5KAQF

Crystal structure of broadly neutralizing influenza a antibody 31.a.83 in complex with hemagglutinin hong kong 1968.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
233
structure length
232
Chain Sequence
VQLLESGGGLVQPGESLRVSCAASGFTFRDSALSWVRQAPGKGLEWVSAISGNGGATYYADTVKGRFTISRDNSQTTLYLQMNSLRADDTATYYCAKDESPPIYNLMPGYYSTYYYMDVWGKGTTVTVSSSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-Induced Antibodies that Neutralize Group 1 and Group 2 Influenza A Viruses.
pubmed doi rcsb
source organism Influenza a virus (a/hong kong/1-4-ma21-1/1968(h3n2))
molecule tags Immune system
molecule keywords Hemagglutinin
total genus 38
structure length 232
sequence length 233
chains with identical sequence H, Q
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kaqF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kaqF02
2X7LB 1RK0A 1YNLL 5D5MF 2GTZA 5KSVB 5EU3A 4E41A 5GISL 1UYWH 4DVRH 1F58H 5AZ2L 4R7DB 5IVXE 4L8BA 1MCPL 4PJAB 2UV3A 4K7FA 1YNTB 1JNNL 1WZMA 3CMOH 5EZIL 1UJTA 1F90L 2XACC 1LO0H 1NSNL 1T3FB 1GGIH 2W9DH 4O2EB 4PRHD 3VXUB 2C3HA 1XF2B 3MLXL 2F74A 5BV7B 3DV4A 4EQ2A 3W9EB 2YPLE 1DQTA 1UXWB 1A1MA 1XIWA 1IAKA 3C2SA 4U2YA 3D3VB 3RWIA 3VG9C 4HK3N 1DBKL 4D9QE 3KS0J 5EC2B 4YX2L 4TNVF 3EYUH 4YPGA 3UTZA 2D03H 2HAZA 4ODXA 3HI5L 1TZGH 3F5WB 4EBQL 3RVXC 1HILA 4QHNA 4HG4K 2NW2A 1CFBA 2B4CH 3H9SE 4R2GB 3ZKSD 1DQJB 1JNLL 4XBEL 5DJXA 3BESR 3QA3B 1KLUB 1NLBL 5L8KB 2NY1B 3OKOB 2YHGA 3FFCA 1H3UA 3JVGC 5F88A 4D0DA 3CX5J 3Q5TA 4Z7UE 1IGML 1BGXL 4JKLA 3TIDB 5EUKA 2X9YA 2NY6B 4TVPL 5F7NC 3CGTA 4RIRB 4PJFF 4UTBH 3BKYL 1I1RA 3WL9B 4UQ2B 3D18A 5IMOB 5I15H 2GFBA 2H1PL 4EDWL 2VDMH 3W39B 1JJUA 4HK0A 4OCNC 4OZGF 2P43B 3EJZD 1OAQH 2P45B 1EVTC 2VQTA 3ULSA 3M17A 1S5IH 5F8RC 2W0LA 4PR5B 1IQDB 1LE5A 5ALBH 1IM9A 5B39B 4PBWD 1A9BB 4QXUL 3DRQB 3KYMA 1TQBC 2QR0A 4ZUSB 2HTKC 4GQ9L 4OZFB 1ZA6A 2ZCHL 1LP9A 1N2RA 3IXAA 1A1NA 3F12A 5ACZB 2X89A 3O6LL 2BVOB 1D5IH 3DUSB 4PJBA 1MIMH 3MBED 5I8CA 4JJ5A 3FJTA 4NGHH 3FT2B 1HIMH 3RQ3A 4TVPE 3GGWA 1P84J 4WVRA 1NGQL 5C0JA 4HWBL 2YD8A 3Q1SH 1ZHLB 4HF5L 4YQXH 5KG9B 4KQ3H 3GMQA 1QRND 3T1FA 4Y5VC 1A14H 2CK0L 2YPVL 2YWYA 1WTGT 4S1RH 2FL5B 3UJIL 1UWEH 5MI0B 5KN5B 4YDVA 4OZIF 4RFOL 5E8OB 3W0WA 5TQ2H 4Z8FL 3ETBF 4PJIF 1QD0A 2VXSH 4XPTL 3LKNB 5HDLA 5K9OA 2VXTH 3GSQB 4G5ZH 4S1SH 3RWCA 3HG1D 5DMIH 2JJTC 3MRNB 3TV3H 3L5XH 3AMKA 5I8OL 2A9NL 4JHAL 1NCNA 4P2OB 2IGFL 2OP4L 2EZ0D 4JHZA 3SKNB 2A0LC 3NZ8A 5B4MD 2VYRE 4L8DA 5L9DH 5MEQA 3FT3A 2CLVA 3LH2L 5FK9B 5GRWA 4N0YH 4TTGA 4WI5A 1RY7B 3CUPB 4WFED 5EBMB 1RULL 2HT3D 4JG1L 4Q9RH 4QF1A 4DKEL 3MLVL 3Q2CA 1QLFB 3O41A 4Q0XL 5F72S 3L5WB 5IHZA 1HOCB 3RA7H 1N59B 3L3DA 2EC9U 1CR9L 3GMOB 5A16A 1UXSB 4LIQL 43CAB 4ELKA 4PJBF 2C3WA 1IARB 2HH0H 2HYMA 2KQNA 2OR9H 4MXWH 3VDCA 1U91A 5KSAD 1CFVH 5I1IH 4MWFA 5C7XL 4Z0BL 1HE7A 2AEPH 4RGNB 4EVNB 1AKJD 5F7MC 4FQ2L 4N0UA 4YHIB 2GSGB 4PD4K 3VFPA 1GRWA 2YRZA 4MZ3A 5DMKA 1AI1H 4Y1AB 1A7QH 4G6FD 5JIPA 2ZJSL 3TJHC 3IDJB 5CWSB 3WKMH 4ZNEE 4HBCH 1HEZA 1A8JH 1KPUA 1NCBL 2LTQB 4PB0L 4YHOH 4HH9B 1IVLA 3IFNL 5DO2D 1EEYA 1KFAL 2XA8L 3SE8L 2D7OA 3FAWA 3QDGE 1I1AD 1JRHI 3JWDL 1YEIL 5GJSL 3Q0HA 1MUJA 1M05B 5JPMB 4HUVA 2X4SA 1CD1A 4XCEB 1MCWM 3PXHA 3UBXG 4LSVL 2CMRH 4JFXA 1ED3B 4RFEB 1Z9SA 1LEIB 2QKIB 3CX5K 2JCCA 4GW4B 1I8IB 1A0QH 1I1FA 5A3IC 4JN1L 1V3LA 4N8PA 5T3ZL 3DJ9A 4NNYB 4ELMA 2VLRB 5ITBH 1X5GA 5EO0B 4ZS6C 2YBRB 3D1MC 5EDXA 1UM6L 2NX5D 5MHSE 5A2JH 3LOWA 1ZVSA 2KUTA 4YHPA 1GIGH 1QR1B 5E1AB 4NZDA 2XN9B 4HXBL 4DFIA 5FA3B 3FOLB 1N3NB 4FXKA 1FZMB 3QUZD 3QDMA 5DEFA 4D3CL 2C4FU 2Q7YA 4K8RL 3GIVB 1S9XA 3RZCD 5T1DH 5EU6B 4NFCA 2L7JA 3DVNB 3TO4A 12E8L 3BZEB 1K5NA 2Q86A 2R0WL 5IJVB 3TO2A 3VFRB 3UTTB 2BP3A 1VERA 4KI1A 1AKJA 2ATKA 1OGTB 4LSUL 5FHBH 4CW1B 1LE9B 4F57L 1CBVL 4FZEL 2DTML 4JFDE 5DVOA 2NY6C 5JR1L 5JW4Q 1OT1A 1A4JB 2DM4A 3WN5C 2GUOB 1UJ3A 2J88L 1A6ZB 1QPPA 2GTWA 3C87A 4I0KA 5IMKB 4OZFG 3BW9A 4JZNA 2WZPD 3VJ6B 1XGPA 3KPSB 5EUOA 4JFFA 3KYNB 5IHLB 3T2QA 4AH2B 3LPGA 2AEIT 2WSKA 3TNNA 4RGOL 1WC7A 2YEZA 4OZGB 1UZ6F 3VXRB 4R8WL 3BP7B 1R3JB 1DVFD 1KCVL 1TVHB 5L2KD 4HPYL 5DRXB 1XCTA 2OI9B 1KJ2B 2BVPB 2YZ8A 5GGUB 1FP5A 4HLZG 4ONOA 2WIMA 5DO2C 1MF2L 1DBML 5TDPA 4A6YL 1TTGA 3ARTA 3PUCA 4CVUA 1Q38A 3LDBC 3MV9E 5C09E 3VXPB 5DC9B 4LCCC 5TF0A 3BO8A 1PBYA 5JNYB 1YYML 1N8ZB 3SE4C 3B43A 4LCIL 1HQRA 4NN7C 4Z0XB 1AD9B 2GK0B 3MV7B 3K80A 2W07A 4KTEL 3IXTA 3ME0A 1S8DB 4PPTA 4OZIB 4Q6IC 5GRYA 5GHWH 4LCCB 4PGZA 3BGMB 3CDGB 4GW5A 4KMQA 1Y18A 3ARDA 4WI4A 3MLRH 2EICA 3ARFD 4XMLH 1U93A 1FNHA 2HT4C 3Q1SL 4G8EB 1JE6A 5KZCD 3G5ZB 3H7BB 1FZJB 3V5DB 2I25N 4XP1L 4ZXBC 3E2HB 3KR3L 5E6IB 5GSRA 4F3FB 5JXAH 3TBSA 2APWA 4L4VE 5DMKB 1KJ2A 5KJRH 5GISH 4OZHB 4NP4H 2E7BA 3PABB 2APBA 4I2XB 1DVFB 5C0CD 4XHQA 2O5ZH 3E2HC 5LCVH 3ZDZF 5GS0D 2PXYC 4X6DB 2C5DC 3WFDH 2QQKH 3BSZL 2WW8A 1RK0B 4JQIL 4B53A 5F7DA 4X9BA 3QNXB 4WFGD 5ESAB 2JTDA 3BQUB 1HCFX 1NANH 4QHUA 4QXWA 3TM6A 3DV6B 4V1DA 4ZUTB 3RBGA 3CUPA 5I1KL 4BZ1L 3H7BA 1TZGL 5JOFB 2CLVB 3B5TA 3ZKNC 3WO4B 3SGKC 3OHXB 4IRZH 1LO4L 4CNIB 3DX9B 4XP9H 3R8BB 5CS7A 1WCBB 2G5RA 3H9SB 4P2OA 3CFCH 2Q8BL 4TN9A 4QTIH 3V7MA 3Q5OA 1A02N 4HFWB 4G9FA 4EEEA 2QHLA 4C58B 3QG6B 5F71A 3V5KB 2JB5H 5I1HL 4P4KA 1OLZA 5CHNB 3ZT7A 4Z0BH 3VXMD 4M61A 4YHPB 5DFVC 1D6EB 4RMTA 3FQUB 3LSOA 2WINB 3LKRB 1DE4A 5HYJB 1Q0YH 5B4MC 2OBGA 2E3VA 1EEUA 5DHYA 2DQDL 3PL6D 3LCYA 3ZZ1A 2WBJA 3WBDA 1G7QB 4X5XB 2PO6C 1N3NA 1VPOL 3ROOB 5K93A 1ADQH 1VFBA 3O9WD 2WBWB 4P9HC 4ESKA 1JRHL 1QQDB 1IEBA 5E9DB 2DKSA 1LGVA 4D0CB 2EKJA 3L5WA 2X4SB 5KTEH 3DBXB 3G04B 4QNPE 5GGQH 4K2UH 2EDXA 2E8YA 3TNMB 1HIML 1WFUA 4E0RB 4GG6A 3M07A 4I18C 3CCHA 1K5NB 2R2HA 3NN8A 5EBLA 2NY1C 5F6IC 4M6AA 4WHTB 4ZOEA 2JCCB 3RGVD 1U9KA 1RZKL 1L7TH 4L8CA 4XMPL 1MFCL 3TYFB 3ARGD 1U58A 2F5AL 3U9PL 3Q6FB 5CUSL 4PRNA 2LVCA 1A14L 4LHUB 3RGVB 1CLCA 4HKBB 2DDQH 2AXGB 2VDPH 3O4OC 4EI5B 1CGUA 5TDOA 5HHMD 3BH8A 1JUFB 3RY5A 4TOYH 4YK4C 3VXRE 2FYYB 1X9QA 4DW2H 1TZHA 3LKPB 1HHJB 5J1AA 5ESVA 4QXGH 5CP3H 3TPKA 3VG9B 2YR3A 2NCMA 2HVJB 3BIKB 2X89D 3QUMA 1Y6MR 2HMIC 2OYPA 2ARWA 2DI7A 4HUXA 4PJDA 5MEOA 1PDKA 1RZJL 3BUTA 3IDNB 1MAKA 3DSNA 3NCMA 5CBEB 3EYFA 1I1YA 4M8VA 5HJ3A 1IT9H 3CZJA 1P6AB 3U36A 2CKBA 2ED9A 3S34H 1ERNA 3QQ9C 3DYPA 2OTUA 2Z31C 5MERB 1OPGL 4M5ZH 1FC1A 3PHOA 5GSVB 4EVNA 3UDWA 3O11B 1ONQB 5JPMA 4HUVB 3KPSD 4OF8A 1HYSD 1PJ9A 1U8NB 1SY6L 4LLMB 5T1KB 4ZOAA 3RRQA 1OTUC 2J5LC 1DQMH 4Y0GA 5FO7A 1XF1A 4FTVD 2ICWA 4RMVA 2IBZY 5C2BL 1NEZG 4N8VA 5DHVH 5MEOB 5MEND 2XTJB 1MWAA 5EBMA 3FZUC 3GSWB 3S37L 1RZ8B 2OS7A 5CJQL 3P0YL 1KF9B 2A6IB 2UUDH 4NM4L 1J1OL 5ICZA 3GJFB 5I8EA 3PGFH 2Y06L 4A6YH 3HPLA 5F21B 1QSVA 2WUCL 1U8LB 3QWRD 5L8JB 3BT2L 3IDIA 3VXTA 1PQZA 1S78D 1EFXA 5T3XE 4KJWD 2JJWA 4KJQC 4LCIH 4PRIE 4OCWL 1FLRH 2R4SH 5C0GB 1FCCA 5I1CH 4NJAL 3OJDB 3DUSA 2NY5H 3FB7B 4WIQA 3VXQA 1G9EA 2QBWA 2FB4H 5IHZB 3C5JB 4XH2A 4HS8L 2JLLA 2GCYB 3GMMA 4UV4L 3G04A 4NM8H 2IBZX 1FCGA 5I8KL 3TT1L 4N0FB 5KJRL 4FQLL 5M7QA 1LEGA 2BSRB 4MCZA 4OQTA 3EO9L 1OCWL 2YS4A 1SYVA 2IG2L 5CD5D 3C2AH 1H3VA 4YHLL 2CRMA 3WFBH 3SGEH 4JO4L 3HN3A 4OI9A 4Q9QL 4JKPL 1XGUA 2BNRE 2EDLA 2OL3B 4MVBC 1A3RL 4HCRL 4NC1C 2X4QA 4TPRH 1BZ9A 4DFHA 5EIIB 4KY1L 3BPCB 2BOBA 4U4BA 5ILTH 3VI3E 4NO2A 1CDJA 2CDGA 4PJGE 3GMNA 4F7EA 3GMQB 2HT4D 5T33H 2CO6B 5JHDD 3DX7B 5JLZA 4H1LA 4YIQA 2P7TB 3QWQB 1JNJA 3JV6A 3B8YA 4KKCC 1CCZA 1IBGL 4M7LT 4HJJH 2CIKA 3T4AA 3KLHD 1OGAD 1QSZA 4F57H 1CBVH 4C55A 1T89C 2BRRL 3KXFB 4LGSB 4XCNB 1D9KD 1CTOA 4Y4HB 3D3VD 3CFEB 3EOYG 4Q0XH 1NAMH 5F44A 3BUYB 1U92A 5IM7B 4JY5H 5BJTB 5BRZB 3GBNH 4HUUB 3CDCA 4X4MA 1YJDC 4KUCF 1XT5A 4LBEB 2HRPH 3KNBB 2IAMA 3BP4B 4MD5A 3TVMA 4XP4H 1GOGA 1DZBA 3CMGA 3MRDA 4TUKH 3BZDA 3CPLB 5MENA 4NUGL 4OAWA 3BYYA 3RJQB 2BVYA 3LN9A 3W9DB 3G6JE 4JRXA 2VIRB 3U0WH 3NH7L 1EMTH 1D5ZA 4KJWC 4NO0D 3MRPB 5F1IA 4MQXC 5ISZE 3UPAA 4YC2B 1MSPA 2XN9D 2GW5A 2VLMD 4QY8A 4LOUD 2X4OB 3P30L 3WDIA 5KTEL 4P2RB 1YY9D 4BH8A 2V2TB 1QBML 5SWSA 3F6IA 3VWJA 2NY4D 4XGZA 4P9MH 1S7VA 1A7PH 2B1HH 4QYOB 3CVIL 1U93B 5IVXF 4MCYA 4NCC2 4PJIE 5I16B 2CJUL 5IK3A 1AHWC 1N4XH 3EOAA 2FSEB 4M1CC 3U48A 5CLWA 4XP5L 4R6UA 2H2SD 4G42A 2XQYK 3CVHB 1RMFL 1HQRB 2ICWB 3H0TB 4MS8D 4ZPTA 3RTQB 2X4RB 1UH4A 1FNSL 3L3OA 2Y36H 1JNHB 1NGQH 4U1LB 1SM3L 1RIHL 3F7QA 1BIIB 1W72A 4JFZH 3MO1A 5GS3A 1Y6KR 4EI5C 4ZFFA 3GSWA 5ITBL 4KKAD 2VAAA 1RPQA 4LHUA 5F1SA 2QADD 4LU5L 1I9JH 1FGNH 3G6DL 2ICEA 1J0HA 5BQ7B 2M1KA 5FA4A 2YSSA 3QQNA 5B39G 3FN0L 2NXYD 3ORJA 1PX3A 1UH3A 1RK1A 4O2CB 2IGFH 2OP4H 1Y0LA 3NAAH 1U3HC 5EZLA 2PO6B 3RVUD 4ETYA 1AKJB 3B5GA 5DJ2A 5DD5L 2OK0L 5CSBA 4F7PB 5I2IA 3G6AB 3HAEH 4LVEA 4KXZI 2MPAL 3KDMB 3MR9A 5FYJL 1KLGA 4E5XB 4PJFB 4JG1H 4BELD 3FKUS 2PTTA 3CZFA 4QRPA 1NBVH 2YD7A 3OTTA 5DD6B 4S0TD 3X14A 1S9XB 1ZA3A 5DZLA 3R06A 1TNNA 2OTPA 5INCA 3U7WH 3ZDZE 5D72H 3IFOB 2XZCL 1BLNA 2O26U 4KKBC 3WXVH 2ZP0T 4QTHA 4QWWD 5D9SA 4OLWL 3ARGC 3QUYC 5HYJA 3V4VL 1KCSL 4NQVB 3V0AC 1CN4A 4KJYA 2PXYD 2DQDH 3VXSB 1JGEB 3CFKA 4RGMC 2CGRH 4WI8A 3VCLB 2VZVA 4PJ8B 4ONHB 3VXMA 3SDXF 1QSFA 1F4YL 4R0LA 4KVNH 5HVGB 3MZTA 1KIRB 4ENED 5GZOD 3OX8A 3HI6L 1YY9C 1U8QB 1PD6A 1NBZA 4KVCL 3FN9A 2EDBA 4U1NB 2V2XA 4RBPK 4NJAH 3D85B 2Z31A 1ACYH 2Z93A 2N7BA 3VWKA 4YNYB 3BFOA 3S35X 4Q6YA 5CGMA 7FABH 2E7MA 3GMMB 1R5WA 1RZGA 1NMAH 2G60L 1P1ZA 3QFDB 3BMWA 2XQBL 3GB7A 3NCYS 4XH2B 1L7TL 2AK4E 4X4YA 4Z7NF 3EO9H 1FH5L 1A9EB 2H26A 3FQXA 5B22A 3MLTA 3ULVL 2ADIA 3AREA 5CCKL 2E9JA 4P9HL 5ENWB 2YK1H 3RUGE 2GFBB 4XVSH 1IGTA 5GGTH 3HE6C 4XNMB 4G8GE 3TZVD 2B20A 1ZGLB 3VFSB 1AFVL 1IAIH 1GL4B 2W59A 3AU1B 2KKQA 1U8LA 4UQ3A 5C07A 1FL3A 3NVQA 4J12A 1YDPA 2WWMD 3JWOH 4Q7DA 3ULVD 1PYWB 3ZYIA 1KOAA 4KRMB 1X4YA 4WO4B 1KLUA 4LASH 3V5DA 1TENA 4JG0L 3BQUA 3F7VB 1FL5A 3ARFA 1KJMA 1G9ML 3LMJL 3AVEA 3ARDD 1ZWIB 4PTTB 4JDZA 3UTQA 5GS0L 3D9AH 2FEEL 3INUL 3U79A 2VL5A 5CIPB 3QG7H 1JMXA 4K8RH 1JN6A 1KYOK 3GMOA 5H35B 2R29H 2EDNA 4XNQB 1Q72L 2VKWA 1YN7A 3EYOB 3QAZC 5KW9H 4RA3A 4ELMF 3SPVA 5HHXH 1I3RA 1W0VA 5EO1B 5C3LD 5IV2A 3QI9D 4W4OA 5I75B 4RNRB 1JF6A 4GRWE 2PUQT 2IQ9H 5ESAA 5TE7L 2VUOA 4WUUE 1V3MA 5FYLD 2OMNA 2CKBB 4JREB 5HHVL 5E94A 4X5WB 1T1XA 4KRPC 5IBUB 4HIEA 3T2OA 1EEQA 1NAKH 2EC9T 3GSQA 1U8MB 2AJSL 3QUXD 3PGFL 3HA0A 4GFTB 2DTSA 2WUCH 4PJ5D 3LS5L 3MLYH 3DO7A 2OR7A 1QEWA 5J6HB 1J8HA 3QXWA 2P5EA 1N8ZA 5KS9F 3MLUH 2BERA 4NFBA 1AO7A 2VDLH 1OB1B 2C3XA 3C09C 3MXWL 3WNPA 4MA3A 2YUVA 3FOMB 5FDWA 5ECJE 4DEPC 1T4KB 2QTEA 5HBBA 3PWPB 5E95B 3KGRA 2BHYA 2PYEE 1VGKA 2QL1A 1LO3H 2Y25A 1ITCA 4JJ5B 5C86A 4WO4C 5KANI 4BZ2L 1SEQH 3V6OC 1NDGB 1Q0XL 4NKDA 5C08D 1OAXH 2J7LA 4RAVB 1QFHA 3H42L 4JQVC 1W8NA 3WXWH 2N7AA 2AJVL 4KROB 1X5IA 5LWYL 3TA3A 5LAXA 5DD1L 4M93B 3UJJH 3D39A 4B50A 3WUWB 2VKXA 1AGBB 5HGHB 4MNQD 4KK9C 2C3GA 4PJDF 4X6EB 4IIQB 4PLNC 4JPKL 2VITB 5L8LB 3EKCA 1T04A 3T0EE 1ZGLM 4MZ2A 2W60B 2RCSH 2AKRA 4UTAL 5ESQA 1G0XA 1T22B 5GGRA 1AJ7H 3HE6B 1JF5A 5FM5M 4AL8H 4MJID 5JHDA 1CE1L 1A47A 3FL7A 3MLSL 2ORBL 4P5TB 3L3KB 4W4OC 4NWTL 5FM8A 1FYHB 2APFA 3DOSA 2DLGA 5C6TL 3RU8L 3TIDA 4GAGH 5HDQL 4JY4B 5KSUB 1TJHL 5D2NC 2XTJE 5HHPA 4R26H 1CQYA 5I1JL 3DHJA 4S1DD 4ZFZA 5ANMB 4PJ8D 3K8LA 2ATKB 4LCCA 2IJ0C 3TO2B 3VFRA 1Q9LB 2BRRH 1EHLH 3STZB 5JZ7C 5CILH 1R3HA 5SWSE 4FFZL 2O61B 3AFLA 4ALAL 3QRFM 4OZ4A 3P77B 1T66C 2VQ1B 4KDTA 1CF8H 4H1LB 4MA3B 3QUXC 5DFTA 2HT2D 1SY6H 5I75C 4GW1B 4R96A 1OSZA 2G9HB 3I9GL 3RWGA 4TUKL 2EYSA 2Y07L 2VN4A 4MS8C 3KXFD 3WN5A 1JPSL 2X4QB 4E9LA 3SO5A 3N9GH 1C7TA 4XVJL 4X8JA 2CLZB 3CMOL 3MC0A 2OSLA 3T4YA 1BM3L 3MCKB 4XRCA 3DYMA 2ADJA 3UTQB 1NCDH 2FBOJ 3MV8D 2NY0B 2QSQA 4PP1D 1MHHB 3TJHD 5IP4A 4OCSH 5D7LA 1TQBB 1K3IA 3M45A 3DVGB 1W0VB 4L4TA 1OTSD 1XGYL 5F89B 2C4XA 3MQIA 1OTUD 3U1SH 3VWKC 1EGJA 3VFTA 1MLCA 2JB6B 1RJYB 1UWGH 3RWEA 2YD2A 1JHKH 3MRRA 1ZV5A 4FMKA 4YDIL 4JANB 3MOBH 4JM2B 3QXUA 2VSDA 5D2LE 3TWCL 3WFEL 1OOAA 5EZOH 4J1UB 3B9DA 4YFLF 5EORL 4PJHF 4PJGA 4I77L 1X5JA 1U8IB 4R0LC 1HK6A 1QA9A 3B3IA 3VXSE 4LVHB 1SM3H 5IJKA 1C08A 3G6JB 2AJXH 4BFBD 1FFRA 1LQSR 3LS4L 4GRWH 4JFZL 3CLEL 4APQB 2WP3O 2XZQL 4HT1L 1VEMA 5GJTH 3MV01 5EWIH 3VXOA 3RWJB 5I9QB 3TP4A 2IG2H 4M7ZC 3QBTB 3UJTL 1N6UA 1C16B 4QF1B 1J1PH 5B3JE 1RUQH 1G9NC 3RDTA 4QGTA 5A3ID 5EU4A 1BOGA 2R56L 4LASL 4UQ3B 5ADOH 3DVGA 4AIZA 3MV8B 1HDMB 3O4OB 4JFEA 4HHAB 4WFHD 5T1KD 1A3RH 3GO1L 4P4RB 3F65A 4R90H 5I73B 2JCCF 1OL0A 1J87A 4WEBL 3NZ8B 2YN3A 3VFOA 3G5XB 4WJ5B 4XPFH 4P57A 3O8XB 1IZJA 4ODVL 5KVGH 4ZOCA 3TBYA 1RZJH 4PJBB 1H0DB 3QCTL 4QRQB 2FX8L 3VMNA 1A1NB 4F7TB 3KPPA 4I5BA 4Q97A 5DFVD 2NYYD 4UZGA 4KJPD 4RAVA 5FM5O 1D5BA 1ZHKA 3JWNC 1OARH 2IPKA 5DVKA 3BZEA 3D0LB 4JDZB 3GSXA 4LGPB 4XVTL 2D9CA 4ISVA 1MAJA 5E24E 3H9YA 2BJML 4HSQA 4ZOBA 1MJUH 5INCB 1ITBB 4I0CC 1G1YA 3MV8A 1PSKL 3GHBH 1VEOA 4Y2DA 3BD3A 4NSKB 4RCAA 5ENWA 1T20A 3MCLL 2BXYA 3WNOA 1WZ1L 4KPHH 4RIRA 2CGRL 3LSOB 5D5ME 4CDGC 1OGAB 1CGWA 3CJJA 3S5LA 1N5YH 4OT1L 5C07B 1JTPA 3O4LD 4YDVB 4LAQH 5TQ2L 4MNHB 4Z8FH 4Z7NE 4HPOH 4QHLB 3K8KA 5E2WL 4QTHB 5T3ZD 1FAKT 4JQXC 1FG2B 4LVOC 1LE5B 3FN3A 2VC2L 3U2SB 1IRAY 4U33A 2DQCH 1A9EA 2ZCHH 3HR5A 2GY5A 3JXAA 4JRYB 1UA6L 4XNYH 1WWCA 1JGLL 4FS0A 4YE4H 4J8RA 3O41B 3EHBC 3SO3C 3MRJB 4NQCD 3BD5A 2DBLH 2BVOA 1AXSB 3RL2B 1IL1A 3BJLA 1S3KL 3P4OA 5EB9A 1O7SA 5FDYA 3G08A 4PY7A 5EOQL 3S36H 1MREH 4X99B 2Z31B 4JPKH 5DA4A 4KHTH 3ARGB 1EH9A 4AG4L 3ILQD 4HXAL 4P5MA 3VE0B 4X8JB 1CFVL 1R5IA 1NDGA 4KRNA 1B4RA 2H32H 3OKMA 1KG0A 1OD7A 3EOTH 1T21A 4QHKJ 3UX9B 4EUPH 1ND0A 2OXGA 2UZXB 3IDMA 2Z31D 3MLWL 3KPRD 4Y1AA 2I9TA 1INQA 3FOMA 5D2NB 3P9LA 5D1ZB 3TT3L 2HKFH 4GUPA 5E9DD 1FSKC 4MX7A 3RU8H 3LMJH 1AQDB 4FABH 4KZDL 3AXLA 3VXNB 4LU5H 4PLKD 4WY7H 4UI2A 1IGTB 5E6ZA 3O9WB 1BJMA 5ILTL 4F8TA 3QIBD 3DVIA 3MOAL 4N0CC 3PWVB 3QPXH 5C6PB 1DSFL 1MFDH 3CD4A 2OQJB 5TGBB 4ZYKA 1P2CB 4JM2A 3LDBB 1T0NB 1FFPB 4XPHH 1K2DB 3QEUA 3UTOA 1XEDA 1K4CB 2XOTA 4QNPF 3F12B 5D93C 5ACZA 3OJVC 5DRNB 3MREA 3CX2A 4K3JH 5IFAL 5JOFA 5JHLL 4JY4A 5KSUA 1OD9A 2P8PA 1XH3A 4ZO7A 3DGCR 2OK0H 2DM7A 2IAMB 3BP4A 4GAJH 1IAKB 1JK8B 4MJ2A 2VAJA 5IVZB 2XWTB 3RWFA 1W72B 4PJ8C 1OQXA 1QSEB 2P4AB 1CTNA 5C0ND 1AGCA 4XZUA 2XPGA 3QDJA 4F2MA 3U0PA 1YEFL 1JWUA 4UTBL 1F02I 3TNNB 2AJSH 3JVGA 3U7WL 2CD0A 2W9EH 3GSNH 2W60A 5KVEH 1OM3L 3KPQA 5AAWA 3L7EA 3LKNA 4FQCH 3EDDA 5EU3B 5JZ7D 5D1QB 1T2QL 3BH9B 3NFNA 2HT2C 4JY6B 4L9LA 1FYTE 3RUGF 3SY0A 3NFSL 4TSAH 3WIFA 4OB5L 3ARFB 4UUJB 3U7AA 3EHBD 4KDWA 3SE3A 2Y4SA 2H9GA 4X4XA 4GQ9H 1S9WA 4R3SA 4UU9A 5EOCJ 4YBLB 5MP6H 2Q86B 1KCKA 5IJVA 2F8VA 1QBBA 4FP8H 1BVLA 4RMSA 4FNLH 2FSEA 4OZ4B 5I76A 1D5IL 3BGMA 1ZHBB 4NNPH 3UZEA 2BNRB 2MQ3A 5BRZE 4X6BA 4E5XA 4P46C 5JXED 4CN1A 4O58H 5EZOL 4XCFH 1OB1A 3ZE2F 5K9KB 3HZYB 5FB8A 3G6JF 5E00B 2BRQA 4HF5H 4J3XA 2VXQH 4W6YB 5SV3A 3QJFA 3SJVA 3X3GL 1WGOA 3RVXD 1U36A 4DVBB 4CMHC 3DRQA 1AIFB 1KIQA 2BSRA 3BPOB 4MCZB 25C8H 2JJSA 2NTSP 2GSIB 3BN3B 2J88H 4ZUWB 2YBRA 4HFUH 1U8MA 4EOWL 4JPWH 4NCDA 2VIRA 1Z9MA 1BD2E 4U6HA 1F4AA 4HMCA 1WTLA 2MJWA 3HC3L 4ERSL 4HH8A 4Y19D 3SE9H 1L7IL 2NQCA 5AWNH 4HS3A 1R3KB 1H5BA 4UBDD 2EE2A 3TZVA 3IFLH 4FQXD 3QCVL 2V2XB 4UOW0 4QRTA 4X6BB 2J6EA 1BP3B 2AJ3B 1YECH 1EX0A 4PGCB 4WFFE 1PQZB 5K9JL 1BZ7B 1JFQL 1S5HB 3CFJB 1KYOJ 4RFNC 3DTXB 4JZJA 5DJYB 4NUJB 1JPTL 2EDJA 2ZCLL 2ATPA 4U0RB 4NT6B 4RBPH 2W65A 5H35A 4HWNA 2ZUQC 1LDSA 1FL6A 2ARJQ 4BUGA 5EBWA 2CDFB 4KAQL 4OD2A 4P3CH 5HVHB 4F7MB 4PJ7E 3MSPA 5HYJD 4LK4A 5DURB 3SQBA 3WD5H 4ETQA 4TRPH 2D03L 2DTMH 4OM1L 4X6DE 5DD6A 2Q8AH 2J8UA 4JR9L 4ZTOL 1VDGA 5SWSB 4AENA 3T3PF 3F8UB 5L7XL 3UPRB 1GGBH 3SDCC 3AS1A 4JFYA 3ZKMC 4Q58C 4PGBB 2P5EB 2ESVB 1KLFA 4CVXA 4CRPA 5EIIA 1DL7L 4X6DF 4XVJH 3DRTA 4AEHH 4XC1H 2RIKA 1SJHB 2DLFL 5HDOA 2BSTB 5TPWH 2X05A 1U6AL 5EO0A 1LDPH 4OFYA 3WKML 3WS6A 4Y2OA 4JRXB 1CIDA 1YNTA 4WTZG 4D8PA 4I3SH 3K46A 3ULUH 2Z91A 4E41B 1K4CA 2H1PH 3WFHA 4JRYA 4JQIH 2YWZA 5HJ3B 1YYMH 1JGLH 3RZWA 5INDB 1KFAH 3BWUC 1FG2A 3UYPA 3HR6A 1TIUA 2VDRH 3TGXA 5F7EL 2DBLL 2R23A 4AEEA 3GRWH 1S3KH 4OLVL 1FJ1A 2F15A 32C2B 3KPMB 3P0VH 5KSAA 5C0CB 3RIAF 1FPTH 4XBPB 3RTQD 2DD8L 4XVUC 4C4KO 5T5FL 2J1KA 4LMQI 5ICYB 2DL9A 2PR4H 5F1NB 3RTQA 1T20B 3P40A 4X6CF 5M94B 2XWBA 4KJPC 3GHEL 2DQUH 4WRLA 1Z5LB 4X7DC 3ZTNH 1CD8A 2AEQH 1DFBH 5MI0C 4IHOB 3HFMH 4OZHF 2WAHA 3ZO0A 1NL0L 2BOCB 1R3LA 3OR6B 1E0OB 1HN1A 3ILPA 1EJOL 2FJFA 4BFIB 3R1GH 4NO3A 5KN5A 1F2XK 3QCUH 5L2KA 2R39A 5DQDL 5DRWB 4PTUB 1JZ6A 4NO3B 5KANG 1CLYH 3B9KC 3L3HA 4GBXB 4YXHL 5I19H 1A3QA 2HVKA 5DJ6A 1QBLL 2IFFL 1I4FB 4M6OH 3ZHDA 5D7SL 3EO1A 4ZO9A 4KI5C 4M1GH 4POZC 4GS7C 5IEHA 3MUGB 3QPXL 1N6QL 2KBGA 4GLRI 1EERB 2R9HD 3KS0H 5IESL 4JAMB 3HPJA 3HR5B 3MBEC 3V6ZA 2X41A 4UMGA 2RFXB 1T7XA 3RDTD 4G6FB 3SJVE 2K7QA 5F3BA 4XAWH 5E2UL 5I1AB 4Y1AD 4PV9A 5CZXD 2OI9C 3QDGA 4OJFL 1SBSH 4K2UL 1S7XB 4JZOB 1DEEA 5F3BB 1A9BA 2D0FA 1N5AA 1I3UA 2IAMD 4EQ3A 1I8LA 1WCQA 2KL6A 1WIPA 3C5JA 2VLKE 5DZNA 1WBXA 4YNYA 5BRZA 4RWYL 2FDBP 3HAEA 1UB6A 3NMEA 3QIWB 5CGYC 4XBEH 3U9PH 2YUXA 5HHQB 1MVUB 3WDJA 5C92A 2W9EL 5EOTA 5I1LA 3CXHK 2AXGA 4GKSA 5GGSY 1X5HA 2EXYC 1UVQB 4QRRB 4LVNB 4JB9L 2DYPA 1LVEA 4U0QB 5C9JB 2DIAA 1HHJA 5IB2B 2FR4A 2HN7A 2RAMA 5FUCC 2HJFB 3CAFA 4HEME 4HMDA 2XFXB 3DO3A 1RZ7L 5E2WH 1YA5A 1ZLWK 1JWMA 1FYTB 3KJ4B 3C6LC 1I8LC 3H0TA 3CXDL 5JIHA 2ICWI 3GMNB 1JP5A 4DKAA 2EYTA 2J2ZA 5F7YC 4UUJA 1C12B 4GJTB 4IRJA 2CXKA 4Q6IA 3RVWD 4OGAC 4GRMB 1H9VA 3OBAA 3ZKQD 4KTEH 4YHNA 2CDFA 4OD2B 3ULVC 4XX1G 4O58L 4JO1H 4LOUC 4RSVA 1G9NL 1HINL 1SHMA 3TLRA 5EO9A 2AGJL 5LGJA 1H3XA 4BH8B 3NZHH 1XGYH 2IEPA 4RDQG 1MPAL 2IMMA 4NIKB 2FRGP 1QYGL 3WFZA 1D5MB 2H6PB 1E4KC 2N56A 5KS9E 2ED7A 5BVPL 1XF3A 2AJVH 3X13A 3BVNA 4K9EL 1JI2A 3D2UA 3J8F7 1B0GB 4N1EA 2LQRA 4R4ND 3K2UH 5AWNL 4KQ3L 2DMKA 4O2FB 4JRXE 2FCBA 2WV3A 3MV7E 3U46A 3BPNC 4CU6A 1IC5H 3FO2A 4OUUB 4KKLC 4U3CA 2VXUH 1U2HA 3GSRB 1CFQB 4NQDE 4WEBH 4X4XB 4ODTH 4HXBH 3L5XL 3FB5A 4JRWA 4OGYH 4PJXA 1T1YA 2OZ4L 1SEBB 4BQ9A 3LEYL 3MROB 4YHKH 1S7SA 3BPLC 5ANME 1T7VA 4MAYA 5E08H 1YEDA 2BK8A 3QPQD 4HS6A 3ARUA 4I9WD 1NMCB 1V5JA 3MV7A 4GAJL 1DP0A 5IG7B 1MCKA 1QACA 4F15C 5HVHC 3LRSA 4FTVA 4NJ9L 3V4UL 3SDDB 3D39D 3TA3D 1ZLSH 1I8KA 4ZS6D 1MI5D 4MDIA 1RD6A 3I2CL 4NBZB 1JTTA 3TZVB 2JJUA 2P5WE 2MHAB 1XH3B 2LU7A 3JV4B 1BF2A 1MAML 4OSUH 3TBTB 4LQFL 4ODHL 5BV7L 1HXMB 1FIGH 3VW3H 4Z7UA 4JFPA 4YFEA 5IW6A 1R0AL 1C5BL 4YR6B 3RVWC 1JRHH 3DWTA 5FDWB 4M6ML 1D6EA 3U30B 5T33L 3C6LB 3QJFB 3SJVB 1WAAF 3U9UA 3L3JA 4MD4B 1GSMA 1NC2B 3V4PL 5FYJE 1MCQA 4GRWB 4CBPA 3BH9A 1FPTL 1TCRA 4YHOL 4P5TC 5FKPB 1KIPA 5T5FH 1QSEE 3D85D 4O4YL 3T4AB 3U7YL 1CD9B 5HSFA 3DVNA 4S1QL 4LLVA 4OCXH 3GSUA 4AT6A 4IMLB 4HKBA 4YXKL 4UDTB 3GBLA 1B2WH 1IGCH 2XPGB 3QDJB 5BS0D 1EJOH 2FEEI 3CXHJ 4JPWL 3O2WH 5EU6E 4B7LA 2HRPL 4X6EA 1QFPA 4K7PL 5D1XC 1S7WA 2ZG3A 2NY2B 1RQ5A 4ODWB 4AG4H 4YZFF 3CLEH 1SBBA 3TC9A 2VZ1A 3DETD 3HUJF 3QFJE 1CDGA 3T4YB 4Z7VA 2YRLA 4G80B 2IANB 3SDDC 3VFUA 4NRYA 3BW9B 4XAKE 4AQOA 1KUMA 5CD3A 3G5XA 4WCYL 1KTDA 1IEAA 4DGVL 5IEKB 5F97E 1ZWIA 3H2WA 3PWPA 1AO7E 1D6VH 4ZFOB 1XGTA 2ZKHH 4FABL 4XCCL 2DWEB 2R0KL 4K7PY 4RFNB 1IBGH 1AXSA 5E8DH 2I9LB 4J6RL 3RL2A 1JZ4A 5FA3A 5F7KC 3F7PC 5GIRA 4MJIA 4O9HH 1HCVA 1YY8A 2RGSA 4NQEA 3QIUB 3DX8B 1DBBH 4RISH 3OXSB 3IS0X 3SN6N 5L0QB 5DTFB 4C56E 5L6YL 5MEPA 1P4IH 4KTYA 5HI3D 4HV8A 1KTLA 3AS0A 4W81A 1F4HA 3K8MA 4JKWA 3VE0A 2B2XH 1T83A 4Y2DB 3QHFL 4GRLA 3UTSB 4OUOA 3ZLQC 1SMAA 3HE7C 2IPTL 4ELKB 4MNHA 4QRRD 3T08A 2FYYA 1MJ8H 1XF3B 3GHBL 4MQSB 4Y5VA 3QWRA 3L3IA 3DUUA 1P4LB 4PUBH 4YZFE 3VXRA 3HE7B 3QUMH 5C09A 3KLAB 4PRIB 2VZTA 2OJEB 4PJ7B 5ADPL 1KB5B 5CEYA 2VITA 1IGFH 1FN4A 2ZSVB 1PG7L 3LRGA 2DQFA 4OF3A 3A0OA 4G6MH 3SDYL 5KS9B 3IJSB 1HHKA 4BKLA 5C2UB 1YMMA 1HYRC 4NHCH 3WFCH 4GSDH 3LQAC 3CFIC 2DKUA 4PJGF 5MP6L 1S7TB 1AE6H 1VSCA 1IC1A 5DJAA 1CG9A 3RAJH 4RMWA 4C59B 4FZ8H 4ZFGH 4OCRL 1ZKAA 4FFWD 5J3HD 1E6JL 3I6KA 3OR7B 4PTUA 4PJHB 5MERA 2AABL 4AK1A 1CFTA 3QXAA 1INEL 2MSPA 4NN6C 4QRPD 1ZGLA 1N26A 3S6CA 3L5JA 4IMLA 4XMPH 3WXVL 4Q9QH 5CKAA 4J3UA 1CLYL 3V0WL 3DNKA 3KPOB 4NNXB 1Q1JH 3RWJA 1KT2A 2IFFH 5DTFA 3IU3A 4K8RC 1FBIH 2CXGA 2HLAA 4C56B 5J6HA 3TN0D 1KT2B 1NCAH 1RIUH 3U9UB 1DEEB 1A6VH 4F9PA 5D7KD 1RZFL 4X0KA 4P23C 4JVUA 4OBSA 5B39A 4G8IB 2RBLA 1CFSA 2FZ3A 4YR6A 3GM8A 4WJ5A 4JGJA 3ZT6A 3UC0L 1VFMA 3QHZL 1SYSA 3OKNA 2BVUA 5HXMA 1KTDB 4UT9L 2BY2A 1N7ML 5HPMA 4YH6A 1N0XH 5GGVY 5DD5H 2EE6A 5EFIA 1S78C 1ZHKB 5KOMC 1XIWC 4FFVD 2ZWLT 1M05A 4EI6A 1IM3A 1I8KB 1A4JA 4K3JL 5IFAH 5D2LB 3BKJH 2Y5TB 3S9DB 1OSZB 2APVA 3SDDA 5E2JA 1VFOA 1JPFA 1HKLL 5F96L 3O2VL 5H2BA 4OF7A 1WVZA 1J5OL 3ZSTA 5GGVL 4JFEB 1DVFA 5BV7H 3S4SA 4NDMA 2E6JA 2V9TA 5HGBA 1J8HE 1I85A 1R3IL 5DK2A 3I6LE 4JFDB 5IHBA 3SGJA 4KVCH 4J4PC 3IDXH 5IBTH 1YYLL 5KG9A 1CLOH 3QUZA 4P2RA 1ACYL 2YPLB 4N8CL 5GGSB 4BSVB 3LAFA 3HS0B 4LRNH 4S0SD 3QIBA 2X4OA 1ZA6B 4H20L 2D0HA 4TNWF 4M9PA 1VESA 4P4KD 2V5RA 1KTLB 4QRTB 3DMMB 5IMLA 2G60H 1KB5A 4XXCA 1Q9OA 3LD8C 1NMBL 3PWNA 2GT9B 1JGUL 3IXAB 3TIEA 2HMID 3EOBB 3FFDB 4U2ZA 1R6VA 2QR0B 5HYQB 1F3DH 2DD8H 2P5WB 1BQHG 3F62A 2X42A 2XIDA 2YN5A 3BPLB 3Q5YA 5HDBE 4N0CD 5TF1H 4V1DD 4Y5VB 4K9EH 1CWVA 1JYNA 2HJLA 1J10A 3MJ8A 4JFXB 2DQUL 3NCYP 2F8XC 3MNVA 1A6AB 2NY3C 3WIHL 5JOPE 5BO1L 3BISA 4ORGB 3LKSB 1G0YR 4G80A 3C6LD 1TDQA 4PJIA 2UVFA 5K9OB 2OJZH 2UZIH 2ZZUT 5IMKA 5IW3A 2FH6A 5T3XL 3CLFH 4EDWH 2X7LA 3QEQE 1G0DA 4LEOA 3FCTA 5CSZA 2D7TH 4M03A 1GC1H 3EUUA 4MLIA 4XWOD 2FL5A 1QBLH 3PDOB 2BY1A 3V7AE 2EIZA 4L3ED 4R96B 1REIA 3IFLL 4UIMA 5D1XD 4OI8A 3MRKB 1EO7A 1Z9LA 2PXYB 2V2TA 4NO2B 5BW7C 1W0WB 3OAYH 3C09B 4QXUH 1QKZH 4MA8L 4RRPG 3NFNB 5IESH 3Q3GA 2IANE 3SDXE 4NKOA 1K8IB 4ODXB 4IOIA 2QHRL 4N68A 1I1AA 4NJ9H 5DI8A 5HY9B 5I2IB 1IAOB 2JK5A 2XT1B 2XXCB 1DQQB 5DFWH 2EDKA 4XPAL 4I8DA 2VRAA 4R7DA 1EHXA 3DURB 4M7KH 1T1XB 3UJJL 3OKEB 3MLZH 3QDME 4S10A 1U2CA 2ERJB 5ALCL 5IVZA 4JO2H 3TVMB 1NAKL 1ZEAL 5D1XB 1PLGH 2EDRA 2F54A 1QLEL 5EU5B 5HGGS 3VFGL 2CK0H 2YPVH 3ZMRA 4YC2C 4WUKL 1NFDE 5D7JB 3UJIH 4OZIE 4P59L 4X7CC 4D0BB 1T22A 3S88H 4XC1L 2FJGB 1PZUB 2E27H 1SJEB 3GJFK 4R4BA 4P2CG 1E4KA 4X6FA 3LPWA 3MXWH 3D25B 3DSFH 1KC5L 1N64L 1I7ZA 5CD5C 2I26N 3NIDE 2CO7B 3G5YB 4UAOB 1G6VK 1PG7W 4JHAH 4L5FL 1QSFB 1K6QL 1MHPL 3TJEH 3DX7A 1AXTL 4E41D 3C6SB 1WBYB 3C8HA 4XCYA 1TZIA 4LQ1A 5CILL 4OQTH 4WENB 1RUKH 5CSZB 3ULUD 4K71B 4LKXB 1G9NH 3S4SG 1FE8H 1MFEL 3P0VL 4L3CA 3LKQA 1YEJL 4EN3A 3VFNA 4WGWB 1UACH 2EDHA 4LPTA 2KZ1B 2UYLB 4OF5A 1A7BA 5E94B 2V17H 4BUHA 3X13B 3NIDF 4QRSA 5HGDB 1ZTXL 5CJBA 5AYUL 3UTPE 5I1IL 4Z7WE 1E6OH 1G6RH 1NC4B 2JIXA 3K1DA 5DQDH 3JTSA 4CVWA 2K1MA 2VDOH 1RZFH 4LEXL 4P2QD 1DEDA 2DI9A 4EDXB 1OP5H 4JFHD 3VXUE 1TJHH 5I18L 3C5SA 5L2JA 1T2JA 2OJEA 5ID1A 2HJKB 5HI5D 4CL7A 3UTSE 1MJ7H 4ZYKB 5TGBA 4PJXB 1HHGA 1UZ8A 1XF5B 5EOCH 4HUXB 3MV11 4PJDB 5DJZA 1JWSA 4ZTPH 4F58L 3NFPA 2D9QB 3FT4B 3HI5H 1JPST 3MBEA 4FQXB 5D6DA 2E5EA 1RAMA 1PYWA 4P5KA 4HUWB 1JCKA 1LNUA 2D0GA 2VLRE 3M1BA 1YQVL 3E6FB 1JHKL 4MJ6B 5EU7E 4Y19B 1D7FA 1OAUL 1M71B 4QXTA 4PJEF 2VL5B 5J1TC 4K8RD 1AD0A 5F1KC 2DF3A 3QHFH 4N90D 3ROLA 3RL1B 3REWB 4PRNB 3E0GA 4G42B 2ZUYA 3D2UB 3HC0A 3WE6A 3T77B 2DQJL 3RL1A 1WISA 4K3GA 1U0QA 4JN1H 1J0ZA 4HT1H 1JV5A 3KYAA 2YMXH 4KKAC 2HT3C 3ZL4L 1JGVL 3QXDA 2XFXA 2GJJA 3P4NA 5EPMA 4HULB 3UYRL 4KV5E 5D2LA 1JHTA 3LKOB 5F7LB 1CLZL 1BZ9B 3Q6GL 5KAQF 5FYKL 1LEKB 1CICD 3DTXA 4JZJB 5DJYA 4OFDA 1AXIB 4F9LC 3RTQC 4QRQA 5D2NE 5GS1B 2ZNWA 4YAQA 4G6ML 1MCPH 1CXFA 5JORB 4LHQB 3ZKXB 3ARPA 2VE6B 1EZVX 1T1WB 4YHNB 4YO0B 3SKOA 4RZCB 2XYCA 3GIZL 2DAVA 1I1YB 4NCC1 4Z76B 3MLXH 5GGTA 3IDNA 1N5AB 1YEGH 2APTA 3ARFC 4OZFA 3I6GB 3GEWB 4RGNC 4LVOB 3VD5A 2EEDA 3RFZC 3DUHA 2P8MA 1A6WL 4PV8B 3MRIA 1A7OL 1RURH 3OKEA 1MQ8A 4XVTH 4HKJB 5GRVK 2DIJA 1P5UA 1NFKA 5JTWA 3KPOA 3WIIL 4OIBA 1RJLA 3WS6C 2X4RA 3T0VA 2AJUH 3QG6A 4UV7L 2FGZA 1UWEL 1ZS8B 5DYOA 4F33B 3HZMB 2Y36L 3O2WL 3UZQA 1NGYA 1SJEA 1N5YL 4GBXA 4U1LA 3VA2C 4HPOL 5DDHA 4A6YB 4JFED 4KHXL 4ZUUB 5FM4A 5F7HA 2XWJB 1L0XA 5ERWA 4F7EB 4O2CA 1IC5L 1MF2H 3UC0H 5CBAA 3FFCE 3UTTD 5INDA 4F7TA 4AJ0A 4AQ1B 3OL2A 2P5ED 3MRCB 1MCLA 3L7EB 3BDXA 2QHRH 3SCMD 2AVGA 4Q2ZB 5J13B 5C0CA 3EGSA 4LPCA 5IQ7L 3D3VA 1KCRH 2BFVH 1N2RB 2RR3A 4A2MA 4PLKC 2OR8A 3R0MA 4BQBA 1MCCA 3ZDYE 4M7ZB 5IWLA 3C8KB 4MXWL 1TJGH 4M8QA 5I74C 1J5OH 4WW2A 4L4TD 2BVEA 5T1LA 3M17B 4P99A 3BUYA 4APQA 2FX9L 2PYFA 2V2WA 1CICC 4MVBD 8FABB 1T0MA 4YQXL 2JJSC 5DC0A 3ZSSA 5C0AA 5F7WC 1KCSH 3ABZA 3MLWH 4QT5B 4OTXH 1VADB 1L9MA 4U1KA 2YD3A 3PV6B 4HBCL 4LVHC 3VWJB 4JO3H 5FYKU 4UT6L 3S3PA 4CMMA 1MCEA 2P8LB 1I7TA 5HTSA 3WSQH 4QKXB 5E99L 4YHML 3VXPA 1OP9A 5E1HB 3P11H 2XA8H 1I7ZB 5SX5H 2CDGB 2E7CA 5AZEH 4UNUA 4JPIA 5DJDA 4MAYD 3VFVA 2R2HB 4RX4D 4LNRA 7FABL 3TIEB 2VTFA 2H2PC 5C0BD 1UACL 1G7PA 5C07D 3STBA 3T0WA 3MNWA 2V9RA 3R0NA 1ROWA 1YEKL 3BVNB 2V17L 1XGPB 4LKCB 4ZFGL 1SMOA 1NCWL 1EO8H 4CADB 1B3JA 5J1SC 2GUOA 1A0QL 3W11C 4U1GB 5I9QC 5DD0H 3LHPH 3V6OE 2ESVA 1S7WB 5IR1B 2VDQL 2FD6L 3P4OB 3O11A 4DUVA 4JFYB 1QRNB 4HKZA 5IB3B 2QSTA 3AAZB 1RZIB 1IGYB 2VDOL 5I1DA 1G7JB 2DOCA 4KI5D 5I71B 3JUYA 4D9LH 4L8BB 2A2QT 3PL6A 2RCSL 2VQUA 4NKOB 2GAZA 4OD3L 2ZUSA 5B38B 5HI4C 1RUPH 5DJDB 5CBEA 1AHWA 1WZKA 2B4CC 1CFSB 2FZ3B 3KG5A 1S8DA 3QB7C 4R7NA 2PW1B 4G6AC 3LRHA 3C6SA 1YN6A 2H9GB 5C0RH 1X5XA 1JF1B 4MLSA 1MFAL 5I8OH 5B8CA 4ZXBB 1QR1A 3GI8L 4RGNE 5K9KA 5DUMH 1QP1A 4MA7H 4J3VA 3FO0L 5CGTA 3S36X 4DWHA 5GS0H 1UB5B 4J6RH 1UADC 3VGEA 1HWHB 4P2OD 3E3QC 3UO1L 5I17A 2HFGL 4PJ5A 3QEGL 2PCPA 1E4WL 2EE3A 3QIWA 4HIEB 3V95A 1PSKH 4G8GA 3ULUC 4PG2C 3JV4A 3OKNB 5AYQA 1WBXB 4K55A 1IKNC 2LAAA 3CCHB 4N0FA 1CFTB 5EBLB 1IQWH 2MCPH 2Q7NA 4Z7UF 2GSIA 1JMZA 3NIGE 1OM3H 1IKNA 4ZXBD 1F6LL 3BKCL 5IIEA 5D71H 1ACZA 5JA9A 3ZE0E 5GGVH 4PRDB 2J8UE 5IFJB 1NGWA 1KJ3L 1PVHA 5FCSH 3SDCB 5E2TH 4KROC 1XCQA 5IF0A 3OJ2C 4WWKA 4M93C 3HUJA 4TNVK 3I3DA 1G7IA 3U6RB 4NNXA 4U1HB 5CEYB 2VDML 3S96B 1EHNA 4FP8L 1C5CL 3TFKD 3DI3B 5B8CC 2YA1A 3SDXB 1FZMA 1AGDB 1O5DT 2DQIL 5GHWL 2GCYA 4L3AA 2OTUB 1YC8A 3X12A 4GG8B 4KAQH 3TH3T 4D3CH 4ZSOA 5D6CB 3FB7A 1MLBA 2FEDD 1A7OH 1RURL 3QI9A 5JW3H 5FAAA 3T77A 1KCLA 4C83B 2F53D 1XGQB 2GJ6A 1C08B 3KR3H 3DXAE 1BEYL 4P2RD 2X4UB 3N1MC 3ARBD 4NSKA 4OZGE 1B4JH 5DF0A 5EORH 1OP3H 4LHJB 3T09A 3FO9A 4Z95H 2IH3A 1EXUB 1J9CT 4F2MB 3OXSA 2VABA 1UKSA 2I9TB 1ZXQA 4NYLB 1T0PB 2X9XA 3SE9L 1DN0B 2WNGA 5GGUA 4X83A 4GRWF 3SKMA 4Y2DC 3RHWF 4WV1A 1HH9B 3RGVC 3AS2A 3UAJC 1A3LL 1B9ZA 4KKCD 2DWEA 1HHGB 1XF5A 4WNQB 4UAOC 5L88H 2F54D 3LB6C 5CMAA 4JFFD 4ZFOA 4XNQA 1JYXA 3EZJB 3WFHB 4LCWD 1JZ2A 1GGYA 1MFDL 3O6KL 4E0RA 2CR3A 1X5KA 4ZODA 2AI0L 3ROOA 4PTTA 3C60D 5C6TH 3QUMB 1XR9A 3OPZH 4MJ4A 3W0WD 2AJZA 1LK3L 4UT9H 3PHOB 4DAGH 5E9DA 4HC1L 1HH6A 3QZWB 4HS8H 3QO1B 3DX8A 3ALXA 4M43L 4D94A 2DQHH 2A77H 5CZVL 1I8MB 5I1EH 5CP7A 3PDDA 2F9BT 4LSUH 3S4SB 4FQLH 2BNUA 2FIRT 1LHZA 3HC0B 5DK0B 3B3IB 2PTTB 4QRPB 1U91B 3BIKA 2R1YA 3CIQA 5CZXC 1UKQA 2KZWA 5F9AC 3SOBH 1MJJA 4NC1E 3QXAB 4YHLH 3I9GH 5DRZB 1FIEA 1I3GH 4JKPH 4WU7A 4MYWB 4AIOA 1T2QH 2OTWB 3BDBA 4Z7VB 3PP4L 1OGAA 1OT2A 5IWLC 2CRIA 4XNUL 4LAQL 4AEFA 1YMMB 4YHZH 3QULB 4NQCA 1ZT1B 1IM9B 3KJ6L 1I7UA 1CGSL 4WW1B 2BXZA 3B4NA 1FO0L 4MXVE 3B2UC 2NPLX 4JDVA 3MJGX 4H20H 1Z0NA 4P4RA 1NCBH 3V52L 3TBVB 4D0BA 3QWOB 2PCPB 3QRGH 1S9KC 1YEKH 4PJ5B 3A6OA 4M7LL 4IS6A 5CJOH 1H15B 1H8OA 2J3SA 5C0FA 1HI6B 3FQRB 3U0TA 4FG6D 4U1SB 4D0CA 1UB5A 1JGUH 3O4LA 3WUWA 3FQUA 3FQWA 5I30L 2IC2A 2IALB 1XGRB 3MLRL 5F9OH 5IT2L 4GW1A 3T1FB 4WHCA 5SWZD 4NN5B 3NCCB 4PS4L 4UOJA 2IADA 1DCLA 5J06A 2PN5A 4U7SA 3I50L 4C4KT 5FYLH 4PG9A 4QXGL 3V6BR 1G6RL 1UCTA 2V7NA 5D7SH 1A2YA 1T80A 1A64A 4L8SA 3HMXA 3LKRA 3ULUF 4RAHA 1LP9E 2CLRB 3NIFF 1AGDA 3EJYD 2J5LB 3PQYD 4KQ4L 3C60C 3CLFL 2ESVD 4RWHA 1CICB 2RB8A 4DUWA 1RU9H 5HHPB 5J12C 3L3JB 4MD4A 3S7GA 1MRCH 5D70H 5DUBA 4QY8B 3BMVA 4PJHE 4U7KA 1TITA 3ZTJH 4PRPE 1UEYA 3ARBA 5D2LF 2L4OA 4F37F 2W0FB 1FNFA 4ODVH 5C0AD 4EUPA 3VFOB 3C60B 2CUMA 5C0BA 1ADQL 4XTRC 4NQXA 5IHUL 1HQ4A 4PRBB 1TJIH 2WBJC 1U3YA 4JFFB 3BZFA 3HLAA 2VLJA 4KKBD 1GJIA 1QRNA 4J3OC 5JXEC 3ESVF 5FHBL 3VDBA 3DRTB 4HUUA 4JM4H 3QUYB 5FGCB 5DK3A 3D39B 4PGBA 5GRJL 1IJ9A 1JNHA 2JB5L 3EOBA 4I0PD 3PJSB 4K23L 1J1OH 3K2UL 2VZOA 3KPSA 3TN0A 4P4KC 5E2TL 1CT8A 3RPKA 5DSCA 2GTWB 4KPHL 3ZL4H 5CAYB 3U46B 3ARBB 4DN3H 3WN5B 1CZ8L 1CK0L 5SV4A 4X9IA 4PREB 3W0WB 3BGAA 4Z0XA 2P42B 4P2OC 5C0EA 3DVFA 4MJIB 4W6XB 3AROA 2P7TA 2VISB 2YPLA 3QDMB 1VB9A 4QOKD 4UBDC 3V6OA 2HLFD 4NT6A 2DLHA 2I9LA 2ZG1A 3BP5A 4JO1L 1WIOA 3AUVA 4PJCB 5D7LD 1NBQA 1JWMB 1MCFA 2X4TB 5LXGH 5TFSL 1BZ7A 3CFJA 4OLUL 4L5FH 1EK3A 4GAYA 4MDJB 3FCTB 2W9LA 3O8XC 4MNQB 5JHDB 3BP7A 2FBJL 4FNLL 2F19H 3RY6A 1Q9LA 5BXFB 2HTKD 5I1DB 4XHJD 1GZQA 4OKVA 5CEZE 1BEYH 1TCMA 1DFBL 2PTUA 1NGXA 3HCVB 2CK2A 3QJHA 3TFKC 5HHOE 4LRIC 3B9AA 3M8OH 3BWAB 1UXSA 3OB0K 3MXVL 4GMSH 5J57B 2NY4C 3G08B 3RHWK 3TA3B 4DJMA 2AQ3A 4DUXA 1KGCE 2VLRA 2JKXA 1JGDA 3VGDA 3PNWB 3B6SA 1BFOB 4NP4L 4N0RA 4OD3H 1DQML 4MQ7A 1TNMA 4M6OL 3AB0C 1ORSB 2NXZD 5DEZA 3KPLB 1FIGL 4Y16A 4HBQA 5EU6A 3GMLA 2X1QA 4KDVA 2IH3B 2ZPKL 1Q9KB 3O6KH 5IEHB 1IFHL 2K7PA 1UWXK 5DEFB 4GRMA 2Z8VC 3MJ9A 1BVKB 1GCFA 4G9DB 5LAXB 1CVRA 3QP3A 4HJJL 5JLZB 4UU9B 3CVHL 1HHIB 4HC1H 3WKNA 1J1XH 2VZSA 3BT2H 4R7NB 2VXVH 3ARYA 3V4UH 4K3DH 4OFPA 2XA3A 3RX5A 3BQUC 1FGVH 1LO4H 3UCRA 2XKNA 1T4KA 1LK2A 4XP6L 4GKSB 4YHYB 3ZDXE 2J12B 3PWLA 2QADC 3KVQA 3AREB 1T04B 3T2NL 4RFEA 1QHOA 5D8JL 3U83A 2V5SA 4OFIA 5IFHH 4G9FD 1A6TA 2VLJE 5DJ0A 5DJ8A 5GGTL 1K4DA 4KK8C 4G7YH 4XPBL 3O3DB 3GRWA 1XF4B 3QUKA 2WM0A 4BFGA 1TTFA 2J4WH 5AZ2H 4GAFB 4O51B 4LCUA 4NNYA 1ES0A 3AC0A 5J7CC 4QCIA 1DDHA 4N1HB 5DQ9A 4PRPA 1IQDA 1EEYB 2EDTA 3Q6GH 1OTTC 4HMEA 5DVNA 1N59A 3L3DB 4JAMA 1QFWM 2Z91B 4D2NA 1FL5B 4XMKH 2G5BB 1SEBA 2OCFD 4HHAA 4XCCH 1AC0A 3PWVA 3MRNA 5E2VH 3ZE2E 3L9RA 1NFDA 4D9QD 4NO0B 4LDOB 4NKIH 4X9HA 4NQSB 1AGFB 2YPKB 4NYLA 4L8DB 5TH2B 5MEQB 1T5XB 5GZOC 2NY5L 4Z78B 4N0UB 4YHIA 1BD2B 5I30H 4TSBL 2YPKA 1FVCA 3QHTC 4MHHG 5DJCB 3BH8B 4WEUD 2MWCA 1WICA 2R0LH 3HMWH 1MHEA 1FNSH 4WTWA 2YXMA 4BK5A 5I1LB 1NCWH 3VGHA 2PYFB 2EDEA 3MOQA 1U58B 1EO8L 2R1XA 1RZKH 4GKZA 1HSAB 3N06B 1YPZF 3ARGA 1HOCA 4L29B 2FD6H 4M8QB 5DHXB 3PL6B 2GJZB 2Z35B 1YDPB 4KMTL 2I07A 3PHQB 4L4TB 1V3JA 1GH7A 3NBNA 4TOYL 1EJ6A 2XY2A 1F13A 3JTSB 4PUBL 4YXHH 5I19L 3BKMH 3HC3H 4NUJA 3ZYOA 4M02A 3G5VA 3FHQA 2UY6A 1OAQL 5DWUH 3NFPB 1F8TH 3U4BL 1BWMA 5KS9A 4S11A 2PYEA 1GAFL 5F1IB 3SEPA 5CJ5A 3QQ4B 4PLJD 3PV7A 5AG9A 2R2EA 4GH7B 3GI9H 3B9EA 5F9DC 4MB5A 1RSFA 4DAGL 1U8PB 5IB4A 4WNQA 4NOFA 4EN3B 3QIBC 1LO3L 1XFPA 1T7YA 2A9MH 2A77L 4MA7L 2BMKB 3MJ6A 2LVEA 4LLWA 5HHOB 3FT3B 3MA9H 3SDAA 4PP2B 5JUEL 2XQYG 4CVXB 4URTB 3FO9B 2X1OA 4TVPD 1CDIA 4GRLB 3UTSA 3HZMA 1A21A 5JO5A 1GZPB 3UBXA 3DI2B 1MVFA 4EI5A 2ZSWB 4X6CA 2X1PA 1Z6JT 5E8PA 2AK4B 4YK4B 4L1DA 4IRSB 5IGXL 3CU7A 2BSSA 5AAMA 4WUUA 1PY4A 3LPFA 2NY5C 5L2JB 5F88B 4D0DB 4CAGA 2VLLA 2H41A 5EIVA 3BHBB 4LRIA 5FUZH 1RK1B 2DICA 5DMIL 3GSOA 3I75A 2VR5A 3UZVB 1NGPH 5E6ID 3QI9C 3RWHA 4Z76A 3MRBB 1XGTB 3GKWH 1TMCB 3KAAA 4K9EC 4GSDL 1H3WM 3RY6C 4WWKD 4Y7MA 3WIHA 3G6DH 3SKOB 4U05A 3O8XA 1J05B 4BZYA 5KVFL 3OAZH 3ZHLA 1OW0A 2R4SL 4LF3A 1XCQB 3AM8C 2AV7A 3N50A 3TCXA 1QSFD 4ZS7H 1NLDH 3ZE1F 3IAPA 3VFNB 4WFEE 4JE4B 1BBJA 2FB4L 4E42B 1F3JB 4I4WB 1I9EA 2CJUH 3STLA 3O3BA 3NOIA 4OLEA 3V8CA 4JRYD 4LPVA 4POUB 3O45B 3ESUF 2BX5A 4GO6B 4FTVB 1RMFH 1AIFA 1YNLH 2PNDA 4YDKL 1IAIL 1U92B 2Q3ZA 2QLVB 2C7UA 1NEZB 3REVA 4Y4HA 4ZAKC 2NMSA 4NN6B 3W39A 1JZ3A 3JWOL 5KOVC 2VDQH 2GI7A 3G5YA 4ZSOE 5KSBE 2JK5B 2QQQA 1FO0A 1QFWH 1AD0B 1A7QL 4WCYH 2AK4A 4O5LL 2DYPD 2XG4A 4PG2A 2QQNH 2ZJSH 3ZE1E 4NFDA 1YYLH 4AEIL 1HZHL 1GZPA 3UBXB 3MYJB 1HYSC 1T89A 1IGJA 4U1JA 4R4FH 3DV4B 2AJ3A 3GBMH 5DD3H 1YJDH 4QT5A 4BH7A 3GZKA 2B39A 1T3FA 5DRXA 4ODTL 4KXZH 1DTUA 1IAIM 1CGYA 3RY4A 2FJHA 2NW3B 1YEIH 3QDGD 3OKMB 1NEZA 5C8JB 1F3RB 3MOBL 4OJFH 4K94H 4HIHB 3RWIB 4JM4L 1J0YA 4F8QA 2XI9A 1BQLH 5JIKA 4LPXA 4O02H 3QEGH 4S1DC 1BGXH 1TQCB 1U8NA 1CI5A 1EGJL 2DMBA 4L8SC 4UB0L 3ARWA 2W0KA 5EO1A 1KB5L 1JK8A 2EECA 3HB3D 1UKTA 2G2RB 3BRFA 3MRHB 3VU2A 3R8QA 1VFUA 3MA7B 2OL3L 1OWRM 3O0RH 1HHHB 1NAMB 3G5ZA 3I2CH 4XP4L 4JB9H 2UZIL 3H9ZA 4OKDA 4RRPA 5FHAH 5CEXB 3WS3A 2HWZH 4L29A 3BKCH 5E6IC 2NX5E 2WIIB 4Q6IB 1RIVL 2XKUA 3GKZA 3HZKA 3VD9A 2Z92A 5FOBA 1JPGB 2GITB 1R24B 3F58H 1U3ZA 5E2VL 4XNZC 4YHZL 4HLJA 3GSRA 4OFVA 5JQ6L 2ZOKA 5E1AA 4MA8H 2FBJH 3WLBB 4ZNEA 5D1ZA 1T5WA 3BZ4A 4PP2A 5D1QD 12E8H 3VFSA 4NO0A 3MBEB 1SVZA 3MRPA 1A7PL 1HINH 2YKLH 1CXKA 4O4YH 4M7LH 1QO3A 4YLQT 1A1OB 4YX2H 5E6YA 2R69H 4PJCF 3LQZA 5KAQG 4XZUB 2WP3T 3MJ8B 3MLZL 4JFDD 5T1LB 3SDAB 3MPCA 1AP2B 3NIGF 1OTSC 2COQA 5D7JD 2PW2B 5D1XA 5FYKE 3QFDA 4NQEE 4GKNB 3FB6A 1KIQB 1UM5H 4M3KB 5HYQA 4JHBA 5BJTA 5IM7A 4AL8L 5T3XH 3BI9X 1NLBH 4P59H 3TBWA 4P2YA 4R8WH 4HX1B 1OP5K 1F8TL 3U4BH 4HPYH 5ACMA 3U4AA 1E27B 3MACL 3PWPE 1CDCA 2MTPA 4JLRB 4PJAF 2A9NH 2IPUK 3RPIA 3QHZH 4TNWK 3QIBB 3LS5H 2X4TA 3S35L 3U2SA 2BC4B 3MV9D 2VJXA 1D6VL 3CNKA 5DHYB 3TJEL 4GUPB 1UENA 5GRUH 4HG4J 2A9ML 1B6UA 5JW4N 2AI0H 4MSWA 1OWWA 3NABL 3SKJL 1I9IL 3DXAA 1W72H 2GJ6E 5D1ZC 1TZIB 2GKIA 3KPRB 3VFPB 3FQWB 5J11B 4Y5XB 2ZUTA 1PFCA 1RFDH 3OJDA 5IHUH 1H8NA 5JMRA 3G6JA 3UEZA 2FO4A 3NCJH 4JO2L 4YGAB 3E8UH 5L6YH 4X6CB 2AQ1A 5AD0A 1M4KA 4IRSC 1ZT7B 5TE4L 4Q9BA 4WV1C 1KLGB 1NPUA 3JBG7 2QV2A 1A6AA 4X99A 1QSEA 2Q20A 2QKIA 5KSAB 2FJGA 3D87B 3NN8B 1AI1L 4IDJL 1PKQA 1VKXA 3ARZA 5DQ9B 4HWBH 4HIJB 4DCQA 1HDMA 2HRLA 5C0CE 3KLDA 2CRYA 4PBVC 5IBTL 5IW1B 4D9RE 4V1DB 4ZUTA 4XNXH 4UOW1 1MCWW 4U1IA 3QDJE 2F54B 2XNAB 2Y23A 2I24N 1JZ8A 3VW3L 1YC7A 4WI9A 4I18A 4RZCA 4RFOH 3C5SB 2W0FA 4MAYC 5FO9B 3IDUA 3SE8H 2WLYA 5HHMB 1Q94A 1VEPA 2Z8RA 4WFGE 4X80H 2BNQD 4MA1C 4HAGA 2DJ4A 3FMGL 4M5YL 2NTFB 3OAUL 3HG1A 4NC2B 1K8IA 4Z5RB 1YQVH 3FQTB 1YNKH 3OKDB 3QRGL 1IC4L 5DUPH 1EHAA 1YY8B 2DM2A 4I48A 4LLAA 5CJOL 3BPOC 1B0RA 3U36B 4OGXL 5D7JC 4LMQE 1YMME 3L9RB 3BAEH 4GXUN 4WWKC 4F7CA 5JA8B 4I13B 1U8JB 4ZQKB 4KKNA 5BO1H 4PJEB 1R5IB 3WUZA 2D31B 4LLDB 2BVTA 3CFDA 4KMTH 3W11D 3MLTB 1G7IB 3U6RA 5ADOL 3GMPB 2HH0L 5I8CB 3H9SA 2X4PA 3O3AA 3C08H 4Y4HC 4N8VG 5CMAB 2E8ZA 5DWUL 5IMMA 3SCMA 3BO8B 3SBWC 1S5HA 1FVDA 3GK8L 4PRHE 3IJSA 8CGTA 3ZKND 1JWSB 3PIQA 1J8KA 2YD9A 4H0GA 3O3UN 4G6KH 2QQLL 2YOCA 2YPLD 1H5BB 4BQ8A 1IEAB 3EYFB 4PRIA 1J0KA 4LPWA 4X6CE 1F11B 1A1OA 3DGGB 4NPYB 2JIXD 1DBKH 3D9AL 1OW0C 4HUMB 1KXTB 4ZAKD 2EH7H 4LLVB 3QIWD 2K3TA 4UT7H 5JMOC 4YPJA 3IGAB 4O9HL 4BK4A 5E0QA 4I2XA 1MFBH 3H9SD 4U6VL 4ALAH 3VGFA 3QEQB 3K0WA 2DQEH 5DRZA 3PP3H 4LPYA 4Y4KD 1CU4L 3PL6C 5D9SB 2DDQL 3UPRA 4PJGB 4PFEA 5DK0A 3BPNB 3UTTA 3IYLW 4J3WA 4OBRA 1IM9D 2IH1A 6FABL 4JFQA 2IPTH 5ICXA 2VQ1A 5HHME 2E27L 5GGRY 3DIFB 3MRQB 4JFPB 5D5MA 1DBAH 1V7ML 3JV5A 2AP2A 2J6EH 3I3EA 2F8OA 3GNMH 1P4BL 4XX1E 4KHXH 2IADB 3MRKA 2UZYB 1CZ8H 4J3SA 4R9HA 3KPPB 1C1EL 4I5BB 3VH8A 5FGCE 4MQXD 3GO1H 3FRPA 4JKMA 4PGEA 2NY0C 4GS7B 4UNTA 4GMTH 3P4LA 3L6FA 1GGCL 4M5ZL 4LKCA 4Z7WB 3HE6D 3L7FA 2E9WA 3DROA 1A6WH 4B41A 3JV0A 1QPXA 1PX4A 2BFVL 3NIFE 4YBLC 1T1ZB 3L7FB 3R4DA 4Z7QF 3VD7A 3D5OF 2DJSA 3KPSE 5EUOF 5I17B 4NZUL 2Q8AL 4QEGA 1KBGH 2DI8A 2A74A 1RUAH 4HJGB 4PJFE 5F3HB 4EUPB 3B9KA 2WINA 1E6OL 4M1CD 4ZNCD 4I77H 3P4MB 3B9VA 1NMCC 3PWJB 1A4KA 4XB7A 1EA9C 5J89A 1F4WH 5DT1L 4I0PB 1MUJB 1QRNE 2BJMH 3N0PB 3MODL 3TEUA 1N6VA 4LEXH 1UCBL 4KZEH 4OLXH 1CL7H 4O5LH 4PP1C 5E5RB 4CMHB 1MI5B 2LFGA 2HKHH 2WWKT 3HB3C 4P3DB 5GS0C 2B0SH 4EKXA 1UH2A 2XKSA 1W0YT 5A2LH 4W6WB 5IW6B 2P47B 5SX4I 1WIUA 2VOTA 2KDGA 1VA9A 5GIRB 3HG1E 1YJDL 2XTLA 2RJMA 3RNKB 4BZ1H 1BVZA 4UIMB 1KNOB 1HXYB 2F5BH 2J8HA 2R4RH 2WWKO 5T3XD 4PRID 1MHHA 3HHRB 4LNVA 2FWOA 1HXMA 2ICES 4OZIA 4YFDB 3U0TB 1HQ4B 5GS1C 4MD0A 4OCLC 1ETZB 5D7IB 4TYUA 2LV4A 3NPZB 5LBSL 1CFNA 1PKQE 3MA9L 1BZQK 1OCWH 4EI6B 3KLAA 1MRDH 3E6HA 2WQ8A 4Y5YC 4KWUA 3I75B 5DS8B 1F5WA 4JO4H 1VGEH 4XP1H 1UQSA 3WEXA 1DN0A 1JPSH 2K9UA 4FN0A 3VRIA 1NQBA 3VJ6A 2ZOLA 5KVDL 5E99H 1NGZB 2SEBB 5JIIA 2NR6C 2OQJA 4XHJC 3B83A 1N0LA 1U95A 4FRWA 8FABA 2X6MA 1NCDL 1TPXC 2R2BB 1AY1H 4N8CH 3BGFB 4I0PA 3F7VA 4OFKA 3L5IA 5LVEA 1FFNA 1OAYH 4XXCC 2EEBA 3QEQA 1DR9A 1MH5A 1OSPL 4PB0H 1MLBB 3FO0H 1BREA 4M62L 4H25B 4LLWB 2EH8H 2MKLC 1F3DJ 5KVFH 1NUGA 1NFIA 1D5MA 2H6PA 4Y8AA 1OGAE 1ND0B 2R69L 3W2DL 1MRFH 1H5BC 5ICXB 4NZTH 1FDLH 4F9LA 4MB4A 4UV7H 3P3YA 5LGJB 4JY5L 1MCJA 5JHLH 1EAJA 1DQLL 2IALA 3I3BA 3MBXL 1RZJC 5FUCE 5IF0B 1DVFC 5CZKA 4BYHA 4YDKH 4PY7B 2XNAA 3K4AA 4NUGH 1LP9F 1MFNA 5FF6B 4R2GC 4RQQA 1NFDF 1YEHH 3BEVA 5DJ6B 4XBGA 1A6PA 5MHSD 2XZZA 1RUQL 1M6OB 2AV1A 4KJYB 4KU1A 5ETUA 1C5DA 2YUWA 4HH9A 2HJFA 1P84K 2D7TL 1S9VB 4AYFA 5BQ7A 1KPUB 1C12A 5I18H 5C0GA 3H9HA 2VLME 3V8OA 3NFSH 4TSAL 1K3ZA 2X1WL 3VXTB 3MOAH 3RDTB 5EOCL 4FQ1L 4FFWC 3SE3C 3KDMA 3ILQC 3MRIB 3M1BB 3E8UL 4ZTOH 3GJFA 3FFCB 4P23A 2Z4QB 1KPRB 5E4EB 4MWFB 3C5ZB 4NNPL 3FB8A 3IDGA 1BLNB 1BFVH 2B5IC 2GEEA 2JJVA 4JGUA 4JM2F 3CSGA 3BIAX 5AEAA 4AEHL 4KK5C 2GHWB 5ALCH 2W1NA 1EGJH 5GQBA 4XC3H 1J0JA 1WV7T 1YUHB 2L7UA 5DGQA 1U3JA 3MNZA 5HYSA 3HG1B 1WT5A 1U42A 2IF7A 2FIKB 3V0VB 1BHGA 1I9JL 5L2KE 1SJHA 2A73B 2IPUG 4LSPH 3VGBA 2P44B 5JPNB 4EUPG 1L7IH 2VDRL 3GDBA 3SO3B 5FO9A 2IQAA 1KJVA 1D5ZB 4JM2C 2DQIH 5C09D 4Z77B 3LV3B 4N9OB 4V2BA 3BOVA 2VC2H 3MNWB 5CSGA 1MQKL 1D3CA 1QFUH 3BRDA 1OAZL 2XKNB 2O5XH 1IC4H 2R2CA 2VAAB 3KYKL 4XI5D 2N4IA 5GPRA 2FATL 2AJYH 1IT9L 2FWOB 1AC6A 4M43H 3THML 2DN7A 1PEWA 5ESVB 1WBYA 3HFML 2R1WA 2EYRA 3ET9F 3SDXA 1EXUA 1G9MC 2A1WH 3CU1A 3MMEB 4QHMB 4XMLL 5F9JA 1ZLSL 4YDJB 3DETC 1UVQA 4XNMA 3TH2T 3MV9B 3P77A 3GSUB 4J23A 2NYYC 2O61A 3CVHA 4L4VD 4H8WL 1DBJH 5HHQA 5IKCB 2JCCE 2ERJC 5C0AB 2B0SL 2H26B 4ZO8A 4F7PA 2NW2B 3LY6A 1ZAGA 5EH1A 2YA0A 5ITFA 3EOTL 2GAZB 1FORH 2Q76A 3VRJB 2V9QA 1T83C 3IRZA 4TULH 2NY4B 3CPLA 4KRPB 5MENB 4MSWB 1R0AH 3P4MA 4MJ5B 2WK2A 2EDFA 4YJZL 1JZ7A 5DZOA 2QQLH 2FO1A 3S3JA 4RQQB 4KTDH 4NM4H 2BC4A 2PW2A 3KJ6H 5J11C 4ZPVA 3LD8B 2LAGB 1JYVA 4GT7A 3O3DA 4UNVA 5CEZL 5F7UA 3V4PH 1MJ7L 4LLQA 3MCKA 5DD3L 1ZT7A 3UO1H 1JBJA 2ZUXA 3AS3A 3V79C 5D7IF 2O5YH 4UINL 1J18A 3ISWA 4S1QH 1LK2B 1LD9B 5DLMH 1CXEA 4IOIB 5IQ7H 2GTZB 4KK5D 3DARA 4IDLA 3RNQA 5F9OL 3BQUD 5IT2H 3IKCA 3X3FL 2IBGA 3QA3A 4MJ5A 5IROC 3TYGL 4Y4HD 3VXME 5I8KH 3LN4B 3REWA 4PJ9C 3HZKB 1V7MH 1BVKA 2LU3A 2A83A 1NCCL 4ZDHA 5C0IA 5B38A 2FX9H 2WUBH 3OKKB 2SEBA 5TPWL 3STZA 3PG2A 2VH5L 1EFQA 1LO0L 2XRAL 3WNLA 4XBPA 4QWWC 3KPLA 2X40A 3F6LA 1EV2E 5KVMC 4OTXL 4XNXL 1JWUB 2JE8A 2P8LA 3IB4A 5I71C 3T3MF 5D4QA 3HPLB 1KXQE 1INDH 1B0WA 1BIHA 2R0KH 3T0BA 3WSQL 1G7MA 1LEGB 4QHUB 2PW1A 4DQOL 4DZ8B 4P5TA 2HP4A 4M6NH 1ULVA 4N5ED 2VLJB 3STLB 1OAKH 4LLUA 3PGCB 5JOEA 2VDNH 4GBXD 4YPGB 4K07A 2BCKA 4LP5A 4DTGH 3MRGA 1DQQA 2B4CL 1S7RB 2EDQA 2MHAA 1FFPA 3HTLX 2A6JB 5A2KH 4XAWL 5E2UH 3WL9A 2GYSA 3D69B 4J4PA 3B5HA 4GXVL 1RIHH 3GHEH 4WUUD 4U6XA 1I85C 5IV2B 2A0LD 5I76B 2DLEA 4JPVH 4ODSL 1JVKA 1MCRA 3WIIH 2F5AH 2LABA 3HNTH 1HWGB 2A38A 4V2CB 2Q87A 5ERWB 3KYOB 1F6AB 3MFFB 4MMZC 5IROA 4IBLT 2EZ0C 2Y5EA 3VXRD 1JPGA 1FO0B 5HGBB 4GW5B 4JY6A 4L9LB 4PREA 3ILPB 5GS2H 1NC4D 1H3PL 1FLTX 4PJEA 4MXVF 4XWGL 1S7VB 1KEGH 3MACH 4M1GL 1NCUA 3S3SA 4HDIA 4XVUD 4LDLB 4GRLD 1PZ5A 4NC0B 3SDYH 3BP6B 3AXLB 3VXNA 1BAFL 1FAIL 1LO2L 4TTDC 5DA0B 5EG6C 3MNVB 5HI5C 1KJ2L 1YZZA 5TH2A 4U1SA 4P5KB 3RAJL 5C9JA 2BDNL 4PJAE 5FCUL 3DHMA 2P5WA 1XR8A 1F2QA 4GOSA 4NKMA 5C08E 4IMKA 2VB5A 3DX6A 4KJQD 3REVB 2G5BA 2DLTA 4HLZH 1TVBA 1AGCB 5KSVA 3KYNA 2M26A 3NCJL 5HYSG 4JZNB 3D48R 4WW2B 5C9KA 3HRPA 2WBKA 4K23H 3KNBA 4D8PB 5I66A 4XP5H 4FTVE 1K8DB 5T1LD 1H3GA 2FNBA 3OGCB 3GMRB 4DVBA 1DLHB 4EXKA 1WUNT 4PJCE 5MENE 3C5ZA 3CFEA 3QISA 4TUJA 4XNUH 4YXLH 4U3XA 4PYHA 5J1AB 4IDJH 5EO9B 3FO1A 3I02A 1S9YA 1IEBB 1U6AH 1KJ3H 5F6IB 4HCRA 1LILA 3CFBB 4N5EC 3QO0A 4CDHA 1WK0A 1UEMA 1KENH 3FONA 3PP3K 4YAQB 4JO3L 1HSAA 5T5NG 2OMBA 3GIVA 3H9HB 2VDKL 1RJCA 2YRPA 5J0BA 2YZ1A 4HKJA 2AJYL 5ISZB 5E8OA 5D2NA 3UXFA 2X4NB 2XQBH 3NA4A 4F7MA 3PDOA 4DOHB 2EDOA 2VXVL 1MRFL 3OR7A 1ZVSB 3GRWL 4Q9RL 4IRJC 1BX2B 1DN2A 1B2WL 3OAUH 2W65B 2DQGH 3I6GA 3IFOA 3M8OL 3NZHL 1ZHLA 5ABDE 2NY3D 1MPAH 3ROLB 4XVSL 2ICCA 4OGXH 4U3HA 4ORGA 1RJLB 2Y6SC 1RUAL 2OM5A 1GXEA 1CGTA 2E7HA 3O2VH 4YBQD 4LLMA 5T1KA 3L3GA 2A6KB 1GVIA 3LHPL 3FTGB 4G7YL 4LSRH 4XI5C 2OZ4A 5IUSA 4ODUA 3K2MC 4PRPB 1C5DB 1KEMH 3KXFE 5HPOA 1NSNH 1Y0LB 2ARJA 2BNRD 3VD3A 4ACPA 4M9OA 4Z7VE 3IDXL 2RFXA 2DS4A 4FXGB 3BYTA 2ADFH 4F80A 4TTDD 1T0NA 1MWAL 2C1OA 1BF8A 3MV8E 1T1WA 1FFNB 3MRMB 2H8PA 4XMKL 2VE6A 5JHDE 3RX8A 5D7IA 5CKGA 4Z7QE 5DHVA 2VZUA 3HS0A 4OGYL 2Z4QA 5HHXL 2OZ4H 3PQYA 4L3CB 1F4XL 4AM0A 1I8MA 1B90A 2AW2A 4PGDA 3TWCH 3WFEH 5F89A 2VN7A 1VACA 1BFVL 4XB8A 3I6KB 3RNKA 5BMFL 1S7QA 4P2QB 3D3VE 5CZVH 2VSCA 2AJXL 4P4KB 3KPNA 3QNYA 2CKBL 3EYQC 4I3RL 1HILB 4QHNB 4I3GA 2XWBB 3A67H 2VLKA 1CU4H 4MB3A 3B2VH 3O2DH 4U1HA 1UGNA 1RHFA 4DN3L 4LLYB 3ULVH 1K9TA 4PJIB 4LIQE 4I18B 2ZOLB 1CXLA 4B0MM 1I3GL 2B8OT 4APQC 4Z7OF 1EO5A 1WFNA 2AXFA 1IKFH 3OG6B 5IIEB 5HHNB 4WFHE 3BD4A 5EU4B 5ISZD 2L0DA 1M7IB 2BVPA 1VFBB 4NHCL 4J8RB 2XN9E 3P73B 3VXOB 2HJKA 2FECI 4HIHA 1Y6NR 2FX8H 4HZLB 1BBDH 1RV6X 4DGVH 4U31A 3WHE1 5E5UB 3UROR 3DX6B 5BS0A 4AIZB 2GT9A 5CFHA 1IAMA 3H42H 1OSPH 1INEH 3CSPA 1GZQB 3ARRA 1I1AB 2D4FA 3CVIH 5HY9A 3DMMA 4ZG1A 5IMLB 1WWWX 3RP1A 3H3PL 1G7MB 4MNQA 3EYUL 3E3QE 4U1JB 1R5VA 1CS6A 4PJDE 4U0RC 4PJXE 2WBJD 4H8WH 4G8FB 2V5TA 3T65A 4XCNA 2HFFB 3S5LG 1FZJA 4Z9KB 1JNLH 4YDLB 3OKLB 5BVPH 2DLIA 1QLRB 2IQ9L 2MQ0A 2B1AH 1EEZA 5DK2B 3IDMB 4Y5YA