2O4EA

The solution structure of a protein-protein interaction module from a family 84 glycoside hydrolase of clostridium perfringens
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
165
structure length
165
Chain Sequence
b'MGSSHHHHHHSSGLVPRGSHMASKLKEAAEVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIEGTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-GlcNAcase nagJ
molecule tags Protein binding
source organism Clostridium perfringens
publication title Three-dimensional structure of a putative non-cellulosomal cohesin module from a Clostridium perfringens family 84 glycoside hydrolase.
pubmed doi rcsb
total genus 13
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o4eA01
5LXVA 2OZNA 4WKZB 2W1NA 1QZNA 3F2LA 2VN6A 4DH2A 5G5DA 2O4EA 1ANUA 2VN5A 3BWZA 2Y3NA 4IU3A 4IU2A 4UMSA 2B59A 4N2OA 3GHPA 4UYPA 4WI0A 3FNKA 4UYQA 1G1KA 2ZF9A 3KCPB 3KCPA 2CCLA 2XDHA 5K39A 3UL4A 5AOZA 4FL4B 3L8QA 1ZV9A 4FL4C 1AOHA 4U3SA 1OHZA 2JH2A 1TYJA 2VO8A 2BM3A
chains in the Genus database with same CATH superfamily
1AD0B 3F6LA 1UXMA 3CMOL 5KJ7E 5EU4A 4LNRB 4JN1L 2NSXA 2BVPA 2HRPH 4FJYA 5E56A 2FJHB 3U6RB 5J5EA 1QZ1A 4EBQL 2ZOLA 5LGHH 4Q6IC 2H9GA 3VJ6A 5T1LA 5I1LA 4I13B 4JDEA 4OM0L 5IMOB 3W9DA 1I9EA 1RV6X 1WGVA 3WSQH 3WL9A 1AI1H 2A77L 3HS9A 4NHUB 2C3VA 1F2QA 3C75A 3UL4A 1U41A 2VAAA 2NZ1A 2EE3A 5DQJA 3V4VB 1AKJD 1HOCA 3D33A 5FGSA 4W9CC 1A9VA 1FQ9C 4YDZA 5JO5B 5J1AA 2TSAA 1RZJL 2XTJE 3JV4B 2CGRH 1KGUA 2WVTA 4J3OD 5J11B 2N3JA 4GYBA 4U1IB 2WLZA 3VXPB 1FORH 4HOMA 5D2LB 4OTXH 1MELA 4AZ8B 4ABVA 4Z95L 3BH9B 5ACLA 3ULUH 4DTGL 3QDJA 4PS8A 3V79C 4A37A 1SMDA 2N1KA 3P02A 3HR5B 3LY6A 1DBAL 3NIFF 1U8HA 3DO3A 5T5FH 5I8CB 2BOCA 2HFGH 1TPXC 2FJGA 1E5BA 4FG6C 4XVUD 1SOSA 3JUYA 3J2PA 4LSVH 3RGBA 3L3IA 3NN8A 4MDRA 4GRWF 4ZMQA 1UJTA 2O61B 3G5ZB 4KH9A 2D9CA 3MRBB 3M17A 4YFLI 3UG3A 4PCKA 3RURA 5LGYA 4B41A 3GMNA 4EAEA 5E8NB 4I85A 1LO2H 5KJ4A 4BSJA 4G9FD 3FTGA 5D2NC 5HI4D 1RZKH 2IGLA 3BZ4A 2CM5A 4Q0XL 4F93B 4JO2L 3H4HA 1S3KH 5C07A 1OLZA 3G5YB 2YGOA 1IEBB 4XBEL 1AKPA 5E1HB 3Q3GB 2CHDA 1ZVYA 3OV6A 1T1XB 2NNCA 3CC5A 4P2RE 3I74A 1T22B 4KC3B 4L8SB 1LP9B 1FZMB 5JDSA 4AL8L 1U8CB 5IEHB 3RL2B 1IC5H 3V0WL 2BP0B 3C5ZC 5T33H 3HVDA 4Q56A 4PLNC 1IARB 5FYJE 1JZDC 1KY7A 2BNUB 1N0XL 2COQA 4I3SL 3OXRA 4PTTA 3BSZA 2DQFA 4M3KB 3FT2A 3WNNA 3BW9B 1ZTMA 3MCKB 4WFFE 5FC9A 4JHUA 3E2HC 5JORB 2BNQE 3WY1A 3DIFB 5GS1A 3EYVA 5CLXA 4O51B 1ZHBB 2H47C 1MFAH 3ZYOA 3O3DA 5DRNA 1VAHA 4HJGB 4OZIA 3LKOA 2L8AA 2R2EB 1EZSA 2XQ0A 3RY6A 2RIKA 1OOWA 5C0JA 3CZUB 3V4PH 1B90A 1D6EB 4OT1H 3JWOL 4R4BB 4XP1H 4G1EA 4G70B 3HG4A 1R3IH 2NX5A 1B4LA 3QAZB 2UXTA 4AGQA 4F33A 1KPUB 2Y7LA 3O2DL 1PSKH 4OZGE 4YDIH 4AUYA 2FX7H 4MJ6A 1RZFH 2QPSA 4FQQB 3E38A 1FZJB 4KGLA 1R3HB 1YJDC 1ZOXA 2RFXB 3WFBH 4NRYA 4YBHA 1CXLA 1MW1A 1FLRH 3CDGB 4J3OF 2PCXA 3T3PF 4BDVB 1P84J 3TM6A 4EMZA 1J05B 3RU8H 1OPGL 1PZCA 5EF0A 4LAJH 1KLUA 3SE8H 3BGAA 2OQJB 1FZOA 3MRMB 1PLBA 2EIDA 4NPYB 1MHEB 3TBVA 2FK9A 3KPLA 4N5ED 1FO0A 5CJBA 5E9NA 1ZS8A 5DSCB 1VA9A 2N0MA 3I50H 1R3LA 3ZMNA 3S35L 4HWZA 2Y5QA 2XI9A 4FL4C 3QFDB 3NCFB 3B8YA 1SRDA 3MUZ1 3F6JA 2V7NB 4YWGL 2GK0A 5I71C 2ZXAA 3AG3B 1KYFA 4L37B 4IRZL 2A6KB 1MPAL 2D3VA 1BX2A 4PJEB 4XAKE 5TDOA 4ZTOL 2P8LA 4MA3A 3T2NH 1R3KA 2CHXA 3TEWA 4UF7C 3SPIA 1HTYA 1IAKA 3MA9H 4OZHF 1D2PA 2HVJA 3QDJE 3QUXD 4MMZA 1UCTA 4B9KC 4GJTB 4YJZL 5A2KH 1PD1A 5KBDA 4PJBB 5E9DA 4I2XA 1D3CA 5CN1A 3X12A 4PLJC 4OLWH 3IYLW 3IVKB 1YJDH 4ZQKB 4Z3TA 2Z31A 4ADJA 5TE6L 5FO8B 4LSUL 5EOCH 2AJVH 3A0OA 3T4YB 3G9AB 2VLJB 1R5VA 2WLMA 4XMPH 4D7PA 3SE9H 5EULV 2UX6A 2VT0A 5BVPL 4F15B 2RQEA 2DI7A 4QOKE 3QUMB 2YKLH 4FMFA 3SIKA 5CIPB 2XACC 3BD5A 3HTLX 4UM9B 1MY7A 1SPDA 1XMEB 3PXJA 3S0PA 2GT9A 2WP3T 3VWJB 5SWSD 2O30A 4MGXA 4YDLB 3WYRA 3KPNA 2X2HA 4GW1B 5GS0D 2B1OA 2FZ3A 4YXHL 4IW4C 3MGAA 5FM4A 3GIVA 4PJFB 4HJ0C 4Y4HA 4UZSA 5I24A 3VFRA 3FUIA 1VB9A 2P8LB 2P44B 1EDHA 3BPCB 3OPZH 1RUQL 5AB2A 1KEGL 2E7HA 2ADJA 4OLXL 4FXGA 3KHQA 3R8QA 1FYTB 5IFJA 1NEPA 3GS4A 1RUMH 1RLWA 3HZVB 1MQ8A 2JELL 1KN4H 3HC3L 4H0LC 5ANME 4QF1A 5IB3B 4Q9QH 3VSUA 1FIGH 2QMKA 1T20B 1XWVA 2OA9A 4OAWA 5DJCA 5EC1A 2F54D 2OXGA 4WHTB 4I0KA 3BVXA 4HU8A 4D9QD 1RHHA 3U0PB 3ZE2F 1BJMA 5D2NB 2XG4A 1F90H 3G6JE 4PRPD 5DJ0B 1PQZB 1J18A 1JZHA 5GRWA 5F9JB 2OR8A 3ATFA 2YAEA 2DQMA 4OLZH 4AL8H 2KDYA 5ISZB 3STLA 4M9OA 4Z23A 2VXUH 4NO2A 1J10A 2XPZA 3INUH 5AW5B 4S1QH 5DEGA 4BYHA 3K74B 4LLMB 2HFEB 2HLEB 4OF8A 2HFEA 4YHOH 3G5XB 4ZUTA 1Y6KR 5L6YL 4Y4HB 3FYIB 3NIFE 3MBXL 3DO4A 1M2VA 4I4WB 1HNFA 3QH3A 4RMWA 1NLBL 3QNYB 5K59E 3DI3B 2W92A 1SYVA 4IRSA 5GGSA 1AP2A 1O6SB 2QKIB 4WHTA 3PABB 3MROA 2P49B 4H1LA 3SDXF 1OSPH 3R1GL 1TCRA 1EO8H 3FCTA 5H94A 4FTVE 1VFUA 3MV9E 3TEZA 4HH9A 2FIKB 1XR8B 5K9JH 5AYQA 1XR8A 1ZV9A 3PHAA 4B95C 3NFNA 2NUPB 5AD0B 3D07A 5E08L 4LPCA 2NT0A 3I3BA 1ONQA 2IQAA 4C59B 2DKUA 2YD3A 2AAVA 3DX4A 3O2DA 5I74C 3GIVB 4PJFA 5BUPA 1T6BX 2IF7A 4MXVF 5DFVC 3I6SA 1IAII 3QDMB 3G5VA 2UZYB 4F58L 2EXWC 5H37H 4OZIE 5IMKB 2W9DL 4WTWA 2AP2A 4YSQA 1C08A 4HD9A 3KYMA 4D9RD 1YY9D 1SEQL 3IDUA 3MRPB 3L3HA 3WLWC 1KCRL 3WFCL 3TCLA 3RY6C 1FRGL 2CDGA 4JLRA 2IBGA 3HCVA 2CSPA 3PPEA 5TTRA 4TF4A 2H6PB 1Q94B 3ZHLA 3S36H 1CIDA 3HE6D 3GMNB 3MJ7A 3QDGE 1DP0A 3S8WA 5AL8A 3TN0D 4NS0A 1CBJA 3IJYB 3KPPB 4NUPA 4QHMA 1FNAA 2NY5L 4PJAE 3BHBB 2ZXEB 3T5WA 5I17A 4LGSB 3BUYB 5I1IH 3KPRD 3BAYA 4ODWA 2X88A 2Y72A 4IRZA 3VDBA 3VXNB 3DPBA 4BBWA 2IMMA 3IGKA 4XN1A 3BP4B 1Q38A 3QPKA 2FX8L 2N1TE 3UX9B 4ONHA 5TDOB 4BDVA 4MX7A 3OX8A 3VXRD 2ZCKH 2FBOJ 4QTIH 1P2CB 4OLWL 4D0DB 3PREA 3WU1A 1PZSA 1H3GA 4WTQA 5AVUB 4OFYD 3OB0H 4X5PA 1HZKA 4POZC 1E5UI 4WNJA 5BRZA 5C0IA 3KWXA 1GZHA 1Q4NX 4HD5A 1HCZA 2WWKO 5GRJL 4LHUB 5T5NF 3ULSA 2HX7A 1JZ2A 1ZGLB 4KJQC 1X5YA 3FB7B 3EJZD 5EZIL 5HDBB 1TVHA 1ZRUA 2PP7A 2V3DA 3O6ML 4K8RH 1ROCA 3O0LA 3T8XA 3DGGB 5DFTA 4Z7QF 5CM1A 3A6CL 4XMLH 3CDGA 2JKRM 4D3CL 2DIJA 2IH3B 4Y2OA 3L4ZA 4HMCA 5LG1A 1MCWM 3I9AA 3VXUE 4G9DB 4FGMA 3X1NA 3HNTH 1FZJA 4PTTB 1OSZB 4JFEA 4PB9L 4FTDA 3GRWH 4PG9A 2XDHA 4JAMB 5FW6A 5F3BB 3QJHB 1H6EA 1JYVA 3A21A 4NRYB 3WXWL 4PJ7B 2VDPL 1WWWX 1V8HA 2BP0A 2DBLL 4XBEH 4ISVA 5FGBA 2IAMC 1LE5A 3R7QA 3AU1B 2APBA 2ZWKA 1DFXA 2EECA 5JHDA 3GEWB 5MI0C 1Z9MA 3WNPA 1NM9A 3LV3B 3MJ8B 4DTGH 1T4KA 3RWFA 5EEVA 1BZ7A 3H6JA 5DZJA 1QMUA 2R0KL 4Y16B 4MDJB 5L88L 1O7VA 4PQXA 1NIEA 3EYVB 3FOLB 1PZ5B 1IBGL 2CDFA 2X4SB 3IT8D 3OAYH 4JO5A 4ZTPL 1H6UA 4F8PA 4I3SH 5F97E 4MWFB 2ZAHA 1VLXA 4W6WB 4NKOA 4MB3A 3VM7A 2Q6WA 1IGCH 3CHPA 4WSGA 2FWOB 5FYLE 5MP6L 5CEZD 2X70B 4P5MB 2FLBT 2WLKA 1DSFH 3TH3T 3V0AC 3SDDD 4DT2A 4R96B 4WWPA 1F4XL 4K2UL 3HUJB 3DRTB 1FFPB 3QXDB 5I1AB 4ZMWA 2QGEA 3IFNH 5CCKH 3EGDA 1XD1A 4NIYE 4GXVL 1XF3B 5K39B 3S7GA 3MRDB 2CK0H 1R34A 2W95A 4XBGA 1NUFA 3T3MB 4MD5A 4R97B 4UQ3B 4YUEL 2ZOKB 4U1HB 4UMGA 4M61B 4XMXA 1AQDA 5F7YC 4I0PB 2W8CA 1ZSDA 3OAWA 2AJSH 2A74A 3BZ4B 4WHYH 3L3GA 1PTZA 3VMOA 5IW6A 5J3HC 4DGYL 5DVKA 5EU7E 3A6BL 4HC1L 5KYUA 1BQ5A 3WFBL 4MHHI 3V4PA 3KJ4C 3I02A 1D6EA 5HVGB 4JY5H 1MHHA 5D7JA 3SCMD 4EDXA 3PQYD 1YYCA 5EUOB 4HAGA 4HT1L 5EU6E 1A4KA 1F86A 4OU3A 1SLUA 2AF2A 2VDRH 1JIBA 1AGCA 2AMGA 3U30B 5FUCC 2WXOA 2AJXH 4G9FA 3W9DB 3CDFA 2JCCF 4G9FB 4LLWB 4OGQC 1GZPA 1QQDB 3FT2B 4NUGH 3TCXA 1NGQL 2A3TA 2Q76A 2BOCB 1XBRA 3B7SA 4YGVB 3D4GA 1HYSD 5DJDB 4HGWB 3VRIA 2LOEA 5ALBH 1CYXA 2EDNA 1FVCB 3FTXA 3B43A 4X99A 1AR1D 3A47A 4IBZA 4S1SH 1U2YA 4L9LC 2K0RA 4OZ4A 5KYWA 2CWRA 1HHGB 1U91A 2CBQA 3KLKA 5J1TC 3A22A 1J8RA 1KULA 4PJHB 1YC8A 3HG1A 1FG9C 3GGWA 3DJZA 3PWVA 3E6FB 4XNUL 4NBZB 1BQUA 3IJ8A 4ETYA 1UXWB 5I1CL 4JKKA 2XETA 3J27A 1II4E 3H4FA 3FU3A 2KLTA 1LWHA 3U6XA 1L7TH 4PHZA 3ZX1A 3ZDZB 1RHFA 2HLFD 3T0EE 4UM8B 4EQ3A 2Q3XA 3SE8L 2BVOB 3K6OA 1M4KA 3A67H 4DKEL 2KLSA 5KBPA 5LNEA 4MXWH 4J1UA 4BK8A 1QFWM 3B2VL 3B4NA 5C6TH 5EOCL 3CFNA 1BFVH 2FX8H 2ICEA 4DPAX 1IX2A 3HNSH 3L3IB 2FJHA 3I6LD 5F6HI 4JQIH 1QSFB 3HHSA 4LMQE 1KGIA 5ESAB 1AO7B 1UGNA 2GJ6E 3FN9A 4B27A 3O6LH 1C7TA 1HSAA 4AI7A 1G0YR 2EDWA 4E42B 1B2WH 1AXIB 5FXCH 1PZ5A 2X4SA 3LHPH 4HSCX 2C9RA 1PY9A 3P2TA 4LPVA 5IFHH 1IKNC 3K6SB 3QQNA 4PJ8B 4LKCA 1HI6A 1L0QA 4N6RB 2NXZB 4OZFG 5BO1L 3BQUD 1BXXA 4M48H 4ZYKA 3P4LA 1BXUA 1TJHH 2AXHA 4JNXA 1SZNA 4EI5B 4PP2B 2FYYA 4E9TA 1FIEA 4PVBA 2OL3A 1R24B 5DVMA 4U4IA 2I69A 5CKAA 3FQXB 3UAJC 3NFSH 3E3QC 3SHSA 1ZT7A 3GXDA 5I5JA 4HHAB 1IZKA 1RI8A 4YGVA 5I2IB 1ETB1 3IS0X 3KCWA 1K4DA 2CLZA 2YKLL 3G6JA 4MNGB 4Q9BA 4MCZA 5I0DA 4RFNB 3ZGHA 3MR9A 5EEXA 2XV3A 3BESR 5KTEH 1A65A 1XCTB 2JB6B 1X9LA 3IXAB 3EFFA 3NFPB 2PO6D 3C5ZA 3NACH 1K85A 3FU7B 3TPUB 5F9OL 3ZR6A 3FB8A 1I8IA 3HOGA 3VG9C 2HCZX 1LE9B 2C9VA 3E6FA 1ODAA 2IADA 3TA3C 3B1TA 5L88H 4F2MB 3ECVA 2VB5A 3HMWH 1RK0A 4KXCA 1OGAA 4A55A 4XGZB 3HB3C 4X6BB 3IK2A 1QQDA 3H3BC 3QIUB 4JG5A 4QHKI 3RBSA 4TPRH 3OR7A 1DDTA 3WJMB 4UT9H 4PJ5B 5J06A 4O5LL 3KPQA 3TEXA 2HFFB 1IFRA 2DQTL 2PPDA 5BW7A 4R9HA 1HINH 2FB4L 3R19A 4MJHA 5HYSB 3C5SB 2V2WB 5D72L 1D5BB 2G3MA 1YNTA 3B2MA 4J7RA 4E5XG 2DWEA 5CCKL 3GSRA 2JWYA 5GGTL 1DQKA 4LHUD 3I6KB 5F1SA 1WD9A 5C97A 4AVJA 3N9GL 5MENB 4OB5L 4R2GC 4IQHA 2FUQA 2OMUA 2OZ4L 2WNXA 1ZSHA 1KENH 2C7UA 1YEDA 2JKXA 4JPWL 2H45A 1N5YL 2GAZB 4BUGA 1HVXA 1AG6A 2DMKA 1NBYB 4QKXB 1SF5A 3MJ7B 3RGVD 4M61A 5J12C 5HHOB 3BT0A 1ASOA 2ZUUA 5EEUA 5J4MA 4P2QE 5IHWA 1UA6H 4P3CH 5KVFE 4IRJC 5GZND 4E9SA 1FFOB 3DV4B 1H5BB 4DWHA 4RWHA 5HVHB 4KNSA 5IHUH 1QRNB 3NCEB 2E3VA 3IDYC 5L9DL 4IBSA 1H6TA 2V3EA 4NO5B 3BGMA 1JWSB 5KAQF 3GSVB 4I5BB 5E6IB 2TAAA 3HMXH 5LAXB 4APQC 2ZX6A 5L0QB 2F15A 4Y8DC 1BAGA 4HPYL 1OTSD 2P43B 1IC7H 4HWEH 5MERA 4KZEH 2VDOH 4X98A 3L6FA 1RVFL 4KZDL 3HI5L 3RVVD 3QJFA 1MFNA 4OCYH 4NQUA 3CQFA 4OQTH 2BHUA 4FCAA 4BK5C 1NJ9B 4N2CA 2MOVA 4PJAB 4BHUI 2J6WA 1F6LL 1TSRA 4D0DA 2VITB 3TBSB 3LEYH 1G7JA 4OV5A 4NM8H 4CDHA 4FEMA 4UZGA 5DMGC 1N0LA 1SBBA 4X5WA 4F9LC 1I85A 5C0AE 4F8OA 1RIHL 2QJDA 4OFYA 3GUTA 2V8LA 2OM5A 1ILSA 5IVXB 2EO9A 5E2TL 4Z7OF 2VDRB 4Y2DC 1VFBA 3ARGC 4XCYA 3T0AA 1AQKH 3S34L 4AM0Q 1FF5A 5I0XA 1QUNB 5CEXB 3OWEA 4PVNA 4GUPA 4FHKA 1OIOA 1S5HA 3S36L 3L17A 4GKZA 2IPTH 3B6SA 2WYIA 3WJJA 1UYWL 3C2AH 1EDQA 4NSKA 3RWGA 3Q43A 4Y19E 2VR3A 3FFOA 1G7IA 4GQPH 5D1XC 1ED3A 5FB8B 4AK1A 1VIWA 3KYKL 3ECWA 3D69B 1PW3A 3ESMA 1EFXB 5C0RH 3PGDB 4JPIA 2QQNL 2IDCA 2YEVB 1MWAB 1T20A 3POHA 5F89B 1NDMA 1G1OA 1EXUB 5CEZE 4K94C 1JK9B 2LTQC 3NIGE 1UD4A 1CZ8L 2HUHA 2VR7A 3NCCB 2IH9A 4WEMB 4Y4FA 4HF5L 2BJMH 3EYSL 3CG8A 3U79A 4OBSA 4ONHB 2YA0A 4X9IA 3MLUL 1DQLH 4XN5A 1XGTB 1Z9SA 3ISYA 4JRYB 3A4AA 2OJZH 1UKTA 1TUPA 1IAOA 2X4TA 1IT9H 4OCXL 1L6ZA 2J5LC 3ZKQD 3VX0A 1IB5A 2YPVL 3O6KL 4KKBD 4YHLL 2E6PA 1E4KC 1EEYB 3FUMA 1DYZA 4JRXE 5IJVB 5I75B 1BA9A 4Z7WB 3UTZA 1S9XA 2ZF8A 5BRQA 3FQUA 3Q5YA 1BVZA 3CTTA 4EIGB 4N0UB 2FSDA 5KVDL 4UT6A 2PYEE 1G6RB 2W1NA 2YPLE 4AENA 1F45A 2JI3A 3FO1A 3UXFA 1JGLL 2ICWI 3VSTA 4I2XE 1CFNB 1AO7D 2QHRL 3IDXL 3BAIA 2DQUL 3MJGX 4ADIA 4D8PA 2VR5A 1DQQA 5CJXC 4HJEA 4HKBA 3RHWK 1BXAA 4OGAD 3CSGA 5IGXH 1MLCA 2E9BA 4FL4B 4XX5A 4DKTA 1JXJA 4YVNA 5SWSA 3BWUC 4YHNA 4LOUC 1YY8A 3UMNA 4EI6A 5KVDE 2EYTB 4DGYH 5DZPA 3N0PB 2D2OA 3BQUB 4V1DB 2ICWB 4JFTA 5E8PB 1J12A 4RGOH 1FAIL 3LQMA 1M6UA 5AFAA 5KS9E 5ADPH 2DM4A 1YEKL 1DEDA 3P4MB 4Q8BA 2NY6C 2EUXA 2DICA 2X0WA 2MHAA 3FDWA 3FCTB 3T65B 3V95A 4YDJB 3LZRA 1WA1X 1OPOA 4U2ZA 4AQ1B 4NQXA 3S96A 2R2HB 2OXGB 1IL1B 4KQ4L 3WIIL 3BGFB 1L5GB 1AOZA 4FOMA 4PYHA 1T21B 3VE0A 3IDIA 4K5LA 4E9XA 3BVTA 5J1SC 3SY0A 3NESA 1IC4H 2APFA 1RJLB 2ZCLL 4FQ2L 5I0YA 3BO8A 3CBRA 3E1F1 3QORB 4PJEF 4WI6A 1DQQB 3APDA 4JRYA 4M1GH 2MQGA 4AKPA 1BFTA 3L7FB 5FR3A 3WO4B 2O5NA 2VC2H 1TMQA 3DX0A 4XNUH 2LQRA 4FQQA 5IQ9B 2WZPA 1ZGLP 4Z7OE 2EXTA 4JK0D 4JM2F 3C08H 3ZW3A 5IJVA 2IPUG 4KPHL 4PB0H 4AGNA 5HBBA 3ARED 4HIIB 3O3UN 1TYRA 2ZUWA 4E9QA 4PJ5D 4A2DA 5I30L 4TQEH 5JXAL 5FO9A 4L3ED 2ARJA 4AIEA 3QHZH 5E94B 4JY6A 1A2YA 3VGDA 2BCKA 3PWUA 5CUSL 4K07A 2Q5BA 3S35X 3HNVH 3UZEC 4JFHE 3L54A 3PY9A 1RUPH 3ABZA 4RQQB 3SDCC 3Q1SL 5DZOA 3RB5A 1TTCA 2J8HA 2FD6L 4ZSOB 1A7NL 2Q8AH 2OTWB 2V9QA 1HYSC 1S78C 4U6XA 4YQXH 5C09E 1ETJA 3T6VA 3HE6A 3RGVB 4IGBD 1EO5A 3X12B 3QA3B 5FECA 5EMYA 1V3LA 4BKLB 4BZ1L 2YWYA 4OVVA 5EA0H 2NY2D 1MCLA 2ED9A 2QSQA 3CMOH 2Y5TA 4JUSA 4MNHA 4PJCA 3CWGA 4MYPA 4PGDA 3PWNA 1CICD 2P24B 2CO1A 1KTDA 1JD9A 1X9RA 4A66A 3HC0B 3GHBH 4FERA 1EAQA 6TAAA 4O58L 3KPLB 3ARVA 5IP4A 1OP9A 5BQ7A 3Q01A 3X14B 4LEBA 3UERA 3BUTA 4P57A 4NEHB 3ARTA 3L5JA 3MC0A 2VLJA 4TSAL 3T9WA 2PCYA 5CD3B 5FPIA 2DTML 5JHLA 4HIEB 4RFOH 5B7FA 2F1EA 1MJ7H 3DUHA 3LXBA 2P1YA 4MKMA 2ZG3A 5E6YA 5J7CC 3RVWD 4XP9L 3WE1A 1D6VH 1JZ5A 4WO4C 5HGAB 2XWJB 1R3KB 3DO7B 4H13C 3PP3K 5FW7A 3BMWA 1SJXA 5F70A 3R4DA 1C5DA 3GI8H 5FCUH 2HVJB 1QRNA 1ZLVH 1EAPA 2W88A 4KH2A 4TNWF 5JIPA 4G6ML 4P9ML 1ETA1 2YR3A 1FBIH 1AHKA 1ITCA 1JWSA 3M6DA 4KRNA 3BYYA 5IHZA 1DBAH 4FZEH 2FEDD 4WWID 2YZ8A 4N2LA 3ZQWA 1MQKH 2IEPA 1NAKH 1S7VB 2YAFA 3BEVA 4WEBL 4W9KC 5AWNH 4K4KA 3RKPA 1KXVA 3QIWD 1S7XB 3ALWA 3IXTB 4OSUH 3ZT6A 2PUQT 1HKLH 2CGYA 2J43A 4YPGA 3A4EA 2K3TA 1AS8A 1KBWA 3UBXI 3U25A 4YMPA 4HHWA 1S7QB 4PMFA 4DK5A 2FB4H 3N44B 3WOVA 4YE0A 5ID1B 1IM3B 5E5UB 3RDTD 3MXWL 4EIZC 3GFUA 4IOFD 3TFKD 5C0JB 3OKMA 4P8QA 5F96H 1Z9OA 4M7KH 3ARFA 1CE6B 1JK8B 5MHSE 4AEIL 4FNUA 2WKLA 5HYQA 2OSXA 2VGLM 1C16B 4X7TA 4KTEL 4MYWB 5GRZA 4XOAA 4M8VA 3SJVD 1UT9A 5DT1H 4F33B 4FYQA 4UMSA 4YE4H 2OMVB 4L1LA 4EOWL 4EN3C 4X6CA 2IAND 1WO2A 2VE6A 8FABB 4YZWA 1R47A 5EG6C 3F85A 3V5DB 4JFQA 4FG4A 3VWKB 4NC2B 5DVLA 1U8QA 5C7ZA 1YDPA 1T3FA 4RGMB 5HI5D 1ML0A 2G2NA 4LLDA 2NNAA 3ULVC 4QRPD 4WK2B 2X4QB 2IALB 4I1PA 2DYSB 1CICA 4PJFE 2VZSA 1U93B 4NFCA 1AY1H 1UD5A 2NY1D 4G8GE 4P2OB 7PAZA 3B2UD 4YFDB 5EUOA 4MXVE 3HG1D 4LVHC 4OI8A 2CLRB 2PW2A 3O45A 3VXTB 3BN9C 5ABDE 5BOJA 2C1PA 2XQBH 2WUCL 4GB9A 3TA3B 3WTUA 3BVVA 1J5DA 5D7IA 1JHTA 1S7SB 3TJHC 2CCWA 4FI7A 4J8QA 3TJPA 2BY1A 4XB7A 4KU1A 5D7HA 4GW4A 4ZODA 5DRXA 2H32H 4Q14A 1PZ3A 4U1LA 4KX9A 4OZFB 3AY4A 4ZNEE 4P5RA 4DNLA 1XZ0B 5FV1L 2K45A 5DFAA 2F7PA 5CD5D 1USZA 2GCYA 1IO4C 4JFFE 1YN7A 1YMMA 3NN8B 3S5LB 4OI9A 1UQSB 3V4VH 4LCIH 4PWKA 3Q1SH 5JO5A 4XC1L 3ZL4H 5HYJA 1IAIH 4WKXA 4NX0A 2OL3B 2ZOWA 4QRBA 3GPEA 4F3FA 4FD0A 2LT9A 3D25B 4X9GA 2CAKA 5FHAH 4Y4KC 2Y6TE 3DTUB 2CDFB 3MFFA 5T1LD 1PL3A 5CJQH 1CLVA 4FP8H 3RNKA 3CFTA 5B7MA 4O2CB 4F80A 4E68A 3GB7B 4PY8I 3BPNB 4ZFZA 4YL4A 3QDJB 1BGXH 2VC2B 3ELQA 2HTKC 4W6YB 2IGFL 1S9KC 1A25A 2W59A 4RIRA 1H15B 3LEYL 3OKLB 3OKLA 1RK1B 4M93B 2G75A 5F2FA 2K6ZA 3LTVA 1NPUA 4ZUUB 2JKJA 1N3NA 2GFBB 2OXHA 3D08A 1J8SA 3QQDA 4I1NB 4E41D 1HOCB 2E4TA 3LQAL 5JYLA 3SDDA 2VNCA 4KHTH 1AJ7H 3CFBB 1SN0A 3QORD 4R0LC 4TUUA 3KLHD 4ODSL 3EYSH 2K7PA 3JTSB 4GINA 4XHJD 3BLPX 5E6ID 4ZFOB 3WIFA 3X1GA 1OF2B 5DK3A 5I5MA 3WS3A 3O2WH 4FXKA 4L9DA 4LPYA 2VAAB 2CG9X 2Y5EA 4YBLC 1CDGA 2VRQA 2DJ4A 2IOOA 2NDFA 4XP9H 3BEWB 4ZFZB 4R26L 4AJVA 4DSYA 1ROWA 3F58H 5FM5M 1E6OL 3FB7A 4MRBA 2XN9E 5KSBA 1O9ZA 1LO0H 3KYKH 4G6MH 4P9MH 3RBGA 3GINA 1U36A 1E0OB 3ULUC 2ZXQA 3LKSB 1AE6H 4NN6C 3V0EA 1GIGL 2WMPA 1YDPB 5IJCC 1WE5A 2FLRT 1E9OA 3MNZA 5CXPA 5L4JA 1U95A 3U46B 2H3XC 2V2TB 1RPUA 1Q9WA 4OZFA 5JPNA 3KEHA 2EVJA 3VD4A 4JFZL 2JE8A 1FO0H 1XZ0A 1DJZA 5DJDA 1PG7L 3VRIB 3L4YA 5JTWA 2FR4B 5SWSE 4PP1C 5IW6B 2WZAA 2D2CC 3VFUA 3MRIA 3LIUA 4RAHA 2XIIA 3MXWH 3O45B 3N3EA 4GAJH 2ENPA 4YAQA 3TTSA 3GBNL 1QTPA 3R0NA 4Z8FH 2VDKB 4X6DF 1I3RB 2BHZA 1H0DB 1P5UA 4LRNL 2NUTA 2XIDA 3A3YB 4PV9B 1IM9D 3LMJH 4XCNB 1KXTB 3F64A 3P69A 1NGYB 4NP4H 4KTEH 1XO8A 3BQUC 3SOBL 5BRZE 2AEPH 1ORSB 3JVGC 3MBWA 4NC0B 1GY2A 1RFDL 2BRRL 5E4IA 4X9YA 3V0GA 3F62A 3VXUB 1YLBB 4QHLB 3LZFL 4N86A 3N85H 1QWHA 4NKQB 4XC3H 3UTPD 3V5DA 1PG7X 1HIML 2PYEA 2DAVA 4GSXA 4OCRL 2VZVA 3RPKA 1CFSA 2QHRH 3IDXH 3CZEA 4PI0A 4AQOA 2W07B 1T3FB 2HX8A 4U1SB 3BZ5A 4BE6A 5JHDB 1SQ2N 5BV7L 3VA2C 4UQ3A 3GBEA 3D09A 1K8IA 5K59F 4RMSA 1S7RB 3MRCA 1FFRA 4MXQC 3SQBA 4KTGA 4OLYH 1JOIA 2UUDH 5EU5B 2NY0C 1IIKA 4JFYB 3H9SE 5DTFB 1OTTC 1C5CH 2W60B 4NO0A 3E8UH 4JM4L 4C56E 4PRAA 1PAMA 3GLDA 4JM2B 1NLDL 1W91A 2GVYA 2V5YA 2Q6WB 3VD0A 4R90H 5CD3A 4R7NB 4Y16C 2DM7A 2G9HB 4KVCH 4PVMA 1OGTA 5KN5B 1NC2A 1X5FA 3NSCA 2BSRB 4ZS7L 4FQLL 3M7FB 3MV8E 2JLLA 3CK0H 3SDYH 2YD1A 4JHBA 5TE4L 4WU5B 1D7BA 1X6NA 1Q9KB 4WNQB 1M56B 5IOPA 4DFIA 5PAZA 3VCLA 1XGPA 1RJCA 3ILQD 3K2MC 3UC0H 3T3ME 4FQPA 2BNQA 3QCVH 3O6FB 4MBOA 1XH3B 4OJDH 4WSJA 4A2GA 5J0BA 2G4GA 5K9OB 4YXHH 4OLVH 4OUUB 1LE5B 2UWEF 2HA1A 3AFLA 4YHKL 2JXMA 1S7XA 2MIZA 3IXTA 3VFWA 4DETA 4G5AA 1JTPA 4N1CA 1J1PL 2WTRA 3BVUA 5DFVD 4DO4A 5D9SA 1RD6A 4F8TA 3D39E 4R4FL 2EIMB 4NZUL 5A43C 2X3BA 3QB7C 3V2AR 3T4AB 4FULA 3HC3H 4FTVA 2EDYA 2R23A 1KCKA 4X7EC 4Q9QL 4H25B 2R0WH 2E9JA 1ZGLA 4O58H 1S9WB 2D0HA 1P7HL 2ESVA 4ONFH 5TK2A 4KJPC 1TPXB 2DLTA 4U7KA 4JZOB 2A4CA 5KBLA 1VACA 1MXDA 3BLKA 2VDNL 1ES0B 5J6GB 5DZVA 4PWHA 3IRZA 4HZLA 4FABL 4P3WA 3RTLA 1S46A 1MI5D 2XXFA 3HNVL 3UJJL 4NBXB 4ANXA 4JE0A 2BNRD 5G5DA 3CNKA 1OO2A 4KWUA 2F58H 3U36A 3QAQA 5ICUA 3HCVB 1CVRA 1FYTA 4BFBD 1KN2L 5L2KE 3BAKA 2W9EL 2X1QA 3CSTA 1CLOL 1DLHB 2WANA 2ZWZA 3RPIA 4U3XA 4LCVA 2IDSA 1F4YL 2EXYC 1I7UA 1U58A 1QO3A 1KTLA 2ORBH 4JO1L 4HFWA 3SPVB 5I28A 4I48B 3SB3A 3F58L 4CSSA 1XIWA 4QXGL 4N20A 3V8OA 3ZSTA 4PW9A 3EJRA 5AG9A 5LKNA 3QJRB 4ELDA 2OYKA 4W81A 4YDIL 2EE9A 1AQHA 2VXTH 2AITA 3M46A 3OHMB 5HHXL 3DVFA 4KXZI 1M7XA 1DQMH 3CDZB 3GK8H 4EXKA 4TM9A 1LDPH 1SMOA 4MJIE 1TQCC 2XUWA 1BM3H 3UPRB 2XVLA 4GQ9L 2Y7OA 3JZ7A 3CFEA 2NW2A 1XGUB 3BE1H 3BH8A 4JQVC 2UYLB 4GI6A 4L3AA 3CN3A 1AP2B 3ZN6A 5L0QC 1YN6A 4JCLA 4EF3A 4H1LB 4OZIF 4P3DA 4KX8A 1T21A 2G3ZA 3VE0B 4GAFB 4YHIB 1OCCB 4IBLT 4B9JA 4TMPA 3VXMA 1KTKE 1MREL 4M03A 4YR6A 4HJ0D 2B9AA 4KKCC 5TQ0L 1Y6NR 1RIUH 1TQTA 3KDPB 3ATDA 5E99L 2UWEA 4OFVA 3NFNB 4PWJA 2H2PD 1BD2D 4FLQA 1CCZA 3O8XA 4XOEA 1HZHL 3VA6A 2I32A 3FT1A 5DEGB 3VM5A 2Q7AA 1KELH 1FCGA 2CBTA 3UBGA 5ETUB 4PPTA 2VABB 3ESUF 4CDGC 3NSYA 4DVRL 4NJAH 1GS8A 4A2EA 3PL6C 3KLSA 1QLEB 4CSPA 5IB4B 1QLEH 4P5KA 3BQUA 1MCKA 3RI5K 1HIMH 4EKXA 1PFOA 3SO5A 2WXNA 3LN4A 4IRSB 1ZVSA 1H3WM 1RULH 1BAFH 1HILB 5DU7A 5HJGA 1KCWA 4TUKH 3MRRB 3MOBH 2NMSA 4N6QA 4ORZC 2RBLA 2I27N 4LSQL 4YSRA 4BUHA 5F9WC 4HPOL 1TZOA 4YHML 4WVRA 3EO0B 2FWSA 4DEPB 3CIQA 2RMNA 3JWDL 2VLJE 4PWGA 3VI3B 5CINL 3WNMA 1ICTA 3QIUC 4JZNB 4OF7A 5GRVK 1PQZA 3UMTA 4ABQA 2W65B 3NAAH 4YR6B 1DJSA 2H3KA 3EJYC 4CN6A 1M3JA 4KVCL 1PDKB 1UZGA 1K3IA 2FWUA 2CO7A 4A2FA 1EXHA 2OP4H 4M8RA 2XKNA 1U3NA 4NT6A 1RMFH 1CLZL 3GTVA 4GRMA 1KXHA 3ZZQA 2JH2A 1QFPA 4MJ2A 3OSKA 1DZ0A 5D4JA 2DLHA 1CFBA 3OPZL 3ARFD 3UPRA 5IBTL 1G4MA 2CXKA 3B2UC 4WI2A 4ZMYA 2QVMA 2YBRB 1Y6MR 4AQEB 2KERA 3DX8B 5F88B 2EXWD 2YD4A 4C56B 5I9QB 1GZHC 1WZMA 2Z8SA 5F7HA 5EU6D 1I85C 4HCGA 4UQEA 1XGYL 5IVXF 5BNXD 1UJ3A 1WAPA 5E6ZA 3RY5A 1SLXA 4YDLC 5D1ZA 1KIPA 3X11A 5I1EH 4PAZA 1BQRA 1N7ML 1IAKB 1U8MB 3WUWB 1BOGB 3CZJA 5AW0B 1EHNA 2PABA 5HHNB 4AYFB 2BIQA 4XMKL 5IMLA 1EUUA 3CN4A 4CJ0A 4CU6A 3AWFA 3SDXA 5HYSG 2AK4D 5F7DB 1KBPA 4LSSL 4KHTL 3BP5B 4LLYB 5CJ8A 3APNA 3BT2H 3MNVA 1TQVA 1BFVL 1EANA 1GYUA 2BDNL 4F7TA 1ZWIB 3JQOB 2P8MB 3PGFL 4Y4KA 4OF6A 3TT3H 3VD2A 4TSCH 5C2UB 4K55A 1YMMD 4FRWA 2ZYSA 1M7UA 1UATA 3AXLA 3EBGA 3PGDA 4YBQC 4BQ9A 5KS9B 4G6JH 4OCWL 2XBTA 3B6SB 3BH4A 2AEQL 3O6LL 4XE5B 3WLBB 4PV8A 3AW5A 1MHPH 4MNGE 2A2QT 3LIZL 2WVVA 4GKLA 5FGCB 2HJLA 5A6LA 1KLUB 1WG3A 3CH8A 3H1ZA 4FNQA 4PRPB 4BWUA 4IS6B 4L8BB 3BVWA 4XNMB 2VDMH 5JXEA 3ZTNH 1KTLB 4M93C 1FZOB 3MRMA 3WHXA 4HISA 1WQVT 2QTEA 4LP4A 3H9ZA 5CMAA 1SF3A 2CK2A 3LZNA 2IDTA 1ZHNB 1GMIA 4JGUA 5LAPA 3E6HA 3PJSB 1BX2B 4PJEA 2PO6A 3LEVH 4G5ZH 4MJ6B 3VXMD 1IBZA 4CU7A 1JZJA 1DVTA 4WF7A 5GPRA 1J5OL 2CJSA 1R3HA 1NA8A 3S4SG 2Y7QB 3ECUA 4OGYL 1ES0A 3QGVA 3VCLB 2YMOA 2A5UA 3IRCA 4UT6L 4JDTH 3IDGB 3O6FA 2EDFA 3JTTA 5AALA 3U9PL 5K9OA 5C08E 4XCCH 5I8OL 5HHPA 1A1MA 4WNQA 1E65A 4WY7L 4X6DE 4AITA 3PGCB 1KTCA 2UVEA 4YO0B 2NLJB 3MV7A 1AGBA 3WEMA 5AVWB 1KB9K 4P48A 3DIFA 4NUGL 4HWBL 3OXSB 3H3PH 2BRRH 1JPFB 3IMBA 3Q7JA 3ROLB 3FHQA 1KB5H 5EDSA 2JXMB 3VFWB 3HAEB 2YK1L 5D4QA 3I3EA 4UZUA 1V7NH 3RP1A 3VRLE 2AJUH 3U4EB 3NEXA 3FUKA 1CGVA 3VFGL 3RL2A 3KYOA 1CFQA 2EH7H 2M2DA 2KDGA 5ITBL 3NUKA 3TVMC 4JGJA 3PWPD 4I3RL 5JUEH 2ILLA 4AGMA 1EPFA 3WNJA 4LSTL 1QLEL 1JHKH 3REWB 3TF7C 4Q2ZB 3G08B 1AAJA 5EU7C 2HKFL 1WK0A 2SODB 3IGUA 2FJUB 5F1NA 2JB6A 3IXAA 3NA4A 4MNQE 5IT2H 5HJDA 1JAEA 1NANH 4N0RA 4OZHB 1DFBL 3G6JB 1ZA6A 1KENL 1Q0EA 1N6VA 2H1PH 1HHJA 1MI5A 3KR3L 2LFEA 5F93C 3RZCC 3S4SB 3VTAA 2B15A 3HNSL 1OKEA 2AEPL 4L29B 2C26A 4ZPVA 3QFJB 3BDYL 5DMJB 4B0MB 1PX3A 2DQJH 3O9WA 1QRNE 4FYSA 1RK0B 2DB8A 3MOAH 5HYSA 1NGXB 3A4FA 2FIRT 3HC4H 3IJHB 3E7JA 2LU7A 4L8DB 4NPJA 3NCMA 3WJMA 4ZS6D 2DYPB 4YHZL 4NUQA 1Y0LB 3VXPA 5AAWC 3OGCA 4HUWB 4UOW1 1L9MA 2PYEB 3LXAA 3IGLA 5EC2A 5IUSA 2CLZB 4XAWL 3V55A 1A5FL 1J1PH 2CNZA 2IFFH 5KYYA 2ZAIA 3LS4L 3MRBA 3IETA 3GJEB 5CU5A 5JPNB 1AO7A 3FSOA 2AJZB 4HGKC 2VJ8A 1I8IB 1FL3A 3C9NA 4LMQI 7TAAA 4FNSA 1G84A 4TQIA 43C9B 2A83B 1Q9LA 1BJ8A 4DJMA 4LSPH 1K8DA 1HHIA 3COOA 3EBAA 1J86A 3BEWA 3WS6A 1EHLL 2NY6D 5IFAL 1GS7A 5AZ2H 3RFZA 3L08A 3U4AA 1S78D 4KNUA 4UM8A 3HS0C 5IHBA 1N7MH 5JIIA 3DUSB 2NY7H 1EX0A 2Y23A 3JWNG 4OD3H 2OR9L 4PMEA 2ZXGA 3NACL 4MMZC 5HDQH 4AMXA 1PJWA 3OKNA 5D2LA 4NUMA 2VO5A 3ERXA 3MLYH 4N87A 4BQ6A 2OCFD 1E9OB 3NA9H 2LLLA 5E5LA 2NT1A 2JV6A 1WS8A 1M1XB 3QBTB 4I18A 3SZ6A 3FUNA 3SDAC 1FHGA 4ZOEA 3ARBC 2AI0H 2ICEB 1FVCA 2AXGA 2AEQH 2VOTA 3N43B 4M3JA 1EJ6A 3MR9B 5IMOA 5JDJA 4JFDD 4YL9A 3O3BA 3WMPA 5C0AD 4EKJA 5LHDA 2Z1KA 2MMXA 2BRQA 3O3BB 4NHUA 3DV6A 2BP8B 4LVNB 1GAFL 2BP8A 5B38G 3NOIA 2DQEH 2WNKA 3HKFA 4FXKB 5CLZA 5EO9A 15C8H 5TGBA 4DOHE 4R0LB 1S7WB 1A4KB 1XTLA 2V5SA 4PJ7F 3CH1B 3MYZA 4LQFL 5HYJB 5GSRA 4LBEA 1QEXA 5DC9B 5IG7B 3MKKA 1CZ8H 3QR0A 3U2SA 5BJTA 4R7LA 3FQRB 2ZUTA 4IBWA 3JUZA 3ATAA 1XSOA 3D4CA 2OMTA 3QNZA 4MJJA 5BO0D 3KPRE 2R4RL 5FM5O 3X17A 2GB2A 2AQPA 2B59A 2CO6A 4MDIB 4UQAA 4XBPA 3VXTA 3T3MF 4RFEB 4KO6A 1H15A 5DR5L 1A1NB 1I1FB 4U6YB 4XPHL 1M1XA 3HB3D 1FNGA 4XCCL 2WK2A 3LPGA 3GGWB 4X5RA 5CZXD 4WY7H 3DC0A 2Y06H 4N24A 5E95B 1GJUA 3KJ6H 3OLDA 1WFIA 4ATTA 2AK4B 5FF6A 2P5EA 3O8XD 3GMOA 4P4KD 1HHIB 1K8DB 1PG7W 5F3FA 2I07A 2PXYA 1K5NA 1LNUB 2OMZB 3HBPA 1NPJA 3DIDA 2OK0L 1D7CA 4LIQL 3MCG1 2MTPA 3AQXA 3V4PB 2VSCA 3ESPA 1MNUH 3BISA 2EVFA 4M7ZC 5I6KA 5I1CH 5D1XD 4YWGH 2F7OA 4EDXB 1GYCA 2G5UA 5T3XL 3GZKA 4TVSa 2YQ3A 1U3HB 2VWEC 3RZCB 4QWWC 3WSQL 3PAUA 5DD6B 2A77H 3DHMA 4WENB 5LB1A 2WXFA 1F58H 5IOKA 4AQZA 4MD5B 3B2VH 4YDVA 2P5ED 5T1KB 1KG0A 3GWJA 1JFQL 4HS6B 2ICWJ 1U8IA 2BWDA 1MREH 2BOBA 1V54B 2HTKD 5CJXA 2DEWX 2YPLD 2Z1PA 5E2TH 5DZ9A 2YOCA 2BC4B 5IK3B 1NGPL 4X0KA 1G9MH 2ZAGA 3IB4A 4JAMA 4QHPA 3TVMB 3MBEC 4I0PA 3V6FB 4N2EA 2F8XC 1BJ1J 4PY7B 2ZX8A 4HJIA 5EEWA 5E5MB 1W8OA 3S2AA 4DIXA 2AJ3B 3K72B 5E9DD 5FOBA 3O9WB 4GUOA 1MJUL 3SD2A 1NIAA 2GSGB 3B7UX 5JPMB 2W0FA 1CE6A 1BZ7B 1T4KB 1B0GB 2DM2A 3VX1A 3UYRL 3BPOB 2WWOA 1CDUA 2WSDA 2YUZA 4I0PC 5JMRA 5TDNB 4CVWA 1L7IH 2D4DA 3C09C 2NYYC 1PF3A 2WBXA 2AV7A 3MLXH 4UDUB 3RGHA 3Q2VA 2PCFB 3GJFB 4GLRH 4FNLL 4RETB 1C5DB 3JZYA 4AV0A 1BIHA 3ELAT 3EJUA 3QJHA 5IM7B 5CCHE 1MW2A 3CN2A 5EH1A 5IHZB 1S3KL 2I25N 3H6AA 5JXEC 1F8TL 4PJXA 1JGIA 1GC1C 1HHHB 4U1KB 2CALA 1A14H 2EE0A 4NENB 3ROLA 2OMYA 3CFJA 3IFOB 4XR8C 4TQEL 1CXHA 4DF9A 5EU3B 1SHSA 1A1MB 5DUBB 4X6FA 1OWRM 3VDCA 4YO0A 2X1WL 4URTB 2WQVA 4FQHB 3O6KH 1G5GA 4YHLH 1MFCH 5LLIC 4QUOA 1JPFA 3ARFC 1JNHA 3SGEI 1MCNA 2C4FT 3VGHA 4ZK8A 1DBKL 1H3UA 1A7PH 3Q9PA 4N1HB 1UVQB 3QUKB 4LLUB 1F3DJ 3QO1A 4K7PH 1PD0A 2KUTA 2DH2A 2HX9A 2Q2EB 5DHVB 4JFXA 1E9QB 2JKTM 5GJTL 5CGTA 2R69L 3VD1A 3MJ6A 3QUML 4HLJA 1THAA 4L3EE 2EYSB 2H32B 4LLVA 4G43B 1WFJA 3VGGA 3B5TA 4NN5C 2PO6B 2NY3D 3UAFA 2AERT 3ZR5A 4HUUB 1IM9A 4PRID 4JG0L 3BYTA 3VXSD 1DBML 4BCXA 4H0GA 1RZIA 2F53A 3MMEA 1OP5K 2OZ4H 5C0IB 5E23A 3T1WA 4JR9L 4YZFF 2EVHA 4O2EB 1VADA 1GAFH 2DYPD 1ZEAL 1KEML 1ZANL 3G6AA 1TITA 1CUOA 2W0LA 3GKWL 3UGEA 3X11B 5FKAB 2CRMA 5CSZA 3D8MA 2DEYX 5AVSB 1OAKH 3TO4A 2XWBB 3WHXB 2XN1A 3EH5B 3QRGL 1BEYH 1ET5A 3UOAB 4P5SA 4L1SA 2GHWB 1T89A 1SXAA 2A0LC 3BP5A 4GAYB 3ZE2E 5JIQA 1JGEB 3OZ9L 4PJFF 4Y2DB 4WUUB 3MRGB 5B38B 4JVPA 3QWOB 4PGDB 1P4IL 1N4XL 3K91A 4NQEE 2EXSA 1K4CA 4KV5F 1KTDB 3I50L 1L3NA 3SDAA 3MQIA 4XO5A 5D7SL 3ZZSA 4LT7A 5F7LB 2QGCA 3WHE0 1N59A 1T5KA 5E6SB 5IR1B 2WCGA 2OYMA 4Z7IA 1IC4L 3FUJA 3UCQA 2EDHA 2UZYA 1MI5E 5AAMC 4ZDHB 4OW6A 1RK7A 5ESVA 4QCIB 4Z0XA 4OGAC 5IQ9A 3DX8A 3FT3B 3KW7A 3LEVL 4G5ZL 1X6LA 4G8FB 3ZKXB 2M26A 3QJVB 2XVKA 3T65A 3FO9B 2D7TH 2XYBA 3DX6B 2QFRA 1X5JA 1EGJA 2A9ML 4RQQA 4X6EA 1OK8A 1U8PB 1XGQA 3AM8A 3B83A 2WXKA 1RU9L 2YARA 3MACH 2R2HA 4TOYL 4FFYH 5FO9B 3O81A 1GL4B 1S3RA 2ATKB 4QT5B 1ZE3C 1X4XA 4JCWA 4PS4H 1UEYA 3N50A 4BFKA 3SGKA 1AZUA 5MEQA 4PVLA 3UZEA 1TF4A 5MEQB 3EIFA 3MUJA 5C0AB 4POYA 1IGJB 1PZUB 1QLFB 5MEOB 2YGNA 1BIIA 2XTJB 4H44C 4OKVB 5JR1H 3SE9L 3Q48A 2VZOA 4LLMA 1R5IB 3SSGA 1TZHA 1YUKB 2DQJL 5AAWA 1EBPA 4GPVA 1J9TA 2HLAA 2EKSB 3D39B 3BGFC 4NQVA 4JG1H 4AUUA 1NFIB 4JM2C 4UB0H 4JQVA 4ENZA 5D7LA 3NCYS 3IU3B 4W1TA 5JUEL 1YO4A 3FSVA 3L81A 1HILA 2XU9A 1O7DC 2ZNWA 1NUNB 3F7YA 2JMRA 5FIEA 3L9BA 4NCC1 32C2A 1AXTH 5DLLA 1E28B 1F1AA 1IC1A 3ABMB 1F13A 3WCYA 3EOAB 5LBSH 2FWLB 2HT4D 5LWYL 3U7WL 3ZT5A 4XXDA 5DJCB 3Q06A 2IDQA 1QYGL 4P46B 5E24E 4ZT1A 2B4CH 4HUMB 4GSDL 4P4KB 4E41A 1JNNL 2VABA 1CPUA 2XQBL 3B9EA 3LVTA 2OJZL 3K5RA 1ZY9A 2XWTA 4KMTL 5F8RC 5D7EA 3OGOE 4ZOBA 5D1XB 1A9EA 4K9JA 2DBLH 5DJXB 4YK4C 4ODXB 1PY4A 2R1XA 4LASL 2DMHA 2HRLA 4N1EA 3T0EB 5J11C 3TF4A 4OD3L 4UT7H 4XNYL 3GSQB 4OLZL 3KXFD 3ROOA 4Y9BA 2HH0H 2Y1AA 3N6YA 3L8QA 2JKSA 2VH5H 1QACA 5GRXG 2AQRA 2QR0B 2VLMD 4JPQA 3IJSA 4L23A 5EORH 4TNVK 5AB9A 4R7DB 1J1OL 4JB9L 2GJ6A 4LEOA 1WIOA 2V7NA 3GMPA 3S97C 2FZ3B 2Z65C 1LO4H 4AUJA 1BWWA 3H3KA 4GKZB 4UTAH 1XR9A 3F7QA 3TVMD 5I23A 5IBLC 4M6OH 2JELH 4MNQD 4JFDA 4NWUH 1ACYH 2Y2WA 3O11A 1SGKA 1NEUA 2RA1A 5GS2D 2ICES 4NQEA 1E3ZA 5DDHA 3RL1A 2R7EB 5I6XB 2Y6SC 4NO0D 4PJBA 3IMSA 1VACB 4ZXBB 3HZVA 4HGMA 3PWPE 2F53B 4KDWA 1QBBA 4PLOB 1MW0A 3DRQB 3QULA 1NEZG 2PR4H 1HS6A 2ZONA 3DTDA 1LD9A 1UADC 2K8QA 4HBCL 3DWTA 1H3TA 1QHQA 3C6SB 3Q8CA 5CZVH 4K3EH 1B2YA 4DPRA 1PS3A 2VUOA 3W11D 4M6ML 4JN2A 2JLPA 2YGQA 3ZL2A 3ZRCC 4GRWB 4CW1A 2GC4C 3W39B 5M94B 4ALAC 4F58H 2VITA 2W9DH 4H26A 3NIDB 1O0VA 4L1HA 3ZYJA 5SX4I 3T71A 1ZTXE 3K0YA 4RSYA 4RZCA 5DHVH 1FGVL 1KJ2L 3KJ6L 2DBJA 4L37A 3RIAK 1SVCP 1DCEA 1OCOB 4K7PY 5DHMC 5AUMB 4FA7B 4ZAKD 2R15A 3BPLC 2NQDA 3MLZL 1QZNA 3PE9A 1JCKA 1B3IA 5I0ZA 4F2ME 2AK4E 2DD8L 2VC2L 3K6NA 1Q0XH 5FUCE 3R0MA 5C09A 1B88A 1RZJC 3N40P 4K7PX 3PUUA 1SEBA 3BPOC 1ZHKB 5I1JL 1MHEA 1CS6A 4IBUA 2RR3A 5IZ7A 1T04A 5EU5A 5EV7A 4PP1D 2AXFA 4KFMA 2KKQA 4LEXL 1F58L 3TLRA 3BCDA 3MACL 2YAOA 3GLAA 3SDXE 5DVOA 3SQBB 4FG0A 2PR9A 5C86A 2PTTA 1WAAA 3QSKB 1SN2A 3UZVB 3G5YA 5AVVB 3UPAA 3GXMA 3KLQA 3GZQA 1AZVA 1V7ML 2GSIB 1LEIB 2NR6C 4LKXB 2OSYA 2UZIH 3QI9D 3OC5A 4BH8B 1E90A 5AVYB 4JRYE 4LDEB 1HQRA 3CE1A 1T6VN 5FA3B 4ZFFA 3LKRA 3VI4F 3K2UL 5TDNA 3LZFH 2C7UB 2V7HB 2Y2YA 4YIQB 3KPSB 4M6NL 3UAJD 1FA4A 1A7RL 3NQKA 1NAMB 4JG1L 5JHDE 3HG0A 5DRNB 4UB0L 4KY1H 1GSKA 3QVAA 1T6WA 3EF4A 2R2CA 2F9BT 1DEEB 4LAQH 1IV8A 1QFWH 1GPOH 2HRHA 2QADB 2YD7A 3QIUA 4TXVB 4ZW6A 4B3EA 5I0WA 1LLAA 2HFFA 3E3QE 5G4OA 3TZVD 3WBDA 1ZGLM 4TTDD 3CFKA 4JFED 4PB9H 3DETC 1JG9A 1PD6A 3GTTA 5EO1B 3LQAH 4MVBC 1E3FA 1P1ZB 4LCCB 4UU9A 3K2KA 1OF0A 2IGTA 3EFDL 1ZT7B 3VRJB 1JNNH 3AXHA 3LKSA 1M53A 2C1OB 2VSDA 3LQAC 5D7JD 1XD0A 4DEUA 3U46A 2HN7B 4Q6IB 5AW9B 2HB0A 5GRJH 3CK0L 1YNLH 3WL9B 4XNDA 4Y1AA 1NWOA 3H9SD 4FQIL 1FNGB 4GG6F 4UAOB 2ZYIA 4WEBH 3ZUCA 4BUQA 4IK6A 3MRHB 3DX9A 5IWLA 1YYLH 4TQ8A 3UH8A 5ABAA 2R8SH 1UCBL 3FJTA 5FK9A 4AYEC 1WFTA 2VM4A 2AC0A 3EXLA 2H0EA 4IMKA 5I5IA 1CD1B 3D5OF 4OM1L 2VDMB 4XGZA 2CIIB 1OGAB 1Q72H 1TJGL 1X5AA 3J07A 5DWUL 5ISZD 3VI3E 4B7LA 1NCDH 3MBEA 4X4MA 1X5XA 3WY2A 3D9AL 4L8SA 2MTAA 3IFNL 5IROA 4B5EA 4L3FA 4LARH 3PFUA 4E36A 3V4VA 3VFUB 3FPYA 4EDWL 3B56A 3MLTA 4NZUH 4ZUVB 5J1AB 3S8GB 4NWUL 1PKQE 3H9HB 1F6AB 4Y7OC 5HDWA 2Z0UA 3AREA 1YEHH 2L7JA 5CNHA 4RA3A 3TEYA 3DX2A 4EEEA 3V5KB 4LDCA 1JN6A 7PCYA 5I2IA 2HG0A 1CDCA 2WMPB 1A3ZA 3EOBA 5DFWH 5GGRY 3TBWA 3WIHA 1NC4A 5C0BB 4RFNC 3M07A 4X8JB 4FJ6A 4AOFA 1K5NB 1LNUA 3BWZA 1PCSA 2HYMA 3ARBB 4M7ZB 1YHPA 4ZX4A 4WWOA 4WFHD 1S5IL 3TL5A 2BSTB 2C3VB 5GISL 1N12A 2YD0A 4CJ1A 4N3TA 3ZDXE 4WW2F 5HI5C 3FH7A 2ED7A 5EIVA 3BLBA 3LZLA 5K9QI 2FNBA 2VMFA 3T2PA 2BS71 3CC1A 2XY2A 4GMTH 2WAHA 3SJVB 4XN8A 2C3HA 4JO1H 5I76A 2YPKA 4PRNB 5D1ZI 3KJ4B 4QXGH 4NDMB 4NIKB 4NUJA 3KXFB 1C5BL 2CJUL 1P69B 1UZ6F 4RRPA 1IKNA 5DD3L 2R29A 4D0BA 5L2KD 2JIXA 4PCTA 2EDLA 2Y1ZA 3QT2A 1MFDL 4PRHE 2ZUYA 1JI1A 2IXQB 2QBWA 4TUJA 3QI9A 1DO5A 1W6WA 3FAWA 2DL2A 1R5WA 1KPRA 2XVGA 4R3SB 3UTOA 2Y69B 4GQ9H 4MCNA 4Z3JA 4G1MB 2RALA 4HDIB 2XZQL 2BWIA 4POZD 5EWIH 1A6TA 2J6EL 2MOQA 2A1WH 2EO7A 3H55A 4FFWD 4U1MA 5EZOL 5IJDC 3D18B 3DX7A 2AJZA 4YVUA 3ZYIA 1DVFC 4HETA 2AJXL 3PWVB 3WE6A 3X13B 4N0FA 4CKQA 1J5CA 1F4HA 4ANUA 3F01A 1KC5L 1NCWH 3ZOAA 2XZZA 1RKRA 5ICZA 2SEBB 4ZXBD 1GMEA 4UINL 2Z34A 5IVNA 3QJOA 5ALBL 4LCUB 1R19A 5JOPE 3DXAD 3ZGIA 2Z4QA 3LRHA 3TNNA 3UBFA 5FGRA 2K4AA 4NZRL 1S7SA 3DRTA 4F7KA 1O6VA 4IBTA 4J4PA 4Y1TA 1I8MA 2CCVA 1CF1A 1EAJA 1XH2A 1MZYA 4XNXL 2C4FU 3K2UH 1ZT1B 1UH3A 3IMRA 3EGDB 2Z64C 3LAFA 4BWTA 1IBDA 2WLLB 5LGHL 2JCCE 4NXKA 3KWVA 4CC0A 5SWQA 1YRKA 4R7XA 2JJTC 2NLJA 3QWNA 1SHMA 1VKXB 4Y16A 4KRLB 1NGWA 2JSFA 1WTLA 5GGUA 3ZPDA 4KUCF 1NAMA 3MUUA 3UP6A 5L2JB 2QSCL 2NNAB 1M05B 2MRYA 4F7MB 4N2DA 3EH3B 2LVEA 2Y6SD 3N91A 4ZMOA 2X70A 1T7WA 4WI0B 5CBEA 1S7QA 2BSED 2N7SA 3ALPA 1KTBA 3DJ9A 5CINH 3SBPA 4AZUA 4HOXA 5KW9H 4JJOA 3PG2A 5I6PA 2WZ0A 2WNGA 3FOLA 5HPMA 2N7AA 5KTEL 4K0OA 1NBZB 1B2WL 4IOSA 1P4BL 2JCWA 2X3CA 2GG1A 4FLRA 3EADA 3MV9A 4AIXA 2X44D 4L4VD 1WWBX 1SN5A 3L3JA 1PZAA 4M8QA 2F0CA 4N26A 2WQRA 2AV1A 3IFLL 4X7TB 2HH0L 3HZYA 4X50A 4DOHB 2FBRA 2UY7B 3D30A 4IDJH 4PGBB 3P3UA 5JLZA 2VJXA 3BQVA 4KHXL 3X3FL 5AZUA 1WBYA 1YY9C 3D1MC 5C09B 4GH7B 3IJEB 3LEXA 4DP6X 5J6HB 3ZTJH 4O2FB 3WD5H 4QY8A 5KS9A 3DDGA 4UYPA 1KJVB 3C6EA 1MFEH 1WISA 2Y7NA 3CCHA 3Q2LA 1PEZA 1E4HA 2KS0A 3IMTA 3B2PA 3CXHJ 1XF2A 2N01B 1PZBA 4GQRA 3OR6A 3LN5A 3QJXA 2OS7A 3KPSD 4EDWH 1DANT 4J4PC 4S1DC 4X4KA 2GW5A 4K71B 1CFTA 4MSWA 4UOQA 2FEJA 3NJFA 1TJXA 3NBNA 3QDGD 1AYRA 3CPUA 4OGXH 3VNYA 1OP3K 4HBCH 4EZKA 1Y7VA 3JXAA 4MA8H 4PG2A 1N0XH 3PS6A 3LH2H 4MXQD 1ORQA 4WFGE 1A1OA 3ZZLA 4I0PD 4K7FB 2QELA 3HPLA 2DLFH 3U4BH 3UDWC 1FAIH 3HLKA 4PJ9B 1N5AA 4A6YA 3LKPA 3WIHL 2EEXA 3QDHA 2V3FA 5D8JH 4UTAL 2KPNA 2R9HD 2YBRA 4I0CC 5GGQH 3U0TB 1ZIAA 5DJAB 3ARZA 1MCPL 3B9KB 4L4TA 3QI9C 3JWOH 4ZMPA 4JRXA 4BKTC 1VDGA 3QO0B 4OLYL 2H4EA 2IJ0C 3BUDA 4ZX5A 3WIIH 1X7QA 5ILTL 3MLZH 4YLBA 1LO3H 2WQSA 2XFXB 4GKOA 4MCYA 4PW3A 3UADA 5IMLB 3T77B 4HPYH 1WZLA 3O2DH 1A6WH 5C3LD 1ZTXH 3ETBJ 3W39A 4Y1AD 4LLYA 43CAB 3PWNB 4NGHH 2NQCA 2J88L 2VMJA 3II3A 4LOUD 1OGSA 2BNRE 2YRZA 3NG5A 5I71B 4IOFC 3FK3A 4BCYA 3QORA 2Y9RT 1MDTA 2WOYA 5H4ZA 5JHDD 3VFNA 1XEDA 1XQ4A 2BSDA 1LD9B 5J9PB 2HT3D 4FC3E 2Y5TB 4MNHB 1IGYA 3KVDD 3WO4C 1CI5A 4P2RB 3B9VA 1SYSA 1QBML 3CVHB 3MNMA 4UNTA 5AKTA 3AQZA 2VDOB 5E8EB 3X2QB 4AMWA 4PRIE 2OYPA 4LRIA 3CZFB 4MNQB 3KCPB 2GJPA 3L5HA 5HGGS 3JV5A 3EHBB 1HWWA 4HIIA 1EJOH 4ZRGA 3P4OA 2V2XB 3ULUD 2UZIL 4BIKA 4RWYL 5EOQH 4H20H 4TQHA 1KYDA 1BVKB 2WLHA 4RISH 5E2WL 1KB5L 1C7SA 1CG9B 3OKDB 3UZQA 4W9FC 2EINB 1ND0B 4Y9FA 4Z78A 2YMXL 1B6DA 2CD0A 2RCSH 1DE4B 2F5AH 1LK2B 3SPHA 4DESA 2I26N 4NOBA 3VFGH 3P3RA 3U4KA 4ZBJA 2COVD 1T7ZA 1U8NA 1GR7A 1BOGA 1KV3A 1X7SA 2XKNB 1TQBB 2K9UA 5F9WB 5I1HL 1TU2B 4RLDA 3VWKC 2NQ3A 1BD2E 1UM5H 1Z9LA 2GIYA 2J2ZA 3LN9A 4EN3B 5GGSY 5IBUG 3P77B 3CFEB 4H88H 4GO8A 5F88A 4LSUH 2E5EA 4AQAB 3RWEA 1JXFA 4XP4H 1TZHB 4GI9A 3UZQB 3MRRA 3P4MA 1A3RH 3IDIB 4UDTB 3PGFH 1TR7A 4CVXB 3IGAA 3QP3A 4M43H 1GHFL 5A7BA 3GSXB 3ZYZA 3F3HA 3TPKA 1XGRB 1D6VL 2IG2L 1W0VA 1BVKA 5DJ2A 1A6AA 4AGLA 1CE1L 1N70A 3LIZH 4IHOA 1P0SE 3VXQA 4ZQTA 1OM3H 1JV5A 4U6VH 1MCIA 1WTGT 4LCWD 5KBKA 2R0LH 2VXQA 3UTTD 1CVSC 5F7WC 1YEIH 5AOLA 1GPOL 5DA4A 3PP4H 4OM1H 1LEGA 3BH8B 1TJGH 4HKXB 1NAKL 3PQYA 1UOVA 4UM9D 4OZGF 4P2QA 2X89A 3VFSA 2GJJA 5F44A 1D5RA 2ADJB 3LKQA 1BM3L 4P3DB 5SWSB 3FHEA 4DW2L 4OLXH 1MHCA 3Q5OA 4B9GA 5IKCB 3GXFA 4HLEA 5K9KB 2F19L 3DIVA 1E4WL 1MAKA 3I9IA 3UTTA 1JK9A 3R7RA 1EZVY 2GT9B 4UT6H 1FE8H 3VWJA 1QSEB 3S2CA 2ZWSA 2WCSA 4OCNC 2A6DA 2EEBA 2K70A 4OJEH 5GS3A 1BZ8A 4JZJB 3AB0C 4TUOB 3QUMA 1EFXA 4LF3A 4UQBA 2NY0D 1ND0A 2LLGA 3DX6A 4NCC2 3OTTA 1KBGL 2AABL 4Y2DA 4EVNA 1FN4B 4KJWC 1ZLUK 1RPKA 4J2QA 3VMPA 5TF0A 2E76C 4YDNA 2JKNA 1UWXH 1R0AL 1AC0A 3DJSA 1WZAA 2QADD 4R7DA 3VFSB 3APFA 1YEKH 5A2LH 2A6JB 4X7CC 2XRAH 3CZFA 3FH5A 3HZMA 1NDGB 3QJZA 4S1QL 2ZKMX 4A6YB 5CAYB 4M1DH 3HE7D 4U1NA 4HUUA 1N8ZA 3TIDA 3EAKA 3FPXA 1QWUA 4LSQH 2ZQKA 5DC2A 3TYGL 1JSYA 2N56A 4ZFOL 4BQ8A 2O5XL 2E9WA 4K5NA 3HI6H 1HJBC 2V6HA 3UJIL 1QRND 2FL5B 5I82A 3N55A 1F4WH 4MJ5A 2DQEL 5C9JA 5CLTA 4CNIB 3KXFE 1N10A 4S1RH 1LYQA 3T4YA 2F2HA 3I84A 3NEOA 4FTVB 4OZGB 1BSIA 3HRZC 4CBZA 1O5PA 4KNTA 2WM0A 2MPAL 1JZ8A 4UAOC 4A2HA 2XPGB 5J6GA 3SOTA 3ZJAA 3BWSA 3TV3L 5IVXA 5LAXA 1K2DA 4AT6A 2WN2A 1N6QL 4PRBB 4NFBA 4H0HB 2ESVB 1J87A 2CJ3A 1WFOA 2R4RH 2OMYB 3CFJB 5JZ7D 3OQRA 4IDLA 3DROB 3F00A 1RZIB 4X6FB 1EGJL 2FATH 1NFDE 3JBG7 2UY7A 4PGBA 4PR5B 3BDXA 5JLZB 4PH8A 5FYJD 2AVGA 2WYHA 5GS0C 4U1KA 3HFML 3EJSA 1U8JA 3OLGA 2XSKA 5CWSA 4MAYD 4Y9GA 5JW3H 5HVHC 1T2JA 2J56A 4AYDC 4YX2H 1J5HA 4LPXA 1N0LB 4BZ1H 2ITDB 5JIDA 4LSDA 4FQHA 4WIQA 4CMHB 2UX7A 3CBKB 2VRKA 3TJEL 1ZPLA 1KB5A 2HKHH 2WCPA 2XV6B 4AVHA 4B7IA 4HUXB 4UV7H 3SDAD 1OY3B 3K3QA 1MH5A 2GKIA 1WAAE 3BSHA 2YAPA 4GRLA 2AV1B 4DUVA 1SHXA 3QJFB 4WO0A 3B9KD 4NAMA 2AK1L 3D0AA 4P4KC 3P40A 1UC6A 1U8CA 4OJFH 5IEHA 1PIFA 4GXUM 3T0XA 1NBZA 5LVEA 1YNTB 1P53A 1HHHA 1TQBC 1EFXD 1RZQA 3T3PB 4LEEA 4KK5C 5B1JC 1BBJB 5ALCH 3OXRB 4CC1A 3PWJA 4ZSOE 1HK6A 1CMOA 4KTDH 5I1KL 4P05A 2ZUQC 5FHBH 4ENED 2X0UA 1FVEB 1QKZH 3DMMD 4MS6A 1HXYA 2EC9T 3O4LE 1DLFL 3QDME 1YMHB 4F2MA 2H26B 1DL7L 1V27A 5L6YH 4M43L 1JPSH 4QTFA 1FBIL 3WAKA 5L4FA 2WIMA 1XV8A 1DBBH 1T1XA 2BHYA 3CC5B 3RIFF 3RLSA 2AXJA 5GGVY 1H0DA 3WFHA 3U1SH 3WJLC 3KBEA 4WJ5B 4DPBX 1OGTB 4ZMAT 5KN5A 2DIAA 1VGKB 1OAQH 4WV1B 1HE7A 1OSPL 1U3HA 4HHAA 3IU4L 4I8DA 4JFOB 2WIIB 1D5BA 3A6CH 2XTJC 1G94A 1U3HC 2JK5B 1AE6L 4MNGA 1VHPA 1JGVL 1ORSA 1R24A 1HH6B 3IE4A 5TH2B 1XDTT 5CEYB 5CHNB 3KG5A 2D7QA 4TNVF 5E2JA 1QR1A 3RAJH 2IDUA 5JXED 3P2DA 5KW9L 5EUOE 1UM6L 3MREB 2V2TA 2KZWA 1P7QD 1PLCA 3IAPA 1F41A 1WBZA 4Z3IA 4FQJL 1U8LA 1FCCA 3VACA 5A2BA 5F7UA 3O0RL 4U6YA 3DX7B 4X6BA 4AW4A 1WZ1H 3TPUA 3CXFA 3C5JA 1NMBL 2YPKB 5B3JF 2EVGA 3D85A 2VZ3A 1E50A 4FZEL 3D0LA 4YEEA 4ZO8A 1LO5B 3LMJL 3MPCA 1MFCL 4O2CA 2OMZA 4K73A 4N8UA 3WKYA 5B3SB 5TF1L 4LDLB 1A7OL 3U2SB 2P5EE 3NK3A 2EIBA 3O4OB 1L3WA 2WJ5A 3RWJA 3S37H 4MD0B 3T0VA 1EV2E 3N2JA 3L3OC 3CIAA 4XCNA 4JRLA 1G7PA 1F4XH 4K2UH 1JHKL 4NNPL 1LK3H 4EI5A 3AM8C 4JFWA 2VM9A 2APSA 2DQCH 4AMKL 5ILTH 1NC4B 2LABA 5C0BA 4C4KT 4ELME 1S9VA 4J12A 2DMGA 2MSPA 3DV6B 1FVDA 1I1FA 1MCQA 1DFBH 3WIFB 4LVEA 2DQHH 3TS8A 1MY5A 3D2TA 6FABL 2QGDA 3NH7L 3ZHDA 2HTLD 1N64L 3GMQB 4LCWB 3SDDB 4L4VB 4YOKA 4HEME 1MRDL 3Q1EA 4KKBC 4ZFOA 1I8KA 1L6XA 3OKYA 3VQ2C 4IOIA 3KH3A 4XPGL 3HI1B 3QEHB 2DI8A 3FHAA 3S3BB 2H0JA 1NWPA 4HH8A 1AMYA 3OBAA 3EYUL 5I76B 1IGIH 1SM3L 2YSSB 3PXHA 5EO9B 3Q05A 4DZ8B 5EN3A 1UD2A 1W8NA 5DEFB 5DUML 3MLRL 2NZIA 4R7VA 4QIRA 1FL6A 2WO3B 3ARWA 2B0SL 1RUAL 4NNYB 3U6RA 3C6LA 2V4LA 5EOCJ 1UWXK 4Z7VE 1KGCD 4JDEB 1N4XH 9PCYA 5J89A 5C08A 1CDBA 1Q1PA 4EIBA 4MD0A 3TO4C 3PRZA 2JCCA 2BVPB 1GGUA 4OQTA 4JBSA 1BLIA 2CH8A 2Q3AA 4FF9A 4Z7NE 5KWYC 4CAGA 1S9YB 1IAIL 4Q6IA 4R8WL 4JJ5B 1E4XH 5GGRB 1L9PA 3EOTH 2WW8A 5L2KA 1KF9B 1E5ZA 2D3JA 1MHHB 1TEFA 4K9EC 4RESB 4RRPG 4ZUUA 5FLUA 3L3GB 1QASA 4D94A 4NQED 3QR2A 3IDMA 3TT1L 2R1YA 3K6DA 4AM0B 2LE9A 3FQTB 5DJ6B 2JNZA 3GIZH 4PJ9D 1UJ3C 4MXWL 4P5TB 2BIHA 5CLYA 4L8DA 5KSAA 2Q76B 1JNJA 4NKMB 4C57C 2GIMA 4NNXB 1PAZA 3KL5A 5D2LF 2GITB 3GSNA 2BSBA 4FE9A 4RISL 1MAML 3ZDYF 1RZJH 2XFGB 4CVZB 2JIXB 5IY5B 5E0QA 1SLVA 1CD8A 4EE2A 2K78A 2EIJB 2MWCA 4L29A 3DMMA 4YFLF 1NIDA 1A64A 3QQXA 5JPMC 5TPWH 1SNRA 5D1XE 5C08D 1B9KA 5DRWA 5D1QB 2H26A 5TFSH 3O41A 3FQTA 1ZLWH 1RZKC 2N59A 4DVBA 3U7YL 4HK3N 2FX9L 3HBZA 5IREA 4GOSA 1SQMA 1DBBL 5DJ8A 4JDZA 4OKDA 4NAJA 3AQDA 1RUKL 3T08A 1KIUB 1UM5L 3VYNA 2AJSL 4WHDA 2D03H 1SDAB 3T2OA 3NFSL 2F08A 3VGAB 4XP6L 1SEBB 5HYQB 3X1BA 1CD0A 5SWZA 2KZBA 1GA2A 5G4MA 2GJ6D 1A3RL 4Z7QE 5C0CD 4X42A 1FE8L 2BVUA 1TVBA 4GG6B 2JKLA 1GJWA 5DO2D 3DSFL 3IN2A 4P57B 5KSBF 4QRAA 1MUJB 3G08A 2VDQL 2NX5D 4QXVA 4OZFH 3REWA 5T1JA 4IJ3C 3PGCA 4EI5D 5F1NB 1CE1H 4KO5A 4YPGB 3ZRFC 1KUMA 2YSSA 4CBPA 1HL8A 4ISVB 3WKML 4WI3A 5SX5H 2DIBA 1I1AD 1ZXQA 1U8JB 2VZ1A 1LEIA 1OT4A 1GIGH 1QFUL 2FHCA 3CVIL 3VNZA 2N4IA 4S1SL 3AG2B 1H3XA 3RWFB 4LL1A 3O3EA 4M4RA 2F54B 4UQ9A 1J88A 3KLLA 2KZ1B 2EKJA 3EUUA 3MBED 4HP5A 1SBSH 2P8PA 4HKZA 1P2CA 1A4JB 1OW0C 3H0TA 3QXAB 4QXWA 1K72A 3KGUA 4XCEA 5F9DC 2VXSH 2VERA 4YBLB 1QX1A 3DROA 4LU5H 4QKTA 1V10A 4RAVA 4QO1A 5I15H 2I60H 1PYWA 5DS1A 3OZLA 4TTDC 5EPMB 4KY2A 4PGCA 2RJMA 2P24A 4PM1A 3AS1A 2E7LA 3N44F 3BIBX 4GBXB 4NO3A 1GCYA 4Y9EA 1EAOA 4YC2B 3OKOA 2AEOA 1SXSA 3MI6A 3WTSA 1XIWC 4KUZL 3ILPB 3WI9A 5E6RB 5F7DA 2R29L 4MTMA 3IWUA 5I5RA 1DO6A 1G7HA 3FTSA 4HW6A 3ARPA 2WPGA 2YA2A 4YC2C 3S48A 5EFIB 2R2BA 4RZKA 2DLEA 4KKLD 3F7LA 1JWUA 1EZLA 3VXNA 3NRPA 5IHUL 3ZKMC 4OH2A 3SY0B 4DK6A 1FDLL 2BS8A 4LBAA 1JL8A 2X7LB 3CQQA 2IWGA 3BKML 3K4AA 1QR1B 4YHKH 2Z35B 4KKPA 3OC8A 2HJKB 2FHFA 3TA4D 5C6PB 1I75A 2N7BA 4JM4H 4S1RL 1NSNL 1A9BA 3P30H 4IU2B 1I1YA 1WLHA 4NWTL 4L2LA 2ZJSH 1MPAH 4HIXL 5D6CB 4ZOCA 3WDHA 5LQBL 1AGDB 3O9WD 4JL1A 3T0DA 2IAMD 1WT5C 4L05A 4OZHA 4MJ5B 5C9JB 2GHZA 1T03L 5KVGE 3QCTH 1OCZB 4GG6E 2CRYA 2YAQA 1CGUA 2WO4A 3QRLA 4QNPE 5FDYA 2P5WA 2D4FA 5H8DA 3F7PC 5DMKB 3CX5K 1NC4D 1NQBA 2Q86A 1DQDL 4NM8L 3VFPB 3VI4B 3Q8FA 3T0EC 4BFIB 1E28A 3VXOB 3HE6B 2WWKT 3RGVA 1LDSA 3F04A 5HYJE 3N04A 1C12A 3V0WH 1INEH 4JANB 4NI3A 3HIZA 1QSFE 3L7FA 4U6XB 2BIIA 4XRCA 4Y5XB 1P4LB 4B6ZA 3FU0A 2WBJB 4JFUA 3EYQD 4P2QB 4KJYB 4E41B 1CLOH 3TT3L 1T66C 2VLLA 2CR0A 3KPRB 2HLAB 2XT1B 3CZKA 2ITCA 3GSNL 5E2VH 2XXCB 2MCMA 1KSRA 3EO1B 3Q0HA 1C8QA 1LO4L 3MNWB 1XCQA 4HIJA 4DKAA 4O5LH 1J9RA 5DJXA 1I1RA 1A2YB 2CDEA 3LSOB 4KDTC 1JI2A 2A6DB 3LSOA 4AV5A 3PV7A 4KQ3L 5GSVA 2A6IA 4ODTL 5KSBE 4UDTA 3U0PA 4Q89A 2CGZA 2IANE 4OT1L 2D7MA 1ZHLB 4FXLA 5HHXH 1RUQH 3MV7D 1WUZA 4FFZA 4ZO9A 1DQML 5IVXE 3VI3A 4Q97A 3ULUE 1CBVH 4D0CB 3OG4B 2AMUA 1A7QL 2R1WA 2AJYH 5CU9A 2R1WB 2F58L 3RAJL 1RJZA 1AMXA 3W57A 2MNUA 3X3GH 1UTDA 2EYTA 3K4DA 4NM4L 5LBSA 1E5AA 4M7LT 4MAYB 2OMNA 4L8CB 1DQLL 1WZ1L 4I9WE 4NQEB 3NJGA 4WTZA 1A6PA 3DX3A 3OKEB 1I3UA 3S98A 2Q0ZX 1YNLL 4X9BA 2MHAB 2CHWA 2VR8A 1FG2A 4QYOB 3DHPA 2VLKB 1QNZH 3EO1A 5AAPA 4LE8A 1EO7A 5EF1A 4XH2B 3FQUB 1JERA 1IGTB 2BZ7A 4HWBH 4L1BA 5J13C 3B9KA 3H3PL 1ADQA 4FXGB 2A9DA 5DZLA 1TQCB 4MB5A 4YHOL 1B0RA 1IC7L 3TO4B 2XWRA 1MFMA 4NAQA 4MNQA 2FL5A 4XNZC 3GK8L 1DQIA 3ZLQC 3ZKSD 2OI9C 2V2XA 3AC0A 8CGTA 2Z3FA 3AACA 4KKZA 3FBKA 5DF0A 4LARL 4NZFA 1UM6H 1YMME 5B8CA 1I7UB 1SBSL 2X4TB 1F18A 3DECA 3R1GH 2B7DT 2MQ3A 4LSTH 5C8JB 1G7LB 1MCCA 3KYAA 1SFHA 1Z9PA 5KVEE 5F1IB 1KB3A 2BM3A 3HZMB 3NZHH 4LLQB 3W5NA 3CAFA 4QRUA 4EZMA 1NMBH 4WZ9A 2E6JA 5I66B 2Z93B 5T3ZE 1UM4H 3KZ8A 3JT0A 5EEZA 4UBDC 1R6VA 1G6RA 5HGHB 3UFIA 3BRDA 2BFVH 2ZSVB 1DVFA 2XWBA 2KH2B 3D69A 1HZHH 2VW6A 4OR1A 4WWKC 4OIIL 5EPMA 1SVZA 3ABKB 5HY9A 5KUKA 1F97A 3BC9A 5GS0H 2GY7B 3OAZH 4GRLD 3EDFA 1BHGA 1QO3B 3EYQC 3B1UA 2F5BL 1PFCA 1JWUB 1W9XA 4S0SD 4WI7A 2WWMD 4HFWB 3FCBA 1MG2C 3K1KC 1S6NA 5LWYH 3CVDA 1BMGA 3VFNB 2PO6C 4CC4A 2WINB 3NT0A 1G9MC 2EYSA 2H32A 3H0TB 3QXAA 4XCEB 2IQ9L 3ZHNA 4ZW8A 3MV9B 4XAWH 3S36X 2NNRA 5EEYA 1GW0A 1A6VH 3V9FA 4JEGB 5DHVA 5C07D 4XPGH 4Z18A 4HUKB 4HZLB 2EDQA 3NJNA 2ARWA 1DUZB 4QYAA 1QP1A 3CFDB 2ZPKH 2QTVA 1EZUA 2PPAA 4BSWB 4F7MA 5C0FB 1RUAH 5FEBA 2MCG1 4QI3A 4ZXBC 5GGUB 2VH5L 3OVUB 4ZAKC 1QNIA 1RQ5A 2H1LM 2E59A 4UIKH 1ZJAA 4QEGA 3T4AA 2C5DC 2YMTA 4Y2NA 5DJZA 3UBXB 3QZNA 4XO9A 1AOHA 4JANA 2GQHA 1U4FA 1TQUA 2VLJD 1G9HA 5SWZB 3BW9A 1QLRA 2RFXA 4ZMTA 5J57B 4YNYB 4BE5A 2BSEA 4Z7WF 1JDAA 3HN8A 3GSNH 4OUUA 5FX3A 4DP9X 2PWDA 2R27A 2I9LA 1RZKL 4Q0XH 1T0NA 3MBXH 4JO2H 4ABUA 4UTBL 1GYAA 5DGRA 3TT1H 2OFQA 4X4XB 3O6MH 4K8RL 3ORJA 5HHOA 1O5DT 4PCYA 5C9KA 5IGXL 5MENA 2FH6A 2VXVH 3VVWA 3LNGA 1BF5A 2ZTBA 1ZHBA 5JOPD 3AG1B 5L7XH 3K72A 2CBMA 2FO4A 1F3DH 2WWMC 3VH8B 4NRZB 3KYNB 4IGBA 5DRWB 4I77L 1YPZB 3H2QA 4M6AA 5IWLC 1DVQA 2W0PA 3NCJH 1NKOA 4O2FA 3P54A 4BK5A 2FCBA 4DK3A 3VGBA 2IMNA 2BNRA 2WXGA 3VO0A 2XV0A 3L5IA 2F1AA 4LGPB 5IB5A 1NCJA 4P46C 3DLQR 2NXZD 3FB6A 5E8OA 3NJVA 1T2QL 1UA7A 4D0BB 1ZT1A 1W72H 1HOEA 1T7VA 1R3JA 3CVHA 4KUCD 1DN0B 3CHQA 4WAFA 2XG5A 3SE4A 5DHEA 4YGAB 2DQFB 1LP9A 3FU7A 3U7YH 4ZTPH 4WUKH 4Z3GA 5AWNL 2YHGA 2J1YA 1HEHC 1MFUA 1UZ8B 4I7ZC 1INQB 3D05A 2P3YA 3MZGB 3OJMB 2C9SA 4XNQB 4UV4H 3ARGB 4WJG3 1Q9WB 1F3RB 2H8PA 4J3UA 1EHAA 1BXVA 1PSKL 5HP5A 1RCYA 5D4IA 3EFFB 2DM3A 4X7SH 5EBMB 1BYOA 3PDGA 4TVUA 1PYWB 5IBUB 5KVFL 2XFXA 4M5TA 3SYOA 4PV9A 2SEBA 1MG3C 5L2JA 4P49A 1ADWA 2JIXD 1ADQL 3DOHA 4I89A 4PGCB 3ENEA 2CK0L 1NGYA 3THML 3PIQA 1EJFA 1YYML 5E9AA 3CH1A 4GT0A 4DO6A 3KDMA 4U1JA 3GRBA