2UYLB

Crystal structure of a monoclonal antibody directed against an antigenic determinant common to ogawa and inaba serotypes of vibrio cholerae o1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
213
Chain Sequence
QVQLEQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGHISPGSSSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCGREETVRASFGNWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Monoclonal Antibody Directed Against an Antigenic Determinant Common to Ogawa and Inaba Serotypes of Vibrio Cholerae O1.
pubmed doi rcsb
molecule tags Immune system
molecule keywords MONOCLONAL ANTIBODY F-22-30
total genus 43
structure length 213
sequence length 220
chains with identical sequence N, W, Y
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB02
1S7QB 4ZMAT 1XFPA 1TCRB 2YKLL 4BZ2L 4Q9RL 4HJ0D 5HY9A 4F8QA 1XT5A 4ENEC 1W8OA 4K23H 5FO7B 1FGVL 3OAZK 4YO0B 4TPRL 4P4KB 1OCWH 4WW1A 5DDHB 3IJYA 1G7JA 2FO4B 3BGFB 1U8LA 4XPHH 3HAEG 5GS2D 3WHXB 2EXWD 4NQUA 5KVFH 1NCBH 4JFOB 2XPGA 3STBA 3V6ZA 2HN7B 1DBML 3VGEA 4ETQA 1QSZA 1ZSDA 3MLXL 3SDXA 4WFHE 4NQDB 4U4BA 1RJZB 4AM0B 3MA9H 4JRXD 3NCFB 1JUFA 4U1SB 4XCCL 4M48H 4AEIH 5C0RH 5I1IH 1ZT1A 4NZDA 3LCYA 4D9RD 3S6CA 1TTFA 3AB0C 4POYA 4L3ED 4NKDA 1A7QH 2GJJA 1T89A 2EDXA 1UXSB 3MV9A 4PJAE 5CP7A 1A21A 4NKMA 3N9GH 4LU5L 3KAAA 4Y4KC 2NLJA 4RMUA 4FZ8L 4NUGH 4R97C 3HC3L 3TBTB 2EC8A 3T0AA 2R0WL 4AZ8A 1A6TA 3SE3A 5EIIA 5T1LA 3L1OL 1TQCB 1XGTB 1FNGB 2XTJC 1MI5D 1DDHA 2IJ0C 4K3HA 3RWCB 3RZCB 2PO6C 2EDEA 2X4PB 4NHCH 3QIWC 3P4OB 3UYPA 1D6EA 5HGHB 1CVSC 3FFDA 2XTLA 3PXJA 4UIKH 3LQMA 4HW6A 1GAFH 1OP9A 4EDXB 4YFLF 5EZLB 1MREL 4PGBB 2ZG1A 4RIRB 5D5MB 3G6DH 1KIRA 3ZLQC 1UJ3C 4XX1E 3OQ3B 4KI5D 5I1KL 2A6IB 5AUMA 3DX8A 1W2KT 2EKJA 2DQFB 3PJSA 1RULL 2IF7A 1VDGA 4RZCB 3X12A 4FABH 1CT8A 4FXKB 4XB7A 3TYFB 1DR9A 1QTYT 3PP4H 4E42A 2IH1A 5FOBA 3E0GA 2DM4A 1EUTA 5C9JB 2AQ2A 4Y4FC 1LO5B 1L0XA 5L8JB 2VDPL 3VFNA 4AQ1B 3MRKA 5IMLA 4PBVC 1BLNA 1NGQL 1HQ4B 1KV3A 5ESVA 2D03L 5CILH 1OP5H 3G04A 3NFPA 4U1HA 2CDEB 4RGND 1G9NH 4H1LH 1AGFB 1L7TH 3ULUH 3FRUA 5JPNA 4JFZH 4JPVH 4O51A 1I1AA 5ITBL 5E08L 1EXUB 1MVUA 4NBXB 1P7QB 2DLTA 1WWBX 1NGXA 4PJGB 3ZYIA 4G8EA 3QRGH 1RPQA 1QBML 1NAMB 3NGBB 3IFPA 1CT8B 3SDYL 3T0BA 1ZT4A 3DX6B 3BKCH 3GBML 1EGJL 5D8JH 3RI5F 3WO4C 1G7PB 3MNVB 1IC5L 3HMWH 1BAFL 4ORGB 1NCAH 2QHRL 2X6MA 2GY5A 3BZ4B 1NLBL 2VDQL 3WN5C 4Y1AE 3DVGA 4UDUB 4Z7VB 3LDBC 4GBXC 4JQIL 4M43H 5C0NC 3BZDA 4TTDD 4Z7WB 5KSBB 4JR9H 5JHLH 2XKNA 1HCFX 5H94B 4GW5A 5E5MA 1X9QA 5KG9A 5IKCB 3SDXE 5KANI 5C70A 3F5WA 2HTKC 1UM4H 2FYYB 2YEZB 4WI8A 3TPUA 2GKIA 4IRJA 4OZGA 1TCMA 4MHHI 3MRHA 5F3HA 3REVA 1YDPB 3WIFB 1JZ5A 3TN0A 4I77L 3F8UB 3KLHD 1KYOK 5DA4A 4XCFL 3JWOH 3AXLA 2A9MH 4MJIE 2HFFB 5GGUB 1F4WL 2P5EB 1A3RH 3EO9L 4HXAL 3DUSB 3PIQB 2CLRA 4I3RL 4H1LB 4LIQH 4XPAL 3V6OC 3UDWA 4LHUG 3ZT7A 2PN5A 2YSSB 3LQAH 1DSFL 1PKOA 5DD0H 4XWGL 2Z31B 1E0OB 1BVZA 4GRMA 2E7CA 1NL0L 4MNHA 5C0CB 3O6FD 5FCUH 4S1RH 4PIRF 5I1HL 4NQED 5FAAA 3U6RB 4FA8A 1W0VA 4EXKA 3MJ7B 4FZEL 4MA1B 1QRND 4OF8A 3SY0A 1DVFA 4IOFC 4I0PC 1KNOB 2EKSA 3FHAA 4M4PA 1HEZB 4WEBH 3LZFL 3MTRA 4HJGA 4HHAA 4X6CE 3BAEL 4NOFA 5HHQA 3TVMA 4QCIA 3TO2A 5HSFA 2GITA 3QDJA 3LHPL 3TVMB 4PJEF 2XACC 3Q5OA 1ED3A 4X7SH 5D7IE 5DQDH 3BP7B 2ZCKL 4WTZG 1IGIH 2V2WB 4RAVB 1I7TB 5D7KE 1UCTA 2R29H 5D1XB 1CGVA 2BY1A 3PXHA 4TRPL 1BJMA 3N1MC 5DFVD 1FFOB 3N1FC 1M05A 1R3IH 3ELAT 1H9VA 2FBJL 1BGXL 1LILA 3MLVH 4OI7A 2P24A 1CDUA 1P4BH 3EKCA 3P4NB 5C3LD 3ZDZE 1YEIH 3SO5A 4LLQA 4OQTL 4KZDL 2OL3A 1U8KB 3VI3E 5C1MB 1F6AA 1ITBB 1X5FA 2R2HB 3KJ4B 5GS0H 5DTFA 4JG0L 3ZKNC 3QUYC 1OD9A 3BGAA 3MLWL 1N6UA 2XWBB 4BFIA 4UB0L 1TVHB 1MCFA 5E00B 1K3IA 4ZFZA 5GGRB 3S88H 5BVPH 2UZXB 3RP1A 1U8HB 2UY7A 3EO0A 2P48B 5TGBA 4UU9A 4UT9L 5H35B 5FO8B 4AK1A 2JK5B 4HZLA 3T09A 1JHLL 4W6YB 4G8IA 1KJ3H 3SJVA 1FL6A 4AIXA 3SOBH 4OM1L 2HT2D 3WFEH 4YHML 3BH8B 4ODVH 4X6BA 3K74B 1T20A 4OUUB 1OF2B 1JWMB 5IB5B 4GSDL 3NACH 3VI4F 1UQSB 4JFFA 1A1OA 5D7JD 1FJ1A 4ZUWA 2B4CL 4FQLH 4JFHE 3O3AB 1OHQA 2DMKA 3DOSA 1PKQB 4HIJA 2WW8A 3G04B 3VCLA 1G6RH 3VG9C 4R2GB 3TNNA 5HYJA 5EUKB 1UEMA 1VA9A 4Z7UA 1SM3H 3G9VA 5SWQA 3FOMA 3RGVA 1RV6X 3GSXA 4LCIH 5MEOB 4LLMA 2ARJB 4D3CH 3RTQC 1U8IA 4HCRA 2G60H 3LRSA 2Q7YB 3K7UA 1UYWH 3Q3GB 4P2RE 3JV4B 5AD0A 3GO1H 3CFDA 3A6BH 4S1QL 1SY6H 5FKAB 3S36H 3MLRH 4X99A 3VFVB 4C83B 4QXTB 2HTKD 1VFBA 1AFVH 4P99A 5I1EH 1RUML 2WLZA 4LLUB 2CH8A 4WUUE 3M1BA 1IM3B 1LD9B 2EH8H 4HXBL 3IFOB 1TVBB 1HXYB 4EZMA 5I73C 1RUMH 3BZEA 1ONQB 1YMMB 4K3JL 1XGRB 1UFUA 4U33A 5GGVH 4J2XA 5INCB 3SDCD 2XG5A 2MCPH 5CZXC 4V1DD 1JHKH 1ORQB 3OG4B 1UJ3B 2VOTA 1MCQA 3U4BH 3V4UL 3W11C 5EFIB 5K9OA 4BZYA 4U1GB 3UPCA 5AD0B 1Y6KR 2A9NH 1YJDL 2AXFB 4NC0B 4BFIB 4PRID 5SV3A 2MMXA 2X2YA 4Z7VE 1RY7B 4RIRA 1CBVH 4MWFB 3GSXB 3MLWH 4I8DA 4WW1B 1EMTL 5JW3L 1CD8A 3RTQB 3WFZA 1C08A 3RGVD 5HPMB 2BZDA 1M6OA 3TLRA 3B3IA 3C9NB 3QIBC 1X5AA 5E24E 4OQTH 5KVFL 3VFMA 2W9DH 4PJ5D 4YUEH 2G2RB 1YYML 2EXYC 1P7KA 1P9MC 3HNTL 2P5WA 3H3PH 3NIGE 3PWPD 8FABA 4LLDA 2GJ6B 3H9YA 1EJOH 3IU4L 4IRSC 2FIKB 4JREC 3V4VH 2UYLA 4OZHA 3GSWA 3WS3B 4KFZC 3UC0L 4YHMH 5GJTL 3WFEL 3MA7A 4JY4A 3ARPA 2CKNA 1J86A 4JEGB 5C2BH 4YDKL 5DHYA 4X7SL 1KEMH 3GK8H 2AGJL 5DJ8B 4PJDA 5FDYA 4E0RB 3S8WA 3V6FB 2JK5A 2COQA 5DQJA 3QH3B 4LVOB 4RMSA 2FDBP 5FGBA 2DM7A 4DZBB 5EU6D 3QXAB 4RFEA 1FIGH 3MJ9A 1TITA 1Q9WA 2PW1B 1K8DA 2P24B 4PJ8C 2DLFL 5KSUA 4MNGE 1Q9WB 4EBQL 1L0QA 4I3SL 3A67L 5F44A 2JB5L 4ZUSA 4OV5B 1X5LA 1NEZA 5B3JF 4M7LL 1I1YB 4MQXC 1RU9L 4A6YL 5DJAB 1JCKA 2X1XR 3QWOB 1KCUH 4CAGA 4YEEA 5F7DB 2ZCHH 5HYQB 2R39A 2X4QA 3QCUL 5DFTA 4WI9A 3U79A 3TBSA 4EI5A 3QUZA 1NC4A 1YPZF 3NCCB 3GNML 3P4MA 1NEUA 5HY9B 3TYGL 2NY3D 3GJFB 3SQOL 3H0TA 4XBPB 4N5UA 1MELA 1ZTXL 4K7PX 1LK2B 5LKNA 5FF6A 2VE6A 1ZHKB 7FABH 1O7SA 5DS8B 4TUJB 3RFZC 4WU5B 2P5WD 3PWPA 3C5JA 4WHCA 3TFKD 3DGGB 2VZ1A 3PQYB 3HCVA 5FA4B 4NO0A 2FJHA 5DUPH 4ZUVB 4YHYC 4IDJL 4JM2B 1QR1B 4MNHB 4MB5A 4Z0BH 1VCAA 2VDRL 3O3EA 2QJDA 2J6EL 4AY0A 3O4LA 5H94A 4FTVA 4O2EA 1RJCA 3VE0A 3L3JA 1G7HB 4MJ6A 5I66B 3LKQA 2BNRE 4PJ5E 3UTPE 4DN4H 1K8DB 3VA2C 3LS5L 5F8RC 1C08B 3TNMA 4I3SH 4OGXL 4DGIL 2ERJC 1K85A 3THML 2NCMA 1OSZA 2F8OA 1M7DA 4ZO9A 4NNYB 3QDHA 4PTTA 3L5HA 4K71B 4NNXA 4NO3A 1P2CA 3O4OB 1ITCA 4HS8L 4PJ7F 1PGRB 5DK2A 2AEPL 4HUVB 2OTWB 3WNLA 4XNQB 4C58B 2IWGA 4L8SB 4LOUD 1FYTD 4ZYKA 4HJJL 3QAZB 4TYUA 1M71A 2FR4A 3AS1A 2P43B 5TFSH 2Q8AH 2FIKA 4AJ0A 4JM4H 4M7KL 2NY4D 2CIIA 3GMPB 3Q3GA 5T1DH 3GSNA 1ONQA 4NM4H 3EHBD 4K07A 4PFEA 4IRJB 3D1MC 3GIZH 2BK8A 2LV4A 2D0FA 4L4TB 4JFEB 3C6LA 5C8JB 5E9DB 1MLCA 4LSTH 4IIQC 3MACL 2AV1B 4N8PA 3M17A 4X7CC 4N68A 4YGVB 5C0BB 4U6XB 5IFHL 3GRWA 3O2WH 4L4JA 4EI6A 4Q2ZB 1NKOA 1EXUA 1MVUB 4MMXC 2CR6A 1OF2A 3BH9A 5JIIA 3NIGF 3MRPB 3EFFB 1FC1A 3P4OA 2C3WA 3O6MH 4S1DD 5J0BA 4AH2B 3DX6A 2E6JA 4PY8I 3DBXB 1YEKH 2YA0A 4NDMB 3V0WL 5FYJU 3MROA 5H35A 3OR6A 1I3VA 5EO0A 2Y4SA 4ZNCD 1V7NH 4U31A 5MEQB 1DBJL 3O41A 4PLKC 4WUKH 4MD4B 2IAMD 4FFVC 2H32H 4MAUL 1R5WA 4YGVA 5C0BA 1C5DA 5L9DH 3X12B 2H3NA 1SYVB 1A9EB 5DQ9B 1UKTA 2Q7YA 3HLAA 4G8IB 1XF1A 1FL5B 3K8MA 3NBNA 4R7NB 3TC9A 4F9LC 1KGCE 3KPRE 3QUYA 5FM8A 2ZUVA 4YR6A 5C9JA 2NXYC 3DHJA 4RFNC 3QXUA 3X13A 4NQDA 3MRBA 4X6DF 3TNMB 4HUMB 3MRLB 1PVHA 4P23D 4WI5A 5DRWB 4WCYH 4UINL 4F7MA 2CKBA 3EYQC 3L3OB 4DZ8A 3QUYD 3HB3D 4OIIL 1HOCB 5EZIH 4ODTH 1C7SA 1NUFA 3RPIB 2UVFA 8CGTA 4X6EB 1AR2A 5EZLA 4KY1H 3QIUC 5D1QD 3MGOA 2IALA 1SY6A 2BNRA 3EIFA 3TVMC 1W0YT 1MJJA 3EYFA 1MI5A 5GGTH 5FA3A 2KZ1B 3HG1A 1AGEA 4ZSOA 5KOMC 3SGEI 5IGXL 1QSEE 5J6HB 1WZ1H 1MRCL 2VUOA 1RMFH 2BY3A 4NYLA 1CN4A 3IGAB 4P9HL 2BC4A 2ZCHL 4X83A 5TQ0H 1Z3GH 2A74A 1LWRA 3NAAH 4X0KB 5AG8A 5EOCH 3LN5B 1T0NA 1MCPL 4W4NA 2NX5D 1AXSB 3K1DA 2H9GB 1MHCA 1IARB 2DQIL 1GC1H 4FQ2H 4GLRH 2V17H 3QEQA 4JG0H 4UT7L 4DGVL 1A5FH 2O61B 1I8IB 3P9WB 3QUKB 3MRJB 1IAKB 3QJHB 5GIRA 3WO3B 4GBXD 2ZNXA 2AJ3B 3KYNA 4X9GA 1D9KB 1U3HC 2WQ8A 4XTRC 5FYKE 1W8NA 4P9HH 4U6YA 2X09A 3GB7A 4H5SA 4OCMC 5A3ID 3ZTNH 2B20A 4LVEA 3P0VL 3VFTA 2AJYH 4H1LA 1YNTA 3H0TB 4XBPA 4NO2B 2BNRB 3TPUB 1FCGA 4MSWB 2IALB 3HE6C 5C08D 1U8NA 4K94H 5KVEL 4HF5L 2Y36L 5KN5A 3EFDL 4TUJA 2NY4C 2O5XL 3KDMB 4ZSOB 3VI4E 2DIJA 4XNYH 1RZIA 3QDGB 5IF0A 4O58H 5HGAA 1BOGA 3I02B 1RZGB 4Y2DB 3WL9A 4NNPL 1A9BB 5F93C 3TWCH 1WAAF 1T7VA 3MRJA 5L0QC 1SVCP 3MRFB 2DQIH 3F7YA 2A1WH 3O8XB 1UJTA 1NAKH 1UVQB 4FZEH 3AC0A 3P73B 4OCRL 1VEMA 3CD4A 4LPVA 4OM0L 5JOPD 5DVLA 5EOCL 5E7BA 1DBKL 3R06A 2FB4H 2A9NL 2X5PA 2YN3A 2ADFH 3NIDE 3EGSA 4H20L 4WHYG 1U8OA 5C09D 1XF3B 5CJQL 3SE8H 3V5DA 1IEBB 5LWYH 5TF1H 3B9KD 3INUL 1DN0A 2P46B 2X1WL 1O7VA 3C08L 2OTUA 2Q3ZA 4YNYA 5EBWA 5CLWA 3LSOA 1SVZA 3B6SA 3VDAA 3LB6C 4L3CA 2NY5H 4U1JB 3QUML 2WINA 1INDL 5JLZB 1LP9F 4OZIE 4O51B 1I1AC 1XZ0B 1G6VK 3MROB 4XX1G 4FQXA 1F6FB 1CIDA 1WWAX 3WFCH 2EEBA 1YUHB 4KDTC 1YMMA 3S5LA 3WLBB 4QY8A 3OKLB 2C9AA 5I1EL 1N6VA 4OKVA 3UTOA 3HZVA 4Q0XL 1EIBA 3MLZH 4ODTL 5DR5H 1Q72H 4HSQA 1H5BA 4Y4FA 3U83A 2QSTA 3L5XH 3D39D 4BYHA 3OAZH 5JW4M 3C6SB 1G7IA 5BRZB 1JMXA 2R8SL 1JHTA 1H3XA 2B1HH 3F65A 4HUXB 4PYGA 5ENWB 4UOJA 3RZCD 1N8ZB 1CD9B 5ISZE 1BWMA 3CCHA 4NPYA 3C8KB 1G9ML 1FORH 3G6JE 2FNBA 2JELL 4F7TB 3LAFA 3C6LB 3BSZH 4PRBB 4P0DA 2ICWB 2IQAB 2IH1B 3JZ7A 2Z4QB 1CDIA 3RWJB 3VFUA 1A9EA 4WI6A 3TPKA 2PO6A 2I5YH 3O9WB 2AS5M 2ADIB 1BAFH 1S5HB 2VSDA 2EDDA 4LRIA 1SBSH 5D1ZD 3NACL 1ES0B 1BEYH 2A6DA 4M7ZC 3V79C 2J2ZA 4RX4D 1YJDC 4Y4KA 3QRGL 5CSBA 4OM1H 1WJ3A 2HJLB 1KGCD 3KPRD 1IFHL 4QRRB 4ACPA 4EDWH 3NFPB 3F6LA 4MMZC 4QY8B 3FB8B 4KWUA 3RNQA 4OIAA 2CDFB 1P2CB 3QXWA 3E6FB 2WP3O 4HMEA 4PJBF 4KROC 1OGAA 5GGTA 2ARJA 2BSSA 4LVOC 1OW0A 2NLJB 2FX9H 5MEOA 3KXFA 4OD2B 4JDTH 4YXHH 1AKJB 5KBNC 1LO0H 1V05A 1TETL 2E8ZA 5C0JA 1V8HA 3M07A 5DGQA 2X42A 1S5HA 1I9EA 4UTBH 4MNQD 5DLML 4YDVB 1PKQA 1TVHA 4NO5A 5GRVL 4KMQA 3L9RA 5E95B 1AQDA 1X4YA 1U0QA 1BF8A 4HC1H 1L6ZA 1DEDA 2FLBT 4DUVA 4OFPA 4F9LA 5CHNA 5SWQB 2OXGA 4NM4L 2BHZA 4TRPH 3BH8A 1MRFH 1INQA 3D85A 3QFDA 5KSBF 3LKQB 4QOKE 2EYRB 2LFGA 4IDJH 3U2SB 2ZP0T 2FD6H 3O45A 5TQ2H 2AEWA 4EUPH 4HUUA 5TE7H 4Z7OE 1BQHG 1JPFB 4P5KA 5C0AB 2CIKB 1LNUB 3NGBC 4O02L 4LKXB 5GGRA 4KH2A 1IT9H 3BPCA 3OKEA 3SE9H 1MFNA 3HPLA 4UV4H 3N1PC 2IPKA 1BPVA 4HIHB 1RUQH 1PZ5B 3NCYS 3E2HC 1D5IH 2F5BL 5HYQA 3LS5H 2VLME 2R23A 4UAOB 2J8UE 2F8XC 1UH2A 5T3ZL 4YE4L 1DBKH 1UB6B 4GH7B 3MA9L 4RQQA 1PQZB 4HPYL 4OCRH 4R90H 1CICB 3V6ZB 2A73A 2NTFB 2RHEA 4KPHH 3S96B 1N64H 1RZJL 4ZFOA 5DD1H 3SE9L 3QIUB 5L2KD 2Z31D 3DMMD 3U4AA 3LKOB 4NGHL 4N8VA 4HK0B 4JFPA 4X8XA 3DX9B 5EU5B 4ZXBC 5C0CD 5JPMA 2VQ1A 5J3HC 5ID1B 2P5EA 5CS7A 5C0EB 1RZFL 3GB7B 4G6AD 4H5SB 1T3FA 4KQ4L 1MCOH 2PXYC 5KJRH 4HJ0C 1IAKA 3BP4B 1T0PB 3EUUA 1HH9B 3B3IB 4NO2A 4LKXA 1HDMB 3W0WA 5A40E 3TO4B 4NN7C 3JWDH 1U2HA 2VLJB 1IZKA 3QG6B 4O5LL 3MNWB 3KPLB 4ISVA 3ESVF 2UYLB 5I1GL 1CL7L 1C12A 1MHPH 2PYFA 4JO2H 5FO9A 5JW4Q 3TBWA 1P7HL 4C56A 5JMOC 3MV7E 4MA1C 4U1MB 5E6ID 2XZCH 3LV3B 1RJLB 5B4MC 2NTSP 2NPLX 2DWEB 4M8VA 2X4TB 1JP5A 3GUTB 3CC5B 3ES6A 4QTHA 3NIFF 1NBYB 4RSVA 1MIMH 1EA9C 4PJIF 1JPSL 2EDRA 3ARFB 4F33A 1NC2D 3HUJE 4J3VA 4KTEL 3MRRB 3C2AL 3EAKA 5K33A 1GSMA 1NCWH 3K8KA 4K3JH 1F3DJ 2X89A 5J12C 3O41B 2EXYD 1XGYH 1X7QA 3QULA 5KG9B 5J13C 4LBEB 5INCA 4RISH 1A6ZB 3MLUL 3HNVH 3DI3B 1NGZB 2ID5A 4KMTH 1UH4A 3IU3B 3PGDA 5EZIL 3MLPA 3DETD 4FQQA 3PL6D 4CADB 6CGTA 3MO1A 5IHUL 3EFFA 4DFIA 2YEZA 3HMXL 3BDBA 1UYWL 1QLFA 1CXKA 5D93C 3X13B 2XN9E 1JF6A 2BNUB 3U0TA 3RJDA 1QOKA 1HK6A 1QZ1A 5EORH 1J1OH 4G9DB 3L3OA 5BW7C 5ADPL 3G6DL 5EOQH 3QJFA 3RY6C 4F7EA 1ND0B 2IQ9L 3BJLA 2L7JA 4NQSB 4NKOA 1GOFA 2NY7H 5GRJL 2FATH 5CD5D 2GTWB 2HVJA 5ICYB 4I18C 4XCYA 5CBEA 3VJ6A 5K9JH 4LLMB 4NQDD 1CGWA 1S9WB 3SDDB 4GKSA 1S8DB 5SWSE 5EPMA 1Q0XL 3GHBH 3BD4A 1BD2B 2X4PA 1BZ9A 1SYVA 2AJVH 3HC3H 5DQ9A 1II4E 4M5ZL 2EE6A 2FL5A 3VRIB 3MLRL 4H25A 1EUUA 2PF6A 5E70A 2I9TB 2NY7L 1KJ3L 3ARZA 3HR5B 1M71B 2FR4B 5LWYL 5CP7B 4YBHA 3EHBC 3B9DA 2NW2A 4M02A 3ZDZF 1PZUB 1MEXL 1WIOA 1EO8L 4HUVA 2P8PA 1UM6H 3O2WL 3WS6C 1EV2E 2J5LC 3AY4A 4XBGA 4QOKB 5BVPL 4CKVX 3P11H 3O6FA 3BH9B 3CVHL 3IFNL 4NNYA 3OXSB 2NNAB 5HDBE 4HWNA 1XF5A 3MV9E 1WV7T 3ROOA 1CR9H 4P2YA 1WBYA 4FXKA 4KKNA 1G7MA 3O9WC 4IEFB 1OQOA 3IDXH 1IKFH 5I8OH 4K3GA 3HI6H 3AUVA 2WANA 4XPHL 4MA7L 5ACZA 2FGWH 3T1WA 1JMZA 5FXCH 2WWKO 4PRPD 3TJHC 2I26N 5GGSY 3I9GL 3FQNB 2J88H 1BFSA 5CEZH 3TH4T 2GT9A 1G1CA 2R56H 2EIZB 4LCWB 2VLMD 1KENL 2IBZX 2DYPD 2D2OA 4HQQH 5DD3L 3ZTNL 5FHBL 3QPQD 1XF2A 3HCVB 5FA4A 5LGHL 1S7QA 2CIIB 2D9CA 4Z7QE 2ITCB 2A83A 1BQUA 1AO7B 5E1AB 3K2UL 2DBLH 3BAEH 1IGCL 4U1JA 1IAII 4XP5H 1A8JH 3GMQA 2VDOL 4JZJA 3MGTA 5KS9B 5EO9B 1D5ZB 2XY1A 1A6VL 1T04A 3MUY1 1EEUA 4HUKB 3OKMA 4HD9A 4P4KC 2XV6B 4PB9L 4PG9A 3RKDD 4NQDE 2QBWA 4B7LA 5I1AB 4RFOL 5GS3A 4I2XA 3AAZA 1BZ7B 5GGQL 4K2UH 1BGXH 1GZQB 5C0DB 1RJZA 4PGDA 2UV3A 3BW9A 4Y4HA 4NQXB 5T33L 1HHGA 4FTVE 4TVPE 1K5NA 3QCVL 4PTUA 1TXKA 5CMAB 3VRLF 1CGXA 4BFEA 4EEEA 5FYKL 4PJDF 4Z9KB 3MZGB 3T8XB 4J6RH 3BUYB 1QNZL 1WZMA 2VZOA 5F3HB 1XH3A 3S3JA 5FYLE 2GHWB 4JDZB 1ETZA 4ZS6D 4HZAA 5FUZH 3QI9C 4OCNC 4WO4C 4HT1H 4GW4A 4YFLI 1A3LH 3WS3A 3CFCL 3GNMH 3K3QA 5JXED 4NIKB 1A7RL 3QT2A 4ZS7L 3NABL 1AGEB 5GSVA 1NGWB 5F72S 4NC1C 2UZIH 2LAAA 4LMQI 2VSCA 4GAGH 4YHOL 4NZRH 4H1LG 3F6IA 3PQYD 3KWWB 5AAWA 4AMKL 2BOCB 1A6WL 5A2JH 5DMJB 5L7XH 3WFHB 3VA6A 1RUQL 5IESH 5LAXA 4G6ML 5BS0E 3MCKA 3BMWA 1HCVA 4NKQB 1M7IA 3OXRA 4R0LC 4MD5B 5KZCB 4ENED 2AJXL 3EO9H 4HXAH 4E41E 1EEYB 3RY4A 2CLZB 4HX1B 3RY5A 3T08A 5L8LB 1CDHA 3PWNA 3VU2A 4JN2A 1T1WA 1T1YA 1YN6A 3JXAA 4YDKH 2RJMA 5JW4N 3WXVH 5E5RB 5KS9F 1KENH 4XP4H 4RMTA 3AREA 5JPNB 5I18L 5FA3B 3UC0H 2FECI 2CDFA 3RDTD 1D5BA 4PV8A 5C0FA 2I9LB 1R5WB 3NH7L 3QI9B 4WO4B 3TZVC 2ZUWA 4NFCA 5C6TL 1YEHL 2VXUL 4XVJH 1KLUA 4LEOB 4EQ2A 4GW5B 3LMJH 5C0GA 3O45B 5DWUH 5DJ6B 3CDGA 4LLDB 3UBXG 3O6KH 4JHWH 2G75A 3LH2H 4HFWA 1Q1JL 4RBPH 4ZOEA 1EAPA 3RVTC 1R6VA 4JDTL 4YXHL 4BKLA 3LN9A 1UG9A 2KBGA 3ILQC 4Z7VA 5EFIA 3QUMB 1FFNA 4PJEB 2I07B 2X40A 1HILA 5AWNH 3T2PA 4LP4A 4ORGA 1DQLH 4P46B 5HYJD 1FSKC 5EUKA 1GGYA 4TNWK 5CJOL 4Y19B 2Q86B 2MCPL 5C71A 4F7EB 5HVWA 3UMTA 2PYEE 3AFLA 1MCHA 1U8JA 3MRIB 2VISB 5I8EA 3KXFB 1KJ2B 1CFSA 5GGRY 1K8IB 5HGHA 3V8OA 3PQYE 3DURB 3S36L 5FV2A 1YUHA 4IRJC 5T5NG 5DF0A 2Z92B 5D5ME 5E8EA 5IQ9A 4KKCD 4DKEH 5BS0D 2IQ9H 1FORL 3QAZC 1OAZL 5B22A 2FJGA 2WINB 1AE6H 1OTUC 5FOBB 2UZIL 2EDQA 1QSEA 4RMVA 1WSST 4HGMA 5TPWH 4TSBH 3ARSA 4BJLA 3O9WA 1MI5E 4FOMA 3ARFA 4NJAH 4GBXA 3OKNB 4NQCB 2XRAH 2OR7A 5DUMH 5IIEB 2A77H 2Z8RA 1J12A 1MJUH 2M2DA 4Z7UE 1OVZA 3MLZL 1MPAH 3BD3A 1OSZB 2CK2A 4HG4J 5LAXB 5J06A 3WS6A 4D94A 5JHDD 3V4PL 3MRFA 9CGTA 4FRWA 2HFTA 3ULVC 1QFUH 1KG0A 1R24B 4LGSB 5HVGB 4JO3L 3SKJH 1C12B 4GLRI 1A6TB 4W70A 5D2LF 4XPGL 1G7JB 2FO4A 5MI0B 3TYGH 4U1KA 4G8FB 3CSYB 4PRHE 3CAFA 1FLTX 3ECBB 5HHXL 3VXMD 2MQ3A 4KROD 4ZFZB 3REWA 2ATKA 2AJUL 1N0LA 5FO8A 2K1MA 2H32A 3FJTA 2R4SL 4C4KT 1TNNA 1OD7A 2QHLA 3DO3A 5DWUL 2NX5E 1ZLUK 5EU5A 4XP6L 1IM9B 4P5MA 4KZDH 4OLZH 3V5DB 3E3QC 4N1HB 3EGSB 5GISH 1K6QH 3MX0A 3ULVD 3G08A 2FBJH 2K9UA 3GK8L 5I76B 4K94L 1QLEL 5HTSA 3DXAE 3G08B 1CYGA 1BX2A 1F6AB 2ESVA 5ICXA 1JRHH 1NEZB 1RVFH 1JF5A 2R29L 1NCDH 4NRZA 3S3PA 4GS7C 2R0LL 2IANB 3ARFC 5GJTH 3QIWA 3SDAA 4QRPB 3HUJB 5ACMA 1BVKA 1NGYB 5FYJH 1N59B 4M1GL 5MHSD 1AD0B 2H32B 5DHXB 2R23B 4UT6H 3D39E 1KNOA 4DW2H 3EJYD 5DJCA 2XZZA 3QO0A 2NY1C 4U6HB 1XF2B 1T89C 4LFHG 2HMID 4ZAKA 3S3SA 3GFUA 2ICEB 3ULUC 2BRQA 4P23C 1KN4H 4JY4B 3FKUS 5DK3A 3RX7A 4YE4H 4GAGL 4YHOH 4W81A 2M8XA 2CLVB 4LHUD 3NZ8B 3SY0B 1J10A 3IFLH 5DZOA 1D9KA 5EBLB 2AXGB 2RBLA 2CRMA 3OHXB 4ZD3L 3V4UH 4X9HA 1SYSA 3O0RH 2E7LC 2O61A 1A3LL 4YDJB 1FE8H 4DUWA 2FECL 3OX8A 1IT9L 3JV5A 1LE9B 3MRQB 3U0PB 1MHCB 3P4LA 1UWGL 3VGHA 4TTDC 1V3MA 1CXFA 1DEEB 5HHNA 2VLKB 2VC2L 4DAGH 1UEYA 1AFVL 4Z0XB 1S9XA 5TH2B 3S4SG 1P1ZA 1OTTC 1CZ8H 1F4XH 1YN7A 5TDNA 3GSOB 1FPTL 3HZMA 1IRAY 5T3ZD 1SEQH 4HKZA 4KV5E 2A6JA 4OZFB 1ZGLB 4DVBB 5TPWL 3E6FA 5J89A 4LSVH 4Q58C 4N0FA 3VXNA 5E4EC 5DJXB 4D8PB 3VFMB 5HHPB 5A2FA 2OZ4L 1INEH 5T3XH 3IFOA 3QPXL 1QA9B 1MFCL 4QYOA 2VR9A 1MJ7L 3DVNB 2YZ8A 4QRPE 1U8MA 1OB1B 4WIQA 3LQZB 5DYOB 1OLZA 4RAUA 2OR8A 4ZQKA 4PY8J 5DFWH 1GGIL 3HFML 4TSCL 4LQFL 3L9RB 2DKUA 2B1AH 2DBLL 3L3GB 1PLGH 1MWAA 5DRZB 2E8YA 4MVBD 4N0CC 2R69L 4Y1AB 1GGCL 4H8WC 5B4MD 3KPSB 3CVIH 1L9MA 5MP6H 3OKDB 3MJ9L 3T4YA 1QRNB 1I1AB 2XN9B 3QQ4A 3L7EB 4S10A 1MQ8A 4Y4HD 4FFWD 3CH1B 2J88L 3CVIL 4JG1L 3TEUA 4MA7H 1NDGA 3WE6A 4NOBA 4YK4B 1L7IL 4LOUC 3ZSSA 1NJ9B 1A14L 2ITDB 3FQUA 3SKNB 5F71A 4Y4KB 1FYTB 2Q6WA 2QLVB 4QXTA 4XAWH 2A2QT 4OFDA 1JGEA 2GUOA 3F7VB 4NRYB 3DETC 3KPRB 2I9LA 3RIFK 1OAKL 2PXYD 2YPLE 4XNQA 1NBVH 5D1XD 3QQ3B 1BHGA 3VD4A 2C3GA 3CJJA 5HGGS 3S7GA 4PRBA 1KTLA 4NP4L 2ARJQ 4O4YH 5IB1A 3QDAA 5HGDB 4PJ7B 3TYFA 1GGBH 4GQ9H 5ENWA 2PW2A 2Z9TA 3EW3B 5EC2B 3RX8A 4Y4HC 4G9DA 1NFIB 5I75B 1FFPB 2YPKA 5IK3B 3ARWA 4NHCL 1KC5L 3SN6N 3O4LB 4Z77A 3T2NH 1MF2L 3B9VA 1OW0C 3RA7H 1S7WA 3UTTE 1D7FA 4DEPC 3JWDC 1CFNA 2C1PA 2E6PA 2VLKE 2MPAH 4K7PL 5K9JL 4BK5A 1RZJH 3QO0B 4JZJC 3UZQA 3T0VA 3RUGE 4F9PC 5SWZB 5DRNA 5L7XL 1WTLA 2DQUL 1JUFB 4U1SA 4XPBL 3GMNA 1A1NB 2CO7B 2OQJB 1B0WA 5F1OB 1T1WB 2VLRD 5ISZB 3LKPB 4LRIC 3MBEC 1T7YA 3UJJH 4J3TA 3MV9D 3T65B 1G9MC 4FQHA 5D9SB 4TUKL 2P8LA 1OM3H 4KU1A 5D7KD 4NC2B 3VXSD 3V8CA 3CDFA 1S7RB 3OJ2C 2CXGA 4DKFH 5EB9A 4EIGB 4YXLH 1WAAA 2A0LD 5FUOH 3WHXA 1CLYH 2A73B 3D2UA 1NSNL 2DDQH 1KYOJ 3HNVL 3MRQA 4UTAH 4MDJA 5LGKA 5M7QA 3KVQA 1U6AH 2F74A 4IJ3B 1MQKL 1G6RB 2PW1A 4MXQD 1OCWL 4JAMB 4F7PA 4YHIA 3SBWA 2HFEB 1X3DA 3IETB 1IL1A 1PG7X 3BPNC 3R1GL 5FGRA 4LRNH 4JFQB 1H5BC 1HHHA 4PPTA 3RVVC 3OZ9L 1LDPH 3ALWA 3U4EA 1MCNA 4G42A 3QIBB 4PJFB 2LABA 5EO9A 1WICA 5INDB 1K6QL 3S35X 3VMPA 4G42B 2F58L 4ZODA 4FQXC 3VXUB 3FFCD 2J7LA 4G80B 1G7LB 1JPGA 2JB5H 4I0CC 1EGJA 3IXTB 1IEHA 3UBXA 4XB8A 1A64A 2VAAB 4HPOH 1ZA6A 4EKXA 2EYTB 2XTJB 3AS0A 4F7PB 1F4AA 2X70B 1P6FA 3VFSA 3WIHH 2IANA 3IDYB 2C3XA 4XHJD 3LKOA 3PHQB 1PFCA 4GRMB 5AYQA 5DJ0B 3MV7D 3OTTA 5ICZA 3FB6A 4QNPE 5KSAC 4AENB 2DWDB 4IHOB 1RZFH 3OB8A 4RQQB 5ITFA 2A6KB 3OGCB 1BZQK 1FG2B 1SQ2N 3H2WA 1KTLB 1TJIL 2NNAA 4M3KB 4NKIH 4D0DB 2E3VA 1CCZA 1XCQA 1F45A 3VXPA 4KUZH 4BH8B 1YDPA 2KUTA 2XQBH 1CLOL 3DARA 4OIIH 1CFNB 2C1PB 4JFDB 3IDGA 1OM3L 5ERWA 1SMAA 3FQNA 1OPGH 4QHUB 1J5OL 1NANH 3NN8A 5T3ZH 1IBGH 3W9DB 2B5IC 1N0XH 3QNYB 2Q76B 4GAFB 2GAZA 4GKOA 3W9EB 5M94B 2XNAA 1TZHA 1WBYB 3PL6B 4ODSH 4KKLD 2Q8BL 1CGSH 2WUCH 3H9SB 3MFGB 4NZUL 3BMVA 3BZ4A 3O8XD 1JBJA 4O2FB 5L9DL 2V2TB 3D0VB 5IB3B 3KJ4C 1GIGL 4X6CA 1ZLVH 4YXKL 1TJHL 4KUCD 1E6JH 4JQXC 1KIQA 2GTWA 3C8KA 4I1NB 2EH8L 2QADB 3HI1A 1ND0A 1E6JL 2H3NB 2GIYA 1B4RA 3B9KC 1T6WA 3CFEA 4X80L 3JBG7 1XIWD 1AH1A 4KVCH 5CEYA 4H25B 3QNXA 4G6KL 5A2KH 1NPUA 4RCAA 1TZIA 3ZL4H 4H20H 2BVPA 2W59A 3GHEH 3HZVB 1OGAD 1HE7A 4UNUA 3W9EA 4G6JL 3FB7B 1OPGL 4AH2A 1G7QA 1OAYH 3HC4H 2X10A 5EIIB 2RGSA 5IFAH 1K4DB 1Y6NR 2ORBH 4TVSa 3BESR 43C9B 1WIPA 4I13B 2XN9A 3RZWA 2YMXL 5IHUH 4A2MA 5D4QA 5E6IA 4ZFFA 3FN3A 2OL3L 4RX4A 5DHVB 4U0RC 4ZPVB 5EZOH 5ETUB 1UXSA 3JTSA 4OCSL 3VG9B 2OSLA 4R2GC 3QJFB 4NNXB 4N0UB 4ODHH 1RI8A 5E8OB 1YZZA 1DBAH 4BQ8A 4JHAH 1Y18B 5IB3A 1FFNB 4PJEA 2FX7L 3SOBL 1YMHA 4GUPA 4FXGA 4BUGA 2OX5A 2VXQH 3F7YB 3UTSE 4C56B 2VR4A 2PETA 1EAPB 2W38A 1BEYL 4KJYB 1J88A 4I0KA 3HHRB 4M93C 1SBSL 4O2EB 4ZG1A 4UQ3A 5MENB 4WDIA 2AV7B 1GVIA 1ZE3C 1J8KA 2VH5L 5F97E 4TSCH 4PUBL 2DQJH 4XGZB 2OYPA 1T20B 4OUUA 1NFDF 4HBCH 3SCMD 5INDA 5JXAL 1JF1A 2FJHB 2DYPB 4V2BA 4YHNB 3MBED 2X41A 2VLKA 1FVDB 1ZWIB 2W9EH 1HHHB 4LSPL 4JFQA 1P4IH 4IBLT 4YHLL 4OB5L 2GCYA 3U0PA 3WJLC 3KYNB 4JFED 5CIPB 2N56A 3G9AB 3T77A 5T5FH 5DK0A 2JCCA 1YC7A 5BQ7B 3O3UN 1EEYA 1DLHB 1MWAH 1UKSA 2HA1A 4MD5A 3HE7A 5JDSB 1HHJA 1W72A 5ICZB 2HVKA 4XMKL 2VZVA 4YHPB 3RIFF 4OV5A 2BFVL 3RL2A 2AJSH 1U95A 3ZDXE 4PRIB 2RB8A 1QYGL 2ICEA 2ED9A 4P3CH 1AD9B 4QRSB 2JJTA 2YUXA 1EZVY 5DD1L 3MUZ1 5IJVB 5CAYB 3D5OF 4M93B 1BOGB 3I02A 4Y2DA 4KXZI 3ARRA 1FNLA 3QH3A 1LEIA 5D2LB 1F8TL 1OTSC 1T1ZB 3GSRB 4OLYH 2XI9A 4PJ5B 3D85D 1ZHKA 4E5XA 3FMGL 5ID1A 5JW4R 3HPLB 3D9AL 2VERN 4JDZA 3FONB 5IP4A 4TQEH 2QV2A 4RDQG 5DT1H 4JPKH 4OLVL 1F11B 4QCIB 3TO2B 3HS0A 3IJHA 2EIEA 1A6VH 3ZKSD 1BX2B 3LEXA 5HJ3B 1R3KB 5L8KB 3QWOA 3S35H 4F3FB 3VGAC 1L9NA 1T0MA 1IQDA 3KPOB 5B39G 1ZAGA 4KVNH 3UTSD 4WI2A 3G5ZA 2AJ3A 1A3RL 1UA6L 4WI4A 4OLWH 3OB0K 1G7MB 4BFBD 2Y36H 2I60L 1A7PH 1KJ2L 1YMHB 4NWUH 4I77H 1EPFA 1ZLSL 5D70L 5JR1H 1OT1A 3BKYH 1LO4L 1IJ9A 1QBAA 4QOKA 2NY6D 4OCYH 4ALAL 2APXA 4KK5D 4KRPB 2VZUA 1CQKA 3LQAC 3MXWH 1DANU 3ZKQD 4X5WB 5JORA 5L6YL 3VH8A 1AQKH 4M1DL 4FQPA 1A1MB 5IFHH 3MLTB 4WTZA 4BUHA 1EFQA 3VRIA 5JA9A 3DTXA 3V2AR 3B9EA 2WZPD 3QFDB 2W0FA 3F7QA 1X5XA 4WGWB 3BVNB 4X7TA 5CKGA 1UZ6E 4I5BA 3QUZC 5CEYB 4MVBC 4N0CD 3I75A 4HKXA 4PR5B 2OI9B 4A6YA 1S78D 4HV8A 1JWSB 4W6WB 1FAKT 1HSBA 3HI5H 5FECA 1JI2A 5IGXH 3GSVA 3CLEH 5DRWA 1HSBB 3T1FA 3OGOE 1MLCB 5DJDA 4LCUB 3NTCH 1TDQA 1CVRA 5E6IB 4HWEL 3U0WL 1I8KA 2R2BA 4PP2A 4S1SH 5DMIL 1TJHH 3BGMB 3VFPB 5CGTA 5FEBA 1TZHB 3QEQD 4CADA 3ZKXC 5IEKA 1B0RA 3GSNB 2Y9RT 1XGTA 4IRSD 4G3YL 3VGBA 1G9MH 3S97C 2B2XH 1AGCB 1DE4B 2IAMA 1KUMA 43CAB 1YEGL 2ZJSL 5IBLC 4X99B 3PF2A 3VFVA 2J6EA 1D6VH 5FGCE 1P9MA 4PJHB 1AHWB 3QDGD 1FL6B 4Y2DD 1RIVL 1G9NC 2VKXA 3HMXH 1AGDB 4OV6F 3ARED 2J6EH 2UUDH 3QP3A 4LPCA 3DGCR 5GHWL 3UAJC 1XR9B 3DRQB 1FQ9C 1HILB 4FXLA 4HKZB 4OZFA 1GC1C 4KKAD 3GMMA 3L1OH 1S9XB 3BWAA 1KIPA 1YMME 1IZJA 1DN0B 2CJUL 2QSCH 4FZ8H 4NUGL 4S0TD 5E8NB 2WWMC 1CK0H 2VDMH 4ODVL 4IM8A 4ELME 1KJMA 5I1CH 4JB9L 1PEWA 3O6ML 2ZOLB 4MZ3A 4P2RB 1IGTB 2L4OA 1EVUA 5D7LA 1AC6A 3BRFA 3G5VA 2RCSH 5CZKA 2ATPB 5LBSH 2FEDC 4QWWC 3SJVB 1EHAA 3DECA 1NEZG 3GSNL 1T1XB 1A1MA 2EDNA 4F9PA 1T1YB 2JB6A 4XNZC 5F1SA 3V6BR 4FG6D 3KR3H 2H1PH 4HK0A 4JFPB 3O2DH 4L8SA 4GMSH 5C07A 4LFHD 3TT3H 3G6AB 4G8GA 3GSRA 3VGGA 5A2IH 3TCXA 1ZT1B 5D2LA 4FN0A 3GRWL 7CGTA 3QFJA 2CUHA 4BSWA 4R2GD 1CTNA 2HFGH 4OKDA 4AQOA 1LO4H 1Z5LB 2YD5A 1LVEA 1RZKH 5IV2B 2DD8L 4NQTA 4MNQE 5GSRA 3GMOA 1MIEH 3H3PL 4QHMB 3VWKB 1F2QA 2VDKL 3HG1D 3UBXB 4YUEL 5FKPA 1R3LA 1QFWH 1IAIM 3VFGH 5DJ8A 2AXHA 3C60A 3ARDB 3DYOA 2X44D 4L8BA 5EUOE 3T65A 2F54E 3Q2CA 2H6PB 5F9JB 3PIQA 4R90L 2Z91A 4QRPD 4OLVH 4N8CL 3GSNH 4G9FD 3BRGC 1DQJA 1WEJL 1CD1A 2FZ3A 3ZE0E 3ARVA 4H88H 3U4BL 3EYUL 4AIOA 2DYPA 4OZHE 1UGNA 2EEAA 3C60C 2P5WE 4V1DB 3RHWF 1T5XB 1GZQA 2WUBL 2CKBL 5C0DA 4HEME 4UQ3B 2BFVH 2BXZA 4PS4L 5DEGA 4OF3A 3T2NL 3MBXL 1DQDH 4CBPA 5TQ2L 4WFGD 4HAFA 5ECJE 5C0AE 3ARGB 2APVA 4AEHL 4R9HA 2YC1A 2X1PA 4YXLL 1SY6L 3K4DA 3VG0L 2V9TA 1YEJH 3K4AA 3WFBH 3RTQD 1OLLA 1A1NA 4MJID 2JCCF 1NMBL 2BSSB 5DC0A 4OFVA 3F12B 3CFJB 5IIEA 2DICA 5J4MA 1HSAA 2L7UA 5TF0A 2XWTB 2FJFA 4UOW1 3T4AB 1VENA 5JHLL 4LHUA 4K7FB 4OD3L 1RURL 3P30L 5C0CE 2DI8A 5TJWK 5JMRA 2C1OA 4MD4A 3OKKA 2BJML 1FLRH 5BV7C 4W68A 4XRCA 3OR6B 2C7UB 1TJGH 3CFEB 1FNEB 4QTIH 2Y5EA 5E8EB 4GRLA 3UYRL 2AKRA 2QHRH 4QO1A 2CKBB 4HWUA 3O3BA 1K9TA 3JVGC 4NJ9H 2BVPB 5EIVA 3F58H 3PDDA 4P23B 1S8DA 5HGDA 3MRBB 5EU6B 3FT3A 3KPQB 1X5IA 4N5ED 1ZKAA 2DM2A 2R1YB 3FZUD 3W11D 2EYSA 1UM5L 4RFNB 3QUYB 4OLEA 3FN0H 1VERA 2HKFH 4OZGF 3DROA 3NZHL 1P5UA 1MWAB 5DRZA 3I6LE 5E8NA 5KTEL 3M17B 2DTML 1UZ8B 1G9NL 3WLWD 1AJ7L 1I9JH 1QLRB 3TM6A 2HT4C 4I2XE 2B1AL 3CLFL 4QHNA 1JFQH 1QLFB 1OAKH 4JY6B 5HI4C 5K9KA 2MKWA 2FEDD 3IDUA 1D6EB 2XNAB 1F02I 3LMJL 1T22A 1HWHB 1BZ9B 4BH8A 3JWOC 3CLFH 1KPRA 3Q5YA 4OD3H 2WBKA 1UM6L 1K8IA 1YA5A 5C0GB 5FYJD 1FDLL 4TSAH 3PV6B 2DKSA 2IAMC 4FG6C 2ZUQB 1BBJB 3OKKB 4G6KH 3LOWA 3QQ9D 4JM2D 3QB7C 1PSKH 4PV8B 4YBQD 3DX8B 3ES6B 5D7LE 4IMLB 4MJ2A 4HKXB 4DOHE 3VXRB 4JZNA 4JFEA 1JGVH 1Q0XH 1WFOA 4EN3B 4FFWC 1HWGB 3G5YA 1K2DA 3ARTA 4PJ8A 3RNKB 4XMPL 1LO2L 3IRPX 1UACL 3PGFL 1JV5A 2AXGA 3OHXA 5B21A 3KPOA 5DVMA 2VDLL 3THMH 1QO3A 5DJ0A 4Y5YC 3FQWB 2A6JB 3VXUA 1JGUL 4CU7A 4NKMB 4YO0A 2C1OB 2EDLA 4X6BB 5JW5A 2NW3A 4LLAA 1BECA 4LSVL 1HINH 1BIIA 4LCIL 1F8TH 4ZAKB 3STLA 4LF3A 5HHPA 1KN4L 2AK4B 1E28A 5F3BA 3AGVA 1E6OL 3CFCH 4CVUA 3LQAL 2AW2A 1BM3L 2JJVA 3A6CH 1KEGH 4PJFE 2DIBA 3WUWB 1CDCA 4WU5A 1U8QB 1V5JA 2NY4B 3SGEH 2YHGA 5AZ2L 3MCG1 3H9ZA 5FYLL 3IAGC 4TNWF 5HYEA 4X7EC 1NCBL 1W0VB 2ZSWB 4CRPA 4OSUH 2ZCLH 4GSDH 3KYOA 3KNBA 5HHOD 3CFBB 3W39A 3RBGA 2CKBH 3C2AH 1OQXA 4KJQD 5FYKH 4QXUL 1KSRA 4NQCD 2EIDA 2PCPA 2WSKA 1FRGH 2J4WL 3P0VH 5CJ8A 5J1AA 1JVKA 2D31A 1IL1B 2EDFA 5CEZE 1FZJB 4OJFH 1KXVC 1TZGL 1PG7L 4H88L 3RVWD 3SDDD 3KWWA 3TZVD 1E4XH 3W81A 3MZTA 1D5MA 4GMSL 5D7IA 5D1XA 4BSWB 4LSSH 2JLLA 2PYEB 2CPCA 2E9JA 4KKBC 2G5BA 3V6FA 4JQIH 3OKMB 4MNGA 3SPVA 2YPVH 3BHBB 3ROLB 1UC6A 4LSSL 2Y6SC 3PGCB 5D7LD 3VXMB 4F7CB 3LS4H 5TQ0L 2CRZA 2FH6A 3X14A 4R26L 3P2TA 4NM8L 3VWKA 5KJRL 2C3HA 5ACZB 1JNNL 5CBAB 2WLYA 1CICA 1RZKC 3HUJA 5DMGC 1RSFA 1G6RA 2ZCKH 5FGCB 3DVGB 5C0CA 4U1NA 3NOIA 5HI5D 2PNDA 3RTQA 1IM9D 1VKXA 4OSUL 5ICXB 1DN2A 1QFWI 1Q0YL 3IDXL 3HB3C 4OLZL 4Z8FL 3FO2B 1ADQA 3FQRB 4F8TA 3KYAA 1WLHA 4D9QE 3F7PC 4PJXA 2H41A 2HG5B 1N64L 2JCCB 4LCWD 1VADB 1CBVL 1KPVA 4PJ7A 5HDQH 5C0AA 3RVUD 1HIML 1K4CB 1ORQA 2VWEE 5D1QB 3MNZA 1X44A 2Q6WB 3PG2A 5J56B 5GXBB 3RQ3A 1B2WH 2BVEA 3SKOA 2UY6A 1BQLH 2GK0A 1T2QL 5BVJB 5F7EL 3SDCB 4XC1L 3WKML 4LLWB 1WCQA 4ZO7A 4Y5VC 4JO3H 3SKJL 3IDNB 4P2CG 1A6UH 4WFHD 5DVNA 1HI6A 1DUZB 1MSPA 5DJYB 4PJCB 1QFHA 4ZFOL 2EDYA 4GO6B 4R3SA 4S1SL 1LEKA 1I85A 3DUUA 3WDIA 4GG6F 3RVUC 5IBTH 2MQCA 2YD7A 3WO4B 3ZTJH 4R0LA 1CTOA 4ZO6A 1U2CA 3BFOA 1JZ4A 2HJFB 4PRHB 3MV8D 3RGVB 4QT5B 1J1XL 1NBZA 1A7OH 4YHZL 1R0AL 5IQ9B 5F7LB 4XPFL 1TMCB 4POZD 3LKNB 3T3MF 2W0FB 5EH1A 5GJSH 3PGDB 3VXQB 2ADGB 4CMHB 4KZEL 5HGBA 1MRDH 2G75B 3BIKA 5IR1A 1A6ZA 1G0XA 2W60B 3MLXH 1KCKA 1ERNA 4J4PA 1H8NA 5I8EB 4C83A 1X6NA 2W60A 4WFFD 1G0DA 3HKFA 4MZ2A 3SHSA 5F1IA 2BNRD 4YDLC 1OWRM 5I8CA 1NMAL 2DQEH 3H42H 3OKLA 1I9IH 4YPJA 3DTXB 3VD7A 1HSAB 1BFOA 4FFZL 3U0WH 2IPUG 1WF5A 2Z4QA 1MY5A 1NCWL 1ZEAL 3M8OH 4EQ3A 4J23A 1ZGLA 2R2BB 4XI5D 5JUEL 2F19L 3FTGB 3CLEL 4EI5D 4CN4A 4U1MA 1ZHNB 2QADC 1JNNH 3BKYL 3B9KA 3ZMRA 2EC9U 4GRWB 4XVSH 1XF3A 2OCFD 5DD5H 4R26H 1MCCA 2CMRH 3PL6C 1OP5K 3ULUL 4L9LC 3PDOA 5C92A 4Q9CA 2VL5B 4OLWL 1H15B 3GKZA 2RQ8A 2ZUTA 1R3KA 4ISVB 4X6CB 5D71H 4P4KA 2WBJD 3HFMH 4QHKI 3DSNA 4LKCA 3P4NA 3V6OA 2VABA 3O8XA 4TUOA 3EOTH 1FZMB 3QEGL 5C0FB 3B8SA 3WLBA 3FL7A 4P59H 4IOIB 3Q5TA 4J12A 2CK0H 5ANMA 5T1LD 1A4KB 5BS0A 3QXTA 2V9RA 4DFHA 1P69B 5BZWA 2P5ED 4EUPA 5IMKA 3B5GA 5D1QA 3GSUB 3NABH 4GKZA 3RX5A 3CUPB 3V5HB 1TZGH 3FO9A 4YNYB 5EBWB 1JGLL 1MCBA 4CVWA 5TH2A 2NY1D 4HEPG 2J4WH 1WT5C 3TFKC 2CLZA 4HX1A 4JKKA 4NZJA 4I9WD 5DK2B 3TO4C 3C60B 5IB4B 1KXQE 2GQHA 2XKSA 4Q6IB 1S7XA 1DANT 5DQDL 4NWUL 2G5BB 4OTXL 3Q0HA 2AJSL 1MQKH 3ZDYF 2PTVA 4KTDL 3ULSA 4J6RL 4PY7A 1VSCA 2W65B 3K81A 5DA0B 5BRZD 4ESKA 4PJXF 4KVNL 2YC1B 1N6QL 1GOHA 5ITFB 5I17A 3TBWB 1KXTB 4MDJB 5CGYD 2EZ0D 3ARFD 5GRXG 1CD1B 4HPYH 3AU1A 1DL7L 5I76A 4XNMA 4HGKC 3S96A 3IVKB 3AY4C 1NL0H 5HYSB 3NIDF 4AEFA 3IJHB 1F90H 1NAML 3Q1SL 5C07B 2CRIA 1RJYA 3WMSA 1ZOXA 5J3HD 3S5LG 3TCLB 1PAMA 4XNUL 2CIKA 3BPLB 2BSTA 1FVCA 1OTUD 4OLXL 3CX5J 4WDIB 1LO2H 5BS0B 5F88B 4LPTA 4ZTPH 5C0EA 1FVCB 2IPKB 1CXEA 1EAJA 2O5XH 1IILE 3C2SA 4PD4J 1RHFA 3RWHB 1BOYA 1YYLH 4R8WL 4J3SA 3RL2B 5E9DD 2H2PC 4LARL 1AKJD 4U1KB 3TJEH 4C4KO 4DCQA 4PB0L 4RGOH 3ILQD 2Z31A 2AAVA 2GJZB 3B2UD 3GI8H 4I18A 5TE6H 1NFDE 2UWEB 5SX5H 4JRXE 4CU6A 4Z7OF 5M95B 4BSJA 4WU7B 3B43A 3N85H 5SX5K 4L4TE 4L3EE 1UJ3A 4OD2A 2CK0L 2BHUA 1Y18A 1T1XA 2H1PL 1HH6B 4KV5F 1ADQH 1U8QA 2DQDH 1FL3A 3QEGH 5F9DC 5J7CC 2F53B 2EICA 2OK0L 4G6AC 4NQCA 1WT5A 3ZZ1A 3FB7A 1JFQL 5DGRA 2BSED 1WFNA 3WDJA 1S5IH 5DO2D 4XC3H 5LJYH 3SE3C 4DKAA 1EO5A 4KROB 3HMWL 3VFRB 2RCSL 4KK8D 3V52H 1ZGLM 5D7JB 5DURB 2I9TA 4Z77B 1A4KA 1NBQA 5KSBA 3FRUB 1K4DA 4EDWL 1PEZA 2HT3D 3MRMA 3NZHH 1OAUL 1Z6JT 1HYRC 2EYRA 2VLJE 2ADGA 3FB8A 3FN0L 4HLZG 5I73B 4MS8C 5C2UB 3MMEA 4TVPH 5CEZL 2XZAH 3O8XC 5E08H 3O4LE 5CWSA 2MWCA 1DBAL 3E8UH 3RIAF 2IPTH 3VGDA 4M7LT 4NN6B 2O26U 1A0QL 2BP3A 5E6YA 4RWYH 3OXSA 2P8MB 3H9SA 3PL6A 4FNLH 4YX2L 4L8CB 1IQWH 2IFFH 3U7AA 3O3DA 4POUB 4JFXB 2GTZA 5SWSA 3BSZL 1JPST 2PW2B 1FLRL 1AY1L 2XYCA 5MEPB 3UYOD 1DUZA 25C8L 4XAKE 5L2KB 3DMMB 4PGBA 3RGHA 3HUJF 2DB8A 1IGMH 5JOEA 2F15A 1AE6L 5IW6A 1FHGA 1TNMA 25C8H 1FH5H 3WHE1 3QZWG 3GMPA 4Z5RA 3MRKB 2PXYA 2QQKL 5E2TL 1WK0A 4WRLA 4X9IA 5D6DA 4IRSB 5HDBF 1NC4D 4Q0XH 5C0IB 4Z7WF 3QULB 4U7MA 1FYTA 1MCWM 3EO0B 3DX7B 3B6SB 2Q1EA 3KPSA 5FOJA 1T4KA 3WFCL 4K9EH 3BISA 1FFRA 4U6XA 3S36X 4RWYL 1J7VR 4ZXBA 2GTZB 2H2SD 5SWSB 3NFSL 1UWGH 4P3DB 4JN1H 4WY7H 3RWJA 2F8VA 2FH8A 2BNQD 3VFPA 1SJHA 3I6LD 4P46A 3SE4C 1QBLL 3HI5L 3I75B 1I8KB 4PP2B 1RJLA 3O0RL 2DQGH 5EU6A 3C8HA 3U48A 4LLQB 4UT9H 1N0XL 1ZHBB 1QSFB 3R0NA 2AABH 4L8DB 3RZCA 1D9KD 1A9BA 3K8LA 4HIJB 1LEKB 1S5IL 4HIEA 4EJ1C 2EDJA 2JJUA 3AROA 1WIUA 1CFBA 2DQTL 2N7BA 2OBGA 4PG2C 5IUSA 2YBRA 4QYOB 4WTXA 3BP6A 3PGCA 1EBPA 5A3IC 1CE6B 1FV1B 1I8LA 4MX7A 3FONA 4P5TD 4XNYL 2CSPA 2HWZL 4HH9A 1ZA6B 1XGYL 1QFOA 5GSVB 5JXEC 1D3CA 3C5JB 2BVTA 1FL3B 1T3FB 3FN9A 4OZFH 1RUPH 1MCOL 4PJXE 4Z7UF 1RHHA 3W0WE 5B38G 5JO5A 3VFOB 4WFGE 1YN7B 3V9FA 3E6HA 4I4WB 3TIDA 4YZFF 1JRHL 1RVFL 2Z8SA 4NM8H 2FWOA 1CDJA 2IPUK 5AYUL 1IAOA 4JGMA 4YBQC 1M7IB 3OXRB 1AXTH 2VO5A 4H8WH 3X11A 4JRWA 4MQ7A 4FTVB 3WJJA 3CU7A 4YAQA 5GS1A 2ZZUT 5I1AA 5A2LH 5I2IB 3WIHL 4CDHA 5SV4A 1X5GA 2AEQL 2I27N 3PP3K 5KSAB 1DLHA 1QVOB 4FQ2L 5IM7A 3S4SA 1NUDA 2E7LA 1A02N 2R4RL 2X70A 2EE2A 1ZLUH 1CL7H 3BW9B 4Y4HB 4U6HA 4Z78B 3I6KB 1FN4A 2EE3A 2G9HB 3GMQB 1LE5A 1M4KA 4J3XA 3C87A 3QDGA 4MLIA 2BHYA 2BMKA 1YPZA 5FFLA 2VJXA 1S7XB 3HG1B 4JKLA 4M8QA 3UAJD 1NGYA 5IJVA 1PG7H 1HHKB 4YHNA 2VQ1B 1K3ZA 3OZ9H 2HRPL 1AO7E 4R7DB 5DRXA 3V0VB 3SEPA 3TCLA 1BJ1J 2NQCA 1CE6A 1FV1A 3HZYB 3MRNA 4PJFA 4XHQA 4XPGH 2VDRH 4B41A 5H37G 4JZJB 4LRNL 4ODWA 5F1KC 5HHMD 3VXOA 1CU4L 3UX9B 3ZE1F 4EUPB 4V1DE 5CJXC 6FABH 2B0SH 4UAOC 3H7BA 5MENA 1T7WA 4KI5C 3NFSH 1U8PB 2XZQH 4JRYD 2ZCLL 3V4PH 5IK3A 5GSRB 4XMKH 4PJ8D 3RVXC 3QJHA 4MJ5A 3O6LL 3U82B 5IV2A 1CU4H 4PLNC 4ORZC 3G5YB 4M61B 4I0PD 1MJUL 5CHNB 1CXHA 3L5WA 3BQUC 2ZOKB 3PWJB 1P4LB 4YAQB 1WC7A 3SDDC 4PYHA 3X11B 4Q6IA 1FSKB 4K2UL 4DJMA 4JVUA 1EEZA 3O9WD 1T04B 3DRTA 4BZ1H 2P8LB 2X4UB 4JR9L 1T66C 4G5ZL 3KPRA 2R9HD 2DM3A 1Q9LB 4R96B 1GRWA 3GMMB 3ULUF 1N5YH 4LAQH 3V0AC 1JPFA 4CNIA 1ZVSB 3ILPA 4U6TA 3WNOA 3TF7C 3D25A 1R5VB 3UZVB 4LDEB 2VDOH 4WWKA 5E1AA 43C9A 2AEQH 2Z92A 4YDLB 3DBXA 4MAUH 2DQCH 5KSVA 5GRUH 4Z18A 3Q6FB 1JGVL 4NZTH 4APQC 5HDOA 4WNQB 5HPMA 1YNLH 1B88A 4KJPC 5AYUH 4IMKA 3ZDYE 3V0WH 2E9WA 3EOBB 4KUCF 1U36A 2OP4H 3FQWA 2CXKA 5CBEB 2W0KA 2VQTA 4RMWA 1U91B 2DL2A 5F6IC 2X4RB 4LVHB 1GPOL 5E8OA 4E42B 5LXGH 4WI7A 2KH2B 5GGSB 4JHAL 3VXQA 1R24A 4JJ5B 15C8H 1VHPA 3GJFH 1I9IL 3VFWA 4XC3L 1A4JB 1NGQH 2NXYB 4F7TA 2XA8L 4LQFH 3VFWB 4LCUA 1NMCC 3TH3T 2FX8L 1GXEA 1RIUH 2DQTH 5JNYB 2YMXH 4PLKD 5BRZA 2Q7NA 1ZV5A 3OR7A 5DJXA 4JHZA 3L3DA 3VXTA 3QPXH 2WNGA 3QDJD 1RAMA 4G8EB 1A14H 4DVBA 4AL8L 5C0JB 1HI6B 1LP9B 3IDNA 1DFBH 3OAYK 4RAUB 4Y16C 2KDGA 2OJZH 4M9OA 3O2DA 1JYXA 1GHFL 4CGTA 4YIQB 4KVCL 1CGYA 2Y23A 4K7FA 2FL5B 3JUZA 2XWTA 2GI7A 2IEPA 5DMYA 3NFNB 1BD2A 4UV7H 2KZWA 3MJ9H 2D7TL 2VL4A 3TGXA 2CO6B 1XCQB 4OFIA 3DXAA 4MA8L 5I15L 1G0YR 1J0KA 1PJ9A 5I9QC 4RGMC 4XCYB 5L2KA 5I1LB 2B8OT 5IJKC 3L3IB 3W2DH 5D2NC 4U3HA 3T1FB 3GEWB 1J8HA 2FCBA 1RUAL 4JY5L 5F7WC 2BOBA 5BXFA 1CGSL 4MHHG 3VE0B 1JWSA 3TA3A 3DMMC 2P8MA 4KAQL 2Y5TA 4ZDHB 3KPLA 4DCQB 1HQRA 5C08A 5HD8C 4NZRL 4W6XB 1UVQA 3EDEA 2F5AL 2X9XA 4L4VD 3W0WB 3AVEA 3JVGA 4ZTOL 3NVQA 3MV01 1N4XH 5FGSA 3L3JB 1L4IA 1NAKL 4TNVK 2A1WL 4FMKA 1N2RB 3L3KA 4EXPX 5IMOA 4JFDD 2IFFL 4R4FL 4URTB 1AD0A 4OGZA 3QQ9C 4FNLL 3ILPB 3K2MC 2VE6B 2QQLL 3QHTC 5T1KA 1B4JH 3BYYA 1L0YA 4J3UA 4LHUB 5B8CC 1UB5A 4Z0XA 3M45A 4IHOA 5BJTB 4Y4KD 3BYTA 3HE6B 4XVTH 1AR1D 1E4JA 3QIUA 4M8QB 3HAEA 1MWAL 2PKDA 2X4QB 3U7WL 3AREB 1MFBH 1DCLA 3AU1B 2MOVA 3T3PF 5EUOA 3NPZB 1JWUB 3QCVH 2ZUSA 3C08H 4EN3C 2WBJA 1IGYA 4U0RB 3OX8B 3VGFA 4EIZC 3BDYL 2C4XA 4OBRA 2P45B 4Y8DC 4Z6AT 1P4IL 1U3JA 1CFTA 1RZ8B 5DEGB 4XXCA 1BZ7A 4FQIL 2WBJC 3S88L 4DZBA 5I2IA 4ZUTA 3MXVH 3DSFL 4ZFOB 1CFQB 3BRDA 4PG9B 4Y19D 1GOGA 3QCTH 3LKSB 3AB0B 3P40A 3L5JA 1I7UB 1JK8A 2VXTL 3NCJH 4DW2L 1PYWB 5B8CA 1B6DA 3MGTB 3BPOB 4PJDE 2NY3C 3TZVB 3LKRB 1QBBA 1R3IL 1KEML 3BWUC 5ANMB 4HIHA 2AXJA 2VXQL 2ATKB 1MCJA 3EYVA 3GI8L 4P5TA 3UTZA 5F70A 1KACB 4Z78A 5E4EB 1TVDA 4Q9QH 4XCNB 4TUOB 3CIQA 4MQXD 3RWEB 1U95B 1I4FB 4F2MA 3EOAA 4HLJA 2JKXA 4G8FA 4JHBA 3ZKND 3LPWA 4ZSOE 5T1MB 4OCWH 5ACLA 1U6AL 2PCPB 5FM4A 4Y2OA 4NGHH 5E4IA 2J8UA 3PDOB 2DBJA 1IKNA 3MOQA 1FFPA 2YPKB 2NY2B 4ONFH 4NCC2 3IYLW 3W39B 4AT6B 4OT1L 1VPOL 1I8IA 4J1UB 2XRAL 4JANA 5D2LE 1N4XL 1FNFA 2HP4A 1AKJA 1SJEA 4TN9A 3LN4B 5CCKH 1CD0A 1P84K 4XPTL 5IBLD 3C6LC 3T0WA 3WD5H 4WFFE 1I3RA 1YECH 1DQMH 1JGUH 1FO0H 2IMNA 1QKZL 3VMNA 32C2B 4I48A 1B3JA 5DD0L 1RMFL 4DKDC 3IFPB 4PBWD 2VDLH 1LHZA 4P2QD 1N5AA 4M7ZB 5A1AA 2YXFA 3JV0A 3GMRA 3QG7L 1N6QH 5J1TC 4WEMB 3BO8B 3WNMA 1AXIB 3QIBD 4YZFE 5IMOB 5CINH 3QUXB 4OZFG 4WUUA 5E9DE 3VRJA 2MJWA 4Y5XB 2ATPA 4YWGH 1NFDA 5IEKB 3FFCB 2Q86A 5FDWB 4U2ZA 3QQNA 2GSIA 1T7ZA 4UILL 5KVDL 3MPCA 2GT9B 5CJOH 4GQ9L 4N1CA 1HKLH 2H8PB 4CVXB 2Z8VC 1EDQA 3B83A 4EUPG 1JN6B 1QHOA 4O2CA 2NY2C 5GZOD 4WJ5A 5CIPH 2GYSA 3NPSC 1DUYA 3QHZH 4PLJD 3ARQA 3L3GA 2VWEC 4WFED 2EDOA 3K1KC 4UBDC 5HHVH 4OZIB 3DROB 3ARGD 1A1OB 3EDFA 4P59L 5C8JA 1ACYL 3GBNL 2IH3B 2BNUA 2V9QA 4GMTH 5F6HI 4MXWL 5H37H 4QRRD 3OAUL 1TETH 4MJIB 4IMKC 3WYRA 4PGEA 4APQA 3WCYA 4KDVA 3KJ6L 4NKIL 3VD3A 4HWEH 2IGFH 2DTMH 4QHUA 1OARH 4FMFA 1QQDA 4N0UE 1CLZL 1UQSA 4ONGH 3RRQA 4WV1A 5B38A 5LXGL 3FQUB 5HDLA 3QEUA 1UM5H 2EDKA 5JORB 1RZJC 1TQCC 3WXVL 3MLYH 1KCRL 3UP1A 1OSPH 2ENYA 3QHFH 2CD0A 4K8RH 1G84A 1L7TL 4NJ9L 1I7ZB 4EI5C 1UZ6F 3C8DA 5EG6C 3L3HB 1PLGL 1S9WA 3HAEH 3R06B 3SDDA 3E2HB 1I75A 4JJHA 4PRHA 4E41B 1FBIH 4KK9C 3BQUA 3VXUE 5D6CA 1FG2A 4XI5C 3RVWC 2YPVL 2BRRL 3NPSB 1NUGA 1S7SB 2LVCA 4IS6A 2D7QA 5I1GH 1MHHA 5BW7A 2LU3A 1MRDL 4RA0C 2F58H 4CN6A 5CEXB 3BPNB 5GJSL 3N85L 5L6YH 4Y16B 3VFRA 5C3TA 3IDGB 1J1XH 4YHZH 3IF1B 1KT2A 3ULVE 5JQ6L 2OTWA 3RKPA 3QDMA 4BH7B 3G6JF 3DXAD 3CFIC 3CC5A 1JZ6A 5FV1L 4R8WH 1KJ2H 4MCZB 3CMOH 4ZOBA 1XF4A 3TP4A 1HXMA 1FAIH 2XZQL 3B2VH 5J9PA 4X9BA 5CINL 4APQD 3UTQB 5IHZB 4PTUB 1KBGH 5AZ2H 2NR6D 2V2XA 3STZB 3ET9F 2P47B 3QDGE 3MV8A 1N7MH 4MXVF 3WKMH 1F5WA 4DKFL 3MQIA 1UKQA 1GGTA 5ESQA 3V7AE 4FQJL 4LK4A 3U7YH 3SE8L 2VAJA 4M9PA 4OAWA 5BOZG 5E1HB 3QCUH 5HYFA 4QGYA 1WCBB 4P5MB 4Y1AD 1M1SA 2BC4B 2YN5A 4M7LH 1J0YA 2Q87A 1HHGB 1GZPA 3QEQB 5LGJA 2DLFH 4UQ2A 3UTTB 1MUJB 1VB9A 3PGFH 2AEIT 4Y0GA 4NNPH 3G6AA 4G8GB 4K71C 5FHAL 3QPQC 3O3EB 2AK4A 4UDTA 1XGUB 4HKBA 3STZA 5IB2B 5KVGH 5DHVH 4UDTB 1I1FB 4OFYA 4HHAB 2VLLA 2JF1A 2QSVA 4PG2A 5FUCE 3RPIA 2EKSB 3CFKA 3U2SA 3H9SD 2F9BT 2AERT 2WMPA 1MAJA 3GBLA 2APWA 3IB4A 5FF6B 5KSUB 5HI5C 3QO1B 4KKLC 3MRLA 3TT3L 3CPLB 5SX4I 1FDLH 2AI0H 4L29A 5EDXA 4OI8A 4YBLB 2HWZH 2X4SB 3CGTA 3ULSB 3ZYOA 4JLRB 3WSQL 3L3HA 5JOFA 4MQ7B 3HAEB 1BJ8A 3WXWH 5DD6B 5I6XC 3IFNH 4P2RD 1B90A 4M6ML 2VH5H 5GQBA 4TULH 5F1NA 1NCUA 5H8DA 2XQYK 1IC5H 2AABL 3CXHK 1R3HA 5HPOA 5DEFB 4ODXB 4OZHB 5LGHH 5EU7E 2EEDA 4WUUD 3MLYL 4MAYD 4OJFL 3KPSE 4ZOAA 4PJAA 3NFNA 4X4XA 2B4CC 3V7AG 4GG6E 3LEYL 4JRYE 1BLNB 2HH0L 2EH7H 3M1BB 2O5ZH 5E8DH 3D87B 4WY7L 5D7LB 3GGWA 3HR5A 3JTTB 4HGWB 2ZPKH 4WV1B 4NWTH 3KJ6H 3H42L 4OF0A 1W72L 3FQTA 5DJ2B 2FIRT 4PRPA 5IQ7H 1D5XB 1MPAL 5EZOL 3VXSB 4MXWH 2AQ3A 3A6CL 5AUMB 3GO1L 1EH9A 1ZHNA 4GAJH 3U0TB 1KB5A 3WLWC 5EORL 3VWKD 3CK0L 4QXGH 1YEGH 2ZJSH 3L5XL 5BOPA 4PJIB 3QXDB 4KHTH 4MNQA 4WWKD 1BF2A 3KLAB 3D69A 1KFAL 1RFDL 2P7TA 2P1YA 5DXWA 3KPNA 1T83C 1H3TA 2C26A 1VACB 1U8MB 2GSIB 2P7TB 2ZG2A 1ROWA 2QKIB 4NWTL 1XR8A 4WHYH 3NTCL 2NY5C 3GZKA 3CH1A 2XZAL 4KTEH 5IBUG 4S1QH 1BFVL 4UU9B 5F7EH 1KJ2A 2Q20A 2B39A 4I0PA 4RRPA 1DVFC 1XMWA 2BNQE 1HNGA 4J4PD 2M26A 5JHDA 2FHBA 4JFHD 1JTPA 2DQHL 3MOAL 1H3VA 2IBZY 4NT6A 2DWDA 5SWSD 1U8OB 4PRPB 3G6JB 5J6GA 1HIMH 4BFGA 2XA3A 3O11A 1RIUL 2RR3A 3EOBA 3LH2L 1MH5A 3R8QA 3QDME 2OK0H 3CX5K 2VLJA 1G6RL 1KJVA 1PKQE 3UDWC 2GEEA 3FFDB 5KSBE 4LEXL 1J05A 4XVJL 3SO3B 5IVNA 4NO0B 4ELMA 4W4OC 4Y5XA 3UTZB 1AC0A 5D2NE 1QSFD 3I2CH 3WL9B 1Q0YH 3GIZL 4YLQT 3BP5A 5H2BA 4GRLB 2VR5A 2CLVA 2QR0B 1FO0B 5KTEH 3QWRA 4UOW0 1RQ5A 2YOCA 3A0OA 4LPYA 2YKLH 1R3HB 5I8KH 5TE6L 3TN0C 4BQ9A 4Y4FD 2AJYL 2HFGL 1MIML 3IRZA 5JR1L 1H0DA 2GK2A 1YYLL 4X4XB 4PLOB 2DMBA 1HYSD 4YEFA 2XWBA 5GISL 5EO1B 3U30C 2BVQB 2I25N 4HS8H 3P3YA 5CZVL 3BN9C 3L5WB 4M6MH 3K0WA 4U49A 3FZUC 1TJGL 4JDVA 2BOCA 4UB0H 1Z9SA 4OLXH 1PYWA 4XHJC 4KPHL 3GJFA 1M05B 2H2SC 5DD6A 1G7HA 4MJ6B 4Z7QF 1LDSA 4FQIH 3FRPG 1NANI 5I1HH 2H9GA 3NAAL 3UO1H 3CFKB 3BI9X 2HVKB 2R2HA 4PJ9D 3BP7A 4RBPK 2BCKB 4L29B 3Q48A 4KRPC 5KSAD 3TO4A 1MRCH 2APTA 1UB5B 4GRWH 3BD5A 4Z0BL 1EHNA 1XIWB 1FGNL 1RZGA 4XP1L 5LQBH 5IMKB 5D1QC 2VDML 3LHPH 5HVHC 4R97B 3VI3F 1FAIL 3B2VL 3L3KB 2OR9L 5HHME 1Z2KA 3ARYA 2A9ML 4U1LB 1MFEH 4M1CD 3RWIB 4C54A 4MSWA 4Y5XC 3MUHL 5F9WB 4R4FH 3S37H 3RWGA 5EOTA 3U9UA 1VEPA 2ESVB 2Y5TB 4ZDHA 3IJSA 4WCYL 5IW3A 1MUJA 3TA3B 1U3HA 1HINL 3HE7B 4JCMA 3G6JA 4ZTOH 1JZ8A 3VXRD 4L9LA 5GGQH 5LCVH 4ZUSB 1C5BL 35C8H 4ZPTA 4EN3D 4PJ8B 3RNKA 1K5NB 1RU9H 4GRWE 4KDWA 3CZFB 4A6YH 3QZWB 3RVXD 3T0EB 4KHXL 4PRPE 4FQJH 3U46B 2HFFA 4I0PB 2DS4A 1NLBH 2DQJL 2VDQH 2X1OA 4XMPH 4C56D 4KRNA 3LN5A 4JO1L 3OKNA 4QRQA 3W2DL 2AJZA 4WUKL 5BJTA 1J8HB 4K8RC 2VDKH 3STLB 1EK3A 2J8OA 3MBEA 4MX7B 4JRYA 1LNUA 3BKCL 3GBMH 4LCWA 5T1KB 3L5IA 1XIWC 5K9OB 1KPUB 3CSPA 2IBBA 5C2BL 1E27B 1R5IB 5C0IA 3GJFK 3B5TA 3OB0H 2R56L 1MRFL 3QWRD 5CZXD 2PXYB 4GXVH 4YDIH 5EBMA 4PJIA 4O4YL 1HXYA 1FZMA 3L7EA 2X05A 5JA8B 3BQUB 3ZHLA 3ARXA 4ZO8A 1RK0B 4C55A 5E0QA 3OAUH 1U3YA 5LG1A 3WN5B 1ZLWH 4EI6B 5JW3H 4M43L 3DO7A 2X4OB 1EEQA 2R9HC 3GSVB 4R4BA 4CW1B 1KIPB 1YEFL 3E1F1 4P3WA 2CQVA 3PWUB 1AQKL 2Y07L 1T7XA 4G6JH 5B38B 1KB5B 4O2FA 1RUKL 1N8ZA 4M7KH 3VWJB 4OCYL 4ALAH 3WDHA 1KCSH 5KSVB 1BMGA 1NCCH 2OMNA 5DR5L 4N0FB 3VXNB 5DFVC 1T21A 1FNEA 4XMLH 1NGXB 5J12B 3QIWD 1QSED 1A7PL 43CAA 3QUZD 2W0PA 4DOHB 1X5HA 2AEPH 4LSDA 3U9PL 4PRNB 4IDLA 4KQ3L 4JO1H 4YXKH 1VADA 4JQVA 5ESAA 4CW1A 4JFXA 2VDPH 5ADOH 2ARWA 5E2JA 2Q8BH 4GQPH 1F4YL 4GMTL 3FO2A 1JPTH 2XIDA 4YFDB 4HZLB 3QQ4B 1I3RB 1E4WL 1JIBA 2ZOKA 3PWJA 4PJGE 4KI1A 5F6IB 1NUNB 2HVJB 5E7FA 5ICYA 4BZ1L 2BSRB 2VDNH 5DSCB 1E4XI 4FFYL 3QWQB 4KK5C 2X4UA 5IG7B 1DUYB 1HKLL 3I3DA 4IIQA 2EDTA 2X7LA 4J7RA 4ZUWB 1QP1A 4A6YB 1VPOH 1CF8H 4PJCA 4UBDD 2GJZA 4N0YH 3RU8L 4K3EL 5T3XD 2X4SA 4P2OC 4G9FB 5DMIH 4K8RD 3IS1X 3VFSB 3QBTB 4OCWL 2X4NB 1CIUA 5BVJA 4TPRH 3RVVD 4F33B 3PP3H 3IU3A 3RWIA 5GRZA 4JVWA 3I6GA 1KTDA 3VDCA 4ZFGH 1LEIB 1VGEH 3H7BB 4WVRA 2ZUQC 1JHLH 2EDBA 2XTJD 5D1XC 3INUH 2G5RA 3LV3A 5K59E 4B0MM 4NFDA 2QTEA 4M6NL 4PRIA 1YECL 4PJXB 4RFOH 2J5LB 4DN3L 4LVNC 4NO3B 5JOFB 4G6FD 4HMDA 4WW2B 1U93B 1XGQB 4EBQH 2VN7A 3CU1A 1REIA 5E2WH 1GC1L 1I1YA 2R4RH 2IC2A 1EBAA 4X0KA 1DBMH 4XH2A 4WHTB 1MVFA 3RWGB 5I6XB 1PQZA 4XP5L 1DZBA 3QZWA 3T0EA 1Z9MA 2OLDA 3DUSA 5EA0L 5JIHA 3T77B 3DGGA 4NCDA 3VH8G 1J0IA 2BVUA 3KDMA 3LEXB 3X14B 2C3VA 1U42A 1E28B 5F3BB 5JPMB 1MFBL 2FWOB 4PB0H 4ZAKC 5ABDE 3D39A 4YPGB 5ISZA 4L8BB 4P5TB 3T0EE 3MJ8B 5DUBB 1CDYA 4PJGF 1AIFA 5A43C 1RZ8A 3QISA 1P53A 1P7KB 1Q9OA 4YHIB 2ESVE 5CSGA 3SDAC 3IF1A 4Z7NF 2F74B 3BE1L 1FFQA 4PRDA 3RUGF 4JPWL 1FZJA 5CJBA 1TQBC 5EBGA 3KYKH 4FFYH 1F90L 1NAMH 1U93A 3D3VE 5ESQB 2RIKA 1VFOA 1XCTB 2NX5A 2AXFA 4XWGH 3PUCA 3ZKXB 3V6OE 4HFUL 4LQ1A 1H0DB 3JTSB 1OY3B 2R1WB 3TBVA 1KULA 1ZXQA 3CUPA 4JB9H 5IB1B 1KCVL 5F96H 4ZFFB 1T80A 1BBJA 1KBGL 3GSWB 4KQ3H 1ZANH 5HI4D 3ZO0A 1T21B 4BQBA 1H3GA 1DBJH 1B4JL 1FVDA 4O9HL 2G2RA 3RWDA 4DK3A 5E5UB 1HKFA 5ESVB 3UZEA 1NCTA 2D7TH 1Z9LA 2WAHA 4JO4H 2Y06H 4K3EH 5GHWH 1ZLVK 2WUCL 4LLUA 4NZUH 1JRHI 2ZOLA 3KHQA 4C57C 1KCSL 3BGFC 5JQ6H 1IC7H 5FK9B 3W5NA 4M1CC 4Y7MA 2W0LA 1UM4L 4IRSA 1P84J 2YRZA 3KLAA 3BEVA 4MD0B 5ALCH 5BXFB 2ADJA 3T0EC 3LKNA 2YA1A 3MRPA 1JYNA 3GIVA 1BQHB 4UI2A 4LSTL 4GAYA 4JY5H 2CDGA 1AQDB 4R0LB 3L7FA 4NQSA 1DQQA 2BERA 3X3FH 2XWJA 5E8PB 2GSGA 3IKCB 4PJHA 5FB8A 1AJ7H 1I9JL 1YPZE 5I8CB 2ZPKL 3MRMB 2NW2B 3NIFE 4ELMF 5K9QI 2IPTL 1OSPL 3QHFL 4K8RL 4XVSL 4MDIB 2YK1H 5T1DL 1YEKL 4HIXL 4OGAD 5E94A 3ARDD 4KTYA 3JSSA 5C7XL 4MDIA 2JIXB 3SCMB 5DJZB 5TFSL 1ES0A 2A6DB 3BIKB 5CWSB 5C6PB 1B9ZA 4XT1C 3MBEB 1NFDB 2PO6B 1T22B 5AWNL 1LMKA 4PJAB 1GGCH 3IDIA 1WQVT 4YIQA 5GRUL 2WM0A 1FNHA 4P49A 1NGPH 3X3FL 3WBDA 1SBBA 5K9QG 3D3VD 4U3XA 2OI9C 3LRGA 2VRAA 5ILTH 1KB9K 2OL3H 1U8HA 3AM8A 1P6AB 4NSKA 3MACH 3B2UC 4G7YL 3HPJB 1ACYH 3GBNH 5FB8B 4AT6A 1ADQL 1T5WA 1D5XA 5E99L 1N5YL 1XCTA 2F53A 5EU4B 3O4LD 4M1DH 3EOYG 4P4RB 2H8PA 3RGVC 2R1YA 1BQHA 2AP2A 3MXWL 4PJ7E 1OB1A 3D2UD 2QEJA 5IMMB 3RWHA 3H3KA 3SDXB 5CP3A 5LVEA 2IMMA 4IJ3C 1I3GH 4BKLB 1MY7A 4CMHC 5HI3C 4UIKL 4XP4L 4PRHD 1IGIL 1KN2L 5F21B 1F6LL 1FJ1B 2V6HA 4XAKD 5JLZA 4JFFD 5D7JA 5DUBA 3NA9L 4S11A 1UA6H 2R2CA 3HZMB 1J11A 3TZVA 4F7CA 3GI9L 3MV9B 3MFFA 5C9KA 2R1WA 3TBVB 1CLYL 1CL7I 4XCNA 2GITB 4WEBL 3TT1L 4F15C 4WENB 4XC1H 3IDYC 1DEEA 4NN7B 2ZSVB 4PJBB 2C3VB 2YPLA 3CFJA 4KKCC 3WUZA 2FSEB 5TF1L 4LAQL 4JPKL 1A6WH 1R5VA 3I50H 4XXCC 1YN6B 3LSOB 3VDBA 5I1IL 1H3PL 4PJHE 3NA4A 3DVIA 1EVTC 2E7BA 1VEOA 4XPBH 2HLFD 4MJ5B 5CD3B 2PYFB 5FO9B