2UYLB

Crystal structure of a monoclonal antibody directed against an antigenic determinant common to ogawa and inaba serotypes of vibrio cholerae o1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
213
Chain Sequence
QVQLEQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGHISPGSSSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCGREETVRASFGNWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY F-22-30
publication title Crystal Structure of a Monoclonal Antibody Directed Against an Antigenic Determinant Common to Ogawa and Inaba Serotypes of Vibrio Cholerae O1.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 213
sequence length 220
chains with identical sequence N, W, Y
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uylB02
3VXNA 5EOQH 1RUQL 3ARGD 4C57C 4Y2DD 4I3GA 1KIRA 2Y7QA 3ZSSA 2G60L 3TP4A 4XNZB 3SEPA 4WNQB 3X13A 1DVFB 3FMGH 2EICA 1I3RA 4JQIL 4NCC1 2V5RA 4DVRH 1BGXL 1F3JB 4L3EA 4MA1B 3FRUB 3SJVA 5C2UB 4LSQL 3NIDF 1JHKL 1R5IB 3QO1B 3VD5A 2BRQA 1OAQH 2NMSA 1YECH 1CL7H 2B1HL 4BSVB 4LCWA 3BUYA 3IFPB 4JCLA 3MCLL 4LCIL 1AD0A 5BZWA 4XP6H 4JO1H 2XPGB 2VSDA 4JFEB 3T0XA 3D39B 2GYSA 5KS9B 4WCYL 4LF3B 4OLZL 4RA3A 3GBLA 2ADJB 3UO1H 4S1SL 4R90H 3MRCB 5I1CL 4F7CA 3HPJA 1D9KA 5J4MA 3IAQA 4D0CA 43CAB 4G42A 4PJHF 2VE6B 2F5BL 2J8UE 4LDOB 3DUSA 4WDIB 1N26A 1CQKA 3QFJE 5TDOA 2Y06H 3RZCB 3DGGA 4MDIA 4KVNH 1VB9A 3QEUB 1OY3B 2DMCA 5IJKA 3UC0L 3L5XL 3K1KC 1TDQA 5JQHC 2X4RB 1MVFA 4Y2DA 2W0FA 1MQ8A 5GGUA 2ZCHL 3S3JA 5DJ0A 4LSPH 4E9LA 3KJ4B 4MD5A 3EZ8A 3IFOA 2MCG1 5HVHB 5C92A 2V6HA 1PZ5B 4WFFE 3V5HA 2YD1A 3BPCB 4OB5H 5FDWB 1EHNA 4U1MB 3RKDC 4OM0L 1H3VA 1FAIL 3P9LB 1L6XA 1A7NL 3G6JE 1BWMA 5D5MB 2J7LA 3EYQD 4X7SH 4XPFH 4G6FB 4QXGL 4DJMA 2OJZH 3QXAA 4QRPE 4OCYL 3UMTA 3HC3L 4JCMA 2JCCA 1ZV5A 1OAXL 1I8IB 4G6JL 1IM3B 3DVGB 3TNMA 2GW5A 2YEZB 4PJ5E 3AY4C 4P4KD 5AAMA 2AEWA 2HG5A 4P57A 5GSRB 5J12B 3CU7A 3U4BL 1OP5H 1EFXB 2PW1A 3VG9C 3OB8A 1CD1A 4R4FL 5JA8B 3TFKD 2MQ3A 1LVEA 4S1RH 3QBTB 3BHBB 4M1GL 2HVJB 3SKJH 5I1HH 1WZ1H 5T3XD 4FQXC 1AR1D 4QRSB 1T22A 3VXUA 3MJGX 1BQSA 3A0OA 5CMAB 4EOWL 3P0VL 4L3AA 3CFJB 2HYMA 2R2EB 3P73B 2FEDC 4N8VA 5E99H 2ARJQ 3TZVA 2FBJH 4X98B 1KB9K 5C1MB 3WUWA 5TH2B 3MR9B 1MJ7H 5CEXB 4JDTL 1U3YA 3F7YB 4RRPA 5CIPB 5ICXB 1KTRL 4N0UE 3HB3D 2WSKA 3KPMB 4YHIB 2ZP0T 1AP2A 2ZUTA 5KN5B 1Q9OB 5DLML 5GGQL 5CBAA 1JUFA 3DXAA 2HT3C 3C08H 3H9ZA 5GRUH 4MWFA 4RGMC 1CLZH 4L3CB 1YC7A 4Y19D 2OR9H 5BV7B 4M5ZH 1B0WA 3QNYB 4PJIA 4X5WA 4PRHE 2C3HA 1NJ9A 1HYSC 2D9QB 3RX8A 2VLLA 2PKDA 4HC1A 5HPOA 2IALA 3BP5B 5HJ3A 1WT5A 5IFJB 3SKUD 4RWYL 4XC3L 1FGNH 1VFAA 2J6EA 4M6OH 2J88L 1K3ZA 4QRRB 3CLEL 2Q76A 5C3TA 5F9WC 4N0FB 1MHEA 3VWJC 3U4EB 5ESVB 4QY8A 4U33A 1MFAH 3MRRA 3VFVB 2GY7B 3L7EB 1J1OH 2H1PL 1G6RA 4GJTB 4K94C 3SDXF 1VACB 4JO3L 1J1PL 1A6WH 3I6KA 1N5YL 4X7CC 4G9FD 2CUMA 3EGSA 4OLXL 3QJHA 2PCPA 2ZPKH 3B9DA 1J05A 3TN0C 3GUTA 3FO9B 1R3HA 1XGTA 2BNQB 2HTLD 2V17L 4ZSOA 4Z8FH 5C07D 5DK2A 1G0XA 1KB5L 1PLGH 1S8DA 1SJHB 5FB8A 3LS4L 4D2NA 1DUZB 2DBLL 2EKJA 3U9UA 4AH2B 3B9EA 5JOEA 4NO0B 1R5WA 5FHAL 1K6QH 3CD4A 4J3SA 4PY7B 1PQZA 4YHKH 4XXCA 5DJAB 4U2YA 4L1DA 3JUYA 4Y19A 1NGQH 3AXLB 4GXUM 4RMRA 3BD4A 1FVCA 3VD3A 1QFOA 5DHVB 4JY4B 2BDNH 2DL2A 3WIFB 1K4DA 4NRYA 3WCYA 3S96A 2VDPL 3D69B 1ZGLP 3GNMH 4JGMA 1KCUH 5SWSD 2NXYB 3WN5A 1KEGL 5EWIL 1OT1A 4A6YH 2VH5H 4TUOA 4WTZG 3U0TA 4I48B 1NANH 2Z8WC 2NY5C 4NO5A 2XICA 5DYOB 4C83B 3RAJH 5J7CC 2ZG1A 4NKIL 2Z91B 1DVFD 4Y4HB 5EPMA 1DDHB 3T4YA 1N3NB 2MQCA 1QFHA 4HQQH 1CLYL 1L0QA 2NTFB 1CZ8L 1QLRB 4D9RD 3FFDA 4G9FA 4JN1L 5DHYA 5DR5H 4W70A 1A3QA 4Y8AA 1VDGA 5TE4H 4JEGB 5D2LB 4LSUL 1GZPB 3PHQA 2R2CA 4PP2B 2NZ9D 4ONGH 1BP3B 4ONHA 5DFVD 5DGRA 4NN5B 1F58H 1MI5A 4X7TA 4PRAB 2I07A 4R96A 4GT7A 3W2DL 1EXUA 3WS3A 4OBSA 4RGNB 1N64L 4K3GA 3IKKA 3D39D 4WGVB 5F6HJ 2FEEL 4HH9B 4EI6B 1LEKB 2AJVL 4CVZA 2IAMB 3MLWL 2VDOH 2DJSA 1INDL 5F8QC 3I2CL 2VISA 4Q6IC 3VXOA 5K9KA 1CT8B 4PJAB 3SBWA 1GXEA 5IB1B 3ZT6A 4KJPC 3RZCD 4AEIL 4F3FA 3DECA 3AU1A 2OL3H 2C1OB 2BVPA 3QDMB 1N59B 4DZ8A 4G43B 4QT5A 3MACL 4EKXA 1F3DH 2NQCA 1WFTA 4KQ4H 4NYLA 3BYYA 5SWZE 5HHME 5A2IH 3BEVA 4BFIA 1OCWL 4XCEB 3OG6B 1QO3B 2EIEA 3NACH 2DMBA 1D3CA 5A43C 4TQEL 4NN7B 4WNQA 4EXPX 1DVFA 3IU3B 2R4SH 1ETZB 1AHWC 1F3JA 5HTSA 4WUKL 3FRUA 5KVMC 1UJ3B 4G7VL 4POZC 3V6OC 3PE9A 3MZGB 1R5IA 1F2QA 4AG4L 1S3KL 3KGRA 3QO1A 4N0CC 4AEFA 2QQLL 4G6FD 2YD7A 2R15A 3Q1SL 4LQFL 2VKWA 1A5FH 2A6IB 3HUJE 1GH7A 4BSVA 1MY5A 1B6DA 4CMHB 1OGAB 4P5TC 3IFPA 4X4XB 3SKNB 4LLUB 1CWVA 4G6AC 5D70L 5B3JF 5F93C 2XPGA 4JFEA 4PB0L 4P59H 3D39A 3RI5F 3L5HA 5KS9A 4LF3A 3SDCB 5I1EH 2ADJA 3V4VH 4NZUH 1AGFB 4CU6A 3MRCA 5BOZG 5C0CD 1DQLL 1BBDL 4G8GB 4GQ9L 3V6ZB 2X1XR 43CAA 5ADPL 2EDFA 2VE6A 4P23B 1VEMA 2DQDH 4WDIA 3RZCA 4L29B 2DQGL 3QDGB 3QEUA 3TA3B 5HPMB 2DQJH 4PIRF 2UVFA 2X4RA 4GS7C 4NPYB 5HI5D 2J8HA 5LKNA 4GXUN 3LOWA 3OKOB 1I1FB 4OQTH 4NHCH 3Q3GB 3WFBH 1PZ5A 3WFDL 3R8QA 3BPCA 4K3JH 3U0PB 5FDWA 4U1MA 1NMAH 3G9VA 3P9LA 1OAUH 5D5MA 5A2KH 3BH9B 5D72L 3VDCA 3WD5L 2O5ZL 4Z18A 3MTRA 4NUGL 5T3ZE 1I9JL 4EUPH 1C5CL 1I8IA 4QRRD 1IM3A 1RIHL 3DVGA 3MX0A 2YEZA 1X7QB 4FQLH 1T66C 4DK3A 1OSPH 1EPFA 3GMRB 4GRWH 5EIIB 4BKLB 5GSRA 4D9LH 2W9LA 3UBXB 1XZ0B 1JGLH 3PXJA 5ID1B 1EFXA 4N8PA 1EHLH 2P43B 4M62H 1N0XL 4PBWD 4EDWL 3BHBA 2HVJA 4MA7L 3CSGA 4Y1AB 4QRSA 2FX7L 5FV2A 1UA6L 5C6TH 5CMAA 3CFJA 2R2EA 3P73A 4X98A 5TH2A 3CK0L 2ICWB 2IG2H 3MR9A 5CEXA 1MCLA 4HEME 2FGWH 3CX2A 3F7YA 5CAYB 5CIPA 5ICXA 1XGQB 4JZJC 3KG5A 4GW1B 4NO0D 4X8XA 2AEQH 2X10A 3KPMA 1X4YA 4YHIA 4OQ1A 4DOHE 1U8MB 5KN5A 1Q9OA 3N1MC 1C5BL 1R3KB 5IFHL 4OLVH 1S7XB 3CH1B 3QI9C 4L3CA 3HE7D 4WW2F 4XXDB 3IGAB 5DQ9B 1OAZH 1I9IH 5E8NB 3OHXB 2CDFB 3QNYA 3PWUB 5K33A 3RKPA 3EIFA 3OX8B 3QCTH 2F19H 2QQQA 3BP5A 1LQSR 2AJXH 2IJ0C 1G7HB 5FHBL 5IFJA 1QEWB 2NXYD 4ODUB 3GKZA 1L7IH 3K80A 4PB9H 3GDBA 4MZ2A 4QRRA 2NY6C 4N0FA 1FAKT 3U4EA 5ESVA 3JWDH 5C6WH 3VFVA 4ZD3H 4IRSC 3L7EA 3MLSL 1A9BB 2Y9RT 5IM7B 1E6OL 2VZSA 5C9JB 1VACA 1A22B 4LOUC 5D7LB 4D3CH 3PDOB 1JCKA 3EBAA 1KJ2B 2X42A 4BUHA 1NCBL 4F9LC 3EAKA 1F3DJ 1Z9MA 1FNGB 1QLEL 3FO9A 2BNQA 5DJ8B 2I24N 3OB0H 1V7MH 1IAIM 4X0KB 1SJHA 1DUZA 3BKYH 5GJSL 4AH2A 3TBSB 1KXVC 3NBNA 4FQPA 4NO0A 4PJDB 3GMMB 4Z7VF 4NP4L 5DRXB 5C09B 4X4MA 5EORH 4RGND 2BJML 4PY7A 1BJ1J 1KELL 3U48A 1RZIB 5DJAA 1MCFA 3REVB 4X7DC 5JO5B 2W59A 4Y5VC 3AXLA 3JVGA 1U92B 3B2VL 3V0AC 3QR2A 1BFTA 5DHVA 4JY4A 1YN6B 5MHSD 5DQJB 3WIFA 4OT1H 4JM2B 5CGYC 2R8SH 3MCKB 5C0DB 3W82A 3WKMH 1Q72L 3D69A 3T65B 2Y23A 5BW7C 3VG9B 3MLVH 1AY1L 5F96L 4H1LB 2JIXD 3QULB 4FQXB 3DRQB 4I48A 3LAFA 1EHXA 4HMCA 2DM7A 5DYOA 4JJ5B 4C83A 1KSRA 3QEGL 4Y4HA 2BZDA 2OBGA 2Z91A 3SJVE 1DDHA 4XWGL 5AZ2H 1N3NA 1LGVA 3MCG1 2YPKB 4UT6H 2NTFA 2DDQL 4OF0A 1QLRA 1A21A 1CDIA 3D9AH 4QRQB 1IGIL 1XIWC 4HULB 5CCKL 4LLQB 5D2LA 4GLRH 4M6MH 1NKRA 1GZPA 1ED3B 2V9RA 4PP2A 4Z9KB 1NCUA 2XKSA 5DD3L 1DJSA 2Q20A 2HT2C 3TYGL 3V79C 3QUMB 6CGTA 4WEUD 4RGMB 1OGAD 4W6WB 4PRAA 1IZJA 1JI1A 4RFEB 1LK3H 1IC4H 1CE1H 2I5YH 2D7TH 5JDSB 2B39A 1CDJA 5KSBF 4HH9A 5EA0H 1MFCL 2M1KA 4EI6A 1LEKA 3HI5L 1MJUH 2EDYA 2YKLH 1R24B 5KSVB 2IAMA 3MLUH 5T33H 5IROA 4P23D 1OPGH 1CT8A 3AROA 4PJAA 4CMMB 1RU9L 5IB1A 3IKCB 1EO8H 3IDGB 1P5UA 4IIQC 2C1OA 1CLOH 5F6IC 3QDMA 3QDGD 1N59A 4IRZH 4G43A 4UT9H 3GHBL 1T0MB 4I2XB 4TNVK 1OAYL 1F4AA 1KEMH 4XCEA 1QO3A 2W9DH 1Q9KB 2ZUQC 4QWWC 4PG2C 3SCMC 1OSZB 3TN0B 3LD8B 2FX8H 4PGZA 3IRPX 4BZ2L 5C71A 5GS1B 1YEFL 3WJLC 3IU3A 4OGYL 4HPOL 1ETZA 2OR8A 4M4RA 1VA9A 1MWAL 1V3LA 3DMMD 3I02B 2J2ZA 3X3GH 3DBXB 1IGTB 2JCCE 4HBCH 1CI5A 1UJ3A 2EDEA 4Y4KD 4K23H 4JPWL 4ZTPH 5I19L 3MOQA 4JG1H 1K85A 5I71B 2A6IA 4U6YB 3RA7L 1OGAA 3TT1H 2UYLB 2VRAA 4X4XA 3SKNA 5EC1B 4LLUA 3VFOB 4K8RD 1NCWH 4JKWA 4MQ7B 1AXSB 4F2MB 4HHAB 3SDCA 1YJDL 1AGFA 5ANME 3LS5L 1RMFH 4Y1AD 4G8GA 2E7CA 3V6ZA 1AE6L 3UTSB 3WKNA 4P23A 3HE6B 1U2CA 5E24E 1WBYB 4L29A 1I85C 3T0VA 3MBEB 2FIKB 2YD8A 3QDGA 3TA3A 4RQQB 1K5NB 5HPMA 1RUAL 3O6ML 1GGUA 2AI0L 4NPYA 2BY0A 2GK0B 1I7UB 5EUKB 3OKOA 1H3PH 2BNRD 1KJ3H 5KVEH 1I1FA 1VENA 4ALAH 3KLDA 5DUMH 4YX2H 3Q3GA 1FLRL 1P4IL 4M5YH 2HTKC 2W9EL 1GSMA 3MLYL 2UZYB 3U0PA 1HCVA 4AYFA 4KXZH 2NY7H 1W0VB 2HKFL 3M8OL 3BH9A 5JIIA 4BSWB 4PS4H 5J1AB 1ACYH 1UCBL 2YMXH 4P99A 2CIKB 2R9HC 1Z3GL 2AKRB 4NOBA 1OL0A 5IW6B 3WFCL 1X7QA 5T3XE 2LU7A 5EIIA 3GMRA 4LSSL 4BKLA 2P47B 4Q6IB 3UBXA 1XZ0A 3ABZA 3BW9B 2ICES 2PF6A 3RBSA 5ID1A 2YPLB 4AMKL 4R0LC 4ZSOE 2N4IA 3B2UC 2D03H 3TO2A 3QDHA 4Y1AA 5TE6H 1B90A 2EDLA 3ARFC 4Z7UF 4QGYA 4L4VB 2IQ9L 3FONB 5FAAA 1N2RB 2EE6A 1MHPL 3KPQB 4TSCL 2ICWA 3TIDB 3HZMB 5GS0C 4M7LH 4FG6C 1AHWB 1XGQA 3NGBC 4GW1A 4Y19E 1ZT4B 1A4JB 4TVPD 5IHZB 3MFFB 3RKDD 2ENSA 4C56B 1U8MA 1F11B 3KR3L 1CU4L 1QQDB 2UUDK 1A2YB 5JW4Q 1R3KA 4NC1C 4H0GA 1S7XA 3CH1A 4I77L 4XXDA 3IGAA 4ZAKC 3UTZB 5DQ9A 2DRUA 3I6GB 4B7IA 5E8NA 3OHXA 1OD7A 2CDFA 1BQLH 3PWUA 3EDEA 3OX8A 5CINH 5L9DH 1N7MH 1F02I 2VXTL 1G7HA 1QEWA 2CKBL 4KVCL 4MQXC 4ODUA 5DDHB 4PRPD 2CR3A 2J4WH 3INUL 5B38G 3FN9A 4J4PC 3W39B 4IM8A 1OARL 4J6RH 4FQXD 2QSVA 1EUTA 4G9FE 4U1LB 3O2WH 5E8EB 4YBLB 2ZUUA 3GK8H 5FCUL 4P2CG 2CK2A 1A9BA 1HWGB 3LRGA 5IM7A 2FEDD 2PW2B 5C9JA 5D7LA 5C07E 3I85A 3PDOA 1KJ2A 1FHGA 3H6JA 5J8OA 1H3TA 3U7YH 3V52H 1SHMA 4HLZH 3KXFB 4M7KL 1PD6A 3QRFM 3H3PL 4GS7B 1FNGA 5IQ7H 5DTFB 5DJ8A 5SX4I 1NCNA 3RU8L 4PGJA 5DD5H 5J56B 4X0KA 2HT3D 5ADOH 3NTCH 4F8TA 3KYKH 4NFDA 3TBSA 3HMXH 4PJDA 3AM8C 3GMMA 5DRXA 1WIPA 1T7ZA 5C09A 5C0NC 4OF7A 4M6AA 1HYSD 4CN4A 5ALBH 1RZIA 3CLFL 3REVA 4XPGL 4MNQB 4J3UA 4GAGH 1F90H 2DQIL 1IBGH 5GJTL 5JO5A 4YIQB 2OMBA 4QNPF 5INCB 1U8LB 5SWSE 1U92A 5CJBA 3S37X 1GAFL 2W92A 3O3AB 3VWJD 1YN6A 5DQJA 3AY4A 4JM2A 2EH7L 3CUPB 3MCKA 5C0DA 3T65A 1NFDB 5FYJD 4O9HL 1YUHB 4H1LA 1K8IB 4AL8L 4ZO6A 3QULA 4UILH 1BECA 4FQXA 3DRQA 4D9RE 3QQ9C 3TN0D 4NGHL 4JJ5A 4XZUB 4YDJB 4HWEL 1I8LC 1ZLUK 1EK3A 3UZEA 2YPKA 1SMOA 1NDGB 5F7YC 3NCMA 5J6HB 4P3WA 3RVUC 4QRQA 2XZAH 4LLQA 3IDYC 4LHJB 4AY0A 3QJFB 3V0VB 3VFPB 1ED3A 5I1LB 2AXGB 2CKNA 1RK1B 5MI0B 5HHVH 1MPAL 2R0ZH 3D39E 4XNYH 5KS9E 3QUMA 3W11C 4LPXA 4J2XA 3EJJX 3MXVL 2A77H 4KZEL 5JUEH 4RFEA 2UV3A 4MD0B 4QHKI 4DW2H 4J3WA 5BS0B 5JDSA 1MUJB 1V7NH 3N06B 2CLRB 1KGCD 5JZ7C 1KENL 3P30H 1IE5A 4FS0A 2YR3A 3NCJL 4MB4A 5I66B 1UB6B 4AJ0A 5AZEL 1R24A 5KSVA 3BJLA 2FX9H 2RAMA 2H32H 3UTSD 2NY6B 1P1ZB 4Z7QE 4YXKH 4CMMA 5H2BB 2D31B 1MEXH 4Z0BH 3IKCA 4LSDA 3IDGA 4IRSB 4GG6B 3P4LA 1DCLA 4KPHH 3KPPB 2R69L 1T0MA 5DEFB 4I2XA 2FEEI 1QD0A 1Q9KA 5GGTH 3P0YH 3OZ9H 1OSZA 3TN0A 5EZIH 1YEJL 5IVNA 2HN7B 3BT2H 5GS1A 2EIBA 4I0CC 5EZOL 4FFZL 1MIMH 3FN0L 2WBKA 5CKAA 1NL0L 3CIQA 1MFDH 3I02A 4BH8B 3DBXA 1IGTA 2FATL 4PJEF 1JTOA 1GGCH 3ARYA 3F5WB 2WQ8A 1U9KA 4XPAL 1FZKB 4U6YA 4N8VG 2GITB 1OVZA 3VWKC 5ICYB 3WUWG 2PR4H 2FD6H 1CR9H 1TQCC 2UYLA 4XCFL 4Y5VB 5EC1A 5C0CE 3PNWB 4C4KT 4RRPG 3VFOA 3MFGB 4MQ7A 4O4YL 1AXSA 4F2MA 2YPLD 4KJPD 4HHAA 5I74C 1MCWW 4OGZA 2EDRA 1OP3K 2YN3A 3RWDB 3UTSA 4XH2B 3BMVA 4L4VD 3PDGA 3BDYL 3HE6A 1WBYA 4RSVA 1IGYB 2AW2A 2HH0H 4CAGA 1TZHB 3IDMB 3MBEA 4POUB 2FIKA 3QHFL 4LFHD 4CRPA 4RQQA 1K5NA 4WEMB 1ZXQA 1OOAA 2R0LH 4RAVB 3SDAC 2GK0A 2VXSH 4C56D 1XIWB 3T0DA 1I7UA 4POZD 5EUKA 4MCZB 1D6VL 3T4AB 3BPLB 4IMKC 2R23B 4E42B 4OZHF 4N0CD 1C7SA 5H94B 4PJ8C 4ZO7A 4P5TD 2X4UB 4QRRE 5ETUB 3ZE2F 1Q94B 4G6AD 3HHRB 4LIQE 3V8OA 4B7LA 1W0VA 2JJTA 3BD5A 4BQBA 1F6FB 1Z0NA 2WP3T 5J1AA 4JM4L 4BSWA 5D2NB 1VSCA 5EDXA 5GS2D 2MKWA 2OYPA 2CIKA 2JJVA 2AKRA 1NEUA 3QHZH 2NYYC 5IW6A 5GGSB 3MLRL 3GSXB 5E9DD 4XPHH 4Q6IA 4WI5A 1IVLA 3BW9A 2YPLA 4HC1L 5F6IB 5I8KL 3GKWL 4YBHA 1CGVA 1F3RB 3EYVB 3HCVB 3IXTB 2J6EL 5E8DL 3KXFD 3VD9A 1KCVL 1WZKA 1TFHA 1URLA 4XNQB 4JPKH 4QEGA 1PSKL 4L4VA 4U6HB 3FONA 1FGVH 1YMHB 2VR5A 1PG7L 4EI5C 3SCMB 1N2RA 4I8DA 4ZS6C 1G6RL 3KPQA 1OGTB 1GC1H 3TIDA 3HZMA 4LGPB 3TV3L 1AHWA 4M9PA 5T3XL 1X5LA 1NMCC 1ZT4A 1A4JA 5IHZA 3HAEH 1S5IH 3MFFA 4C56A 1F11A 1KC5L 2VDQL 5KW9H 1QQDA 1A2YA 1HNFA 1JWMB 3MOBH 4GW4B 4MNQD 5KJRH 3D1MC 4NT6B 5F7UA 3KPSB 2VAJA 4LLYB 4DEPB 1KLGB 3UTZA 1TETL 1WIOA 3I6GA 4L4TB 2ZNXA 4FQJH 3E1F1 5DWUL 3LMJL 1MCDA 2X70B 1T66D 3DGCR 2AABH 2EE3A 3VDAA 3VFUB 4NZTL 2X4SB 3MUGB 5DDHA 1A47A 4K3DH 1R0AL 1YPZF 1CGSH 2W65B 3NIFE 3W39A 3WDIA 3S4SB 2XRAH 3G5XB 4U1LA 5E8EA 5T1DH 5C0BB 5LGHH 4XI5C 3V4PL 2YWYA 3LKNB 3U7AA 5D2LE 2PW2A 4O2EB 5IHUH 4H20H 1DBBH 1CDHA 1BPVA 2WINB 2XXMB 4PD4K 4U05A 2J8UF 1JGVH 5CJQH 3KXFA 2EIZB 5JXAL 1JGDB 5DTFA 1LO3L 1S7RB 2Z4QB 3UZQA 1MAMH 4RGNE 3QI9D 4ZXBC 4HSQA 2HKHL 2A9NL 4KGLA 1KN2H 1HIMH 2VXUH 1GGYA 3UZVB 5BS0D 2A6JB 3E6FB 4PJAE 5MHSE 4MNQA 2MPAL 4FN0A 5CGTA 3DYPA 4YIQA 2XKUA 5INCA 1U8LA 2E7LC 2CGRL 3G6JF 3O3AA 2NY6D 1TIUA 1U8OB 4MB5A 5ISZB 1JFQH 2APFA 4MHHG 3U0WL 2N7BA 4CNIB 4UV4L 4IRSD 1ACZA 3VFGH 4P2RB 2APVA 3CUPA 3G6DH 4LU5H 3WHE0 4J1UB 2R56H 3S3SA 5ALCL 1NFDA 3MLZH 3A67L 1CFVL 4LOUD 3MRMB 1YUHA 2VDKH 1K8IA 1BMGA 4OCWL 4XBPB 4LVNC 4M02A 3O9WC 2X44D 5CZXC 1NFKA 4XZUA 2A1WH 2Z92B 3CXDH 5LGKA 4YDJA 4X80L 1BVKB 4GRMB 3KPNB 3ZE1F 1NDGA 1NC4B 3E6HB 2X4OB 3ARBB 5L8KB 5J6HA 3TBTB 3NGBB 3P9WB 1OGAE 3HRZB 1RUKH 2A73B 4WY7L 4PJ9B 4LAQH 3QJFA 3V0VA 5E5MB 3VFPA 5I1LA 3JV5A 1PFCA 2AXGA 2HFGH 4UINH 4NQSB 1RK1A 2GTWB 3WO4B 5F9OL 3AREB 5F3HB 2Z31C 3M45A 4ZAKB 4YDLC 3JWDC 1PG7W 4GG8B 3ARUA 4S0SD 4MD0A 5HVGB 5LBSL 2DLIA 2VDRH 4RMSA 1MUJA 5BS0A 2XG5A 2CLRA 4OCXL 4HG4J 5I0DA 5CILL 1FH5L 5CGYD 3MV7E 5J6GB 5I66A 2GUOB 1ITBB 1UB6A 1UWGH 4KRMB 3QDGE 3QB7C 4NKMB 2QKIB 4DGIH 4JO4H 1JP5A 4UOJA 1UWXH 1P1ZA 1QLFB 4JN2B 3FO1B 2F54D 5BMFH 3OQ3B 5H2BA 2D31A 4PJ7E 4JFZH 4IRSA 4GG6A 4ODVL 1FL5B 4HIEB 5JXEC 3KPPA 2JELL 5DEFA 1QSFB 3MLXL 4OF8A 3TO4B 5FYLL 1AI1H 1RIUH 4KTDH 2VQ1B 4F9LA 4WUUB 3U1SL 1TJIL 3MJ9A 4Z7WB 1EBPA 1XIWD 4G6ML 5D7IE 2XQYG 2K3TA 2HN7A 3LZFH 1PDKA 1U6AL 1B2WH 3ZL4H 1RUQH 3SGEI 1QFWI 2HT2D 4EN3C 4BH8A 4KFZC 4PTTB 4Z5RB 4RGOL 3OPZL 4MQTB 3F5WA 3B9KB 4DK6A 5TF0A 2DWDB 2PTVA 4XP9L 1BGXH 1FZKA 1QOKA 1TNMA 2GITA 5ICYA 5E4EB 3DSNA 1QPPA 4Y5VA 4LSQH 4LCUB 3PNWA 2NY2C 4Y1AE 4AEHL 2GJZB 2B1HH 4TULL 1SVZA 4X7FC 1QPXA 4LMQE 1MF2L 1ZE3C 5BW7A 3RWDA 3BWAB 1IARB 1WC7B 4XH2A 3DETC 4C54A 4X6CB 4OLZH 4YZFE 4QWWD 1AC6A 1IGYA 4S1SH 3SCMD 1TZHA 3IDMA 4FQIH 5I18L 5D71L 3C8KB 3DI3B 2BNRE 4OFPA 2X9WA 1A6UL 2F5BH 4K9EH 2D2OA 1E6JH 4GOSA 4RAVA 2AK4B 1SM3L 4OZFB 1XIWA 1A1MB 4MCZA 3T4AA 1TXKA 5M7QA 2R23A 4E42A 3UC0H 4LPVA 2ILLA 3KPSD 4HD9A 5H94A 1MRCL 1LO4H 2X4UA 1QKZL 5ETUA 1Q94A 2C3XA 1A6AB 3X12B 5AEAA 1ZLVH 3WO3B 1CDGA 1KYOJ 4KUZL 1AQKL 3ZE0E 1QA9B 5D2NA 2A9ML 1WLHA 3BRDA 4XVUC 1WWAX 4ACPA 1FAIH 2WM0A 4R7NB 5GGSA 1BJ8A 5BV7L 2ZOKB 3GSXA 3E2HC 4QXGH 3DWTA 5JPNB 4OCYH 5I1KH 1OAXH 2Y4SA 4LPYA 3RIAK 3EYVA 3HCVA 1ZHNB 3IXTA 2E9JA 2GT9B 4NOFA 4R26L 4XNQA 4LIQL 3EYOB 4U6HA 3C6LC 2V9TA 4PJDE 4DN4H 4TVPE 1D5IL 1YMHA 5SV3A 3SCMA 3IFNL 4M1GH 4XGZB 1OGTA 1Y18B 4LHUD 3WJLA 1T7VA 1NC2B 4I0PC 4EOWH 3H9SB 3KPTA 1M1SA 2HTKD 1KXTB 4PV9B 1JWMA 4JDTH 3ZTJG 4GW4A 3DX9B 4HKXB 4NT6A 4PGCB 3KPSA 1RSFA 3MOAL 4LLYA 5IMOB 5J06A 1YMMD 1IKNA 1BQHB 1KLGA 4M7ZB 4L4TA 4ODHL 1FNEB 4KKLC 1R3JB 2VC2L 4PRPE 2R9HD 5DLMH 5ISZD 5GGQH 1TQCB 1QG3A 3VGGA 2ADFL 2X70A 1HHKB 3HUJF 3ULVL 1LE5B 3K4DA 3VFUA 2X4SA 3ECBB 5I74B 1K4CB 3B2UD 3OJDB 3QO0B 5I30L 2NR6C 2W65A 2IWGA 3VXRB 2D7PA 3OAZK 3ETBF 3S4SA 3G5XA 1KUMA 1VHPA 4BH7B 3ARFD 2EKSB 5C0BA 4WI7A 4HPYH 3MQIA 3LKNA 4HAFA 3QCVH 4RWYH 4XC3H 3AS1A 2QL1A 1I85A 2J88H 4O2EA 5SX4H 3GIZL 3CLEH 5FM5O 1RVFL 4NQDB 4OAWB 3UJTL 2WINA 3V0WL 5GS0D 4HGMA 5AYUH 4FG6D 2EIZA 1I8KB 2H1PH 5T1MB 1JGDA 3SDAB 1S7RA 2Z4QA 4JO3H 1J1PH 3FQRB 4KI1A 1DQMH 4LSVL 4DKFL 3UPRB 1KCRL 1N5YH 1V3JA 5C7XL 2W07A 4OLXH 1LMKA 5CFHA 4JB9H 1FNHA 4ZAKD 3LH2H 4JRYB 3VGAB 1KB5H 1MREL 1BAFL 4LGSB 3GSQB 3U6RB 2A6JA 3E6FA 1Q0YH 5C2BH 4OLUL 2DQCH 3TIEB 5L2JB 4F7PB 2OL3B 4KROC 3S36H 1PJ9A 3DO7B 2V2WB 4MQXD 3GSRB 4JKPL 5FYJE 2CJUH 2O26U 4I2XE 4ZTOH 1U8OA 5ISZA 3S5LB 4J4PD 4AT6B 2JB5L 4CNIA 1I9RL 2DLTA 4FFWC 4P2RA 2WZPD 4YHZL 4J1UA 5DURB 4N0YL 4H8WH 3JXAA 1QSFD 3VGEA 3P2TA 3MRMA 4XNXL 5HGAB 4XBPA 4WUUD 3B43A 5KOVC 4RAUB 5K93A 2UWEB 2VDPH 4YLQT 2Z92A 1KEGH 2P24B 5BRZE 4EI5B 4HIXL 1BVKA 4GRMA 3KPNA 2R0KL 3N1QC 4FXKB 2ARJB 5JMRA 4AIZB 1NC4A 3E6HA 2X4OA 3ARBA 1S9VB 2VZ1A 3TBTA 3HRZA 2A73A 5I1AB 2Z8SA 4PJ9A 1R3IH 4ODXB 5D1ZC 5F71A 5C0ND 5E5MA 3T0EB 2ZKHL 1CLYH 1J8HB 1XCTB 1CZ8H 4NQSA 4JN1H 4E41D 2GTWA 3UDWC 2P1YA 1KGCE 3AREA 5F3HA 2ED9A 4TYUA 3PL6C 4ZAKA 4RAHA 1I3UA 3WLBB 4DQOL 1L0YA 4GG8A 1CBVL 3UTSE 5JIPA 5JOFB 5J6GA 2GUOA 4X5LA 2KPNA 4EXKA 5GS3A 1XF3B 4NKMA 2QKIA 2HLFC 4JHWH 4PRIB 1WUNT 4MXQC 1QLFA 1N64H 1Z0MA 4JN2A 3FO1A 3EJZC 5HYFA 3QQ9D 3UP1A 1FL5A 4HIEA 5I8EB 2AJVH 3MLWH 4KTYA 1QSFA 2PNDA 3HNSH 3TO4A 1NPUA 2VR9A 4U1NB 3MV9D 2VQ1A 2B5IC 4WUUA 3RVUD 4Z7WA 2P8MB 4OD1L 3SQBA 3MACH 1NLBH 1UH2A 3UBXG 3OKKB 4HIIB 4R2GC 4WHTB 4UNTA 5KBNC 4EUPB 3AS0A 4PTTA 1YY9C 3O4LB 4Z5RA 4PJCB 4ZXBB 3W11D 3B9KA 4R97C 1MFBH 3AM8A 1WISA 4GRWB 2DWDA 3E8UL 1LEIB 4WUKH 5JZ7D 1ROWA 1SYSB 4L5FL 2VXVL 3F6IA 3NIGE 2P8LB 1TNNA 4LCUA 1LP9E 2QQLH 2GJZA 4PGDB 1EERB 3S98A 3KAAA 4L4VE 1YEIL 1FRGL 4L9DA 4XRCB 4EQ2A 5D70H 3BWAA 4OIIL 1WC7A 2C9AA 1W8OA 5IK3B 4X6CA 4LVNB 5GZOC 5KVFL 3O9WB 4K8RL 2GSGB 5GRXG 4C56E 4YXLL 4OFKA 4K3EL 1DQLH 3C8KA 3JTSB 4MAUH 3V6OE 1BBDH 4GQ9H 2P49B 5E6IB 5D7SL 1I8LA 5ADPH 3UYOD 4YDKL 4JG0L 1T89A 3OJ2C 3H9SD 1FFPB 4FFYL 1ADQA 5SX5K 3ZDYE 2AK4A 4OZFA 4P3CL 1HCFX 1ZLUH 4I13B 1A1MA 3GI8L 3ZKXB 1FPTH 3CJJA 5DQDL 1WFUA 1IL1B 1Y0LB 3FTGB 2JTDA 4Z76B 2BSSB 1G7IB 4X6FB 4C59B 5TPWL 3VWKD 1OHQA 4LSTL 2Z31B 3TEUA 1UH4A 3GZKA 2YA1A 1A6AA 3X12A 1UCTA 4YDLB 3DURB 4NNYB 5E9DE 2D4FA 1QA9A 4BQCA 3EO9L 3RPKA 1WWWX 2EDHA 1UKSA 3T0WA 1GRWA 2ZG2A 3VXRD 2X4QB 1RIVL 3IJHB 1JZ4A 4R7NA 5C86A 1T1ZB 4QTIL 3BO8B 3FRPG 5D72H 1I3GH 2ZOKA 4K71C 3WD5H 3SDDC 4DFHA 2NY0C 3KXFE 4MS8C 3NAAL 1I9JH 5JPNA 1HINH 2XV6B 4NQDD 5I15L 2OI9C 4JKKA 4XTRC 1ZHNA 3MNZB 2GT9A 5E2TL 4U49A 1PKQB 3EYOA 4QLRA 3V2AR 3SDAD 4DWHA 3EYUH 1WCBB 1JYWA 4ZQKB 3VMOA 1N0XH 4XAWH 4EDWH 4BFGA 4MA7H 1PY9A 1Y18A 4XGZA 4NSKB 4NQCB 4MNQE 5B39B 1UA6H 1NC2A 1KJ2L 1VPOH 3H9SA 4PJ8D 4JRYD 4EN3B 5T1KB 4PV9A 5FUOL 4H1LG 2CLZB 2FJHB 3C09B 3CK0H 4UB0L 4Y4FC 2E9BA 3U30C 3DX9A 2JCCF 4HKXA 4PGCA 2BSED 5IMOA 3NCEB 3RWCB 1BQHA 2VDML 1NFDE 1FNEA 1R3JA 1AO7D 2FJFA 1AXTL 2C4FU 2NYYD 4MNGB 3MRPB 1C5BH 2NY2B 5IFHH 1HHKA 2I60H 1LE5A 1IC7L 5DURD 1WSST 2DM3A 4MMXC 3ECBA 4XPBL 1CQYA 1K4CA 3OJDA 3QO0A 3KPRD 3VXRA 4YEEA 5FO9B 4BH7A 2EKSA 3Q6FB 3NCYP 1KPRB 4EI5D 2Y72A 4A2LA 4ZS6D 5I2IB 1A7OL 3D85B 4NQDA 4OAWA 5EO9B 1F8TL 2ATKB 4HJ0C 3I3DA 5IG7B 4ODBD 1CF8L 4KGJA 4IDJL 2BFVH 5CD3B 1I8KA 5JOPD 5T1MA 4W4OC 2IANB 1E6OH 1BF2A 2DJ4A 1ZLWK 1P84J 5DD0L 3SDAA 5E6ZA 3FQRA 1JHLH 4NKOB 3UPRA 1AIFB 2IBBA 1WZLA 3H42L 2COQA 5FA3B 5BS0E 1N6QL 1NCBH 4IMKA 1G7LB 1X5HA 1OM3L 4HKZB 4JRYA 3V7AE 1IEBB 2H2PC 3GSQA 1BWWA 3U6RA 3S3PA 3TIEA 1EEYB 5L2JA 3UTTB 4GKNB 4F7PA 1XF5B 2OL3A 4UI2A 3DO7A 2V2WA 3QUML 4PBVC 3GSRA 4PRID 4YQXL 3CZJA 1TITA 2BJMH 3S5LA 1KELH 1UFUA 1EUUA 5E2UL 4AT6A 5JHLH 1EAJA 3U83A 3ALXA 3E2HB 4XI5D 2DLFH 3UROR 4LRIC 3T0AA 3K8LA 2XIDA 3B2VH 4OFDA 4CU8A 2JJSC 2WLYA 3QUXB 2BNUB 5HGAA 2OMNA 4ODTL 4M61B 2DTMH 2APXA 2VJXA 4RAUA 2KQNA 2XQYK 1F4YL 2UWEA 3MLTB 1IEAB 4MYWB 2P24A 4RDQG 4EI5A 3QG7L 3DROB 1AY1H 3HRPA 5F96H 5IB4B 32C2B 5FUZH 4FXKA 4K94L 2ARJA 4KHXH 5FYJL 4AIZA 1DQDH 1S9VA 4ZXBD 1TJGL 2YOCA 2NY1C 3QEGH 4ONFH 1G9MC 5I1AA 1QFWM 4XWGH 4ODXA 2WIMA 3T0EA 1J8HA 2K1MA 2DDQH 1XCTA 5HDOA 4FZEL 4K07A 3NPSB 1IGIH 5C70A 3WFEL 1X5ZA 3WLBA 1ZT7B 1KXQE 3MRKB 1DZBA 1XT5A 3F7RA 1QBLH 5DD3H 3TYGH 3QXDB 2F54E 5JOFA 4HT1H 5M94B 3CSBA 1XF3A 2F5AL 4X6DE 4UTBL 1KN4L 2HFEB 4PRIA 1I1YB 2C3WA 4M03A 3O9WD 4QXUL 5CZXD 4MHHI 3GHEH 1UM5L 1HDMB 5I8EA 3CVIL 5D7JB 3GSUB 5E03A 3ZYOA 4JPIB 1RU9H 2EEBA 4U1NA 3G5VB 5HD8C 3RRQA 2VZTA 4TSBL 5DJDB 2P8MA 5IB2B 4YPGB 3H9HB 4AIXA 2NY5L 5DUPL 1OAYH 3OKKA 3SDXB 4HIIA 4WHTA 4ORZC 4H5SB 4HMEA 4D9QD 4EUPA 2QHRL 3O4LA 1XFPA 4PJCA 4ZXBA 2Z31D 3BGMB 1YEFH 2D7QA 4OGYH 2VXQL 4YDIL 3EHBC 4XMPL 2DL9A 2VQTA 1GOHA 3CZFB 4R6UA 1HXMB 1WEJL 1IAIL 4P9HH 1LEIA 2GJJA 1SYSA 1AJ7L 4LFHG 2P8LA 2PUQT 2B20A 4XB7A 2E7LA 2AEPL 3P4OB 5I19H 4PGDA 3GMNB 3IYLW 2Q3AA 3RA7H 4XRCA 4OZ4B 5JXED 1F13A 3IFLL 5EIVA 4LLDB 2EDXA 2NY3B 2H9GB 1P6FA 5CZVL 1U3ZA 5IK3A 3O9WA 1YJDH 2GSGA 2ZWLT 5IWLA 4D8PB 3JTSA 2EC8A 5E6IA 3GIVB 5KG9B 5KZCB 4NKDB 3KPSE 1C12B 4XVTL 1FFPA 1D5XB 2E7HA 1HHJB 5T1KD 4EN3D 2VTFA 1UEYA 5CP7B 3WXWL 2XZCL 3R4DA 5C0FB 4Q9QL 4MJ4A 3MPCA 1IL1A 2AJUL 1Y0LA 4D0BB 3FTGA 2AI0H 5JORB 4Z76A 2BSSA 1G7IA 4X6FA 4WHYH 2YS4A 3IVKB 1KTDB 2Z31A 4QGTA 2EDKA 1WTLA 4UOW1 2NY2D 4G8EB 2P5WB 5KS9F 3DURA 4KKNA 4NNYA 4UTAL 5ENWB 5LQBL 2LAGB 2FHBA 2F8OA 4WFED 4NZRL 4OLWL 2BSTB 3O3BB 2RGSA 2X4QA 1EEUA 3IJHA 1T1ZA 4OI8A 1EGJH 3BO8A 2HKFH 4DZBB 2VLKD 2AJSL 3TZVC 3D3VB 3DETD 1I7ZB 4MVBC 1UCBH 3SGDI 2ADGB 2XZQH 1BZQK 1Z3GH 3D85D 1DUYB 5JXEA 4Z7QF 2H6PB 4WVRA 2PYEB 3MNZA 5IEHB 5KSUB 1PKQA 5C0RH 5LJYH 2D7NA 4LCCB 2B5IB 1WCBA 1NUFA 1RULL 3BZDA 4QHMB 4ZQKA 2DD8H 5KAQG 1CGTA 3HNTL 4NSKA 4NQCA 1DN2A 5CLWA 5B39A 4EIZC 4R2GB 1YDPB 3C9NB 2IQ9H 3EKCA 4JFDB 4NWUL 1YMME 4CUCA 4EN3A 5T1KA 4FQQB 1L9MA 2CLZA 2FJHA 3DVNB 3OKLB 5T3ZH 4TSCH 2I9LB 4UMGA 3OGCB 2IMMA 2KQMA 2ENYA 4R97B 1FIEA 4QO1A 1SBSH 5JR1L 3UTTD 4J8RB 4NJ9L 2QSTA 3B9VA 4UZGA 3RWCA 3VMPA 4XVUD 4YAQB 3LKOB 1XMWA 4MNGA 1PEZA 3MRPA 2OTUB 5E2VL 4I77H 1UB5B 3PHOB 3ZLQC 2NW3B 3PQYB 2QQKL 1DR9A 1NGPL 3HR5B 1QBML 1ZOXA 5FO9A 5HHNB 2X40A 2B1AH 1X5GA 2VXTH 3Q6FA 4NQED 1NCAL 2CKBH 4KVCH 3C6LD 5TGBB 1KPRA 4FXGB 4OLYH 5I2IA 3D85A 4MD4B 1OP9A 1WFNA 4JKMA 5EO9A 2ATKA 5J3HC 2GIYA 4NC1E 5IG7A 4I0PD 3BGFB 5FCUH 4LK4A 5CD3A 3T77B 3ZYIA 1NBVH 4K2UL 2IANA 3QWQB 3V7AG 4ZODA 3AS3A 4OCRL 4NKOA 2VDLL 1EVUA 1AIFA 3OJMB 5FA3A 4P46C 4OF6A 5IFAH 5IVOA 2IC2A 1G7LA 4M7KH 4RMQA 1KCSL 2A2QT 3H3PH 4HKZA 4KKLD 2H32B 2ZCLL 5L88H 3X17A 1P2CB 1IEBA 1WK0A 4JO2L 4WU5B 3AB0C 1OTTC 1EEYA 7FABH 3UTTA 4GKNA 4R8WH 1XF5A 1TJHL 4HS6B 1HQRB 1JMZA 3HR6A 5EN2B 4YHML 1QSFE 5DRWB 2NR6D 3MGAA 2P45B 4ERSL 3O2DH 3CLFH 4XPGH 4K71B 2OR7A 4WUUE 2Q8AL 3SDDB 2DQIH 2NY0B 4XBGB 3QWRD 3ARWA 3RNKB 1MY7A 3MYZA 1GAFH 4Z7NE 1MQKL 3QUXA 2BNUA 2OI9B 3ZO0A 3S8WA 4M61A 1X44A 3DVIA 5DJCB 5EUOB 2QTEA 3MLTA 1IEAA 1UM6L 4O9HH 3O41B 3DROA 5IB4A 1SEQL 32C2A 4AL8H 4DKEL 5IW3A 2X09A 1T83C 4E41E 3DSFL 3ZZ1A 1T1WB 2VLRE 3MJ9L 4HWEH 3P77B 2AK1L 5HYQB 3ORJA 4Y4FB 3VXQB 5MEPB 3U30B 3BE1L 4U1IB 4XP4L 4JRXE 2KH2B 2P42B 4KROD 1UYWH 4OSUH 1ZT7A 1WAAE 5ICZB 3MRKA 1EHAA 3K4ZA 1F00I 4XVSH 3QXDA 1MPAH 2BRRH 3ES6B 4FFWD 2QHLA 3GSWB 5FA4B 3JWOC 1BBJB 4KZEH 1CE6B 3N0PB 2C7UB 3KWWB 4WW2B 3VMNA 2HFEA 3ARPA 3OMZA 1I1YA 1GGTA 1LD9B 4XNZC 3MV9E 1KENH 8FABB 1HXYB 4HJJH 3L9RB 1D7FA 1HEZB 2FYYB 2HJKB 3QWRA 1HDMA 4XCCL 4IRJC 3NIFF 2FZ3B 5D7JA 2CMRL 3GSUA 2PXYB 4MA1C 5KZCD 4JPIA 5CBEB 2XG4A 2AS5M 3G5VA 5D2LF 5CSZB 5DJDA 4Z0XB 5IB2A 2AV7B 4YPGA 4E5XB 1FP5A 3HZVB 4MXWL 3H9HA 3L3OB 1ZVHA 2R69H 5D1ZD 1EBAA 4XNUL 1NCCH 4Y7MA 3SDXA 4AZ8A 1MRDL 4H5SA 4UQ3B 4HEPG 4QRTB 4XP1L 4JPVL 5MENB 5E5UB 5K9JL 3CSPA 3R1GL 3O2VH 3BGMA 1B4JL 3PL6D 3QQ4B 2YD4A 2HLAB 2MCPH 3K74B 5DJ6B 5JW5B 2P5WD 5FYJU 1GPOH 4KKBC 3CZFA 1HXMA 1IGCH 5CS7A 2YRZA 4H8WC 4P9ML 3U7WL 2FATH 3H3KA 5L6YH 1E0OB 1X4XA 2HLFD 4OCSL 1OT2A 4MXQD 3P4OA 4Z7VB 3D3VD 4XPAH 1NGYB 2XI9A 5EC2B 1HILB 2HRPL 3GMNA 5FKAB 3EJZD 3W81A 1NKOA 4OZ4A 3F58L 2PYED 4LLDA 2WWMC 2H9GA 2MQ0A 2MFNA 4J7RA 3H9SE 4HF5H 3KJ4C 3HAEB 3SPVB 2R0WL 2AJYH 5HVHC 4D8PA 4QKXB 5IEKB 4OUUB 3GIVA 4LKXB 5KG9A 4R2GD 4NKDA 2IH3B 1RZ8B 5D96B 43C9B 1C12A 4JFDD 3BDYH 1D5XA 1HHJA 1YY9D 1AKJD 4KMLB 2NY4C 5CP7A 2NY1B 2F8XC 3S4SG 2W0KA 5I1GL 4OUOA 5C0FA 1JNNL 3DX8B 3MLPA 4NNXB 4D0BA 4ZFFB 5JORA 5IW1B 3UBXI 3VGFA 1ZSDB 4X9GA 1JF6A 1WZMA 3TBWB 3IVKA 1KTDA 1YEGL 2IH1B 4RMTA 3VXRE 1D6VH 1MJ8L 4G8EA 1WWBX 5IVZB 5EBMB 2P5WA 5IR1B 1N4XL 2IFFL 5ENWA 1ONQB 1NAMB 5IGXL 4GMSL 3PQYD 3VXMB 2BSTA 3O3BA 4W6YB 2ZUYA 2FR4B 4NQDE 4LHUG 3VI4F 1EIBA 1XF2B 4LMQI 4HK3J 2ICWI 4DZBA 4JM4H 3D3VA 3K81A 2ADGA 2YUVA 2VL5B 5GZOD 3VFNA 5KSBB 1WQVT 1DUYA 2WUBL 4BK5A 1SVCP 5CP3H 2H6PA 2PYEA 4PV8B 1ZT1B 2VLMD 4ELKB 5GSVB 5IEHA 1JGUL 5KSUA 2B0SL 4PJ7F 1MAKA 1RV6X 5CLTA 3FJTA 4HC1H 4JRYE 4LCCA 4YDVB 2G5BB 4QHMA 3VFMB 3GKWH 5ITFB 1NLDL 3UTQB 1T2QL 2DB8A 3O6KH 3T2PA 1JI2A 3STLB 1LO5B 1YDPA 3C9NA 1F4WL 5D7IF 5HYJB 4JFDA 4F57L 5DJYB 1PG7H 1A3LL 4RBPK 4FQQA 2E27L 5A3IC 3DVNA 3OKLA 2I9LA 1AO7E 3D2UB 3MUHL 3OGCA 5ILTL 4JQVA 4XPTL 2B2XL 4MA8L 3KDMB 4J8RA 5EB9A 3TCXA 5FIEA 2F9BT 4ZS7L 2YPVL 3DRTB 4TSAH 2ZCKH 2GAZB 2XQBH 2CDGA 4N8CL 2ESVD 4YAQA 3LKOA 3KPRE 6FABH 4ENEC 2OTUA 1U8JB 3SDDD 5IMLB 2NY0D 4MS8D 3VFRB 1UB5A 3CFCL 3PHOA 3PQYA 2NW3A 3OKDB 2OZ4H 4X99B 5DWUH 1Y6MR 5K9QG 5L0QC 4XTRD 3RVWC 3HR5A 4JANB 5HHNA 4KC3B 3O0RL 2A0LC 3QZWB 4R4BB 5EOQL 4OI7A 5JOPE 1NDMB 5TGBA 4B5EA 1R0AH 2XY2A 4FXGA 1I75A 5TF1H 5ID0B 1U0QA 3PUCA 4MD4A 1HYRC 1WICA 4YZFF 4XMLH 4DVRL 3V4PH 4MJID 3ULVC 1HZHH 3T77A 1JYVA 1GCFA 3F8UB 4I3SL 4Y4FD 4TPRH 3CVHB 3JVGC 3BIAX 1MFNA 1OAQL 4HUWB 1ULVA 2DQTL 5GS0L 1LO3H 1G6VK 2H32A 1P2CA 2OX5A 4UIKL 4PRIE 3ELAT 2DF3A 1KBGH 1JZ5A 4OD3L 4WU5A 4J23A 4JO1L 4HS6A 1CK0H 4HS8L 3SKMB 1HQRA 2HKHH 3HC4L 3UO1L 5GGRB 5EN2A 5D8JL 2I27N 5DRWA 1INEL 4R90L 3RIFF 4LASL 3JZ7A 3WSQL 1JMXA 2CR6A 4U3XA 1T2JA 4JFFE 3ZE0F 4Y4HC 1GZQB 2CQVA 1DBJL 3G6AB 2MPAH 5GGTA 3SDDA 4XBGA 4LRNH 3L5JA 3RNKA 4ZNCD 1BJMA 3IS0X 3WFZA 5T5FL 1GJIA 3U0WH 4XHQA 1QRNB 4HJ0D 5DJCA 4UV4H 5EUOA 3FQWB 4PJCE 2FHFA 2WAHA 5ALCH 1ZA3B 3A67H 1CFVH 1QTYT 3O41A 2Y25A 4OCWH 2YRPA 3UYRH 4L1HA 4WI6A 1XGUB 3TVMB 2YA2A 2X7LB 5H8DA 4Z7UB 1T1WA 4JHAL 4X80H 3EYSH 5GRVK 3P77A 4KK5C 3UJIH 2X6MA 2H2PD 5HYQA 3WNNA 4Y4FA 1P7HL 3VXQA 2NX5B 5MEPA 2IAMC 4JAMB 4U1IA 4JREB 2GY5A 1W8NA 5IROC 1BVLB 3RWFB 4WY7H 5E1HB 2HWZL 2M26A 3DPBA 5ICZA 1LO0H 4MB3A 1KCLA 3ES6A 1DL7L 4OZFG 5F9OH 4FQHB 2EYTB 1GOFA 2YRLA 3GSWA 1QBBA 5FA4A 3SOBL 1BBJA 4LARH 1XGYL 4NZDA 1CE6A 2C7UA 3KWWA 4WW2A 4UT7L 5C0JB 3NA4A 3SKJL 4JE4B 1LD9A 4OCXH 3GJFH 4NN7C 5MEQB 5CILH 8FABA 1HXYA 4LVHC 3L9RA 1FH5H 1HEZA 2Q7YB 2FYYA 2HJKA 4NQUA 2FZ3A 5HHXL 2FBJL 2PXYA 3KJ6L 5JLZB 4JFXB 1PW3A 1UJ3C 5CBEA 4HAGA 3N85H 4RIRB 4D9QE 1A7QL 4ODVH 5CSZA 4Z0XA 2AV7A 2NY1D 2XN9D 4E5XA 3HZVA 4W4OA 1J18A 4IOFC 2JELH 3L3OA 2VKXA 4QYOB 2X05A 4CADB 3ARRA 4P46B 4UQ3A 3C08L 4FZ8H 4YFLI 4QRTA 3U1SH 1TJIH 3MJ8B 1ZLWH 5MENA 4OZGE 1MNUH 2FECL 1ADQL 2WMPA 3QQ4A 2HLAA 4ZDHB 5DJ6A 3SDCC 4ZOCA 5JW5A 2DTSA 1K9TA 3R8BB 2VAAB 3OPZH 3AB0B 2GJ6B 1R6VA 1FNLA 4UV7H 1FGNL 1IAMA 4M6OL 4XP9H 4YXHL 1AQDB 5EC2A 4Z7VA 1NGYA 3VRIB 1FBIL 2AQ2A 1HILA 1IFHH 5FKAA 5J9PB 5FUCC 3TA3C 4NFBA 1J1OL 3FT2B 4GFTB 4LRIA 2EH8L 4L3ED 4U4BA 4WHCA 2JJSA 1A6WL 2NTSP 3RWEB 1BQHG 4X5XB 4YGAB 1B0RB 1SY6A 4PLJC 3BP6B 5HD8D 1DE4B 2KZWA 3HAEA 3SPVA 1MF2H 5C6PB 1W72B 4U3CA 5IEKA 4OUUA 4Z8FL 1FN4B 4LKXA 4C55A 3KLHC 1UXWB 4LCWD 3AS2A 2IH3A 1RZ8A 3MREB 43C9A 5LWYH 3PF2A 1UENA 4JFYB 1ZLSH 4OZIE 4NRXB 4M1CC 5I18H 5AWNL 4F9PC 3D2UD 5D71H 4MNGE 3BISA 1K6QL 3EHBD 2WUCL 3DX8A 1A6UH 4NNXA 3NIDE 4ZFFA 4YHKL 4ELME 5TDNB 5IW1A 4WFEE 1SM3H 1ZSDA 2JF1A 3TBWA 4Z78B 5TFSL 2IH1A 1NGQL 4LHQB 3ULUC 4WTXA 1FIGL 4YFLF 1AXIB 1QFUH 1QSEB 5IVZA 1W0YT 4IEFB 2VLKE 5EBMA 5IR1A 3DIFB 4LCYB 4I5BB 2BDNL 5I1IL 1ONQA 1NAMA 4DVBB 3SGDH 1M7XA 5CIPH 3VXSB 3VXMA 3GBMH 5EULV 3CC5B 2FR4A 3GNML 1KCUL 1EVTC 4OV6F 1XF2A 4ZNEA 4KUZH 1AQKH 4YPJA 2VOTA 2VL5A 1IM9B 1A6VH 4M48H 5KSBA 1PG7X 1FYHB 1JWUB 5BV7H 5IVXF 4IRJB 3CDYA 4PV8A 5C0IB 1ZT1A 5GRZA 4ELKA 5GSVA 5E2WL 1KFAH 2Y5TB 4HZAA 3U9PH 1W2KT 3QSKB 1MCEA 5DR5L 2PO6B 5AUMB 4F7TB 1IILE 4YDVA 2G5BA 3S5LG 3VFMA 1J0HA 5ITFA 2APWA 3GJEB 3UTQA 3WLWC 4H88L 5IQ9B 4R26H 5GISL 1G9NC 3STLA 3UTTE 5C3LD 1LO5A 1XAUA 4LIQH 5HYJA 1JTPA 3QG6B 4BZ1H 2JK5B 5DJYA 5JHDB 1HKLL 5DVLA 3D2UA 1Y6KR 3H3BC 4MX7B 3F7PC 3KDMA 3FN3A 1N6UA 3QT2A 3DRTA 2GAZA 3VG0L 4FMKA 3VXUD 5LGJB 3O6LH 1KNOB 5IJVB 3L95B 1U8NB 1U8JA 2W0LA 3TZVD 5IMLA 4JKLA 3MOAH 4MVBD 3VFRA 4NQEE 3NIGF 3WE6B 2W0PA 2K7PA 2X1PA 3MA9H 4ODHH 2VC2H 2X4TB 3OKDA 4X99A 1LP9F 4MSWB 3RDTB 5I16B 5E7FA 4KI5F 4JANA 5EU6B 4G6KL 1FC2D 3BD3A 4KQ4L 3QZWA 3KPOB 4R4BA 2XYCA 3DXAD 1JTTA 2YSSB 1DP0A 1NDMA 5ID0A 4H0HB 2KKQA 2R4SL 5FM5M 1V05A 1DANT 3ULSB 1KJMB 3C5SB 2CLVB 2NY4B 3GIZH 3NFNB 1RURL 1RVFH 5F3BB 3UJTH 1QBAA 3CVHA 4IS6B 3P4MB 3ZDYF 4L8BB 2FGZA 4HUWA 4HXBH 2DBJA 1A5FL 2DS4A 4IOIB 3LB6C 3W5MA 2GHWB 4WGWB 1Z5LB 4JM2C 5TQ0L 3QYCA 3GMPB 3O3DB 3Q6GL 2BERA 2DQHH 2A74B 4WI9A 1KTKE 4OZHB 3SKMA 3VD4A 4JLRB 1TVHB 4BQ6A 5GGRA 4NZUL 1BAFH 2ICEB 4EUPG 4BQ8A 1DBKL 4OLUH 1GZQA 3G6AA 3LEYH 5F9DC 4M6NL 1VFUA 3UCRA 4JKPH 3DHMA 4UIMB 3SDXE 3BDXA 2Z8RA 4DTGL 3BKML 4W81A 4NNPH 1QRNA 1OAKL 5J3HD 3FQWA 4YHZH 4LPWA 4N0YH 1ZA3A 1UKTA 3CX5J 2VQUA 4KK6C 4PJFE 4XNXH 3IB4A 4P46D 1OB1B 1SJEB 3L3JB 1XGUA 4CVXB 1DFBH 1S7TB 3TVMA 4U6XB 5LXGH 4HDIB 3O45B 1YQ2A 2X7LA 4Z7UA 5HYIA 1JGEB 4PLKC 3NZHL 2R0KH 1HSBB 1RFDH 5DMGC 4NJAL 4BFEA 1OAUL 3MXWL 2NX5A 5HI3C 4MZ3A 2GJ6D 4JAMA 1OTTD 3M17B 3IJYB 3RWFA 1BVLA 1U42A 1QSZA 4KU1A 5LCVH 3WIHA 5FGCE 5I1JL 1T6WA 1WWCA 4N1EA 4FQLL 4TRPL 1CDUA 4D9LL 4FQHA 2EYTA 1NFDF 5CUSH 1JGLL 2CH8A 1Z6JT 1EHLL 4DAGL 3MBXL 5C0JA 3LD8C 1ITCA 5L0QB 5MEQA 5GS1C 1V3MA 1C1EH 5J1TC 2Q7YA 1YYML 5C6TL 1AC0A 1QR1B 3SN6N 2XFXB 5D1QC 1ZANH 5F97E 3TWCH 3N9GH 5JLZA 4JFXA 1MI5D 3LQAC 4FABH 3SE8L 1YPZB 3ARZA 2FGWL 3C5JB 3UXFA 4NIKB 4TNWK 4RIRA 2ED7A 4QXTB 1UACL 1IGMH 4QOKB 2AEQL 5I71C 4HZLB 4QYOA 4CADA 2P5WE 4P46A 3BZFB 4OLVL 3MJ8A 5MERB 4YK4B 2J8UB 2X5PA 1XF1A 4URTB 1QSED 4ZDHA 3MRLB 5ECJE 3RTQB 3D3VE 5H37G 2VAAA 5I73B 3L3DB 3QCTL 2GJ6A 2AJXL 3QPXH 1JZ2A 2PYEE 1L7IL 2E7MA 1RZJH 3HE6C 5B39G 3E8UH 1RZGB 1JRHL 1T2XA 1AQDA 3MBEC 3VRIA 4C4KO 1IGFL 1IM9D 5J9PA 3JWDL 4L5FH 4WHDA 4ZD3L 3OAYK 3V95A 4OKDA 4KH2A 3FT2A 4IRJD 1CFSB 2Y36L 3RWEA 3G6JB 4X5XA 2E9WA 1B0RA 4JFDE 1FRGH 3BP6A 1DE4A 4QRPB 1J0YA 2EXWC 1Z9LA 1W72A 1QHPA 1FN4A 2YK1H 3EOYG 1UXWA 1IC5H 3MREA 4YUEL 1T83A 4JFYA 4NRXA 2JJTC 4JFED 4K3EH 2ZJSH 1Q1JL 1E4KC 4JG0H 1A6PA 5JNYB 4KKBD 5FYLD 5TDNA 4I18B 5F7FA 3PQYE 3CAFA 4Z78A 4ODSL 3O11B 4MQSB 4J3OC 2N1KA 1QSEA 5DQDH 2BHYA 3DIFA 4LCYA 5B3JE 4I5BA 4DVBA 5TPWH 4ZOAA 3VXSA 2WP3O 4N0UB 3CC5A 1EZVX 4B41A 1TVDA 2RIKA 2VLME 2H8PB 4FQ1H 5EU6D 2WWMD 3VRLE 3ARDC 3EO9H 1IM9A 4LVHB 3B6SB 1FNFA 4X6DF 4MDJB 4YBQC 1RIVH 5EOCL 1JWUA 4CVUA 4IRJA 5C0IA 2Y5TA 4WFGD 3NAAH 4PRHB 1WITA 4UT6L 4NHUB 4PYHA 2PO6A 5AUMA 4F7TA 1BLNB 3EO1B 2NY4D 4ZUUB 3RHWK 3PHSA 4DKDC 3GJEA 4M6ML 4FQCH 2L7JA 2XTJC 5IQ9A 4KV5E 5FDYA 3QG6A 2JK5A 4IMLB 4WO4B 5JHDA 3FZUC 3LPGA 3CCHB 1BREA 2ESVE 3NCYS 3LIZH 1LK3L 1EFXD 3V4UL 4GRLC 4MX7A 3CFBB 3PGFL 1IC4L 1CE1L 3WIIH 5CEZH 5CSBA 1M4KA 4JFOB 5FUOH 2VZUA 1MJUL 1X6NA 5LGJA 4YBLC 1KNOA 5IJVA 3L95A 3MLUL 5T33L 1U8NA 5EUOE 3BPNC 1OPGL 1FO0B 3JWNC 3WE6A 2RCSH 3LVEA 4POYA 2VDMH 1FG2B 2X4TA 4DGYL 1OP5K 1U36A 3DLQR 4MSWA 3RDTA 4TVPH 4UT9L 5I16A 4YGVB 1LE9B 1FORH 5EU6A 3C60C 2QV2A 1RJZB 3KPOA 1KEML 1IC7H 3ISWA 4PJXB 4MJIE 2W9DL 2YSSA 2E8ZA 2AXJA 2WV3A 4XPBH 4TUKL 3GGWB 2WBJB 2FX8L 1J8KA 3BP7B 3QQNA 3W9DB 1QP1A 3OAUL 3WL9B 3X14B 3K4AA 3ULSA 2EDJA 1KJMA 3X3GL 2QQNH 2CLVA 1NAKL 3C5SA 1A7OH 4HBCL 5A3ID 3NFNA 4OJFL 3MO1B 5F3BA 3QUYC 1LHZA 3MRJB 4RNRB 4YC2B 1F8TH 2DICA 4JY5L 1GOGA 4H1LH 4IS6A 4K23L 3P4MA 4HUXB 4IDJH 4L8BA 4ZTPL 3WNMA 1JPTL 3AAZB 4JG1L 3FHQA 5HDQH 4IOIA 3ZHDA 5DD0H 1Z5LA 4OFYD 3A6CH 4R7DB 3VGBA 1LWRA 3H42H 3VFSB 4ENED 1N6QH 1A8JH 1AGCB 3GMPA 3MC0A 3O3DA 4U7KA 2A74A 1OM3H 4OZHA 1HK6A 2OM5A 2DQFB 4JLRA 1TVHA 1U95B 2C4FT 4GSDL 4HGKC 1EO5A 1BZ9B 2ICEA 3RVWD 5HSFA 1I4FB 2LU3A 2BNQD 1CG9B 4XX1E 5B4MC 1WBXB 2A0LD 2FH6A 5GGVL 1S7UB 3QUMH 4KUCD 4YQXH 4UIMA 1Q0XL 1BFSA 1ZWIB 5E2UH 5J11B 5K9QI 2HMIC 5GXBB 4QOKD 3ULVD 1F97A 1BQUA 5EBGA 5D6CB 4CGTA 2C4XA 5MI0C 4LBEB 1B6UA 4NBXB 1OB1A 1GHFH 1HSAB 1KJ3L 1SJEA 3L3JA 1OD9A 2OP4L 4FHBD 4ALAL 4CVXA 5DUML 1S7TA 4U6XA 4HDIA 4M5YL 2V5MA 3U2SB 1JGEA 4LNVA 1MRFH 2KUTA 1HSBA 1RK0B 5FYJH 5SWZB 2Q1EA 1TJGH 5EH1A 3M17A 3IJYA 4PS4L 1ACYL 1BM3H 2IGFH 4BYHA 2DKUA 3CXHJ 3PWPB 1S7VB 4OFYA 4HUMB 2XTLA 4B53A 4Y4HD 1U3HB 2E3VA 2WWKT 4I1NB 1JZ6A 2HFTA 2FLBT 5F6HI 1UGNA 2IPKB 4KAQH 2VDNL 2F15A 2X4PB 1X5JA 4XAKD 1UJTA 1TMCB 1G9EA 2F5AH 3OKEB 2XN9E 4UTBH 1QR1A 2XFXA 1FSKB 2Q7NA 1YPZA 2XWBB 3C5JA 3E0GA 1G1YA 4QXTA 4QOKA 3KLAB 4HZLA 3K2UL 4KK5D 3ZYZA 3M07A 3F7VB 3OTTA 5F1NB 3BZFA 4HWZB 4XWOC 2IAMD 2HA1A 3O6FC 2C1PB 3LV3B 5MERA 2J8UA 4HFWB 3FB7B 5DZOA 3VA2C 2BXYA 3PWVB 2NY5H 5DUPH 1X3DA 2ZUSA 3MRLA 1YNLL 3RTQA 3JBG7 3ESUF 3QDMD 4KRPC 1J88A 2QHRH 4KJYB 3C6SB 3L3DA 2X1QA 3I6LD 4YDIH 1ZS8B 4TUJB 4XMPH 4L3EE 1RZGA 3VJ6B 4NC0B 4H26B 1WEJH 4J6RL 1IAIH 3MUJA 4LKCB 3RY6C 3S37H 4LPTA 3WYRA 2BVTA 2F74B 1AJ7H 2FECI 3GK8L 4PYGA 1C7TA 3TBVB 1CFSA 1WFOA 3LN5B 5F72S 2IQAB 4LCWE 3G6JA 3U7YL 3V52L 3BPLC 2P5EB 2H41A 1CFTB 2WANA 4Z7NF 2YZ8A 4QRPA 3IFLH 4IOFD 7CGTA 2MJWA 5CZVH 4JDZB 2O61B 1DBMH 4KKCC 3FO2B 2UY7A 3NH7L 4DFIA 3KYKL 1YZZA 1UG9A 2ZUWA 1JNJA 1GGIL 1P4LB 5D2NC 2JE8A 3SDCD 5JNYA 1DLFL 2ORBH 4I18A 4G8GD 1UVQB 5EFIB 4GAGL 1IBGL 3O11A 2XZCH 2NXZC 1YY8B 4HCRA 1N6VA 1QFWL 2AJUH 4Z6AT 2CKBB 2CRYA 3TA3D 4HWBA 1WAAF 4N0UA 1ZTXL 1T0NB 2G9HB 5DEGB 4DOHB 2H8PA 2E9IA 4LAJH 5DZLA 5LQBH 3RVVC 4UILL 4PLJD 3QCUL 3B8SA 3B6SA 4OLWH 4MDJA 3CH8A 5LG1A 1MCNA 5FGBA 5E8PB 5D1QB 1G0DA 2B8OT 3KLHD 4PRHA 3P3YA 3O8XC 4O51B 1E4XL 2BMKB 2DQEH 4NHUA 4UDUB 2GFBB 1BLNA 3EO1A 4M1CD 4ZUUA 1RZKC 4DEPC 1IKNC 5L2KB 3JV6B 4Y16B 1CD0A 3ALPA 1FFRA 4NBZB 4Q6YA 4MJ6B 5HHVL 2R0ZL 4U0QB 3LEVH 4K7PL 4XNYL 3TJEL 4IMLA 1RULH 4WO4A 3VXUE 3CCHA 3CNKA 5JTWA 3ULUD 5I8OL 2F8VA 3QUZB 3CFBA 5ERWB 5B38B 4Z95L 3W9EB 4DW2L 4NWUH 4RFNB 5JW4R 4JFOA 5DI8B 3U36B 1I7RB 1A3RH 2DLHA 2GKIA 3KYAA 2FX9L 2BY1A 2IPTL 3R0NA 4NJ9H 4PRDB 1FO0A 4YXKL 1MEXL 3DXAE 4Z0BL 1EJ6A 1FG2A 2AGJL 5EZJB 3T0BA 1U91B 5DC9B 4YGVA 5F7LB 3PWLB 5E2VH 1LE9A 1S7QB 4PPTA 1RJZA 4PJIE 4PJXA 3RGVC 3P0YL 4YWGL 3GGWA 3OZ9L 5JIHA 1NCTA 3BP7A 3W9DA 1MIEH 4MJ5B 2AAVA 1QBMH 4EJ1C 3WLWD 3WL9A 4P0DA 3X14A 1NCAH 1IQWH 4KKAC 1NFIB 5IIEB 3S88L 4M3JA 3MA7B 1YEKH 1XGRB 3MO1A 1GGCL 2ERJB 4F9PA 3MRJA 4RNRA 1I3VA 1JF5A 3TJHC 1UH3A 4HUXA 5DRZB 1U8QB 3ZDXE 1ZHBB 3AAZA 1UADC 3WJJC 4OCRH 3PWPD 3D5OF 2PR4L 2FD6L 2VDLH 2D7MA 4R7DA 3DV6B 3VFSA 1RHHB 1AGCA 25C8H 4PG9B 4XX1G 4L8CB 5D7LD 3VD7A 1KCSH 3SY0B 2DQFA 1U95A 2ZCLH 5D1XB 4B50A 1BZ9A 1S9XB 1I4FA 4PY8J 4S0TD 3T09A 1CG9A 2KL6A 2BHZA 1WBXA 3ARDB 1S7UA 3X3FH 4YHMH 3KS0H 3FB5B 3ARBC 4S1QH 4YHLH 1ZWIA 3RUGB 4PJ9C 5C09D 1HH6B 4OI9A 4X4ZA 5DA4A 4CN6A 2R0LL 5D6CA 4LBEA 4PGEB 1MQKH 3WO4C 3AREC 3PXHA 3UJJL 3FQNB 5E95B 1T20B 1HSAA 3OB0K 3FQTB 2XTJB 2GJ6E 2F58L 3G9AB 4OIAA 3ARGB 3LB6D 3U2SA 1NQBA 2DIBA 1SEQH 3F6LA 4JM2D 1L0XA 4DKEH 2GCYB 1RK0A 2VERN 4GRLB 5SWZA 3HAEG 3DSFH 4X8JB 2YUZA 4RMVA 1K3IA 2D9CA 3PWPA 1S7VA 3CSYB 2AK1H 3QHZL 4QNPE 1NCDL 4S2SB 1RAMA 4XP4H 1KACB 1RZFL 4XPHL 2VMFA 3BPNB 1U3HA 3TO4C 2ZSWB 4IJ3C 4Z7OE 4G3YH 2IPKA 2DKMA 1YA5A 1MI5E 4IBLT 5HI4C 2X4PA 5F1IB 2P5ED 2SEBB 2VLJB 3C60B 1HQ4B 5T3ZD 5BVPH 3BMWA 3OKEA 1FGVL 3D0VB 1P9MC 4KK6D 4JR9H 3MUZ1 3B9KC 2EYSB 2XWBA 1JVKA 1I1RA 1ZGLB 1SY6L 4XCCH 1BFOB 1A0QL 3KLAA 4PLKD 2AJZB 1S5IL 1QSEE 3N1FC 4TNVF 5ANMB 4U0RB 1XH3B 3QUYB 5DMGD 3F7VA 1PGRB 5KW9L 5E4EC 5F1NA 3MOBL 3DVFA 5HI3D 3P4NB 4HWZA 2QR0B 4UAOB 3LRHA 5KJRL 1KT2B 2C1PA 3LV3A 4HFWA 3NCBB 3FB7A 4N0RA 5CGMA 3QNZB 3PWVA 3K2MC 4XNUH 1EGJA 4FQJL 1JNLL 5DMYA 4D94A 1MRDH 1G9ML 1KG0B 3I75B 4JPVH 4XC1H 4KJYA 3C6SA 3R1GH 1JPSH 4JQXC 1ZS8A 1EJOH 3BN3B 4TUJA 3GMQB 1PKOA 4PJGF 4DCQB 1CGSL 3VJ6A 4BQ9A 4H26A 1H5BC 2Q8BH 4LKCA 4U2ZA 4P9MH 3U7WH 2F74A 1NAML 1T89C 1YEEL 3TBVA 5D1QD 1VESA 4OCSH 3LN5A 1HHGB 5IHUL 1RUPH 2IQAA 3FL7A 2HRPH 4P4KB 1JGVL 5CJQL 2P5EA 2BOBB 3SO3C 1CFTA 3F58H 4JFEE 2YWZA 1JRHI 4L4JA 5L2KD 4OF5A 5DVNA 4JDZA 4X83A 2O61A 1TCRB 2M8XA 5FYLE 3FO2A 5F9JB 4LSRH 3ZKSD 5E56A 1MCBA 3D25B 4ORGB 3TNNB 3GUTB 1P4LA 1KN2L 3AC0A 3FAXA 3MRBB 1B9ZA 3QZWG 4WTWA 1UC6A 3LEXB 4N90D 1ZEAL 5EFIA 1UVQA 1J0ZA 2PN5A 5KANG 2YHGA 3NN8B 1YY8A 3HE6D 5EU6E 1MCSA 3MBED 5F89B 5DUBB 3ZT7A 3L7FB 4Q74A 1YEGH 5ACMA 3VFGL 4LU5L 4LNRB 1T0NA 4RMUA 2R56L 3RY4A 2G9HA 1WTGT 5DEGA 3N50A 1U8HB 3GSNH 2LV4A 1M7IB 2IFFH 3MJ6A 2VDKL 4WFGE 2FWOB 5IGXH 4HW6A 4GMSH 3CFKB 3LN9A 5D6DC 4LPUA 2OK0H 3J8F7 5D5ME 2EXWD 2A1WL 2FJGB 1EH9A 1IGJB 3PGCB 5E8PA 5D1QA 1CTNA 4YO0B 5I76B 2VUYA 1T7WA 3KS0J 4O51A 3QIUC 4EZMA 3IU4L 2BMKA 4UDUA 3WHE1 2GFBA 1RUKL 4W4NA 1LO2L 4EBQH 2X1OA 5L2KA 2R2HB 3JV6A 4Y16A 4M7ZC 4FMFA 3AUVA 4U6VH 1JGUH 2B0SH 3EZJB 3RZWA 5GGSY 4UINL 4OM1L 4MJ6A 1FG9C 3O6FB 3HN3A 4U1GB 4F8QA 3K46A 3O2DA 2FO4B 5C07B 1NGZB 3QUZA 5ERWA 2APBA 3CDCA 5B38A 3V6BR 3W9EA 1KIQB 4OZGF 4KRPB 3CVHL 3LRSB 4F57H 3HZKB 3R0MA 1A3LH 5DI8A 3U36A 1I7RA 3F62A 4GLRI 4UDTB 5DJZB 1UWGL 1ZKAA 3EUUA 2CRMA 4JO4L 4XPTH 2UZXB 3WNOA 2B2XH 4MA8H 3DV4B 3QXTA 4NKQB 1QVOB 3AGVA 4PRDA 3ARDD 4ZS7H 1HKFA 5BMFL 1C08B 2XACC 4JFZL 1IKFL 1NMBL 4N8CH 3TGXA 4YBQD 5LAXB 1U91A 4HIHB 3PWLA 4X4YB 1S7QA 5F21B 4AIOA 1AI1L 1RIUL 1CGXA 5F1SA 3CFCH 1UEMA 5C8JB 1TQBC 3BIBX 1OWRM 4MJ5A 5SWSB 2V5TA 2QSCL 2XTJD 3RWIB 3VGAC 1UWEL 5KTEL 1NFIA 3CGTA 5IIEA 5F7HA 3MA7A 3FZUD 3ZDZE 1XGRA 4LDEB 3JTTB 4FP8L 1HHHB 1E4KA 4GRLD 4JFHD 1G84A 5IB3B 4OZIF 5DRZA 1U8QA 1S9KC 2LVEA 1ZHBA 3GO1L 1VFBB 15C8L 4I3SH 3T2NH 1FDLH 5JPMB 3DV6A 4XP5L 1RHHA 2NXZB 4PG9A 1F42A 3GJFB 4ELMF 2BNQE 4L8CA 2DQTH 5GS0H 3SY0A 3KLSA 5D1XA 1DBAL 4UIKH 4V1DB 4MA3B 1CXLA 1T6VN 1DEEB 3GRWA 3NFPB 1CN4A 1S9XA 1YPZE 4OD3H 3T1WA 3WIHL 3AMKA 1NGWB 2VLJD 3C60D 2ITDB 4X4ME 4HS8H 2W38A 3ARDA 1H3XA 4QOKE 3ULVE 4CBPA 3HC4H 3HLAB 5D8JH 1INEH 3WSQH 2OS7A 3FB5A 1CLCA 3BP4B 2R4RL 4FQIL 4LASH 1A7RL 5DK0B 2CD0A 2MOVA 2XKNB 1VKXB 4U1KB 3S34L 3RUGA 1DBJH 3L3GB 1UM4H 5TQ2L 3T0EC 4K9EL 1HH6A 1E6JL 3O8XB 3SGJC 2FIRT 3S97C 4PJBB 1KB9J 4YHOL 4PGEA 5T5FH 3HI1B 5DF0A 4HX1B 3QUYD 3FQNA 3IDXL 4BELD 5C0EB 1T20A 1JYNA 3FQTA 2BHUA 2FDBP 4JVPA 1O7VA 4CDGC 5E94B 3ARGA 3RWGB 1RJCA 1LO4L 1IRAY 3WUZA 2GCYA 2GSIB 2X9XA 4P5MB 4GRLA 5FYKD 4U6TA 4X8JA 4JHAH 1I8MB 2XA8L 3CSYA 1S9YB 1LILA 3MRNB 4S2SA 3FT4B 4JY6B 5B4MD 2QJDA 4XAKE 1MFEL 1T04B 2ZSWA 2HWZH 4ETYA 5I1KL 4XCYB 3ZYJA 3UYPA 4KXZI 1H0DB 5I8CB 4J3XA 1DL7H 4QHNB 5F1IA 2SEBA 2VLJA 3C60A 3SOBH 2HMID 2E5EA 1HQ4A 2EO1A 2G2RB 3IDIB 1XGYH 4XBEL 3RGVB 3D0VA 4DN4L 3LHPL 2P46B 2GEEA 4UT7H 1J12A 4ZFOB 2HJLB 5C0CB 4MAYC 2EYSA 3JV4B 1F6AB 3ZE1E 3OGOE 2R1XB 2YN5A 1ZGLA 2O93L 5TE7L 1BFOA 5HHXH 2AJZA 5ANMA 3KJ6H 4Q9RH 2O5YL 1T03L 1XH3A 3QUYA 2BC4B 1W72L 3U46B 3QDME 3RI5K 1BEYL 3P4NA 4NN6B 2QR0A 1A7QH 1KT2A 1OQXA 1WF5A 3I6LE 3QNZA 2EO9A 3MODH 3R06B 5FECB 4LLAA 3K0WA 5KVGL 1KG0A 1S78C 5CJXC 3I75A 4YH6A 1WCQA 2VITB 1FZMB 1F5WA 1ADQH 5CP3A 4OZFH 1ORSB 3GMQA 4DCQA 5IWLC 3FKUS 2OLDA 3HC0B 3MRGB 3F7QA 3V5DB 4NRZB 5E6IC 2ZNWA 2B4CH 4HPYL 4MLIA 3DYOA 1IAKB 2CK0H 3QCVL 1HHGA 3JWOL 4YXHH 3EJYC 2E8YA 1FBIH 3BRGC 4P4KA 3ZKXC 4FFVC 5AYUL 2BOBA 4M7LT 1V3KA 3IT8D 3UAJC 2EH8H 1A7PL 1BX2B 1DQML 5JW3L 5BO1L 2EIDA 2J3SA 3RX7A 3A6OA 1TCRA 4XWOD 5F9JA 1BFVH 3O6FD 1ES0B 2Z93B 4G8GE 3WEXB 3D25A 4JB9L 4ORGA 4PJFF 3TNNA 3WDJA 1KLFA 3LH2L 3BN9C 5D93B 3SQOL 3MRBA 4NO3B 1I1AC 5F44A 4KRPD 3EOBB 1Q0YL 2V5SA 3LEXA 5C2BL 2DQCL 5FUCE 1YYLL 5AWNH 2VZVA 2OZ4A 3S36L 5IBTL 5DSCB 3NN8A 2EECA 1Q8MA 3PWNB 2WUCH 1MOEA 2CJUL 3ILPB 4ZTOL 5BJTB 5F89A 5JQ6L 5DUBA 2DOCA 4PJXE 3BAEL 3L7FA 2ADIB 2I25N 3HE7B 5TFSH 1X5FA 4LNRA 3ZSTA 5ELIA 1FIGH 4IJ3B 4H8WL 3SKOB 1U8HA 1M7IA 5I1IH 2FWOA 1HOCB 1RPQA 3CFKA 4PP1C 3RWHB 4XVJL 5I75C 2YA0A 1PYWB 2FJGA 1IGJA 3PGCA 1YQVL 4NQTA 4YO0A 5I76A 3K8MA 2G60H 3C09C 1H8OA 4KKCD 3EDJA 1OLLA 4JQIH 1P4BL 3T1FB 1R3IL 4KY1L 4DUWA 3ULUE 2R2HA 5E2WH 5I17B 5IKCB 1RZ7L 1QNZL 5H35B 1JHKH 3O6FA 5IP4A 4I4WB 4Y5XB 5B8CB 2NXZD 3CDGB 3I9GL 2IBGA 5DVKA 2FO4A 5C07A 1K2DB 1NGZA 4H88H 4R4NC 2LQRA 2VNCA 5HGBB 4HG4K 5GISH 1E4XI 1KIQA 3V6FB 4YFDB 3LRSA 3MCLH 3HZKA 4LCIH 1HKLH 4V1DD 4UDTA 5DJZA 1IEHA 1CGYA 1U2HA 1ORQB 4WCYH 4JHWL 3DV4A 1J0JA 1JPST 1QVOA 3KYNB 3RVVD 1H5BB 5I1CH 3RY6A 1C08A 4TTDC 4WV1C 3VG0H 3VU2A 1CFQB 5LAXA 5F7WC 2EC9U 3QEQB 4HIHA 1FFOB 4X4YA 3V5KB 3HNSL 3O8XD 4F58L 1JL8A 3OBAA 5C8JA 2Q86B 4CDHA 2C26A 4S10A 3SO3B 3LDBC 3L5XH 4K55A 5SWSA 1QYGL 5L7XL 1NLBL 2DI8A 4GAJL 2VWEC 4G6KH 4L4TD 3RWIA 1GL4B 2NNAB 4KI5C 2JIXB 3OKMB 2ZCHH 4RFOL 3HNVL 1FFQA 4JFQB 1QUNA 4XNMB 1CXFA 1L6ZA 3JSSA 3PWPE 3JTTA 1MFBL 3QDJB 1CFBA 1HHHA 4G80B 1DLHB 4KK9C 5IB3A 3WDHA 5D7LE 4OM0H 1A7NH 1VFBA 1SMAA 1BJ1H 1H8SA 1RURH 2DQUL 5C0BD 5JPMA 3QXVA 4F7EB 3HC3H 3GJFA 4G6JH 5HYSB 4Y5YC 1L7TL 3QUXC 4NWTL 4V1DA 4MA3A 4RA0C 5DMIL 5TQ0H 1DEEA 3C2SA 3BSZL 3NFPA 3U4BH 5IOPB 3Q6GH 3ARVA 3HPLB 2JJUA 5KVDL 4M93C 1NGWA 4R4FH 2ITDA 2V2XB 3MMEB 2WBWB 5C09E 3RGVD 3ARTA 4YHYB 3HLAA 3BP4A 4OFVA 5MEOB 5DK0A 2XKNA 1DBKH 4MAUL 3P0VH 4PFEA 4U1KA 3VRLF 1VKXA 3L3GA 3EOTL 3O3UN 4M6NH 3O8XA 3QIUB 3RPIB 4KKAD 2JB6B 4PJBA 3MV7B 3HI1A 1BOYA 3SE9L 4HX1A 3NPSC 3DX6B 2YD2A 3BKMH 4DTGH 1JYXA 5C0EA 1OAKH 2EE2A 4OF3A 3TJHD 1FPTL 4A6YB 2OXHA 1YEHL 5E94A 4PJ7B 4M1DL 3RWGA 4HMDA 5CSGA 4P2RD 1KYOK 2GSIA 1NSNL 4NCC2 4P5MA 4KV5F 4V2BA 3MUGA 1J9CT 5CJOL 1XF4B 3BX7C 4X6BB 1CGWA 3DMMB 1PY4A 1I8MA 3NZHH 2AQ1A 2D0GA 5D7IB 4QTHB 1S9YA 3LQZB 4NJAH 3MRNA 3OG4B 3MXWH 4KRLB 3FT4A 4JY6A 1I3GL 5D7JC