2O4EA

The solution structure of a protein-protein interaction module from a family 84 glycoside hydrolase of clostridium perfringens
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
165
structure length
165
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMASKLKEAAEVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIEGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-GlcNAcase nagJ
publication title Three-dimensional structure of a putative non-cellulosomal cohesin module from a Clostridium perfringens family 84 glycoside hydrolase.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Protein binding
total genus 13
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o4eA01
2VN5A 2W1NA 4N2OA 2CCLA 5AOZA 3L8QA 1QZNA 1ZV9A 2VO8A 4FL4C 4WI0A 1OHZA 3KCPA 4IU2A 3KCPB 4WKZB 1ANUA 2XDHA 4UYQA 1AOHA 3UL4A 2ZF9A 4UYPA 4UMSA 1TYJA 2JH2A 1G1KA 4U3SA 4DH2A 5G5DA 3GHPA 4FL4B 2B59A 3F2LA 2VN6A 2Y3NA 2BM3A 3BWZA 5LXVA 2O4EA 2OZNA 3FNKA 5K39A 4IU3A
chains in the Genus database with same CATH superfamily
3QQXA 5DUML 5T1JA 4GMTH 3NJIA 3O45B 1XB8A 1DVXA 4APQD 2R2CA 2QADB 3HRZB 2Q87A 1RZ8A 4CC4A 1WBZB 3IBEA 1OCZB 1S4IA 2E9JA 1XF1A 3OKEA 4LEXH 4FERA 4AYBA 1HZHL 1WAEA 4JKLA 5KJ4A 1A4BA 2QGDA 4WENB 4PRHE 5ADPL 4KFZC 2Y3NA 3VW3H 3QORA 2PTVA 1QOKA 3DURA 4GKLA 4Y4FD 4XT1C 1J1PL 3SJVD 4Y4FC 3FT0A 2VIRA 1P6WA 4L1SA 5EORH 3VXMD 3NA9H 5FYLD 1LO2L 3CZUB 3ULVD 5FO2A 1BOGA 2X4SA 3ULVC 3TN0A 1EJOL 4Y7OC 2Q8BH 3VWKA 3VD1A 1JIBA 2D0HA 4ZMOA 1MY7A 4HH8A 3AQXA 3EH3B 4JO1L 4HIEA 4RNRA 1EDQA 3JVGC 4L3EE 5FM5M 1FV1A 3QUKA 2AQ1A 1SDDA 4JFED 2WBJA 4PD4J 3GMNB 3C5ZB 4R7XA 4ZPTB 3ME0A 1ZWIA 5DD0L 1TXKA 1OXYA 2VO8A 1L7IH 5J6GA 4LMQE 2PN5A 3DBXA 4TNWK 4GFTB 1S3KL 5F89A 3I85A 2J6EH 4PRNB 1HHJA 4KTYA 4JL2A 1PZDA 2FB4L 1I7ZB 3BH4A 3RTQA 3PWLB 3LRKA 3V7MA 6PAZA 4J2QA 5ID1B 4D2NA 1OCOB 1SJVA 3ARGA 5C3LD 1P4LA 2Z31D 1U8PA 3GIVB 4H40A 4PV8A 2Z31C 3N1FC 5FOJA 5F2FA 1GAFH 2DBLL 4KRPD 1YMMA 2VR3A 3IGAB 3PAUA 4KRPC 1QRKA 3GKWL 4UIKH 3DVGB 1DZ0A 3SKJH 4R26L 4PCYA 2NUPB 4XC3L 2R56L 4AYGA 2PYED 3ULUD 3U36B 1W72A 3U4KA 1KJ2H 4JKKA 3TIEA 4DNLA 1AXTL 2CO6A 1MNUH 1SYSB 5IM7B 1QASA 4Q9RL 4PJCF 3B2MA 3MJ9A 5IEKA 2DQUH 4O02H 1HSAB 4N2NA 3QIBA 1CLOL 3MV8D 4ZUUB 3IS0X 5AOZA 4BKLB 2YUVA 3FCTB 1TZIB 3VI3A 1JNLH 1ZT4A 3JWOL 4L37B 1MHCB 4OSUL 3TEWA 3BAIA 4FE9A 3KH4A 1S7WB 1CFBA 4GINA 2GBTA 3C2AH 2APWA 2XZZA 1I8UA 4EIBA 3E6HA 4MAYD 3V4VB 1CGSH 4LCWB 4I48A 3WJLC 4IGBD 2YOAA 3AAZB 5I19H 2VDNH 5CIPH 5BOJA 3NCBB 2JJVA 4L29B 2C3GA 4M43L 2FNWA 3LMJH 4FA8A 1NZRA 3UBXA 2DYPB 3EYFB 1Z7JA 2X9XA 1MFDH 4M7ZC 5I71B 2WTPA 3US9A 2DWEB 1KGJA 4F3FB 4YK4B 1DJZA 2B1OA 3QNYA 1JUFA 5TGBA 3CCHB 5C2BL 2O5XH 3ULSB 1KY6A 4BZYA 1HT6A 5EU4B 1UGKA 4JCMA 3GZQA 2E6QA 1X5JA 3CVHH 4HIJB 5B4MC 1NSNL 4X50A 1UJ3B 1R46A 2D7NA 2FL5A 2UZIL 3D25A 3H9SB 3EFFA 1JDDA 2OZNA 2WNGA 1MJUH 4KXCA 1E4HA 4Z77B 5C7XL 1JYVA 3IXAB 2KLRA 3LNIA 3H3PL 2PYFB 1RPUA 4LASL 5EBWA 1W6LA 3PAZA 3SJVA 4BCZA 4KK6D 1M7XA 3K80A 2XV2A 2DQ6A 2Z34A 3KE0A 3D1MC 2X6VA 4HJEA 4NQVA 3SDXA 4K9EC 3TFKC 5FUCC 3QXAA 1WEJL 2BOCB 3M88A 2V5SA 4R4BB 4ONHB 2DL2A 4ODWB 1TCMA 3U9PH 5F70A 3BN3B 3VD0A 5D1XC 2MSPA 4TNFA 5EB9A 4ZTOH 2PMZA 4HXAH 4A2FA 5KSBF 5I1EL 5FS5A 4PB9L 2I07B 1WYJA 3H4HA 1Y1DA 5MERB 1MW2A 4RAHA 5FM8A 1RL1A 1AG6A 3P4MA 4K3JH 4Y5VB 4ZMPA 3F6IA 2MIZA 4WFHD 2X0VA 1S8DB 1ORQA 2B39A 2YRBA 2ZOLB 2ITEA 4PRID 3T77A 4ZXBB 2YLHA 1KBVA 2UX6A 3T0EE 5IJKC 4N8VA 4NQQA 2ERJB 4FJ6A 4JRYB 4APQB 3D4CA 3KPMB 1BD2B 2D7PA 3DO7B 3H56A 4H13C 4S1SH 5AENA 5LXVA 4JNXA 4RGND 3LNDA 3OXRB 4XBPB 2WMPB 4RGNC 2OMYB 1LO4H 3QCTH 1Z9LA 1O6SB 3PWNB 3R4DA 4H8WC 1G1YA 4M62H 4XMWA 4JDEB 3EIFA 4JFDD 3C09B 2NY4D 3ULVF 2FBOJ 2X4QA 3HZMA 4FLOA 1C5DB 1IJ9A 1YUKB 5GSRA 2ODIA 4IYKA 4JY5H 4IOFD 3GSOB 2YARA 4AI7A 4G6JH 4OJCA 3G04A 4X8JB 3QFJE 2VMDA 3FU3A 2WCSA 1BIIA 4E9RA 1FVDA 1ZXKA 4XP9L 3IN0A 1KUMA 1E9QA 2P44B 3TO4A 1L4IA 2N4IA 2WYZA 1U8JB 1UB6B 3DTUB 3FNKA 2IMNA 5EO0A 3GSRB 2EIJB 4JDVA 1NBYB 1NMCB 1I75A 3NRFA 3QJZA 4JZNA 1RIVH 4WKXA 5CKGA 3UIZA 2H7WA 2R69L 3ESNA 4JO4H 4H2AA 1UWGH 1X9QA 3IDIA 3SYOA 4PBXA 1EZSA 4NZRH 4JG0H 3RWJB 1UHVA 4A7GA 2OZ4A 2I7SA 3IXTA 2QDWA 3S36X 4M5SA 1Z3GL 3P3TA 1VLXA 5F88A 4Z3FA 3HUJE 2GG1A 1MCCA 1NGZB 4XNQA 4B9CA 2PWFA 4FXGA 3CXHK 3R1GL 2OMUB 4P3DB 5DZAA 4MAYA 4KVCH 5KVMC 1Q1PA 3B5TA 5GRJL 2YFNA 1FE8H 5E4EB 1M53A 1JJUA 2ZICA 4F24A 1HS6A 4PY7A 1S9WB 3HI1A 5HYQB 3EYSL 3QUYA 4HULB 2QR0B 4GSXA 1A4JB 2VZSA 3U6RB 1WITA 2X1QA 5F6IB 5KZCD 3ULUF 1DL7H 2HN7B 1U8MA 4A6YB 3HW7A 4Y16B 2IPUK 3RBGA 1GCFA 2P42B 1P2CB 4KUZH 1P9MC 4DN4L 1J0JA 2K45A 2OLDA 3ZTCC 4HC1A 5C8JB 4H25A 1LDPH 2GIMA 4XAKE 4ODUA 2HTLD 3MRCA 3IDNB 3DGGA 1NUGA 4XRCB 3WFBL 2HTLC 3B3IB 2AEWA 4S0TD 2EH8H 5EFIB 4YJZL 3C8DA 4K94C 2CKBB 1HHGA 1WG3A 1A4CA 1YZZA 1KJVB 2LAAA 3AW5A 3RL2A 1KJMA 4XMLH 5J0BA 4PU2A 1G7MB 5I6XC 4BSWB 4PMFA 5TK4A 2CLZB 5I26A 3GI8L 5F44A 4BD4A 1T20A 4KI5D 4JB9H 3MN8A 5KVEH 2J7LA 4HDIA 3V4PA 2A77H 2OI9B 1TQUA 5EIVA 3RWIA 3GUTB 4DKFH 1HOCB 2H6OA 5BV7H 3DUHA 4JPKL 2H26A 2I9LA 2L0DA 2W59A 2EEAA 4TOYH 3G08A 4FABL 3ES6B 5FFOA 2KYIA 1TMCB 1A8JH 5EWIH 2TSAA 4DP1X 3MLSL 2ZJSL 2PTTB 1CFMA 4MD0A 1J5HA 5HHOD 1VEMA 2YS4A 3D7PA 4FQQB 1HQRB 5DF0A 3IU4L 4G7RB 2IV8A 1ZANH 2BSTB 3LQZA 4AVIA 3CUPA 4KX8A 1T2QH 3ALXA 3VJ6B 2EUXA 5EA0L 5F9DC 4FGMA 1BBJA 2JH2A 2I25N 5DTFB 2DN7A 4PP2B 5KVDH 2BSDA 4NP9A 1OAYL 1J5OL 4PY8J 2BIQA 3FF8A 3JWNH 4U7MA 4J3XA 5TJWK 1ZT1A 3KPLA 3GNMH 1OLZA 4B5EA 5BQ7A 3WN5B 4PJFE 2XZQH 4LSTH 2NY2D 4PJGB 1QFHA 3S34H 5DMJB 1XL6A 3GMMA 5HGAA 1GS7A 1FGVL 3GQFA 3LPPA 4OGYH 4AM0Q 1ZXQA 3WIHA 2XPGA 3IN2A 4YFEA 2XYBA 1ZHNA 3HG1B 4G71B 1CD8A 2CO1A 2R0KL 4IRJD 3ZHNA 1P1VA 4XXCA 4EO5A 5IW1A 1E0OB 4IRJC 1I7TA 3D52A 2OTWA 1UB5A 1EUTA 4HT1L 4QUOA 5DEGA 1VJSA 3D05A 1NBCA 1IC4L 1ED3A 2PO6B 1FZKB 2VKXA 4TQIA 2V17H 4MKMA 1OAUH 1P7BA 1KJ3H 3N43F 3BSGA 5FYJD 3VRLE 5JW5B 5CGMA 1TCRB 4ZS7H 5IB3A 3SD2A 3BQUB 3X3FH 3W3BA 5EF0A 1PX8A 1I1YB 1M7DB 3S37H 1G94A 2IH8A 4B0MM 3DX9B 5L8JB 5JIHA 1MFAL 4AT6A 3QZWG 3CH1B 1ZGLP 1L7TL 3IWVA 3ZX1A 5E94A 4NI3A 3UXFA 4C55A 1AGDB 1HNYA 3DKHA 1BQHB 3QYMA 3GO1H 3CZKA 1AIFB 3I75A 4ZRGA 3FOMB 4LT7A 3EGSB 3VXNB 2VMFA 3RWFB 2BNRD 3D9AH 2ZCHL 3TZVB 4J3UA 4EN3A 1SYVA 4NFDA 3AJ7A 4L4VD 2AJ3A 2R23B 3HC4H 1JZIA 1JWUA 1P4BL 4F37K 1R3LA 4HXBH 3B6SA 3LRSB 4OZ4A 2RTTA 1RJYB 2BZCA 3ESMA 4QTFA 1G5GA 4YDJA 1EA9C 4M8RA 3NDZE 3HB3B 3NIDF 4CAGA 1MCBA 4OI7A 4H44C 2ZZUT 3UJIH 5L0QC 5IVXE 2ADGB 3FUFA 5JXAH 4LLVA 1IJNA 3HC2A 4JFOA 1BF8A 4EDWH 3L5JA 2EIZA 4XZUB 5ERWB 1U58B 5DSCB 2CWRA 1BQRA 3BYYA 4HOZA 3RWHA 1SN2A 3CX2A 4HUVA 2FK9A 2ZCZA 1KIQB 3KH3A 3KPNA 2EICA 4Y1AA 4AYSA 5ADOL 1J9QA 3Q6GL 2EH7L 3GZOA 3X12B 3K71A 1GSMA 4N1CA 1BEYL 4KDTC 3MMEB 4XNDA 4HALA 4N0YL 3V5KB 4E5XG 2ZPKL 4BZ1L 3DX6A 4F7CA 4NQCD 4JQXA 5DVOA 3VYOA 1J0YA 3G9VA 3X13A 4JJOA 3RWDA 2UXVA 2EO9A 5DHMC 4ZMWA 1KMGA 4P2CG 1N70A 3DX4A 1KGCD 2NXZB 5CBEA 5GZND 2O61B 4BV1A 3BEVB 4HH9A 2Q3XA 3RU8L 4X4YA 1CC3A 3O9WC 2VM3A 5L4FA 3QJRB 2QGCA 1I9IH 1E27A 2R0ZH 4P4KB 4FADA 4ZMNA 5F3BA 4WHTB 2XLLA 4XP6L 1AZVA 2H3NA 2X6BA 3ZU8A 5HHOA 2DW5A 2C26A 2VJ8A 4YHOL 4ENED 1YEEL 5TE7H 4YXLL 4ENEC 1CE6A 3BP6A 5FYKH 5IROD 1IIIA 4MDJA 3QUZC 2WXOA 4BGLA 5DUJA 5IROC 1QSFE 2DQMA 2VDLH 1KGWA 1J0KA 2CSPA 2UZYB 3ATEA 2H1PL 2ICEC 1QSEE 5CUSL 2WLZA 5JORB 4P2RD 5I18H 5DHVH 3K5SA 4HWNA 3Q44A 3O3EA 3FUNA 2F8IA 4HU8A 3HAEG 1JPTL 4KI5F 3TV3H 1MHPL 3FQRB 3AMKA 5L7XH 2X4UA 3GMOA 1HAUA 5DDHB 3MRMB 3QRBA 1ZVSB 4G8IB 4HU2A 3DYMA 5IB4A 3U79A 1S7VA 4P2QE 4X80L 1MRFH 1PKQB 1A0QH 5ANME 4ZFOL 3EBHA 3QDAA 4MNHB 3EOAB 4ZO6A 3AB0B 1E4XL 2OMZA 3P3RA 4P23A 4Z3IA 5I6KA 1DBJH 1ML0A 1I85C 1ZIAA 4GI8A 2GABA 3KJ4C 4R90L 2WZPA 2X9YA 3EGXB 3IPFA 4Q6KA 4TL5A 3SPVB 4XBMA 1WZ1H 3VQLA 1UC6A 3CFMA 2DQDH 3LKQA 5TE4L 4L9LC 2DMKA 4H88L 4KZ0A 3WGUB 1HYSD 4LBEA 5AVSB 5AQ0A 1Y0LB 4PREA 1HYSC 12E8L 5TQ2H 1XMEB 5BV7B 2WVTA 1OHZA 4AG4L 1U41A 3RHWF 4U6YA 3IPBA 5BW7A 3MBWA 2VABB 2AC0A 4GXVH 2BFVL 5LCVL 4Z7QB 4ZUWA 1JV5B 35C8H 4U3SB 3H54A 4XBGB 1GJIA 3MROB 1DQMH 2PR9A 1E8WA 5AW5B 3QJHA 5ITFB 3SDAB 5GGRB 5BS0B 1BJ1J 4Y88A 1B4LA 3ABKB 4CW1A 1M6OA 3F7LA 3QPKA 3WDIA 5L4MA 2IANE 3GTNA 3ZUNC 1I3UA 2CM5A 4GS7C 2X4TA 4YHZL 2R39A 2J1ZA 3CN2A 4LGRB 2WWKT 1ADWA 1QPKA 3WUWG 4GW4B 1Z5LA 4UQ2B 1EZUA 3QFDB 5LNDA 2ZYIA 2DV6A 4DUVA 1KB5L 1C7TA 3QRGH 1MCDA 5E4OA 3VSVA 4GSRA 4IIQA 2AK4B 3FQUB 4CILA 3FSVA 4M3JA 3EO1B 4F2FA 3Q2NA 2HX7A 4OD1L 1NFDB 1S7SB 4UQEA 4L4VA 4ZTEA 5IFJB 1SOSA 3DC0A 2ITCB 2WZ6A 4FLRA 5F7UA 5J11C 4CGUB 5DD5L 5B22A 3VI4B 3W38A 4G9FD 2EVHA 3CC1A 4NS0A 4TNEA 3EYQD 3OR6B 3C08H 3E1ZA 4PJ8D 3E3QE 5J1AB 5D1ZI 1YSOA 4PJ8C 3PHQA 1OM9A 1D2PA 1NGWB 4ES8A 2D9CA 5EU7C 1AP2A 1FLTX 1SBSH 3FPXA 1L0YA 5IHZB 2R2EA 2WLJA 5F1OB 1V55B 2YGNA 4I3RH 1VACB 4FULA 3MNMA 2DQCL 2VMJA 3D4YA 1NBZA 4FHBD 4Z7OF 1GPOL 1KLUA 3MRBB 1UM4H 3DJRA 4NCC2 2CRZA 1NCCH 3NJJA 1HH6A 3MGOB 5AVYB 3VM5A 3MAWA 5HDOA 4EIZC 5CKAA 1FF5A 5D7JB 2JCWA 3S2AA 3E7JA 4HPYL 2E6PA 4P3CH 3EFDL 2IDUA 3QZBA 4JFVA 2XICA 1NM4A 5CLXA 4W9ZA 1OLLA 2BNQE 1KACB 3WIIL 1Q94B 1S78D 4JFHE 3GMRA 1S78C 5IQ7L 1TYJA 3FSWA 4HGMA 1ZHKA 1WAAA 2DQHL 2OXHB 5E00B 1DLHA 2ZX7A 1F6AB 2YEQA 3S5YA 4CVXA 4OY9A 4X6FB 2WKOA 2OAAA 4YC2C 2EVJA 4F1SA 4C4KT 2OJEB 4YDLB 3OJDB 5F9JB 5K39B 2GUYA 3JV4A 4WRLA 4WDIB 4X9YA 4YHNA 4ECNA 4LLMB 5D7KE 5FPIA 3P77B 2CCVA 5IJCC 4LSVH 1JPSL 2XWCA 1GGIH 4KMQA 4P2RA 4XNUL 3MREB 3O2WL 4X6CE 5D70L 3TCXA 3QGVA 2AZAA 4RETB 3D07A 2OW6A 4LQFL 1FO0H 4XP1H 2PKDA 4X7TB 4Y5YB 3QBTB 2W60A 3IMWA 3CDCA 5DK2B 1CUOA 5C0BE 4XBEH 4OM1H 3BPLC 2CCWA 1FORL 2YSSA 4KK5C 1WAAF 5D2NE 5DD3L 1CG9A 3KXFB 2WNXA 1JGIA 1ZA6A 5D8JL 5EZJA 1OCWH 1IC5L 1T5XA 3QEHA 3W0WA 7TAAA 5D96C 2XG5A 4LHUD 4PVBA 2ZE0A 3VFPB 2FBJL 2XVLA 2WTRA 1YG9A 1EQWA 2AKRB 1A6VL 3FB5B 4UQCA 2AXWA 1AGCA 3O81A 4JFXB 5DC2A 3WKYA 3MUJA 1EHXA 2V7HA 4I2XB 3VFMA 3VQMA 2XY1A 1EHLL 1RIHH 2X7LB 3ECBA 2YD6A 3HBQA 2V9TA 4G72B 3MA9H 3SB3A 5C0AD 2VJ0A 4F33A 3DX8B 2XTJD 1UKQA 1OGTB 2DBJA 4EXPX 3OZ9H 1E6JH 1Y07A 3NSXA 2CDEA 4AEIH 2JFCA 3FCBA 4QF1B 3TBSA 3VGDA 1YEJH 3GJFH 2BHYA 3MLRL 3RGVD 1E30A 2YK1L 2XN1A 1FGNL 5GGSA 3VW3L 5BOPA 3B7UX 1FNSH 2CLVA 4RFOH 5B1BB 1AZBA 4BUHA 5EIIG 5IKCB 1R9FA 4WSGA 2JKWA 3BE1L 3AS3A 3NA9L 4DFHA 5IV2B 2KL6A 5ACMA 1TETL 3D85A 4JG9A 1UQSA 3KLLA 4BK4A 2F7OA 5J6HA 3TNNB 4GQQA 3SBRA 3BVNA 3N50A 2Q8BL 4OZHE 2DEXX 3NPSB 1WCQA 5AKVA 5FM5O 4Q4IA 1WT5A 2Y2YA 4HGKC 1PZ2A 2ZUYA 4HZ1A 5DZOA 3LPOA 2DLTA 1AHWC 3GBMH 4J3WA 4URTB 2QFRA 5IWLA 4L5FH 3FUIA 1BPLB 3A6CH 4W6XB 1G9NC 4M3KB 4NC2B 3GHPA 5IMLB 3BKJL 5JW3H 3C12A 4O00A 5DUBA 4EI0A 3GDCA 3SKNB 4ZFZB 4FN0A 2PUQT 3AWGA 3LS5H 1U3NA 2JKXA 2WM0A 2J6EL 5LNGA 3KWTA 1IL1B 3GS0A 4HA1A 4NAJA 4XN1A 2X53A 1DFBL 1SXCA 5DUPH 1JZ8A 3T0DA 1LP9B 3D39E 4N9OB 4WKZA 3MV7A 3I6GA 1I8LA 1S7XA 4HKZA 2HWZH 3RE0A 2R51A 2I9TA 2F5AH 4KKAD 3L1OL 4QY8A 4PH8A 4YHIA 1GAFL 3STLA 2JCCA 4KKAC 1JGDA 4OCNC 4AMWA 4Z7VE 2DZEA 3EDFA 3K2IA 2BW5A 3GSNA 4AL8H 3O4OB 4FQJH 1I3RB 3PQYA 5CFAA 4UIKL 3FTGA 3AM8A 5F72S 4NBXB 1W16A 4U1KB 3MRJB 3SKJL 1XSJA 3TNMA 2CD0A 2CK0H 2X0UA 1XT5A 1CDIA 1INQB 3Q6FA 1LVEA 3SKOB 1TQWA 2GT9A 3SO3C 4Y19D 3HG0A 2CNYA 1KJ2L 2YAHA 1T03H 5B3JF 3VFUB 1OZTG 1MNUL 3OKDB 1DFXA 3KPRB 4APXB 1F86A 2DQUL 2EC9U 5FO9B 4O02L 4QRPB 4RCAA 1GYAA 2Y7LA 2ICWI 3F7PC 4DH2A 1XGUA 2H4EA 2Y24A 1JNLL 1FG2A 4V1DA 1BXVA 3HE7B 1FYTA 2WLHA 4HGWA 4TNVK 3D4GA 2WP3T 4N5ED 5CCKH 3SZ6A 4G2AA 3QI9B 5E2TH 3SDDA 3QIUB 2F0CA 2JCCF 3C2AL 3ORJA 2Q7YB 2OK0H 2NY0B 3FT3A 3FQTB 1YYLL 5CEYB 1J88A 5I19L 2VDNL 3ARBA 1YEGL 1BWWA 4XNZB 2BWIA 3ROOB 2V2TB 2GYSA 4B53A 4KJYA 1XSOA 4UOJA 3P4NA 1P5VB 4F8QA 4EI6A 3D33A 3OKOB 4RWYH 1MFDL 4UUJB 5D1QA 2VR8A 4E9LA 4LMQI 2GJ6B 2XY2A 5TQ0H 1E5AA 2VM4A 3BRFA 2BCKB 3BSZH 4PCKA 2BK8A 2E7HA 4HC1H 4JL1A 1JN6B 5C0CB 2O5ZH 5JQIB 1CN4A 3HVDA 1TOXA 3BUQA 4CMHC 1SDAB 4AZ8B 4OJYA 1BFSA 2KKQA 3CVHL 2C9VA 3L16A 5C0AA 1PY4A 3PABA 1ILUA 1S9VA 5TH2A 4HCRH 4YPGA 2YAOA 1MAJA 3VGFA 2XHNA 2V0AA 3P11L 1MJUL 1XBRA 1I82A 1G7HA 1MXDA 2EKSA 2R1WB 1Z9MA 2C9XA 3DSFL 4NZJA 2AXGB 3SGJA 4YEFA 4K7PY 4YL4A 1GS8A 5DA0B 3MNVB 2NY1B 5D71H 4PRAA 5AAPA 1K6QH 1E5ZA 2ZOUA 4KNTA 5DJ8A 3OC5A 3PV6A 3FCSA 5KS9F 5L2JB 4JGNA 3E6FA 3U30C 2MQ0A 3QEQE 2CPCA 5GS1C 3BAJA 1E4JA 4N24A 3ZDXF 2MOGA 2AVFA 5GRUH 4XPAH 3FO0H 3GRGA 3U9PL 4LKXB 2F19H 5GQBA 5B7FA 4ZTOL 3FULA 4HXAL 2MCG1 3LEXA 3ESOA 4PRHB 4HQQH 4JZOA 4PRDB 1G7QB 1OZUA 2D9QB 2KS0A 3C60A 4WEEA 2IMMA 3BDYH 5IB1A 2NCEA 3KBFA 3JQOB 4O4YH 2ICWB 1UACH 5MEND 1HEZB 2HG5B 3WFCL 1SN5A 3M1CA 1Q9OA 3B7SA 1BZEA 3H55A 2CMRH 4QRRD 4BELD 2ZKWA 3VFTA 4S1SL 2OCJA 4PV9A 3MCKA 5AZ2H 4PHZA 4CVZB 4HBQA 4L8CB 1MVUB 4OVVA 2BP3A 2VLKB 1II4E 4P2OA 2RIKA 4L3EB 5A6LA 1F13A 2X42A 4URKA 2MRYA 5HI5D 5DZVA 2QADC 3QXTA 4GRLD 1CU4H 1MAKA 2JJWA 4JY5L 1MEXH 5JNYB 1DCLA 2Y4SA 2G5BA 4O9HH 1AXSA 4G6JL 2CCLA 3DWTA 4W1TA 5C07A 1P6FA 3TT3H 2MOQA 4P9HC 2VWEC 2FSEB 1J1OH 1CGTA 1KTDA 1F2XK 2CG9X 3FFCE 3PCYA 1AD0B 5EN3A 4J12A 5AL0A 3CLWA 2OYMA 1XGRA 3C5JB 5GSVB 4M1GH 3FQWA 1GW6A 5CP7B 2JF1A 2F7IA 1ZEAH 4JY6A 1PQZA 4YBLB 2GSGA 3KYOB 4XXWC 4OLXH 1Z2KA 1QWNA 1PVHA 5IQNA 1UWGL 3VH8A 1OE2A 1OP3K 4NZRL 3SPJA 4N8UA 2XWRA 3K0WA 4FA7B 3NFNB 1SDYA 1MI5B 3NFSH 2VXQA 2CZNA 2ENJA 2VLJE 3WS6A 3D09A 3MOAH 4LEBA 5E1GA 2HLFD 4R0LA 3ZYIA 1F8TH 2HLFC 4E5XB 1DSWA 4POUB 1QWUA 2FQDA 3MQIA 2CHXA 4UT7H 1KXQE 5F8QC 4UT9A 1AG0A 1UXWA 4HK3J 3MJ8B 3TONA 3WEBA 1BZQK 1LTXA 2HAZA 4PJBE 4KVCL 3VG0H 4JJHA 1FE8L 3CC5B 5SX4H 3C5ZC 3I84A 1I9EA 3CDGB 1J8HD 1H19A 2FZ3A 1GGCH 5AUMB 1TR7A 1VFUA 2FHFA 4FYRA 3AVEA 3CN0A 3NZHH 2G3MA 3G6DH 1DL7L 1N12A 2O4EA 3T9WA 1U93A 4MBOA 5AWNH 2BVOB 2W65B 3PPSA 3RJDA 4D0DA 2G2NA 3MOBH 4UQDA 3D08A 3PWJA 2W81C 2XQBL 4P5TB 5HYSA 1LDPL 4G11A 5E5MB 2P80D 5TFSL 4NZTH 5TDNA 1AQDA 1AVAA 2EDNA 2EH8L 2IH3B 1EK3A 1KZYA 4KJPD 3GZKA 4KXZH 2GIXA 1JPEA 2OMWB 2OX5B 4KJPC 3ATFA 2JKJA 1VZIA 4MD5A 3QWOA 1EDHA 4C56A 2XXCB 3TEXA 1NGPH 5F7YC 2ICES 4XMLL 5PCYA 4X6EB 3WD5L 3GSXA 3HAEB 4L1LA 4HIHA 5CD5C 4JB9L 4IKJA 4MJ6A 5KVEL 2AK1H 3FONA 2A77L 1IX2A 5IB2B 3WI9A 3WEXA 2YD1A 4QYOB 1N19A 3BESR 3ZGHA 3QIWB 3C5XA 4MCNA 4YSPA 2VR7A 4UDTB 2DWDB 2ZT9C 4FQLH 2GTWB 4ALAC 1AQKH 4TOYL 4OZIA 3LIUA 3REVB 2XQ0A 3I6LE 1V7NH 3UZQA 3MLTB 2V7NB 4LCUB 4N6RA 1CURA 5I30L 1RVFH 3F6JA 4ZUSB 2XWTA 2F08A 5AVRB 2FR4A 1WVZA 4KROB 3FT2B 2XWXA 1ZANL 2WXKA 3K74B 4F7KA 4G80A 4GY4A 1SUHA 3T3PE 4HKXA 3M1OA 4WTZG 3BPCB 5LAXA 3X1GA 4PJEA 3DMMD 4I18B 4K3EL 1KFAL 3DMMC 2RH0A 3DTDA 4HWBA 4ILDA 5I6LA 5IF0A 5KSUB 2CLRB 1HEHC 3S5LB 5KVDL 3NJVA 1NCJA 2FIKB 4U33A 3F6LA 1FL5B 2Z35A 2WCPA 2DQTH 2G0KA 2DYPD 5C6WH 5I0DA 1F02I 2YFOA 3GNML 3L4CA 5I71C 2XZQL 3LZLA 2NX5A 2OXGB 3WJMA 4E9QA 4OZIF 4YK4C 3WUWB 2PP7A 2N56A 2VRQA 1TUPA 5E8EB 4WFFD 5C0EA 5DURB 5I1LB 4OGYL 3I3EA 2YA0A 2YN3A 4CU6A 4J3VA 5DJXB 2DD8H 5FHAH 5C0GA 5T5FA 4MA3A 4L8DA 2ATKA 3H9SD 3ZKMD 1UJ3C 2CJTA 3Q8EA 1DDHB 1DR9A 4PJEF 4FLQA 4WJ5B 4W4OC 3RVWD 4BSVA 5DGRA 2CHZA 2HVJB 5F93C 2HX8A 4UNUA 5KOMC 3GBLA 1DO6A 4JPVL 4YGAB 1GIGH 4ZFGL 1DN0A 4GUOA 2ED6A 1C16A 2V17L 1AQHA 4FG6D 2CDGA 3DIVA 3IDGA 1WFJA 3SQOL 3CIQA 1OAUL 1X5AA 3AREA 4FG6C 3L1FA 1KJ3L 3I6KB 2IADA 3RZCA 4TVPD 2WBWB 1EPFA 4ZS7L 5M7QA 2VAAA 2FWOB 3X3FL 3VXPA 2LE9A 3NVQA 1KIPA 3QVAA 4OAWA 2NNFA 3V0IA 5DRXA 3V0DA 1D7CA 4DKEH 1TNMA 2K3TA 4OI9A 1INDH 3FBQA 1D7DA 4ZZFA 1OAXH 4DWHA 1UCBH 2L3BA 3QFJB 3TP4A 3NK4A 1LEIB 4HD5A 1MCKA 1A6PA 4W9DC 1PLCA 4RFEA 3GO1L 3ASWA 2N0KA 3QA3A 1DQTA 1VGKB 3DTXA 2BY3A 3R06B 1QUPA 4OQ1A 2NTSP 5E6ZA 5KYWA 4JQVC 3D9AL 1J8HA 2CHWA 4Y5VC 4YOKA 3HC4L 1M1XB 1L9QA 5DFTA 4HXBL 4IOIB 3VDBA 4F9LC 2XA8H 4ZXBC 3EDEA 4X8CA 4NCDA 2R8SH 4JRYD 4J3TA 5DVMA 1BD2D 2ERJC 4UIMB 1XCQB 3UJIL 5FB8B 4CC0A 1E4XI 3FB8B 3O8XB 3A6BL 4PGCB 3CU7A 1BQKA 3DPBB 2HLAA 3SQBB 5AD0B 5DJCB 5JXAL 4YX2H 3HUJB 4W4NA 3FT4B 1KIUA 3KGTA 2KQMA 3IMUA 2P80A 1EBAA 1I8KB 3C09C 4MJHA 3RY6C 4DO6A 5L8KB 5HI3D 5E9NA 1NLBH 5HI3C 2W88A 4YSOA 2D3JA 3BP7A 4X5QA 1MCQA 1ZTXE 4R4FH 5C0ND 3MUGB 5E5UB 4ZOAA 3TTSA 3ZT7A 5IMOA 4XPFL 1VSCA 4R4NC 4WTWA 1URLA 4DOHE 1QSVA 2IF7A 3LH9A 2XWZA 1NAMB 3HBZA 1CDJA 1YMME 3CFBA 4E68A 1X4XA 1HXMB 5LDSA 1C1EH 4WK0B 1CFVH 4W9KC 4LF3B 1UG9A 1NMCC 4ORZC 1JZFA 2EEXA 2J72A 3Q1SH 1BQSA 4GW5B 4UOW1 3DHJA 1I9IL 2R0ZL 4JX0A 3WKMH 3D6GA 3KYMB 3HE6D 2BCMA 2YXWA 2OR9H 1JZHA 2A6DA 5TE7L 4XNBA 2DJMA 2VXSH 3S3PA 3TU6A 5FYKL 4WI0A 3OZLA 3PJNA 3VI3E 5AAWC 1J0ZA 1QRNA 2VDLL 2XWDA 1J87A 4BDVA 1WFNA 3APMA 5I18L 1Q0EA 5T1LB 1G7PA 1TJGH 2D4DA 3IT8D 1EFXD 1RUQH 1RUPL 2B3RA 1CXFA 1IAIL 3GMLA 1CXKA 3TV3L 2ZX6A 4ABQA 5L7XL 4JZJA 4PTUB 3PREA 4RGOH 5F6IC 5IEHA 2CUMA 1IQWL 2Q76B 2PPFA 3KPPB 4Y16D 3QNFA 4UINH 3APCA 2CGRH 4X9IA 1IEAB 1SMOA 4Y16C 3VSTA 5KBLA 3BO8B 3TESA 3HKZA 1MRFL 3LCYA 1A0QL 4GAJH 1BXUA 3GS7A 3HI5L 1NOFA 4YDVB 4NQDB 2BMKB 3VX1A 3U9WA 3IFOA 1QFWH 1DBJL 4L9DA 3MHZA 4K5PA 5EIIB 4HSQA 1QWHA 2VISA 3HJEA 4EXKA 3L4YA 4RMVA 2GQHA 2AEQL 5EZOH 2NQ3A 4PY8I 1WZ1L 3IDUA 4MX7B 1H9VA 2DQDL 1BA9A 3ZIYA 1CR9H 4F15B 1IGIL 1N6UA 3EF7A 3CFEA 3M6DA 4NT6B 3OC8A 5DS8A 3KJ6H 3T6ZA 3VFWA 2FGWH 1YC8A 3L3DB 2WO3B 3BP4B 2WPGA 4FI6A 4GXVL 1KIRB 2OI9C 3LIZA 4PJFB 3C75A 1YPZA 3GK8H 1ZLVK 3T2OA 2WSDA 1DQML 5DJYB 4QJ5B 4QXTA 2YMXH 3RX8A 1T0OA 5HYJA 1N64H 1GVIA 3MV9B 5IOPB 2DOCA 1YA5A 4IW4C 1ESOA 1IM9B 3N1MC 1DVSA 4JPIA 4GRWH 3W57A 4TUJA 1MW3A 3OGOE 4HOWA 1ACXA 5HGBB 3SYQA 2VE6B 3SDXE 4U1SA 1UWYA 1OL0A 2H1LM 2NYZA 4OFDA 5B39A 2WLIA 3Q8CA 3FFDB 5D9SB 3GKZA 1OIOA 1PYWA 4RMUA 1SEQH 1XH1A 1E9PA 4IRSB 3QG7L 4XN2A 5EC1A 4PJ5E 5FK9B 3F7VA 1T6VN 2NNCA 1YYMH 4NPYA 1IQDB 1KGXA 3G5XA 3VXUB 1KB5B 3GBNL 3LQAH 3QG6B 2XWJA 3TA3D 1D6VH 5I1CL 4AXWB 3SPCA 3C08L 3TA3C 2H8PB 4PI2A 3WN5C 1AO7A 5ESAA 4Y9GA 3US0A 3F83A 4B27A 2HRLA 2OPCA 4X5XA 1QMUA 2K6YA 1ASPA 1SBSL 1DP0A 1MCOH 3LKRA 3NQIA 2EC8A 1O7SA 3H42H 4A7QA 3HG1D 3GSWA 4FCHA 1QVOA 1ZV9A 4AYEC 4I3RL 1PZ5A 3WTVA 3W9DB 2EJ1A 4X4XB 5DQ9A 4OKDA 1MWAH 1UM4L 1NCCL 4HEPG 3PUCA 4HLZG 3NH7H 3BZFB 1NA8A 4NNYB 3IJEB 1HZLA 2PO6C 2ROYA 4PVLA 4HK0A 4FZ8H 3L95B 4TTDD 4JAMB 5D5MB 3HMXA 1WHOA 1N2RB 3T6XA 5IVXB 4P3CL 4PG9A 4WSKA 3CHOA 2Y6SC 2WIMA 3KVPA 4DPAX 1YC7A 2ZUXA 3TWYA 5HJDA 5DYOB 5A2FA 2MJWA 4ZO7A 3BQUC 4GBXD 4I0PB 3GSNH 3KDMA 3MO1A 4PG2A 4B97A 1D5XB 2X89D 3LV3B 3HS0B 3HE6A 2I85A 1JTPA 1Y18A 4X98B 4XP4H 4PWEA 5LUMA 4FYSA 2O5YH 2EP6A 3KPOB 5I66A 3VDAA 4LSVL 3FU0A 1N0XH 2G2RB 3MJ9L 1GGIL 3V5DB 5A3ID 2CIKB 2PTUA 3TZVD 3ZKND 3CPLB 3TZVC 1EFXA 4PYGA 3FW6A 1QA9A 2XSKA 2NUTA 2IGFH 4IBWA 5F1NB 1FO0L 3KS0H 3QDHA 4FTVA 2Z1PA 4UDUB 4XP1L 3BN9C 1WTLA 4AWJC 3HB3C 3O2VH 2X4OA 4QO1B 4FAAB 3TFBA 4LDCA 3UABA 4UOZA 1HU8A 4FRWA 4OM1L 4UNTA 4ZQKB 3L7EB 3IMBA 1WGOA 5IK3B 5LXGH 4YEEA 1RZKL 3K7UA 3T65B 5T3XD 2VDPB 1OCWL 1QSFB 4JFFE 3IU3B 1UXSA 1WAPA 2CDFA 5DD6A 2H1XA 3CDYA 1G9MC 1QSEB 2IG2H 4J4PD 2VB5A 3L9RB 3FTSA 1UD4A 2IAMD 1E7VA 1IGYA 2IAMC 3IJYB 3CFIC 4GXUN 2V3DA 4HHGA 1AKJD 3KCPA 4P2QB 1CF1A 1RIHL 1HL4A 1XWVA 2P52A 4HX1B 5T5NG 1IB5A 5IJVA 3N06B 1QAWA 3JBG7 4JM2A 2NXZC 4CKVX 2PXYB 1LEKB 2JI3A 3VFRA 3WL9B 1PFCA 1T89A 4KZEL 1BSIA 4BFOA 1RJZB 2VW6A 4OKVB 4AEIL 1RP9A 4P4KD 5LBVA 4XZ4A 1L0QA 3T6QC 4P4KC 1YEJL 3CDZA 1WICA 3F01A 1LL1A 2WWNA 8CGTA 1HHHB 1FNSL 1SXZA 1QO3B 5K1VA 2NW3A 2WC7A 2ZUQB 4RFOL 1B0RA 1GOHA 2UY6B 3MKKA 4N90E 3GXFA 1BLNB 2W5PA 4R7DB 1AANA 4BYHA 4ZDHA 4ZMYA 5C0FB 1X5FA 1CO1A 1HXYB 3GMQA 3QO1A 2AV7B 1QUNB 3HHRB 3QW9A 3QEGH 2R0LH 3G5WA 1IKNC 1KDIA 1QPXA 5IIEA 5DVKA 5PAZA 4U1MA 5K9KA 3ZDYE 3LH8A 4N2HA 4QCIA 2VDKH 5EPMA 3NESA 1M3JA 5DT1H 4L5FL 2HKHH 3A6CL 4JO3H 3VXTB 1WIPA 4U1NB 2EE6A 3AB0C 3WLWC 1CD1B 2ADFH 3KM2A 4D9QE 1CGYA 2MCMA 1D5BB 3RG1C 3G6JB 5FKPA 2DKSA 4Y4KB 3M8OL 2FJFA 2I5YH 3LS5L 1XO8A 4RZCA 4R2GB 4AYFB 4XPBL 5I9QC 2C9QA 4YAQB 3BMVA 1BGXL 1N59A 3KLHD 1ZOXA 3IS1X 3KLHC 2ATPA 4YSTA 1IEBB 3F8UB 5LDUA 5BV7C 1CBVL 1XF2B 3ATDA 3BKMH 4HS6A 3MRRB 2Y1AA 1KT2A 3AU1B 3WJLA 3NQKA 5I1GH 2GFBA 2CE6A 2HMID 2IVFC 2R2HB 3MXWH 3SZKC 3V6FA 3NEEA 5HHPB 1RKRA 1TFHA 1UTDA 4AL8L 4LPTA 4FQJL 3IDJA 4IMLB 3TYFB 3UMTA 3UTPE 4YR6B 4ZG1A 1N0LA 5BS0D 4JRXD 3SDAC 2EYRA 2X89A 3NIDE 4OZFA 4S0HA 2CK0L 1N8ZB 3D48R 1QLRB 4IJ3B 1LEGB 2JIXB 5JIMA 1A14H 1RQ5A 4RAUB 1U95B 4N0FB 2YD8A 3KBEA 4PJ7A 1T03L 2FBRA 4GAGH 2EIDA 1CFQA 1GHFH 4CDHA 1JFHA 5CINH 3JWNC 5DD1H 4NUJA 5AZEL 3TIDA 5C2UB 1JF1B 2Y3AA 2CUAA 2BNQB 2OZ4L 4ZUVA 1NGXA 1ET8A 5B1JC 5L9DH 4LLWA 3EUDA 3ZR6A 2NLJB 1I1AD 1TQTA 3MNDA 1MFMA 2IV9A 3FPYA 3MGAA 2IH1B 3KNBB 4NM8H 1H9DA 4JHAH 3RDTA 1K3ZA 4LSPL 3SYAA 3GGWB 4MQTB 4N2CA 2P45B 1ZV2A 4F2MA 1TVBA 4XCYB 4H26B 1XH3B 5B1KA 5CXPA 5I1DA 3QT2A 4XI5D 4NWTH 1P7QA 4QHMA 2UZXB 4LQ1A 1IBGH 1H15A 3FDWA 4Q89A 4XI5C 5DK3A 3AT8A 4NQEA 4L8SA 4YIQB 4AEEA 5EC2A 3PUUA 4QXVA 3P0GB 1HH9B 5D1XA 2GI7A 2EUVA 3O3DB 4HC1L 4X6BA 3ZSSA 3SBPA 1R33A 4Y1AE 1MWOA 2VMEA 4Z3JA 3DRQA 3B9AA 4I9XA 3GIZH 4QAWA 3L08A 1TZAA 5D7JD 5EUOB 2F58L 5D7JC 1M71A 2Z93A 5GIRB 1U42A 5FLVA 2WW8A 4QRUA 1TJXA 5EOCH 1ZS8B 3L3GA 2G5UA 3DHPA 4HCRL 1BJMA 4KI5E 2J1XA 1DE4A 3PHAA 1CVSC 4FI8A 4G1EB 3U2JA 3K72B 4RA0C 1XTLA 3DSNA 2ZD0A 2ZAGA 4PJ9B 4PLOB 1ICTA 3H9ZA 4XX1E 4JN2B 5D71L 1NKGA 1F97A 1F4XH 4IBQA 4NQTA 1F1AA 4OJFH 5FYJU 5J57B 3P9MA 4YDLC 3O11A 1XFPA 1W8EA 4WO4A 2E9WA 4PAZA 4UTAA 4IKNA 3ARTA 3UPAA 2B4CH 2Z92A 5EUKB 5GGQH 3MRIA 1XGQB 5GRUL 2QTEA 3FO0L 2KERA 4X0NA 2TRYA 3E8VA 2F19L 1YDPA 3QXWA 1MREH 3ISWA 1JTOA 4Y5YC 4HQQL 5JMRA 2LGNA 4YSAA 1NPUA 2OM5A 3OXSB 2IH9A 1HQ4A 3RWGB 1BZ7B 4FXLA 3UBXG 2PF6A 2C1PB 2NY3B 3QFGA 3KXFD 3UTSE 5ITBH 4O4YL 2X5PA 1UACL 4XB8A 5JLZA 3SO5A 2H5UA 3FJTA 2JELH 3EO0A 1DQQA 1EZLA 4WW1B 3DVNA 3EOTH 4FFVC 3BFWA 5A16B 5LBGA 2VLRA 2VN5A 4XMUA 4MS8D 2ALWA 4JE0A 2Z1KA 4MS8C 1TF4A 4OUOA 5D1ZD 5BPPA 3CFJA 2MH4A 2Z9TA 1OE1A 2YXVA 1TZHB 4XNXL 2EXWD 1FL3B 5KSVB 1N9PA 2R4RL 2EXWC 2P8PA 1IBHA 2ZX9A 2C4FU 3CVIH 3ZL1A 3SPHA 1CU4L 4X5WB 3V0HA 3N55A 2KDYA 5HDRA 1ZE3H 3TT3L 1X3DA 1J1OL 1FN4A 1PLAA 4MZ2A 4TSAH 2DI7A 5JHDA 4AIZB 1MJ7H 2FJHB 2UXTA 1QQDB 2VZ1A 4FXKA 1O75A 1LK3H 4BFRA 1SEBB 2HTKD 4B9FA 1FFOB 4M1GL 1KTBA 4WI4A 4R3SA 1ZEAL 3U25A 4OLXL 4L4TA 2C4FT 4PS4H 4Y1SA 4HG4J 5IESH 2F9BT 2LR4A 5TDOA 4J6IA 4ELKA 3VD3A 2OMXB 3QJOA 1KLGB 4O2EB 5CBAB 4XCFL 4XMZA 4LL9A 4Z7OE 2F53B 3H2QA 3MJ6A 4Z7VB 5DLLA 3CG8A 3CSTA 5G5DA 2VDKB 1KBKA 2VSDA 3IFLH 3MOAL 4AJ0A 1MF2H 4IBSA 1F8TL 3H9HB 2BSRA 4G8GB 3NPSC 3RNQA 1I1AA 3EJZD 4UCFA 4UT7L 5BZDA 4GUQA 5I8EA 1U91B 2BVQA 4F58H 1WH0A 4L4VE 3AS2A 2LU3A 1KNOA 5JOPD 4XPHL 3VG0L 1BF5A 3LN5A 2HVKA 2AQTA 1MJJA 3CSGA 3IFPB 4PLKD 4Z18A 3QP3A 2IPTL 2WXRA 4PLKC 1K5NB 1JZ6A 3ARFD 8FABB 4I87A 3ARFC 4LK4A 2BZDA 2OSLB 3G6DL 1SXSA 4G83A 3ML9A 1ODAA 5AWNL 4D7BA 4OCMC 1O5DT 3ELAT 5EOTB 3U0PA 1A1NB 1FAIH 3N85H 3QXUA 3SGEH 1OSPH 4N2KA 1CF8H 4Z9KB 2QVFB 5I24A 5E2WL 3PGFH 1XGPB 1OWWA 4NZTL 1NCGA 3PNWA 1NFDF 3ZDWA 3IRCA 4PJXE 2X2IA 1E40A 43CAA 5SWZD 3VI4F 3SY6A 1NGPL 3O4OC 3WO3B 1JCVA 3MBEB 2AJZB 4FFWD 3BUIA 5DO2D 5DO2C 2X10A 3VDCA 3LXAA 5DJDB 1JD9A 3X14B 1WAAE 2VZVA 1PZSA 1R5WB 1VFMA 4GKNA 1R3KB 4JCLA 3U46B 3C87A 4NRZB 1GOFA 3MRKB 3DBSA 1AQKL 4HHAB 3X1EA 2X88A 3SDCD 1V7NL 4QRPD 4UZUA 1IE5A 2FEDD 3QUMH 3EXLA 1RVFL 1DJGA 4P46B 4Y4HB 4MXQC 3MGTB 3C9NB 5INDB 2P24A 4Q6IA 3OVUB 4PJIA 3HE7C 2QGBA 3SODB 5KTEL 4MVBD 3G6AA 3QI9C 1GA2A 1UATA 1U92B 5AW0B 4FQXA 3QIUC 3GWJA 1BVNT 4QXGH 5EBMA 2HFEB 3H7BB 1WIOA 2NT1A 4OQTA 1NCAH 2MPVA 4NN7B 3K6IA 4PP1D 1KTLB 4DEPB 5J1TC 4PP1C 5E6SB 3L7FB 4HEMA 4NO0D 4TULH 2GAZA 3ULAB 3S35H 1V05A 4LSUL 1I7UB 3SYPA 4MD4A 5CR8A 5JZ7C 2E9IA 1QI3A 1JWMA 4NQXB 3V0FA 5JR1H 3PY9A 4H2CA 4L3CB 1O7DE 5HHVH 1S46A 4E9WA 5I16B 4K3DH 1OALA 3LNHA 5D1ZA 3W0WE 1I1CA 3WFHA 3K6DA 1JL8A 2E86A 4B9IA 1UADC 4OVUA 4PJIF 2ADYA 3W9EB 3Q2CA 3F12A 4K7PH 2B20A 5FHAL 4EI5A 2P5WD 5CD3A 1MOEA 4MSWB 4LHQB 4YDKH 4GP4B 2X4PB 4NZFA 3VWJD 4KO5A 3ZE1F 2X3BA 5C71A 3FCUB 3T09A 4HLEA 5ISZD 4GNKB 1U8IA 2DH3A 2FYYB 1GIGL 4P59H 2F7RA 2B1HH 4X7SH 1CYWA 5CJBA 4POYA 2NY1D 3N44B 1U2HA 2NY1C 2MNWA 2EIBA 4G8FA 1GY2A 1JGLH 3DHMA 4NBYB 3EJQA 2NZ9D 2UWEA 4NAMA 4G43A 1CLYH 5BVJA 2YBRB 1T7VA 4Q2ZB 1VGEL 3O4LB 3A47A 4DKEL 1H3PH 4BK5A 5AL8A 1OAXL 2E3VA 4KDTA 5J9PA 2AAVA 4DF9A 3LKSB 1UCBL 3O0RH 4UAHA 2IBZY 4J8QA 4BRVA 3QJQB 2D3LA 5K33A 4BQBA 4GP5B 4PRHD 1JNHA 1KXVC 1GGBH 1M1SA 5ID0A 4BFNA 4AQ1B 1XGZA 2OULB 1IAII 1ZDQA 5SV4A 5JOFB 2A3TA 4IEFB 1L9MA 3JZYA 3AS0A 2VYRE 4GLRI 1CL7L 3OPZH 4ELMA 1BF2A 3QARA 2XA8L 4LOFA 2WZ0A 2R8SL 5BNXD 1Q4NX 3H7LA 1NDGA 3RWEB 3AUVA 2UWEF 3HFMH 5CGYD 4U4IA 3V0VA 5CGYC 5IW6A 3U9UA 4BA8A 3EJPA 3OTTA 4NLAA 1MRDL 4L3ED 4GG6B 3OMAB 2B8OT 4GKZB 5I6OA 4TLTA 1NLBL 2QQNH 5HP5A 1TTUA 4RIRA 2ZYRA 3MV7E 1PU0A 5SWZA 1IILE 4TTGA 3JZ7A 4EZKA 4HOMA 3SEPA 1LE9B 1ZIBA 3Q2WA 2HFFB 4P9MH 1VPOH 2JCCE 2J56A 1GZQA 1U8QB 2B2XH 1RUKH 1U3HD 2B08A 3OKLB 5I5JA 3Q8BA 2AXFB 4CSTA 2J43A 4DVBA 6CGTA 1C1EL 2BC4A 3WY3A 3PQYE 3QC6X 4ELMF 3IRPX 1FNGA 1U3ZA 1I85A 4X7CC 3TH2T 4NKDB 4YBLC 4UNVA 4NUPA 4ZFQA 5IHLB 4RLDA 2QPSA 3Q1SL 2ADJA 3SDCA 2F15A 2J12B 3CFCH 3HG5A 5EZLA 2A99A 3WKML 1LP9F 5F0MB 4TLSA 4CUCA 3HN8A 4K8RH 4P07A 5DK0A 1Q90A 4XODA 5JDSB 2VXSL 4NOFA 5LWYH 4F9PA 1MXGA 1THCA 1CDGA 4J27A 5CSGA 3VRIA 3WY2A 1KG0A 1IO4C 1XAUA 4P3WA 3FF7A 1J7VR 4V1DE 4WZ9A 5DWUH 1FYTE 3MLWH 1JZGA 4H1LB 1TU2A 1TJGL 2D31B 3BIKB 4JK0D 1RUQL 1JRHL 3OMNB 1FFTB 1RZGB 3QQ3B 4MXVF 4M8QA 2IOIA 4RGOL 1CFSA 4QLRA 1J9RA 4A38A 3OWEA 1ERNA 1G6RB 1TJIH 1YUHB 2CGRL 4UINL 2Z4QA 4NC1E 5E0FA 4I1NB 4D94A 2APSA 2VC2H 2IDFA 4GAJL 5TPWH 5T1DL 2CR6A 1OB0A 5FXCH 1IGJB 4NQSB 4P5TD 3I3DA 3U7YH 2A74B 4P5TC 3O6FD 3VCLA 1N10A 4YDIH 5D1QE 4KAQH 5DGQA 5B3NA 1GSKA 1CICB 2ARJB 4Z0BH 2A73A 3ULVH 5JHAA 2QKIA 4XPGL 1CR9L 5F9AC 3R7RA 4HJGA 4UU9B 2EQDA 3VWJA 5CWSB 4F7TB 1ZVNA 3ZE2E 1IKOP 5ISZA 5LJYH 1S7RA 1RIUH 2X70A 1JZEA 5C0AE 5H4YA 4XX1G 3D3VB 3KPQB 2FGWL 1EXUA 4KXBA 3V6OA 3THML 2DLIA 1D5ZA 2FATH 3GK8L 1WBXA 2R4SH 1K9TA 3QIWC 1MLCA 1VFBA 2YMXL 5H94B 2AJUL 1K85A 1N64L 1F3DH 1PD6A 4ZPVB 5E1IA 1P5UC 3WNPA 2HPOA 4JPWH 3EW3B 5IGXH 4DJMA 4CGTA 4JANA 2QQQA 3ZTDC 2GC7C 2ORBH 4KROC 1RZIA 2NSQA 4X7EC 1U8HA 1W91A 3EJJX 3FB7A 3UL4A 4PJDF 1U36A 2EECA 5J06A 3MNZA 5E2VH 1K5WA 4MA1C 4I18C 1X5YA 1QZ1A 5CJQH 4KKCD 3N40P 3U0WH 3PWVB 1BPVA 2W38A 4KKCC 3AT0A 4ICWA 3K6SA 2OBGA 3QUXA 4HJIA 3FFOA 1RK7A 4MB5A 1JI2A 1N67A 3QORB 1G7LA 3L4XA 3CD4A 2YC1A 3DURB 3OQ3B 3LQAL 1D6VL 1F3JA 1AHMA 1MW0A 4OIBA 1UM5H 4X4MA 1EZVX 2BNUA 1RULH 1LNUA 4HAFA 5DURD 4ZYKB 4LEEA 1BOGB 4AENA 2X4SB 1MCOL 4WWKD 3TN0B 3UBXI 1BVLB 1SJMA 4WWKC 2F7PA 5CLZA 4BSJA 2DEYX 3QXDA 2HA1A 1AZUA 4KY1H 5KYYB 3VM7A 2ROXA 3MUY1 4RNRB 4YUEH 4GMSH 4UQBA 4WY7L 3U2SA 1MWAL 2C5DC 1FV1B 3QUKB 2XN9A 3T0ED 3T0EC 1SDDB 2YGPA 1U3HA 4EUPH 3ME0B 4FZ8L 5ICXA 5BZXA 3VTAA 5C07E 1LYQA 2NY7H 5J6GB 4NKMB 3A24A 4OU3A 3DBXB 3NSFA 4LVNB 1V3JA 1H3TA 5F89B 5EU6A 1AMXA 4YE4H 1HHJB 1NBVH 2PCXA 3GSNL 2F74A 1OOAA 1F41A 4QTHA 3RTQB 3FQXA 1DQLH 4JKPL 3TBBA 3ARGB 4G6FB 1P4LB 4RMBA 5G4MA 5TDPB 3VXSB 4PV8B 1T83A 3QFJD 4V2CB 5FO8A 4X4KA 3OG4B 5EO9A 2ZWYA 3OL2A 3ILPB 3NJFA 2EDFA 4NDMA 5DZPA 4DOHB 1OGAA 2O5YL 1SLUA 3O41A 2PP9A 2R69A 1C7SA 4KTDH 1YMMB 3NG5A 4NRYA 1N0XL 1F4HA 3D51A 4BHUA 5HPMA 4JMXA 2K0RA 3RVVD 3U4BH 3RVVC 4M1CD 2IGFL 2GUOA 4BE5A 3QJTB 4M1CC 3ESPA 5C0JA 1W72B 5I1HL 2VUKA 5A6MA 1TMQA 3KYNA 4LXFA 3FYEB 3FS9A 2WWMD 3MV01 3O2VL 1PGRB 3O8XD 2CO6B 4MA7L 5D2LA 3O8XC 3ZKXB 5LQBH 2IFFH 5IEKB 4KNSA 5DZNA 5DZLA 4NBZB 4PUBH 1QSZA 1DEDA 1M2OA 5LXGL 5D93B 3RX5A 4LZKA 1ZT4B 2QZQA 3CSYA 2YN5A 3FAWA 4G7QB 1KXTB 4K9EH 1HKLH 2IG2L 4NI6A 4UYQA 4WWNA 5FR3A 1XB6A 2J6WA 5D6DA 2ZCLH 2EYTA 4XH2A 4DEUA 3BUTA 5CMAB 2YUZA 3E6HB 1BCIA 4I48B 1AHWA 4RMSA 2KPNA 3SKMA 4C56E 4FG4A 3KHQA 5DZJA 1MCFA 4RH4A 1T5WA 5IJDC 2BHZA 4XAKD 2YPKA 1LQBC 3MX0A 4FJZA 5JIIA 4LDEB 2V5MA 3SE6A 1J0HA 5J6SA 1MHEB 1NEZB 1BYOA 2XN0A 3QNYB 1JUFB 3RVUC 2EDHA 1MN4A 4FZEH 2J2ZA 3VB8A 4OCSH 4H8WH 4R5XA 5D6CB 5E6YA 3P4OA 3RUGE 1HINL 4U1HA 1I3GH 5LB1A 2FL5B 3D25B 2ZSVA 3DXAA 3EFFB 4JO2H 3DRTB 1KCRH 3S98A 2UX7A 3WELA 1NKOA 2WQRA 4PJEE 4TPRH 2CUIA 2R0LL 1N4XH 2YPLA 3L5HA 2J55A 3E8UH 4PGZA 5EBWB 4WVRA 3DUSB 2R9HD 3SJVB 1UWEH 3QXVA 2R9HC 4U6HB 2H2SD 2H2SC 1CLZH 3VXMB 2HKHL 5DO8A 4JO3L 4WHYH 4NQVB 4HIPA 4MZIA 5ESVA 3Q5YA 5I8OH 2ADFL 1JZJA 2GPZA 1KELH 2NX5E 2I5YL 2Z3FA 3T04D 1CB4A 3MFFA 4LKCA 3KWWB 3BGMA 3QWRD 3HA0A 1FNLA 4F15C 5ACZB 1KTJA 4QHLA 1EXGA 3MJ7A 2A6IA 4JFEB 4JRWA 4WHCA 3P4MB 2RQ8A 3BKML 2ZIDA 3L81A 1ORQB 4PYHA 3T77B 5ALBH 3UAFA 5I1GL 3B7TA 1R47A 1A6AA 4J3SA 2O6DA 4I13B 1R75A 3MXWL 4N8VB 5FGBC 2H32A 4DVRH 3SHSA 2WQ8A 5DJAA 1AJ7H 3TF7C 1OB1A 4ZD3H 2PWEA 1IM9D 4I77L 4JPSA 2QL1A 1WZAA 3VRJA 1H5BA 3N42F 1REIA 1A14L 1N18A 3RFZB 1JNNH 2OL3H 1CMOA 1OTUD 3HZMB 4RGMB 4Z95H 2WYHA 1OTUC 4GAGL 3II2A 5GSRB 3B9KA 4GG8A 1FIGH 3X17A 3J07A 3U7WH 1GHFL 4Q4EA 5CINL 5DD1L 4TQEH 1FH2A 4IRSD 1BIIB 4K94H 1FVDB 4IRSC 4ETQA 3UBFA 1UA6L 2IOOA 1PS3A 4XE5B 5JDJA 1E9QB 3TO4B 3KEDA 5L9DL 5IG7A 3ABZA 3V9CA 1QBAA 2CXKA 2R0WH 3HBGA 4HFUH 1J8HE 3WGVB 4JDVB 1BAFH 2C1OA 4FQIH 2I24N 1RZJC 1NFAA 4PGBA 3VFVA 3ZUCA 5E03A 1G1KA 4NWTL 5DMIH 1IBGL 1FNHA 2CR3A 2IWFA 2B59A 2VN3A 2HJLA 5F88B 1BXAA 4YXKH 1OM3H 2Z4TA 3U1PA 3T8VA 5AB0A 5C6TH 4ZFFA 4Z78A 4XNQB 1TEYA 2FCBA 4KY2A 2PCFA 1TO4A 2HRPL 4MAYB 3P0YH 4IGBB 1U4FA 5LGYA 5JW4M 3GIZL 1U8KA 3HBPA 4PY7B 4MCZA 1TYRA 2JK5A 4I3SH 1I8IA 3Q43A 5KEZA 5EOCL 3ZZSA 1MUJA 2XYCA 3QO0B 5LAPA 4AC4A 4M7ZB 1U8MB 3X2QB 4AJVA 4B3EA 4ISVA 1CFTA 2BXZA 1F56A 2B5IC 3FKUS 4LP8A 1HTYA 4I0PC 5FGRA 1FSKB 4HWZA 1TJMA 3CSPA 1USQA 3HS0C 3HUJF 1OT2A 4ODUB 2A9NH 3MRCB 2DF3A 3DGGB 2KT6A 3CFDA 4OJFL 2FEEL 3O45A 5A7BA 1YEDA 4JQIA 3CFKA 3WO4B 5GS2D 1HHGB 3HRZA 1KPVA 4YVUA 3RL2B 1WBZA 2B4CL 3DA0A 4KQ3L 3PG2A 2BVYA 2JKLA 5GGQL 2F1EA 3LN4A 5IMKA 4UB0H 3WXVH 5KVFE 1T20B 3Q13A 3QYNA 1QRNE 1OQXA 2X2JA 4JLRB 3V4PB 2OQJA 1MREL 3RWIB 1XMWA 4MJ4A 3IMRA 1NKRA 1IVTA 4DCQA 2HUEA 2H26B 2I9LB 3AQZA 4M1DH 4NSKA 4DP4X 3ILEA 3G08B 3FUJA 4HWEH 4ODHH 3WNIA 1DUYA 1U3YA 5ITBL 1IBDA 3O2DH 1ID5I 1UH2A 1G9EA 2Z7UA 4MD0B 4XOAA 1QSFD 2JELL 3UCQA 3BPNC 4A39A 3HN3A 4FKHA 1QSED 3LQZB 3EOTL 4F8TA 4X5PA 1Q72H 4KMLB 4G6AD 4ZFOA 4CRPA 3BJ91 4G6AC 2EE3A 2W9LA 5DLMH 3Q9PA 1OGSA 2NZ1A 2XA3A 2IGLA 3BWZA 4P2QD 4AJWA 2IQAA 2CRMA 1WFIA 3LKPA 3GMNA 3KLDA 3GRWA 4PRIB 5CFHA 3CVIL 4IU3A 4ZPTA 3N43B 4Z1PA 1Q0YL 2PCPA 4KBPA 1FIEA 1ZT1B 2OKMA 1SQMA 3AS1A 4PD4K 2PXYD 1AZNA 1E5BA 5JIDA 3KPLB 5T5FL 2PXYC 3EH5B 3BUBA 3QHTC 2VQUA 3ZKQD 5BQ7B 1HAWA 4G3YH 3AWEA 1ETB1 3VQ2C 1YPZE 3GMMB 1UVQA 5CLTA 5HGAB 1CDCA 2BFGA 1PZAA 5I17A 2MNUA 1LK3L 2NY4B 3GF8A 4Q6YA 5LCVA 5CGBA 2AZUA 5HYJE 1DUZB 2RD0A 2XPGB 2ZUQC 1ZHNB 1EJ6A 4AKQA 1X7QB 5CZXD 2HPTA 5IESL 5CZXC 2BY0A 1T1YA 5IW1B 1KTCA 1I7TB 4WW2F 2OTWB 1T04A 1UB5B 2K1MA 4NIYE 1T0PB 2DQFA 4NFBA 2GITA 3HC0A 1K3IA 5DEGB 2MHAB 4KV5E 2Q8AH 3M07A 1ED3B 3KL0A 2WOYA 3IGAA 1EO8H 3B2VH 1MF2L 4P2YA 5B38G 2VDQH 5F7BA 2CO7A 2EEFA 1NIBA 3OAYK 2IAND 1MCRA 3L54A 3NIDB 4F58L 1QW8A 1ZLWK 5F0JB 4HSAC 2PWGA 3TXAA 5BRZD 3STZA 3JYBA 3BCDA 2CH8A 2X1WL 1PJWA 1A65A 1F4WH 3OSKA 2X6UA 1SYSA 4L2LA 2VITA 5IT2H 4KU1A 4W9IC 1KPUB 4AT6B 5HJBA 2NNAB 2CHNA 4ZTPH 1HSAA 4TXVB 4Y4KD 1O9ZA 1HI6B 1AO7E 4Y4KC 5E94B 3FCTA 1QPPA 4R2GD 3FCGA 4L37A 4R2GC 1SLVA 4PWIA 1FAIL 1S7WA 3WSQH 1OSPL 3UADA 1B0GA 1CF8L 4PS8A 4OBRA 4UTBA 1DSYA 2GTQA 4G7VH 3WS3A 4GSUA 2AJ3B 4GXFA 1JK8A 3V4VA 2OCCB 1JWUB 1RMFH 2D3NA 1R3LB 3B6SB 3E3QC 3MLVH 4ANVA 2Z6FA 4PJHA 2BHFA 3REWB 5KZCB 1QX1A 4YDJB 3ZOAA 4KZDH 2DM3A 2X4NA 3AITA 4Z0XA 3OB0K 4J28A 3BVWA 3VB9A 3ABLB 2Q2EB 3IJSA 4XXDA 1G0DA 2EIZB 1KDJA 3VH8G 4F3FA 4IJ3C 3MZGB 2XBTA 1G7JA 3CCHA 4HUVB 2C4XA 4Y1AB 3UPCA 5EU4A 1XIWD 5KJ7E 2EAEA 3K71B 1O6VA 5IJBC 1PLBA 3FZUC 3JWDL 4HIJA 4AVHA 3LPFA 3QUML 4WTQA 4EOWL 4DHLA 3BKYH 3DX6B 4F7CB 5E56A 1S7TB 2BNQD 4Y0GA 1CBJA 4LCIL 3X13B 3NCJL 4JFHD 1PFOA 3RWDB 1GC1C 3IXAA 1PX4A 4IOSD 2IDQA 4Z7UA 2DQGH 3V9EA 3ZYZA 2DI9A 4PJHF 1TENA 4KXDA 2Y25A 5CBEB 5I5MA 2BIPA 1X4ZA 2FT7A 2EO1A 2AEIT 4HH9B 1B9KA 4QXGL 5FWQA 5F8RC 1CL7I 4FTVE 5F3BB 1E27B 3ZSTA 2UXGA 2H3NB 3KLSA 2XIDA 2H0FA 5D7KD 5DC4B 3S35L 5HHOB 5HYSG 1CE6B 4N0CD 4N0CC 3C8KA 4MDJB 2HSIA 3CBRA 2ZKMX 5HHVL 1NICA 2HJKA 2YAEA 4K3DL 1XCWA 4M9PA 4WAFA 3NZ8B 3AACA 4RMQA 4U3HA 5EEVA 4DKAA 1H8LA 2I07A 1OP3H 2F7QA 5H37H 5C0BD 5CEZE 1GCYA 1O9VA 1OTTD 3EYOB 5AW7B 4EQ2A 1FQ9C 4K7PL 2VZUA 1S8DA 2UXFA 4WI9A 1T4KA 3GMOB 5LKNA 4YDKL 1JGUH 4Z7UF 1FDLL 5IB4B 3FOLB 3WTTA 4M3HA 3I9GH 4APQA 2NY2B 3KPMA 4N26A 3RX9A 1PEZA 2OMZB 4ONOA 4P23B 5FGSA 4X7SL 2B1HL 5LGJA 3WTSA 3OXRA 4PJ9C 4ZMQA 2V5RA 2WMPA 5F1IA 3B2DC 1BREA 1JGLL 3NJKA 3CLEH 3LKQB 3GEWB 1VHPA 1KULA 1KSRA 5I15H 4UILH 1CLVA 2VQ4A 3O0RL 1SMDA 1NL0H 3KBHE 1RZPA 4M7LT 3ZN6A 5BO0D 4Q74A 5E7FA 4MJ5B 4L0PB 3N04A 4ZUWB 2IANA 3L4UA 1SJHA 2Y7QA 3UYPB 3QNXA 1GGBL 1U8JA 3QJHB 3FH5A 5BRZA 1JRHI 4S1QH 1XF3B 2NY3D 1AZRA 1NBYA 4CW1B 2ENPA 1M6OB 5KBNC 4K07A 2NY3C 1ZMYA 2WUBH 3OPZL 3QPQD 1YJDC 3RWJA 5E8DH 2VW4A 2D2OA 4QRBA 4NENA 1ZY9A 4Z7OB 1DBAL 25C8H 3PPEA 4XVTH 3HFML 4G8EA 3ZMEA 1G84A 1SQ2N 5HVHB 1ZJBA 3VSUA 4KO7A 4ZMZA 1R3HB 5I82A 1QFWM 1C08A 4P3DA 4L4VB 2VERA 3KG5A 1AIZA 1BZ8A 2E56A 3UZVB 5H2BA 3BYTA 2J6EA 4CC1A 1RCYA 1CDBA 5GGTH 1NDTA 4OLWH 1I8MA 3L4WA 4XO9A 3K4AA 3SE3A 1USZA 2HN7A 1CZ8H 1VENA 4PBDA 4A6YA 4P9ML 1VPOL 3PHQB 1D9KA 1RUKL 2B2XL 3V0WL 3F7YA 1UXLA 2E5EA 3QWNA 4PVNA 1I9RH 4UT6H 5C8JA 3CX5J 1AP2B 4ZMLA 3U1QA 1TLMA 2R2EB 3D39D 4RVBA 5AOLA 1X5XA 1E67A 4XRCA 3O6LH 4A7TA 2VUYA 3B3IA 1NBZB 1PSKL 1WA1X 3GM0A 5EFIA 5BZWA 1KLUB 2V9QA 1PNDA 3CFCL 3NK3A 3SCMD 1HH6B 1S6NA 4NQCB 4PJ7E 4L1TA 3J8F7 4BSWA 4R8WH 1JD7A 1KJ2A 3LZNA 4J3OC 1NMAL 2V33A 2WQUA 4OZGA 2DAVA 4XO8A 1CTMA 3CN4A 3KD4A 1CFNA 4N0UA 4O02A 5IFAH 4GEJA 5DWUL 1Z0NA 3P2TA 1YVLA 3GMRB 1ZHKB 1DLHB 3ARZA 1X7SA 3EDKA 3ES6A 5B3SB 2W92A 3NCFB 4U6TA 4X6DE 5CHNA 1FZOA 3UX9B 1TJIL 4F2ME 1HQRA 3F04A 1IAOA 3JV4B 4YHNB 2AABH 3KVDD 4NYLB 3VJ6A 5CIPA 2CO2A 3U7YL 3F58H 3BLBA 1RXLA 4P2RB 4Y5XB 4NQEE 8PAZA 1G87A 4KAQL 2QVKA 2X4RA 5D1XE 5EOQH 4XP5H 4P05A 3HR5A 1R3IH 4GI6A 4A2DA 3G5ZA 4DW2L 3ULVL 3VMPA 2V6HA 1T66C 2W60B 3FT1A 1KCBA 1A9BA 2BOBA 3MBED 5CEZL 1N26A 3MBEC 4Y8AA 3AABA 4IKIA 1RIUL 1J10A 2KBGA 4I1PA 4ZX4A 2YSSB 1OOWA 3WN5A 2HFTA 4PJGA 1CG9B 1UJTA 4M61B 2GW5A 2N3JA 3CVHA 1ZA6B 2FATL 1T5XB 5F97E 5L8LB 1G9NH 4QRTB 3W0WB 5ENWA 1MQKL 2Y2TA 2XG5B 4MXWH 1B4JH 2C3VB 2OMTB 4X6CF 4CNIB 1RFDH 2BH0A 1Y1UA 2WTRB 3NMEA 2OP4H 3QCUL 4JPWL 5IGXL 1XH0A 4P46D 5TF1H 3ET9F 4NKIH 4Y4HD 1AGCB 4P46C 3NCYP 4Y4HC 1JNJA 3LN9A 3N1QC 3VFMB 5GJTH 4MA8H 3IGFA 1XTMA 3ECBB 2IOMA 2XVBA 4CBZA 4F33B 2NR6A 1MFBH 4GQZA 1EHKB 2CQVA 1KV3A 3PWPA 4M29A 3GD1C 4NKOA 3CMOH 2OA9A 3U0WL 1FFQA 2CDEB 4FQ2H 3PXLA 4NN7C 3BQUA 5IVOA 5TE6H 3TBSB 2FTAA 3BZ5A 4DEPC 1EMTH 1ONQB 5GGSB 1CXEA 3ZY7A 3QEQD 1E6OH 1IFHH 5I8CB 1SN0A 1QEXA 1CD9B 1PX3A 4GT0A 1DEEB 3GHEH 3L1EA 4Y1TA 1UM5L 1RULL 3D85B 1KLFA 1HEJC 1UQSB 3GXNA 1BQHA 1G43A 3FH7A 1AIFA 5J6HB 4YWGH 3CHQA 3BVNB 2VLRE 1FZJA 1IGTA 1KFGA 1YY8A 5ECJE 4KY1L 4YUEL 4GMSL 3H2WA 5DVNA 4G9FB 1WD8A 5HHME 2Y6TE 5L6YH 4PJ8B 1K4CA 1OF2A 3FHQA 1N6QH 2VDOH 3B4NA 4GIOA 4HF5H 1I4FB 2ADGA 1G7IA 5DUBB 2NY7L 5HYFA 1X5GA 4BCYA 1EAQA 4N86A 4OCWH 1R19A 3D39A 5JIPA 1WFUA 4YPJA 1SF5A 1QABA 5CN3A 5JPMB 4BM7A 3ALPA 3W5MA 4EDXA 5DSCA 5JHDE 1PLGH 1NBVL 2XFXA 3UFIA 3F64A 5JHMA 3X12A 1DQLL 4OZHF 3SCMA 2MFNA 1V5JA 5B39G 4FC3E 1L6PA 3I6GB 3MMEA 3MV7B 4WKZB 4L4TE 5FA3B 4EKJA 4HLJA 2DS4A 3RIFK 4HKZB 5T3ZH 3RKDD 4A7VA 1UURA 1ECYA 1LE5A 2X0WA 3RKDC 2YRLA 4QY8B 3S3CB 2EE2A 3ZT6A 3STLB 2JCCB 1JGDB 3FFCD 5D72H 3VE0A 3IBOA 3OHXA 2PW1A 4JY4A 4OD3H 2PPDA 1GY1A 3FL7A 1AS6A 3PQYB 3FTGB 4LDOB 2G4GA 5E2UL 4AQ1C 4DKDC 2O61A 4X7FC 4JCWA 3U4BL 4XAWL 3TNMB 3K5RA 2BIHA 1NDMB 3EYVA 2AQQA 3Q6FB 2VDMH 2ZXQA 3PWUB 3MA7B 2GT9B 4WHTA 3BLKA 3T1WA 2H3KA 1QKZH 1ODUA 4LSRH 1H6TA 2VLJD 4HYTB 4LL4A 1W0VB 5DRNA 1UENA 1M57B 4DQOL 5LQBL 1ZLVH 1ZSDA 3ZLQC 1H3XA 2OTPA 4PUBL 2YJLA 4MRBA 4CL7A 1FG2B 1FZMA 2UZYA 3PGDB 1NINA 1UT1A 3LSOB 4HGWB 2E9BA 1HKLL 4K9EL 5EIQA 5F0PB 5F7FA 1B2WH 5J89A 3SDDB 2BP0A 4YLCA 5GISL 4R6UA 3FT3B 2EXTA 2WUCH 2V3FA 3LD8B 1A7NH 5A7EA 2VXVH 1RU9H 3CXDH 4HWUA 3ARBB 4OGXH 1PKQA 1XCTA 1HE8A 3WE6B 4ZNEA 4KJYB 5HJGA 2Z8WC 3KWVA 5D96B 3A67H 4PLJC 4DP0X 4JN1H 4EI6B 4MB1A 1X9LA 5D1QB 1PZBA 3EHBB 4OV5A 2XVKA 2GVYA 3BXNA 3DOSA 1TVDA 4WLCA 3ZDXB 1UOKA 2Y7OA 3DO4A 2YAMA 1XGYL 5EU3B 3JT0A 1H8OA 1IT9H 3KM1A 1QTYT 4FZEL 3UAJA 4OCSL 5I5IA 5J7CC 4H8WL 3RVTD 3ZRFC 1XDTT 5C0AB 3MI6A 3VGEA 1FCCA 3PABB 4WNQB 1S9VB 5TH2B 2XTJB 1I3GL 4H5SA 5I0YA 4OLVL 1XGTA 1OVZA 3ARQA 4JFYA 3EH2A 4U3SA 1KCRL 3MROA 3ZXAC 4ZMVA 1WLHA 1G7HB 2EKSB 4XTRD 3UG5A 4XTRC 3RGVB 5GGRA 4K5LA 1N4XL 1TJHH 3GI9H 3I6LD 4P9HH 3E8UL 2A1WH 4Z5RA 4PRAB 4NUMA 3IDMA 4X99A 2DJSA 3DYPA 3WG7B 2AXHA 4G6KL 2R1XB 4K15A 1UWEL 3GLEA 4NJ9H 2UY7A 5DJ8B 5I75B 3U82B 1DQKA 2NY6D 2DLEA 3PV6B 4HEME 1FJ1B 1H6UA 5E6ID 2DLGA 3E6FB 3EO9H 1NGQL 4P4RA 2HJFB 3T3MF 3IE4A 1ULVA 1J1XH 5I8OL 3LEYL 5AKSA 2AVGA 5CZVH 2PPCA 3EO1A 4IHOA 2BS71 2BSED 4OLZH 3B1UA 4AW7A 2M8XA 4IM8A 3V55A 1M05B 3KYAA 1T1ZB 4KO6A 2E7LA 3C60B 4PS3A 3SYCA 3OR6A 2F5BH 1OAKH 5ALBL 2ZXWB 3PHSA 1BMWA 1TDQA 3L1GA 3B2UC 4X8GA 5CJXC 4QHUB 5MEOA 4DVRL 1Q9OB 1GS6X 5JXEC 4FNUA 4RX4D 3VFTB 1AJ7L 3ERXA 4AOFA 4ZD3L 1VACA 1R0AH 1E28A 3MCKB 4PV9B 4FFYH 4Y2LA 4AKOA 3TBYA 4J1UA 2AJYL 2UWEE 3MRBA 4LCYA 4N1HB 1JK9A 2QVIA 1JNNL 1L5GA 2OL3L 4X5LA 5LHDA 2YD0A 4Z95L 2WLKA 1YNKH 5HSFA 1OSEA 5AW6B 4CC4C 4J2XA 4BWUA 4KJQD 3X1NA 3U7WL 4KJQC 1AXSB 4HJUA 5C07B 1I53A 4ODSH 3AG4B 2APTA 4TQEL 4UMGA 5HI4C 5DS1A 5AOMA 3CVDA 2JLPA 1B0WA 3IVKA 1F5WA 3QORD 2OXHA 3QORC 1XGRB 4Y19B 3FQWB 2R0WL 2X09A 4TLUA 4UBDD 4HFUL 1HXKA 4JY6B 1PQZB 5B8CB 2GSGB 4RISH 3CBJB 4X6FA 2VLJA 1E9OB 2BVEA 1YO4A 3FTZA 4PWHA 5FUOH 2AANA 5T1MA 1A7PL 4KH9A 4BH7A 4ELME 3VH8B 3OJDA 1YEFH 3I3BA 5K39A 3WN6A 2DWTA 4WDIA 4LLMA 3P77A 3BH8A 4ALAH 3PNRB 5DMIL 2G2PA 3TN0C 1HESA 4PJBA 3VWKD 1G9HA 5HDBE 2SEBA 2E46A 3MREA 1NQBA 1TT6A 1L9OA 4LSQL 4YXKL 2AF2A 5C6TL 2FX9H 1JZ3A 4PR5A 1NOAA 3IJHA 3WUZA 1NFIA 1UXWB 5DHYB 4OUUA 4X7TA 3VVVA 1E4KA 2WBJD 3DUUA 1TEGA 2WBJC 2VTFA 4RFNB 4QWWD 2V5TA 1TLKA 3BZ4B 1S9YA 5DK2A 4Z8FH 2LU7A 4QWWC 1JVLA 2FZ3B 1NBQA 4I3SL 4JHUA 4U0RB 4XMVA 4HIIA 4OZFG 1T3FA 3CFNA 4AGMA 4NB7A 4DGIH 4I9WE 4LVNC 3QDGE 4AV0A 4XWGL 2IEPA 3QS3A 2XJLA 4D0DB 5IQ9B 3BFOA 3RTQD 5FDYA 4LGPB 4LLDA 3V6ZA 5A43C 3RTQC 2JB5H 1NANH 2G75A 2XI9A 4N2AA 4MNQE 5HYSB 2XCMC 2A9NL 3ARGC 4KTGA 4OT1H 4X9BA 2H2PD 2P49B 1AQDB 3ASOB 3QHFH 1MIEH 4PJBF 2JSFA 2FWSA 4G5ZH 2X7LA 4MD5B 1YMMD 3QWOB 4C56B 5GGUA 2AJVH 3OKKA 1CT8A 1I31A 3GSXB 2QDVA 4UB0L 1UWXK 4X4ZA 1AACA 2HLEB 4GIAA 4HIHB 3WXVL 4BKSC 4C54A 1HIMH 3MLYH 4LSSH 4MJ6B 4JDTH 2ARJQ 4YHKH 5LNEA 5FUZL 1ZPLA 4G7SB 5C09A 1VF5C 1OAZH 4UANA 3MRHA 3CQQA 4M1DL 5EBLA 4JGMA 4OZIB 2YRPA 5AG9A 4NFCA 4HWEL 3ZKXC 3FXIC 5DHVA 3SDYH 2UUDK 1AMYA 3QIBD 3DETD 4N6RB 1C8QA 4OQTL 3O2DL 2LHAA 1QEWA 3DETC 4P99A 2AEPL 4TVPH 5D93C 3EBAA 2FR4B 1M9WA 3NSYA 3OX8A 3DOHA 4BJLA 4G80B 3ROLB 3TNNA 4HKXB 5CS7A 4UAOB 1Q72L 4F8PA 4A2HA 5LAXB 4WEBH 4DKTA 4PJEB 4HV8B 2EILB 2Z64C 2VRAA 1KEGH 2ZG2A 3VGBA 2ZWSA 1DO5A 4YHLH 3AXIA 5T5NF 3D50A 3N40F 1RZKC 2ZCKH 2Z91A 2YOCA 3L2NA 2JVUA 3LNEA 3VYPA 1CGXA 4FYTA 2X41A 1P4IH 4HFWA 3WENA 2ZWZA 5GGVL 2YGQA 3BHBA 2EDBA 4YBQD 3V6OE 3WJMB 2GC4C 5F21B 3T3PF 3VXRE 2BS8A 3I02A 2ZXCA 3VXQA 2DYRB 2H0PA 3MRGA 1WWBX 4WI8A 3WXWH 2OFQA 3MNWA 5L2KA 4LDLB 1UZ8A 4D8OA 1TTRA 3I2CL 3B43A 4GRLB 1C5BH 2APBA 4RMTA 2D7TH 5C0GB 1IGMH 5KBDA 2B9BA 4LCCA 4L8DB 4MA3B 2ATKB 2K7PA 3UZEA 4YSDA 3GSUA 4NN6B 4XOCA 4LE8A 2AI0H 2Q86A 4BBWA 1EO8L 1I3RA 4L05A 5FHBL 1DN0B 3B2VL 1C16B 3OHMB 3FB6B 2CDGB 2QQKH 2VDQL 3UAEA 3AREB 3K2KA 4JM4L 4D8PA 5EF3A 1ES0B 2FQFA 2XKSA 1INQA 2IADB 1YAZA 2K3HA 3A22A 3K8LA 1NMBH 3VXPB 5D7LE 3V5HA 1KIPB 4OAWB 3H4FA 1N5AB 1F4WL 5CSBA 5IT2L 1HCVA 3EBIA 3OKDA 4OIAA 1FG9C 5FO9A 5GS0D 5HDQL 3AWFA 4ZTPL 5I0ZA 4I0KA 5GS0C 3PHOA 4Q8BA 3G5VA 4X4ME 2WLLA 2WGNB 5H35A 1HSBA 3NRPA 3HE7A 4PJ5D 4RFEB 1JZ2A 2CXGA 3WYRA 3S2CA 4H7VA 4OCXL 3DTXB 3QI9A 3V4UH 1KN2H 5KYWB 5AW4B 5DJ0A 4G7VL 4LIQE 5FGCE 5I17B 1IMHC 1J8HB 2K6WA 2N59A 5CEYA 1YNTA 2CRIA 1ZA3B 3QS2A 1RMFL 3FU5A 4AVKA 2XN9E 3MLVL 5DHEA 4JW3A 3KLAB 4KZDL 5IUSA 3GXUB 2BZ7A 4YHYB 2Y69B 1JXKA 1P5VA 4M56A 2YQBA 1DQVA 4CJ0A 5C1MB 2FX8H 2HLAB 5H8DA 3FQNA 4NCC1 4X5RA 4A6YH 4HAKA 4NO5B 4PRBA 2HP4A 5EU6E 3DGDA 4YGVA 2Q3ZA 3RFZC 3RILA 3WHE0 4ZX3A 5C0CA 2WO2B 3DX1A 4BFIA 2YLKA 4RGMC 3BP7B 3ZTJH 4KRNA 5LBSH 3G3LA 1ZLUK 5IZ7A 1LHZA 1BIHA 3NSJA 3STBA 5IMOB 5BUGA 5FOBA 2CKBH 2FVNA 1OGAE 3OF6A 5HDLA 1VERA 3QJFA 3TO4D 3EAKA 1WA2X 3BIAX 3TO4C 3S8WA 3CFBB 4AYID 3ULUC 2ETWA 2R27A 1YEIL 5A2BA 4BZ2H 3MNVA 2X6CA 3Q3GA 2WJ5A 1JI1A 3WHXB 4HJTA 4HZAA 5C08E 5G2NA 4R96A 3PE9A 5L2JA 4HKJB 2WBKA 2MKLC 3JTTA 3N91A 5KUKA 1FO0A 3ESUF 5D2LE 4AYDC 2A9DA 4QHNA 1FFNA 3AXLB 2Y23A 4WI0B 3N0PB 1DBKH 1V7ML 3DNKA 3DMMB 3T0WA 5JW4N 1ND0A 1QRNB 3D34A 4KK9D 1M7IA 3BISA 3QCVL 4MAYC 3FSOA 4MQ7A 2UV3A 4IGBC 1G7PB 5K59E 3HMWH 3GMLB 1QLEB 3QUYD 7CGTA 3QUYC 2ZYSA 3EADA 3WIAA 4JZJB 3PJSA 4PTTA 3IEAA 5IEHB 2BWQA 4NNPH 5E23A 2HCZX 2G9KA 1HEZA 3UO8B 3I9GL 3FBKA 4JFFD 4NIKB 3NEOA 3MRLA 4X42A 4DIXA 1FSKC 2G4EA 4IMKA 3IFOB 5KBMA 3WFZA 4CVZA 3CQPA 2VISB 3KPTA