2UYLB

Crystal structure of a monoclonal antibody directed against an antigenic determinant common to ogawa and inaba serotypes of vibrio cholerae o1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
213
Chain Sequence
b'QVQLEQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGHISPGSSSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCGREETVRASFGNWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY F-22-30
publication title Crystal Structure of a Monoclonal Antibody Directed Against an Antigenic Determinant Common to Ogawa and Inaba Serotypes of Vibrio Cholerae O1.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 213
sequence length 220
chains with identical sequence N, W, Y
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB02
1A4KB 5BO1H 1J05A 1NAMH 1YNTA 3MLZL 3D6GA 4LASL 5CD5D 1MH5B 3MLVH 4MZ3A 2XWBB 5IROC 1JNNL 2OXGA 5B39G 1T1ZA 1UH3A 4M1CC 1IC4L 5A2LH 4XGZB 3U4AA 3GNMH 1J5OL 4NN6B 2EXWD 5I6XB 1SJHA 5C0AA 3U46B 2D31A 2XQBH 1A1NA 1M05A 2IPUG 3HG1D 4XVJH 1GPOL 3SGDH 4G8FA 1EEYA 3PDDA 5JHDA 3GM0A 3MLSL 4XP9L 5E08H 2FWOB 2R69H 1LEIB 3ZDYE 1NANI 1CDYA 1VCAA 5DEFB 1MQ8A 4L9LA 1CXFA 1XF3B 1QBBA 3GFUA 1JUFA 3QIWA 2OL3L 1ZTXL 4YXHH 1J18A 2FLBT 2W07A 4XCEA 4RGNC 5GJSL 5DJ0B 4LDEB 1D6EA 1N26A 1HQRA 2GEEA 4MD4A 4ZS7L 4U1LB 1QD0A 2OBGA 5FYKD 3MLWL 2NY1D 3WLBB 4FA8A 3VRIB 1RVFL 2VZUA 4HIHB 1NDMB 3OG6B 3F58L 4PG9A 4LCUB 1CD0A 3RWJB 3IKCB 3S98A 1IC7L 4XWGH 3EYSH 4JZOA 1TQBB 1XR8A 4G6KL 3VW3H 3TN0D 3ETBF 5F7WC 1RZKC 3TA3A 1G7HB 3DV4A 2DQGH 2FZ3A 3VFOA 5ENWB 1CICD 3GMQA 2F53B 2GUOA 5FOBB 4V1DE 1K8DB 3P11L 3AU1B 4OM1L 5HYQA 2A0LC 5C09E 3WO4C 1P4LA 4NGHH 3ROOA 3MBEA 2BVEA 1KB5L 2IBGA 3JTTA 1JV5A 3MRGA 1E28B 2OX5A 1UC6A 1U8PB 4WHDA 3RY6C 1VEPA 5DJXA 5CEXB 4WDIB 1TETL 4OGYL 5F72S 2PYFB 2WIMA 4QRSB 3RP1A 5TDPB 3VXMD 1JMZA 3C5JA 3OB0K 3VFPB 1VESA 3VRJA 4NBYB 1GGIL 2Y36L 3RRQA 1KIRB 4WI9A 5I17B 3RWHA 4GKOA 1CLOH 3OB0H 5I75C 4M1DL 4GXUM 4DN4H 5IMMB 4BH8B 4NQCE 5I1AB 2XYCA 5JHLL 4LSSH 4P5TA 1U8OB 2WUBH 4NZRH 1A3RL 2HMIC 1FHGA 3UEZA 3WIIH 5B38B 3EYUH 3CSYB 2FIKA 2FHFA 1ZT4A 3OKOA 1FQ9C 1JPSH 1YN7B 3GBMH 4GAGH 4U6VH 4BYHA 4U1MB 2JJWA 4HJGB 4HT1H 5MI0C 3JUZA 5DMKB 4BUGA 2B4CC 1KCSL 4F7TB 3H3BC 3WKNA 4J3VA 2I60H 1FG9C 2J3SA 5DUBA 1OB1A 1ZT1B 5CJBA 2Q1EA 3LOWA 4NZTL 2BRQA 5FGSA 5KSAD 1KLGB 3RVUC 1JHKH 5LGHH 1XR9A 1UJ3C 3HE6A 4U6YA 4ZFZA 3B3IB 3BZ4B 1Q0YL 4OLZL 4HZLA 5GGTA 1P1ZA 5J1AA 3HCVA 1ZGLA 3F6LA 2K7PA 3KYAA 1B0WA 1F6AA 1E27B 4PJEE 1HH6A 3GMRB 4AIZB 5JZ7C 4IS6A 3KYMA 1NFKA 3C6LA 3UJIL 3KLDA 1AJ7L 4ZUSA 3MJ9L 3BPNB 4JFFB 2CDEB 3DYPA 1KC5L 1HHHA 4LKCA 4LSTH 2E6QA 1QSFE 4UILL 3UC0H 3DO7A 1RIHH 1MJJA 2DM2A 1LVEA 5I16A 3FB5B 4N8VB 5MEPB 2DM3A 2VSCA 2A77H 5E2WL 3UP1A 3OXRB 5A3ID 1DJSA 2QQKL 4WWKB 4OZ4B 4OZFH 1IM9A 1RU9L 4NN5C 2AXFB 3ARUA 3V8CA 5ABDE 2YA0A 5DWUL 3PWPB 4ZUWA 1EAPA 3GMNB 1MCRA 3BPCB 2WM0A 1G0YR 4Y2DC 4LPTA 5T1KA 3IDNB 1CLYL 4L3ED 3ILPA 3TO4A 1A7PH 3LKQA 4QRUA 5DGRA 3DUUA 5FF6B 4PV9B 3AY4C 3EO0B 5C0CB 3V52L 2JKXA 5EC1B 2VZOA 1AC6A 3BDYH 1JGVH 1DBKH 5LBSH 2C1PA 3PHSA 1CXHA 1NCUA 4U1IA 3K0WA 3L3DA 4LQFL 4G3YH 1UB6B 4PGJA 1J87A 1WITA 1FZMA 2QSTA 3UPCA 1TVBB 4NWUH 5FYKH 1ZLSL 4PJIB 3WIFB 3QUXC 3SKNA 4OUOA 3GSQB 2BVOB 2FECI 2R8SH 1I8MB 2YPLD 5EOQL 1MCPH 5F7LB 3V2AR 4HS3B 1IAKA 2HLFC 4XPGL 1MFBL 1NPUA 1PY4A 2ZUUA 1R5WA 2V2TB 3QIBD 4MNQB 1GIGH 3RNKB 4FQCH 1A9EB 3GMMB 4P23B 5T1DL 4YUEH 3VGHA 3N0PB 2NXZC 4HLZG 3D0LA 3NIDF 2AAVA 2HJKA 3VD5A 4PGBA 2EXYD 1UWGL 5I2IB 1ZEAL 2FL5B 3PL6C 3V0WH 3S36L 1JPGB 2RQ8A 4OT1L 3RL1B 3BP6A 3EO1A 4GXUN 1D3CA 3VI4F 1A4JA 4OB5L 1LDPH 2H6PB 5DMIH 3BOVA 3G6DL 2W9DL 3HB3C 1N7MH 1WGOA 3SJVA 3QP3A 4JPWH 4OLUL 1FRGH 3BXNA 2PCPB 4WCYH 1CR9H 4M43H 2BNUA 3VWKD 5LKNA 2VQTA 4HWBH 2BNRA 5BVJA 2DQEH 5B4MD 2WANA 3ZL4L 4P9ML 1IKFH 5IEKB 1Q9OA 6FABH 3P4LA 1A6AB 1K5NA 2XTJD 3L5WA 3EGSA 5E1HB 2ADFL 1R3IH 3KPTA 3GSNB 4H1LH 5ALBH 1D5BA 4YHIB 3KPRA 5HHOE 1TZIA 3EDFA 3PIQA 5GZOC 3QNXA 4M03A 4HWUA 1H5BB 4IRJA 4BQCA 4XTRC 5D1ZC 5IB2A 1YDPA 2GAZB 1S7VA 1CDGA 3GSWA 3QQ3B 2YD2A 3H8NA 4I8DA 1YY8A 5LGJA 4E5XA 3O0RH 5GS0C 3TO2B 3U6RA 1A6TB 1FORH 3MV11 5KN5B 1BHGA 3VFRB 5IFAL 2YD5A 2P42B 5C70A 5M95B 3RFZC 1L7IH 3L5JA 2R9HC 3TBYA 1AE6L 5DQ9B 4O58L 1I1AD 4RMRA 1JF1B 1EJ6A 4MXVE 5D1QC 1PW3A 1U8HB 3WNMA 4MXQC 1A1OB 2KBGA 3H3KA 4P2RD 4CVUA 3L3KB 4N0CC 3B9EA 4F7MB 2IAND 1I8LC 1T7YA 4RNRB 3LQAC 3OV6A 5AZ2H 3LV3A 2F8XC 3BAEH 1YQVL 2UYLB 1S9VA 4QOKE 5T1LD 5BQ7B 5DFWH 4EUPA 1NGWA 4LLMB 3S34L 3BH8B 2CQVA 4X80H 3WN5C 4TQEL 4G42B 4RMTA 3KHQA 4RFEB 3WFHA 1N2RA 2HTLD 4MNGB 5BV7L 1QSVA 1G7PB 2NLJA 4D9QE 4FZEL 1AKJB 1BD2A 4O4YH 4DN3L 1OTTD 2XRAL 3TBTA 5HDOA 4HUMB 5E2TL 3U1SH 1KBGH 1D9KC 5DRXB 1FC2D 4PGEA 2VLRD 2CK0L 1M71B 4XP6L 5B8CB 5D9SA 1ACYH 2XKSA 4FXKA 1OAZL 3HNTH 3L3IA 3WL9B 4UBDD 5HVHB 3WFZA 1HSAB 1FYTE 3NH7H 1CXLA 8FABA 5IB3A 1RJCA 4K2UL 5E6YA 4LLAA 1W72B 2VSDA 3WEXB 1XCQB 3BQUC 4HXAL 4EI6A 4ODUA 2ITDA 3NCCB 1UKSA 5JQ6L 3WSQL 2ITCA 5I8EB 3T8XB 1EUTA 4JDZA 4AJ0A 1MFEL 4YO0B 1NAKL 4I9WE 4RWHA 5IV2A 1I85C 3SDXF 5GS1C 2QR0B 4I2XA 4YBLC 4Z7VF 3O11A 4UNVA 3SO3C 5JOPD 4PRPB 4JGUA 3WXWL 4MJ5B 3L5HA 1T2QH 1SBBA 4GMTL 1KTKE 4JJHA 2J8UF 4QRQA 2CUHA 3RVTD 3WXVL 3KS0H 5GRJH 3NGBC 4NJAH 3BD5A 4U3XA 4F9LA 3O6ML 3QCTL 2WBJA 4DCQA 4LKXA 4UT7L 2UVEA 3UTSD 25C8H 4PJDA 1LO5A 3TFKD 3FQRA 4UDTB 4BSWB 4XXDA 5J13C 3PHQB 1S9XB 3LS5L 2NY5C 2NW2B 3O8XC 3LSOA 4EOWH 1MWAL 3L9RB 5A1AA 3ZDXE 4GKNB 2GSIB 5IQ9B 4ODHH 2X1XR 1EEZB 5F9JB 4MA1B 2IGFH 3UDWA 5KVGL 3G5ZB 2F54B 1J0ZA 3RAJH 1JN6B 4N9GB 4YGAB 2VISA 4M7JH 3OGOE 2ADJA 3Q0HA 1LE5B 4OIBA 4WFGE 1CF8H 1QO3B 3RX5A 4XBGB 3GB7B 5EIVA 3GMOB 1FFNB 4Z0XA 2PW1B 4LSUH 1KPUB 5EBWB 1H0DA 4TVSa 5CINH 1KIPA 1K6QH 3RPIB 5EU6B 3PP4H 4UTBL 4CVWA 5DYOA 4X5LA 1UEYA 3RUGF 1S8DB 3P0VL 4XPHH 1ZMYA 4CNIB 3MUZ1 1NC2A 2WNGA 4LCWD 3QPQD 4UOJA 3HN3A 5FHAL 2EDEA 3O6FD 3VXTA 3UROR 4CJ0A 4F57L 3KPNB 4HJ0C 1RJYB 3G5XA 1UWXK 2FJHB 2MHAA 5DRZB 3OF6D 3UTTD 3RZCC 1YUHA 1RJZA 5CGYD 5BRZD 3F8UB 3BH9A 4MLSA 4IRSC 4JFEE 4NQDB 3P9LB 1DN2A 5C0BB 1UWXH 1ULVA 1MFCL 3HUJB 2D2OA 3MO1B 4Z7QF 3RL2A 5D5ME 4QRRA 4NNYB 2AV1A 1WSST 3QUYA 4P2CG 4Z7UB 4RGOH 3ULVD 5CUSL 5BJTA 1OD7A 4CDGC 2HH0H 1FJ1B 2XNAB 2R1YA 4QHMA 2V17L 1X7QB 1LNUB 4BSVA 4DVBA 1QTYT 5D71L 4A6YB 3P73A 3RWCB 5FDWA 4JLRB 1IQDB 1RJLA 5BS0D 1AP2B 2DWDA 2N1KA 3MRNB 1BOYA 4Z18A 1DEEA 3FFCB 3PNWB 3QQ9D 4KHTH 3VXUD 1I3GH 4NZRL 1J05B 4HUVB 4KTDH 1AC0A 4JRXA 5LCVL 5HGBA 5IGXL 3FT4A 4NP4H 3ZSTA 5AG9A 5DHVH 4JPIA 5GRVL 2JCCB 4FMFA 1BF2A 1SJHB 2XA8L 4L29A 4X9FA 4BZ2L 2D31B 1BIHA 1YY9D 2AJ3A 4G8FB 5JHDB 3NIGE 2H1PH 2VDRL 4DKFH 3IVKA 2Z35B 2ZUQC 3C5ZC 3W0WE 5TE4H 4KQ3H 4K8RD 3QIWB 3QDMB 5D7IA 4XCEB 5GGRY 1KNOA 4LLWA 2JB5L 2J6EA 4MD4B 1HQRB 4Q58C 4JAMA 2UZYB 1VGKA 3GSRA 2BVPA 2FIRT 4DAGL 3MRDA 1RZJL 2R4RL 1GGUA 2LU4A 3HG1E 3FN3A 3NAAL 1LP9F 1SJVA 4NBXB 4OAWA 4PG9B 2R2BA 1Y6MR 4KV5E 3RDTC 3MRKB 1TTFA 4LAQL 4R3SA 4KK8C 4JZOB 3UC0L 1XR8B 2VXUH 3IAGC 3O2DH 2ADGA 3S96A 3RVXD 1BQLH 3HNVH 3DV4B 3QIUD 4OF3A 5DUML 3VFOB 4ODWA 3AXLA 3HZYA 3GMQB 4UTAH 5BVPH 2B1HL 4F3FA 2GUOB 2XZAH 4Y19D 5HYQB 3MOQA 3BW9A 2GJJA 3AROA 1PY9A 1J1XH 4N0FB 1P4LB 3ROOB 4QHNA 5C86A 3U9UA 3IDXL 1U8MA 3JWOH 5B39A 3JTTB 1JV5B 2DI9A 3MRGB 4ZAKA 4ZYKA 3ULSA 4KU1A 2HT2D 5DJXB 2YK1H 2Y23A 4JRYA 5FKAA 1KACB 3C5JB 4RIRA 1RHFA 3VRJB 2DI7A 1WISA 4NQED 3M07A 5H8DA 2AXHA 3RWHB 5LBSL 2OCFD 3WYRA 4QRPD 4LLDA 3VWJC 1T7WA 3AS3A 1F4AA 1AXSB 4P5TB 2FYYB 3AB0B 4HMEA 3BYYA 3MA9H 2BNQD 5AYUL 1PQZB 1ZANH 5D2LE 2FIKB 1FFOA 5CZVH 2CPCA 1BJ8A 3I2CL 3DSFH 1RK1A 4YDKL 2LTQC 4GKZA 1LE9A 2Q87A 2MQ0A 5BW7C 3BDBA 2DLIA 3P0GB 4X0KA 4AQ1B 3VXME 2R29H 3FOLB 3SDCC 1F2QA 1Y18A 5C0RL 5DUBB 1OB1B 3RVWC 2F58L 1YMMA 5IMOA 2MSPA 3L1OL 4KMTH 3DXAD 4N1CA 2C26A 5JOFA 3PQYD 1XR9B 3E2HB 3HE6B 5F70A 4U6YB 4ZFZB 5J11B 3CGTA 5E00A 4JVPA 4HZLB 1IQWH 5J1AB 3HCVB 1ZGLB 2Z31C 5C0IA 3MOBL 1F6AB 2EDDA 5DMIL 2QLVB 2A1WH 4HXBH 4NZJA 1FNEA 1HH6B 3QDGB 4RFOH 3WDHA 4IS6B 2VDQL 1NEZB 3KYMB 3ULVH 1WFUA 3C6LB 1KULA 5DJZB 4JANA 4ZUSB 1FPTL 4P9HC 5GIRA 5FUOH 6FABL 4IMLA 3FO9A 4MS8C 1JRHH 4YHNA 1HHHB 4LKCB 4MX7A 5F7NC 3GIZL 1UM6L 4DUXA 1F45A 3KJ6L 3DO7B 1U41A 4JQVC 1MJJB 4NHUB 3BP4A 5I16B 5CZXC 1YC7A 1A22B 4N0UB 2Y06H 4G6MH 2VZ1A 2IG2H 4KKAD 4QXUL 1YEHH 1BVZA 4NO0D 3THML 1IM9B 1HHIA 3KR3L 4P4KB 4X6CA 1OM3H 4R4ND 5I73C 4L8SC 3ES6A 4ZUWB 1EAPB 3PJSA 2AEQL 4Y4HA 5H37G 1BFSA 1EZVY 4HGMA 3BMVA 3H42H 5T1KB 2LFGA 3ILPB 3LB6D 3TO4B 1ZV5A 2R2EA 3LKQB 4QRUB 3DUUB 1Q94A 4QYOA 4JO3H 1INQA 2VIRA 4X83A 2DBLL 4R96A 5AZEH 5FKPA 2I9TB 4XZUA 1MJ8H 2C1PB 5ITFA 3Q48A 1XZ0A 4U1IB 3L3DB 3JVGA 3OQ3B 5EO9A 4X6DF 1SM3L 1PJ9A 1PG7L 3V6OA 2AEPL 4FQXC 4LIQH 2KZ1B 3R8BB 4KZEH 4IOSD 4GXVH 3SKNB 4ZSOE 3B4NA 4DGVH 5DR5L 5IB4A 1DQML 3WKMH 1FGNL 4C56A 1W0WA 1FLRH 3TIDB 3DX7B 3NIFE 1NDGB 5C3LD 1DBBH 1S7TA 4Y5YC 3MBXL 5CJ8A 3IGAA 4YE4H 4R4FL 1WBYA 4JKWA 3D0LB 3NPZB 3T3ME 1IEAB 1IZKA 2HJKB 1XH3A 4P4RA 4PGBB 3R0NA 1TJHL 4PLOB 4WI5A 4LPYA 3BP6B 3EO1B 1A4JB 1UWEH 4M5ZL 1CGWA 1VHPA 2YPLE 1JFQH 5GSVB 3SJVB 4PPTA 1QHPA 3H9ZA 2AEWA 4ZTPL 3WFEH 3SKJH 2BNUB 1HQ4A 4JM2C 5FB8A 2YRPA 2BNRB 4AEIL 5BVJB 4CRPA 3QI9D 1N3NB 1Q9OB 2QADC 5GRYA 3BE1H 1K5NB 2VH5H 2AK1H 2VB5A 3CD4A 3L5WB 4R2GC 4EBQL 5ACLA 3EGSB 5DHYA 3B5GA 1UACL 5J56B 3BRDA 4X9IA 3OMZA 1EFXA 1F4XL 2WQ8A 1D5BB 3KPRB 2YUZA 1TZIB 3CVIL 3PIQB 4LCYA 4AMKL 3QNXB 3HRZA 1HINH 4IRJB 4DWHA 4R0LA 5I1HH 2EE9A 3I50L 4KI5C 5IB2B 1YDPB 4OLVH 2VDMH 3VGFA 1S7VB 3GSWB 4RWYH 1JZ4A 5FYLH 1YEDA 4G9FA 5J06A 3ZTJH 4WFEE 2HT3C 1YY8B 5LGJB 4E5XB 1UKQA 3PGFH 1ROWA 2DICA 4HBCL 1G6RB 3U6RB 4TN9A 2XTJE 4UINH 5DHXB 1YPZF 2GTZA 2P8MB 1CT8A 4GQPH 2AI0H 1PG7W 3TBYB 3NA4A 2OQJA 3MXWH 3ZKXC 3BJ91 3FFDA 4YGVA 5I76A 3FO0L 2Q8AL 5D2NC 2XOTA 1JTTA 1J1PH 5GZNC 1KN2H 2FGZA 1PKQA 2JF1A 3LV3B 4R6UA 2WIIA 1S9VB 4JGMA 3AY4A 5AD0A 4EUPB 1NGWB 1CF8L 1NCCL 4XAWH 1HXYA 5ISZA 3EDEA 1N2RB 4LSUL 4C4KT 1WFNA 2C5DC 1FV1A 1TIUA 2NLJB 1CK0L 1K6QL 4P2RE 1OAQL 2IANE 3F7VA 3GUTA 1JHLH 4OLYH 5F9WB 3BPLB 4F8TA 1R3HA 3SDAC 1RI8A 5CEYA 1NUGA 4EDXA 2EC9U 5D9SB 4FXKB 1RFDH 3HA0A 3L3IB 4KTEH 3GJEA 5FYKU 2YRLA 4L8BA 2XN9B 2E7LC 2GCYA 3LKSA 1ADQL 2HYMA 3QUKA 4FRWA 8FABB 3CVHA 5IB3B 1G7IA 4FS0A 5EUOF 5F1IA 3BSZL 3CXDH 2EXWC 4JFHD 1A7QL 1CN4A 4LHUG 4JHAL 4EI6B 4ODUB 2ITDB 1CD9B 2JELL 3QHZL 4KRPC 1T21A 4JDZB 4PJCA 1FLTX 3WJLC 5IV2B 2IPTH 4GLRI 1T1YA 3ELAT 1YEGH 4LEOA 2X4RA 2PO6A 4I2XB 1VENA 2YKLL 3UTPE 4K71C 4S2SA 5HYSG 3T1WA 3B9KB 3K8KA 5SWZE 2H8PA 3D1MC 3HI5H 3VDBA 3LRGA 1TENA 4M3KB 1MJUH 2VO5A 3JXAA 4QRQB 3S35L 2DYPD 2B5IC 3KPLA 5ECJE 4ALAL 4XNUL 2V7HA 2WBJB 3SE8L 4DCQB 4RISL 4LKXB 3BJLA 2ZCHL 4PJDB 4EN3C 5K9KA 1LO5B 4NQTA 3FQRB 3E1F1 4E9LA 3IFNH 3RIFF 3LSOB 2ZOLA 3T0EE 5JOPE 4JO2H 3SCMD 4HKJA 2MFNA 1C5BH 1CFSB 1CICC 2J5LB 2GTWA 4Q97A 3M17A 1SQ2N 4Z7WA 2G60H 1DVFA 5HHXH 1R3LA 2R0ZH 2MMXA 3K4ZA 1KJ2A 4FNLH 2CKBH 1QBLL 3MA7A 5D1QA 2XTLA 2ARWA 3P4OA 1CVRA 1KFAH 5FGBA 5C0DA 3UTSE 2DJUA 1CL7L 4JKPL 1N6VA 4F15B 1KCRL 5IMLA 3B9AA 1I8LA 5FM4A 5F9DC 1H0DB 3MOAH 3OAZK 4YLQT 4X5XB 3DRTB 1KIPB 4FHBD 3BYTA 2R56H 4QLRA 1IGJA 1K85A 4G80A 5DYOB 3OAZH 4NCDA 3V4VH 1QRNA 2JJUA 3N9GL 2OL3A 3DX6B 2YN3A 4G6JL 4PYGA 2NY6B 2CLVA 5EWIH 3VXTB 2BFVH 3O4LA 4XH2A 2LABA 4CU6A 1SHMA 2C3XA 5SX5K 3VGGA 5BVPL 3G5XB 1X5JA 2MHAB 4Q9RH 5MHSD 1YUHB 1RJZB 3QAZB 4UV7L 5ACMA 1NCAL 2HVKA 4X6FA 5SX5H 5DSCA 3JZ7A 1NUDA 1AO7D 1J1XL 2JIXD 3X3FH 4FABH 1X9QA 4QRRB 3RL2B 2HAZA 1Q0XH 2AV1B 3QUYB 4FN0A 5DD0L 1MIEH 2E27H 1I3RA 1WBXA 5BJTB 1A64A 1WAAF 5ALCH 3VMOA 5E94A 2EC8A 5HHPA 4QHMB 4LCWE 3QUMA 3CFEA 1B9ZA 5ILTL 5T5FL 4BSVB 4DVBB 5C92A 3P73B 3LDBC 5FDWB 3UTZA 2AERT 4HIIA 1IARB 1RJLB 2DWDB 3U0WL 3UTTE 1D5MA 1DEEB 4L4VE 1X44A 3HC4H 4I0PC 4OCXH 1A6UL 4OD3H 3MRCB 3T0WA 5C2BH 3BQUA 4JRXB 3QCUL 4NFDA 2DQUL 1KEML 1MFAH 5HGBB 3FT4B 4L9DA 2VZTA 1FSKB 2W59A 2EDQA 3FRUB 3CFIC 1WV7T 1CQKA 4JPIB 2BHYA 4PP1D 2PTUA 3OX8A 4L29B 1JWSA 3MSPA 4WGVB 4P3DB 2HG5A 2AJ3B 1I1CA 4NWTL 4KKCD 2WMPA 3QT2A 5BS0E 4QRTA 1FO0H 3IVKB 1QFOA 4PGDB 1K9TA 4HFUL 3SGJC 4QGTA 3VXUE 1A6ZA 4XWOD 1E6OL 1YJDL 4IDJL 5FCUL 5D7IB 5C09A 4QY8A 1KNOB 3K2UH 4LLWB 1BVLA 4B5EA 2IAMC 4JAMB 4OZIE 1VGKB 4JO4L 3GSRB 3FN0L 4YXKH 2BVPB 3FRPA 2NY3C 4KFZC 1NCWL 3MRDB 1TNMA 4OAWB 4FFYL 2R2BB 4H0HB 3O3AA 4FTVA 1Z3GL 1RUQH 4Z0BH 4LARL 3IS0X 1ZHBB 4TVPL 1MI5E 4XXCC 2ADGB 3S96B 1OPGH 3CLFH 4UOW1 4MAYA 2X6MA 2Y06L 4ODWB 2DJ4A 1NCNA 3AXLB 3HZYB 4JFZH 4NKMB 4O2EA 4LIQE 5HYJE 1OGAD 3Q5YA 3BW9B 2YUVA 3EYVA 2DLFL 4WTZG 4G9DB 3TT3L 1OM3L 1G9MH 5TQ2H 4QHNB 3U9UB 5B39B 5BXFA 1DBJL 3V5DA 2AQ1A 4ZYKB 1Z9LA 1XIWA 4RMWA 3SDDD 3W2DH 3H42L 2QL1A 3ULSB 1EFQA 4ONHA 3QIBC 1NH6A 1MF2H 1VB9A 1ZLVK 4JRYB 1FCCA 5FKAB 1RUPH 4HCRA 1H9VA 3O3DA 1GC1H 1ZLVH 4RIRB 4PJHE 7FABL 2OZ4L 4K8RL 1CZ8H 1G9NL 5I1EH 5J3HD 4JR9H 4LLDB 3MODL 2BXZA 2ERJC 3E6HA 2H2SD 4Y19E 4AENA 2P8LA 2PR4H 4UAOB 5IJKA 4KRMB 4ZPVA 3VJ6B 4UUJA 1LK3L 3AM8C 2C4XA 1QUNA 4Q9QL 1MNUH 5FO8B 4KXZI 1RK1B 4GKZB 1HN1A 3VG9C 5EPMA 3SE3A 4PJIF 5JPMA 2VTFA 5DZOA 3TP4A 4X0KB 3TBWA 4D3CH 5D6DC 4EI5D 1VFBA 1WC7A 1Y18B 4HKXA 1SEBA 4NQEE 1YMMB 5IMOB 4M6OL 3WFBL 4C83A 4QRPE 3V4PH 4HG4J 5JOFB 5KVEH 1BGXL 2D7QA 5DVKA 5L2JA 5HGAA 5E00B 4X8JA 1BJMA 4I3GA 2BNQE 5IHUH 3VXOA 2YD1A 2DKSA 5C0IB 1OAXH 2RFXA 4M4RA 2R0KH 1G7LA 4BM7A 1FNEB 1NLDH 1HIML 5FYLE 5D1XA 3QDHA 1U92B 4JKLA 4TULH 2Q7YA 5E6IC 4P2QB 4XC3L 4JANB 4OIAA 4QTHA 4U3HA 4IJ3B 1A6VH 3ZLQC 2VE6A 1AD9A 3DXAE 5GIRB 4M6ML 2IQ9L 3D85A 1TZHA 4IMLB 3FO9B 3GBNH 4YHNB 2AK1L 2P5EE 1Z2KA 4MX7B 1MEXL 2IF7A 3MLRH 4AG4H 2DN7A 5HVWA 3BP4B 4XCFL 5SX4I 2V5SA 3IFOA 1ZHKB 4GQ9H 3KXFA 3QHFH 5EZIL 3QPXH 4POUB 4ODSH 4NQSB 4JG1H 1KENL 1OT1A 4HIJA 1INDH 5LQBH 2YUWA 1AXTL 5GS2D 2DTSA 1HHIB 4KK9C 3MNZA 4TSCL 4X6CB 3RQ3A 4ZD3H 3VD4A 4Z7NF 4JFQA 2PXYA 4M7KH 1AR1C 5CS7A 3PJSB 4LCIL 4Y4HB 1AQDA 1V8HA 5EBMA 5IVNA 5I1LA 4LL9A 4GAJH 2R2EB 2CRMA 1Q94B 4ZMAT 4JY4A 4QYOB 4OBRA 1UM5L 1INQB 2VIRB 5ADOL 4P48A 4R96B 2NX5A 3N06B 3ZE0F 5FKPB 3P0YL 2OK0L 3GSNL 4XZUB 2R15A 1G1YA 3K1DA 5ITFB 4UNTA 5DQJA 3I3DA 4JFDE 1U3HD 4APQD 5EO9B 3BKCH 5E99L 5L6YH 3OR7A 3ARGA 3HI6L 4EDWL 2E9JA 2BY2A 1IGML 5ACZA 2BHUA 1W0WB 2NR6C 1EERB 5F9AC 5CBEA 5KS9E 3QEUA 1QFWH 1S7TB 4ETYA 5E8EA 2X4OA 3BD4A 4S11A 3IGAB 1P4BL 5JW4R 5L0QB 3KGRA 3VRLE 1WZLA 3MACL 1MFDL 1OCWL 1CL7I 2D03L 1WBYB 1IAIH 3LHPH 2D9QB 2GJ6D 5MEND 5BMFL 4P4RB 3QFJD 5JMRA 4Y1AA 4ORGA 1UJTA 3UZVB 5D7JC 1BOGA 2XFXA 5CJXC 3EJJX 1KGCD 3T0EC 1JZ8A 5IHLB 1U8LA 4ONFL 1EMTL 3H7LA 3FO2A 1JCKA 5L7XL 4G8GA 2NY0D 2QTEA 4CVXA 5HDBE 3ZT6A 1PZ5A 4J12A 1HQ4B 4EEEA 4WFFE 5FB8B 4OZHB 5I1GL 4MD0A 4N68A 4JDVA 2B39A 4ODBD 5DHYB 3V5KA 4HS8L 2CD0A 3TFKC 1S78C 2WLYA 1X5IA 1F90L 5FGCE 4XMLH 1BX2A 5EBGA 4M62H 3ARBA 4LCYB 4XHQA 5AEAA 2VLMD 3HRZB 5T3XL 2HKFH 2X7LB 5F6HI 3H3PH 1CD1A 5TFSH 2CMRL 4I3SH 3CMOH 5FOJA 4PRAA 2OJEA 4G9FB 4DKEH 3SN6N 5CLWA 1GYAA 3NTCH 3WD5L 1B2WH 4PJFE 1U8QA 2BJMH 2GTZB 2HLAA 2W91A 4X7FC 3T2OA 2YZ8A 1CT8B 4LRNL 3BZFA 35C8L 3JUYA 3P3YA 2OQJB 4JZJA 4ODVL 2A38A 2P5WD 4F7CA 3FFDB 4YGVB 4ELME 5I76B 3Q6GH 4QF1A 3ZYOA 1F11A 4NN5B 3U4BL 1DANU 3RWIA 2YSSA 4PJ8A 5KSBE 1CDCA 3O6FC 1NAMA 1GHFH 1PKQB 4Y2DB 2BY1A 3NVQA 1A0QH 4XNYL 3QZWG 4HC1L 2ADIA 1FYTA 2LVCA 5KW9H 2WIIB 1JF6A 2ED8A 3SY0B 1NMAH 4MNHA 3P30H 5JUEL 1FAIH 1TCMA 5AD0B 2BMKA 2Z93A 3WUZA 4PJAE 3VH8A 1WEJH 3UO1H 1QACA 5ISZB 2NYYC 2VXTL 4P2OA 3EDDA 4FQIL 3U7WL 2BRRL 1T5WB 2FLRT 3HMWL 4NOBA 4GRLA 1INEH 1FV1B 1KCVL 4Z7VA 3B5TA 5AAMA 4BSJA 1MWAA 2VNCA 3T2QA 3F7VB 3GUTB 1HNGA 3CFKA 4J8RA 3HLAA 4IMKC 3AC0A 1IGCH 2J8UA 4K9EL 3GK8L 4TNVK 1R3HB 3QEQA 1FIGH 5GS2H 3MYJA 4Q7DA 2XI9A 5CEYB 3ARED 3DARA 4EDXB 4QNPF 2Q76A 3B2UC 1J12A 5C08A 2AS5M 4S10A 1CGUA 4G8IA 3GJEB 1FVDB 3DGCR 1FAKT 4L8BB 4M9OA 4ZS6D 4HGKC 2GCYB 3LKSB 1T7XA 3QUKB 3T2NL 3CVHB 4WO4A 4X7TB 1G7IB 5EU5A 3PL6B 1MCNA 5F1IB 2AJXH 1S5HB 4OGAD 1EGJH 5EBLB 1YY9C 4N90D 3C2AL 5F7UA 3T04D 4HK3N 2EDHA 5IVXE 1T5XB 1V7ML 2DMKA 4Z7UF 1T21B 5C07E 3L3HB 2B2XH 2VQ1A 4PJCB 2RGSA 1CU4H 2M2DA 2YWZA 1D5ZB 1T1YB 3MUY1 4LEOB 4PYHA 2X4RB 2PO6B 3DVIA 3PWLA 1DQQA 4M8QA 4S2SB 2O93L 3VFGH 2YHGA 1ZVSA 1W0YT 2H8PB 5J6GA 1J1OH 1T66D 5E2UL 5ESVA 4MD5A 4M8VA 1IKNC 1EDQA 1U8NA 1C08A 3K81A 4P46C 5HHMD 1HCVA 4DGIH 3ZE2F 2JB6A 5J12B 3KPLB 4JDTL 5E2VL 2DQHH 2HT4C 2V7HB 4UDUA 5EUKA 3I6GA 1RZGB 3B43A 2HFTA 1FZJB 5HI3D 5K9KB 1B88A 1UH2A 2AJSH 1KPVA 4GW4A 1U95A 1HKLH 3NFSL 5JDSA 2AJZA 2JCCF 3EFFA 2ZOLB 4A6YL 2EE3A 5HDQL 4Y16C 1LD9A 1TTGA 4HKJB 2VZ3A 4JFEA 3QIUC 3LS4L 5F7DA 3RHWK 1UZ8A 4DFHA 5MEQA 4TSBH 3M17B 1YEFH 4X6EA 1DVFB 1FC1A 1C5CL 1R3LB 2NY4B 5GRZA 1KJ2B 3TLRA 1OARH 1EH9A 2X4PA 3EOAA 3BT2H 3MA7B 2V5MA 5D1QB 3P4OB 4PR5A 5C0DB 4HPOH 2R4SH 1FBIL 3ARFA 1IGFL 3C9NA 2HT2C 5IMLB 1QFWM 2O5XL 2XG4A 1E4XL 1FNGA 1UQSA 4LLYA 1HKFA 4JPVL 4I4WB 4JFFD 3VGDA 1RZFL 5LWYL 1IGJB 1CGSH 4XBPA 1XCTA 4XMPL 1QRNB 1XGQA 4NQUA 4D9LL 2OL3B 1IAIM 2EDRA 4P3CH 4OLWL 4RGMB 1A6WH 4U05A 1NEUA 2CLVB 3RWDA 3O4LB 3RWGA 4MMXC 1MLBA 4XH2B 3BVNA 4ZOBA 4Y5XC 4BFIA 3DMMC 4JFZL 4K7FA 3TVMC 3MV8A 4OGXH 2HVKB 2O26U 5DSCB 1LP9E 2KUTA 4XBEH 3MRQB 2OMBA 3PWJA 1IGYA 3ZKND 1EBAA 4PJXE 1PLGH 4Z6AT 1I3RB 1VADA 3PWPD 1WBXB 2WWKO 2HN7B 2PNDA 4NNPL 5E94B 5HHPB 3TV3L 1T3FA 3QUMB 3CFEB 4KPHH 5AG8A 3BP7A 1W8NA 1AI1L 3ULUD 3UTZB 4Q6IC 3FO1B 3VXSA 4D0BA 4HIIB 3KJ4B 1EK3A 5MHSE 2ZWLT 1D5MB 3MFFA 3CDGA 4O02L 4OZFA 3W9EA 1MRCH 4P59L 4LSPL 1JGUH 3BQUB 2EH7H 1GAFL 3HG1A 1Q1JL 3MRRA 4H8WL 1EHLL 4QTIH 1ITBB 1BVKA 1XGRA 4X6BA 2H32B 3V6ZA 2FX8H 1DLFH 4QXTA 3OX8B 2QQNL 1DSFH 4YBLB 3V4UL 3SQOH 1JWSB 4OSUH 3U30C 2MCPL 2HG5B 1XFPA 3HNSH 4ODXA 3K4DA 2ICWA 3H9SD 4QRTB 5C6PB 1FIEA 4ZXBC 4Z8FL 4WUUE 1A6ZB 1B90A 3DNKA 3HC0A 3BKYL 1Z5LA 3GSOA 2M26A 1MCOH 3NGBB 4J23A 4R90L 5C09B 3MRLA 4TRPH 4QY8B 4KKAC 1MUJA 1BVLB 2W60A 4FFZL 3ARRA 5SWSA 4M1GL 3RGVC 1JNHA 1CFQA 4WW1A 3BGFB 3ZMRA 5IMKA 3TN0A 2NY2B 3KWWA 4FQLL 1I7TA 1WT5C 5INDA 5IWLA 3LB6C 3LEYL 4UT9H 4PG2C 3O3AB 4HUNB 5I19L 4NO2A 5TDOA 1LK2A 5BV7C 3NABH 5FHBH 4ONGL 5CGTA 3AS0A 1K8IB 1X5AA 4KH2A 2E9IA 1K4CA 1MCSA 4MAYB 1V7NH 3N1MC 4Y5VC 2Y72A 4NC0B 2EDOA 2X44D 2A74A 4O2EB 2A0LD 3GDBA 3NCFB 3HZVA 4TSAH 5TQ0H 1FDLL 2BOCB 2C3WA 4ERSL 2DQCH 1KELL 1YYMH 5BXFB 4KUZL 1FFQA 1XIWB 1VGEL 5SV3A 4GMSH 2XWJA 4K3HA 3AS2A 2X89D 5DC0A 3O3DB 3MUHL 4H1LA 3RZCB 5E8PA 1DR9A 3LRSA 1CCZA 1DDHA 3MLUL 1V05A 4FFVD 2APFA 1OGAE 3E6HB 3IT8D 4AENB 2P8LB 5KG9A 1QSED 3ZKMC 3ZO0A 4ZPVB 4OF5A 4UUJB 1PX4A 3B2VH 3L3JA 3GKWL 1ERNA 1G84A 5KSAA 3RI5K 4GJTB 3KYKL 1JZ6A 5EPMB 5AWNH 2KKQA 1JF5A 5KVDL 5JPMB 3IDUA 4QHUB 3B8SA 2L7JA 3KPPA 3TBWB 5I1CH 4XNXH 1VFBB 1WC7B 4HKXB 1SEBB 2O61B 4YWGH 1TJGH 4OI9A 1S3KL 1DBAL 3MNWA 5F8QC 1FNLA 4X6DE 4Q6YA 2GJZA 1LO4L 5E4EC 1K2DB 5L2JB 3FHQA 4GBXC 4X8JB 4KQ4H 3ECBA 1YEKL 1MRDH 2G9HA 3BWUC 3VXOB 2D4FA 3AMLA 4YHZL 2ICES 1PVHA 2RFXB 4J4PC 5JQHC 1D6VL 1G7LB 1T83A 1A5FH 5F6IC 5D1XB 3NA9H 4KY1L 4WTZA 4OIIH 5KTEH 4QTHB 1U42A 4YK4B 4KVNH 3HMXH 3C5ZB 5H94A 1AD9B 2B1AH 4HH8A 4OBSA 4HX1A 2OJZH 3DOSA 3Q1SH 1T0PB 5FAAA 3ULUH 4OV5A 4HWEL 4RZCA 5TPWH 4OM0L 3D2UD 4U1HA 4HG4K 5E70A 2I25N 2KZWA 1JJUA 4M62L 3KXFB 5D72L 4ZSOA 1UA6L 4HIJB 4L3EA 3FL7A 1Q72L 1OSPH 2Z91A 3MNZB 5IVOA 1R6VA 2BP3A 5FUZH 3S3JA 2QQLH 2PXYB 4JFQB 1AQDB 1QRKA 5T3ZD 1L0QA 5EBMB 5I1LB 5IESL 1OAKH 1TQCB 2PN5A 4LEXH 2ILLA 5ID1A 4JY4B 2EE2A 1M7DA 5C1MB 1KJVA 3G04A 3MRJA 5GGQL 2NX5B 4PB0L 3CH8A 4WUKH 1LO0L 1E6JH 3CNKA 3MREA 5DQJB 1I75A 2EIBA 1F8TH 2E8YA 3IDJA 5B3JE 1A1MA 9CGTA 1RUKH 3X12B 1WLHA 5C7XL 4S1DC 2ENSA 4MA8L 1EAJA 3ARGB 4RFNC 4S1QH 1FAIL 2HLFD 1A14L 3WFDH 1UADC 3MV9A 5ACZB 2IBBA 1SYVA 3DUSA 3QEUB 1CDBA 2DAVA 1G6RL 3QDJA 2NXZD 2X4OB 4RBPK 1INEL 2QHRL 4H5SA 43CAA 4FG6C 4X4ME 2JJVA 4U1SA 1MCKA 4RBPH 4L8DB 1FG2A 1L7TH 1E4XI 5HY9B 5CJQL 1T89C 4Y1AB 5C6WH 2B0SH 4ORGB 4N0YL 3VWKA 3HB3D 2VXVL 5DJ6A 1BOGB 2XFXB 1YPZA 3OKKA 1U8LB 3FO2B 1CE1L 4IM8A 3DROA 5D7SL 1L0XA 3BEVA 4CVXB 1TTUA 3REVA 4D0DA 1PZ5B 4U1KB 1BWMA 4QCIA 4NQDD 4QXGH 3ZDZE 1DFBL 5C9JA 5HGHA 1G9MC 4JREB 3WHXA 4HK0A 1CQYA 4UIKL 4JDVB 2GJ6E 5BOZG 5MENE 3DI2B 4I3RL 3D69A 3V5KB 1H8OA 2FCBA 5E56A 4OLXL 5GZOD 5L88H 2XQYG 1BX2B 1KGCE 2D3VA 4WTWA 5F89A 4ENEC 5D1ZD 2VDPH 1CDUA 3ARBB 4CMHC 5CEZD 3TYGL 3VDAA 1U0QA 3QJHA 2AABL 4WW2A 4YXLH 2B4CH 1CD1B 1KTDA 2OP4L 5CSGA 4LGSB 1YYLL 4PRAB 4JCMA 4PS4H 4Y4KC 2OJEB 5IG7A 4XPTH 5GS0D 2ZG2A 1I1AA 2VDLL 1JBJA 2PTVA 4HFWA 2OR7A 4LCCC 2R9HD 2QSQA 2HLAB 4FP8L 3IAPA 3BZFB 3BGAA 2F19H 4JZJB 2WV3A 4F7CB 4MXQD 3FQTA 4G6FD 1T6VN 4QF1B 5GHWH 3IRZA 4N0CD 5C0AD 1DQJB 4NIKB 2FATH 1F97A 3TNNA 3RWIB 2YPVH 1JGEA 1WBZA 3U7YL 4YAQA 4PJ8B 4PJDF 3CFBA 2AQ3A 1NAMB 1NMCB 4JM4H 5EUOA 3C60C 3VA2C 1JPTH 2ADIB 1FYTB 5L9DL 4LU5L 2V5YA 5DI8A 1X3DA 4TOYL 4DEPB 3NPSC 4AIOA 2BMKB 1SEQH 2Z93B 3STBA 3VH8B 2NY7H 4JB9L 1XF2A 3QULA 3ZHDA 1CD8A 2P5WE 4P2OB 4LPUA 1MFNA 5I8OL 3LCYA 2ESVA 2VLRA 4GRLB 4WIQA 1U91A 4Z7VB 2DQDL 1IFHH 1MWAB 5HI5C 4FQXB 5I18L 3MFGB 3KPSD 1DQLH 3IS1X 4J8RB 3CFKB 3HLAB 1FZKA 4PRHA 4MXWL 3QEQB 4HJJH 3MYJB 1QSZA 2Q76B 1QFUH 2XWTA 5C08B 3TCLA 5M7QA 1S7WA 3TA3D 3BZDA 1WUNT 3O2VH 1PSKL 3ARDC 4B7IA 5T3ZH 2XICA 1MVFA 1R24A 3A6CH 2ED7A 4XMKL 3LMJL 5EU5B 3UJJL 4LPVA 3MBED 3O9WD 5J8OA 5D6CB 4L4TD 1MREH 1P6FA 1A3LL 5CJXA 4J2XA 4KZDH 5IFHH 3WLWD 2KQNA 3IDYB 4TPRH 3O2DA 3BPOB 3QXDA 4KKCC 5CCKL 2GY7B 3A6BL 1T7VA 1QYGH 4G7YL 3WJJC 4JHWH 3PWLB 4ZDHA 1DQQB 4K3DH 3WUWB 4M8QB 5GGRA 4ETQA 1ZVSB 3NCJL 4V1DD 2QADB 5J6GB 3QZWA 5ESVB 1NKRA 4QGYA 4MD5B 4P5TD 3VRIA 1U8NB 1C08B 5DQDL 2JB6B 4O00A 5J1SC 3RWJA 3WIHH 4AL8L 1DLFL 5EUKB 4O5LL 1FYHB 3I6GB 5I1IL 5E8DH 2IFGA 1NBYB 3O8XD 4YEEA 1KPVB 4GW4B 1U95B 4GRWH 1TMCB 1G7HA 5JDSB 2AJZB 3EFFB 5ENWA 3S88H 3LZFH 1XGTB 1IAII 1LD9B 3LPGA 4NM4L 1K8DA 4JFEB 1PX3A 4NQCD 1NEZG 5F7DB 1UZ8B 4ORZC 5MEQB 1WWCA 4X6EB 5D5MB 3F7RA 5HHME 2B20A 1UYWL 1NMBH 5EZLA 4DGYH 5GGUA 2X4PB 3EOAB 3WFCL 4PR5B 2PYFA 3O6LH 1TNNA 2BDNL 3ARFB 3C9NB 6CGTA 1F3RB 4UT9L 1FNGB 3VFPA 1UQSB 4LLYB 3ZKQD 4ZNEE 4BQ6A 3OF6A 3UTTA 5CEZH 4XBPB 4GW5B 1KJMA 5BRZA 1KYOJ 4TVPE 1XCTB 4KMQA 1XGQB 4YHPA 3CXHJ 5I1AA 1LDSA 4F58L 4HJ0D 3N1PC 1T7ZA 1CBVL 1UCBL 3RWDB 3RWGB 1MLBB 2XZCL 2G5RA 3BVNB 4PJ9A 5GS0H 5DT1H 1WICA 4IRSD 4XCNA 4BFIB 4K7FB 4NUGL 1F4HA 3MV8B 4YNYA 1BP3B 1EVUA 1J8HD 4U3CA 3RA7H 2FHCA 2J6EL 1EJOH 5D70H 3PWJB 1IGYB 1WIPA 4JFFE 1P2CA 5BS0A 1VADB 4OCWH 1RIVL 2CLRA 2EO1A 3U7AA 3BRGC 1T3FB 2VC2L 4JO1H 3CFCL 5T1KD 3LQAH 4F37K 3BP7B 1MQKL 1QSFD 1RURL 1UENA 4YHMH 4BQBA 3T09A 2DQJL 3VXSB 4D0BB 4M7LH 1KN4H 1QOKA 2BSRA 4NRZA 3MFFB 3O6KL 3CDGB 4X7SH 1E27A 4OZFB 4MAUL 5LG1A 3W9EB 1T22A 4OZIA 4OFKA 4BELD 3R1GH 5HGGS 1QKZL 1TXKA 4HUWA 1KCUH 1NGQH 1VFAA 4N8CH 1C1EH 3W5NA 3HG1B 4NDMA 3KYNA 3PWPE 3MRRB 4FQPA 2COQA 3UJTL 1BVKB 1XGRB 4X6BB 1HILB 3V6ZB 2IBZX 4L1HA 5HYIA 4LBEB 4QXTB 1YEJH 3MZTA 2OZ4A 2GITA 5ITBH 5JTWA 3ULUE 2ICWB 3V7AG 1ETZA 4IEFB 1MCQA 3OGCA 1TJIH 5MEPA 4YFEA 4PJ7E 1FP5A 4MVBC 3HC0B 4Y4FC 1KV3A 1Z5LB 3UPRB 2VZSA 2NY1B 3GSOB 4CN4A 4S1SL 4WWKA 3I9GL 2B5IB 2Y07H 3KHOA 3MRLB 3OAUL 1M7IB 4GAFB 1HHKA 3MUGA 2W60B 1G0XA 3HC3H 1MAML 3QXWA 3ARZA 5SWSB 4IIQC 5IQ7L 1CFQB 3GI8L 2ORBH 3EAKA 5KTEL 3QRGH 3TN0B 2DMBA 3DGGA 3DURA 3KWWB 1I7TB 5INDB 3RDTD 4LRIC 4MNQE 4GSDH 1T6WA 3H9SE 5C0CA 2ZCKL 3QIUA 4JFYA 1IBGH 4FQJL 4NO2B 1LK2B 2ZSWA 3C8KA 3TZVC 3VFTA 2BX5A 5GRUH 3TM6A 5IFJA 1MAJA 1YEEH 2F5AL 3BKJL 3MJ8A 1K4CB 3MLPA 1U3HC 4APQC 2WQRA 5JW3H 2R0LH 5DMYA 2A74B 4X8XA 5DC4B 3HZVB 3L5XH 5I0ZA 5IHZA 2DM7A 4Z76A 3MRMA 4HBQA 4HS3A 3RKPA 3VXMB 2LU3A 4NOFA 2ZUWA 1LO2H 3QISA 2NY5H 1ZHNA 4XVUD 3BRFA 4DK6A 1EUUA 4QRPA 2XWJB 4X6CF 4YIQB 4ZO7A 2DQIL 1VPOH 2MQ3A 4U0RC 4EIZC 3NFNA 3BIBX 1SBSL 4H1LB 4LP5A 4YHKH 5E8PB 5KVFL 4KAQH 4K3EH 3RBGA 3O4OB 3VWJD 3LRSB 1DDHB 2H6PA 5GGTH 1JYWA 4EUPG 3MCLH 4HUXB 4DW2L 3L3JB 3T08A 4FQQA 5KSAB 2HWZL 1NBVL 3EO9H 3PQYA 3UXFA 3SDCD 3U82B 5EO0B 4PRNA 5IF0A 4OTXL 3RVWD 4OZGA 3KPPB 5I15H 1RZKL 5IBTH 2DDQL 3CC5A 4LMQI 3MNWB 2NXYD 2GJZB 4PUBL 1J86A 2FD6H 2FB4H 4YHIA 4AH2A 3QH3A 1BD2D 4UV4H 4M5YL 2Z31D 3OSKA 1KXVC 3ECBB 4WHTA 1I1YA 2G9HB 4UZGA 4WY7L 3ZYZA 5DD1H 1E4KA 2X42A 3U79A 4Z95L 1RUML 2WBKA 4Z77B 4RAUA 5E1AB 3FJTA 5HHVH 3JWDH 1TLKA 1R3JA 1A7RH 3SE9H 5DQ9A 5H94B 3VI3E 4W70A 3W11D 4MNGE 4HX1B 4OV5B 3MR9A 5D7LA 4U1GC 1QNZL 1R0AL 2NNAA 3PV6A 1IGTB 4RZCB 2VDOL 2YRZA 5AYQA 4NN6C 3NACH 4NO0A 4OZHF 5CZXD 3U83A 3K80A 1DBML 4ZSOB 3RGHA 4UOW0 1AGEA 2UYLA 1N59B 1X5FA 4L3EB 3HFMH 4ACPA 3OR6A 2JJTA 4R26L 1I9RH 1ZWIA 3I75B 3DJ9A 5I8KH 2Z91B 1BM3L 5C0GA 4G42A 2IFFH 3CFJA 4LSRH 1AY1L 2X4SA 3QO1A 4BQ9A 3S36X 1WCQA 1G7PA 2I27N 4XNQA 4KVCH 5IBLC 4O9HH 4Y5VA 2O5ZL 5ID1B 4NKIH 2A9ML 3V0AC 4QXWA 1M7DB 2XXMB 1KJVB 3G04B 2GYSA 1S7RA 3MRJB 1FH5H 4WHYG 2BOBA 3MV7A 3MREB 1TQBC 7CGTA 3AREC 3IDJB 1A1MB 4XCCH 3X3GH 4PRPE 3QIBB 1WZMA 3CZFA 4Q74A 2BK8A 5DD3L 3GSVB 4ZS6C 2E8ZA 3MV9B 4OKVB 5TE7L 1UEMA 3M8OH 4RMVA 3VXNA 2ZUVA 3QDJB 1AQKL 4IOFD 4IRZL 2P45B 4NM8H 2ERJB 2ZKHL 4H5SB 43CAB 1GGTA 4NKDA 4U1SB 1GGCL 1T03L 4HQQH 4YDVA 1FG2B 2QSCL 4I5BA 3T0VA 2AJUL 3T3PE 4I13B 4OCRH 2PYED 1OLZA 1XMWA 3HZKA 4Q0XH 1LO3L 1NLBL 3VWKB 5DJ6B 3VG0H 4K3JH 3OKKB 1CDJA 3DHMA 1NC2D 2F54E 1BZ7A 4OJFH 2CKBA 2D7NA 1S5IL 1YJDC 3QI9A 4H20H 3DROB 5T3ZL 3X17A 2XTJB 3BEVB 4JM2D 1RUAH 1P7QD 3REVB 1QHOA 5F88B 4KK5C 4D0DB 3RU8H 2LAGB 1N64H 3HR5A 4YZFE 1P7HL 1S9YA 4U4BA 1T2XA 2OYPA 3C08H 5HGHB 3OBAA 3WHXB 2AV7A 4HK0B 1KF9B 1N6UA 3BZEA 4RDQG 3TEUA 4XVTL 3D69B 5HI3C 3SOBH 2NW2A 3EBAA 1RULH 4GRWE 2APTA 5F89B 1JNLH 1NFDE 4KI5D 5ESAA 3TT1L 1QPPA 2BZDA 3VU2A 2BVUA 3QJHB 4WW2B 3QUZA 1WVZA 4M02A 1KTDB 4HHAA 4PJCF 2QHLA 5EIQA 3BIAX 1N6QH 3INUH 5IG7B 4NQDE 5K93A 5C0BE 4LVOB 1I1AB 3HUJE 5I1KL 1FFNA 1LEKA 4HFWB 1C8PA 2MQCA 5EBWA 5ANMA 1E4WL 2Q8BL 1JVKA 5E7BA 5GJTL 1MJ7H 1BEYH 4WEBH 1CLZH 2ZJSL 5KVMC 2EDNA 3BPNC 4XX1G 3GRWL 4DJMA 1WZ1H 1JGLH 5CEZE 1OP3K 5T1LB 1IGIL 4KDVA 3TNNB 1EX0A 1JGEB 2CJUH 1WBZB 5DFTA 2DIJA 2FJFA 4YAQB 3FZUD 1OP3H 3CFBB 5HVGB 1G9NC 1Y0LA 4WGWB 1YNKH 4P9HH 4HH9A 1ZGLM 4OFYA 1MELA 3EFDH 5JXEA 2PETA 4ZTOL 1Z0MA 5DHVB 3R06B 1RQ5A 1XF2B 3IJHA 4MJ2A 2W9EH 4PJ5D 2RCSH 2R0WH 5IVXA 1MIMH 2VLRB 3D39A 5C0AE 3FT2B 1FO0A 1U91B 2X1PA 2XZQH 1JWUB 1NL0H 2M8XA 3IFLH 1ZE3C 3FQXA 4JQIH 2WUCL 4C57C 1FZKB 4PRHB 3ULUC 3FFCA 4YBHA 2IALA 5CILH 1MHEA 2BY0A 3GI9H 3W0WD 3OPZH 2RR3A 4HUVA 5DT1L 4KUCF 2XWTB 3TCLB 4PJBF 1S7WB 4O2CA 3E6FA 4F37F 5HHQA 1IEBA 3EDKA 4PB9L 3PP3K 1R24B 1KJ2L 1U6AH 3KPQA 4U2ZA 1FVCA 5EU4A 3SQBA 3RY5A 2JCCA 3FN9A 4YX2H 1EO8L 3PP3H 4NHCL 5I66A 2NTFA 1WWAX 2HFGL 3KPSE 3O3UN 1ACZA 3REWA 2A73A 3GKZA 3T0XA 4KRPD 4ZAKD 2WWKT 5EU7C 5CP3A 2Z35A 1FE8H 5DLMH 5I30H 3QXDB 4JY5H 2FNBA 4JRYD 4TUKH 4P23C 4JQXA 4GG6E 3ET9F 3QDMA 4D9RE 3DVNA 3ZDYF 3O45A 2DYPA 4X7SL 1MPAH 4ZDHB 1T1WB 1RIUH 1BBDH 2FBJL 2ZSVA 5GGRB 4WV1A 4ETQB 2VRAA 2BC4A 4P5KB 5I1DA 5IT2H 3QZWB 4B53A 4YHLL 1ZA3A 2RBLA 2MNUA 2X1QA 4E42A 4DUVA 5IB5B 4L4TE 2DQTH 3Q2CA 4BJLA 1UH4A 4M00A 4EN3D 3MRKA 12E8H 5DJAA 1ZLUK 4XB7A 3SCMA 5ICXA 4PY8I 5GISL 1BFVH 3QCVL 5D8JH 1ZLUH 4OCYL 3QUML 4XNMA 1MY5A 2BSTA 5K9JL 5FYJE 3IU4H 1OW0C 1A7OH 3K4AA 2WW8A 1ZHLA 2X4UA 1XF4A 3ZHKA 4IBLT 4N0FA 1P4IL 5E7FA 3OWEA 1H5BC 2J88H 2AK4D 2LE9A 5EZLB 5GGUB 1PD6A 1MHHA 3HAEH 5EORL 4NZUH 1C16A 1X5KA 2PKDA 4LCWB 1J8KA 3O6FB 4D2NA 5DUPL 3UTTB 1KJMB 5BRZB 2GSGA 1ZSDB 4YHPB 5GRUL 1AO7A 2JIXA 2I5YH 1AXSA 2OR9L 2FYYA 4FFVC 3UAJC 5LXGL 2VDNH 4PJ9B 3ARPA 4XCNB 1F4YL 2VN7A 1PQZA 4XCYA 2V5TA 1OAUL 4PRBA 3IDIA 4YR6B 4YNYB 4CDHA 2ZNWA 5DJ2A 4WFHE 5T5NF 3S5LB 3CFDA 4NJ9H 3BD3A 4DTGH 3GHEL 5I74B 3FOLA 2D4DA 2VWEE 1TPXC 1I9IL 5EA0H 1P2CB 3OZ9H 4KJWC 5BS0B 2CLRB 3OKYA 3RJDA 3VXUB 3LIZL 3QFDA 4FZ8H 2YD4A 3GZKA 1KJ3H 1KYOK 3L7FA 3CXHK 4I0PD 2BSRB 4NRZB 4J3TA 2OI9B 5F97E 3W5MA 2DLEA 1J8HE 3QDGA 1T22B 2X09A 4OZIB 5KANI 2RJMA 3SDYH 1NEZA 4DVRH 1HOCA 4HUWB 1VFAB 5B8CC 1XGYH 5DJZA 5HYFA 4NDMB 3CU1A 3KYNB 1B0GA 5F96H 5HVHC 1AFVL 3E8UL 4XVSH 4MMZC 1DZBA 4C56D 1JHTA 1U8JA 5JR1L 2GITB 5FXCH 4NHUA 1SJEA 2DTMH 2X5PA 4HCRL 1ETZB 3MXVH 3OGCB 2FB4L 2ZPKL 4N0UA 4XT1C 2VXQH 5DC9B 2EDJA 4P3WA 3NOIA 4PJGE 4UT6H 4P4KA 2IAMD 2EDTA 4J6RH 1HHKB 3MUGB 4KC3B 4CUCA 2IEPA 4KROD 2NY3D 5E5RB 4O51A 5FUCE 5GGVH 4F80A 1ONQA 1OT2A 3D3VD 2FEDC 3M1BA 3DGGB 3I3EA 1U3YA 3DURB 3MLYL 1A7RL 1RMFL 2DBJA 4Q9CA 1MRFH 5EO1B 4PJHB 5KANG 2IPUK 3QIUB 4JFYB 3TWCL 5SV4A 2I9TA 4DQOL 4TUJA 1QLFA 2ZSWB 1OGAA 3C8KB 3VFTB 3LKOA 4W68A 5IFJB 3CLEL 1MHCA 3RZWA 4ZUVA 3MJ8B 4K9EC 2WINA 4C59B 1QBMH 4HIXL 3SDDA 3VXPB 1EFXD 3TH2T 4XI5D 4I18A 4WENB 4J3WA 1PGRB 5IHZB 2HKHL 3SJVE 4Z76B 2BY3A 1X5HA 3DX7A 4MA1C 2GY5A 3MRMB 4YHOL 5IVZA 3TIDA 1V5JA 1NDGA 4JPKL 4PREB 3SGEH 3P40A 3VFVA 3BMWA 1AGDA 4UB0H 3A67H 4XP4H 3BWAA 4AEHH 2ARJB 5FO7A 5ICZA 2BNRE 2PW2A 1ZHNB 4RMUA 1O7SA 2NPLX 3FOMA 4QRPB 3ZZ1A 2OTPA 4IDLA 4MQSB 1GCFA 2FGWL 4LHJB 1VSCA 4YHYB 1IEAA 4Y5XB 1OAYH 5I9QC 4ZO8A 2EYRA 3NFNB 3DVGA 3CCHB 4OQTH 2BNQB 3P4MA 4LVNB 1I7RA 3ZE1E 3LEVH 1ZK9A 1DQDH 2KPNA 2VABA 4HF5L 3HZMA 3KPRE 2EICA 3OL2A 5GSVA 5A2JH 3DYOA 2F9BT 1P53A 4EI5A 1N5AA 1GGBL 3ARSA 2EH8H 4FQQB 3QG7L 4CU8A 2W0PA 5E2JA 5FCSH 2HRPL 1ZLWK 3N85H 1JI2A 4WFED 3F7YA 2Y1VA 4XPFH 3PQYB 1I8IA 1N3NA 1ZVYA 2FX7H 4PRNB 5IF0B 5JIHA 1ZLWH 1NANH 3QEGH 4OZGB 5I1JH 4MA7H 4E41D 3CC5B 2E6JA 4G7VL 3DPBA 5D93B 1SY6H 4ZO6A 4CVZA 3U4EA 2VZVA 4WI6A 4AH2B 3QH3B 5DDHA 5F3BA 4WHTB 4YEFA 1I1YB 1L9NA 5CSZA 5I71C 3F12A 4H88L 1AR2A 2UWEE 3U9PL 2AJVH 5E6ID 3BHBA 1IAOA 1G6RA 4RAUB 4YH6A 4Y2OA 3VXRA 2P8MA 2SEBA 1UXSB 1NGPL 1R3JB 1B4JH 1WZKA 4JVWA 4W4OA 3SBWA 1N0XH 2ENYA 1PG7X 2AEIT 3LH2L 2RB8A 3MR9B 4JG0L 5D7LB 3OAYK 4XPAH 2NNAB 3PV6B 1BD2E 3EOBA 1I9JH 4NO0B 2X1OA 4MXVF 1PAMA 3OAYH 1QPXA 1JNLL 3CH1A 1N5YL 1AGEB 3QRFM 1A2YA 3U48A 5C8JA 4KK9D 2J4WL 2FO1A 3OR6B 4L5FL 3B9DA 1ZWIB 1AR1D 4L9LC 4PY7B 3UMTA 3QIWC 5C0GB 5EG6C 2DB8A 5DK0B 3WNNA 1H3WM 4AQOA 4JRWA 3B6SB 3CFJB 2QQQA 4X4MA 2X4SB 3QO1B 4YJZL 2CUIA 3UYRH 1JZ3A 1BAFL 1MJ7L 1TZGH 4XNQB 4M48H 4Y5VB 4KDTA 5JIIA 4JN1H 1GH7A 4NCC2 2VDKL 1NCDL 3GO1L 1EPFA 1S7RB 4M6AA 3QXVA 2CGRH 1DCLA 2OS7A 2BOBB 3MV7B 5B21A 2UZIH 2AXJA 5DD6A 4OCSL 5ADPL 4I2XE 5ICYB 1VERA 3UTPD 3TA3C 1YEIL 4R8WH 1UXWA 2J2ZA 2XN9A 3CZFB 3EFDL 5SWZD 2NR6D 4P57A 4EVNA 1H3VA 15C8L 5CJOL 2GJ6A 3QB7C 1Q9KA 5MENA 1YECH 3VXNB 3QFJA 2OTUB 4JFPB 4LAJH 4H8WC 3MBEC 1XT5A 3O9WC 4K94H 4ZOAA 1D5IL 3EJYC 4KHXH 4NKDB 5F7EH 1IT9H 3WLWC 4BZ1H 4PJDE 5JORB 5GRXG 4YDVB 4MYWB 4I5BB 4ODTL 4XC1L 5F9OL 5L8JB 4G43A 5D7JD 3HZKB 2AJYH 1RZ7H 3T0ED 1G9EA 3B9KA 3ZTNL 4FQ2L 5BOPA 2G2RA 2X2YA 3BKMH 1QRND 5BO1L 1CWVA 1NAML 1FNSH 2EEBA 1A9BA 1BZ7B 3MLVL 2CKBB 3QI9B 1QR4A 3RPKA 2O5YH 3O2WH 1IE5A 4P5TC 3AB0C 3MJ7B 5EDXA 1NQBA 4JFOA 2A9NH 1V3JA 3GNML 1OWRM 3HR5B 1S9YB 3LN4B 1EV2E 1BLNB 3C2SA 4XP1H 4ZO9A 1CVSC 3NZHH 2XQBL 2AV7B 3TJHC 1BIIA 1S78D 4XVJL 3BZEB 4GRMA 3T77B 1U9KA 2PYEE 4XNZB 5E08L 5F93C 4PLKD 5DA0B 4HLZH 2R69L 1C5DA 5TF1H 4K23H 3QYCA 1CFSA 1MHPH 5ESAB 5FK9A 5CMAA 4YXHL 3OJVC 3E2HC 3HE6C 4J1UA 3ZDXF 5J11C 4V2CB 3QUZB 3TJEH 4HHAB 1X5XA 4WI8A 2W38A 5TE6H 1WIUA 1MCCA 2P5WA 4JM2F 1LEKB 4GS7B 4QRRE 3HI1A 5B3NA 2VLJA 3SGKA 4DKDC 5ANMB 3BP5A 3DRTA 4LGRB 4X5XA 1JYVA 3C6LC 3OG4B 4XWGL 3EYSL 4F9PA 2VWEC 1PDKA 2VXSH 4YQXH 1KSRA 2LU7A 2ATPA 3VW3L 1X4YA 2VUOA 3DX6A 4KI5E 1MAKA 3L6FA 4ELKB 1MLCB 4KI1A 5DEGB 3FQWA 2DQGL 5L2KA 4XP5H 2FJFB 1DE4A 5IW3A 5J1TC 1Y0LB 2VQUA 4L4VD 1E4JA 4HH9B 1NBQA 1QQDA 1I1FA 3FRPG 4HK3J 4NGHL 3DLQR 2NYYD 4C58B 3VA6A 2IQAA 1A7NH 3CVHH 3IJHB 5F1KC 2Z8WC 4OD1H 3A0OA 5D2NE 5D5MF 2MTPA 1RZIA 2D0FA 4GW1A 2QV2A 5DD5H 5IVXB 4I0CC 3D39B 1FO0B 4I77H 3JWDC 3H2WA 2D7TH 5HBBA 5T5NG 3FQXB 3TO4C 1CLOL 3B5HA 2ZCLH 3FCTA 4NRYB 5H2BB 4RFNB 4FTVD 4DN4L 2IALB 3S35X 1U3JA 3B2UD 1EA9C 1MHEB 5JIPA 4LSSL 2WUBL 4ZFGH 2W65A 3MRCA 3WIIL 5D7IE 3EYUL 4HEME 1CE6A 4O2CB 1URLA 3E6FB 5HHQB 1IEBB 1QLEH 5JXAH 1JPSL 2JJSA 3TBSA 3GBML 4GAGL 4Q2ZB 4U6VL 4PJ5E 4MDJA 3FRUA 1KCKA 4HT1L 1IC5H 3KPQB 1DL7H 5EU4B 1FVCB 2A6JA 5DMGC 5JO5A 1OP5K 2I60L 1JWMA 3DWTA 3P9WB 1SYSA 3EOTH 3QNZA 5I66B 4P3DA 3MLTB 2NTFB 5EA0L 5FUCC 1FL5A 3REWB 1OP5H 2A73B 1VFOA 4KKLD 3GEWB 1JHKL 1MVUB 4PGDA 5LGHL 3OJMB 4F33A 4FQHA 3VFNA 5KJRH 2XKNA 3WHE1 1AHWA 1UM4H 5CLTA 3NIGF 1MI5D 1P7KA 3U2SA 2QEJA 1DLHA 1WTLA 4L8CA 3DVNB 3MLZH 4LASH 3O45B 2DYPB 1T20B 1JNNH 2ZSVB 5LAXA 3B83A 4WV1B 4PLJD 2BC4B 5I1DB 1NBZA 1BQHA 1IC4H 3C5SA 4DVRL 1ZA3B 4P46D 5HYJD 1S7UA 3RTQA 3L7EA 2Y5EA 1J5OH 4E42B 1TCRA 2HT4D 4TUOA 5JA8B 1JIBA 4KK6C 2VYRE 4ZNEA 1GPOH 1EO5A 5DJAB 3MLSH 3SCMB 4XP9H 5ICXB 1KTRL 4LSTL 4JRYE 2F5BH 1RIHL 1ZHBA 5MERA 4KV5F 4XNMB 2W9LA 4Y16D 2BSTB 1ZTXH 2A77L 1NC4D 5GJSH 4LVEA 4HMDA 4NKMA 1ZHLB 2X4UB 1XF4B 4ZS7H 4G9DA 3MLWH 4LGPB 2PF6A 3UCRA 4IRJC 5C0EA 1RVFH 2GQHA 2OM5A 1MHHB 3F58H 4RRPA 1JP5A 1FFPB 2P44B 3K7UA 1C16B 1IC7H 1A7PL 1SMAA 4XVUC 4G6KH 1MRFL 3CDFA 1F3JA 2XXCB 4CKVX 3BDYL 1JGVL 1DBKL 3ILQC 3D85D 3GMLA 1F4WH 2EO9A 5FFLA 2GSGB 1AO7B 2JIXB 4G3YL 3DMMD 4E0RA 2ICEB 3P11H 3STZB 3TVMD 4NWUL 4OM1H 3VJ6A 5FYKL 2AK4E 1KB5H 4XCYB 1H3XA 5K33A 2R8SL 5FO8A 2OXHA 2RIKA 3MGAA 3P4NA 1MCPL 3IDIB 4PRBB 3K1KC 5DJ2B 5FYLD 3CFDB 3HMXA 5D2LF 1TETH 4OGYH 3WS3A 5CWSA 1QR1A 1GIGL 4ZODA 4DFIA 4FQCL 2X05A 4YUEL 1P9MA 4OCNC 1GGIH 1I3VA 2Y36H 4PJ7A 2C4FU 4HPYH 4M1DH 2P5ED 3QFDB 5IROA 4JE4B 3EYQD 1EXUA 2NXYC 3V0WL 5JHLH 3LEVL 3D48R 1A3RH 1G7QA 3L7FB 1DQDL 1LDPL 4EQ2A 4YFDB 4PRIA 1N7ML 5F9WC 3BPLC 4JPWL 1S7XA 1FRGL 4KJYB 1U92A 1KUMA 1HOCB 4WCYL 3BN3B 1IZJA 1CR9L 4P2QA 4M43L 1KCSH 4HWBL 1Y6KR 1B0GB 2DQEL 3H9SA 4ZQKA 3MCKA 1IKFL 2P24A 2IH3A 1KXQE 1JHTB 1U8JB 3W11C 1R3IL 2YR3A 4ZXBD 5AAWA 1SJEB 1Q0YH 4OLZH 1BFOA 3MRBA 1ZHKA 2C7UA 1KOAA 5ALBL 1M6OA 2P4AB 1Z6JT 4LFHG 3G6JE 4NQSA 1GZPA 2WBWB 3SE4C 4JFDD 5FM8A 4Y1AD 3V6OE 4KJPC 3PWUA 3UJIH 3RGVD 1AJ7H 1AGCA 3MJ9H 2IPKA 3O0RL 2X1WL 4C56E 4O51B 1OF2B 1FORL 1ONQB 5DMJB 1KC5H 4HMCA 1IEHA 4G8GD 5DTFA 3M1BB 5IOPA 1L7IL 1H3GA 4UILH 5EZJB 3MRIA 2BSED 4HEPG 4F9LC 4TUJB 1QLFB 4OQ1A 2WBJC 1OGAB 5E2WH 4DK3A 3LKOB 3SGDI 2E9BA 1MHCB 2QQKH 4ZUVB 4POZC 4QT5A 5AZ2L 3RY6A 3T0DA 1RU9H 3BAEL 2WINB 4W6WB 3SDDB 5DWUH 1EZVX 4I18B 5IBUG 1GZQA 2X89A 3D3VE 5IVZB 4X80L 3UDWC 3BI9X 1CLYH 3U0PA 2APWA 3VFVB 1AGDB 3BWAB 2QKIA 5FO7B 2C3VA 5ICZB 2PW2B 3DETC 4WFFD 4IOFC 3NIFF 3FOMB 3V52H 5TJWK 4O4YL 1QSEA 3U1SL 1KBGL 2EYRB 4F15C 3DVGB 5EOCJ 1WFTA 1GOFA 3P4MB 4LQFH 4LVHC 1I7RB 1CGTA 1AGFA 3T3MF 5CJ5A 1BQSA 2VABB 2UZIL 3HZMB 1ACYL 3ZKMD 1EVTC 3HNTL 3EZ8A 5EOQH 4MB3A 4PJ8D 3VH8G 2NY6C 3U36B 4EI5B 1N5AB 3LAFA 1MFBH 1MOEA 3MNVA 3NH7L 4G9FE 1UJ3A 2VAAA 4OZHA 5TGBA 2H26A 2YA2A 3F7YB 3QAZC 5T1DH 1I8IB 2VOTA 2EKSA 4FMKA 4MZ2A 5C6TH 5E8NA 2EC9T 3SPVB 4OI7A 2F15A 1UWGH 3QUYC 1ZEAH 1KLUA 1RZ8A 3S36H 4OT1H 4GBXD 4GRLD 5B22A 4CVZB 4OB5H 3U4EB 4PGCA 1JTPA 4WWID 2X7LA 2W9DH 3G6DH 5DDHB 5F3BB 4J4PD 4OLUH 4G8EA 1PKQE 5CSZB 3F12B 1T2QL 3OKLA 3QEQD 2Y7QA 3HE7D 4MJ6A 1ZGLP 1PEZA 5E9DA 4PV8A 1PYWA 3BHBB 1IAOB 2A6KA 4LSVH 5C08D 3ZL4H 4P9MH 5GRJL 3TH3T 5F44A 3D2UA 4NJAL 3VXRB 1FL6A 4E41E 2SEBB 1YN6B 2ADFH 4X4YB 25C8L 5JNYB 1EHNA 1FSKC 4WO4D 4BFGA 4O2FA 1RK0A 4EOWL 3EOBB 3C6SA 3WUWG 1U2CA 3AMKA 1PBYA 4ODHL 4X4ZA 4Y2DA 2IGFL 3FZUC 3CH1B 3RAJL 5HJ3A 4M7JL 1A2YB 4ZUUA 4NZDA 3TF7C 5C8JB 3SY0A 3GJFA 5KZCD 3TJEL 3QQNA 4G6AC 5GGSY 5IFAH 5K59F 3FAXA 4NQXA 4WW2F 1T5WA 1AE6H 1J10A 2C3GA 4O58H 5CINL 2ARJQ 3PP4L 3QUXA 5JOEA 5JW4M 4DZ8A 5KSVA 1GXEA 4XPHL 1W2KT 1F02I 1PZUB 4PJCE 5C07D 4U7KA 4X99A 2K1MA 5DD6B 3CIQA 1YQVH 5DFVC 3Q6FA 1BZQK 4S1DD 2ZZUT 4UQ2A 2CLZA 3S34H 1FVDA 5IW1A 1UXWB 5IHBA 4Z7OE 4TQEH 5TDNA 3MMEA 4P57B 1KIQA 1K4DA 3CX2A 4I1NB 4X7TA 4EVNB 3WIHA 4HDIA 5BV7H 4LLQA 3TGXA 3PL6A 4RGOL 2GJ6B 1Q9KB 5MENB 3QFJB 1S5HA 2D7OA 5H37H 4FG6D 4FZEH 3MC0A 4GG8A 2HH0L 3U0TA 4DN3H 2LQRA 2XRAH 5EBLA 3GRWA 1NGYA 5L8KB 5E2TH 1YA5A 1T5XA 1HCFX 4A2MA 3OKEB 4ZAKC 2CO6B 1NFDA 3L3HA 3DBXA 4ZOCA 2XZZA 2CK0H 4XP6H 1D5ZA 1I7ZA 1EHXA 2E6PA 2NY0B 4G43B 3W9DB 1OAZH 4LHUD 1KT2A 4KHTL 1I3GL 2G2RB 2ICWI 4GFTB 4KTDL 4NC1E 1A9BB 4Z7WE 4NP4L 4K2UH 4UAOC 4JFOB 3MV8D 3NN8A 2G75A 1N4XH 1RZGA 4HXAH 2VN4A 3HKFA 1FZJA 5D1ZA 1UGNA 4MCYA 5JQ6H 3T2PA 5J89A 1BIIB 1DN0B 2FO4A 3I3BA 1MFEH 3LEXA 1NAKH 4GRMB 2H1PL 4DKFL 3IU3A 3S97C 4ENED 1C5DB 4QKXB 4OZFG 4OF7A 5TE4L 1QRNE 3IAQA 4KQ3L 3M45A 5IB1A 3WXWH 2VLKD 5FK9B 5CMAB 3SHSA 4KDWA 3O4LE 3FQUA 4X9BA 4J1UB 4GMTH 4Y4KD 4NN7C 4POYA 3VXSD 5DS8A 3WXVH 3T65A 3PUCA 2P5WB 4U1GB 4K7PX 3O6MH 3QCTH 2J1KA 3BISA 3GM8A 4UT7H 3HI1B 2VLJB 3BP5B 1BZ9A 4I4WA 5EN2A 3LS5H 4PJBA 1MWAH 2F5BL 4IJ3C 2ATPB 2VXUL 3O2DL 3L6FB 1BQLL 4K3GA 3FQWB 3WN5A 3HNVL 5KVGH 4GAYA 2X4NA 2YBRA 2BVQA 5L2KB 1DE4B 3C60D 4UTAL 3FQNA 2XZAL 3KYOA 3S7GA 2VITA 2DF3A 1QQDB 1I1FB 3QWQB 3MRQA 3JWOL 1D9KA 1LGVA 3KPSA 2IQAB 2ZNXA 4MWFA 5F6HJ 2YK1L 2HN7A 1P6AB 5SWSD 3SKMA 1RZIB 4GW1B 4UTBH 3UZQA 2C9AA 5GSRA 5HI5D 3ME0A 4GG6A 4Y4HC 2ZG1A 3P0VH 4UQ3A 3AREB 4LDOB 5CP7A 4LLUA 2D0HA 5JW4N 5FHAH 5HPMB 3FO1A 1XAUA 1QBAA 3FCTB 2GK2A 2VLLA 4QEGA 1F4WL 1I1RA 4F57H 4NYLA 4WUUD 1H15A 2W65B 1VEOA 2N7BA 3IJYA 3MA9L 1MFCH 3NCYP 3ARDD 2A6DB 4U31A 1CE6B 1ZANL 3O9WA 5CZVL 3SEPA 4KTYA 4L4TA 1UZ6F 3DSFL 1XGPA 3JVGC 4JY6A 2VR5A 3TBSB 1HSBA 4MDJB 3V6OC 1BBJB 4Y8DC 4LQ1A 2H32A 5CUSH 1I85A 1A21A 2A6JB 3EW3B 5GS1A 5JO5B 3ULVF 2R29L 4KJQD 1JWMB 4H26A 1SYSB 4H1LG 3QNZB 2V17H 3VD7A 1FL5B 5D71H 4KMTL 1OD9A 4FTVE 4HPYL 3N1FC 4F33B 4FQHB 3VFNB 4V1DA 2XKNB 2Z9TA 5L0QC 1AHWB 1IQWL 2E9WA 1P7KB 3NBNA 3U2SB 1DLHB 5HHMB 1JMXA 4L8CB 3C09B 3IXTA 2A1WL 4HXBL 5LCVH 5LAXB 5IGXH 5K9QI 4RFOL 5GRVK 4S0TD 1NBZB 1BQHB 1WCBA 3C5SB 3ULVL 2CRZA 1S7UB 4KROC 3RTQB 3L7EB 3O8XA 1T04A 1TCRB 2XA8H 4TUOB 2AGJH 1GSMA 4BZ2H 4OZIF 4HWZA 5FUOL 4M6NH 1KIUA 1XF5A 1JRHL 5DK3A 2VDRH 4NQCA 5DVMA 3K8LA 5MERB 1K8IA 4K94C 4UMGA 5K9OA 1HH9A 5INCB 5C0ND 4G6ML 1S9WA 2IG2L 2JB5H 3AFLA 3IXAA 1YEHL 4NPYA 4XI5C 3W81A 2BOCA 4DAGH 5C0EB 5LGKA 1RZJH 4R0LC 2R4RH 1D7FA 1YMHA 1IJ9A 3NAAH 1HDMA 4LAQH 5HVFB 2UZXB 4JO3L 5K9QG 3RZCA 1F3JB 4IRSA 5AZEL 4F7PA 1NCBH 4J7RA 1TFHA 4NT6A 1MJ8L 3F7PC 3GMLB 4PJEA 5DUMH 1NKOA 1J8HA 2B1HH 4PJHF 4E0RB 4QHKJ 4AZ8A 4LIQL 5EB9A 4KZEL 4GXVL 4DGVL 3ARQA 3WKML 3IDXH 3P4NB 2K7QA 1FLRL 4N1EA 3F6IA 2VKWA 1DBBL 4QHUA 3WS3B 1QP1A 3CSBA 5CWSB 5F1SA 1QSFA 1QR1B 2O61A 4GLRH 3TH4T 4MQ7A 4YE4L 4CJ1A 2EDKA 2I26N 4NUJA 3VGBA 2VMFA 2BCKA 4PJ7B 1DUZA 3JV4A 5IKCA 1K2DA 1PFCA 2AVGA 1EXUB 4PJGA 2ID5A 4DOHB 2X41A 3H0TA 1G7QB 2DOCA 1UWEL 3KXFE 3FB6A 5AYUH 4PRIB 1JFQL 3I2CH 1S7XB 4YDKH 3BUYB 3WFEL 1MCEA 3SKJL 3LQZB 3NIDE 2JE8A 1CS6A 4MJID 3H9SB 4AK1A 3C5ZA 4ZQKB 1YNLH 3V0VA 5C0RH 2HTKC 3MTRA 2HJLA 3MCKB 2F58H 2QBWA 2Y5TB 4CW1A 2P24B 3L1OH 2IH3B 3BE1L 2VH5L 3MV9D 5C6TL 5F71A 3G5YA 4WEMB 2CO7B 4RGNB 3VI4E 2PTTA 3Q3GA 3QDJD 2K9UA 1BFOB 3MRBB 1QVOA 2C7UB 2APBA 4MVBD 2NX5E 4LSDA 4Y4FD 1M6OB 4PLNC 4A2LA 4OZGF 2MCG1 1F2XK 3MOBH 1HINL 1GZPB 4OF6A 5I1HL 2D9CA 4OLVL 2VDML 5C9KA 2VDQH 2ZOKA 3MRPA 4RWYL 5FYLL 3PWUB 4HZAA 3RDTA 2ATKA 2PO6C 1IL1A 1AGCB 1BWWA 1FPTH 2IPKB 3NCMA 3QA3A 3PGFL 4M7ZC 4LSVL 5JLZA 4UINL 3S4SA 2CIKA 5DTFB 5IOPB 2AI0L 1U36A 3GIZH 4GKSA 1UM6H 3MXWL 3KJ6H 3MRIB 5E03A 5J12C 3TZVD 1YZZA 3BEWA 1FVEA 3WO4B 4F2MA 1J1PL 3ESUF 1I4FA 4IHOA 4NO5A 1KN2L 1VDGA 4QXUH 4Y1AE 3SO5A 3THMH 4QT5B 3X12A 1UKTA 3KR3H 3I02A 4MA3A 1B3JA 4LHQB 2WK2A 2AEQH 1GZQB 4G8GE 4NNXA 4NC1C 4XAWL 2Y6SC 3U0PB 4S0SD 5I75B 1DANT 1DVFC 2NY4C 2QKIB 3VWJA 5KS9F 2C3VB 4HS6A 2FR4A 2DBLH 4L8DA 5HHOA 5DO2C 5FGBC 4KMLB 5HY9A 1QSEB 1JHLL 4OLYL 3VRLF 2Z8SA 1JNJA 5HGDA 1SM3H 4HD9A 1OQOA 1PG7H 1AGFB 5BW7A 2AEPH 5MI0B 2UWEA 1CFVH 5JW5A 2X9YA 1RFDL 5DR5H 3SDCA 1DQMH 1FGNH 1TPXB 4KTEL 5DZLA 4RGMC 4ESKA 5CIPH 3TIEA 3MNVB 3ALXA 4U1KA 1UJ3B 2IH1B 3ESVF 4P2YA 2VAAB 3LN5A 3MBXH 5TGBB 3IFPA 2H26B 5F1NA 5A2IH 3CXDL 2HP4A 2DI8A 5HDBF 4R4FH 3C8HA 2EKSB 1R5VB 2Z31A 5E8NB 2Q6WA 3ABZA 2CK2A 4FFWD 1PKOA 1CGVA 4PLKC 1TJHH 1KLUB 1RZ8B 2ESVD 4U49A 4RQQA 5DURD 2IPTL 5KSUB 4M5ZH 1YEGL 4PGCB 1CGXA 3S37X 4QOKA 4AT6A 3KNBA 3V6FA 5F1OB 5EOCH 1OHQA 3AUVA 3LD8C 4G8EB 3HI5L 3IJSA 4PRHD 1VA9A 4ZTPH 1FGVH 3KJ4C 3OKLB 2Y7QB 1A7BA 4MJ6B 1ZA6A 5E9DB 3WS6C 1MJUL 4PV8B 1PYWB 4AEIH 2A6KB 4JQVA 4M4PA 3D2UB 4J3XA 1FL6B 5DRWA 4PJFF 1N4XL 5AUMA 5DJDA 4EBQH 3SDXE 1UACH 1LWRA 1PEWA 2X40A 32C2A 3UYPA 5CD3A 4XHJC 4Z7VE 3SE4A 1F4XH 1DQJA 4JVUA 4O2FB 1RK0B 3KDMA 3IFNL 5M94B 1GRWA 3CVIH 3C6SB 4AMKH 5FA3A 4L8SA 4ELMF 1I9EA 4RAVA 4JO2L 1HYSD 3I50H 2J8UE 1JPFB 5EH1A 1OTSC 1C5BL 3QEQE 2UVFA 4BUHA 3MRFA 2N56A 5HJ3B 3I84A 2DQFA 2G60L 4ZUUB 5KSBF 1NCTA 5HHXL 5C08E 3GJFB 2R0ZL 2NW3B 1MSPA 4HBCH 2V5RA 1KPRA 4FNLL 2CKBL 4N5EC 4N8PA 1WWBX 5DXWA 2X4QA 1KFAL 4NQXB 1G0DA 1H3PH 1ND0B 5IBLD 4PJAF 3MOAL 1UVQA 43C9A 3FO0H 4N0RA 2Q8AH 5DGQA 3BGFC 1JE6A 2R56L 4FQXA 4PFEA 4D0CA 5DRNB 3QUXB 4DZ8B 5KSVB 3V4VL 3KLHD 2NY2C 3MCG1 4Y88A 1JRHI 2V9TA 3SKUD 3MV01 3HR6A 3QJFA 5EWIL 3QWOB 5IJVA 2BFVL 4M9PA 4KXZH 4X99B 4Y5YA 3VE0A 4R7DA 5KBNC 5ERWA 5HD8C 3Q6FB 4WU5A 3PXHA 4Q9RL 1P5UA 4UQ2B 2CLZB 3KVQA 2NXZB 5EOTA 5IW1B 1NCCH 2F53D 3X3FL 5TDNB 4FABL 4MAYC 3L95A 3MMEB 1KIQB 1K4DB 1M4KA 5FDYA 5I9QB 1Q0XL 3BIKA 4HDIB 4LLQB 1A02N 1HNFA 3RUGE 1MIEL 2E27L 2M1KA 1CK0H 5D6CA 2PYEA 5ALCL 4GG8B 3U0TB 1OAQH 3DUHA 4AM0B 1NGYB 3ZHLA 4GRWB 4KKLC 1MCJA 2FSEA 3RVVC 1XIWC 1NFDB 1T2JA 3DBXB 1I7ZB 1B6DA 5IVXF 4JM2A 1VKXA 2X4TB 3WUWA 1P7QA 4Z7QE