5KAQF

Crystal structure of broadly neutralizing influenza a antibody 31.a.83 in complex with hemagglutinin hong kong 1968.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
233
structure length
232
Chain Sequence
VQLLESGGGLVQPGESLRVSCAASGFTFRDSALSWVRQAPGKGLEWVSAISGNGGATYYADTVKGRFTISRDNSQTTLYLQMNSLRADDTATYYCAKDESPPIYNLMPGYYSTYYYMDVWGKGTTVTVSSSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Vaccine-Induced Antibodies that Neutralize Group 1 and Group 2 Influenza A Viruses.
pubmed doi rcsb
source organism Influenza a virus (a/hong kong/1-4-ma21-1/1968(h3n2))
molecule tags Immune system
total genus 38
structure length 232
sequence length 233
chains with identical sequence H, Q
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kaqF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kaqF02
1C1EH 1WWBX 3AB0C 3K3QA 2YPLB 4YAQA 3MNWB 1J1XH 1EO7A 5I30L 5J12B 5TH2B 3FQWA 5IMLA 4PP2A 3T2NH 4JO2H 1XCTB 3MRGB 4HJJL 5CP3A 3MNZA 4HUXA 4I0PA 3RKDD 2A77L 1KLFA 2Z93A 2OJZH 3KLAB 4OKDA 4QRTB 3NFSL 3O6KH 4FABH 1UT9A 3SGEI 2ZUSA 4LVNC 1U9KA 4U0QB 4EN3B 2PYED 3OX8A 1AGBB 4O5LH 3IDXH 2HT3D 2GK0A 4MJID 3X3GH 4PJFB 1KB9K 4FFWC 3T8XB 3GMRA 3I84A 1EMTL 4U2YA 1WZMA 2FL5B 3GRWH 1T0MA 1HI6B 3UEZA 3ZE0E 1EEUA 1NCCL 4QRPA 1B90A 1A6AB 3IJYA 2G5BA 1QNZH 2EDLA 5J1SC 2EXWD 1TITA 4JRXE 2PYFA 2XTJC 4HXAL 1W8OA 3PWVB 3C5SA 2GUOB 3UJJH 4X4ME 5D72H 4BH8A 4GRLA 1D6VL 2AXFB 3V5KA 1XR8B 5D2NE 4L8SA 4AH2A 1YQ2A 5D96B 3TO4B 5BJTB 1LO4H 4QHUB 3UTTD 2AJUH 1J8HA 1Q9WB 2J5LB 3U48A 3MV01 1UH2A 1OB1A 3M17B 3O3AA 4HHAA 5DVMA 5TPWL 3WNOA 2CIKB 5D1ZC 4S1SH 2EECA 3G08A 1EK3A 3TBWB 2Y23A 4ZFOB 3WIIL 3MRPA 4KKBD 1U8JB 3TGXA 5IK3A 4ODVH 3T0WA 2X70A 3CX2A 3RIFK 4V2CB 5EU6D 2ZNXA 4G6JL 5GSVA 3FB5A 4JRWA 4GUPB 1KIRB 2P8MA 3U30B 3CZFA 1OTSC 3OSKA 3IFNH 3MRNA 3ZKMC 4MLIA 2HMID 3MLWH 4MJIA 3PGFH 4JANB 2AEWA 3QDJA 4JPVL 3VGEA 1JNNL 1TCMA 5JIPA 4JHAL 1RU9L 4X6BB 3G6AB 4B0MM 4OGYL 3LEYH 3LB6D 4DK3A 5FB8A 5GS0D 1HQ4A 1VADB 1KJ2A 1UB5A 2OJEB 3KJ6H 4JZNB 4G9FD 2RIKA 1QEWA 1YUHA 4XPTL 4Z7WF 1ZANL 2Q76A 3QIWD 4M1GL 1MAMH 4ORGB 4YWGL 3WN5B 3MJ8B 1GL4B 2VH5L 3CUPA 1F4WH 5DGQA 4JN2B 3STLB 1KGCE 2XWBB 1A7NH 5ITFB 3S35H 3RVWD 4CRPA 5EOTA 1R24A 5I1HH 3FFCD 1FRGL 3V5HA 1PW3A 3VGGA 1WVZA 8FABB 3VGAB 2VLRE 1F6LL 5FK9B 1G7MB 1FJ1A 4HMCA 4U1SA 4MJ5A 5C08E 3MCKA 3IJSB 7FABL 4F7PA 1OAUL 2IAMC 4WCYL 3RHWF 5KSVA 1JWUB 4PJ9C 3LHPH 5AZEH 4OFIA 3K8MA 2JELL 3K4DA 1F00I 4NJAL 2EYRA 4FFYH 1FVCA 5IB2A 1H5BC 1RK0B 1RK1B 3ARDC 5F9OH 1UACL 3TN0A 4MD0B 1ZOXA 1JF1A 3QHZH 3JWDH 1ZHKA 3PWPB 3Q1SH 5JXAL 1Z0NA 3SKMA 2M2DA 2BNQA 8CGTA 2FNBA 2I07B 3QDGE 1U8LA 3W9EA 1CK0H 3QDAA 3RUGA 2EDJA 3H3BC 1EEYA 3ZYZA 1NCWH 5EC2A 1HKFA 1IEAA 4YXLH 2CMRL 3PL6D 2GFBB 2V5SA 3L5HA 3OAYH 2F58H 1Z3GH 4CJ0A 4LSSH 3IFPA 4XP1L 3WHE0 2YWZA 2W60B 3MRIA 4X80H 1R3IH 1UJ3C 5JW5A 5CBAA 3CVHB 4P0DA 2CKBH 4UIKL 1NCAL 4Z77A 2NXZD 1U8IB 2AV1A 2JB5L 3AVEA 2IEPA 3FRPG 3TT1H 2A6KB 1ZGLM 5CEYA 5DD0H 3QZWA 4XNXH 5FUCE 3A6CH 5SWSB 3TESA 4OLWH 1HH9A 3LDBB 5FKAA 2DQIH 1AIFA 4JFFA 5KOVC 2Z31D 4WUKL 5EZIL 3OGCA 2R69L 4PG2C 4DAGH 2SEBA 1T1ZB 2ICWJ 5J13C 4XBEH 4LCYB 3DETC 4N5EC 5BMFL 3OKLB 4PRPE 4TQEL 3UBXB 4RAUB 4HJ0D 4TOYH 1BBJB 3QEQE 3BEWB 1HDMA 1CXFA 1GIGL 4JN1L 3BDYH 3MFFB 1AO7B 3GMNA 2FB4L 1NMCB 3QEGH 2WBWB 4PGCA 1T20B 5D9SB 2EIBA 5EA0L 4R0LC 4JDVA 4QOKD 1S8DA 2VZUA 3IJHA 5TQ0L 4UBDC 3RWGA 1BZ7A 1D5XB 2APXA 3REWB 4OLEA 4JM4L 3KPOA 3R0MA 2OYPA 4H1LH 4Z7WE 4M48H 1M4KA 3IDMB 3K4AA 3T65A 3TVMD 2BVPB 4WWKC 1SYVB 2CSPA 1KB5A 2QQKL 1M7DA 1ZSDA 3HG1D 1UZ8B 3RJQB 4HKBA 3DO3A 1DEDA 1JHKH 4PJ7A 1BFOA 4R4NC 4C54A 5KVMC 5ICYA 4JG0H 1CBVL 5K9OA 3RWIB 1AXSB 4MNQA 3WJLA 4KDTA 1KEMH 4YO0A 5SX4H 3D1MC 1LE9B 5FYLL 4XWOC 4GXVL 2ZCLH 3P0YL 4NDMA 3T2PA 4Y1AD 4I0CC 3T0ED 1H15B 2QSQA 3O45A 5J1AB 4E5XA 2ENYA 5FYJU 5AAMA 2V2TA 4RRPG 3MRCA 3BW9A 5T1MA 1NUNB 2X4RB 5TE7H 4GBXD 5J11B 3P0GB 5DD6B 1YY8A 4PLJC 4G6MH 4MVBC 1MVFA 3BXNB 3P4MA 3QWRA 1GSMA 4QRRA 4NIKB 3GSWB 5EPMA 4Y5XC 3TBSB 5EORL 4XX1E 4LKCB 4NQED 2C4FT 4PGBB 3BP5B 4WW2F 5KAQG 5CWSB 2UY7A 5FA3B 4J3WA 5I1LB 3D85A 3JUYA 4BK5A 4Y2DC 1QFWM 2DQUH 3BKYL 2F15A 4D8PB 3DVNB 4OCYL 3FZUC 1BVKA 3L3KA 4JJ5B 3TVMA 2YD3A 3ZDZF 2WNGA 5JLZA 2NZ9D 5HI3D 1XGUB 2DMCA 4OLVH 5BS0A 1UXSB 5JO5B 3LN4A 2VL5A 2OP4L 5IJKA 4LSVL 1ZWIA 1CFTA 3UP1A 1KB5L 2QADC 1CWVA 2MKLC 3K46A 1N64H 5I1EH 3U36B 3HFML 1S5HB 2BHYA 3AU1B 2Q8AL 3CK0H 2ICWB 1BEYL 4JGJA 1NC4D 3V0VA 3U0TA 4Y1AA 1I1YB 4PRAB 4JFZH 3O2DA 2R1YA 3ROLA 1OAQL 3RWHA 3N9GH 1YC7A 3GBMH 3SDCA 4N0FB 3GSNH 4HJGB 3S6CA 3D48R 1L7IH 4GBXA 5J0BA 4L29A 4AM0A 4Z0BL 3TH3T 4MHHI 4DGYH 3LKSB 1H3UA 4NQVB 5F71A 5F7FA 2GTZB 5DEZA 3RIAF 5BOPA 3W0WD 3JTTA 5GRVK 4LSQH 3VXUB 2DBJA 5C0FA 4KKLD 2DQEL 1FBIL 2Q3AA 1A2YA 2R56L 3MCLL 4UMGA 1INQA 2FZ3B 5JR1L 5D6DA 5DRNB 1A7BA 4CVUA 3ESUF 3HR6A 3E1F1 4IHOB 2CKNA 5HYSA 5FYJH 1RIUL 1CGXA 4PTUA 2F19H 4EIZC 2IJ0C 3WFDL 1X4XA 2XWTB 4L4VB 4KTYA 1UEMA 4FN0A 2UV3A 3TBTA 5EU4B 3U6RA 3HE7D 1T6WA 4PJCF 3GBNL 3ZE1F 1CGUA 4K3DH 2NCMA 1Q94A 1KTDB 4XNZB 5EO9A 1RZIA 2XTJD 2VLLA 3LKRA 2P8PB 2IQAA 1U58A 3S36X 3W2DL 3HC0A 2HG5B 3QH3A 4MA8H 1MCRA 3OKYA 5DJ0B 1DBKH 3WYRA 2P46B 4MS8C 4NKOB 5ACMA 1NBYB 1DFBH 5JHDD 2BVOA 5D71H 5CD5D 3MV9B 5E8OB 1FLRL 2XZCL 3G6JB 3Q6GL 3IFLH 3P11L 2B2XH 1CDCA 5D1ZD 5AG9A 2IBZY 2YN3A 3VH8A 1FZOB 3W0WA 2A83A 4TYUA 3QUXB 1YEKL 4KMTL 4NFDA 3VG0H 4PJ8B 4UV7L 1BQLH 3L5WA 1GGBL 1TDQA 4MAYB 2YUVA 3I6LD 4L4TE 3DBXA 5FGBC 3ZDZE 2VLKD 5F93C 1MHEB 4ZQKB 1UB6A 1INEH 2E7LC 3W39A 2JJWA 1JI2A 4PRHD 2EKJA 5LWYH 2RCSL 2OK0L 1OTSD 1R5WB 4LOUD 4DW2L 4JFPB 3OKEB 1ORSA 3NIGF 4JRYD 5E0QA 3ZKMD 3KYOB 5JZ7C 3PDDA 4XP4L 3I6KA 1KT2A 2WBJA 2EH7L 5CHNB 2XT1B 3GK8L 1MHPH 3OZ9L 4L5FH 2W9EL 1CLOL 3MOQA 2R9HC 4FZEH 1HKLL 4HPOL 2YK1L 4O00A 4S2SB 2HT4C 4ODBD 2VIRA 1YEHH 1AQKH 4K7PL 1KIPB 1LDSA 4EXPX 3DVFA 5GRYA 1ZLWH 5IP4A 3GJFA 1O0VA 4K9EL 4NP4L 3CX5K 2AS5M 2BSRB 1L0QA 2HFEA 4I8DA 5T3XH 3VFPB 4JR9L 1J0KA 2LQRA 5E5UB 3SDAC 3ULVH 2F5BL 3QZWG 3O6ML 1ZVSB 3EO1A 4BFGA 3JWDC 4C83A 3C5JA 1F6AB 1OAKH 4P2QB 1XZ0B 2GQHA 3KS0H 4O02L 3ZKND 3RWJA 1E6OH 1FYTE 4HWEH 3NN8B 3D18A 1XIWD 2IAMD 1N7MH 1B9ZA 4IS6A 4PJ9D 1TTGA 2Q86A 4PRHA 3G5ZB 1NUFA 2R4RH 2R0KH 4Y0GA 4ZODA 4MCZB 3PNWA 1ADQH 4JRYA 4U1NA 4PJCE 2BDNL 2OBGA 3ZE1E 1OAXL 4LASH 1YEDB 3BJ91 5E9DE 1KJMA 2CLRA 2AJYL 3NZHH 5DHYA 2K1MA 2BHZA 1FAIH 4MD5A 3OTTA 4Q6IA 5C0IA 3GIZH 3RVXC 3B43A 3OJ2C 5T1KA 1KG0A 4GRWH 4DGIL 1W72H 1R5IA 3ECBA 1KC5L 2R0ZH 1K3ZA 5DFWH 4UOW0 2XZZA 4LSTH 3O6LH 5E70A 4G8IA 1KEGL 4K2UH 1QOKA 1Q0XL 3V95A 1RZ8B 2PO6B 2BY3A 5EWIH 4NN7B 4XXDA 3X14A 5IEKB 5F7DA 3PDGA 4QXTB 1HWGB 1UG9A 3IDJB 1YEIH 1MNUL 1GPOL 4HS8L 4L3EE 5D7JC 3QBTB 4N1EA 2X4TB 3RPIB 2ZOLA 1JNJA 4M7JH 5B4MC 2FBJL 4I9WE 1IQDB 4I5BA 3KDMB 3RWCB 2P49B 2YMXH 3KYAA 4P59L 5L88H 2DM3A 1E4JA 2P5WE 5I15H 5T1LD 3PWLA 2PETA 3DMMA 3U82B 3BD5A 3QUYA 2FRGP 2IAMA 3DETD 4N5ED 3U9UA 4DK6A 1DR9A 4MB3A 1A7PH 3NIGE 4MB5A 2ARWA 1FO0H 3ARBC 4TVPH 5JPMB 3HZKB 5MEPA 5FCUL 1C5DA 1BIIB 1OARL 5CIPA 3ARDA 1LP9A 4PGEA 5L2KA 3FOMB 5IVZB 1NGYA 4LEOB 2EDQA 2VDNH 2E3VA 4LP4A 1ZA3A 1KCVH 3ARGA 2XXMB 4PJDA 3CDYA 1JGUH 3W9DA 1LO0H 4UBDD 4R4BA 1S9WB 1UM4L 4RGMC 5I17B 2ZUUA 3AS1A 1IGCL 3WHXA 4F57L 5CMAA 1CE6B 2AQ2A 1EGJL 5FYKD 1EJOL 2W0FA 2PYEE 3REVB 4LLDA 5DJCB 1T03H 4ODSH 3VXOB 1EDQA 2FLBT 5SWZB 3A67H 2XZQL 4MAUL 2VABA 2J8UA 1CGSL 2GITA 4XGZA 5EBWB 3BN9D 2DQTL 4R4ND 4M8QA 4ZTOH 1N5AB 1PLGH 1WCBB 3BZFA 1U8NA 2R1XA 5FM8A 1B88A 1IEBB 2VDOH 5DQ9A 1KOAA 4DEPC 4XWOD 2VO5A 3HRZA 3QAZC 2E9BA 4G5ZL 4Y5YB 2NX5A 2PW2A 3NPZB 3VXMA 3I6GA 1J88A 1DCLA 5AYUL 1A7OL 3SO3B 2NR6C 4ODUA 4WDIA 3UTTE 1RUMH 3TH2T 5DK0B 2EDDA 4QTIH 3O6FB 3UYRH 4PLJD 4X4XB 3JV5A 4MVBD 1PAMA 3QIBA 3FKUS 1RUKH 5KSUA 1H9VA 5H37H 5TDNB 4NM8L 5H35B 1K4DB 2YD7A 3O81A 4JKMA 1QBAA 2BJML 1TZHB 4LGRB 1LEGB 1QLRA 3NCYS 1QTYT 1S5IL 3HZMA 1JPGA 5HYSG 3BX7C 4GMTH 5SV3A 4Y2DD 5EU6E 4JHZA 1S7XA 5KS9A 4JFXA 4N1CA 1DQDH 1ETZB 1NAMB 3MUGB 3FZUD 4Z78B 1JPTH 1OTUC 3CPLA 3WIHA 2YN5A 4WWKA 3FQTA 2AI0H 3SJVA 4JGUA 4I13B 5L2JB 4XI5C 3E3QE 3LV3B 3QUZD 1YEGL 3UTSD 3PWUA 5FEBA 1R0AH 3VFTA 3LH2L 3QI9C 2BX5A 1DEEA 5JA8B 5IF0B 2QADD 2Y5EA 1A14H 5J56B 2MCPH 15C8H 4NKIL 4AMKH 2X4SA 2CRMA 5C07D 4J6RL 2IANB 1KV3A 3QB7C 1U6AH 3X13B 4NZDA 2ITDA 5GSRA 3MXWH 5IFHH 5MP6H 3VD3A 3O9WB 4G9FE 2X4OA 4TTDC 3R06A 3QWOB 1YNLH 1YEJH 2Q3ZA 1XH3A 1BJ8A 4DWHA 1SJHB 4U1HA 5IBLD 3ROOA 4RWYL 3RWFB 3VH8G 5I1KL 5I19L 3VWKA 1VERA 3BQUC 4Q2ZB 3R8BB 4G8GA 3FFCE 2ZNWA 3OXSB 5BV7B 4WENB 5CSZA 3LN5A 4MJ6B 3HS0B 1NDMA 2ED8A 2AK1L 1ZV5A 1CU4L 2DLFL 3C60A 4N68A 5GJSL 5TF1L 1G7LA 5TE4L 1A6VH 5IMKA 5INDA 2FD6H 3QO1A 5F9AC 5IQ7L 4K94H 3IDIA 3VFSA 4JFEB 2LAGB 2EDTA 1MCEA 2XYCA 4MCYB 3GM0A 1IC7H 4GAJL 3WIHL 3VFWB 5BW7C 3QXDB 4HIJA 1HHIA 1XGRB 2HJKA 1NAKL 2EYSA 1DBJL 2V7HB 1MCOL 2ZWLT 5JQHC 4M93B 3VXSA 3HI6H 4P9ML 5LG1A 5A2IH 2A6DA 2UZIH 4OZ4A 3RZCA 1IAIL 2Y06L 4MDIA 3TF7C 1KCSL 4K7FA 2CK2A 1Y18A 4KZEL 5L0QC 4M9OA 1DVFB 1VFBB 1LK3H 3S96B 2VQTA 3D3VD 5ICXB 1JZ7A 5T33H 4JM2B 2JTDA 2O5YL 1J1PL 1A6UH 1PYWA 4HZLA 1RMFL 2YPVH 4YHIA 5F9WC 1NSNH 3IDYC 1TQCC 1CFVH 2XWJA 1G9ML 4DN4L 5J57B 4E42B 5F70A 2ZJSH 5TFSH 3IAGC 3B83A 4U3CA 1LDPL 1EIBA 1X7QA 3MJ7A 3VG9B 2X6MA 1FLTX 5D7LA 5SWQB 5C6TL 4X9HA 1MJJB 3H7BA 1KJVB 3V4VH 1HSAB 3D87B 3V7AG 1KPRB 1X5JA 4XBGA 1KXTB 3FT4A 4PS4L 3BIAX 1BX2B 4V1DD 2FH8A 4JY4B 1L7TH 3AUVA 1I9IL 5D5MB 5D70L 4KKCC 3QEUA 3B9AA 3CDGA 4WGWB 3SE8L 2H1PH 4X98A 2EC8A 4AIZA 3O0RH 3BWAB 1TENA 2DQGL 2O93L 2P8LA 4HKZB 3CVIL 1JGVL 5HYJA 3ULVC 5JZ7D 4ESKA 3MLSH 3WFCL 4JPWL 5D7KD 2UVFA 1I8LA 4QOKE 2UZXB 5E99L 1OSPL 2VXUL 5LBSH 4KC3B 4ODHL 1FG2A 2CGRH 1JGEA 1HEZB 5JORA 2R9HD 3TBYB 2IFFL 2EXYC 2HT4D 3VRLF 3KYMA 2HTKC 5F9JA 1D5IL 3D0LB 2B0SH 5D1QC 3HG1E 3MNVB 1HIMH 4HDIB 2DLGA 5DMYA 3MA9H 4H25B 2YD9A 4NHUA 3OAYK 4PBVC 4NWUH 5C0AD 2F8XC 5I1GL 3MRFA 4FTVB 5FM4A 3VE0A 3SDAD 3QHFL 1A4KB 4QXGL 3OKNB 5C7XL 3QQ4A 5BQ7A 43CAA 2A9NL 5HI5C 4F58L 4RDQF 4QRQA 5I75B 5IT2L 4X9GA 3ARVA 3SY0B 2Z35A 4LBEA 4O2EA 4YC2C 2DB8A 4YAQB 1U42A 4K3EH 4KVCL 5GHWL 1J0YA 5CJBA 1CLZL 1QBML 5DD5L 3FQWB 4ZNEA 1FGVH 4PP2B 2HN7B 4LSPH 2X09A 4IOIB 4RMSA 1MRDH 4WJ5A 3MNZB 4HUXB 3EFFA 2Z93B 1YA5A 2I24N 4OT1L 4NQEE 1RULH 4QTHA 5GGQL 3DARA 2BXZA 2C3HA 4GKSA 4L8DA 4PB9H 3KYKL 3OX8B 4NZRL 3RDTD 4F8QA 3MSPA 2C1OA 3RVXD 1EHLH 2XG5A 4OZFA 1E4XH 1T0MB 5IVXA 3C6LC 4P49A 2H9GA 4QRPB 5DWUH 5JHLL 3IJYB 1T0NB 1DQJA 2G5BB 1F4AA 5D93C 1KNOA 2PYFB 1JHLH 4HGKC 4MX7B 1G9NL 3ES6B 5DMIH 5D7IA 3C5SB 3MRJA 1QFWI 3I75A 3BUYA 1MVUB 2QV2A 4GRLB 4BH8B 1Y6KR 2P5EE 5FGRA 1NMAL 4OD1H 3V5KB 3E2HC 3S34L 2CPCA 5I8KH 4HWBH 4L8SB 1RSFA 4XMKL 5M7QA 2ITCA 5LKNA 1NGPH 3U7YL 1J8HB 1F11A 4OSUH 1OB1B 3O3AB 4HHAB 3FCTA 4O58L 4YE4H 5D7JD 3L3GA 4ONHA 1A47A 1YN6A 4IMKA 12E8H 5B4MD 1AD9A 4NZUH 3G08B 1UWEH 3ZL4L 5ISZD 3D39D 1A02N 5IK3B 4F37K 2X70B 1S7WA 4W4OA 1NH6A 2KPNA 5L6YL 3MLYL 3V4PL 1GOHA 3ARBD 2ZPKH 4IRSC 3FB5B 2CRIA 1J0JA 4ZUUA 4ELMF 4HQQL 2P8MB 3WJJC 3U4EA 2E27L 2DWDA 3CZFB 1HE7A 2LV4A 3Q5TA 1C08A 1EO5A 3ZHDA 5ID1B 2QQNL 3VRLE 1I7RA 3DIFA 4HS6A 4MNGA 1P2CA 1SY6H 4MJIB 2DJ4A 4HPYH 3QDJB 3WKML 3OKKA 4YPJA 4LCUA 1RUAL 4KZDL 2NY7L 4PY7A 4DKEL 2APFA 4N0YL 3LQMA 1KYOJ 1IGFL 4XP5H 5IWLC 2AQ3A 2EC9T 2XY2A 5GJTH 1HQ4B 3NACH 5I71C 3GSRA 1UB5B 4CMHB 4JFDD 4P5TC 3VW3L 1YUHB 1BGXL 1QHPA 2Q76B 5F1SA 5C6PB 3RWDA 4K3JH 4CU6A 3NABH 3CUPB 3BH9A 3P9MA 1MPAL 5ANME 1EO8H 4NHCL 4CADB 2DRUA 4APQC 2I60L 4NKDB 1W2KT 3GSVA 1FDLL 2Y72A 3G6DH 5EOTB 3L7FA 1JYVA 3V5HB 1N0XH 5DC0A 5JHDE 3FFDB 1MFDH 4KPHH 1FJ1B 4YDLC 2NR6D 1HN1A 4P2RD 4U1SB 5D4QA 4MJ5B 1UA6L 3MCKB 4RIRA 4F7PB 5CZVH 5KSVB 5CBEA 3MMEA 5EFIB 3GHEL 2EYRB 4P3DA 4KTEH 4EUPA 1C5BH 1Z5LA 1CD0A 1FVCB 4X5WA 3I6LE 1JGLL 4YHLH 3TN0B 5IB3B 1P84J 2B5IC 1JF1B 2VLKE 1G7HA 1X44A 3SKMB 4D0CA 2BNQB 1TCRA 2DM7A 3SBWA 1OTUD 1U8LB 4ETYA 5B3NA 3LS4L 1NLBL 1I8KA 3RUGB 2XA8H 5K9QI 1EEYB 3BYTA 4XX1G 4XI5D 2OTUA 1YEFH 2LVCA 1ZLUH 2FHBA 5EC2B 2R4SH 5DJAA 5EIQA 4JFDA 5FOJA 3QI9D 4OM1L 2Q8BL 4OQTH 2Y6SC 3K1DA 3IFPB 4RFOH 3RFZC 4CDHA 4W6YB 3MRIB 3WCYA 1L9MA 3MRRA 2GIYA 5JW5B 2NYYC 5CBAB 1AKJD 1CE1L 3EFDL 1MQKH 1MRCL 3Q2CA 4YDJA 2VDLH 4DOHB 4HEPG 3IKCA 4AL8L 2AV1B 1KENL 3WLBA 1RHHA 5CEYB 3N85H 3QZWB 4TTDD 3KPQA 2X44D 1HH9B 3QR2A 5FYJD 4ZOEA 5FKAB 4TSCH 4K94C 4JFFB 4ERSH 3VXQA 4ELME 3OGCB 4HUMB 4YQXH 1T83C 2SEBB 5ERWA 4JQVC 3BRGC 4LVHB 4X83A 3GDBA 3WD5H 2BMKA 1WUNT 5HHMD 4LQFH 3RU8L 2C7UB 3BQUD 1KCRL 3C2AH 5T5NF 3IT8D 4M6ML 1HDMB 2H8PA 5H8DA 4XPGH 1SJVA 4ENED 2P24A 3GMNB 4YBLB 2JK5B 3W5MA 4PGCB 4U1GB 2G60H 3HAEA 4JDVB 5C70A 4A2LA 2D03H 5F6IB 1S7TA 4UT6L 3BEVA 1BZ7B 3L6FA 3RWGB 4B41A 3FN3A 3KPOB 5C9JA 1RJYA 3BKJL 1GHFH 4NOFA 1A7QL 5IGXH 5LAXA 4OD2A 1C12A 1NL0L 1P53A 4CN4A 4BZ2H 5KSBF 1KB5B 4OLZH 1M7DB 2DL9A 4XPFL 4HKBB 1IVLA 5DQJA 2ADFH 4YHYC 4PJ7B 1BFOB 1UYWH 2L7JA 4RGOL 1AKJA 5ICYB 5K9OB 1PQZA 1F8TH 4NN5B 4MNQB 4YO0B 3KNBA 2O26U 2ZSVA 3EW3B 4NDMB 2DDQH 1N59A 3H9ZA 2DTSA 2XQYG 2FDBP 1NBZA 4E5XB 1ZLWK 1BJMA 4HIXH 1OTTC 1EFQA 2V2TB 3MRCB 3BW9B 4WFGD 3DYPA 4Q9QH 1JTOA 5T1MB 4WEBH 3MODH 3KPRD 3SKJL 1YY8B 3TYFA 3GMQA 3MLZL 2F74A 1CLCA 2Y07L 4QXUL 4P5MA 4QRRB 4H88H 2ADIA 5EPMB 3H0TB 5FM5O 4K3HA 3BISA 1A6ZA 4PJAA 5KSAC 5F7MC 1F42A 4GW4A 3JBG7 1FZMA 4KKCD 3D85B 1YMMD 4WY7H 2CUMA 3WEXA 3MRQA 3P4LA 3LN9A 3ZKXC 4PLKC 3QG7H 2J2ZA 5IFJA 3FOLA 3O3EB 4OF6A 3L7EA 3L3KB 5T3XD 2X9YA 2R2HA 2X7LA 5BW7A 5JLZB 3MBEA 5BS0B 2H6PA 1FNFA 3ULVD 2VL5B 1ZTXH 4ZPVA 2IADA 3LQAH 1ZWIB 1EJ6A 4OZFG 4EOWH 5C8JA 1A5FL 5J12C 2Y36H 1ZT1A 1I9EA 2AJVH 3RX5A 4JFOB 1DANU 2HTKD 5FYKE 4M00A 2KUTA 1MFCL 4WTXA 1AP2B 3KPMB 3Q3GB 3V0VB 2DBLL 4OLXH 5D1QD 4S0TD 1FZKB 2R1YB 3ROLB 2C1PA 3QCTL 1BOGA 5E8DL 3MLVH 3RWHB 3SDCB 2YZ8A 4EN3C 4XVTL 4L29B 4AM0B 3VA6A 3KWWB 4Z76A 3MV11 1QRNE 3BKCH 4RBPH 2XV6B 5GS0L 2HWZL 3JTTB 3I2CH 5D2LF 1V7NL 5C0FB 4XNYH 4JFYA 4ZFFA 2XPGA 2VISA 4R4FL 3VFGH 1A2YB 3PV6A 3HNVH 5HGDA 2R0WL 4LHJB 1INQB 1TJHL 1TPXC 5F7EH 2W0LA 1D9KB 2VDRL 5HYSB 3U4BL 5KSBE 5D96C 3TO4C 4CVZA 3MGAA 4FQCH 5CEXA 4PTUB 4B50A 4MDJB 1CGWA 3DX8A 3DGGA 4GO6B 2J5LC 1S9KC 5EBLA 3BE1L 1FH5L 3CMOH 4PRNA 4F80A 3HI5H 4UV4L 3S37H 3H9SA 3U6RB 4LCWD 3D0VA 4FQ2H 3EYUL 4R2GB 4DUXA 1I4FA 5IBUG 4H0HB 1N8ZA 2H2SC 2OTPA 1KTLA 1Q94B 4CBPA 5EO9B 4I3RL 1VEPA 1J9CT 1J5OL 1RZIB 4M3KB 4NQXA 4RMWA 3LKRB 4X6CA 2XKNA 5D1QA 3UTSE 4MXWH 1CXKA 1U3ZA 2DQDH 3AM8C 4MD4A 2X05A 3U30C 5DZNA 3H3KA 2APWA 2ADGA 4XPHH 3NMEA 4QHKJ 5DZOA 3L5IA 1LEKA 5C07E 2BVOB 7CGTA 2IALA 3Q5YA 1BVZA 1HNGA 4Z7VF 4AJ0A 3G5XA 3CZJA 1LEIA 4FFZH 4XTRC 4TSAL 4L4JA 3VH8B 2A83B 5IVXF 4NO0D 4JREB 4D0BA 3NCMA 3L5WB 5ADPH 2NLJA 3F7YA 4QGYA 4PR5A 4UINL 3S3PA 2C3VA 3DBXB 4KUZL 5I9QC 2V9QA 3W39B 3WN5C 4MZ2A 4QGTA 4IRSD 1I7UA 2VXVL 1NGQH 1S7VA 4LVNB 4K3GA 1SQ2N 1KCUL 1ORSB 4Y19A 4XVSH 4PY8I 5CJQH 3ZSSA 5DTFA 3QULA 4HH9A 3I6KB 4MMXC 1KT2B 2WBJB 2ZUXA 4OZGA 4Z18A 1OD9A 1JPST 1A1OB 3QUMA 4KAQH 3C6LA 1IM9A 4UI2A 5I18H 4EI6A 3TZVC 4LLAA 2VIRB 5GGVL 3W11C 5I16A 1K2DA 3O8XA 1KBGL 1REIA 4WI2A 2DQCH 4YPGB 5H94A 2H2PC 3KPSD 2B1AL 4FZ8H 2DQHH 4OUUA 4IDLA 4P5TD 4B5EA 3KXFD 3GJFB 4D9LH 3QT2A 4JDZA 3OR6A 2HFEB 3MRKA 5D2LE 3MC0A 3C08H 3P3YA 4XCYA 3RL1A 5CINL 4APQD 4H20H 4WHTB 2AABL 3EO1B 2R0LH 3LZFL 1T2QH 2Z8RA 3MFGB 3HZVA 4NO0A 4P3CH 5FKPA 3D3VE 4C83B 3QNZA 3DHMA 3GO1H 2J6EL 3CAFA 3RWJB 4X99A 5K59F 3KJ4B 1OPGH 1MCDA 1RFDL 1AJ7H 5GRJL 3D18B 5DJZA 1JNLL 1B2WH 1VEMA 2FLRT 2E8YA 4IS6B 3JWOL 5EOCL 2Q86B 4HXBH 1P4LA 4PRHB 4U6YA 3ZTNL 4DVRL 5GGTA 2HH0L 1D5MA 3BPLB 4G80A 4WEMB 3PNWB 5J6GA 4M43L 3MJ6A 1WFTA 3VXTA 4V1DE 3GMMA 2CUIA 2CLRB 5DHYB 3LDBC 4MD5B 3VXPA 5IMMA 4Q6IB 5C0IB 3BKML 4YXKL 2IPTL 5CUSH 5ID0A 1SBSH 4K7PY 5T1KB 3QUML 2W9DH 1KG0B 1UM6L 3LMJH 2ZG3A 1R5IB 5KVEH 2WLZA 1MCNA 3ECBB 3D2UD 4NQTA 5KVFH 1CDUA 5HHXH 3HUJA 2EDNA 1OD7A 2OR8A 2BY2A 1PFCA 2QR0A 3FHAA 5D7KE 5DQDL 3CH8A 3K1KC 1SEQH 4G8IB 4Z7VE 3HMXA 1AD0B 2IH3B 2VE6A 4YDIL 1IKFH 1NMCC 3EIFA 4XXDB 4XHQA 4ZS7H 2ZSWA 3X14B 2NY3B 2XN9A 5F7DB 2GW5A 2NYYD 3BP6A 4APQA 1CD8A 3OJVC 1FV1A 3GI8H 3TT3H 3DUHA 1IRAY 2YRPA 2MWCA 4ORZC 3V4UH 2ZOLB 4F37F 4I4WA 4X9FA 3A6BH 4I5BB 4XMLL 5HHVL 5C0AE 3WFBL 4L3CA 4PJXF 2V5MA 5F1IA 2I25N 3VMOA 3PWLB 3DMMB 3QUYB 2IAMB 3U9UB 5DK2A 1JJUA 1JFQL 4URTB 3CSPA 4XMPL 2VAJA 3TJEL 4N0UA 3E8UL 1FPTL 4PJ5A 1Q0YL 3BH8B 2EIDA 5GIRA 5MEPB 1C5DB 4YX2L 1K6QL 1A3RH 4Y8AA 5CIPB 3ARDB 1LP9B 2COQA 4PGEB 3V52H 1HCVA 1ULVA 2DD8H 5L2KB 5EG6C 3F58L 1ZA3B 3ARGB 4PJDB 2JB6A 3GHBL 3CXHK 3W9DB 3WO4B 4JDTL 4R4BB 1T4KA 5I1IL 3LS5H 5BVJA 1SJXA 1ZS8B 4FQ1L 4R26H 5EU7C 3WHXB 5J11C 1VFUA 1CCZA 3BMVA 3I9GH 2CIIA 3DSFH 3WXWL 3UPRA 2W0FB 4H0GA 1K4CA 2GT9A 2VZVA 4LLDB 3H3PL 2AAVA 4W6WB 4FQXA 3EAKA 4NFBA 4RFNB 4G9DA 2VABB 2J8UB 2GKIA 3NCBB 4XGZB 1KF9B 5DVLA 4M8QB 4G3YH 3BZFB 1U8NB 3SOBL 2LU4A 3C9NA 2R1XB 4NBZB 3NIFF 3RGHA 1IMHC 3SQOH 4Z0XA 4PJIF 1U3HD 5DQ9B 1K9TA 3P4OA 3V6FA 3DI3B 3HRZB 3F65A 4HUKB 5K59E 3BD4A 3S3JA 3LKNA 2NX5B 2PW2B 3VXMB 3I6GB 1OTTD 5EZJA 5ICZA 3CLFH 4ODUB 2I9TA 4JQVA 2AK4D 5GRVL 4LSUL 3WFEL 2FGWH 5AEAA 3LQAC 5FGCE 3H9HA 3QIBB 2ICCA 2ZUVA 5KSUB 3OKDA 5ISZE 3D39E 2IQ9H 5BCAA 4YHKH 4QKXB 1HZHL 4PV9B 4LFHD 5KSAD 4PYHA 1KELL 3K8KA 5C0CA 1BD2A 1NAMH 3HZMB 1JPGB 4M6NH 1YEEL 1CICD 1S7XB 2ILLA 4JFXB 5E95B 1U92A 4PGZA 4JQIL 4ZO6A 3CPLB 1MFAL 5INCA 1XF4A 3DV4A 4HBCH 3FQTB 4WWKB 4D3CH 3BZ4B 3SJVB 1LO2H 3QXUA 4OTXH 3VRJA 3PWUB 3VFTB 3FMGH 1DEEB 2X89D 5F7YC 3NVQA 2YPLD 1ZGLP 3BIKA 1B3JA 1P5UA 4JLRA 5IB1B 4X6FA 2X4SB 1GOFA 4YFDB 4ZUWB 4EBQH 4PJXE 1T7VA 2ITDB 3IF1A 4OJFH 5GSRB 5C0GA 4Z7WB 1GC1C 4KV5F 4TNVK 1SYSA 4P9HL 1NQBA 2X4OB 3RA7H 5F9DC 1XGTA 3R06B 2MFNA 2ADJA 4RZCA 1RZKL 1XH3B 2GY7B 4EN3D 2E9WA 3MPCA 1DBML 4U1HB 3ROOB 5IESL 4A6YH 3RL2B 5BV7H 3VWKB 4G8GB 3HMWH 2DI7A 4XNZC 5CILL 1IAOA 4ODWA 1SMOA 3N1FC 1OW0C 3UTOA 2E6PA 1LILA 3LN5B 4UT7H 4FXLA 2EICA 2QHRH 4P2RE 4HSQA 1NDMB 1KULA 3SE4C 4JQXA 5KW9H 3C60B 5KJRH 1T1WA 4ONGH 4UTBL 4UNVA 4GW1A 1T5XA 5IMKB 1P4BH 3TO4D 3QO1B 3IDIB 2C4FU 3VFSB 4DTGL 2XFXA 1SEBA 1H0DB 1F3DH 1KXVC 1T0PB 1J0HA 5HGGS 4PRBA 2HYMA 3DX9A 5EU5A 1QA9A 2G9HA 5TQ2L 3NPSB 4HIJB 3S7GA 1HHIB 3QUXC 3F62A 3NIFE 2HJKB 3ZT6A 4ODTH 4PJ8C 4PJIE 4NQDA 3VXSB 3P0VL 2ATKA 4MAYC 4Y16A 2H2SD 1YPZA 2XZAH 4I1NB 2DM4A 4OZ4B 3RZCB 1NPUA 3C5ZA 1MIEL 4MDIB 5JIIA 1Y18B 1UWGH 3LSOA 5GS2H 1PG7L 3VGDA 3MLPA 1INDL 4HZLB 1PYWB 1KN4L 2V5YA 4YHIB 2XWJB 3ULVF 4FS0A 4F9PC 4QHMB 4WTWA 3GBLA 4GS7B 1W8NA 5AWNH 2YXFA 4GSDL 5IEHA 1X7QB 1GAFL 4NGHH 2BFVH 1B4JL 3MJ7B 3SGJC 3KLDA 2OZ4A 4XTRD 5D7LB 5I30H 1OQOA 1A6AA 5I1AB 4LDEB 4KY1L 3H7BB 5FYJE 1I9JL 3T08A 4M7ZB 3T1FA 2D9CA 4MSWB 1DQLH 3NIDF 4HJJH 3PWVA 4OV5A 2A77H 2BXYA 3FT4B 1MJ7L 2ZKHL 5I76A 4PRDA 3QEUB 3NFSH 5HHME 2AQ1A 1S9YA 2E7HA 4L9LA 4X98B 4FQIL 1FCCA 4AIZB 4Q9RL 3OPZL 5HHQA 2P8LB 4PJGF 4HC1A 1FL5A 5HYJB 5DA4A 3OG4B 1NCCH 1IFHL 1U8JA 2JCCF 1MI5A 3QCUL 1F58L 1FFNA 4GRWF 1FG2B 1JGEB 4JZOA 5JORB 4KV5E 4OLYL 3KYMB 3W11D 1D6VH 3MQIA 5F9JB 1Q9KA 2YUZA 1WZ1H 3FAWA 2HFTA 5C2BL 3LOWA 5JQ6L 3OF6D 2BC4A 4AEHL 4NHUB 3SDXA 3IFOA 2B4CH 3B8SA 1KN2H 3MRFB 5DO2C 3VE0B 4R90H 4HFWA 2FECI 3QQ4B 3PWPD 5BQ7B 43CAB 1MF2L 4QRQB 4X6BA 3TA3A 4PB0L 1OP3H 2HKFL 2Z35B 4LBEB 4O2EB 4FQLL 2KBGA 3GJEA 5HHOA 3TYGL 4RDQG 1OQXA 1IGIL 4OAWB 3U4AA 2UWEF 4JKLA 4B7IA 5CP3H 4KQ4H 3O3UN 2Q7YB 2FEDD 5I66A 4ORGA 3KPRE 2PO6C 1QSZA 3RAJH 1BZ9A 3T1WA 4GKNA 4WJ5B 3EFFB 2BRRL 1VKXB 2AXGB 2XWBA 2Z91A 3O2WH 4JPVH 1VENA 1FIGL 3QFDA 4QTHB 4JHAH 4GG6A 5C92A 4RMUA 5EC1A 1CDJA 4GKSB 4L8DB 4HC1L 5SWSD 4OGYH 1YMME 5DVOA 2C1OB 2QBWA 5DLML 1MOEA 4L4TB 4WO4A 1KPUA 3B9EA 1N5YH 4OZFB 2EDYA 3L5XH 1OP5H 2D7TL 3FB6A 3TZVA 4CVWA 3HZYA 2H9GB 2M8XA 5BRZE 5T3XE 1DQJB 1XFPA 5EOQH 1KNOB 2IGFL 4X7TA 2MJWA 3ULVE 2YXMA 2OS7A 2VH5H 5D7IB 3OF6A 3MRJB 1G6RL 3OXRA 4PV8B 3BUYB 2MQ0A 1IAKA 1AO7D 1EFXA 4OF5A 1NBQA 4EXKA 1SM3L 4BZ1H 1YJDL 3DGCR 4X7SL 2ITCB 3AAZB 3NIDE 1NCBL 4HAFA 3FCTB 3L3GB 4ONHB 1YN6B 5IHUL 2RJMA 1FCGA 1AD9B 1OAUH 3QXWA 2R39A 3SEPA 5C6WH 4F3FB 2JELH 1UM5L 2IPKA 4NJAH 4PJGE 1C1EL 4J8RA 3EHBC 4XHJC 1MREH 3CVHA 1UACH 4ZUUB 2JCCE 5F1KC 4PD4J 3U4EB 2DWDB 4GRWE 1C08B 1L0XA 4FA8A 3SDDA 4GFTB 3FN9A 1BWMA 1I7RB 3DIFB 4HS6B 4Y5YC 4MNGB 3U7WL 1P2CB 2OJZL 1MCHA 1UFUA 2VSCA 4LCUB 4FABL 3ARFC 1TLKA 3SO3C 1LQSR 1T66C 5IBUB 1S3KH 3UBXA 5E4EB 4PY7B 4O5LL 3IDXL 1KJ2H 5E6IA 3ZO0A 3NFNA 3KYNA 3X3GL 1BBJA 2CR3A 4NCDA 3TPUA 3GSRB 4LCWE 4UIKH 1UKSA 1A6WH 1QNZL 2JB5H 3MO1A 2JJTC 1T20A 4HMEA 3RWDB 1KB9J 4PJBA 5EO0B 3BH9B 3P9MB 3RWEA 5I1JL 3QA3A 4NRYA 3EDFA 3U1SH 3UJJL 1AC0A 3NZ8B 1UVQA 2UWEE 5EZIH 3QDHA 2R69H 3IDMA 3L7FB 1LO4L 5LJYH 2BVPA 4TVPE 2AJUL 5BMFH 3D69B 1ITCA 2CR6A 1HXMA 4NZTH 2RAMA 1R3JA 3GSQA 4UDTA 4RIRB 4U1JA 5HVWA 5CBEB 4KVNH 1HH6A 4FNLH 4ODVL 1KTRL 4L3EB 2NY5C 2V9TA 2CO6B 3P30H 4P3DB 5J89A 1ZT7A 1Z5LB 2B1HL 4TUOB 4RBPK 2FATL 4YUEL 4X5WB 5DUPH 1QLEL 5TQ0H 3BI9X 3O9WC 3RNQA 1NKOA 2VZ1A 1G7HB 2P5WB 2BERA 3PE9A 2VUOA 2CD0A 4HUNB 1PEZA 3D5OF 4JB9L 1TCRB 5E94A 4D0CB 1UQSB 1X6LA 2X4RA 2YSSA 4RGMB 2EDFA 4EJ1C 2QQKH 1OT1A 3KPTA 1I8KB 3MLWL 3PGFL 2CRZA 3STBA 2OTUB 3JVGC 1ORQA 2N4IA 3IAPA 4LHUA 5DJAB 1FNGB 3GSWA 5DJ2A 3TBSA 3UTZA 1WT5A 3T0VA 4XT1C 3VXUD 1L6ZA 5BV7C 5MHSE 3LEYL 3HNTH 1JZ2A 4GQ9H 3BP5A 2PUQT 4XCNA 4F7TB 3MRRB 4NWTL 4YDJB 4PFEA 4D8PA 3IKCB 3KPSE 4A2MA 3WLBB 1RHHB 4JJ5A 5FV2A 3KXFE 1F4WL 3D25A 3KPQB 2BNUA 4NNXA 5HY9A 5JO5A 4HZAA 5DVNA 4L4VD 1J0IA 3VXQB 1OY3B 1J7VR 3T0AA 1WISA 4MA3A 2WLYA 1FN4B 2V2WB 3S35L 5ERWB 3DX6B 3V5DA 5EORH 4FFVC 4Q97A 4M93C 3DNKA 2BMKB 3HPLA 2ICWA 1LO5A 1M05B 2H8PB 1YY9C 3F7VA 4PRAA 2P24B 2NY2B 3WL9A 5DC9B 3LHPL 1VACA 1DVFC 5T5NG 1M1SA 5AZEL 1QSEA 4BYHA 3SPVA 1BFSA 4NC1E 5BVPL 4QCIA 4HJGA 4FFYL 2B39A 1S7UA 3NOIA 1S7TB 4BQCA 3MV9D 3BEVB 3L6FB 4DQOH 5F9OL 1I85A 1U8MB 5C9JB 1KB5H 4Q9BA 3QHZL 3VG9C 5LAXB 1L6XA 3Q1SL 4OD2B 2ESVE 5MERA 4G6AC 2GTZA 2APBA 3HFMH 4OCWH 3QUXD 4NUGL 3UJIL 1BEYH 4PJ8D 5C0BA 4KK5C 5DQJB 4MAYD 1EZVY 1A3LL 1NCWL 5FHBH 4WTZA 2VZ3A 4YXLL 1DUYB 2VSDA 2QTEA 4IHOA 4X6DA 1PQZB 5E6ZA 1OAQH 4LPCA 4WI3A 3KNBB 4LSSL 1ROWA 5GGRA 1MLCA 2ICEA 4X80L 2ZSVB 5IIEA 5JXED 1N59B 1R3IL 1URLA 4Z0BH 4JCLA 3N1GC 1JZ5A 4TSBH 1NBZB 2CKBL 2XNAA 3ARXA 3BZEA 3F6IA 5DD0L 4XNXL 3A6CL 3SGKC 4OLWL 4ZDHA 2DQEH 2LABA 4POYA 3TYFB 5DEFA 3GMQB 2F74B 2R56H 1JE6A 1CTOA 3MCLH 4LPXA 4YDVA 5JR1H 4P5MB 4KDWA 5E2VL 2ADIB 4DAGL 5IFAH 4Y4FA 3WUWA 4RGNB 1A22B 3MA7A 2HG5A 1A6ZB 1RIUH 2ZOKA 4G8EA 4PJAB 4KFZC 3SE4A 4GW4B 4G43A 1FZMB 4NKOA 5FUOH 3QQNA 3WFDH 3U9PL 3WEXB 4Y4KC 3MRQB 3QEGL 5IFJB 1Z9SA 3L7EB 4PJFF 4O2FA 5KOMC 2R2HB 2X7LB 5I75C 5T3ZL 3MBEB 4NRXA 3ZE2F 2H6PB 3QUXA 4ZPVB 2IADB 3IGAA 5DT1L 1G7IA 3KAAA 2YRZA 4P2QD 5C8JB 3I50L 3BT2H 3FN0H 1ZT1B 3W2DH 2R2EB 5GS1B 1FNEA 3O2DH 5L0QB 1ED3A 2VL4A 4XAKD 1NDGA 4M62H 1FLRH 2BNRA 2XZCH 3CU1A 3KPNA 1BOGB 3Q6GH 5E8EA 3OKEA 4WNQA 5F96H 5E08L 3T3PF 1TETL 3P11H 1KEML 3JV4A 4RQQA 5CHNA 5DO2D 3SGDH 1U8KA 4KMTH 5JOPD 2JLLA 4N5UA 5CJOH 3VWJA 1GGBH 1OSZB 4OFYA 1DP0A 4ZUTA 4QO1A 5DS8A 3BPOB 3FQUA 1PSKL 3C8KA 2YHGA 5TE7L 1A7RH 5L7XL 4JFYB 4ZFFB 2XPGB 1UCBL 1FNSH 2VISB 3TCXA 3PV6B 5HGDB 1O5DT 2AK4E 3MXVH 4DGVH 3C09B 4GRLC 2PO6D 2XI9A 25C8H 4KRNA 3ZTJG 4L8SC 4PIRF 3VXRA 1HHGA 4CVZB 4XP4H 5CEXB 4J3SA 5IUSA 1NC2A 3DX8B 3DGGB 3OKMA 2QSVA 4HGWA 3F8UB 4NPYA 4PRNB 2DQUL 3LRGA 4JPIA 4RNRB 4U7KA 3EDEA 4P4KA 4HLZG 3H9SB 2ID5A 4ZFGH 3D0VB 4U1IA 4K7PH 3RVTC 4XPAH 4HUVA 4OLVL 1N8ZB 4RWHA 3UAJC 1KTLB 1P4IH 1FFQA 1T1YA 4K9EH 2VWEC 4NQXB 3G5ZA 3FQNA 4X6CB 2XKNB 3IS0X 4LLQA 3C8HA 4JR9H 2P7TB 4HV8A 4PRIA 2P1YA 1N64L 1X4ZA 4HK3J 4MD4B 2YPLE 1IKNA 3CK0L 4FMFA 2F5BH 1YEDA 2ADGB 3O6MH 3MROA 3QIUA 1LEKB 2GJ6E 1QFOA 1HNFA 2IALB 4LAJH 1MCIA 1N6VA 1S9VA 3E0GA 1CDGA 4JZJA 3R0NA 3G5XB 1LEIB 4ISVA 4O02H 3GBML 4YEEA 2AEPH 3GSNL 2LFGA 4HD9A 2YZ1A 3CGTA 1NFDA 3F7YB 4DGYL 4BZYA 4PR5B 4CMHC 2C26A 1PX3A 1RZ8A 2C3VB 4PJFE 5SWZD 3GUTA 3WS6C 3IXAB 5L8KB 4LSQL 4XHJD 3ZE2E 2BDNH 5IEKA 2DKUA 3MRMA 4YR6A 3IDJA 5FO7A 6FABH 2AJYH 4PREA 1I7UB 1EVTC 4J4PD 4LVOB 1U8PA 1S7VB 2X4TA 1VSCA 4Y19B 2VLJA 1F02I 4HH9B 1IQDA 4DGIH 4HIEA 4OZGB 1Z9LA 2UYLB 5JW3L 3QUMB 5IR1B 3C6LB 4X9BA 1IM9B 4RFEB 1T66D 4IRZH 5EUKA 2D31B 4X5XA 3T3PE 4LHUG 3TNNA 5I8CA 1IARB 5I16B 1K2DB 3O8XB 3GJFH 5H94B 4XNMA 4OUUB 4UU9B 2F53A 4K3DL 2Z0BA 1MNUH 4JDZB 3ZMRA 1GGYA 5D1XA 4U4BA 5IQ9A 3MRKB 3WUZA 5AYQA 4MA8L 2FBJH 4XCYB 3RL1B 1DBKL 1X3DA 3X17A 4J3XA 5KVDL 1CFSA 5LGHL 3HZVB 1BM3H 5FKPB 5D71L 3QNZB 5MI0B 2O5ZH 1NUGA 3P2TA 1FZJA 2B2XL 5IHBA 2P5EB 4HCRA 3HRPA 4OZHF 4H26A 4X99B 5FCUH 3VFUA 4MNHA 2VZSA 1PG7X 5DJZB 3VG0L 1BQLL 1WCBA 1P4LB 4U6YB 2E6JA 1D5MB 2IAND 4G80B 4R8WL 1PGRB 1LMKA 3VGHA 3VXTB 3O9WD 3GMMB 2I26N 5DZLA 3OL2A 3RX7A 2YKLL 5F7WC 5IMMB 1JPFA 5DJ8A 2BOCB 5LWYL 3ARFA 4WUUA 1EJOH 1YNKH 4P2OB 5GGVY 5ID0B 3VD9A 5A16A 3MBXH 5BXFB 2BCKA 3WNPA 4M3JA 4X4XA 2QJDA 3STZA 2IBGA 1PKQA 4MAUH 1ZKAA 3HUJB 4NC2B 3S8WA 4AEFA 1CGSH 1DTUA 1DQML 2DQTH 5MENA 2QR0B 5DRZA 3KHOA 5TDNA 5ESQA 1A64A 1YNTA 2JJTA 2GJZA 1AQKL 4WTZG 2Z4QA 1QBLH 2VE6B 4YBLC 2ZSWB 4KI5D 3RJDA 2XN9B 2EC9U 4U1GC 4G5ZH 3BP6B 3L3IB 3S36L 1FV1B 1LGVA 4Z78A 5F6IC 3GI9H 3CDFA 3PXHA 4JFED 4LGPB 3U83A 1CS6A 2R29L 4I4WB 4X0KA 5IHZA 1HXYA 4NZJA 1R3HA 4L3CB 4R6UA 3RTQC 5F1IB 5IF0A 2QSCH 3CX5J 5A2JH 3PWPE 4HWZA 2ED7A 4NM8H 5DK2B 4FXGA 4AQOA 4QYOA 4N0UB 4PJ5B 3EJZC 5CIPH 2X40A 2YPKA 3WUWG 4FQJL 5JOEA 5GIRB 3HLAA 4NN5C 1YY9D 4HWEL 2OQJB 3HNSL 5HYIA 1ZLVH 1GCFA 1DVFD 4U1MA 4FHBD 2VDKL 2ZZUT 4JM2D 5E5RB 2JB6B 4AEEA 3TP4A 5GS2D 3MV8D 5T1DL 1CFQA 3BPNB 3O4OC 4LASL 4XB8A 1JV5A 1V8HA 4J7RA 4AQ1B 3NZHL 5BVJB 2VC2H 2CIIB 2JJVA 3GIZL 4G6AD 1K4CB 2GT9B 1CXHA 5SWSE 3GMOA 3T0DA 4J6RH 4FQXB 2XRAL 2XACC 4GOSA 5DK3A 4KK5D 4G9DB 3RIAK 1JP5A 3S9DB 35C8H 4PGDA 3LEXA 4Z0XB 1HHKA 4XP6L 4OZHE 4X8JA 3UX9B 3P4OB 3V6FB 1BAFL 1IC5H 4L8BA 3BWUC 5DJYA 1RVFL 3LKNB 4XPBL 4U49A 3QXDA 1YEIL 1AO7E 4PJEF 1CQKA 5ICZB 5I1KH 5FAAA 3UBXI 1XGRA 2W0KA 4GMSL 1BQUA 1QP1A 3WNMA 3DRQA 2I9TB 2HLAB 2V7HA 2VR4A 5FDWA 4M7JL 4YEFA 4ONFH 1IT9H 1T7XA 5L88L 1FNHA 3H9HB 2AK1H 2GAZA 4LCIL 1CU4H 3TLRA 3DV6A 1OP3K 5TF1H 5ILTL 3X12A 1U91A 5ENWB 3OKDB 1JHTB 5TE4H 1HHHA 1I9RL 1DQTA 3FRPA 4GAFB 1A7PL 1DVFA 5MEQA 5IQ7H 1FO0L 1W0WA 5C0CB 4TVPL 1BD2B 1FAKT 2F54A 3QXAA 3MV8A 3QDMA 4HK3N 3WIHH 4FTVD 1AE6L 4M5ZH 5JUEL 1AI1H 1U92B 2X9XA 2XIDA 4S1RH 4HF5H 1I8IA 2E7MA 1NAKH 1XF4B 3LKQA 2F8OA 1DBJH 1KCVL 3DV4B 4J23A 1BWWA 5SWQA 1MCOH 1JGUL 3ULUL 4P9MH 4ZOCA 3VRJB 4RX4D 4DJMA 2JF1A 4IOFC 5CGYD 5LVEA 3BIKB 2Y06H 4JLRB 3QJHA 5AAWA 4X6FB 5CJXA 2F9BT 1E27B 1T03L 1A6TA 5EU7E 5BOZG 1OCWL 5D6DC 1OP5K 1T2XA 2X4QA 5GISH 1D9KC 2Z9TA 3BGMA 3A67L 4PG9A 1VPOH 3IF1B 3VFMA 2X1QA 1G9MH 4DN4H 1N0LA 1SYSB 1JYXA 3G6JF 3AXLA 2P4AB 4G7YL 1XGTB 1I75A 3HC3H 1LDPH 1FL6A 2ADJB 4RZCB 2J12B 2VDOL 4XCEB 1IGYB 5IBTH 2KKQA 4GT7A 5DMJB 4CAGA 1ZVHA 3AS0A 1K8DA 3DI2B 4QRPD 4PS4H 4NNYA 1IAOB 4ODWB 1RUML 5L8LB 4QTIL 2AW2A 3UYRL 4ZO8A 3SE8H 2W1NA 4K9EC 5EIIB 3I3DA 4GRLD 2DQGH 1T1WB 4Y4KA 2FR4A 4G7VH 4XZUA 4GW1B 1T5XB 3IDGB 1QYGL 2CJUH 3R1GL 4GG8B 4JPWH 2XFXB 1J8HD 5E99H 1OSPH 4GMTL 2QQLH 3SY0A 3DXAA 4PRBB 4RX4A 3RBSA 2X1WL 3DX9B 1UH4A 5EU5B 1QA9B 2G9HB 2K9UA 2FYYB 1JPTL 4KGJA 2YR3A 2ICWI 4JREC 3ARWA 4NQDB 1D5IH 3RVTD 2AI0L 2YUWA 3NAAL 2ATKB 4WI4A 4XBPA 5FCSH 1WAAF 4Y16B 2HN7A 4ALAH 1YPZB 4IOIA 4KDVA 5CKGA 4PJEE 2YUXA 4OIBA 3C5ZB 1BHGA 3V8OA 15C8L 5I1GH 3LSOB 1U8OA 4AMKL 3QHFH 5BO1L 3VXUE 5C7XH 3QPXL 2A9NH 4F58H 1U6AL 4CU8A 1BECA 3MXWL 1CXEA 2NPLX 1NJ9A 1L9NA 2WBJC 3S5LG 3QDJD 3AS2A 5IEHB 1J8KA 1JZ4A 1GZPB 2FSEA 1YNLL 5GHWH 3MV7A 3MUHL 5IB5A 1IQWH 1QBMH 5DD5H 1T0NA 3EUUA 1QD0A 3T1FB 2EDHA 4L4VE 4MX7A 4F9LA 1JRHL 2HRPH 3ES6A 1LD9A 3BESR 4OV5B 1MVUA 1QSFA 1TPXB 4DKFH 3RVUC 4OT1H 1NEZA 5GGQH 5I76B 4PRDB 1U95A 5T5FL 3WMSA 3EYFA 3BP4A 1S9YB 3KYKH 4L9LB 4OF7A 4XP9L 1QRNB 4U33A 5HHQB 4OB5H 2P47B 3S35X 3HPJA 3MACH 1FL5B 3ALXA 4DFHA 5IJVA 1LO3H 1H3GA 1Z0MA 1M71A 5LGJA 3F12A 3PGDA 1J1OH 1MI5B 2LVEA 1FFNB 3MV9E 4JZOB 4R7DA 1C16B 1G9NH 1MCKA 3G6JE 5IW1A 1HINL 4WIQA 3KJ4C 5DSCA 2FHFA 3UTPD 1Q9KB 1E6JL 3S34H 5E00A 1G6RB 3HI6L 3SE9H 3BPLC 3U7YH 2BC4B 5HPMA 3SDXB 3VDAA 2ORBH 3IFOB 4TNWK 5ID1A 1CF8H 2A0LD 3AREA 1LNUA 2GHWB 4O58H 2IPUG 3TN0D 3LQZA 4KQ3H 1LK3L 4HFWB 4QT5A 2IH1A 4Q6IC 2VYRE 3ZL4H 1A6UL 3TA3B 2BNQD 3MRBA 2YPVL 2A1WH 3RPKA 2LU3A 5IV2A 1QACA 5A3IC 2Y5TA 2ZJSL 3GJEB 5I8OL 4RA3A 5HHOB 5L6YH 3GGWB 3T3MF 4RAHA 2A73A 1U8QA 1LE5B 1P9MA 3WS6A 5I9QB 5I66B 1DBAL 3V4VL 3UROR 2WUBL 3CSYB 4N8CL 1BZ9B 1S7RA 4GKNB 3P9WB 2VAAB 3VD4A 2NY3C 5F97E 3RNKA 1UCTA 4J3OC 2HJLB 3NCFB 4CADA 1JGDA 1L7TL 2Z91B 4ZFZA 4OZIF 3QFDB 3QFJA 2EDBA 4NKDA 4WI5A 5FYLD 2HAZA 4P2CG 4GG6B 1WAAE 4QXWA 4XVJH 5EC1B 5I2IA 2H1PL 5CEZH 1ZLSL 4OZFH 4DKEH 4N0YH 3FFDA 5CJ8A 5C1MB 4XNUH 4WO4B 3O0RL 1KPUB 4JFFD 5LQBL 5ACZA 2VXSL 3FB6B 3TZVB 3HZYB 3DMMC 3MLSL 3QUYC 3U7AA 4KHTH 4EDXA 1BGXH 2AEIT 1MJ8H 1XT5A 3EJYC 4X7TB 3B9KA 5EFIA 5LBSL 1VHPA 2CGRL 2PTUA 4M4PA 2X4NA 2HFGH 4QWWC 1YC8A 4X6EA 3GB7A 3OXRB 3MRLB 2DYPA 1IAKB 4NHCH 4P2QE 2KQMA 4NC0B 1EFXB 5IB3A 5F7LB 4BJLA 1FDLH 3O3DA 2PCPA 2VMFA 3ARGC 4GW5A 1F2QA 4QEGA 3WO4C 2D0GA 1EAPA 4OD3H 1NMBL 4NWUL 4XAKE 4OFPA 3TNMA 5M94B 3SHSA 1UXWA 1E4WL 3NCJL 5E2WH 2IFGA 3ILQC 5BZWA 5J8OA 4Y4HA 2D7MA 1KFAH 1HSBB 2IPKB 3GHEH 5JOPE 3PDOA 4RFNC 3IETA 3PF2A 4J8RB 5D2LB 1IGML 5ITBL 1JGLH 3EJZD 1CI5A 5E1AA 1FGVL 4U31A 5JW4N 4Z8FH 4MNQD 3PQYA 5FHAH 1MRDL 2J8OA 3SDDB 1B0GA 4DUVA 1OGAA 4KK6C 1CL7L 3U0WH 1MCJA 3QP3A 3ME0A 4OM1H 4JVPA 4OI9A 4YDKL 5IM7A 4XNQA 5C09A 2Q8BH 2P42B 5E6IB 1HILA 2C7UA 3NFNB 3KYNB 3Q5OA 1EHLL 3QIBC 3QWRD 1E4XL 1DSFH 3TPUB 4QRRD 4I3GA 1CE1H 5FUCC 4AT6A 3UZEA 1QQDA 2JK5A 3MO1B 2OMNA 2UVEA 1JHLL 5DJDA 4JFHE 4PJBB 4I0KA 5DF0A 5E56A 3RWEB 2DF3A 3D85D 3QA3B 4NQSA 4NRYB 3ISWA 3T3ME 5IG7A 3BAEH 4MA7H 4N9GA 1UVQB 4OD1L 4HK0A 5CLWA 4D9QE 4HWBL 3LKOB 4YHOL 1NGPL 3V79C 3O41A 3RTQA 5BS0D 4HMDA 4LIQL 1F4XL 1HXMB 3BDXA 4HAGA 4OZIE 1R3JB 3GSQB 4UDTB 4NZUL 3K4ZA 4U1JB 1UWEL 4EUPH 1HH6B 5LCVH 2FJGA 4KI5F 2V2XA 3WNKA 4OCLC 4Y5VC 2MPAH 4H8WL 2L7UA 1ZT7B 1F45A 4Z7UA 1Q8MA 2D0HA 1X5YA 3DYMA 4MA1C 4E41E 1M7IA 3RNQB 2ZPKL 5SWZE 3PIQA 4QRUA 3MYJA 1G9MC 2G5RA 1NL0H 5E94B 3SDCD 5JPNA 2YSSB 4P4RA 5HI4C 2PXYC 4KU1A 1SY6L 2P44B 3EYVA 2MMXA 1ORQB 4LHUB 3VWKC 3H0TA 3L3HB 5DJ2B 5K9JH 2WZPD 3UTZB 4DZ8A 3WFZA 1SVCP 4XCNB 3RI5K 3TFKC 3O4LA 5DHVA 1ZT4A 3C60C 4JM2F 4GXUN 1D9KD 3FB7A 5JMOC 3UO1H 1B4RA 5EZLA 1H3PL 3O3EA 3VMNA 1Q9OA 4K3JL 4RISH 3WO3B 4EZMA 3D25B 1EO8L 2BNUB 4NNXB 3SE3A 5HY9B 3ILPA 3SKJH 4PJHA 3MLZH 5FO8A 3NPSC 4MA3B 5I1DA 3G6DL 3ZYJA 3V5DB 5DD1H 4R2GD 1N0XL 4JFOA 3HPLB 2VKXA 1RJLA 4U6HA 1LO5B 5D5MF 3F7RA 3RZCC 1E0OB 2AXHA 3KVQA 1AP2A 3KPMA 3Q3GA 5ALCL 3F7VB 1FZKA 5CZVL 3HAEH 5DYOA 3WL9B 3N50A 2NXYB 1VACB 2APVA 3AC0A 1NEZG 1WIOA 1QSEB 3MREB 3SPVB 1F97A 3LPWA 1M7XA 1RZJH 2HJFA 4KTEL 4LKXA 3PHQA 4JY6A 4QCIB 3FO0H 1S7UB 1DJSA 4PLOB 4GS7C 1CT8A 3KWWA 4YHLL 2E7BA 3CFCH 1BBDL 3MUY1 1A5FH 2DJUA 5MERB 4G6FB 3MJGX 5J7CC 5HYEA 3NA9L 5DEGA 4N0CC 3IU4H 4M7ZC 4M4RA 2R15A 5C0BB 2XA8L 1I1AA 2VDMH 1YEFL 4S11A 3CSGA 3QQ9C 1D9KA 3O11A 4X6DB 1MAJA 2AVGA 3QCTH 4Z6AT 4OQTL 1V3LA 2C3XA 2DQJL 1VDGA 5HVFB 4QY8A 3MTRA 5SX5H 2CLVA 4MDJA 5GGRB 3GM8A 1MLCB 2ICEB 4KHXH 5IIEB 2YD5A 3PWNA 4XVTH 2CLZA 5BZDA 2H32A 1MQKL 1JF5A 2VDLL 4HGMA 2XNAB 4KI5E 3BZEB 2P43B 1QZ1A 1Z6JT 2WBJD 3MLUL 3N85L 4FFWD 1I8LC 2HWZH 1V7NH 3J7HA 4ZDHB 1AGEA 4TSCL 4R4FH 5DEFB 3ULSA 4JFEE 2DOCA 4YDVB 4ZAKA 3OQ3B 1TJHH 4FQPA 5KAQF 5EUOA 4Y4FB 4ZUSB 3WUWB 1G9NC 2VDRH 3U4BH 3MA7B 2ZOKB 4G8EB 4KH2A 2H26A 4LQFL 4G43B 5EN2B 3RVUD 4PP1C 4C56A 3HI1A 4XPGL 1XGQA 3ALPA 4L1DA 4OV6F 1WZLA 2BVYA 1CR9H 4XWGL 1CZ8L 5DXWA 4OIIL 5ALBH 2K3TA 3MYZA 4O2FB 3V6OE 3EYUH 3TJHC 5FA4A 2D03L 5JMRA 4NRXB 2E8ZA 4OCRH 3IGAB 2GCYA 1DL7L 1G1CA 1QG3A 2EO9A 4EVNA 1WC7A 3MUZ1 1G7IB 4D0DA 5IGXL 1Q72H 4XH2B 4DUWA 4OLZL 4P23C 4NJ9L 1FNEB 1MEXL 4IOSD 3WSQH 1ED3B 2ADFL 1CTNA 4M7LH 1CVRA 1UYWL 1NCTA 4NQCA 1NDGB 5K9KA 3RKPA 2BNRB 1N6QH 4WW2C 3KPNB 5E8EB 4HFUH 4WNQB 3I85A 5DMGC 3JV4B 4RQQB 4TSAH 5D5ME 3NGBB 1TJGL 3LPFA 1U8KB 3HE6C 1A9EA 1A1OA 2DDQL 3VWJB 1PD6A 1U2HA 3GSNB 1WEJH 4HIXL 4ZUTB 5T1KD 5E8PA 1P7QA 5DS8B 5A3ID 4UINH 4JY5H 2CXKA 2DLHA 4KUZH 3FQUB 3UPAA 4YPGA 1U3JA 3C8KB 4MWFA 1WTGT 3MODL 4LHQB 4S1QH 4AIOA 3KPLA 2VXVH 4H88L 4CVXA 4BH7A 1MCLA 5HTSA 4M61A 1KCUH 1RUQL 2CDEA 3VXRB 1HHGB 2NY3D 4M6OH 1XEDA 2VDPH 1NC2B 4WHTA 2EDWA 1JZ8A 3OKMB 4OF3A 4JRXA 4UB0L 4HGWB 4NPYB 4WY7L 4IMKC 2FX9L 4JPIB 3INUL 3QG7L 2IF7A 4P4KB 5DJ6A 4X4MA 1MCBA 3BDBA 5GGVH 4FTVE 4U1IB 1KBGH 3KS0J 4HUVB 2BY1A 5D2NA 3VGFA 1G9EA 3CXDL 1AXTL 4W4OC 3DMMD 3QUYD 1T1YB 5GGRY 3OB0H 3EJYD 3FQNB 1EBPA 2E5EA 2X9WA 4LLQB 4HV8B 4PRIB 1IAMA 2Y36L 2AJVL 3ARYA 1BZQK 5CINH 3ARDD 3QISA 2AABH 2PN5A 4EI5C 5L2KD 3MROB 3QIUB 4JCMA 3EO9H 1DE4A 2H3NA 3ARGD 2ARJQ 3H42H 1S9VB 3FQXA 1NGZA 4JZJB 1XGYH 3QRFM 4ISVB 1BLNA 1EGJA 4KROB 4L1HA 5KG9A 3SCMA 5E4EC 2HKHL 5C2UB 1VCAA 5F1NA 4N8VA 5GRJH 2VQUA 2YD4A 1OGTA 1NFDB 3JWOH 5EOCH 3TO2A 1JNHA 3BKCL 4M5YH 4WHYG 1AGFB 1AD0A 2IH3A 3GUTB 1MUJA 4XNYL 4M43H 5KVGH 4QRPE 3MRMB 4YR6B 3ZDYF 3VFGL 5FO7B 1FORH 3GZKA 3HNVL 4PREB 5JA9A 1RJCA 4I18A 1U8PB 1L4IA 4D2NA 5F7EL 2FWOB 3DSNA 2VXTL 2VLJB 3QUMH 4JPKH 2MKWA 1AGCA 4KK6D 3RUGF 2X42A 2NX5D 4HIEB 1RQ5A 3B6SA 3VXMD 4ZUVA 3VI4F 4HG4K 2Y25A 3CCHB 2IBBA 3CMOL 1J8HE 3HI5L 5EUKB 4XAWH 4X5XB 3TNNB 5I8CB 1YN7A 3EOAB 4FQ2L 3BH8A 5JIHA 4TNWF 4XNMB 3QIBD 3O2VL 2N7BA 2F53B 2NY0B 3MR9A 2B8OT 5D1XB 2VLRA 1BOYA 5IQ9B 3BYYA 4MXWL 2WSKA 4DFIA 3G9AB 2VWEE 5C08A 3S5LB 5BRZB 3SBWC 1G84A 1UH3A 4XPHL 1CFSB 3WDIA 1ZS8A 1T1XA 3PHSA 4KJPC 3VA2C 4K8RL 4WWKD 3SJVD 4P46A 4HBQA 5F8QC 1IGTA 5F44A 1FZJB 3D9AH 3TJEH 3E8UH 4FFZL 4I48A 4MJIE 4JJHA 4H26B 3QDJE 1JN6A 3VFUB 2ZG1A 4MNHB 5GGTH 4YX2H 2WM0A 1IAIM 4UIMA 4Y89A 1JK8A 2QLVB 4Z95L 1PY9A 3F58H 4KKNA 3QDGA 1EHXA 3L1OL 3GHBH 3ZKQD 4UZGA 1NKRA 5I1IH 1YECH 4IMLA 4OCXH 4Z7OF 2HT3C 4Q7DA 1JPFB 5DJ8B 3ARFB 4WUUB 4PJGB 5A16B 2BCKB 2PXYD 3B2VL 3CFEA 4XVSL 2K7PA 5HI4D 4JO1H 4JG1H 3STZB 4HEME 1PKQB 1CLYH 5FM5M 4PJ7F 1BVLA 3VWKD 3HMXH 5MENB 4G8GD 5DRZB 5ESQB 3AY4A 3G5VA 1YNTB 3EYSH 4PV9A 2GJZB 4YFLF 1EAJA 2DN7A 2NY2C 4GLRI 1EXUA 2Z4QB 2DQCL 3TFKD 3C60D 1AH1A 1QKZH 1MY5A 3UTPE 3JV6B 1MWAA 4KTDH 4PRPA 2YD8A 5C0RH 1AFVL 4YHZH 3UZVB 3WFHA 2VB5A 2R8SH 1RZJC 3QEQA 3BZ4A 4LSUH 1UKTA 4X0KB 5IHZB 1HXYB 5DHXB 2MQCA 3C08L 5EU3A 3WFEH 4DKDC 2FJFA 3FL7A 1R3HB 3ZDYE 4H20L 1ES0B 2R0LL 3M8OL 2JKXA 4HWZB 5IB1A 2BNQE 1PZ5A 4BELD 4FXGB 5JDSB 3VXSD 4WI7A 1HZHH 3GO1L 5FF6A 4ZUWA 4OF0A 3IDNA 4QYOB 4Y5VA 5H2BA 1QPPA 3RUGE 2YPKB 4LCCA 3RZCD 4JO4L 3HLAB 3VI4E 4Z7WA 2VXQH 4C59B 1OPGL 1YEEH 1AJ7L 4O51A 2R2BB 4X9IA 4OFDA 4U1MB 2ED9A 4HXBL 4JQIH 1MFAH 2PTTA 2E6QA 4PLNC 2AERT 1CFQB 4M9PA 3JSSA 2PXYA 1JV5B 4DOHE 3VD5A 4Q74A 5C0JA 3OBAA 3RL2A 4BQ6A 5J9PA 5D7LD 3M07A 1WITA 1J12A 4NRZB 4PUBH 5GS0C 4N0CD 3GMOB 1J18A 4U6VL 2E9JA 4GAGL 4JFFE 5KVEL 5HHXL 4RGNC 4YHML 4U0RB 3QQ9D 2EYTA 4LPWA 4KRPB 2EEAA 3JTSB 4PGDB 1SEQL 1FG9C 1P1ZA 3LEXB 2DKSA 5AUMA 1HHKB 3RRQA 4X8JB 1MWAL 1H0DA 4NO2A 3AS3A 4ZS7L 4L8BB 5DJYB 2DLIA 3RVWC 4U1KA 4NCC1 2XQYK 3GI8L 3MBEC 3IAQA 5HYJD 3IB4A 3TT3L 3ZDXF 3QEHA 3DRQB 1QFPA 5FDWB 3UJTH 5A2FA 3MGOA 2VITB 3A6BL 2GAZB 4M7KH 3TV3H 2VOTA 3DV6B 5GS1C 1CD9B 3X12B 4Z7OE 1Z9MA 1U91B 4LF3A 5HDQH 3W81A 1N26A 1HHHB 4UTBH 2LE9A 5MEQB 1NCNA 1VGKA 1W0WB 4MS8D 5JIKA 2F54B 5E2UL 3QXAB 3MV8B 5I1CH 3QDMB 4PP1D 4PJ7E 5HBBA 4QHMA 3HHRB 3V52L 1EA9C 2BVTA 2DD8L 1V3KA 5TQ2H 1I8IB 4TUKH 3LKQB 4HUWA 3TJHD 5I1AA 4M03A 2C9AA 4KMLB 3D6GA 1YZZA 4MSWA 3BPOC 4HKJA 3RI5F 1EPFA 3LS5L 3MGTA 3QJFA 1GGUA 3L95A 3THMH 4G8FA 1MIEH 3FB8A 2M1KA 3QJHB 1V05A 4YFLI 3CXHJ 3C09C 4UQ2A 1A6TB 1PG7H 3L3DA 2V7NB 2X4QB 4JHWH 1KN4H 3BGMB 3FO2A 4PG9B 3PG2A 1XCQB 3VFMB 4QRRE 4G3YL 2ESVB 4AIXA 3AXLB 1CGVA 5HHNA 1FL6B 5DMGD 1NBVH 2WQRA 3FRUA 5AZ2L 2Z31C 3QHTC 2VNCA 1H3XA 4L4TD 1AHWA 1VGEH 2C3WA 1PDKA 5CEZD 1K8DB 4HJ0C 1MJ7H 4KXZI 4N8VG 4NNYB 1CQYA 2ZKHH 3BP7A 3EZJB 1EEZB 1H3VA 1Q1JL 5BS0E 2FGWL 4LGSB 1JF6A 4FQIH 3RGVA 1YYLH 3OPZH 5C3LD 3S88L 4Y4KB 1G1YA 2FCBA 2FR4B 4XZUB 4LEXH 1EHNA 4YHKL 3PP3H 2AEQH 3R8QA 3MUJA 3MZGB 1IFHH 1NAML 2N56A 1TVHA 1WQVT 1F58H 3BD3A 4M6NL 4NBYB 4AYFA 4Y1AE 3DXAB 3T0EE 2AKRA 4OLYH 5IW3A 2BVQA 1U0QA 3FONB 1TNMA 4OAWA 3RX8A 5HDLA 4D3CL 4LQ1A 5FUZL 4XBPB 1RZ7L 2Q7YA 3NCYP 4P23A 1DN0A 1T89C 5JQ6H 3FMGL 4D94A 1OM3L 3JWOC 2JIXA 4LLVA 4Q0XH 5EDXA 4W68A 1VKXA 4NM4H 2AXGA 4IRJA 1U8OB 5IB4B 1I8MA 4WW2A 4LVEA 2EEDA 4IIQB 4LVOC 5I74B 1VFMA 1MF2H 5DUBA 4EBQL 4BSWA 4PB0H 1RUPH 3HE6A 3SGDI 3QUKA 1NJ9B 2OZ4H 4L4TA 4FQLH 4OIAA 3TYGH 3RA7L 5FOBA 5GRWA 1AR2A 1UC6A 4ZSOE 4AZ8A 2FSEB 3MV7B 1IGIH 5IB5B 2WWKO 4YXHH 1TVDA 2NY1B 1XF5A 1CGYA 4BSVA 5HJ3A 1F13A 1AQDA 1S7SA 3O8XC 2D7OA 2BZDA 3ARTA 4A6YL 1LD9B 4HLJA 4PV8A 2XY1A 4BUHA 1QSFB 3EDDA 2WBKA 3HMWL 3CLEL 1NEZB 1FIGH 1W0YT 1U95B 3EYFB 5IMOB 4UT7L 1A21A 3AAZA 3BP4B 3TPKA 2QHRL 1ZK9A 4HC1H 3U0PA 2FJHA 4ZXBA 5KW9L 4AY0A 5I73B 5DLMH 5KJRL 3HPJB 5IJVB 1P4BL 1OAZL 5ADOH 1NFIA 3DX7A 5HYQA 4UTAL 1M71B 5LGJB 3F12B 3PGDB 5MI0C 2WUCH 4F3FA 2FGZA 4JKKA 4R7DB 2KZWA 2Y7QA 4Z5RA 5IW1B 3ZLQC 3L9RA 5DSCB 4Z9KB 5ACLA 4RAVA 5E00B 3W0WE 4L3ED 1SM3H 3T09A 1YDPB 5HPMB 4EI5A 4WU7A 1MCPH 2Q6WA 1NCBH 1WCQA 2JJSC 1LNUB 3AREB 4QF1A 3LQZB 5IHUH 2GEEA 2FX7H 1FYTA 2P5WD 4QT5B 2IH1B 1X5AA 4P2OC 3MRBB 4Q6YA 4TPRH 3IVKA 4YZFF 5IV2B 4AG4L 4KJPD 5TDOA 2EZ0C 3P40A 4BM7A 2Y5TB 1KCKA 3KPPA 3AROA 4NGHL 2BFVL 4TRPH 4PJCA 4KKLC 1N6UA 2A73B 1NLDH 1ZVYA 4KK8C 3T0XA 1U8QB 5E9DA 1QFUL 3F5WB 1G6VK 1SBBA 2GJ6B 1DQLL 1LP9F 5GRZA 1S7RB 1A9BA 5EO0A 1VFOA 5CD3B 3RNKB 2XTJE 2XICA 3U7WH 3NZ8A 3ET9F 1JGDB 2IG2H 4PJDF 4ZFZB 3QFJB 2IWGA 5CFHA 5I2IB 1VFAB 3NA4A 4IDJH 3D69A 4LLUA 1RHFA 4FXKA 3HE7C 5ACZB 3HC4L 5C86A 5DR5H 1AR1C 4EDXB 2J8UF 4L3EA 3B9KB 3O3BA 5DRWA 1MIMH 2X4NB 2D7PA 2DJSA 4TUOA 5I1JH 2MHAA 4X6EB 3GB7B 1CDYA 2DYPB 5EBMA 2NY2D 5KTEL 1WGOA 3V7AE 4OM0L 4L9DA 1WZ1L 3O3DB 2P5WA 2PCPB 2VTFA 5CD5C 4GW5B 3B5HA 1Z2KA 1UQSA 2WP3T 4PRHE 1BFVL 1EAPB 1X5IA 3BPNC 1KXQE 3TNMB 2B4CL 4I77L 1KN2L 5SX5K 1UXWB 4KK9C 4JRYE 3UXFA 4R90L 5BZWB 1FNGA 1KIUA 2OR9L 3OWEA 4Y4HB 3LIZL 1O7SA 4FQXC 4CW1A 4BQ9A 3CVHH 3K8LA 2B1HH 3PDOB 3ZTJH 3IETB 4F7TA 2FATH 3LPGA 4YUEH 5HHPA 3MOAL 1R3KA 1R3LA 1QLEH 3NCCB 2W92A 4WW1A 5E1AB 4KQ4L 3T4AA 5KS9F 2YC1A 1MFBH 3PQYB 3RAJL 4JB9H 3SKNB 4P9HC 2XOTA 4QRSA 4LOUC 4IM8A 3UTQA 2PYEA 4QHKI 1B0GB 1RZGA 2Z8SA 4HLZH 1OGAB 1RZKC 1MCWM 3O2WL 1BPVA 2VDQL 1FN4A 2V2WA 2FO4B 3DX6A 1JCKA 2VQ1A 3UDWC 2IBZX 5IM7B 4XNQB 1II4E 5C09B 4TVSa 1J87A 1HILB 4JAMA 1IJ9A 1JPSL 2AGJL 4WFFD 4MHHG 1N5YL 1M05A 2EH8H 3L5XL 4NWTH 1PX4A 1T80A 2CDFA 1N3NA 4HUUA 3DWTA 4ZO7A 4AT6B 1IM3A 4RGND 1QQDB 5EOQL 4YZFE 1RIHH 5DJDB 3UTTA 4Y2OA 4I3SL 4NQSB 5EZOH 1T22A 4Q9CA 5IG7B 2X4PA 4N9GB 5C0EA 4HK0B 1U8MA 5D7SH 4BZ1L 1LP9E 4JO3L 5L2KE 3O41B 3RTQB 3MBED 4AK1A 3HA0A 1JWMA 5LXGL 1U36A 4MZ3A 3ZKNC 4WV1A 3N1MC 4NUJA 4PJDE 3CFKB 4NO5A 43C9A 5EU6A 1XIWC 1DUYA 2FJGB 2I27N 2V2XB 2QHLA 2FIRT 4Z7UB 5BVPH 5F3HA 1JI1A 1MREL 1M7IB 4CMMA 4TULH 3PIQB 2BSTA 1BP3B 2J8UE 4QRUB 4ZYKA 3E6HA 3MYJB 3O4OB 1DBBL 5JPNB 4ONOA 4LRIA 1XR9A 4P4RB 4NUGH 1S7QA 3UJIH 3EYVB 1MCWW 4O4YH 4LU5H 2BSSA 1GVIA 1ZEAH 2V17L 1A3LH 2WP3O 2NX5E 4G9FA 1T21A 1I7ZA 3VXME 1S3KL 5B8CA 3QIWA 4DZ8B 1F90L 1KJ2L 2HLFC 1GOGA 4ETQA 2PR4H 5TGBA 3KG5A 3MLRH 3O4LB 3PABA 4JQXC 1ZT4B 1T5WA 2J88H 5DHVB 5I8EA 3V0AC 2AJZA 3FB7B 5F89A 1GRWA 5EZLB 1A6WL 1UWXH 3OB0K 2DIAA 2EIZA 2R1WB 4XCCH 1Q9OB 4ZMAT 3KLSA 3FFCA 2GYSA 1A1MA 3U1SL 3ILPB 4P99A 3S37X 4PJHB 3MRHA 3QXTA 5FO8B 2ZUWA 1H8SA 2A74A 5E2VH 5I1DB 3H9SD 3R4DA 5KS9E 1W0VA 5JOFA 1Q9LB 1P7KA 2EXYD 3JUZA 2R2EA 4Y16C 5GS1A 1RJLB 4U6HB 4OZHB 4NZTL 9CGTA 3SJVE 2OI9C 3C5ZC 1QPXA 2D9QB 3U9PH 5DYOB 4KVNL 4FNLL 2CDGA 2ZUQB 2DLTA 3VRIB 3NFPA 3P30L 2HJFB 4LKXB 3PHQB 4JY6B 1HYSC 5T3ZH 2AJXL 5DUPL 2KQNA 5HI5D 1CT8B 4HKXA 5DT1H 3OKOA 4FP8L 3UC0L 1OSZA 5L9DH 5HGAA 3I50H 3PL6A 5DEGB 1A1NA 1IAII 1OLZA 1FC2D 1I1AB 1YYML 1P6FA 5TDPA 4F7EA 3QXVA 3HKFA 1GC1H 3BN9C 3O11B 1HWHB 5E08H 1JMZA 1TETH 2FH6A 5DD3L 1Z9OA 3HNTL 4QY8B 4GQ9L 2CLVB 4G8GE 4L9LC 5EO1A 1ZGLA 1FE8L 3PWNB 2CLZB 5KANG 5BZDB 5HGBA 2Y9RT 2H32B 1V7MH 4Y19D 4RNRA 2Z31A 1F6FB 4H0IA 4M1DH 1OAYL 5FECA 4CJ1A 2FX8H 1PSKH 4J2XA 3TWCL 2ZG2A 5L7XH 1AGEB 3C6LD 4KJWC 1UCBH 2MQ3A 3NTCH 3PJSB 1IM9D 3ULSB 4BUGA 4NBXB 3K81A 4ZAKB 5E2JA 5EUOB 3O8XD 5F7UA 2P7TA 1FSKB 4LSRL 2H26B 4YHNB 2UY6A 3CFDA 3OB8A 4JVWA 1AXIB 3VXSE 4QOKA 1Y0LB 4C56B 3HI1B 1XGQB 1YJDC 3GEWB 3MJ9A 1TIUA 4YK4B 1DLHA 1NGWA 3TA3C 1IBGH 1I3RA 3HCVA 2WINA 5FA4B 3MOBH 3JWNC 4U7MA 2J6EA 3QUZC 3HG1A 2GCYB 4EVNB 3C6SA 4DQOL 1WC7B 4UQ3A 3OG6B 3EGSA 4D0DB 1WTLA 2P5ED 2J3SA 1T89A 2NW3A 5D7IF 2H45A 1MFEH 3IXAA 3AMKA 3LY6A 1N2RB 1PKOA 4OCWL 1IC4L 2XTLA 4IBLT 1IZKA 5D7LE 4DN3H 1C7SA 3NCEB 2X10A 1J11A 3LVEA 3JXAA 5FHBL 1ZHBA 4NQCB 5K9KB 4OGXL 3T0EA 3KR3L 4C4KT 4O2CA 5AD0A 1DN2A 1OWRM 2X1XR 2UYLA 1A9EB 5IR1A 4WO4C 5IBLC 5D8JH 4MYWB 4P2OD 4RFEA 4TSBL 4PJEB 1KJ3H 2D31A 5E8PB 5IW6B 1P7QB 2EZ0D 1HHJA 3B9VA 1GGCL 4MWFB 5E1HB 4NQEA 5HYJE 2DIJA 3ZYIA 4UU9A 4KK8D 5EULV 3BSZH 3GNML 2QL1A 3KPLB 2DICA 4XCFH 2Z8VC 1ZHNA 3WXVH 4CVXB 3WE6A 1CIDA 5IFAL 4BH7B 4M61B 2DTML 4E9LA 5C0DA 4LAQH 2CDEB 2XN9