3RU8H 1GHFH 4NWUL 5IMLA 4LF3B 3EFDL 5JLZB 4LMQI 3QDGE 5F96H 1U8OA 1JN6B 2H2SC 2Z4QB 2W65A 1NCUA 4X0KA 4KK9C 3O11A 1U8IB 2EYRA 1IZJA 4XGZA 3BVNA 4NQSA 3ULUC 2J3SA 1RJLA 1T1WA 4PJ7E 4L8SB 1U8LA 1HQRB 3R1GL 1R0AH 3KHOA 4GMTH 5CIPH 4K2UL 2DL9A 1U8MA 1I85C 3CX2A 1IFHH 5DA0B 1Q9KA 4MNHA 3DYMA 1WSST 2R0KH 2VXTH 3MRKB 2DICA 3UC0L 3I3BA 4GG6A 2ZWLT 2Z93B 1WFOA 1RIUL 3FO1A 1DEDA 5T1MA 2L7UA 2GSGA 3D85D 2LTQC 1H9VA 3H42H 4XNYL 1JK8B 5HGAB 2D31A 2GAZB 4NYLB 2YXMA 3EO0B 3PWNB 4APQB 3M1BB 4U3CA 5TQ0L 2OSLA 4M6NL 3BPNC 2BVQB 2GK0A 5E24E 5KVDL 1QFWM 2DQIL 4MCYA 1L7IH 2KUTA 4TRPH 3HE6D 1MCWM 3QXDB 3QUYD 4DAGL 3QQ4A 3LN5B 4M03A 4P23D 3ULVC 3TT1H 5AZ2L 5EO0A 5F7UA 1J86A 1KCRL 4LFHG 4OTXH 3QEGL 3CH1A 4MJ5A 1TTGA 2EH8L 3FO9A 2HJKA 5IBUB 4XVUC 2B1HH 2R9HD 3W0WD 1CTOA 1DBBH 4LSVL 3RWHB 5DJ0A 5GGSY 5JW4M 4YDKL 4FTVB 4KKCC 2ENSA 3CSGA 5K93A 5EULV 3QJFB 1NGZA 3U36A 2APVA 3PHOA 3TWCH 4EZMA 4X99B 4Y2DC 4ZUVA 5TDNA 4YFEA 5BMFL 1NBVL 2HT2D 2VDNH 1QFPA 2HVKA 4OLXH 1SY6A 2HT3D 4YAQA 1NGQH 1E4JA 3ARGA 2ZUVA 1C7SA 1Y6NR 4P4KA 3FFDA 4HK3J 1H3WM 1XFPA 1KIUA 1B9ZA 4RAHA 4V1DB 1HWGB 1YECL 3WEXA 2PKDA 3P0YL 3G9AB 3HR6A 1IAIM 1F45A 1S78C 1SBSL 4DQOH 4LSPL 4O5LL 4OGZA 5EBLB 1UM6H 1EUUA 1XH3B 2VDQH 3WHXA 1IL1A 3ARPA 3AAZA 4EEEA 4R3SA 1BECA 4QHUA 3RIAK 3LKSB 1YMHB 3ZKXB 1ZLWH 1HNGA 4Z7WA 3CIQA 3UMTA 3O3DA 3RTQB 2HKFH 4JM4L 5D96C 1S7QA 3MA7A 5CEZE 2MCPH 1LEGA 4TOYL 4PS4H 3WS6C 1XEDA 3GI9H 4KQ3H 3SDXF 5EWIL 1XGYH 5GS0C 3VD9A 4JRWA 5DZNA 4POUB 4G9FB 5CGYC 5FHAH 4HFWA 3SE8H 3VXRA 2IQ9H 4JANA 1F11B 3RWGB 3MODL 4TQEH 1EHLL 3AVEA 1IKFH 3ULUL 1BJ1J 5FKAA 3CPLB 3H7BA 1ZV5A 4QRQB 3I3DA 4OKVB 3QPXH 3IDNB 3MLXH 1EVTC 2I5YH 3WFDL 4I0PD 4NQEB 3T0EA 5SX4H 1DE4A 1XGTA 4LCCC 4OM1L 3VG0H 3T0XA 2B7DT 3GSWB 4WY7H 4YIQA 3DSFL 3HC4L 1GVIA 4KROD 2CPCA 4ZFGH 1MREH 4KJQC 3S5LB 1RULL 1S8DB 3L95A 4W4OA 2EDQA 4N9OB 1P2CB 3BXNA 2FZ3B 1G1CA 5FB8B 4JO2L 1I9RH 2M2DA 3U83A 5IB4B 2R4RH 5GGTL 4M7LT 1KXTB 3BKCL 1JYNA 1S3KL 2EXWD 2RCSL 4XCYB 2AQ3A 1CR9H 1X5XA 5B39B 4QRUB 4ZFOL 3C2AL 3CUPA 1J11A 4CN6A 4M1DH 5B8CC 3FQRA 3KAAA 3CLFH 4P2YA 2R56L 4RFNC 1H3GA 4NPYA 5LCVH 1JZ5A 3RUGF 1H5BA 4X8JB 5EORL 3MGOA 1J0YA 2IFFL 2Z31C 2IPKA 4KFZC 3WCYA 3JUYA 2XKNB 5BV7C 1FYTA 4H1LA 5E95B 5GRVL 4DW2L 5GIRB 5DMKB 1T89C 4ALAL 3VGGA 5DHYB 1XGRA 1FV1A 3O3EA 3KWWA 4JPIB 3HRZB 3TGXA 2WZPD 3VFUA 4YBHA 1MWAB 1S5HA 1A6WL 1JRHH 3D69A 4I5BA 4NJ9H 3QG6B 4O51A 3U9UB 1ZGLA 1K5NA 4XP4L 4S0TD 2CLZA 1R3KB 1ZSDB 1CFVL 1TCMA 4PJ7F 3TC9A 5SX4I 1ZT4A 2GYSA 2YPVH 1A14H 3LB6C 4QWWC 4F57L 4HBQA 4KGLA 5DJ8A 3V6FB 1PX4A 2A73B 5FYJE 3P0VL 5DSCA 1K8DA 1KTDA 3AMLA 5DRZB 1MLBB 1VGEH 1ZHBB 1KJVA 1OY3B 4MAYB 1G0DA 2YEZB 3FN0L 3U4EA 5FECB 2ARJB 2WWKT 2ICWJ 4RWYL 5A16B 3TN0C 1SM3H 3AMKA 2XACC 5JZ7D 3K8LA 4FQLH 4RISL 3RRQA 2UUDK 1FFQA 1K2DA 2UY6A 3SKNA 1CFBA 1DQDH 2X4SA 4DZBB 2Q7YA 5SX5K 2N1KA 1BQHG 3SDCD 5J6GB 5EO9B 5F7YC 5ENWB 5CBAA 2JELH 4N0UB 5C07D 1JE6A 1L7TL 3WFBL 1RJZB 3TV3H 5BRZB 5M95B 2CR3A 1U8QB 1QLFA 4X7FC 4OLWH 5HI4D 1JPST 1C16A 4YHKL 3BP7A 3UTZA 2DKSA 3CK0L 5T1DL 1EFQA 1JGUH 5IBLD 3DARA 2D4FA 2BVTA 2X4RA 2IANA 1IEBB 2V9QA 1WFTA 5A1AA 2VQUA 5I8KH 5KVFH 4P0DA 5C9JA 2BK8A 3LQMA 3NCBB 4KHTL 4X7TB 5IMKB 5T33L 3QDGA 4WO4D 1TCRA 3ARFD 2C3HA 1TZIB 1A0QH 5FF6A 4YHOL 3NFNA 4P46B 1GRWA 2ID5A 4RAUA 1JRHI 3C5ZA 1PZ5B 4OF7A 4PJ7A 4FMFA 5D1QA 3RX5A 2CIKA 4L1DA 1IZKA 1MH5B 1VERA 3RWEB 3P9MB 5DT1L 1FLTX 5SWZD 3WFZA 3IFNH 2DBLL 4HIHB 2DTMH 3ULUD 2GJ6D 3V5HA 1A7QH 1DUYA 4QY8B 1VFUA 4W70A 2CDEA 1A1NA 3SCMB 2CK0H 4HAGA 2DB8A 3H9HB 5DRWA 3K2MC 5DRNB 4I1NB 3VW3H 4CADA 4ORGA 3K8KA 2VQTA 4KJWC 4XNQB 5I75C 3BH9B 1VFBA 4ZDHA 4Z0BH 1YQ2A 3ZTNL 3IDIA 1NANI 3MNWB 2R15A 4OF0A 3LS4L 5IB5B 2Q8AH 2MWCA 4DN3L 3RPKA 3TO4C 5KAQF 4RA0C 5CJQH 4BH8A 2V6HA 2VISA 3OJDA 3RDTB 2EIBA 3IS0X 4XNUH 5DHVB 1YEKL 4EBQH 1RAMA 2EDHA 2NY5C 4KI5D 4WI9A 1HHJA 1E4XH 3R0MA 2VABB 4J3WA 4N0YL 4L4VD 5C8JB 5I71C 1T7WA 4YXKH 2VUOA 2ICEA 3VWKC 1HOCA 4X9FA 1M6OB 4F58H 1KJ2B 4LRIC 2OZ4A 1JYWA 5HI3D 3DVIA 4QRTA 5SWQA 4XVUD 3INUL 5DMIL 3DTXB 5C86A 5K9OB 3ARVA 1SY6H 2A0LC 4QCIB 4KKCD 1T66C 1YEHL 2P8MA 4MNQE 4YDVA 1QSED 1YEDA 2NY6B 1A7PL 4MXVE 4L9LB 4JG1L 2V2WA 1J1XH 2GJJA 5IEKB 1KEGL 1OARL 3QXUA 3HAEA 2ZPKH 4G8EB 4HGKC 4NO3A 2CDGB 1CZ8H 2Y6SC 5INDA 1ES0A 3UTTE 1JV5B 3VXOB 4U1GB 3HNTL 1ZXQA 2F9BT 1BP3B 1QSVA 1S78D 5I2IA 3AU1A 1KPVA 4LLMA 3QIBA 1RFDL 4DGIL 2R4SH 3ARXA 3MR9A 5IQ9B 1UEMA 1AR2A 4CUCA 4PJCE 5CKGA 4U6XB 3BP6B 5CJ8A 5I1JL 3FZUC 4HS8L 4U1KA 2XFXB 1N26A 1CK0H 1JFQH 2BJMH 3KLAB 4M61B 4NZDA 4I48B 1KCLA 4I8DA 3GMNA 3MBEC 2OK0L 5CGYD 5IR1B 3NFPB 1FPTH 4MX7A 1QYGH 3DUSB 4BK5A 3U1SL 3IJSA 1UXWA 4KK5C 2QKIA 5I1GL 3NCCB 4EI5D 1ZS8A 4HDIB 3BGFC 2GT9A 3C08L 5H35B 4J8RB 4WFEE 1E4XI 1JTOA 5I1IL 2NTSP 1S7VB 1YJDC 3AGVA 5A43C 3RKPA 3KPSB 4MJ6A 3THML 3X3FH 3W2DH 2HKHL 4XX1G 5C0JB 2NY1C 2Y4SA 2LU7A 1NLBL 4EUPA 1FE8H 3I9GH 5DD5L 4KJQD 1JWUA 2VZUA 5C08D 1EO8L 3UTSE 1U92B 1J8HD 2A9MH 3NTCL 1B0RB 1YC8A 3RKDD 1RUQL 4PRIB 5F89B 2H32B 1H3PH 4OIBA 3MYJA 2W9EH 3F7PC 3DRTA 2NY5L 2A6JA 3QYCA 1CF8L 3MUGA 3WIIL 5DVNA 3RAJL 1CDBA 2XZCL 3MLWL 3BEVB 4ZUUB 5I19L 1PY9A 1C1EL 1A9EA 3TCLB 3VFOB 3UZEA 1G6RB 5KSAC 1R24B 4ZUTA 1KCVL 4H1LH 3L5HA 2IG2L 2F19L 5TE7H 3SJVB 1CLOH 1GGBL 4HFUH 2VZ3A 2UZIH 3B9KD 1CLZL 5EZIH 1FL6B 3VE0A 1WZ1H 3GBLA 3MXVH 3BKYH 3JWDC 1F8TL 3MV9E 1DVFB 3QUMH 2NY0C 3VXPB 4JO3H 4PGCB 3OJMB 5E8DH 5D70L 1BBDH 1BVKA 1ZA6A 2F54A 1FL3A 4PGEB 4W6WB 5M94B 5E2WL 1IEAA 4PREB 3FQNA 1A2YB 2NMSA 4FXKA 4NQCE 4HSQA 5DD3H 2GJZB 5HGDB 4Q97A 4NNYB 2OQJA 5FUOH 1QBML 1OWWA 5DZLA 5T1LA 4ERSH 1Z9OA 3MRRA 3T77A 5BXFB 5EO1B 3HE7C 1MVUB 1ZE3C 3ALWA 3D18A 2X40A 5L88L 3Q48A 4Y4FC 3VFSB 5DD1L 3K8MA 3QSKB 3ALPA 4O4YH 5D1ZB 3JSSA 2A6KB 1EHAA 4D9LH 1MJ8H 3A67H 5DQJA 1OAQL 3ULSA 5H94B 1RVFH 4BH7B 1S9XB 1JMZA 4EN3D 2WM0A 5C0AE 3PWLB 4UDUA 2X4QA 1M7XA 1IGMH 3QUKB 3VGEA 2EC9T 4DUXA 4CVUA 1LE9A 1ZWIB 4GG8A 5J3HC 3FRUA 1FFNA 1LD9B 4K3GA 4YHLH 3PHQB 3WJLA 2DYPD 3UZQA 2V5MA 5E99L 1C8PA 4LLWA 1EAJA 1MHCA 4HMCA 5IFJA 4YR6B 5E8NA 4LSUL 3HMXA 2DRUA 3O4LE 3MA9L 1KG0B 2XA8H 4ZXBD 5CP7B 5KZCD 4M4RA 4E5XB 3BPOC 5T3XE 2E6PA 4G6JH 4P2OC 4XTRD 5EU3B 5D71L 1AD0A 2CO7B 2NX5D 1HH9A 3VRLF 4C56B 1Z0NA 3EOBB 4X6EB 1A9BB 1IILE 4LSSH 5I1KH 3PV7A 1CYGA 2RGSA 4HMEA 6FABH 5EC2A 4JB9H 5C0EA 2GK2A 1HSBB 1K3ZA 1G7IB 3T65B 3H3KA 4UV7L 2D7NA 1MHHB 1GYAA 1U8KB 1AD9A 3MSPA 4OB5L 1YNLL 5DEFB 1TVHA 3GMMB 4G42B 4YGAB 2ITCB 4MXVF 2C1PB 3CDGB 4MQ7A 3SKMA 5LBSL 5JTWA 2EDFA 2F8VA 4TTDD 5B21A 3S88L 1NUGA 1Z9MA 1INDL 4FQ2H 5HVGB 1ED3A 5ID1B 5I17A 3STBA 5CSZB 1NC4A 5GGRY 4GRLB 4BQ6A 1AR1C 1AXSB 2FEEL 5DWUL 2DWDB 1YEJL 4XPBH 1DBMH 1EEQA 2BY0A 1DQMH 3G5YB 3RJQB 4D0BA 5GZNC 4CVXA 4KC3B 5EU7E 4JRYE 1K8IA 4PJCF 2N7BA 2R23B 5HYIA 1QA9A 2ATPB 4DWHA 5I8CA 3WO4C 1CU4H 4HWUA 4NRZB 1BD2B 3BEWB 1QBBA 2K9UA 3TNNB 5MI0B 5D5MA 2AJ3B 1CS6A 1P7KA 3EKCA 4NUGL 4IHOA 2X4TB 1T3FB 2BCKA 3GI8H 4IOSD 3DYOA 1CDHA 5DVLA 3UBXI 5KG9B 4KMQA 4J4PA 3CSYB 3HKFA 4TULH 3WXVH 3UTQA 2OZ4H 3MOAL 1GGIH 4GKNA 3HNSL 1ODAA 4N9GB 4OD2B 4APQD 4ZFFB 3SQOH 1T0MA 1NFIA 3MREA 4YDLC 4Y4HB 1I9IH 4KTEH 4LOUC 4P2RA 4IEFB 4NO2A 4I0KA 4Q0XL 1BQSA 3VGFA 4QRRE 2PO6C 1NUFA 5FGBA 2BXYA 5I74B 1WBXA 3Q5TA 3U9PH 2FX8H 1GGTA 3HAEH 4ZD3L 1T66D 3L3OA 4G3YH 3HI6L 3MNZA 1ZHNA 2WQ8A 3QFDB 4JQIL 2DQDH 1FAIL 3UTTA 4WI5A 1AGDA 2COQA 1JUFA 4M93C 2X89D 1HCVA 5JA9A 1I1CA 4FTVD 1Z3GL 1W72A 1FLRL 5BVJA 2Y6SD 5LQBH 1UJTA 3OKLA 5CEZH 4IRJA 4N8VG 5F9AC 2IH3A 1F58H 4PJCA 2FB4H 3PWJB 3EDEA 3MV11 2AW2A 3NPZB 2VLJD 3BDBA 2HA1A 3BAEL 2R39A 5E94A 4M8QA 3DSNA 5ALCL 3MRHA 3FQXA 1EAPB 3NH7H 1N5AB 4PJ9C 1HXMA 2WLYA 4V1DD 4CDHA 1V7NL 3WLWC 3SO5A 3LIZL 4LL9A 3W39B 4ELME 2A9NH 3T08A 4XZUA 3SGJC 1G9EA 2AK4B 3T4AB 5IK3B 5FM4A 4OZFG 4KRNA 3E8UL 3NZHL 1FZOA 2BMKB 4HG4K 4KKNA 3F8UB 2WK2A 3RTQD 1MCKA 3KDMB 3IGAA 5F9WB 3RP1A 1BZ9A 3N1QC 3EYQC 4NO0A 2OJZL 5J9PA 3MRPA 2AGJH 4TVPE 3LN9A 4PLNC 3V4UL 1QR1A 2P1YA 3P30H 1Q0XH 2W60A 4X6FB 3KXFE 2FGWH 1ZGLM 3ZSSA 1UKTA 1DQJA 3GMRA 3RPIA 5DMJB 4EXPX 1XF3B 1AKJA 1RD6A 1KIPA 5EU6D 1NKOA 4JVWA 3QI9A 2IGFH 3HR5B 3AS0A 1KBGL 2EE3A 5CJOL 1Q0YH 3GSRA 4OUUB 2GIYA 4FRWA 1A6AB 1FH5H 1HINH 3LKOA 3IFLH 4L8BA 3WIFB 4H88H 4ODVH 4I18C 4FQPA 1JHKH 4JG0L 4RDQG 4Z8FH 3OKMB 3JV4A 2QBWA 3AREA 4HLZH 4NRYB 4RRPA 3VFGH 2J8UB 1D6VL 5GSVA 3TZVB 5J12C 5FA4B 4FS0A 4KHXH 4HUWA 1S9WB 1NFKA 3CX5K 1VFAA 5FHBH 1EEZB 1FSKB 3EYVA 2JB5L 1V05A 2DQFA 2R1YA 1T1XA 3VWJA 1IEHA 4ZPTB 1WIOA 4ODUA 3PNWB 2PTTB 4LCYA 2B8OT 4WVRA 4GW4A 1F4YH 2AXGB 1GIGH 1RMFH 3VXQA 3LVEA 3KYNB 4Y1AB 2X70B 1UH4A 1KJ2L 3CFDA 4HG4J 4YEEA 2QQLH 3ET9F 1S7SA 3OXRA 3KYKH 1KJ3L 2NXYB 5EZLA 2IPTH 5F93C 2ZZUT 4UTAH 2BHYA 1PW3A 4JZNB 2W9DL 3QUZA 4QHKJ 2VLMD 1N6VA 3WMSA 4JRXB 1S7WB 4NWTL 1UM4H 1UT9A 2GFBB 4XVJH 1G7MA 1WBYA 4TUKH 5FYJH 4FQXA 5E9DE 5A2KH 1RZ8B 2DQGH 1U8PA 3QEQE 1JHTB 5GRVK 1V8HA 3IDGB 4PRHE 5C09B 1F6FB 1QFUH 1I9EA 1OD7A 3RNQA 1MI5B 1YPZA 2NYYD 1DUZB 1OF2B 3D2UD 4X9IA 3V52H 4CNIA 5FM8A 1NCNA 1FFPA 5C0AA 5CUSH 4YXLH 4AIXA 5GGQH 1KJMA 2D7MA 4L4JA 4WU5A 5DJYA 4W6YB 2FATH 1ZVSB 1R3IH 5KN5B 1FVCB 2X9YA 5HDBE 3IFPA 4JR9H 5I9QC 4XMKL 4AH2A 4NOBA 3WNNA 1YN6B 3HMXH 4AZ8A 1WUNT 5EU4B 3QXAA 2KL6A 2AEIT 1QBLH 5GJSH 8FABB 3RVVD 4HXBH 3RY6C 3LOWA 2CKNA 3CX5J 3H0TA 1G7LB 1QKZH 2O5YL 4R4NC 5CCKL 1UJ3A 4JVPA 1WCBB 3I6LD 2VC2H 3SDAC 2FJGB 5K9KB 4UB0L 3U7WL 2DLIA 2AKRA 4XMPH 2EYTA 1BFSA 2D9QB 5IQ7L 1K9TA 3H3PL 5GGSB 5C0NC 3MRLB 2Y06H 5IMMB 5I73B 1GPOL 3V4PH 2JB6B 5CD3B 2IAMC 5E8PA 1XF4A 2VMFA 3ZDYF 1JNNH 1F90H 3FFCB 3UTOA 5K59E 1YNTA 1ERNA 3CCHA 1FIGH 3P4OA 4KQ4H 1FZMA 4LRNL 3WUZA 4L8CB 2R69L 4WW2C 5TGBB 1VKXB 5BRZD 4YHZH 5CZXC 1IGTA 2E7LA 3L3IA 3UAJC 2H3NB 5HHNB 4M6OH 5HVHC 5CEXB 1BOGA 4TYUA 4FQCL 3GNML 1TPXC 5FCUH 3MLSL 2R0ZL 1D5IH 3ELAT 4JM2B 3NCJH 4BFBD 4XP9L 4XNZC 3C8KA 1CGVA 4UDTB 3VDCA 4C55A 2FRGP 2E7CA 4QXGH 3PABA 3BZEA 3JV6A 4NGHH 1YYLL 5J1SC 1LQSR 2XN9D 2CUMA 1G6RL 4GLRH 5I1LA 3EW3B 3HZKB 3S4SG 5HYQA 1S9KC 1P4LA 3LQAH 5ILTL 3FKUS 4Y16B 3T09A 1HHIA 5GZND 1NAML 4L29B 1PEZA 2BDNH 2GTZA 2MQCA 2NTFA 3NACL 4JDVA 3IDUA 3O2WL 3Q3GA 2VDMH 1T2QL 2H1PL 4ELMF 4LGPB 1FL5A 3O6KL 4FG6D 5FKPA 1A4JB 4R26L 1TVBB 1MCLA 3WSQL 3N0PB 3MV7B 1T20A 4AG4H 1BWWA 2H26A 5E1AB 1R5IA 1ORSA 4MA7H 4RNRB 4YHPA 2ORBL 4F37K 2ITDA 1RZFL 4WEUD 2JE8A 3S7GA 1CT8B 4WWKB 1NH6A 1QG3A 1MIML 4G6MH 2X42A 1JF6A 4JY5L 4R96B 1JI1A 3PWVB 4JHAL 1IC5L 5CJXA 2V2XB 5CBEB 3GMPB 4PY7B 4MJ2A 2R0WL 4DOHB 3W5MA 1T2JA 3F58H 1FAKT 1NDMB 3OXSA 5E6IB 1JHLL 1VGKB 1QSFB 4U6TA 3BGMB 3QHFH 2PO6D 2ZCKH 4XPFH 3JWOC 4ZYKB 1LO3H 4Z78A 1A1MB 2FX7L 1W72H 4NBZB 3BRFA 4GAGH 1FRGH 1CBVL 4QHLB 3KS0H 3WL9B 1LHZA 1I8IB 4QOKA 4M7ZB 4U1NA 1MFEH 5JQ6L 3K4AA 3BD3A 2JF1A 1GGYA 1NEZA 4X83A 4PJIE 5C0BD 4LCWD 5GJTH 2NY6D 2QHRH 5HHQB 4P5TA 1CD8A 5BZWB 3U6RB 1Q94B 1IAOB 4Y5VC 4GKZA 4I3RL 1KEMH 2GY5A 5D1XA 3IKCA 2YUXA 4Y19D 3MRFB 1NCAL 15C8H 3NVQA 4S2SB 1ZLSL 1JNJA 5AZEH 4RGNB 4X80H 1PKOA 5FYKL 1UQSA 2A74B 3O45A 1AE6H 1IQWL 3EYUL 2SEBB 1G9NC 3O9WB 4M1GL 5ADOL 4GXUM 2XICA 2AI0H 3GMLA 4ZO6A 4M7KL 4EJ1C 3P4LA 1RUAH 3ZYOA 3T1WA 1KLGB 4A2MA 1F4HA 1RZJL 2R2CA 3LEVH 4RZCB 5JHDB 5L9DH 4NNPH 1XIWC 1G7QA 3MRMA 5ICXB 4OF5A 4DKEL 1ONQA 2M26A 5DJDA 3O8XC 3ZYZA 4CVZB 1MJJB 4PGJA 1CDUA 5ALBL 4YBQD 4K7PH 5AWNL 2X4UA 3MBXH 5SWZE 3QIUB 3P4MA 2HN7A 1MNUL 3ULUE 3IVKB 2GJ6E 3RZCA 3UJTL 2OTWA 3SY0A 3OHXA 12E8L 3QO1A 3BIAX 5JIHA 1JZ2A 1FBIH 1GAFL 3H2WA 3WUWG 1OAKH 2X7LB 3D85A 5HDBF 3TP4A 2YA2A 3L3HA 2EIZB 5EBMB 2OTPA 3C5JA 4XX1E 1MHEB 4B5EA 3ROOB 2I60H 3KPMA 2FH8A 4S1QL 1J1PH 1FO0H 2AK1H 4OQTA 2E9WA 3IU3A 3P9WB 4ONHA 3S36H 4Y4KB 3HE6A 5J06A 3EDFA 3QUYA 3HI5H 1FIEA 3OKNA 1N2RB 1T1YB 4P23A 2J88H 2CSPA 2XKSA 4FFZH 5MP6H 4KI5E 1AFVL 2BY3A 4JFPB 4NN5C 1KV3A 1Q9LA 4L4VE 5IVOA 4YHYB 2Q86A 5CZVL 3ULVE 4ZAKB 3JTTB 3W0WA 4LLQB 1MIEH 2VZVA 3JWOL 4OCYL 5K59F 1U3HB 2ICCA 4YDJA 3SJVD 4K94H 32C2A 4F3FB 2C3VB 3DV6A 3VFPA 3CFJA 4JQVC 3P77B 4G6KL 1FNAA 1KC5L 4JKMA 4Z7UF 5IFHH 1NGPL 4FZ8L 5C0FA 1T4KA 1BLNA 2CLVA 4BQ9A 1J0ZA 3PGCA 3QQNA 2YUWA 3T0AA 2YD3A 3PXHA 1DVFD 2K7QA 5DK2B 5EOQH 2I25N 1QSEE 4DGVH 2X4NB 4GAJH 4WIQA 1A7NH 1F2XK 3BD5A 4GSDL 4DEPB 5HVFB 1Q72L 4DFHA 1NBYA 1YNKH 1YEFL 4P2CG 4JN1L 4R6UA 2UUDH 1LE5B 4ZNCD 1CQYA 2CGRL 2FJHB 2W0FA 4MJIB 4QGYA 5SX5H 3BIKB 1ACYH 2R1WA 3SKOB 5KS9E 1OM3L 1N5YL 4DGYH 4RMQA 2AXJA 2W9LA 1HQ4B 3T04D 5C3LD 1NMCB 3H6JA 4RBPH 3GSNA 5F1IB 5C2BL 5T3XH 1RUPL 5D1ZD 4RAVB 2NZ9C 2P49B 4ONFL 2YRLA 2YPKB 3DJ9A 4MA3B 3STLA 3IFOB 1A22B 4JE4B 4XWGH 4HC1A 1YN7A 4YLQT 2H45A 4ZFZB 5LG1A 1G7PB 4FZEH 3MLYL 3SGKC 1JVKA 3BJ91 4JZOB 1OB1B 4I0PA 4LNRB 3ZE2F 4OD3H 2GUOB 3TYFB 4Z7QE 3QWRD 1DJSA 4YFLF 1CE1H 1JJUA 5GGVL 1AGBB 3AROA 2JJSC 3B4NA 4MA8H 3UX9B 1N0XH 2P5ED 1FG9C 2Z8WC 3ABZA 1LNUA 3EOTL 1T03L 4HV8B 1AO7B 4OD1H 2VXUL 4GRWE 4HF5L 1IC7H 3UTPD 1H3VA 4LPTA 1N7MH 2FD6L 4PR5B 2OMNA 4UBDC 5IESH 1I7ZB 4I3SH 3CVHB 4K3EH 1UWEL 4KKLC 3X17A 5C08E 1WITA 3TNMB 5CZKA 3JTSA 1J8HE 4BZYA 1KTLB 4PJFB 5FYKD 2V5TA 3P73A 4R7DA 4U1IA 4A2LA 1T5WA 5E8OA 4TVSa 1KT2A 2HVJA 4HIEB 5I1HH 4KV5E 1CGSL 4UNUA 4PJIF 3ARGC 1QRKA 1LEKB 4FXLA 1FHGA 3DBXA 3GDBA 5J13B 4P4KC 5ID0B 4L3CA 2V17L 3ME0A 4HK3N 1CLCA 5CEYA 3OKOB 3HCVB 5DR5L 4H26B 1WWBX 3KPLB 5L6YH 1HXYA 5FUCC 3KPQB 5C0GA 3VXUB 2XWJA 4OLEA 2XZQL 3CXHK 2P7TA 5J89A 4PJXE 3QZWB 3DMMA 5HYJB 2IMMA 4GRLD 3O3AA 3OX8A 2UWEB 3U2SB 3VFRA 2FGZA 4HWZB 4PG2A 2VXQL 2PXYC 4ZO8A 2O61B 4AEIH 1UVQA 3MRDA 4IS6A 3F65A 5JNYB 4QXUL 3DX8B 2ZCLL 1II4E 3BSZH 2QQNH 1RURH 5L2JB 5EOCH 5BZDB 2VLRB 4C83A 4HS6B 5GXBB 4YO0A 3T0EC 5HHVL 5CD5C 5FO9B 3ULUF 5I18L 1MSPA 3GEWB 1FNFA 1J18A 5DC9B 3FT2B 4K3DL 1LDPH 4NCC1 4HT1H 1ZHKA 3OQ3B 4XBGB 5E2VH 4OT1H 2IBZY 3VGHA 1CWVA 1MFAL 3GGWA 4MLSA 2QSCL 1XGPA 4D0CA 1CFSB 5FV1L 3RHWF 5AD0B 2NXZC 3ARWA 3HPLB 4I4WA 4AT6A 4QRSB 3CFBA 5CHNA 3KVQA 1BBJB 3EJYD 2R29H 4Y4HD 3BUYA 2DBJA 4RGOL 3ZZ1A 3ARRA 2G2RA 4PJIA 3F5WA 5K9JL 3MRJB 3FB5B 4L8DB 3VXTA 5ERWA 3IDJB 3SDCA 4U6HB 4BZ2L 1IGJB 2P5WB 4KKBD 5DJZB 5C07A 1VENA 3NN8B 3CXHJ 2NY7L 3MTRA 1T0NB 5K33A 3EYSH 1A6ZB 4KI5F 5CJ5A 1NMAL 1PQZA 1H5BC 3BDYH 1T5XB 2UVFA 4DCQB 3ULVF 2RBLA 5IV2B 4IMKA 2NX5E 4XB7A 2DN7A 3FMGH 5HYSG 4LAQH 1YA5A 2P45B 5AAMA 3IRPX 2CIIB 5I1EL 4TVPH 4RMVA 4WFFD 5IB1A 3CZJA 1KCUL 2WBJB 2IBBA 5JORB 4KTYA 4RSVA 1JGDB 4NKMA 1HHHB 4Z9KB 3SE9H 3FONA 4WO4A 1EHXA 1NGXA 3ARFA 2VIRA 2B4CC 3QA3B 5JW4R 3O41A 4OCSL 2EH7L 4AIZB 4UILH 4JDTL 5IVXF 3TCXA 4DVBA 3TJEL 1YYMH 3QAZB 3B9VA 3TBWA 4ODWB 2UVEA 3MLVL 4KMTL 5SWZA 3QWOB 3SDYL 4PG9A 1H3XA 1GOFA 2GJ6A 2AK4D 2YK1H 4PUBH 3E6FA 4PP1C 4A6YB 5FXCH 3WKML 1D5BB 4I9WD 1I85A 2OYPA 1BM3H 5KS9F 4YC2B 5DFVC 2Y36H 2HLAA 4FQIH 2O5XL 2XPGA 4XBEL 3HC3L 4WI7A 4LKCA 2L4OA 1F4AA 3SE3A 1RJYA 5JO5B 3AS1A 3B9AA 1OSZA 4HUNB 4EVNA 4K3HA 4M6ML 4PB0L 4ZTOL 1MY7A 4PJAB 3T4YB 2BVOA 5GGTA 3OR6A 4DKFH 4NFBA 3SKUD 3K1KC 1UGNA 4ZFOA 5TDPB 4OCXL 3MJGX 4L4VA 4F15C 2E8YA 4S0SD 4PV8A 3HS0B 2LU3A 3B43A 3VRIA 2APXA 4LU5H 4Z7QF 5DFWH 3OBAA 5FA3A 4AL8H 3MACH 5EDXA 4NZRL 1F4XH 3VFTB 4F7PB 4QTHA 4IOIB 1NPUA 1H8SA 4YNYA 3TZVD 7FABL 35C8H 3I50H 1NLDL 4PJHB 4YHIB 4CMHC 4KK8D 2AXHA 1P4BL 4GRWF 4U2ZA 4M7JL 2FJFA 1D9KB 5BJTA 4TSBH 4NHCL 2YA1A 4KTDL 3J8F7 1QSEA 1LO5A 2XNAB 5GGRB 3WS3A 5DVMA 3RVUC 2Z35B 3G6DH 1KB9K 5CJBA 4N5EC 3HMWH 1RU9H 3PGDA 3F7RA 3BHBB 4WDIA 4R2GC 1OD9A 1Z2KA 4NN7C 1N59B 3FCTA 3QQ3B 2YWYA 1BEYL 4XVSH 4R9HA 5C0DA 3S37H 3IAQA 3O81A 4HGWA 4OLYL 5KS9A 1GZQA 1BX2A 2YKLL 4JRXD 4K23L 3TIDB 3GSNH 3QEUA 3VXMB 1BOYA 2C7UB 1H3TA 2IC2A 1UB6A 5DS8B 2CK2A 4LLUA 5HGHA 2VLJE 5C09D 5D7KD 2B4CL 1RIVH 4HC1H 2DQHL 2RFXB 3PHSA 4HJGB 5IW3A 43CAA 1MI5D 2CDFB 3WN5B 5FGSA 5IBTH 4EDWH 3O6FB 2X4OB 1BVZA 4V1DE 4Z0XA 2E27L 2ZSVB 4K7FB 1DLFL 3WE6B 2NZ9D 5GPRA 2EE9A 3RVTC 4P9MH 2EEBA 1A8JH 4EI5A 3TBYA 1CGUA 4WNQA 4OGXH 1FDLL 2FNBA 1L9NA 2WINA 3BPCA 2H2PC 3WNLA 2PYFB 4X5XA 3EOAB 4JKKA 3GJEB 3B9EA 1PLGL 4G8FB 5C7XL 1E6OL 1U58A 5ESQA 3BJLA 4WI8A 1RIHH 2VL4A 2O26U 3F7QA 5C08A 5JHLH 3GBMH 2BVPA 1J8HA 1VADB 1KB9J 5EU6E 3X14B 1NBZA 5D7IB 3TH4T 1MCPH 4UBDD 4E42A 4HK0B 4KKLD 1RHHB 3MLTA 5F7EL 1YEEL 4XRCB 5HPOA 3P40A 3G6JE 2BC4A 1C5CH 3EFDH 1ZANL 4PJGE 5DYOA 1NGWB 2VDPH 5CIPB 3CXDL 3FFCD 1DL7H 3H9YA 3RNKA 1R3JA 3L5XL 3MOQA 4MYWB 5C92A 1CCZA 5J11C 2BRRL 5B8CA 4R4BA 5ETUB 3B9KA 3R1GH 4PGBB 4LPXA 4K2UH 2YD6A 5IOPA 1TQBB 1AHWA 2BOBB 4HKBB 4MA1B 3CFKA 4JM2D 3NAAH 3BZFA 3PWUB 4PJXA 4CW1B 5DDHA 3UC0H 4GJTB 5GZOD 1QEWB 3F7VA 1RIUH 3QIBC 3ZKNC 2E6QA 1K3IA 4X5WA 1HYRC 4JFZH 5EFIA 3VMNA 1KLFA 3DOSA 2Y23A 4FP8L 2GI7A 3VXSE 4XNYH 5EIVA 1MFDL 5FIEA 4AEEA 4ODSL 5LAXA 5TQ0H 3RGVB 4M6NH 3QPQC 3MO1B 1FVEB 2YPLB 3EFFA 2W1NA 5KVDH 4Y16D 3W9EB 5KSUB 1EBAA 4RFOL 2DQIH 1U41A 3NIGE 3T1FA 3NIFF 2PXYD 4Y89A 3QG7L 3BQUB 5BOPA 2VLME 4NZUL 1NL0H 5HY9B 4HUXA 4HXAL 4FXGB 4WI3A 5D4QA 5DUML 2F58L 5C1MB 4MCZA 5MHSE 1HHKA 1I7RA 4S1RL 3RWFB 1KCRH 4MHHI 1N64L 3QEGH 3KPRB 2YUZA 4KZDL 3DO3A 2EH8H 3FQUB 3SDDB 5ISZB 2DDQL 5F88A 3MRNA 4EN3A 4LSVH 4JHWL 3IF1A 1EH9A 3EYOA 4AK1A 2VDLL 4UQ2A 3MV01 4XC1L 4WWKD 2AXFB 4BSVB 4CJ1A 1AQKH 4HX1B 1ZTXL 2DYPA 2GCYA 4JY6B 5D9SB 1GXEA 4NT6A 1OPGL 3K74B 3LY6A 1KENH 3U0PB 1QPPA 4UUJA 5F9JB 4X4YB 1C08A 5E6ID 2GSIB 4ZXBA 4RDQF 3F7YA 3GKWL 5HGBA 4Z7NE 3P0YH 3I6GB 3PP3H 2E7MA 3I6LE 4LSPH 4WUKH 1EXUB 4G80B 1LK3L 2NX5A 3O6LH 3WFCL 1FZKA 4IRSB 1LGVA 3DLQR 2B20A 3DX7B 5A3ID 2EDRA 4RGMB 4K71C 3L3KB 1U8HB 4G8IB 3BT2L 3OKDA 1UWGL 4U0RC 3CMOL 2CRMA 3IYLW 4TOYH 3WYRA 4HPOL 4WJ5B 4YXHL 2ADJB 5KSBB 4NQDB 1A6VH 1Y18A 1P4IL 2AEPL 3MODH 3T8XA 5BRZE 1INQB 4JFDB 1T04B 3HG1E 1BFVH 3CVHL 4OZFA 3ULUH 3DUHA 2B5IB 1W0WA 4RGND 4M5ZL 4GS7C 4BSJA 2VAAA 3WFDH 3G08A 2ERJB 5EUKB 3V8OA 4Q74A 3S3SA 1IC4L 5I76B 1AGCA 2PYED 1KXVC 1JGVL 2BSSB 2LFGA 2EECA 1OGAD 3DSFH 4LF3A 3HC4H 5E2UL 3EJZC 4PP1D 4PBWD 1EO7A 4Z7VE 1JN6A 2XI9A 2Z4QA 2XN9E 1U8IA 3LEYL 3LRGA 1RULH 1G9ML 5FUZH 4UT9L 1P1ZA 1I9JL 1KN4L 2VLKB 3DPBA 5EU5B 3SGEI 4JO2H 2D9CA 3MV8B 1HQRA 3BX7C 3QQ9C 5GGTH 5GRXG 4U33A 1J88A 1FNHA 2RCSH 1F6AB 1NBQA 3FAXA 2FX9L 3MRKA 2HLFC 3C2AH 3NABH 3RY4A 2WUBL 5I6XB 3TLRA 5CINH 3WD5L 3ULVH 4G7YL 5EPMB 4MWFB 4R7NB 4UV4L 5B38G 1JK8A 2LV4A 2MOVA 3V4VL 2GAZA 3I2CL 3EO0A 3PWNA 1EFXD 1SEBA 3M1BA 4APQA 4S1DC 4ZODA 2RB8A 1QLEL 2F5BL 2GTWB 2BNQB 4OIIL 3HZMB 4DW2H 4CJ0A 3M17B 4QHKI 4Y4KD 5D7LB 4H8WL 4QF1A 4U4BA 3D25A 4LQFH 4O58L 3GSXA 3WDIA 8CGTA 2XTJB 4G5ZL 3FN9A 1I8KB 4ZS6C 1IARB 1A6WH 3G6JF 4ZAKD 4PJGF 1BVLB 1BIIB 4XNXL 3PP4H 4TNVF 2X89A 1BIHA 4N5ED 4XP4H 1U3HD 4LPUA 2Q76B 4FTVA 5D2NC 1CFVH 3QJFA 3L3GA 4P5KB 2RJMA 4R2GD 3LKPB 4X99A 3DV4B 3MJ7B 4F57H 3WLBB 1QFWL 5C0BE 5JW5A 4O02L 2VLJA 2AVGA 4F8TA 4LCWE 3P0VH 4NRXB 1RJCA 4JJ5B 5MEOB 4G43B 5GS0H 3FB8B 3LPFA 1PJ9A 4V1DA 2JJWA 4KRLB 3UPCA 2HFFA 2WSKA 2XWTB 2LU4A 1A7OH 5DJCB 5HHXH 5E6ZA 4NC2B 5EOTB 4Y19E 1D5ZA 5EBLA 1K6QL 4K3JL 1XH3A 4DZ8B 3MFGB 3L7EA 5E08L 3DGGA 2G75B 1KPRB 3QNZA 5BCAA 3LKSA 1YMHA 5L7XH 1CDJA 3RTQA 3OAZK 4JPWL 4M43L 2FDBP 3UJIL 5CP3A 3OB0K 4GRWH 3ARZA 2VZSA 3B9DA 5H37G 3WFBH 1L7TH 4G9FA 2H2PD 3MXWL 3QIWB 3OAYK 5DRXB 5GRJL 5ADPL 1F11A 4M3KB 3RWGA 4J4PC 5IMOB 5DC0A 1U8OB 4E41B 2W65B 3CK0H 3ZHLA 3O11B 2EYRB 3CPLA 5EU6A 2V2TA 3IB4A 4NQSB 4OKVA 4OCWL 3O2DL 3ARBB 4A6YL 1IAIL 1JPTL 3IDNA 2A1WL 4M7LH 4LMQE 4KHTH 1HKFA 1OQOA 3GSWA 4FA8A 4FMKA 1QQDB 1L6XA 4KVNL 4GG6B 4XP5H 4GUPB 1AO7D 1MQ8A 1X6NA 5T1MB 2XWBB 1XF2A 1JF5A 3KYOB 2GSGB 3GB7B 2VDKL 4P3DB 3MRQB 2FZ3A 3KNBB 5DT1H 5FB8A 2VJXA 2XZAL 2D31B 4KGJA 5E56A 3UYRL 2YHGA 2VE6B 2DBLH 4Z7NF 5IB4A 1XF5B 1S7RB 3GSVB 2IBGA 5C0CB 4F7EB 4XCYA 3H8NA 5B39A 1FCGA 4IRJC 4OZHB 3OKYA 1MF2L 4MCYB 5MEND 3UBXG 3L5WB 5GS1B 5B4MC 5KVEL 3QQ4B 5DI8B 3ZTNH 4K55A 3ZKND 4N5UA 1OW0A 5EO0B 1YY8B 4O2EB 4X8JA 3GJFB 2EO1A 4ENED 3LS4H 4KK6C 4JO4H 1JZ3A 4MJ5B 2XKNA 3SJVE 2HJKB 3DWTA 3WXWL 5F3BA 1YEIH 3CFCL 5GIRA 5DJ0B 1QRNE 5DMKA 3SHSA 1A47A 3KLHD 4O2CB 4QLRA 5DHYA 2DLEA 5MERB 1DBAL 4LCUA 3U36B 4JPIA 4ODHL 1MEXH 5TDNB 4NUJB 2V5SA 2WQRA 2IADB 5TQ2L 2YD5A 4N0YH 3U0WL 1UH3A 4XPAL 1UC6A 5TF1H 3D2UA 4YAQB 2ADGB 1VEOA 2W91A 3STZB 3VD7A 5I0DA 3UZVB 4Z7VF 3U9UA 4AM0B 1A02N 1VCAA 1DN0A 3INUH 1R3KA 1ZSDA 1IGYB 1CE6B 1RUML 1PX3A 4GMSH 3QI9C 2VR5A 1YEHH 1UKSA 5AUMB 4R3SB 1KIQB 2QTEA 1A7PH 3S35L 1G0YR 4PRPB 3V6FA 5EUOE 3O3DB 1GGUA 2A73A 4K8RL 1KEGH 1OARH 1W8NA 1S7QB 3MA7B 5DRZA 1MLBA 1XAUA 4NIKB 2F15A 4U1JB 3B3IB 5DQ9B 2YEZA 5FECA 3AREC 1SJHA 1JPSH 2D3VA 5J6HB 4HFWB 3HUJE 4GW5B 2QADC 4JANB 1QBAA 5A16A 5DO2D 4LSRL 4RQQA 3BPLC 4Y5YB 1RFDH 4DGIH 4IM8A 4PY8I 2XG5A 2VLLB 3TH3T 1RI8A 5FKAB 2DD8H 3DO7B 4TNWF 3UYPA 1CQKA 4PYHA 4DZBA 1MCCA 1ZMYA 2BZDA 4XCFL 4WI2A 3MUZ1 5E5RB 2P5EE 2NY4C 4HS8H 5EO9A 1DE4B 3RIFK 5J6GA 2P5WD 1CIUA 2D7TL 2GY7B 3VGBA 3QFJB 4YIQB 1DP0A 1RJZA 4OZFH 5BRZA 1AXTL 1U8QA 3RU8L 4Z6AT 1GHFL 3REWB 3UTPE 2A6IB 2OK0H 3FO2B 5HI5C 1A6UL 1IEBA 3TEUA 3U1SH 3MGAA 2EZ0D 3BXNB 4XCNA 2OJEB 1S5IL 5FYKE 3A6OA 3QUZC 4XXDA 2YD4A 3R06B 4XBPB 2WBJD 4X7TA 1J1OL 5IMKA 5DJAA 3W81A 4Z7VA 1IFHL 1AGEA 4NDMA 2XN9A 4FQXC 3QDMD 1F00I 2VAJA 1OLLA 3CUPB 3LPGA 1OHQA 4D0DB 3WDJA 3DHMA 3W11C 1A6PA 2HKHH 3EJZD 5DUBA 1NLBH 4X6BB 5DD5H 3RWCB 1MH5A 5GISL 1EO8H 2Z8RA 3RWEA 3NTCH 4HIHA 1E4WL 3TO2B 2DJUA 2J5LC 4MAUH 3ECBB 4QY8A 1UH2A 4H1LB 4NQXB 4PJEE 1M7IB 5JXEC 3H9HA 2BERA 4XC3L 3SDXB 1ZLUK 2NY5H 5DRNA 1JNLL 1J5OL 1CF8H 1L7IL 5FK9B 1KPUA 3WIIH 3RAJH 4XNQA 3BH9A 3KWWB 5CLTA 4OFVA 3MLWH 5I19H 1MRDH 4NP4H 3QUMB 3MNWA 4UIKH 3VFUB 4KRPC 2IG2H 3T0WA 3SO3C 3FT4B 5IB5A 1R3LA 3GUTB 1UJ3C 3GFUA 4G6AC 2MQ0A 4GBXB 4S1DD 5DHVA 1ZGLB 4NN6B 1F8TH 4CAGA 4YX2H 1IGCH 4XNMB 2AQ2A 2X10A 1KB5L 3TWCL 2R1XB 4YZFE 5E2WH 1CDYA 2PO6A 2VABA 5AG8A 1WT5A 5C8JA 1ZT4B 4KVCL 2OP4L 4EUPG 4JVUA 5AEAA 4OLXL 2DQTL 4ZS7L 2VN7A 3EGSB 3IDYB 2DLGA 4HH8A 4LLAA 1QBMH 1K8DB 1KJ2A 1AH1A 1KLUB 2ZOKB 4ZOCA 3U4EB 4C4KO 3DTXA 4NKOB 4DQOL 3GIVB 5K9OA 3K1DA 5L88H 1UM6L 1D9KD 1OTSD 5C0BA 5E2TL 2PF6A 4LCWA 5ACMA 3H9ZA 2DMCA 4L9LA 5IJVB 3RUGB 2BFVH 3RWIB 1T7VA 2HKFL 4QHNB 1OAQH 5IEKA 2J6EL 4P3CH 1W0VB 2Q7YB 4NOFA 4Y19A 4PS4L 2WANA 5CBAB 5IIEB 1XGYL 4EDXB 1B88A 1JV5A 3VXOA 1QLFB 3CDFA 4PJ8C 5FHAL 2BY2A 3SE8L 1G1YA 3DVNB 3K3QA 4Z77B 4TQEL 3QNYA 5CP3H 3SGJA 4O2FB 2X4RB 4WFFE 5EZOL 5IQ9A 4WHCA 2WUCH 2X1PA 3VXMD 2LAGB 3V6ZB 3MLXL 3O4OB 3BP6A 4LSUH 4D3CL 3GRWL 5C9JB 3VDBA 1B0GB 4HGMA 2XFXA 4QYOB 5EN2B 3VG0L 1Q8MA 1OAXL 3MRIB 1WEJL 4K8RD 3KLAA 4M61A 3AC0A 4I48A 5D71H 2HRPH 3IJHB 1NEUA 4RAUB 5CILL 5IR1A 3NFPA 3C5ZB 4ZFGL 4RX4D 4RWHA 4N1EA 5I1CL 5D1QB 2XQYK 3DUSA 4PJ7B 2CIKB 1I1AC 1TTFA 3RZWA 4LARH 4HDIA 5KW9H 2F8XC 2YUVA 3Q6FB 1I9RL 5H35A 4I9WE 4J8RA 1Q38A 5CJXC 4LSTL 4K9EC 2YXFA 1ZA3B 1EHNA 1YNLH 2H9GA 3EDDA 5DRWB 1U6AL 4CADB 5C0JA 5EUOF 3ISWA 3CD4A 3JWNC 1FG2B 4ZDHB 2R8SH 5AAWA 2C4FT 4LEXH 3S88H 1V7ML 1X5YA 2LE9A 4UQ3B 1WC7A 3HNVL 1GC1C 1U92A 1UYWH 1X5LA 4QO1A 4CU6A 3L9RA 5F89A 3RY5A 1KUMA 6CGTA 3HUJF 3JWDH 3N1MC 4BH8B 4UOJA 5DWUH 1M71B 2V7NB 4OFIA 4U6YA 5HDOA 2DM7A 3OB8A 3BEVA 3TCLA 1HHJB 5B4MD 1G6RA 1R24A 1C12B 3SJVA 5EH1A 4UAOC 2ICEB 3E3QC 4YQXL 3LV3A 5D1XC 1HOCB 1NAMA 2VNCA 4PRAB 2ZUQB 1DVFA 5FEBA 4QRTB 5SWQB 4WW2F 3VXPA 4DN4L 1UXSB 4PGCA 1ZT7B 1IT9H 4PGEA 4PREA 1TIUA 5E1HB 1A2YA 1DTUA 2P8MB 1A14L 3CDYA 3MOAH 3HNSH 2GJZA 5HGDA 2V9TA 4NNYA 3RGVD 4UT7L 3N1FC 4NJAL 2YPLD 3HAEB 1CI5A 4Y5XB 3NGBC 5GS3A 4X6DE 3RL1B 5INDB 4Q0XH 4RCAA 5BXFA 3BQUD 1MVUA 1TZHB 1U8NA 1FZJA 2V5YA 5I2IB 3RZCC 5EUOA 1MHPH 1UFUA 2P8LB 3MR9B 4YDIL 4FQHB 5D1ZA 3RX7A 5F6IB 2A6KA 1LO0L 3HI6H 4JHZA 5D7KE 4FQLL 5C09E 4PJEF 3GMOB 3KPRD 1A1OA 1FN4A 1DQDL 4PJBF 1FAIH 5ISZD 4BH7A 3LSOB 1S9XA 2AJYL 2GITB 4FFYL 4HUUA 3HUJA 1DQTA 3PWLA 3LD8B 5E8EA 1ZWIA 4OLWL 3HTLX 1LD9A 1CG9B 2YD9A 2FEEI 3QWRA 3HE6C 3QUYC 3IJSB 2EDKA 2P5EA 3BAEH 1X5FA 2GT9B 1KG0A 3DRQB 4ZSOB 5CP7A 1CXHA 1FC2D 1V7NH 3LIZH 5HYSA 2NY4D 1XR9B 2HH0L 4MD0B 4WW2A 1SJEA 3OKKB 2G60L 4C56A 3EOBA 3E8UH 5I30L 4JFHD 4IRSD 2H6PB 4IBLT 5HI5D 4EI6B 4D94A 1X4YA 3NOIA 1HSBA 2HT2C 3MCLL 3WIHH 1G7IA 3V4UH 2HT3C 1JYXA 1U8KA 3FFCE 3PIQB 3BRDA 4FABH 4NQDD 3GMMA 4G42A 2ITCA 3VW3L 2C1PA 3CDGA 3JVGC 3MUGB 3PG2A 5DUPL 4LSDA 4JFDD 4ZUTB 1HILB 2GEEA 5ID1A 3T2PA 3C6LC 3D9AL 1DR9A 4PJEA 1U3JA 2D0FA 1FVDB 4GRLA 3OPZH 5CJQL 5D8JL 3FQWB 1AXSA 2DWDA 4XNUL 4EBQL 4JKLA 1J10A 2PTUA 2J4WL 4H0IA 5JXED 4HEPG 4JREC 1D6VH 1BVKB 1FL3B 4O9HL 5T3ZL 4LVOC 1IEAB 2W0KA 2ATPA 1DBJL 4I0CC 1PD6A 4WI6A 4YXKL 5DHVH 3VD5A 3BEWA 3K0WA 3MV8D 3P4NB 1QNZH 3EDKA 3TNNA 3GHEH 3OKEB 2JB5H 4LSQH 1X3DA 3VXRE 4ZOAA 1JNHB 2AJ3A 3FTGA 2P4AB 2X4TA 1I4FB 5GHWL 5E4EB 2R2HB 3RJDA 4HIXH 3CSYA 4R97C 4YBLC 4KROC 3T0EE 1ORQA 4XPHL 3TPUB 1J1XL 1KJ3H 4ZFFA 2JCCE 4Y4HA 3TVMC 2BNQD 2ZPKL 3BO8A 4NWTH 4JPVL 5FOBB 4JKPH 4HJJL 1DDHB 1K4CB 1ZT1A 1MAMH 5D7LD 3PL6B 3U4AA 2IPUK 2EXWC 2QQKL 1LE9B 4LVHB 4RRPG 3FRUB 3QISA 1FFRA 2JLLA 5HD8D 2R4SL 4X8XA 2XTJD 3ARQA 1NSNH 3TBTB 1NC2B 3IETB 5IFJB 4OAWB 5E8NB 4PB9L 3LDBB 5CFHA 2DIBA 4QGTA 4KDVA 3BOVA 4Y5VA 4M5YL 1JFQL 4JDZA 2AJUH 4YUEL 3S34H 2ZUYA 3C09C 3MROB 3UO1H 5J8OA 4PD4J 1AD0B 4MNGE 4XMKH 4PJ8D 1BQLL 4GKSB 2ZG2A 1QYGL 3C2SA 4WV1B 5J0BA 3VFMB 3DMMC 1TDQA 5C0EB 1EAPA 3MRGB 1N5AA 2O5YH 4U2YA 3LZFL 2ZJSH 2EDDA 3QUXB 3WV0A 5IHBA 1J0KA 4UB0H 1CXKA 3W39A 4PG2C 3C6SA 1I1RA 1TVHB 4H0GA 5IQ7H 3X3FL 4MQ7B 2AK4A 3T4AA 1Y0LB 5IK3A 3W2DL 1GPOH 3AB0B 2F53D 2O5ZH 3I9GL 2BMKA 2YC1B 5F7NC 4ETQB 4DVRH 3KDMA 2PYEE 4ODXB 4X6DF 1I1AD 1OGAE 1HCFX 1NC4B 4XXCA 4HUVB 4LRNH 3A6BL 5DEGA 1H3PL 2R69H 3X3GL 1JZ7A 2W9EL 3QIWD 2OL3L 4Z95H 4LLYB 3VH8B 4NQUA 4E41D 1XF3A 4D9QD 3GSUA 4FQCH 3MLSH 2R0ZH 3DROB 3HR5A 5I8CB 3L7FB 3ARBD 2Y72A 5TE7L 1OP3K 4OUUA 1CLOL 4HFUL 3HC0A 4U1LA 2UZIL 1A6AA 5EZIL 4ZQKA 1YYLH 2VITB 1CD1B 3MXVL 3BKYL 1ZEAL 2RHEA 3QUML 4IHOB 4QOKD 3V5KA 5F1NB 2MPAL 3NCYP 4JO3L 3SDCC 1V3MA 4IJ3C 4NRYA 2J8UA 3RBGA 3WFHB 5ILTH 3TZVA 4G6FB 5FA4A 1NAMH 4FNLH 1NGYA 3GK8H 1S9WA 5LGHL 2A6DA 1U8JB 1PY4A 2CUHA 4P59L 3BUTA 3O2WH 4JFYA 5FUOL 4IMKC 1T2QH 1NFIB 3MREB 3CVIL 5C0CD 1KULA 4R26H 4ERSL 3WSQH 4LHUB 2FLBT 4ZPTA 3BKML 3PNWA 2IANE 2NY2B 2PTTA 5DJ6B 4MNQB 4WO4C 1WBXB 2AXGA 3ARFC 4H5SB 3Q6GL 5BO1L 4ELKA 3RWDB 3KYNA 2NW2B 2YD2A 4O4YL 1PVHA 1I7UB 1RZFH 3FT3A 1HSAB 5T3ZD 4X6DA 4OI8A 1YMMB 4JZNA 2WV3A 1MIMH 3UTTB 3ZKMC 1PDKA 5FM5M 1AGDB 4JRXA 1S7WA 4I13B 4JHAH 1JUFB 1IC5H 2GFBA 5E7BA 1PG7X 5LJYH 4JO1L 4JFQB 2R0WH 4X5LA 3VU2A 5D2LE 5BVJB 3TA3C 5EIQA 1RZ8A 5JOFA 1JHTA 1JHLH 3OZ9H 4BFGA 3IDGA 5C09A 4KPHH 2IH3B 4YHLL 1QHPA 1L4IA 5D93C 4PJCB 1MI5A 1ZVYA 4GFTB 4PBVC 3RZCD 4POYA 1MQKL 1MCBA 3KPTA 2FX7H 2E6JA 5E94B 2B1AL 2PUQT 3MRHB 2XA8L 2HFGL 3JBG7 3SE3C 4Z7WF 1ZVSA 4N0CD 5KN5A 1AP2B 1S7UB 4F7TB 5JQ6H 1MFCH 2P8PB 4KH2A 3SGKA 2DI7A 2APWA 1YN6A 2D2OA 4L9DA 3ZE0E 3P11H 1RK0B 2A38A 4J3UA 5EU4A 4JLRA 1BFOB 4PRPD 8FABA 1FZOB 4KI5C 4BA8A 5I1KL 5DGQA 1E6JH 1UA6L 2AQ1A 3DIFB 1BZ9B 1LP9E 4I3RH 3G5VA 2JJSA 4OLVL 2NCMA 4ETYA 1ND0B 1WCBA 1NCAH 1ZLSH 1JWSA 2FJGA 5D7JB 1IAKB 3MQIA 5C3TA 2W60B 1AC6A 3VI4E 5K9KA 2YSSA 5FYKH 3GIZL 4TUJB 3VD4A 5IJKA 3EYUH 3GMRB 3RPIB 5HI3C 1LO2H 5GGSA 3UTSB 4M1GH 4DKDC 5IMMA 2JCCF 1CD0A 4F2MB 1KIPB 5ADOH 5CD3A 3QWQB 3D87B 4I2XE 4FQ2L 1FNSH 3GSRB 1OP5K 3FFCA 4IRZL 4M00A 1WCQA 3UJJH 1U95A 3ARDB 5HDLA 4DKEH 5TGBA 1H8NA 1KGCD 3QFJD 3X11B 2ATKA 4XPBL 2Q6WB 3VGAC 3RI5F 1DQML 2ADIB 3BKJL 1NEZG 2H3NA 1QTYT 2FBJL 5AWNH 5HHNA 4HBCH 4PTTB 4F33B 1OAZH 4JM2A 3UJTH 1YDPB 1N3NA 3C60C 4R0LB 1AJ7L 1CU4L 12E8H 3DNKA 4HUWB 1NUNB 2BNRD 2EDNA 2B39A 4PJFE 1IGIL 4UDTA 3DGCR 1KYOK 3KJ6L 1GAFH 1M7DB 1FO0B 2ZUXA 5MENE 3MV9B 3LHPL 3C6LD 1JGEB 4P99A 2DQFB 2R1YB 4HULB 4AJ0A 4JFFD 3WJJA 1UACH 3VWJB 3OTTA 3AXLA 1J8KA 4HMDA 4LCYB 3FOLB 4NQCB 1EPFA 4Y16A 3GSOB 3VXQB 4B41A 2FLRT 4L29A 1PBYA 4TULL 3WXVL 2PXYA 1GGIL 3OXRB 2VR9A 4NO5A 3ILPB 1A4JA 4EI5C 5B38A 1TVBA 4LLDB 1ROWA 4HEME 1P7QB 1QLRB 4JY4B 5CZVH 4KY1H 3Q2CA 3WFEH 3ZE1E 2W59A 3U9PL 3JWOH 2FX8L 4OCYH 4RNRA 2JCCA 5HXMA 1VSCA 3RNQB 4FN0A 4G3YL 3V6BR 4HQQL 3DETD 1MCOH 1FFPB 5AYUL 4G6KH 1CT8A 1KC5H 2P24B 4WWKA 1NGPH 1FNLA 4FZ8H 4GBXD 3U0TB 4R96A 3E2HC 3D39B 3PWVA 5DJYB 3TYGH 5CBEA 3JV5A 1CICB 3R0NA 3GMPA 3TVMD 3VG9B 1OGTA 3RKDC 3UXFA 3LKRA 1TQCB 5LQBL 5E6YA 5GSRA 4N68A 2WWMD 3RA7H 3IFPB 5E6IA 1VGKA 2VOTA 2XOTA 4WHTB 4XAKD 2FB4L 3O4LB 2APTA 4CN4A 1KYOJ 1YEFH 1A1MA 2EEAA 4N90D 3FO0L 3H0TB 5F7FA 2CGRH 3NH7L 2FR4B 2OCFD 3DX9A 1I8IA 2CD0A 1RZGB 3B9KC 1OM3H 4MNGA 1N5YH 1G9NH 1I3GL 1AHWC 2EYTB 4TPRH 4Y8AA 1RUPH 1CFTB 4ONFH 3U6RA 2XT1B 1Q94A 2P5WE 1IAOA 3BWUC 5F7MC 4JZJC 3V2AR 3DMMD 1FC1A 1L0XA 4YHML 1ZLWK 3MRFA 3NIDE 1FZMB 1G7JB 3MLYH 5L0QC 1T80A 2F54E 3LMJH 3LH2H 2IQAB 2A74A 1IGTB 4LASH 1Q9WB 4HUMB 3NPSB 2OXGA 3H7LA 1BF2A 1BOGB 3QEHB 2MMXA 2PYEA 3GSQB 1Z9SA 3BZDA 1OGAA 5GGVH 4W81A 1Q0YL 3EOTH 1KLGA 4OFDA 4J23A 3PJSB 3QDME 4RZCA 1D6EB 5D2LF 3BZEB 2VXUH 4GO6B 4ODVL 4HF5H 4PJ5D 1F3DJ 1CGYA 4XP1L 1IGFH 5IROC 2FD6H 3EYFB 5GRZA 4BZ1L 4CVZA 4JRYB 5I1LB 1MJJA 2DWEB 1MY5A 1UWEH 4HJ0D 1WZLA 4EN3C 3MRCB 4JCMA 2B2XH 3MCG1 1P4LB 5F72S 4Q58C 3IVKA 4RIRB 1HHIB 1NANH 3K4ZA 4MZ2A 1P7HL 2NTFB 2FIRT 1GZPB 3HZYB 1I8LA 5EBMA 2EIZA 1MCDA 5KBNC 3D0LB 1I3UA 1MHEA 1HH6B 5GRYA 3ZE0F 1EFXA 4ZXBC 1T20B 2V17H 1WTGT 3DXAD 1F4YL 1LP9F 4XTRC 2DQJL 4NKDB 3UBXA 1JIBA 2XZQH 4Y4KA 2QQLL 3BP5B 3ZL4H 4HH9B 3VI4F 1TITA 2IPTL 5DK0B 5L8JB 4PJAE 4JGUA 2OI9C 1T1YA 4UTAL 4MHHG 1QP1A 1U93B 4QRRB 1UM4L 4NM4H 43C9B 4JFPA 5JR1H 3QNXB 5FYJL 2CKBB 4ZAKA 1TJHL 1MLCB 1B90A 4LCIL 2VXQH 3JTTA 4LLQA 2YRPA 1CDIA 1QFUL 1E28A 1U3HA 4ZUWA 4LPYA 4PJDE 1F2QA 4QXUH 5F44A 4F3FA 4IIQC 4PJHE 4TTDC 1Q1JL 5CUSL 2IH1B 4YXLL 3FB6B 5GGQL 1PFCA 3CU7A 5D72L 5D2LA 1NCCL 1MPAL 5D2NE 2QLVB 2VWEC 5DK2A 3ZKMD 4OF8A 2YRZA 4RMTA 5I18H 2X4NA 5K9QI 1WAAA 3LPWA 4JR9L 3B8SA 3TA3D 1XGUB 2V5RA 5HHOB 4MD5B 5JPNA 2EIDA 2XG4A 1QBLL 4P5TB 5GJSL 1R5VB 5SWSD 5IWLC 5F70A 2BX5A 2FJHA 4KDTC 1QKZL 5IW1A 4GKOA 3IKCB 4L8SC 4AEHL 4ELMB 2FEDD 3BIKA 1K4DB 3B6SA 2VC2L 3KPNB 1NCDH 4LEOB 5K9JH 3G5XB 3O45B 2HG5B 1HQ4A 1F3JB 3VXME 4P2QB 5F1IA 1J9CT 4NSKA 1LP9A 3V4PL 4UINH 1TJGL 3EHBC 1UEYA 1FP5A 4ZOEA 2YPKA 1H3UA 5D5ME 1JNNL 3BP4B 4ZFZA 1G7PA 3HHRB 3KXFB 1G7QB 3CFEA 3DUUA 4KQ4L 4OZGE 4APQC 1Z6JT 4M6AA 4NCC2 3ZE1F 5DJDB 3V95A 3K2UL 2I27N 4LNRA 5I1EH 1HIML 4M6OL 3PGFH 3IRZA 3LRHA 4I2XA 3P4MB 2WMPA 2DKUA 1D5IL 3QHTC 2OTWB 1AGBA 1NAKL 3OHXB 4HZLA 3QO1B 4LVNB 4P2RE 4JDTH 1WWCA 1HKLH 3PQYD 4HV8A 1AO7A 4JFXB 5F3HB 4WEBL 1T83A 4HPYL 1CTNA 4NGHL 5KANI 3MLVH 4KMTH 1T21B 4Q9QH 1I7ZA 3CVHA 1SYSB 3TNMA 4PLOB 1IM9B 3LQAL 3QP3A 4PJFA 4CU8A 4HWEL 2VH5H 2YS4A 5A40E 3MLUL 3OAUL 1IRAY 5MENA 2OS7A 3ARSA 1KTKE 2H8PB 4ONHB 3C60D 1J0IA 4X4XA 2BNUB 2M1KA 3OKNB 1MAKA 4P23B 4OZIB 2EDTA 3OG4B 1MCEA 1LEKA 3HC3H 3TH2T 3VDAA 5ID0A 2VXVL 1JPFB 3B2VH 2JIXD 3OKOA 4H26A 3KPLA 4N8CL 2CXKA 4ZTOH 4M6MH 4MA7L 3KPQA 1CFQB 1EGJA 1PKQB 2XTLA 4U3HA 2HP4A 1NFDE 4YDJB 3NIDF 3VFPB 1SVZA 1WFUA 3QZWA 3O3BB 1EUTA 1RZ7H 4YPJA 3ZKXC 1JPGB 4OCXH 4OLZH 4AEFA 3RTQC 1SJVA 5I0ZA 3AY4A 2UWEA 5E9DB 3CSBA 1MJ7L 3QEQB 2OM5A 4PRHB 4IMLB 4NZRH 3F58L 4FQJH 7FABH 3QHFL 2O61A 2DAVA 2NY3B 2ZCKL 5IG7B 2YPLE 3GJFK 4XPFL 1P4BH 5JNYA 4X7DC 4M7JH 3VRJB 4LBEB 2ZSWA 3DX8A 1T7ZA 4NHCH 2ZOLB 2W0FB 4KTDH 5JOEA 5L2JA 2HJLB 2PTVA 5BZDA 4G9DB 4HS6A 3TT3L 4LLVB 5FO9A 1MFEL 3OMZA 3Q1SH 3L6FB 1BJ8A 1IVLA 3FT2A 3KPRE 5DXWA 2PNDA 5F71A 5FYJD 5ISZE 4D9RD 5GJTL 4YK4B 2QHRL 1QFHA 2PR4H 4WW1B 5AD0A 1CFSA 2PETA 3STLB 1BEYH 3HPLA 3VFVB 2VDOL 1BBJA 1FGNH 2YKLH 4K23H 3AS2A 1IBGH 1YC7A 4JHBA 3PL6D 5E00A 1NJ9B 2EC9U 3FB5A 3MRJA 4L8DA 1F4WH 1AE6L 4Y7MA 4I0PB 3IDJA 1BQHB 4U6HA 2B4CH 3EO1B 1IGJA 2DQHH 2P5WA 2WIIA 3OG6B 2AI0L 1TJIL 1T0NA 4B7LA 5L8LB 1A6ZA 1NC2D 1RUAL 1DLFH 4L1HA 4P5MB 1OW0C 3ZT6A 2P46B 3BMWA 4QNPE 3I84A 1T5XA 3PWPD 3LEVL 4Z7UB 4DCQA 4NNPL 1FQ9C 1NCBL 3TIEB 4M3JA 5H37H 4JFHE 1GJIA 1Z5LA 2CIIA 4PJDF 2M8XA 2WBJA 5JORA 3HPJB 2F5AL 4QXWA 1JGDA 3K7UA 4NHUB 1HK6A 3QA3A 4U1IB 3QDMA 4P57B 4MMXC 4MJ4A 5KSBE 1FBIL 1E6OH 4ZOBA 4NQDE 3B2UC 2NYYC 3QUXD 4KJYA 5KJRH 4M1CD 2K3TA 3UPRA 1X5AA 3QWOA 2DJ4A 3QCTH 2P48B 5C2UB 4F7MA 1YPZE 1J1PL 5CEYB 1FO0L 3O2DA 4A6YA 5F7EH 1D5BA 2XWJB 1I1FB 3S36L 2E5EA 5DJXB 2I9TB 1S9YB 4Q7DA 1RK1B 5GGUB 2J88L 4FFZL 4YPGA 3RVVC 3OX8B 3D0VB 3K46A 5JO5A 2KDGA 4IDLA 4LGSB 4OV5B 4MAYC 2X6MA 4N0FB 5D5MF 1MIEL 4PJAA 1BWMA 4OZGF 4S1SH 2YD1A 2HWZL 1N6QH 5TFSH 5BS0B 1XCTA 3VA6A 1SVCP 1ZAGA 1BZQK 1T1ZB 4HLJA 2Z91B 2DI9A 4ODSH 4F7PA 4IOIA 2W0LA 3EJJX 4PJDA 3LKNB 4XP6H 4PJHA 4YHIA 4RFOH 2NW3A 2JKXA 3QG7H 5FDWA 1CDCA 25C8H 4KJPD 3U30B 1YNKL 2MSPA 1U91B 4HXAH 2ZG3A 5D2NA 1D9KA 3MC0A 4I4WB 2F58H 2UYLB 3VXNB 3BUYB 1EX0A 1N64H 4U3XA 2ZNXA 4NKQB 2YMXL 5GGRA 4LHUD 4OGAC 3NCMA 2NY2D 3O6ML 3KJ4B 1EDQA 4MNQD 5ERWB 1P69B 4UTBL 2QSQA 3BHBA 3RIAF 3QDHA 2BSED 2Y7QB 4P46C 4D8PB 3S96B 5T3XL 2BOCB 5ACZB 5TDOA 1JGLL 1N59A 3NZ8B 2VDLH 3QQ3A 4XC1H 1PG7L 5CMAA 4XWGL 1YMMD 1PQZB 5KOMC 1ZTXH 2HTKD 3TIDA 3VXMA 4PLJD 3DI2B 2AJSH 2C7UA 3SCMC 4FG6C 5DS8A 1ADQL 4NQTA 1NFDF 4HKJA 2UZXB 5IB1B 4HJGA 2RFXA 1KIRB 2CDFA 4ONGH 3WN5A 3O6FA 2VIRB 2X4OA 1DQLL 3LAFA 4K7FA 3O41B 4Q6IB 1MWAL 1LK3H 4OZGA 3EHBD 4U6VL 3WFCH 4RX4A 4MDJB 4OD1L 1NDGB 5IF0B 2YBRB 1N7ML 4ZPVB 4NBYB 3N85L 3BT2H 2F53E 4I3SL 2XY2A 3RDTC 2GJ6B 3ARYA 3EOYG 1X4XA 1IM3B 2PYFA 3E6FB 3B5TA 3X13B 3OJVC 2GQHA 1UCBH 2X44D 3IJYB 5L2KB 1S7TB 5F1SA 3PXJA 1TMCB 2AEPH 3L5IA 4G8FA 1WT5C 1J87A 5HHMB 4F9PA 4DFIA 5I1HL 1V3JA 4YWGH 2FL5B 3RWJB 5D7JD 4X4ME 1BAFL 2XPGB 4D9QE 1VADA 2LTQB 3HA0A 4OSUH 4LKCB 3CDCA 4GQ9H 1H0DA 3UTSD 3D5OF 3M07A 5DK3A 1RHHA 4XRCA 5L6YL 1JGVH 1B6DA 3BPNB 5IM7B 4RA3A 3OR6B 1NGWA 5CIPA 3ZO0A 5JPMA 4QOKE 2NY6C 3LEYH 4RMUA 4L9LC 3I6KB 3V5DA 2QSVA 4ZFOB 4X6CE 4L4VB 1KN4H 2X2YA 3ZT5A 3P9LB 3T2NL 4V2BA 3VRIB 1HEZA 5ETUA 1EGJH 2ZCHH 4PGBA 1MRFH 5ECJE 3RVXD 2BOBA 4HKBA 1NFDA 5LVEA 4U1GC 3PWUA 4BKLA 1YY9D 3FOMA 4QNPF 4CW1A 3E3QE 2WUBH 3IDXH 1QEWA 4G7YH 1DFBL 4OZHE 4LIQL 2FJFB 2ILLA 5IVXB 3LQZB 2CKBL 5GRWA 3BSZL 2ZUSA 2QQNL 1RURL 4MD4B 4EQ3A 1T22B 4N0RA 1QSEB 5F9OH 1ZHLB 4DK6A 4WHDA 1LO5B 4Y2DB 3I2CH 5EA0L 4KZEL 3VMPA 2J8OA 2ZG1A 2Y9RT 3RGVA 1X5KA 4FFWC 1QLEH 1FVEA 2YPLA 3I3EA 1V3LA 4NQCD 1GCFA 2CR6A 4OIIH 5KSUA 5T3ZE 3R8BB 3A6CH 3DX6B 5HPMB 4OT1L 4PRNB 4XHJC 3BQUA 4G9FD 4YBQC 4EUPH 4H8WH 4F9LC 5HY9A 4FXGA 4O58H 5ESAB 5KS9B 2DIJA 1BX2B 1CGTA 2OLDA 1YPZF 2FECL 2W38A 3RWFA 5IT2L 3I75B 3MLPA 1KB5A 5LWYL 3KPRA 4C58B 1P7QD 5ISZA 2ICWA 4NQED 4MMZC 4XNXH 4PLKC 4LLUB