2O4EA

The solution structure of a protein-protein interaction module from a family 84 glycoside hydrolase of clostridium perfringens
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
165
structure length
165
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMASKLKEAAEVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIEGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords O-GlcNAcase nagJ
publication title Three-dimensional structure of a putative non-cellulosomal cohesin module from a Clostridium perfringens family 84 glycoside hydrolase.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 13
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o4eA01
4U3SA 4UYPA 3UL4A 2VN6A 2XDHA 1G1KA 3FNKA 4UYQA 3L8QA 4WKZB 4DH2A 2CCLA 1OHZA 1ZV9A 5K39A 5G5DA 3BWZA 2BM3A 2Y3NA 1QZNA 4FL4C 2W1NA 2VO8A 2O4EA 2OZNA 4N2OA 4IU3A 2B59A 4IU2A 3KCPB 2ZF9A 1TYJA 2JH2A 5LXVA 4UMSA 5AOZA 4FL4B 2VN5A 1ANUA 3KCPA 3F2LA 4WI0A 3GHPA 1AOHA
chains in the Genus database with same CATH superfamily
2B9AA 2XJKA 2HPOA 3FCGA 4PRPA 1QTYT 3RNQA 5IHZB 4OJCA 5K5YA 1E9QA 2MRYA 4N28A 3WV0A 1U92B 1UKSA 4Z6AT 3NJKA 5J6SA 1KTCA 2N01B 4UT7H 5B7MA 3L6FB 4JDEA 3CFEA 3CZSA 5ANME 3BEWA 4O2CB 4M1CD 3SYQA 4X4ZA 5BRQA 1UASA 1UTDA 3HCVB 4HHAA 4YBHA 1JVOA 4XRCA 1KWGA 2DOCA 1EPFA 4IBUA 2OCJA 1OZTG 4E41A 2XWRA 3NSFA 1Q9OB 3V0WH 3BH4A 3KJ4B 1CMOA 4FXGA 1Z66A 5IFAL 2O1AA 4LCWB 4CVXA 1SBBA 5C0JB 2GAZA 5E6ZA 2ALAA 4JN2A 4QRUB 3ENEA 3ARSA 4MJ5A 1SOSA 2AAVA 1FLRH 5MENB 3S3SA 1R1CA 5LN8A 1FFTB 4ZAKB 1LP9A 3V4PB 3IGAB 2B2XL 4EQ3A 2K1MA 4Y5XB 1G87A 1PDKB 4F7CA 1KTDA 4HJ0C 1I9RL 2NQ3A 3L4ZA 2GK0A 1KJ2L 1YVLA 5D1XB 3DECA 4PJ5B 1NGZB 3GZOA 1XGPB 4DP4X 5EOCJ 4Y4KC 1WAAA 4DCQB 5A6MA 4XAWH 5SWZB 1NKGA 1UWXK 4AMKH 4A55A 4NQDE 1UM6L 5EU6A 1N59A 5LAXA 3VFRB 2YGVA 3WDIA 3KPSE 3UGXA 4YSCA 2EDLA 4TKWA 1NEZB 3RTQB 3WKMH 5IG7A 1P9MC 4UNVA 1PFOA 4N0UB 3B9KA 4JO4H 4XOAA 5EOTA 4PUBH 4ZMOA 4P23A 2K45A 1SXAA 4RA0C 3V4UH 2K8QA 3ISYA 1FC2D 2QTVA 2YQBA 1RSYA 4JZOB 1RMFH 4UDUA 3EJQA 2BNRE 5L2JB 1RZIB 2NY2B 3C75A 1T2QL 4PGEB 3VWKD 4YSOA 5CEZE 1VB9A 1CQKA 4JPIB 3WLBA 4DP8X 2JB5L 5IEHA 4HKJB 3MZTA 3RIFF 3U7WH 5A3IC 5HVWA 3HJ0A 3FN3A 5C09B 5HVHB 3GIZH 1BMWA 2GTZB 5CU5A 4R0LA 4MA8H 4XO4A 2P8LB 3WS6A 3RPIA 4GS7B 4HWZB 4L8CB 2BDNL 1ZT4B 3CAFA 3RWDB 3IF1A 4W68A 2FBJH 3FQ1A 4M6NH 3BUDA 2EUWA 1QLRA 1PZ5B 4HVBA 5T1MA 5E2WL 4KI5F 1NAMH 1UD8A 2AQQA 2WC7A 4YHML 4EI0A 1LWRA 3AC0A 4OD1H 4POZD 2GSIB 2XACC 3HRZA 3T2NH 1FV1B 2GW5A 2Q86B 4F20A 2EIBA 3QDMD 2VXQH 2EH8L 5EO1B 2H1XA 2KLSA 4ABVA 4XODA 2ZJSH 1EGJL 4OLYH 4GG6E 1X3DA 1H9VA 1I7RB 1YEKH 2ZUXA 3E6HB 3N42B 4AGLA 5I0DA 5DD1H 3TBVB 3MLZL 3P3RA 4OZIF 2ZP8A 1I85C 4I2XB 5ENWB 2CBMA 3DXAB 1JWUA 1E4XH 1OALA 2HFFA 2VABA 1BYNA 4NQCB 5CMAB 5EN3A 4BDVB 5K59E 3M6DA 5IIEB 3I9GL 4FQXC 2W0FA 3MTXA 2DQMA 1OP3K 1UB6B 2OJZL 1C7SA 3DYMA 4OCYH 2NW3A 4JFYA 4PR5B 1MHCA 3BVTA 3CTTA 5EO9A 5FW8A 3TBCA 2FLMA 2C7UB 1R24A 2WWKO 3QCVL 2NMSA 3TV3L 3AY2A 2UZXA 2VB5A 4AIEA 4ZUWA 3E6FB 4MNGE 3O2DL 4LOFA 5E1IA 1YEFH 5C0CB 5MENE 2PYED 1CZ8H 4KDTC 1GY2A 3SCMA 3GI8L 3T6XA 3DK2A 3OKLA 1S9YB 4FNUA 4R90L 1I8IB 4L4VA 4ZO7A 3LIZH 4LRIA 3MGTB 1WZLA 5D1XE 4QTIH 4L48A 2J6EH 3BGMB 2J1XA 2YPVL 1EEZB 4YXLH 4EUPG 3IAGC 1CE6B 2VR7A 2YD2A 4L2YA 4NZFA 3UGUA 1K4DB 3LOWA 5IROA 1PJWA 1MCQA 3FTGA 1DTUA 1X5KA 5C6PB 3DVGB 2VGLM 3IETB 2Q3AA 2DBLH 4HXBL 2P5WB 4N0UE 3L3IA 1QSZA 2Q8AH 4X5WB 5FR3A 4L3CB 2P9RA 4OQTL 1PSKH 2VSMB 4IOIA 1XGYH 1GOHA 1Z3RA 1YMMB 4TQEL 3S37X 1AGCB 4HK3J 5C2UB 1O9VA 4NKOB 3RWGB 4ELMF 1NAKH 5FA4B 5FGBC 3ZE0B 1KYOK 1L9OA 5CILL 3DDFA 3P73B 1JTTA 3GM8A 4KXZH 1NFDB 4TSCL 3V8CA 5C09E 5C86A 4H26A 2ROYA 4WUUD 4NQXB 3UAAA 3K74B 1GR7A 1X5LA 3OMAB 4M7ZC 5BUGA 1U8IB 5AOMA 1NAMA 2Y24A 1CLZL 3L4CA 2Q5BA 2X4SB 5E1AA 5E94B 3MODH 4C4BA 1JP5A 3FKUS 4BCYA 1J1OL 1JGEA 5AQ0A 1M4KA 3RIAK 4N22A 5ALBH 1ORSB 5DR5H 4A39A 1UXSB 5ESVB 1Y7VA 2VXQA 5D7SL 3VJ6A 3GI9H 4AXWA 4NSKA 1FAIL 4HS3A 2CIKB 3S4SA 1XF1A 1KPRA 2BJML 2AXHA 3OR6B 5BPPA 1GTFA 4TQPA 2X6VA 4WO4B 5EBGA 4BH7B 4PJGF 5L4MA 5E8DH 5JW4M 1TLKA 5I0VA 4F7EB 3Q2WA 4JO1H 1K4CB 1Q72L 1TO5A 2JCCB 5G4MA 5SWSD 4WI3A 4IJ3C 2QMKA 4NKMA 5JLZB 2CGRH 3NCYS 1ZLWH 5I1IL 4GKLA 4M3JA 4HHWA 5FYJD 1QBMH 3FBQA 4NKIH 5HHOD 4CSTA 4KXBA 4XX1E 1RIUL 3IXTA 1P69B 3PCYA 5E99H 1CT8B 1LO4L 2MNWA 4UYPA 5FM5O 1MW2A 5EN2B 4W93A 1F18A 3GMLA 1RUMH 1SXNA 2P8MB 2E7MA 3MLXH 1LM8V 5GGQH 4QJ4B 3TVMA 2OBGA 2YPKB 4DK6A 3ABZA 3NP3A 2Y1YA 1I7TB 1C1EH 5DEZA 1V7NL 2YJLA 3HG4A 3WEAA 4OZGF 5BW7A 1QZ1A 4X8XA 3UCRA 4AKOA 2APTA 1MIEL 4HEPA 5FA3B 1OWRM 3LIZA 3WHE0 3VFGH 4JFPA 4YHIA 1T89C 1TZ8A 4FTVB 1CF8L 2VLJB 4HJSA 4TUOB 2I07B 5AAMC 1JS4A 5E6IA 3LVTA 2QZ5A 2X6CA 3CBRA 3GSRB 3K6DA 3MA9L 2Z7WA 1ZHKA 2FX8H 4P5TB 2NTSP 3L3OA 1XTMA 1GGCL 2Z93A 1EO8L 2YXFA 4MWFB 4HOMA 1VRSA 2ZUWA 3KPQB 4XPAL 4XBPB 3I2CH 4PS8A 1OIOA 3HC0B 1THAA 2G2RA 4K5MA 4XPBH 1P5UB 1F3RB 1J5DA 3F00A 4X6DF 5E24E 1J9QA 1X4YA 2N7AA 1WQVT 4AM0Q 1F41A 4LXFA 4FE9A 4M48H 5HDBF 3CSPA 2GEQA 3BD4A 2VXSL 3D85B 3WN5B 1WJ3A 3X13B 3QJRB 1THCA 2CKBB 3B2PA 3FT0A 1UACL 4ZOBA 3TIEA 4R7LA 5AOIA 4HXAL 2VKXA 5C0GB 4YO0B 3HS9A 1I1AB 4ZODA 1IEAB 4Z0BL 1ICTA 4FLOA 1GC1L 1KCRL 1OCZB 2GSGA 3BN3B 1HSBA 5FM8A 4KRPD 2IADB 4OM1L 3ZTJH 3FOLA 1B0GA 5F21B 3RX8A 4PJCE 2CO2A 1YEGL 4Y1AA 3V0EA 1H5BC 1TVDA 2CMRH 2Q7AA 3NIFB 2ADYA 1TCMA 3MRKA 1F1GA 4K7PL 4NEHB 4JKPL 4PGBA 4H1LB 2ARJQ 5FHBH 1FE8L 2YEVB 3A47A 3WY4A 3FTVA 1YO4A 3A3YB 3PREA 2QGCA 3RWCB 4F58H 4J3TA 3PNWB 2OR9L 5KS9E 3SDXA 3RIFK 4OLXH 4UQAA 3UZQA 4C56E 3WNMA 3VGFA 1K9TA 1CL7I 2JCCE 3ELAT 3HZMA 5EOCL 1PBYA 3JV6A 3NFPA 5B3JF 4RFOH 1NCGA 1FH5H 2EC8A 4PSRA 3EBAA 4HALA 2PCFB 3APCA 4UIMA 4PSPA 3SDAC 3SGEI 5H4ZA 1FFOB 4GYBA 4FA8A 1CC3A 5E95B 1KLUB 2VDNH 2VDOH 4WTWA 2H6PB 1OTUC 4PRIB 3L95A 5T3ZL 1LO2L 2YPLD 4GRMB 4D3CL 1AACA 1W72L 2YC1B 5DQDL 1J5OL 2Y9RT 3FQUA 3HPJB 5HYIA 3QQ9C 2CE6A 5DMIH 3CK0H 3VXMD 3CZKA 4FLQA 3SKMB 1I8AA 2DS4A 3LVEA 5IP4A 1DN0A 2HRHA 4R3SA 1A25A 1CFNB 4NX0A 3Q13A 1OV8A 3S9DB 3EYSH 3EDEA 4FQQB 2H26B 2VLJE 4FTVE 4O2EB 1U21A 4FQLL 3E8UL 4OD2B 4N2LA 4XCCL 4DVRH 1N2RB 5DD3H 4AKQA 3MUJA 4YHKL 3HFFA 1RK0A 2V7NA 4P07A 1H0DB 1CD1A 2X1WL 5CN3A 2V5MA 3BIAX 2F15A 1KOAA 3LNIA 3O4OB 1IAKA 3E3QE 1UZ8A 1PTZA 3DROA 3QNXB 1LE9B 4LBAA 2N56A 1ND0B 1KTKE 5TQ2H 4U6YA 1O7SA 4GSQA 4LO9A 1FVDA 4O4YH 4LPCA 5DU7A 1WZ1L 2X4TA 3PWNB 1N68A 4L1TA 3MJWA 1HIML 3MNDA 4FERA 1SYVB 4ODXB 1WFUA 3G6JA 5SV4A 1JZ7A 2BY0A 2JKLA 4KKNA 4E9XA 5CD5C 3HG1A 4JQVA 1B0RA 4S1SH 4AJ0A 2ZX9A 1JERA 4JG0H 1T3FB 1NPJA 1T04B 4HBCL 2APWA 5KVEH 1MJ7H 1JJUA 4PJ9B 1AZZC 2AJZB 5EZJB 4QGYA 5B3NA 1ES0A 4OFVA 4H8WL 4Y19A 3QDJD 2GIYA 3OXRA 4L3EA 5FPIA 4LLMB 1TZIA 3SDYL 1AHWA 1UZ6E 3VXPA 2ENJA 1F5WA 3T77A 2X2YA 3DRQB 4AQ1A 5D6DC 2JJVA 2XPYA 2X2JA 2QV2A 3ARDB 4WFFD 4CW1A 1B3JA 1ZK9A 1NDMB 5CSBA 4R9HA 3LNFA 3UYPB 5DVOA 1NCHA 1P4IH 3AS0A 3REVB 2W9DH 3IGLA 1BZ7A 2AC0A 5DEGA 3MUZ1 1U3ZA 3TBWA 3BVWA 4L0YA 5B21A 1FBIL 1IGFH 4ICWA 1RZJC 1JPTL 1YG9A 1X7SA 3L3HA 3WNNA 4HUUA 3WE6A 1E5YA 1NCWH 2FX7H 5CJBA 5LXGH 4U1GC 4UF7C 3FHAA 1MAMH 2B16A 5I26A 4QOKE 1TFHA 1P84K 2N1KA 1W0WA 3K7UA 4FQIL 5I16B 2EZ0C 5EEYA 1MLCA 2PUQT 3BKML 3EBGA 4JGJA 1Z9SA 1F90L 1L9MA 3VCLA 4Y2NA 2XTJE 4IRSA 4YDIL 5FF6B 1Q0XH 2FJGB 3DNKA 4OUUB 2ZP0T 4F37F 1S7XA 4HS8L 3OKMB 4K23H 1D5MA 3ILQC 4A6YL 3VMOA 1U8LB 5GGVL 1RJYA 2AJXL 2K6ZA 1N5YH 5IQMA 1PGRB 1MCKA 2DIEA 1J10A 1SLUA 2G4GA 2VM3A 3QP3A 4YSEA 4X50A 2R9HC 2IPTH 3TZVD 2DYPA 4AGMA 5F7NC 3RBGA 1OTUD 2NY7L 2VN6A 2HH0H 2NY0B 1MCLA 1F3DJ 4LSVL 2Y7OA 3LZOA 4N0CD 2IEPA 5JTWA 2ZOKA 4J28A 2WWMD 4IRJC 5DFAA 2XWZA 4XCFL 3MKKA 4BKTC 4WWKB 4EXKA 1XSKA 1J0IA 4P4KC 5IHZA 1V7ML 4BUGA 5MEOB 5F96L 5AKTA 1ZA6B 2CGYA 4FMKA 1U92A 3US9A 3HI6L 1KN4L 1MAJA 2NXYD 1IM9D 3L6FA 1CJYA 2EE2A 1OAXL 1V8HA 2M1KA 3T04D 2OSWA 2UXGA 3OAUH 5CLXA 2XWXA 4O2CA 1YEEH 2L7EA 2VRQA 3DHJA 4CC4A 5J7CC 4FHKA 3D69A 1WTGT 2FBOJ 3HCVA 4G6AD 1KBBA 1IC4H 2AXJA 1TETH 2UYLB 1Q9OA 2MCMA 4JY5H 3LEYH 2YGQA 5EEZA 5JR1L 2NYKA 4LCWA 3BP5B 4J2QA 4QRAA 4HZAA 4XZ4A 5K33A 1IC7L 2C9XA 5C0JA 2IFGA 3MACH 3D34A 4QRUA 1CLYL 5FYKH 4B9JA 5GGSY 3QIUC 5MENA 1L9QA 1W8OA 3KPRB 1WA1X 4FG0A 5E4OA 4FN0A 5LXVA 4ZAKA 3IKCB 4DVBB 4N0RA 3V4PA 3IGAA 4UIKH 5AKRA 4GT0A 1CLCA 4Y5XA 5F7MC 4D7PA 4OZIB 2IAAC 2ARWA 2WN3A 2FIRT 1MRFH 5D1XA 4HG4K 4PJ5A 1EVTC 1NGZA 2LTQB 1XGPA 2QSCH 4XI5D 1BCIA 4ODBD 5SWZA 2Z31A 4K3DL 4RH4A 2GBAA 4XMKL 4N68A 1WAPA 2WCSA 4AENB 3M7FB 5D4HA 1NEZA 3RTQA 5FUZL 1WSST 3D3VD 4N0UA 4LASH 1DEEB 2D8KA 3OTTA 4A7SA 2ETWA 3KZ8A 3N1GC 2Z7YA 3L9RA 4JZOA 5AAWA 3I02B 5L2JA 1BXVA 1B4LA 1YDPB 2CK2A 4EI6B 1DBML 3IAQA 1HEHC 3EOYG 4PGEA 3BQUC 1GPOL 1NUFA 4RZKA 3QUXD 1GOFA 4JPIA 1QQDB 5KBMA 4DW2L 2YQGA 1EFXB 4HKJA 3BP4A 1UCBH 3MLWH 1CLVA 4XMVA 2ENSA 2GTZA 4U2ZA 1ZD6A 1VZGA 1AZBA 5I6XC 2P8LA 5FGRA 1X6NA 4MKMA 4L8CA 4HWZA 1ETA1 1ZT4A 5CUSL 3RWDA 3B3IB 5CLZA 5CWSB 4AK1A 3RKPA 1F58L 1IEBB 1PZ5A 1WC7B 4OIFA 3F7VB 1MG3C 2XWCA 4ZSOB 1RULL 4FL4B 3UJTL 3TTYA 5FHAH 2RHEA 1AMYA 3HC4H 2AABL 4PRHD 2DLEA 3W3BA 1O9ZA 2GSIA 4PJ6A 4NRZA 1FV1A 4UWQB 3LS5L 2Q86A 4K9EC 4IGBB 4UYQA 5EO1A 1RUQH 1HWWA 4ELMB 2EZ0D 1IM3D 3K2MC 3EUUA 5F0PB 1I53A 2P44B 4W9JC 3ARFC 3CDZB 5BOPA 2Z34A 4BZ1L 1I7RA 3E6HA 5IMKA 5DC0A 2VC2B 4NQEB 3TBVA 3S4SG 3A22A 4I2XA 4MAUH 5ENWA 1CU4H 2EDHA 1UWXH 3FONB 3HN8A 3KPTA 3DXAA 4ANKA 2Y6TE 4A63A 3JZ7A 3GPEA 4I3SH 3ZW3A 3U30C 4NQCA 5CMAA 1J12A 4BDVA 5IIEA 1JZ3A 3W9EB 2NY3D 1TMCB 3NFSL 3N1PC 5T5FH 1UB6A 4ECNA 2EEBA 5EZOH 2HUHA 4PR5A 4LHUB 2C9RA 2DTMH 2C7UA 2WN2A 3HB3C 3HNSH 5B8CC 3EYOA 3MRBB 3QXVA 1A9EA 3P3SA 1OSZB 4R4FH 4JO2L 3E6FA 3MPCA 3QUZD 1T80A 4PJGB 2V2XB 4OKVB 2WLHA 3TN0B 4Z3JA 5C0CA 4NM8H 3QHZL 3H3PH 1MFUA 2K3TA 1R0AL 2AQ1A 2NXZC 1KYDA 4A7TA 1CR9H 1JYWA 1S9YA 4MJ2A 2BVYA 3HUJE 1I8IA 4TVPE 4HU8A 4AV0A 4YNYB 2XNAB 3W1ZA 5FUOL 3MGTA 1MUJB 4NJ9L 2X0VA 4DNLA 2Z9TA 3HOGA 3BGMA 1H19A 1I9IL 3QT2A 4HEPG 3TL5A 1CE6A 1MHPL 1IAOB 1K4DA 1SXSA 1U2HA 4GUCA 2XHNA 1JCKA 5GSVA 3WIIH 5IHUL 1QWUA 2ZXWB 4R83A 4F8QA 4DUWA 1IGIH 1IILE 3DVGA 1IIKA 3IETA 4ZMNA 2P5WA 4GI8A 4YHOH 5JQHC 4AL8H 1I7UB 4X5WA 4L3CA 1BFSA 4CU8A 1W91A 1OCOB 2BXYA 4OZGB 2OSXA 5CXPA 3QUGA 1YMMA 4PQXA 3OJ2C 1AGCA 1OGAB 3FQ2A 5CO1A 4NKOA 3RWGA 3CFDB 2DQEH 1NL0H 2CKBH 3P73A 3IS1X 4R4ND 3BWUC 1NFDA 4H8PA 1NEPA 5I1DB 5DVPA 4F2ME 4YC2B 3BDYL 4A04A 1P7HL 1F86A 5EULV 4RETB 2VLRD 1NTDA 4JFQB 4HCIA 4MAYB 5FYLL 5J3HD 5CZXC 2VXUH 5EBWB 3SKUD 1OVZA 1U8IA 1PNDA 3AUWB 2G60L 1OP3H 3EZ8A 4XB3A 5E94A 2X4SA 1QBAA 2IFFL 4FMFA 3UBXI 2VDRL 3NCBB 3BZ4B 4LCUB 2ZCLH 4JPWL 5FWRA 4XNUL 1ORSA 4X6DB 3EO1B 1UXSA 2FO4B 5ESVA 2LR4A 3RLSA 1CURA 1OTSC 4PRBB 5HDBB 2VN7A 4CA4A 3QHFL 2CIKA 3BQUD 1M2OA 4Y8DC 5K9KB 1T6BX 4A38A 3OR6A 4EN3C 3ABMB 4WO4A 5C8JB 4BH7A 4FFTA 1EAJA 2WBWB 1QTSA 2L3BA 4O5LL 4F7EA 4Y16B 4IOSA 1K4CA 2JCCA 3V5HB 3AVEA 5I23A 1E8YA 4ELDA 3ULVD 4UQIM 2ZXCA 2ZZUT 4J3OH 4F37K 4OF0A 3V6OA 4M8QB 5JLZA 5KTEL 1D9KB 5G55A 2VRKA 5HJ3B 1X5IA 3I50H 5T5FA 3GMNB 2V9QA 2KLTA 3O6LH 1EJ8A 4A68A 2ED7A 1CT8A 2QQKH 4ZNEA 2JWYA 5D7KE 4GAJL 5D7IF 5HGAB 4G11A 5EN2A 2AJUH 1ZSDB 1KB5L 4DEPB 1OSPH 5IQ9B 2P8MA 3N43F 4L2LA 4JFDD 1UM4L 3S36H 2YPKA 4JM2D 1I7TA 3UBGA 2PXYB 5DJ6B 4RMBA 4FG2A 3SPIA 9PCYA 3BFOA 3RU8H 3LQMA 5INCA 5FA3A 2BY2A 2CO6B 2ZOWA 2WXRA 4FTVA 2VLJA 3JZYA 4TUOA 4Y5VC 3RY5A 3AGVA 5E2TL 4BFNA 1KG0B 5CLYA 1QATA 4JW3A 3GSRA 2E0PA 3KCWA 4LLAA 1ZS8B 4P5TA 5CCKL 3K71B 1QWHA 3HE7C 2CHXA 3L8QA 2IWEA 2FWUA 1DBJL 4GSXA 4MWFA 3SGKA 3KPQA 3P9WB 4YJZL 2OK0H 4XBPA 3KDMB 3WUWB 2H7WA 4M4RB 3L1FA 43CAB 3AXLB 1P5UA 3RZCC 2HT3D 5F1KC 4XNXL 1EQWA 2J73A 3FK3A 1A1OB 1EDYA 3QZLA 1GGUA 3WN5A 3D85A 3X13A 1IFGA 2CKBA 4QXWA 4C83B 4FNLH 2VW7A 1RZFH 3F84A 4YO0A 5C0GA 1KZQA 2X4NB 2W0PA 5CEYB 1IEAA 2R4SH 1QWNA 4TULH 4JKWA 4GG8B 5JPMC 2O5ZH 5I1GL 1TDQA 4JREB 5LCVL 4X99B 2IADA 3L16A 1SY6L 2V3FA 4P5RA 4ES8A 2OYPA 2VW6A 2YBGA 3ZU8A 2EYRA 3STLB 5E9DB 1KULA 4UQEA 3VYPA 1FORL 3ZTJG 5KW9L 1MREL 1CGTA 1MF2L 1WGVA 1QX1A 3K0WA 4H1LA 2X40A 4X6DE 5B1BB 2VLKD 5AW7B 2DI8A 5HDBE 3RWCA 2LW3A 5EDSA 2IOOA 2CPCA 3B56A 3F7LA 3PNWA 2JMRA 4G8GD 4BGLA 1NGWB 4TNWF 4X5RA 3FFCD 4ZX5A 4FQJH 4YDJB 4KVCL 5DYOB 4ZW8A 4U1HB 4WV1B 3HMWH 3O8XC 3MNWB 2VR5A 5AB2A 3QXUA 4L8BB 2V0AA 4LF3A 1HHKB 3BT2L 3MLVH 5CZXD 3FU5A 1ACCA 1LMKA 2PCFA 5I73C 4HGKC 5JIHA 4WO0A 1FFOA 5HYSB 5G2NA 3CXDH 4JFFB 3AMLA 4G7YL 4RAVB 1KLUA 5BOZG 3QCUL 3QJFB 2H6PA 3FQRB 4PRIA 3OZKA 5BNXD 2F2HA 4GRMA 2OMBA 4LLQB 4PAZA 1TZHB 3W39B 3Q5OA 1DEDA 1H6UA 1NIDA 3IFPB 3HPJA 1Z7JA 3LQAL 2ITDB 1IJ9A 1OZUA 1G9MC 5I5MA 3H3KA 3SKMA 2QVFB 2MCAA 1UM6H 4U0QB 3CFKB 4HW6A 1QACA 3MU3A 1U2CA 1CFNA 4IBVA 4UAOB 2BSSB 3ZDWA 1BEXA 4PB0L 5B3JE 3VDBA 2YAEA 1MI5A 2H26A 4O2EA 1AGFB 1BBDH 5T3ZE 1WDAA 4OD2A 4BK8A 5F3HB 2ZUYA 1N2RA 3IFLH 4NENB 3AMKA 3EDFA 1I9JL 2ZCHH 1WS8A 1H0DA 3OC8A 1OLZA 4TUKL 3KVPA 4PTTB 1H3GA 4Y0GA 2MOVA 5FFLA 5GRXG 1OPGL 5DVNA 2F5AL 4PVNA 2ZKWA 2OZ4H 3MLUL 2XRAH 3QNXA 1LE9A 1B2WL 2A74B 4ELKB 5KJ7E 1BFVL 1ND0A 4ZOCA 3IBOA 5E08L 3G5VB 1E3ZA 3PWNA 1DQVA 2IXQB 1BECA 4A7UA 1F6AB 1SYVA 1KBGL 3CQQA 2CUHA 3B2MA 4ODXA 2EO9A 4IMKA 3DOIA 3QZWB 4V1DB 4X5PA 3BGAA 1HH6B 1T04A 1T3FA 3HE7D 4FXGC 5I8KL 4TL4A 5T1DH 2X9XA 4ZFFB 1VADB 1T5WB 1FGNH 2AJZA 5EZJA 1AS7A 1QI5A 5E9DE 3FSAA 4RX4D 3ULUE 1QSFD 1FNSL 1OK8A 2IJ0C 2V7HB 3ASNB 3C5ZB 3P4OB 4JRXE 3DURA 4LLMA 4J4PD 2XBZA 2FEDC 1AOHA 5DO2C 3N85H 3Q8CA 5I6PA 4LPTA 4P9HH 3ARDA 3LD8B 3NJMA 4GSDH 4UILL 3W11C 1ZT1B 2CO3A 3IDYC 4YSDA 5DA0B 4XVUC 3UYPA 5CLTA 4N24A 2F53E 2L7JA 3REWB 2MH4A 3O6MH 5G4OA 4KHXH 2CJ3A 3VVVA 3REVA 4W9LC 3T6WA 4ZW7A 3B1UA 3JVFC 3FB7B 2ATKB 4B7LA 4M7LL 2WLJA 1T22B 1MOEA 2ADFL 2QMJA 3MV11 4KJQD 4BJLA 3WAJA 4BQCA 3QCVH 2BHUA 4V33A 3B9KC 3D39A 5ISZB 4OLZH 4P23C 5JPNB 1QR1A 1L7TH 2BNQB 3LNHA 4JFFE 1HESA 2PCYA 4OY9A 3SE4A 4M61B 2F7OA 1WFOA 5GZOA 2LLNA 1E4JA 3GI8H 3NZ8A 1X5MA 5DD0L 2JVUA 4ODTL 1Y6KR 3S88H 5I16A 1NEZG 2VLME 4FC3E 2WQUA 2W9EL 4H25B 5K9QG 1HYSC 4R0LC 4LEOB 3WS6C 4JR9H 4JM4L 4JG9A 3HMXL 5FF6A 2XFXB 2NNRA 2FJGA 4PP2B 4OUUA 3BLBA 3O8XD 3OKMA 1G9NL 4Z7OF 1JGDB 4ANWA 3BPLB 4HXBH 1SJEB 1W6LA 1WFNA 1EEYB 3ZKNC 4DHLA 3UXFA 4DQAA 3VXOB 3AT9A 3HRZC 4O2FB 3TFBA 4YEEA 1RFDH 2OXHB 5HGDB 1Z5HA 4F91B 2OYLA 3F58L 2OZ4A 1IFHL 3QPXH 5GZND 5KSVA 4WWKA 1OAUL 3L2MA 5I9QC 5MEOA 3QEGL 1IBZA 2OPCA 1JE6A 1ZA6A 4EIUA 4X5XB 2FX9H 5E4EB 1KGWA 3NVQA 1N6UA 1S5IH 5D7LB 3TFKD 4BWWA 2LVCA 3O11B 1DL7L 4OKDA 3DHPA 2VC2H 4YHPB 4ZNCD 3B9DA 2ZCKH 4UOW1 2AK4D 1YSOA 2UYLA 4JS7A 1EGJA 5BMFL 2YO3A 1TU2B 3BP5A 2MFNA 2JE8A 4OLUL 1A65A 3R19A 3KPNB 3AUVA 3TPKA 2DL9A 4P5SA 5IOPA 2H32H 2YZ1A 5IJBC 2ZP9A 3R4RA 1JWMB 3KPRA 3SCMC 1KFAH 4TUUA 4Q7DA 3IKCA 4DVBA 1RI8A 2AJYL 4Y7MA 3PWUB 5IM7B 3N9GH 3FAXA 4OZIA 4LRIC 3P3TA 2X1OA 5CF3A 5C0NC 3W5MA 3K80A 1BJ1J 2Z8RA 2DJ4A 3GMMB 4R2GC 5F7BA 1WA0X 2AS5M 5TQ0L 2BS71 1F97A 1JF1B 1UWYA 1YY8B 4Q97A 1F13A 1N64H 4E9LA 5T1JA 1CD8A 5I18H 3PHAA 3WNLA 4AENA 1P2CB 3GJEB 5ISZE 1TNNA 1F4XL 3RQ3A 4PBDA 4ZOAA 3U79A 1DEEA 2X2UA 4AGPA 1EERB 4OFYD 2FEDD 3BGFC 4WSKA 3I02A 3U2JA 1EHLH 3T71A 1YDPA 3VQLA 3RJQB 4EI6A 1DJGA 4JN1L 2VAAB 1BOYA 3NIGF 1FVEB 1QQDA 4YHZH 3WD5H 3M1BA 4XVUD 1GGBL 1CYXA 1EFXA 2OX5B 2UZYB 3VX1A 4F57L 4TNWK 2UXFA 4AEEA 2MEJB 2YWYA 1GGCH 1HAWA 2NY4C 5DHEA 1TYJA 5EU6D 2PWGA 3NJVA 5GRUH 1D7CA 1J05B 1BW8A 5B38B 2OAAA 2WPGA 3CVIH 2WUBL 3B3IA 3WIFB 3DSNB 5CWSA 1A66A 3HHMA 4CMMA 4B9FA 4N90E 4DO6A 1IEBA 1LLAA 1WC7A 3F7VA 3JWOL 4RLDA 4ZSOA 1HWHB 1DZBA 3IDJB 3PFQA 1TPXC 2VXSH 1JXDA 1GYUA 2X0WA 2VQUA 4BRJA 3BZEB 2QHRL 4HXAH 1GIGH 2JTYA 3A5VA 1U93B 3ABGA 4IGBA 3S35X 5ALCL 1J8HE 4ELMA 1GC1H 2HKHL 3ARXA 1HYSD 1NANI 3FC8A 1DVTA 1SOKA 1X5XA 2J72A 4IHBA 5HYJB 3VB8A 1IT9L 4LSDA 4P2QE 3CDZA 2GB2A 5CZVL 2BY3A 4E9YA 5D7LE 4NQEA 2DH3A 2FD6H 4IBYA 3BP4B 4JPQA 1BWMA 3FONA 2IBGA 1O6TA 4X6CF 2ZOUA 4GLRH 4JKPH 3QGVA 4WEEA 2BINA 1JK8B 1PG7L 4WENB 4BFJA 3BWZA 1MZYA 1IBGL 2KKQA 4JKNA 5BRZD 4DPCX 3VFVB 4LHUA 2OR9H 3OZLA 1MCWM 5AB1A 2YQ2A 3CHSA 1EFQA 2H32A 4B5EA 3ZRSA 3MRBA 5F0MB 5BW7C 4FJ6A 3L7FB 1OSZA 5KYYB 3BUPA 4PJGA 2V2XA 4NGHH 4OKVA 3RB7A 3TN0A 1ODUA 4QRPE 4WTXA 2J2ZB 2IVFC 4MS8C 5I8EB 3T1FB 1DN2A 2HTLC 3AU0A 3HNVL 4AC2A 3C8DA 5E6IC 1MFEL 3KG5A 5GQBA 5ADPH 1HC1A 2LE9A 4YNYA 2XNAA 2MPAL 4PJHF 1KB5B 4UZSA 1MUJA 4IRZH 1ZWIB 3JSSA 3KL3A 2B1AH 3QWOB 4KY1H 4KNTA 5TF1H 1HNGA 1T0MB 3IRCA 4PJIF 2IDQA 1IAOA 5D7IB 5DQDH 5EUKB 4R97C 4XO3A 1F1DA 3LZFL 2P42B 5F0LB 1EDQA 3N43B 4DP0X 3NYKA 1J1XH 35C8L 3FFOA 1F2XK 1I7UA 4YVNA 4MD0B 2N4IA 5EBLB 2XN9E 2XXFA 4OZGA 2IC2A 3L1OH 3OLGA 2XICA 1OGAA 4OTXL 1LQBC 1OAYL 4XCCH 2OMWB 4XC1L 3CFDA 3EOTL 5I28A 2IGTA 5J89A 1CGSH 2EVHA 4HCRL 4I9XA 4FFWD 3QO1A 4U3HA 5I1DA 2HSIA 2ADGB 2NNAB 1PEZA 2A9AA 4DIXA 5IROD 4I0PC 4JFQA 4MAYA 5HP5A 5EBWA 3QUHA 5JOPD 3EFFB 2A4CA 2HTKC 4DT2A 2WXKA 3VFTB 3BZ4A 4LCUA 2BS8A 4NZRL 3ZE1F 4X6DA 2FO4A 4KK6C 4HSAC 4QRSB 1P7BA 1U8QB 2EDQA 4PRBA 3ZBMA 2YKLH 4M5TA 1I8LA 3S3JA 2I60H 3S36X 3U9WA 5DZPA 4EIZC 2Y7QB 5FYLE 5JDSB 1X5AA 5C8JA 2HCZX 3C60D 5HYJE 3DX1A 3PRZA 3PUUA 4TV3A 4GXVL 3LHPL 4GIOA 4Y16A 1FYTB 3V5HA 1IAIM 3ML9A 4UM9B 5C07B 2VW4A 4M8QA 1JV2B 3BRDA 1ZPUA 5K39B 1A7PH 5DK0B 1D9KA 3B2UC 3QEHA 2XVKA 5HJ3A 4X8GA 2EXWC 3GKWH 5E9NA 4TVSa 3GMNA 2MQ3A 4J3OG 1T66D 3QWRA 1PF3A 1XCWA 3BAIA 5HGAA 5KYUB 3THML 1GYAA 1UH4A 1ZSDA 3HNTL 4XP9H 3FTYA 1T4WA 2V9RA 4RGND 5IQ9A 3D4ZA 1I3VA 2A3TA 2EC9T 3ECQA 1AR1B 3ZVVA 4DTGL 4AUUA 2PXYA 5TE4H 5DJ6A 4IDJL 2WXNA 3VXSA 5T3XL 1CK0H 1K6QH 3NQIA 1IAII 3MFFB 2CO6A 1JPTH 5E8PB 4IRZA 3CFBB 3QZPA 4HPYH 4WKZB 3BVVA 2FUTA 4PMFA 1QEWB 3LV3B 1ZS8A 4WTZA 2OA9A 4Y9CA 4BCZA 1XHHA 4JFSA 4MXQC 3VXUA 5CJOL 2VXTH 3TVMD 1MFAL 3KDMA 3WUWA 4KITB 3QQNA 5FIEA 4M4RA 4NBXB 1HNFA 43CAA 3ZYOA 2X3CA 4ODUB 4OBRA 4YDIH 3V6ZB 3SQOL 3LDBB 2EAEA 2OI9C 5F1NB 1A1OA 5HDQL 2OL3L 4PJDF 2DB8A 1GKOA 3OWRA 4M7JH 3U36B 3NRQA 3TEZA 4QKTA 5HTSA 2AJXH 5F1SA 5E6ID 4QHNB 1KGCE 4DGWC 4G7RB 2X4NA 1QZNA 4JQVC 3HBQA 4F8LA 4GG8A 2WVTA 5HYQA 3NT0A 2B5IB 1XGZA 1R46A 3MLPA 2NY7H 3NSDA 4X99A 5DI8B 3KYMB 5ITBL 2ZXEB 1EHKB 1MFCL 3DOSB 3EADA 3STLA 5E9DA 5M7QA 2ZG3A 1Q0YL 1A14L 1OANA 1AHWC 1MQKL 3I74A 4AQ1C 2X4UB 3O3AB 3WNPA 3HFML 4FAAB 1UD3A 1FA4A 4HWBL 1DCEA 5F7AA 1FFRA 4FKEA 1S8DA 4P9MH 1NLBH 1SVZA 2WZ6A 3PHQB 4P99A 1NGWA 4M6MH 5I71C 1KBKA 4QJ3B 1DP0A 3NEOA 4U2YA 3EYVB 2AJVL 3GHEH 1A7OL 3OJDB 4U1HA 4WV1A 4Y1AD 3ZRFC 7PCYA 3MNWA 1PX3A 3CZFB 3L3DB 3CVHH 4L8BA 5C07E 1U3YA 4YDKH 1HHKA 1IC7H 3QPKA 1P4UA 5F9OL 1IGML 3BC9A 3IDIB 2YUZA 1WG3A 5HYSA 1DQLL 2HP4A 5IMLB 2A0LC 4JFFA 3I3BA 3QI9B 4RAVA 5ECJE 3QJFA 3H56A 3FQRA 1NCCL 2YD4A 1QYGL 5C0EB 4G9DA 4LLQA 4KJWD 1OWWA 4J7RA 1OT1A 1HOCB 2XBTA 4PJAF 3IFPA 2WXPA 5LNDA 3ETTA 4IRSC 1WHOA 5AW3B 2ITDA 4PLJC 2ZICA 3O6KL 1RZPA 4WF7A 3LY6A 3CFKA 4H0HB 4AJWA 3EG9B 5FFOA 4NHCH 4AMXA 4M9OA 1OHQA 2BSSA 5B7EA 3MOBH 4P5MB 4K5OA 3BZDA 4KPHH 1F8TH 3ZZ1A 1L6ZA 4ZMPA 3B2UD 5F3HA 2MQCA 3V79C 1NM4A 2X42A 1XTLA 4NENA 3R06B 5DWUH 1JGIA 4APQA 4PTTA 3FZUD 1H6TA 3CFMA 1FLTX 3BIKB 4RSVA 3SKOB 4O58L 1M05B 4YFLI 5MHSE 1F00I 3O3EB 1HNYA 5DUPL 1SM3L 1U8JB 2A74A 4ELKA 3H55A 1SDYA 3ALWA 4XMPH 2V8LA 4ZI8A 1HQ4B 4EE2A 2IXQA 4POUB 4CC4C 4CAGA 3X14B 1HHJB 3U0PB 4Z7OB 5A2KH 1F6AA 1RULH 3UJTH 2WWOA 3SKJH 1JZHA 3BSHA 4V1DA 1ILSA 2AABH 5T1KD 1ZCRA 3FB8B 1MDAA 5HJGA 1HH6A 3MV7B 2VN4A 3SYPA 1WIPA 4QXUH 4ZFFA 5AUMB 3HPLB 1GS6X 1T5WA 4YSTA 4Z8FL 1S9XB 3P30H 3NJJA 1JPSH 3OSKA 3WBDA 5GS0H 2V7HA 3C5ZA 3P4OA 5F9DC 3TCLB 4ZAKC 1SMOA 1UFUA 4ONGH 1XH3B 3L9YA 2F74B 2GYSA 5GRJL 1M1XB 3A24A 4Y5XC 5GS1C 4IDLA 1YEIL 4JY6B 2V17L 1A7QL 2ITCB 3R4DA 4RWYL 5A2BA 5D1XC 2P4AB 1NOFA 4KK5D 2O4EA 3HG1D 3REWA 3FB5B 4P2RB 1QRNB 2Z31C 4ZJ9A 1QSEB 2GJ6B 3TA3B 4GSRA 4MA1C 4WU7B 3WTWA 1U3HA 1E5ZA 4HZLB 4NRXB 2XN2A 3VM5A 3FB7A 2ATKA 3MOAL 1TJGL 3QXWA 3ZL4L 1T22A 3DMMB 4J3XA 3RTQC 1K2DB 2GEEA 3UBXB 1VEOA 3ARGB 1ET5A 2PMZA 3KDPB 1B4TA 1OE3A 2CXGA 3MCG1 2YZ8A 3MJ6A 4L3ED 4NNPL 5ISZA 5JPNA 15C8H 1QLEL 2BNQA 3QHZH 3IDXL 3TXAA 5FDWB 2KZBA 2NY2C 3NDYE 4M61A 4M93B 5HVFB 3P9LB 3VFOB 1MN4A 5F71A 1LDSA 4LARL 4EDWH 1L3WA 2EH7H 4NP4L 1H3PL 3BKYL 3W38A 3ZQXA 5F7FA 5HVHC 2X6BA 4H25A 1VGEH 2WNWA 3L5WB 1ID2A 5D70L 4LEOA 3ES6B 3FS9A 1I9IH 3W2DH 4NQDD 4GS7C 2FAUA 4YE0A 3V7AE 2XFXA 4AYID 2FJSA 4PP2A 3KPSD 4DKEL 2E86A 1CL7H 5J6GB 3ATFA 3DX9B 4AEHH 6FABL 1JGDA 5E5UB 1SJEA 1ZS2A 7FABL 1KIRB 1EEYA 3ARBB 3CXHJ 2DEYX 2XTLA 4M7KL 2F7RA 3SGEH 3WIHL 1OY3B 3VXOA 1O75A 2A0LD 4O2FA 4BQ9A 3D6GA 4PCSA 4WW2C 2QSTA 4B9YA 5GJSH 5CEZD 1HILB 1MRCH 4ES9A 3N44F 1R3IL 5TK4A 1LILA 1ZLSH 3NIGB 5B39B 5B4MD 2EIZB 2K6WA 5SWQB 2DL2A 3GK8H 3I9AA 3ZYJA 5JZ7C 1UEYA 2K4AA 4X5XA 1UGNA 3QZOA 5DFWH 5D7LA 2G60H 1TJIH 4FCAA 4MB3A 4HQQH 1QUNB 3OLIA 5FUCC 3O11A 4YHPA 4DQOL 5CJ5A 4NZUL 3EBIA 3K3QA 1OARL 1SJMA 5A43C 2C7FA 3L1EA 3DTUB 3MV7E 1LJMA 1F6LL 1FSKB 1FHGA 1IIIA 2F54B 2AJSH 1XFPA 3ESVF 4IKJA 4LE8A 1E8ZA 4X9HA 3ZJAA 1TU2A 5LGHH 1MRDL 4R5TA 3GBLA 3UX9B 1QHQA 4BZ1A 4DESA 2EP6A 1ZLEA 3KPNA 3ZDXE 3RGVD 1TF4A 2J5LC 4O5LH 4YMPA 3IU4L 4R8WL 1IARB 5KANG 1JWMA 1A22B 2VAJA 3ARQA 4P3CL 5LB1A 3UDWA 5KVMC 3GBDA 4LHUG 1AXTL 1A4KB 3PWUA 4KX8A 5IM7A 4RGOH 2PWFA 4GMSH 3FN0L 3SPJA 2FWOB 4EZJA 4ZS6C 3NK3A 4X6CB 3TYGH 4P2RE 3N40F 5H37H 4LSPH 2GJ6E 1P6FA 4DP7X 5GJTL 1JF1A 1KB5H 2FB4L 2OMVA 1YY8A 2K7PA 4PBVC 4LRNL 3DTXB 1Y07A 4M62H 1P2CA 3GJEA 5GGSB 2X1PA 3D4YA 3UMTA 5DC4B 5MEND 2X2IA 4QHKI 4NO0D 4QF1B 1MEXH 3JV4B 4ZAKD 4WK4B 3GZPA 1QW9A 3L5XL 2ZYSA 1AE6L 3GSXB 2VAAA 4U49A 3PQYE 1MFBH 4FD0A 1Q1JH 2V5RA 1FVEA 5E2TH 4AYDC 1HOEA 4E9TA 5D1XD 2FJHB 2OX5A 5FV1L 2UZYA 3OX8B 3WNKA 1EAQA 1M9SA 1XR8A 2ZIDA 1HFUA 1RZJL 3B9VA 4PJHB 5SWZD 4D9QE 1M57B 1M3JA 3HE6D 1UWFA 1BMZA 1J05A 1MJUL 3K5SA 5A2FA 5B38A 4PJIB 3WIFA 3MJ8B 3DSNA 1V3LA 4D8OA 1IAIL 2JJTC 5ADOL 2DMCA 3K1KC 5D72H 2B15A 3IDJA 5ESAB 5FGCE 4ODVH 1CXHA 3RZWA 2NY2D 1E4WL 3RVTD 1MCRA 3GMRB 1OEZW 1K8IB 2H4EA 4UV7L 3BZEA 4Z77B 2OQJB 2MNUA 1U93A 4FP8L 4LIQL 3VI3F 4NWTH 4WO4C 3NIGE 3G9AB 1NMAH 1TZOA 3PAVA 3LN5A 4FNQA 4A2FA 1AR2A 3K6SB 5C09D 5HYJA 5LCVH 1WEJL 2HMID 4QHKJ 5D7HA 2Z7ZA 2E8ZA 3PHSA 5TK2A 2XZCH 2ZOLB 3PFUA 5I1LB 4BFOA 1G1YA 3V6OC 3HA0A 4UQ9A 3IFNH 3PL6D 4BZ2L 1ZVYA 1UJ3B 3PAYA 1QNZL 3T2PA 1A4JA 1VEMA 4P06A 1C5DB 4KZCA 2WLIB 2IANB 3DDGA 1JK8A 4G8FB 2QVTA 2WVSA 2WQWA 2EDWA 5J1AB 1GVIA 2EDEA 3ZE1B 3OHMB 1QOKA 2ICWB 2R0ZL 3E7JA 3RYMA 3VFVA 1BG9A 3KMDA 1J5CA 4N2HA 3QW9A 4ZYKB 2ZPKL 5IZ7A 4PJXE 1T7YA 1QA9B 3L7FA 4JAMA 4KVCH 1J1PL 4L1SA 2B0SH 1DYZA 3RVUD 1TQVA 2BCMA 3VRJB 2J2ZA 4GOSA 5I8EA 3T1FA 4P04A 3DXAD 4L9LB 4F3FB 4P48A 5H37A 4XMZA 1OTTD 4MXVF 4P5TC 4XPHH 1KB5A 3UFIA 3QCUH 4ILDA 3DARA 1ZWIA 3QWOA 2GK2A 3CNKA 3SGKC 3II1A 3Q8AA 1P7QD 3BPNB 3UCQA 1E5BA 2BX5A 5D7IA 4AL8C 4ZXBD 2IOIA 3KR3L 5EUKA 5FYKD 4AJVA 5BVPL 2G30A 1SVCP 3VU1A 1P5UC 2DWTA 3EHBD 3L3JB 2XDHA 4FQXB 5CJXA 2DJMA 3EF7A 3EO0B 5C0CD 1K5NB 2ZUUA 5I1EH 3VGGA 2YRPA 1L4IA 4MD0A 4WTZG 1ZEAH 4PH8A 4WIQA 4KI1A 5EBLA 3WN5C 3ZKXC 4EVNB 4DZBB 3ETBF 3TCXA 4LVOB 2RCSH 4PVLA 3CFNA 3HG5A 3MZGB 3WUWG 2OMWA 3S3BB 1WBZB 5EZIH 4ZS6D 2Y5EA 1ZTXH 1YEJL 3ELQA 4PJHE 2PR4L 4Q2ZB 5AVXB 3TF4A 3RPBA 2NNAA 4FABH 1NBCA 1OPGH 4PJIE 3EFFA 1ZDSA 3FQNB 3MREB 4JCLA 1BZQK 3K2UL 1UCTA 4OIIL 4POYA 3ZHFA 3VFTA 4XH2B 3RWJB 4C54A 3AFLA 5DQJB 5C7ZA 5DS8B 3X1GA 4XNDA 1GAFH 3V0VB 5L9DL 3OBAA 3PYCA 4QRSA 1XCTB 1JWSB 1KPVB 3FF7A 4PJDB 3V6FB 1KYUA 2G0KA 4YFLF 5LCVA 3RUGF 2GTWB 2DKSA 4HAFA 1HINL 1KXTB 2D2OA 2Y7QA 4J3OC 5JDSA 5HI3C 4H88L 3TNNB 3WJLA 1IBYA 1URIA 5AVTB 1XCQB 4N8CH 3G08B 1FYTA 5J1TC 3CDYA 3NABL 4UM9A 5ESQB 5C07A 3SYAA 5HD8D 5K39A 5DK0A 1YNLL 5JO5B 4EXPX 1JGVL 5I30L 1SN0A 3HBZA 3KW8A 2UZIL 2ZNWA 3P0GB 2E59A 5KYUA 3ZE1E 1QLFB 3Q3GB 4W81A 4OCWL 3OKEB 4G6ML 1JZJA 2VM9A 3A21A 2BOLA 4WO4D 1JZ8A 2WVVB 4LU5H 4C56D 5HYSG 3CSTA 3QUML 4GAGL 3ZR6A 2XZAL 2BP8B 5MP6H 1L0XA 2DMGA 2ADFH 2BFVH 3UABA 3P11H 1BLNB 1C12B 3MYZA 5E8PA 2L04A 1EH9A 1MDTA 3CFBA 4WKZA 4XCNB 4JZJC 1MIMH 1CGVA 1QEWA 2X88A 3FQTB 5DHDA 3LV3A 3U4BL 1KEGL 2M2DA 1G5AA 2C3VB 4ODTH 1DO6A 2A99A 4PY7B 1QKZL 1XV8A 1A21A 2W9EH 4BZYA 5JIKA 4J39A 3ILPB 5E5MB 3U6XS 1DFXA 3ARWA 3P54A 3BPCB 4PJAB 3V5KB 4JM4H 3ARED 1YJDH 5KYWB 2YN5A 3HMXH 25C8H 3QYCA 4LOUD 4ODUA 3V0AC 3V6ZA 5F1NA 1S78D 2YGNA 5ICXB 5I6MA 3E1ZA 1Z2KA 3U36A 4L4TB 4FTVD 2VLJD 1QSVA 4YGAB 4QHNA 4PREB 1GY1A 1GJWA 5DF0A 1PZ2A 3E8VA 1MKFA 3D08A 3PGFH 3ATBA 3C2AL 1D6VL 4PJ8D 4P5TD 1U3NA 5E8EB 2H0PA 3GHBH 1BGXL 4DPBX 5DI8A 3KYMA 3DOSA 2Y6SD 1KGJA 2NY6C 3CZUB 4BE5A 3BWUF 2P5EE 4X4ME 4JFHE 4LSUH 4N26A 1LO0H 2N3JA 1FFQA 1SJHA 1XZWA 4TPRL 2X4UA 3O3AA 5EOQL 5I5JA 3KLKA 2UV3A 2FT7A 2JKXA 4M5YL 2D3NA 3KWTA 2AP2A 4PJEE 1I1AD 3IJ7A 3H9SB 3RAJL 4AVIA 4Z7NE 1BQ5A 1OO2A 3JT2A 1HKLH 2VXVH 3WYRA 2DQIL 4W9GC 4ODHH 3ERXA 3EYVA 1GGIL 3S37L 5BMFH 2JELL 5DJ8B 3CZFA 3BH9B 4BFRA 1I1CA 4OLUH 4J1UB 2HVKB 4X7EC 3V9CA 3IDIA 3SE4C 3VGHA 5FYJU 5IMLA 5GZOC 3TOPA 4OGXH 3QI9A 1N0XH 3IE9A 4LLVB 4AWJC 4HUVB 5C0EA 1CBVL 4X80L 2V2TA 1VENA 3MRNB 5HHPB 2VNCA 3FYEB 3EUDA 3UC2A 4AYEC 2KHAA 1D5XB 1JNNL 2HX8A 2CZNA 4M1DH 3VXRE 1NINA 5JHDB 1U8KB 3QAZB 4P59L 4FFZH 4X6EB 1MNNA 3NJIA 2CDEB 1D5IH 2ZXDA 3DLQR 3EG9A 4BFBD 2D7QA 4F9LA 5HHXH 5EWIH 3QISA 4P5MA 2RJMA 4Q6YA 4WFGE 1MFVA 4YX2L 5L0QB 3QJQB 1DJYA 4NO3B 1X4ZA 2LV4A 4NN7B 2YOAA 4PRID 2UZPA 4LLYB 2NY0C 1FFPB 4PWEA 2GY7B 4QOKD 1AAJA 4L3AA 4S1QH 3HMXA 4HLJA 2ITFA 3BIKA 5GHWL 4XPFL 4KDWA 2XTJD 4PJAE 3SKOA 1M05A 1YEHL 1ZKAA 4KTYA 2FJUB 3O3EA 2UY7B 1CGYA 1U8JA 4KZEH 4FNRA 3QJTB 2Q2EB 3FUIA 2Y23A 1HQ4A 2P5PA 4ZFQA 5GXBB 5C0RH 3HVDA 1QASA 4K7FB 3X14A 1HHJA 3U0PA 5EG6C 1FGVL 2D7OA 4KI5C 3D12B 3FFDA 1JNJA 3FSOA 1HI6B 5CSGA 3FB8A 2R0KH 4HX1B 4XNBA 1E4XI 2PW2B 3MV7A 3RFZB 2A83B 1NFKA 1F11B 2QHRH 4OI8A 1RCYA 5AUMA 3F65A 3HPLA 4LKXB 1T0PB 5JHMA 3N44B 1S9XA 1FPTH 1ML0A 1PNCA 4P9HC 5TE6H 1Z9MA 1GH7A 2O5YL 4I3GA 3KYKL 3TCLA 4JDTH 2IBZY 1XH3A 3FHEA 2ORBH 3DV4B 1M1XA 4UBDC 3HBPA 1A8JH 1N4XL 3LPGA 4JY6A 1CTMA 2ITCA 3F5WB 3T2LA 2F58L 2AQRA 2GITB 2W80C 3H9SE 4GBXD 4ZTOL 2HJFB 3VH8G 1PAZA 3FB5A 4P2RA 1PG7H 1QRNA 3IPEA 4F8OA 5HXMA 1QSEA 2GJ6A 3TA3A 3KD4A 4WU7A 2LU7A 4PJ7F 4NRXA 3BRFA 4HZLA 1S5HB 3D51A 1TSRA 4XNMB 4MJ6B 3WKQA 3BPOC 4PJ9D 2FJFB 3DMMA 5AVZB 4AOFA 1K2DA 2QR0B 5FAAA 3UBXA 2YBRB 3ARGA 3DBXA 1HHIB 2XWJB 4AW4A 4E68A 1Y18B 3OL2A 5FO9B 4AG4L 3KXFA 3GT6A 4DAGL 3LSOB 4QHLB 3RHWF 3SE9L 3SBQA 2BC4B 5FDWA 4XVSH 1UA6H 3P9LA 3ARDD 1SGKA 3OQ3B 3VFOA 1FQ9C 3EDDA 5I1KL 2ZKXA 3AWEA 2Q7YB 3ET9F 4FFZA 4OM0L 2WQAA 3L5WA 3LH2L 4H0IA 2GJZB 3ES6A 5JHDE 3IXAB 1VF5C 5DMJB 2EO7A 4AEIH 1PCXA 4WCYH 1L9RA 5LBVA 2UX6A 4YE4H 3LZFH 5J6GA 4YSSA 2Q7NA 2DLIA 3DX9A 4PRAB 4FL4C 4M8RA 1KIRA 5D93B 3ARBA 4Q9QL 3EOBB 4JRYE 4LVHC 2F1EA 2WLNA 4WI0B 2YHGA 4UUJB 3ZDYF 1G9ML 4XWOD 4BM7A 2EIJB 4IGBC 1X5HA 1HILA 4MCZB 2ZYHA 1HJCA 4WLCA 1NSNH 1E30A 1GYVA 4MZIA 5B39A 2DQDL 2CXKA 4LBEB 4NYLB 2AEPH 2EIZA 3NH7H 5SWQA 4LFHG 4KXAA 4PJBF 1WP6A 1A6PA 1A0QH 2MCPH 3BSZL 3CXHK 3APFA 4NN5C 3VI4E 2J1YA 1NIAA 1FZMB 2XZQH 3P2DA 5L7XH 1S7RB 2YUVA 4JB9H 5IHLB 1JV5B 3L5HA 2NLJB 4AM0B 5GSRB 2F54A 5DT1L 2I7SA 3KEHA 4KUZL 3QUYB 4WWKD 4NQSA 4UQCA 3VI3B 3C6LA 3L9EA 1KY7A 2Q8BL 2WAQA 5B1KA 3FN9A 4OLVH 3AB0B 3TN0C 4WFEE 2B59B 5IMMA 3DI3B 5DZLA 3WMPA 4PV9B 2J4WH 4J12A 3I6GB 2AF2A 2WB7A 3QIWB 1I4FB 4KKCC 5CGBA 1SN5A 1A4KA 3PP4L 4N6RB 4XBEH 3FMGL 4PY8J 2KZWA 2WP3T 5FECB 2FWOA 5I66B 1S9WA 1VLXA 4DKDC 1E90A 1C08B 1FNLA 3IAPA 4X6CA 4EIBA 5HI5C 5JHBA 4MRCA 1T1WB 4EOWH 2YGPA 4R26H 3EFDH 2LU4A 5AKVA 4XB7A 1OM9A 2ARJB 4FA7B 1HK6A 3BDXA 1Q1PA 3DTXA 4YHYB 5I76B 1N6QL 4KQ4H 5GGSA 5H37G 1LEIB 1INQB 1KCSL 3C8KB 4DP6X 4DN3L 1OAZL 5J11B 2A6IB 1RHFA 2BSTB 5T3XH 4NNXB 4QF1A 4NFDA 3JV4A 2EDDA 1ERNA 1BXXA 1MFDL 2AI0L 3G3LA 4I3RH 4OSUL 1CXIA 1F0LA 3MUUA 3DJTA 5ICZA 4XP4H 2WO4A 1KIPB 2FJHA 1R5IB 3QIUB 2HKAA 4YC2C 3OX8A 3ZX1A 2VDQH 3MV9B 2R2HB 1KTLB 2YAMA 3OD3A 4OCRH 4PJHA 4ATTA 4GJTB 2QFRA 4Y8AA 2D7TH 4PJIA 3MJ8A 2XQYK 3WFCH 1PY9A 2W1NA 1S7VB 4YPGA 5K9JH 2DQJL 5ESAA 4YS4A 1AGDB 1EMTH 2YRZA 5L2KB 4PLNC 1GC1C 1BYOA 1I8LC 3GMRA 2J21A 1K8IA 1O6SB 2SEBB 4ZUVB 1NWOA 4KU1A 4Z77A 2OQJA 2PP8A 1EFXD 3EYQC 1JZ4A 4PWHA 3K6SA 3UROR 4QY8B 4J23A 4IYKA 4Y16C 4Y2OB 3MCYA 3DUSB 5I1LA 5ITBH 2ZOLA 1U6AL 2BRRH 4BWUA 4S2SB 4Z9KB 3GM0A 4R5XA 1TQCB 1A14H 1D9KC 2VDLL 4JEGB 2VISA 1UJ3A 3MLYH 3P3YA 2F18A 4FLSA 4PS7A 4UCFA 1X5ZA 4UT7L 3GBEA 1G0YR 1C5DA 5I6XB 2WLIA 2IANA 3IK2A 5D2NB 4X4YB 2H8PB 5J1AA 4G8FA 4HWBH 4ANXA 2Z91B 2EXYD 1EHNA 2ICWA 4JQXC 3I3DA 3AQDA 4IGBD 3B7SA 4DGIH 2JI2A 1W0YT 1TTBA 2GCYA 4ZYKA 5F3BB 4WDIB 3RUGB 2PXYC 4AKPA 2KDGA 1QA9A 3V0WL 4JPKH 1BJ1H 3WFDH 3VRJA 3ETSA 2YMOA 3TO4D 4WJKB 4KJYB 1OP4A 4HFWB 5IMOA 1KGIA 1OD9A 5F3FA 4HMEA 3E0GA 2E5EA 4L9LA 4OV6F 1FLRL 3MHZA 2QVKA 4Y4FA 3K6NA 2GBVA 5D7KD 1NBZB 1QYGH 1OKEA 1NCOA 4QNPE 3PUCA 1PZBA 4U1KB 3CFCH 4NWUL 2IWFA 1T4KB 3OAZK 4QWWD 3L3JA 3OGOE 2EIMB 4XAWL 3L4WA 3K2KA 4FQXA 3EO0A 4HJJH 4AMKL 1K5NA 4GIAA 2A9DA 4EVNA 1FNHA 2BOCB 3CZGA 3HB3B 3MROB 5CP3H 3WKML 4DZBA 3Q8BA 5B8CB 4KKCD 3B7TA 4NQUA 3BVNB 4PUBL 4QRFA 3V4UL 4EUPB 1WBZA 5B1CA 1GW0A 5DC2A 4JREC 4MXVE 2NTFB 3MV9E 5HI5D 3BEVB 2NXZB 4X9IA 4Q2ZA 1AO7B 4FI6A 3B5TA 2FLBT 3PLYA 2MTPA 4B9KC 5I0XA 3O41B 3U7WL 3GSOB 4GQZA 5EIVA 2VTFA 3FQNA 3MREA 4X4MA 3GIZL 3IS0X 2Q3XA 2XFGB 1Q38A 4P3WA 4FOMA 4MA8L 4KKAC 3NJGA 4NZJA 4RAHA 4XH2A 3RWJA 3BN9C 5TE7H 4JFXB 4ATWA 5C0AB 5IBUB 3RHWK 5DS8A 3VU2A 5L2KE 2FBJL 4M6NL 5C0BE 3N91A 1UUSA 1XCTA 1KPVA 4L1LA 4PJDA 3V6FA 2VJ0A 1AHMA 1NAML 2GTWA 4FRWA 1KXTA 3VD5A 4OD1L 3M1CA 2FH6A 3A67L 1NIEA 4WV1C 1JPFB 3TNNA 3Q1EA 4ABQA 5IHWA 2QT6A 1XCQA 4MAYD 2VXQL 3G08A 3R7QA 4NPJA 4A2LA 2FHCA 2ZJSL 4NFCA 5ESQA 4TQHA 4OLYL 2OV0A 1RZ8B 4Y2DB 5JO5A 4HWBA 2ADJB 1TCRB 1YEKL 1GTNA 4ZOEA 2YFNA 1UOLA 2HG0A 5DD1L 2NY1C 4Z95H 1QRKA 1AFVL 5GRJH 1TNMA 1UFGA 2JXMB 2DLFL 1QLFA 2IH9A 3Q3GA 2P24B 3OKEA 1E4XL 3P4LA 4GW4B 5K9QI 4QRRB 2WVVA 1H3VA 3C8HA 3CPLA 3QYNA 2OYMA 1U8NB 1ZAGA 4OCYL 2BP8A 3HLAB 3ZL4H 1TJGH 4P2OB 4UAOC 4EN3B 1IBDA 1C12A 3BIBX 3PNRB 5BS0B 1YEFL 4XCNA 5FW7A 1T83C 1WICA 3LKOB 1JNHB 1JL8A 5E6YA 1CZ8L 3FQTA 1X7TA 4Q56A 4APQC 1YPZF 1A7NL 2C3VA 2EEXA 3OV6A 3VDAA 1NKOA 2ICEC 2C9AA 1HHHA 5A2JH 3KLHC 3LIZL 4PY7A 2WKOF 1AQ8A 4QTIL 3ILPA 1MHHB 5E2JA 1PD0A 4H2AA 2J6EL 5E5MA 1URZA 3NCCB 4PJAA 4YXLL 3BPCA 2A74C 5KYWA 4OZHF 2NCMA 3IU3B 3SZKC 1N8OE 4RDBA 1KXVA 5ICXA 1Z9NA 3K72B 5KVDH 4NXSA 3T0EB 2FE0A 2B7DT 2P46B 3VUAA 1SBSH 4L4TA 3V55A 4DGUA 7FABH 5T3ZD 4FYQA 4P2CG 5JQIB 1LEKB 4XCYB 4M7KH 3E80A 4PREA 3NA9H 4J3UA 3VFPA 1PSKL 2YR3A 4JANA 4CN6A 1T0NB 3ESNA 3P69A 3QZNA 5E8EA 3P40A 3U1SL 5IBLD 3M46A 3TT3H 4G1EB 3VB9A 1L9SA 1JOIA 3B34A 4MFHA 4U1NB 1AGEA 1CVRA 1IRAY 3MV8E 4QXVA 4Y5VB 2EC9U 4FXLA 3C5ZC 1SEBB 4F33B 1ACXA 1CD0A 1T0OA 2E27H 3DX2A 3WAKA 1BEYH 4TL5A 4JFUA 3RWIB 4Z7IA 1XGRB 1CFQB 3LD8C 4RAUB 1DE4B 2KQNA 3MODL 3PHOA 3AADB 2V2WB 2UY6B 5ALBL 5DR5L 2F7PA 4MKTA 3WU1A 2DIAA 1U3HC 3GI9L 1J0HA 4CGUB 5LQBH 2ESVB 4GUPB 1S3RA 5DA4A 5FKAA 2GBTA 3V5DB 3IBEA 4HWNA 5DJ8A 5E9DD 1SMDA 3BH9A 5JPNC 5E8DL 4J1UA 4R7VA 4B9PA 5IEKB 4MSWB 4M9PA 1EJOH 4JRXD 1VGKA 4ODWB 3TP4A 2EKSB 2O72A 2PTUA 2QPDB 3IU4H 3O0RH 4JO1L 4KKAD 4UOZA 1SLWA 5I75B 4KUCF 4LLVA 2Y72A 4HUVA 1C5CH 2VSKB 2CGRL 2ZX7A 3NPZB 4N1HB 3UBXG 1QBML 2R29H 4NKIL 2WSPA 4X7FC 3MRNA 5HHPA 4QRRE 2F53D 2Y1VA 3OB0K 5JHDA 1U8KA 4X6EA 2FB4H 2O93L 4NKDB 3ZGHA 2X6MA 3MLXL 2CDEA 1OQOA 5GGQL 5A2AA 2X89A 3B2XA 4PJ7B 3CBJB 3BPLC 4PWKA 1S7TB 5BS0E 1C1EL 1JZFA 4DEUA 5BO0D 4JFZH 1IBHA 4AVHA 5EV7A 1SQ2N 3D52A 4JFFD 4GRLD 4NO3A 4G3YL 4P2YA 4XGZB 4OBSA 3L5XH 1LVEA 4LLYA 1FFPA 1SRDA 5KUMA 3VFGL 2AQPA 1AE6H 2CQVA 2LAGB 2EDNA 2NR6A 3QG7H 4L3FA 4OF7A 2VLMD 3S8FB 3CLFH 2Y3AA 4TSAL 1TR7A 5I1AB 2FX8L 3K91A 1MCOH 4FFYH 2IF7A 3S5LA 4AQOA 2WANA 4GKSA 5E4EC 2EYTB 1HE7A 2UY7A 1K3ZA 2OCCB 5T1LA 3SPHA 1ADWA 1WD8A 5JDJA 3I2CL 4PV8B 5AVQB 3T0EE 5F9JB 4A7QA 1IAIH 5EBMB 2OTWB 3JVGA 1B3IA 4HSQA 5B39G 2XX0A 3B7UX 3C6EA 4M48L 5DUBB 1YYCA 4AQAB 1E4WH 1HI6A 2P1YA 3ZL1A 1M2VB 1ZGLM 4HX1A 3ZDYB 2PW2A 3RFZA 5GS0C 2A83A 2XV2A 4KROC 4DH2A 4LIQH 4HV8B 1HXYB 2ZKMX 4LKXA 4WFHE 1BD2E 4B0MB 3POCA 2FECI 5AYQA 2OS7A 1FRGH 1ASQA 3NJHA 1BM3L 3ZE2E 3UDWC 4CVUA 3DV4A 3FU7B 4NB7A 4BZ2H 2CMRL 4PJBB 4XHJD 1HCFX 2G0LA 4K94L 4B9GA 3B5HA 3T9WA 2HJFA 4C55A 4LEBA 1BZOA 3MXWH 3NGBC 4JDVB 1UVQB 4KKBC 2ESVE 1DVXA 2ZTBA 3MJ7A 3SE8H 4TXVB 1S5HA 4EAEA 4XNMA 2FJFA 2B20A 3Q8FA 4N2KA 2QR0A 4Y7OC 2YBRA 4YXKH 4OLXL 1HHIA 1QFPA 2XWJA 4N0FB 4AY0A 3C5ZD 1Y18A 5FO9A 3UP6A 2D7MA 1LK3H 2IDFA 1N19A 3VTMA 3GRGA 3LSOA 3ZTEA 4QHLA 4HIXH 2BC4A 1BZEA 3N41F 2B08A 4RFOL 2IQAB 2R29A 3Q0HA 1CE1H 3EGSB 5IR1B 1RIHH 3U9PH 1X4XA 5F44A 2DYRB 4GXUN 4HGWB 4MJ5B 4F5CA 5A7EA 2VMFA 2W95A 2Q7YA 4QUOA 3TONA 2VDNL 1WISA 2V8MA 5DZAA 2VDOL 5DHYB 4UQ3B 3VTTA 1VJSA 1U8HB 1DLHB 1ROWA 1OW0A 2GJZA 2YXMA 4QAWA 2VO5A 4IHOB 3IXAA 3QWNA 1PKQB 3KR3H 3IDYB 1TKWB 4NI6A 2ZX5A 4AE0A 4PRAA 2OR8A 3CK0L 3FH8A 4Z7WF 5JUEH 5ISZD 4FQ1H 1YECH 4YUEH 5GISH 1RUPL 2ZKHH 2BNQD 3EOBA 3HR6A 2K3HA 4UUJA 4V11A 4WI0A 1IVTA 3EYSL 3O9WB 1HDMB 2DF3A 4MCZA 3LEVL 4XN4A 4FFYA 4DVRL 5DS1A 3B6SB 5DD3L 4MVBD 4NYLA 4LBEA 2DM7A 1CDYA 4YZFE 1AQHA 3CQPA 3WLBB 2Z8VC 3EH1A 2BHFA 1FZJB 5F6HI 3N06B 2WUCH 1QW8A 1T7XA 1CFSB 1DVZA 3B9AA 1CLOH 2ZSVB 3K2UH 4N90D 3WG7B 4JQIH 2V5SA 4OIIH 2X87A 3BESR 1A6TA 4KMLB 1ZXKA 4W6YB 1FZMA 4NBZB 2P80D 3RPIB 5TQ2L 5AYTA 7TAAA 1S7RA 4Q9BA 4O4YL 1ECZA 1JV5A 3EJZD 4NP9A 5DJ2B 1QLRB 2NLJA 4AM0A 3ZDYE 2CHNA 1BLIA 3GIVB 1J8HD 2R0WL 2JQMA 3QUYA 4PJFF 3UTSE 1N3NB 2WY3B 4S1SL 2EDFA 3GMOB 3VI3A 4JG0L 4H88H 5KVEL 1DJXA 2GI7A 4ODSL 2B59A 2YMXH 2VDLB 1MJ7L 3SIKA 4ADIA 4BZ2A 1I8MB 4X5QA 4PRPE 3GNMH 4PV9A 5D7LD 1X9RA 3I6GA 3QIWA 1I4FA 1ROCA 4PJBE 4YDMA 2CLRB 3PWPB 4N6RA 1PX8A 4KGJA 5DHVH 5FECA 5I66A 4QD2E 5M95B 2JKIS 3UL4A 2DRUA 3ESUF 3PU7A 2KUTA 1MHEB 5KVGL 3GLEA 1JNLH 3IM1A 1T1WA 3V0GA 1ZIAA 5FX3A 1O7DC 1UOVA 2ARJA 3U6RB 4OCWH 3BSGA 4XO8A 1CFVH 1GGYA 5D71H 4EDXB 2VABB 1P4IL 4WKXA 4KV5E 5CJXC 5F72S 1INQA 2NW3B 3ILDA 4QIRA 4P46C 3NCMA 1MHCB 4KK9D 1LK2B 2A6IA 2BSTA 4QRPD 4NNXA 4DP1X 3UJJL 1J9CT 2FEEL 5IB2B 3IVKB 1IGFL 4ZUWB 4H40A 4NOBA 5FO7B 3GTNA 3I9IA 5CJQH 1WV7T 1IC1A 1NCWL 1KIPA 2ZONA 4O00A 3QIUA 3SCMB 4P3DA 3MV9A 2R2HA 1KTLA 1KEGH 2R27A 1XF4B 3N1MC 1VKXB 5IVNA 5JNYB 3MRGB 4UI2A 1U95B 2DN7A 2R8SH 3OG6B 2IIJA 1KJMB 2QDWA 3P9MB 1FIGH 1DVUA 3LKPB 4L1DA 2VQ1B 1VHPA 1S7VA 2BVPB 2Q0ZX 1Q0XL 1LO5A 1AGDA 4K23L 4M4PA 5L2KA 1MFMA 4MJ4A 5E56A 4CMHB 1O6VA 4ZUVA 3EIFA 1BVNP 1O6SA 2SEBA 1N5YL 4WNQB 3MBWB 2W60B 1U2YA 3CMGA 1D6VH 4AZ8B 4WW2F 3WJLC 3V4LA 4AV5A 1JZIA 4QY8A 3TASA 5AOLA 4N2DA 1BGXH 2HH0L 4E5XB 4Y2OA 5TF0A 1TQSA 3ECBB 5I1HL 4NM4H 4HJTA 3E2HB 4JQIA 1OCRB 4S2SA 3ABLB 3QH3B 3UC0L 2J43A 4G83A 3F12B 4H26B 1MVUB 1R6VA 1AG0A 3VSUA 2ZWKA 3VWKB 1E2ZA 3KPOB 1IE4A 3QJSB 4LVEA 1QFOA 5CKGA 2H8PA 2CJUL 3APDA 5D2NA 4HMDA 4X4YA 1G7LB 3OAUL 3PWLB 1I3RB 1YEEL 3GD1C 3DX4A 2H1PL 3JTTB 4ZG1A 2F19L 2L8AA 1QNIA 1IC4L 5F3BA 4WDIA 5FYLD 3RUGA 5IVXF 5HYJD 1TETL 5MI0C 4D9LH 2DV6A 4JY5L 3SHSA 3LEYL 4G7SB 5HGHB 1BMGA 4KJYA 5E8OB 4HFWA 2KZKA 3VD0A 1P5VB 2X41A 3MACL 5D1QC 3DX0A 3B2VH 3P4MB 2XY1A 3BJLA 1A4AA 4MYPA 1DUYB 4NKMB 4UIKL 1NBZA 4RMRA 4Z5RA 1UT2A 1H3UA 3N0AA 4BSVA 1DJZA 1ACZA 4HOZA 3AJ7A 4U1KA 2A9CA 1MRFL 3B7RL 5GPRA 1SF3A 2BXZA 2QSCL 4FXKB 2EDXA 3GS7A 1C16B 2G3NA 3K8LA 3LDBC 4YLBA 5KOVC 4F80A 3RL1B 2WJ7A 1TIUA 3ZTNL 2BOCA 3MROA 2F8OA 4UINH 3ZLQC 4JKLA 3BVNA 3SBWA 4LASL 4GO9A 3ULSB 4EUPA 2NZIA 2B5IC 2QKIB 1PYWB 1ZHNB 2NTFA 3N1FC 5FKPB 3BEVA 4OUOA 1RUAH 1AO7A 4L4VE 2AJ3B 3DVIA 1YPZB 1ZXQA 4RFEB 3MCLH 4OCMC 3O41A 4DK3A 1A4CA 1UCBL 2N7BA 3NQKA 2PYEB 1Z5LB 1BIIB 5C7XL 4GNKB 4JFXA 5C0AA 4OZHB 5JOPE 3U1QA 1IV8A 1JZDC 1UEMA 4NDMB 4BXSV 3WJMB 4Q89A 3ECUA 1KGCD 2GPZA 5FHAL 4YIQB 3HC4L 2W94A 5CINL 5I6KA 5LWYH 3RNKB 3TIEB 3FO0H 5CSZB 3DHMA 4M00A 3HIZA 2W65B 1RUQL 1MPAH 4AW7A 2Q10A 1TUPA 5F7EH 3AT8A 1Z9OA 4BELD 4CDHA 1SDDB 1EHXA 3IDMB 4K5PA 1RZ8A 4Y2DA 3QI9C 2ADJA 1TCRA 4ORGB 3M7OA 3Q6GH 3OAZH 4I0PB 2EIKB 4I4WB 2X5PA 3CFTA 3PABB 1CU4L 2JXMA 3PS6A 3D18B 1KJVB 2P24A 1BPLB 5EF0A 5MEQB 4GW4A 2NQDA 4I3SL 4HK3N 2WXLA 4WUUB 4ETYA 4GXUM 2PO6B 1FHNA 1U8OB 5HBBA 4HWEH 1TQTA 5T5FL 2CM5A 2FECL 3TH4T 1O5DT 1U8NA 2NDFA 5EZOL 4BGDA 4HEME 3AS3A 3HLAA 1FYTD 4F9LC 1KELL 3UG4A 4X9FA 3FH7A 4P2OA 1VDGA 3HNSL 4UM9D 2W88A 1ADQH 5C07D 3AM8A 4K8RH 3S35L 3C2SA 4EN3A 2GIXA 1DSWA 1IL1B 1KDIA 4R4FL 4NRYB 2XQYA 4JE0A 4BYHA 2HKFL 3HZMB 3UOAB 3LKOA 4N2IA 4NM8L 1JNHA 3BUBA 3H3PL 1V05A 4PGZA 2FO1A 3MSPA 4A2EA 2HT2C 4LPYA 1II4E 1YJDC 1JGLL 4XNZB 5DRWB 1AR1D 2OSLB 3QRFM 1MHHA 3DTDA 5AB0A 3KM1A 1ETZB 5DC9B 2JLPA 4G9FB 2BZCA 4WI7A 5SWSB 5KZCB 3IU3A 2P3YA 4ACTA 1NMBH 3WIIL 3H0TB 5L88H 3K72A 4HBQA 5HHOB 3T0EA 1G7HB 2N0KA 4HH8A 2NYYC 4YHOL 3GB7B 4AL8L 4XCYA 1LEKA 5CLWA 4Q9QH 3S5LG 5D4JA 2HJLB 1N70A 4XCEB 1T0NA 2VKWA 4AQZA 4CKVX 1JVKA 4G1EA 3FRUA 3NJFA 1L6PA 3N0PB 4U1NA 5J06A 4J5VA 4OI9A 1RIVL 4P2AA 4R84A 4G5ZL 1SEBA 1RK0B 2QPUA 2H47C 2FQFA 2V7NB 4F33A 2XN0A 3CVBA 5MHSD 3LN4B 1JTOA 4UZGA 1CD1B 4KK8D 4YXHH 1HZLA 3RWIA 2LAAA 4KRMB 1GJIA 1XGRA 2VXUL 3BD5A 1CFQA 1AD9B 1WH0A 4P0DA 4RAUA 1DE4A 1USQA 2JKTM 4WY7H 3DROB 3NCXA 3F7QA 2ZCLL 1CF1A 4LLUB 4Z7UA 2GC4C 2V2WA 4K3EH 2Y5QA 3QC5X 2OI9B 4N4YB 3TA3C 1JHTB 1IZJA 1GGTA 2ESVA 3U83A 5J13B 1BWWA 1JDCA 1UGKA 4GUPA 2GUYA 3DMMC 4OJDH 2MSPA 5DT1H 3V5DA 4KUZH 3ARGC 4I87A 3L5IA 3MYJB 4TRPH 1IGCH 8CGTA 1ZE3H 5AVVB 4PFEA 1UH2A 2AK1L 5IEKA 4MSWA 1CBJA 1GOGA 2CHDA 4QEGA 4ODWA 4YR6B 1ILUA 2EKSA 4ALAH 4CSSA 2ZWZA 4JO8A 2J56A 4M93C 5KSAA 3RVXD 1AQKH 4N5ED 1DUZB 1KB9K 3PP4H 1ID5I 5HDRA 4OD3H 1COBA 5B22A 1P6WA 4KRPB 2R4RH 3ULVF 1JZ2A 2HLFD 3O6LL 3P1VA 4KJPC 3HZVA 1OLLA 2QQKL 4HMCA 3IYLW 2XQBH 4JPVL 4UT9H 1ADQA 4Y4HD 1TVBB 2AJUL 3NP4A 4YBQC 1DJWA 1P84J 4NKDA 2JH2A 3AS2A 4W9DC 2EXSA 5JW4N 3TYFB 1YYMH 4PJ7A 3S36L 1S9KC 1IVLA 1F4AA 3VD3A 1S7TA 5I71B 1S2EA 1XWVA 3A6CH 3ARBC 3Q2LA 4XGZA 4GUOA 3BP6B 1JZ6A 3RU8L 1MFDH 2A1WH 2AI0H 3HI5H 2IGFL 2PPFA 3LB6C 3N41B 3FOMB 4E2OA 2GHWB 4NQTA 4MTMA 3TESA 1GS8A 3KYAA 3ZRCC 5CD3B 4YOKA 1S7SB 3EXLA 5I1AA 4PIBA 2HWZH 3VE0B 3H8NA 3TO2B 4DGYH 5LGJB 1E5CA 2YN3A 4Q4EA 4XMLH 2EYTA 3SGDI 2OK0L 2HT4D 1WD9A 2DWSA 2IH1B 2IQ9H 5F9JA 4ONOA 4IRSB 2EDYA 5EBMA 2OTWA 5AAPA 4Z7WB 1E2WA 1BFTA 1TLMA 5DUBA 4AQAA 4LSRH 1M2VA 2EDOA 4FNLL 5JORB 1AJ7H 2JF1A 4WZ9A 1B4JH 4GLRI 5AYUH 4M5ZH 2R4SL 4HV8A 1HXYA 2FO8A 2VYRE 3C6LC 2DYPB 4TULL 2LLGA 2O5ZL 2VIRB 1EZLA 4N8UA 4NIYE 5I1CH 4KVNL 2CUAA 4G8EA 5AOJA 1GW6A 5BVJB 1QEXA 3UAEA 3VD7A 2DEWX 2E74C 1IGTB 5DZOA 2JIXD 1E6JH 5LAPA 3FU7A 4Y89A 2VDLH 3OB0H 5G5DB 4PJBA 4QI3A 4LP5A 3MOQA 2NYYD 4WNJA 5FXCH 4GFTB 4ZW3A 1LWJA 2H45A 1OSYA 1QABA 5IK3B 1B9ZA 4IU2B 4GY4A 5LO7A 5I5RA 3H54A 4JDVA 1UVQA 4DSYA 3UYRL 3UIYA 2BSED 2VUKA 3MV7D 3HJEA 5I6LA 1X5YA 3G6JE 2XT1B 4JL2A 5DZVA 6TAAA 1HL5A 3A23A 3D69B 4KAQL 5KEZA 1P0SE 5IJKC 3OM3B 3HG1E 1S9VB 4HG4J 4FQJL 4N0FA 1AQDB 2D7PA 4PJFB 2XPZA 3NEXA 5ILTL 1F2QA 3HMWL 1BOGB 1R5VB 4PHZA 1PLAA 2IQAA 4Y19E 3MLVL 1CWVA 4WWOA 5EC1B 3EGSA 2QL1A 4L3EE 4N1EA 1MWOA 5IR1A 4WI2A 2OTUA 4HGWA 4FQCH 4XR8C 1NOLA 3NG5A 4UT9A 5CGTA 2WMPB 3LZLA 3CXDL 3WGUB 3VFSB 2K0RA 5DRXB 4FA6A 4P2RD 4J8RB 5DHYA 4UQ3A 4N2GA 3T8MA 1PPIA 1U8HA 3LRGA 1DLHA 1QSED 2GJ6D 4MMYB 5GS1B 4IHOA 4N2FA 3MKGA 3KLDA 1PKQA 4XO9A 2UX7A 3RGHA 4NWUH 1TKWA 1E67A 1TENA 3ARGD 4K2UH 3F64A 4JFEB 3Q8EA 1XEDA 1FIEA 2Z31B 5C08B 2R56H 4B53A 5E0FA 2UXTA 4K73A 1CICB 4MA1B 4MJIB 2ZUVA 2D0GA 1VFUA 1N12A 3ZT5A 3HZ3A 4OJFH 3O9WA 1HDMA 1NCJA 5HHMB 1N0LB 3PQYD 1BBDL 1UB5B 3B6SA 2IG2H 1A9BB 4L23A 3L9RB 1J5IA 3SE3C 3IFLL 3WNOA 3GSWB 4D9QD 2Y7MA 1YAZA 2ZCHL 4J3WA 1XAUA 5JXEA 1IEHA 1FZJA 1W16A 2C1OB 2Y06H 1ACYH 3ARRA 1G4MA 1UJ3C 2CO7B 1CFSA 3CH1B 4PLKC 1G84A 2KBGA 2ZSVA 4KFZC 4GRWF 4R5VA 1LEGB 1G6RB 2OZ4L 2XRAL 3OJVC 3C12A 3RVVC 2WLLB 3DO7B 1EVUA 3D8MA 3LNEA 1JXJA 3LZRA 4DGVH 5A6IA 4QTFA 4QHPA 5DJ2A 1KMGA 1ZJAA 2Y69B 3OMZA 3NSJA 3ZT6A 2CBOA 1JSYA 3GIVA 3U4EA 1CYGA 4NBYB 4LP4A 1N3NA 4GQRA 3CCHB 3GMOA 4NRZB 3A67H 3UAJA 3D2UB 3FUNA 4WW2B 5T1DL 5FCSH 5D7JD 1I8MA 1FGNL 1DBAH 2WXQA 4D0CB 5E00B 5ES4B 4L9LC 2CLRA 3PWPA 3TZVB 1PU0A 2NZ9D 4WWNA 4Y4FC 2WB1A 3S6CA 5IMKB 3UTTA 2VZUA 4LCCB 5DJAB 2F9BT 3N85L 1MHEA 1AFVH 1VZIA 3MI6A 4P9HL 3BPNC 4GSDL 3CN3A 2DLFH 1BA9A 3VTAA 1YAIA 4NAJA 3EH3B 3U6RA 1ZHBB 5KVEE 1H8OA 1N6VA 4U7SA 4RISH 4EDXA 4G42B 3O6ML 4KHXL 4PMEA 2H2PC 4PJFE 2NXYB 3QEUB 4RSYA 1E2VA 1J18A 5IVXB 3T1WA 1XEUA 1LK2A 3GUTB 4KNSA 4LCWE 4MMZB 3V95A 3EYOB 1PAMA 2R69H 1FG2B 4LVOC 3AG2B 1B6UA 5IB2A 3IVKA 4OLZL 1A9EB 3I6SA 3TH2T 5KVGE 4E41B 5FO7A 4PW9A 2ODIA 3VAEA 1L7TL 4ANUA 4RCAA 2J5LB 1RERA 2Y1AA 4O02H 4XN9A 4ZO6A 2J12B 2D4FA 5CGYC 3TPUB 1XF4A 1URLA 1A7NH 2HXAA 1VKXA 4AYSA 5JNYA 1BAWA 3O2VL 3MRGA 4MNQB 4L1BA 3S88L 1U95A 2O6EA 1I3UA 1RUKH 3JWNH 4PJ5E 1KJMA 3GBNL 3WS3B 3ARUA 4JFEE 3ZHLA 3P9MA 4YEFA 3MX0B 3LKPA 5SWZE 4JR9L 2VQ1A 2H41A 5C08E 2BVPA 3F7RA 4NERA 1AMXA 5GSVB 4OGAC 2Q1EA 1HEJC 4QHMB 2DIBA 3M8OL 2QSQA 4FG4A 1AGBB 5HHME 3DETC 3FQXB 1LXMA 3U82B 1UD4A 5IQ7L 3QRLA 4WNQA 3MBWA 2FEJA 4G6FB 1KCKA 2W60A 3T0AA 3UBHA 4KZDH 1TZGH 2VSDA 1Q90A 4AZ8A 1TITA 3BAKA 1RFDL 3U1SH 4EBQH 4OFKA 4E5XA 3AG1B 5IBUG 3ECBA 4YHNB 5HPOA 1LGVA 4HJ0D 5D1ZI