2O4EA

The solution structure of a protein-protein interaction module from a family 84 glycoside hydrolase of clostridium perfringens
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
165
structure length
165
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMASKLKEAAEVTGSVSLEALEEVQVGENLEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIEDGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKAEGSNLSVTNSSVGDGEGLVHEIAGTEKTVNIIEGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a putative non-cellulosomal cohesin module from a Clostridium perfringens family 84 glycoside hydrolase.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Protein binding
molecule keywords O-GlcNAcase nagJ
total genus 13
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o4eA01
2VN5A 3GHPA 1G1KA 4UYQA 2CCLA 2JH2A 4N2OA 4UMSA 1ANUA 4WKZB 1OHZA 1TYJA 3BWZA 2B59A 1QZNA 4U3SA 2XDHA 3UL4A 4WI0A 2BM3A 2OZNA 2W1NA 4DH2A 3FNKA 2Y3NA 5AOZA 2VN6A 3L8QA 4IU3A 4UYPA 5LXVA 2O4EA 2VO8A 1AOHA 4IU2A 2ZF9A 4FL4C 1ZV9A 4FL4B 5G5DA 3F2LA 5K39A 3KCPB 3KCPA
chains in the Genus database with same CATH superfamily
4HQQL 3S37H 7PCYA 5JQHC 4U1HA 3TVMC 5FCUH 1O0VA 3RIFK 4FMVA 2G60H 4DERA 4G1MB 3CLEL 3I3BA 5ESAB 3WJMA 3PQYD 3UTTE 2A74A 3WUWA 2XYCA 3HS0C 4I48B 4MB3A 1MI5D 3VGBA 1WHPA 4AY0A 3PHQA 4PJAF 2X4QA 4QTIH 4JFZH 3RPBA 3UPRB 1HK6A 3GC3A 1PLAA 4Z7NB 5GGSB 4XTRC 4ZT1A 4ZMPA 3RY5A 5HI3D 4ZD3L 3B5GA 5LB1A 5J57B 1NUNB 1KXHA 4NQEB 3OJDB 5IEHB 1T1ZB 5PAZA 3RHWF 3WELA 5MHSD 1TQTA 1TEFA 2XIBA 3KPNA 2RACA 5CAYB 3RZWA 2XVKA 1SY6A 3AB0B 1Z9SB 4ALAC 1J5CA 5J8OA 3O8XB 1P5UA 4PJ6A 2PPEA 3SKMB 4XCFH 2KLSA 4JMNA 3SKUD 5KWYC 3D05A 5BS0D 5A1AA 4O4YH 3LNHA 4V1DB 1CXFA 1EBPA 4XCCH 5B3JE 5J13B 2LAAA 3THML 1OD9A 4L3ED 1INEL 1PCXA 4MTMA 3ZGIA 4OZHB 2M8XA 1DLFL 1UJ3C 2HTKD 1NH6A 5MEOB 3KGUA 4KJWC 5GSVA 1KJ2A 5JIDA 1AS8A 4JAMA 1JF1A 4I1RA 2NY6D 3ZLQC 4YDVA 3DUSA 4YHKL 1FFOA 1LQSR 3IK2A 1NGZB 4RFNB 3HUJA 2D9CA 1F4AA 1D9KC 1VB9A 1RERA 4G6JH 2IQAB 4HJTA 4TS6A 3OV6A 3VGAB 3VFRB 1IM3B 3L7EA 1IEHA 1HN1A 5C08D 3UTPD 5CJOL 1CDHA 1D9KB 3V52L 3DX8A 1URIA 1IFHL 4WI9A 4XO5A 1RSYA 4I0KA 4XX1E 2NX5A 4A2FA 2EIDA 4PW3A 4WFFD 4NN7B 2FX9L 5I1LA 5DT1H 1QZNA 1DHKA 5C07B 5HJ3B 5LDSA 2FQDA 1ZK9A 4JCWA 4YVUA 4GRMB 2Z6FA 1IQDB 1LVEA 1U58A 2WY3B 3O8XD 4QEGA 3NK3A 4MDRA 1CDCA 2HT3C 4D3CL 5HJGA 3ARDB 5E6RB 2MHAB 3HPLA 1IZKA 2ZF9A 3WOVA 4AIZA 2XTSA 4EIZC 5DMGD 4E41B 3MV7B 4J4PC 4UTAH 1BMGA 3LQZA 2FBRA 5F1IB 5A2IH 2WP3O 1MPAL 3ZX1A 2PUQT 5C09E 4C47A 2EH8H 3QDMD 2OYMA 3R06A 2IDFA 5JPMB 1A7RL 1DJHA 1FAIH 3PP4L 2CK2A 2XDHA 4PYHA 4WGWB 4YSSA 1MRFH 3DX6A 4Z77A 1CD8A 3B2VL 3AZUA 1YY9C 3RWCB 2R9HC 1DBAH 3SHSA 1HESA 3ALXA 1VSCA 3BPOC 4Q97A 1VGEL 3CBKB 3D12B 2YAOA 5L2KB 1P7HL 1NGWB 2NYYD 4HLZH 2DLHA 3U0PB 4R26H 3F00A 5KAQG 1L3WA 4KH9A 3D30A 1E3ZA 1TKWA 2VW7A 3Q9QA 4K2UH 4WUUE 5I8OH 5F89B 4XPFL 2P49B 4AL8H 3T3PB 4CN6A 3MRCB 2C9UA 3F5WA 4XN1A 4RZCB 3DPBB 5K59E 1MJJB 3O0RH 4HIEB 4PRHD 1UD2A 4BUGA 4CKQA 2VZSA 2XPZA 3QHFH 3RWIA 2XNAA 1TG8A 1K2DB 1UCBL 1UZGA 2UX7A 3ELAT 3NG5A 3ATEA 3QXDB 5DJCB 5FO2A 1BOGA 3UZQB 3POCA 4I9WD 4QY8B 3OB0K 3QORD 3PXJA 4OU3A 1ECZA 4G7RB 4X9IA 3U4EB 4NKMA 1IKOP 3OAYH 2QMKA 4R7LA 4QPEA 1RUKH 2VUOA 3RRQA 1KXQA 3FPYA 4MD4B 3DBSA 2CO4A 2QL1A 2FHFA 1MEXH 5F96H 2F74A 3X3FL 4K0OA 1E27B 1MCFA 4HT1H 4Y4FB 3VI4F 1TQSA 5CF3A 3IJHB 4AMWA 4DVBB 3ELQA 1ADQH 5DZVA 4K4KA 4LCIL 3L95A 2VXUH 2Y5TB 3EYVA 4OD1H 5DMIH 4AGQA 3GSQA 3KPPB 3I84A 4XVUC 2PXYB 4MJ5A 2L0DA 4NIYE 1JRHI 1S5IL 4QRUA 3RY4A 5I1GL 4ZFQA 2X4SB 1P4BH 3NFNA 2ORBL 4KZDH 3UJJH 1X5JA 1F2QA 3KPRB 1NAML 2IG2H 2XZQH 4OW6A 3D0AA 1K5NA 4Y9CA 2AITA 2BSSB 1F4XH 2IXQB 1UG9A 3FRPA 4UAOC 3LRMA 2Z1KA 3QPQD 4H26B 5AZUA 1CXLA 3QEQA 2MSPA 5BW7A 3LVTA 3WLBA 1HILB 1CDBA 3P4NA 2VLMD 4TTGA 5J89A 3UABA 1ZAGA 1BXVA 1DUZA 3ZMEA 2EC9T 1E2VA 3FTYA 1FZMA 2ZXAA 2E7HA 4OJCA 4F2MB 4UNIA 4PG9A 1UHVA 4QRBA 2GK2A 4WU7B 3DNKA 1T7YA 3FTSA 3CFTA 3MODH 1QO3B 5JPNB 5HGDB 5E4IA 4KJPD 3CFBB 1AGEA 5JUEL 1D5MB 1U93B 2AJYH 2K8MA 4G6ML 1QLEH 3TBWA 2Z0BA 4QRTB 3WBDA 2G5RA 4LSQH 1W72H 2GUOA 5E2WL 4DESA 3FCGA 2XQBH 4D7PA 2YPKA 3BQUC 2M83A 3O2WH 5CBEB 5F3BB 1F13A 1J10A 2IH3A 1WT5A 5C0AB 3WMPA 4V1DA 4H0GA 4HUWA 1C1EL 1BQHG 4BZ2L 2FSEB 4G9FD 4JPKH 4KDWA 3BSZL 3TYGL 2HFTA 1KGIA 1F8TL 2RR3A 3UACA 4D7BA 3C8HA 4NQCD 1X5GA 2BSBA 2VH5L 4RMUA 4JFOB 4Z5RA 4KK9D 3LQAL 1HX0A 4WUUB 4FQQB 1BZ9A 3LSOA 3UO1L 1IGJB 3H6AA 4GPVA 4NGHH 4MB1A 1CLYH 2F54E 4JDTH 3JT0A 1OVZA 5F7EH 2PCXA 5DMJB 4BFBD 2FUTA 2P5WD 4FFVC 2GC4C 3NIDE 2PCPA 2NMSA 4RRPG 5F3HB 5L88H 4NAQA 4B9JA 3H7BA 1JN6B 5I6MA 2WC7A 1HCFX 4P05A 2QQQA 3HW7A 1DVQA 4KJYB 2XCMC 3BLKA 3TCXA 1Q38A 3QORB 1CTOA 1U3JA 4QHMB 2HLAA 2ZWSA 3EJPA 1YJDH 1EAOA 2AK4B 1GS7A 3B2MA 2NXZB 4FNPA 4WTWA 2YPLB 3FCSB 4W9HC 2F2HA 1FGNH 5I1CH 3OF6D 2ZP0T 3WNNA 4OD3H 4OLYL 3LDBB 1EFXB 2LQRA 4L4VE 5F1NB 1M4KA 4DTGL 4LO9A 1NCCH 2HVJA 5T1KB 1XGPA 1RQ5A 4BDVA 4C4KO 3ZTJH 3J07A 2WXGA 4XBGB 4K7PH 4U1KB 5D7HA 5DQ9A 1U8PB 2YD2A 2J8UF 4TUOB 5F9AC 2PWEA 4I3RL 4Y1TA 2X05A 1PTZA 3DOIA 2EDWA 4NBZB 2VDRH 2IH9A 1NIAA 4KKAC 1BG1A 2J1KA 2IDQA 1ZGLA 1MJ7L 4O51B 3HC2A 3VRJB 2JIXD 3CZNA 4H2CA 1FNLA 3MLWH 3AS0A 4LPTA 4MXWL 4PGBB 3TBBA 3AQZA 2NPLX 2W8CA 3BLBA 4ZW7A 3OKOB 3KH4A 4UQCA 2BVUA 4B9CA 4XRCB 4DGVL 2BCMA 1ZKAA 3JQOB 5EBGA 5I5JA 5D6DC 4AIZB 1JZ4A 4LQ1A 3HMXL 4JFEA 3LPOA 4RCAA 4LAJH 2VMJA 2BXZA 2UXTA 3T6QC 4YAQB 5LXGH 3F6JA 5C7XL 1V7MH 3BO8A 2NNFA 3TO4D 3L9RA 4QGYA 1BX2B 4L3CA 2Y7MA 4YDVB 3QR0A 5IKCA 2X7LB 3E9TA 3NCMA 1U36A 3KL0A 5LBSA 3CH8A 4JFEE 5IHLB 4L1HA 2Y06H 4YDJA 3U83A 7FABL 1KN4H 3BIAX 4TL4A 1PS3A 1VFOA 3HZKB 3CVHH 2V4LA 2WLKA 1V7NH 5HI5D 4L3EE 3UAAA 3OR6B 3GS4A 1WG3A 2QDVA 1G6RL 2XTJC 2P5PA 3MZTA 1XF3B 4KTDL 3VXTA 3IDNB 3BXNA 2BOLA 5IBUB 4UUJB 2GIMA 1JV2B 3DJZA 4UIKL 4N20A 5DEGA 1I85C 5CGMA 1T0OA 5L0QC 1JGDA 4AZ8B 3K5SA 4QOKB 3G6JF 1CD0A 3DOSA 4UIMB 5B1JA 1ZLVK 2OCJA 3D39E 3BZ4A 1GGYA 1S5HA 1NGXB 4YSEA 3L5XL 4KAQL 1YMMD 32C2A 2DBLL 4J8RB 4J8QA 1XF4A 4NN6C 3DIFA 4I18C 1WAAF 3PYCA 1RP9A 4Q6IB 2YQGA 5B22A 3TL5A 5FYKE 1PAMA 4L9DA 1YG9A 3UH8A 3ULVD 1GKOA 1GYVA 2VL4A 2WBJB 5K1NA 1SMAA 2V6HA 3H2QA 4RMWA 2NZ9C 2X2YA 3KNBB 2ZUUA 2DYRB 1XF5A 4PRIE 4XAKE 5I0ZA 2C7FA 2EYSB 4OFIA 5LBGA 4FULA 3QUXB 2YC1B 3PJSA 1GOHA 2KC0A 1O9WA 3AMKA 3LKSA 5F1OB 4WEBH 4HC1A 3L3IB 1J05A 1LO2H 3NRFA 3QEHA 5BS0B 4JKNA 3VWJB 2AF2A 4JX0A 3DX2A 3NP3A 4DKFL 5KVEL 1OP5K 4KU1A 3SYAA 3MLUL 2EQDA 4Y2DD 4ZXBD 1VJSA 3TN0D 4PJ8D 4ELDA 2WYHA 1LK3L 1VZHA 2BOCB 3CUPA 3WJLC 3O0RL 2OQJB 4HPYL 2B3IA 5EFIA 3FOLB 4TTDD 4HSQA 5E1HB 1N5AB 3MI6A 1YY8B 3Q6FB 4LFHD 2GEQA 5FHAL 2PWHA 1PMYA 3CMGA 1TZAA 1WZLA 3FB7B 3WXVH 1H6FA 5BCAA 3SQOH 1KT2A 3PE9A 1PZAA 4R9HA 3IMWA 5D72H 3ZGHA 3E2HC 2ZX7A 1ZGLB 5K9OB 1M7IB 3GRWL 1CLZL 5JHBA 3QXUA 4R2GC 4TNWK 2MCAA 4WO0A 4NLAA 3VNZA 2WUBH 1JD7A 4D2NA 5CJ5A 5I6NA 4M7ZB 3GMRB 3WLWD 2AQQA 4FFWC 5I5MA 3DO3A 4FQIL 3H42L 4BDVB 4N3UA 1E90A 3NH7L 4GS7B 3S35H 4KRMB 1G7IB 3KPOA 1NBYA 3HC0B 4WFHE 1WS8A 1OM3L 1BJ8A 5AAMC 1CBVH 2YXFA 4Y16B 1T1WB 2QQLH 2WXOA 5HGAA 3WFBH 4DGYH 1QBML 2MKWA 4JUSA 4HCRA 2BNRD 1A25A 3C2SA 4OI7A 4DQAA 3HR5B 1XBDA 5E8EB 4BRJA 3FW6A 4M5TA 1VKXB 1T5KA 2MEJB 4GQ9L 4LP4A 2OZ4H 2RALA 4JJOA 4PJ9B 1VHPA 1FNGB 2BIHA 5E51A 2VUKA 3F2LA 3BX7C 5T5FL 4ZUVB 5EIIG 3QZPA 4NXKA 1KN2L 3LTVA 1AZZC 1SVBA 2VITA 4FQCH 4TRPL 4UOQA 4YNYB 3CZFB 4Y5YB 3ZL1A 2X4NA 2IEPA 4UILL 5J1AA 1AZRA 3GMRA 3NUKA 2DH2A 4PI2A 5IBTL 4YXLL 3JTBA 2V2WA 2VL5A 4Z7QF 2OSXA 2VDPH 3VMPA 3TCLB 1VPOL 4X7CC 1MFEL 4WJ5A 5EF1A 1NEZG 2WN2A 2X0UA 4MAZA 3QJSB 5FM4A 3B34A 4JG0H 4HF5L 2ESVE 4FI6A 4BV1A 3BP6B 2OW7A 1X5MA 2WWKT 4X98A 4RAVB 3DLQR 4G6MH 4PLJD 1IGFH 5SWZA 1NFAA 4RMRA 2GT9A 2IADA 1TZHA 2YA2A 1FC2D 1F86A 3EJQA 4WWNA 1JERA 2VT0A 5D1XD 1IEBA 4P57A 3C87A 4ECNA 3I50L 1FN4B 3PG2A 5B8CA 2YR3A 4HOXA 1RFDL 2EKSA 2AV1B 4XVTH 2PP7A 3L2MA 1BXUA 4LP8A 4PWEA 4Y2NA 3TV3H 5T1LB 3TWYA 4OI8A 5JHDD 4WFGD 3ESUF 4X5XA 1E9PA 4OZ4A 3TZVD 3UCQA 5IB4B 3OHXA 3WU1A 4OSUH 3SGKC 2OV0A 4AM0Q 1P4LB 4NZUH 2PW1B 2EIZA 5GS2D 1QHOA 5J1AB 4OCNC 3MXWH 4LRNL 3HHRB 1YEDA 1MCWM 5FIEA 1CLVA 2VW6A 1JI2A 1MAMH 2ZUVA 4DKEL 1NBCA 1ZTXE 4JPQA 4P9ML 1RL1A 3B7TA 3VFRA 1OM9A 3EFOA 2OTWB 4N22A 3DIVA 2ICWA 4Z7NE 2ZXGA 3EO9H 4KJWD 2F19L 4DKAA 5CSBA 3RI5F 2QHLA 3NJVA 1RZFH 1T7VA 4WAFA 5AOJA 3T04D 4Z7IA 1TTAA 3B8SA 3MV9B 3EYFB 1AYOA 2GTWA 1BWWA 1DQTA 1T03H 3V10A 3TO4A 2GJ6B 1TJIH 3MMEA 5T1LA 4HD9A 3V8OA 1QWHA 2MPAH 4FLRA 4F91B 4HJ0C 4DN3H 1K3IA 3GMNA 4G3YL 1IAMA 3QFJE 1UD5A 3RX7A 4ZS7L 4MX7A 3BD4A 3MGTA 2XTLA 2J21A 4XHJD 1LEKB 1R5VB 3F7QA 1AE6L 3T4YB 3NACL 1T21B 4NN7C 4UQ9A 4X9FA 3N0PB 5EUOA 1WPCA 1C5CH 3FUIA 3JWDL 3UBXG 2CGZA 3VGGA 4IOFC 5CSZB 1OCCB 5EHFA 3SGDI 5FYLE 1UM4L 1Q9LB 1X7TA 1IJ9A 2D73A 2VDKH 4CU7A 3U7YL 2CLVA 2Q76B 2BY1A 3GMLA 3RGVC 3STZA 2E9BA 5AKTA 3TPUB 3NRQA 5E1IA 3REWA 5I0WA 4MXWH 1E5AA 1J48A 1AO7D 5ITFA 1BFTA 2LOEA 1BPVA 5E9NA 1MNNA 3FMGL 1WCBA 1KCUH 5FOBA 4JDEA 4XNYH 3D33A 3PL6B 3B9AA 4GIOA 4DNLA 4NZTH 2VMEA 3PWVA 3QCTH 2W9DH 2DBJA 3NESA 2DMBA 5EG6C 4EXPX 4C56A 3OR7A 4WU5A 1W8NA 2E7LA 1KOAA 2E9JA 4IK6A 1IGJA 3ASOB 4P4RA 4HLJA 2V17L 4R4ND 2DWEA 2BVPB 1RZ7L 5HYQA 3HUJE 4MSWA 3IJYB 1YEIH 1WWBX 3BEWA 5DZ9A 4J7RA 3B2DC 5EUOF 4RVBA 4NNPL 1CFSB 1I1FB 2OMVA 1MLBA 1I9EA 3HEIB 1LWRA 4K15A 2MCPH 4JZJC 4KK5D 2NCEA 2K1MA 2LT9A 2HVKB 2YSSA 4MQXD 4Z8FH 4P5MB 2VDPB 1PJ9A 4YXKL 4UU9A 4W9KC 1IC4H 1G6RH 4WWPA 3FB6B 2W65A 3RA7L 5KTEL 5JO5A 3FUJA 1QRND 1SBBA 4KV5F 1DJIA 2UZIH 2UY6A 1VIWA 3IU3B 1IX2A 4PJIE 5DEJA 1UH4A 5INDA 1CE1L 2ZXDA 5GS0H 3OLDA 1CICA 2X41A 4CVXA 2NY0C 2DL2A 1WJ3A 5FHBL 1HKLH 1GGBL 1A4BA 2GITA 4GUOA 4P2RA 5E6IB 4W9JC 2HZHA 3GRWA 2V33A 3FOLA 1BJ1H 5IW3A 4CBZA 5AWNL 1HINH 2VC2B 1H6TA 1MOEA 3DO7A 1UB5A 1NGQH 1XAKA 2W60A 5AZ2H 2BO0A 1DQJA 1A1MB 3WIFB 2E7BA 3FTUA 2BZDA 5D5MB 2ZNWA 5C0AD 3JWOL 3SIKA 5FYJH 5I6PA 1DBJL 1NCAL 4Y2OA 5I8CA 3WV0A 1EXHA 3LZQA 1OCRB 4LSRL 2WKOF 2NUTB 4N2AA 4PGCA 3EH1A 2OL3A 1J5OL 4RMTA 1NTDA 3QJTB 2B8OT 1OCWH 3MLZL 3MNVB 3GBLA 4HDIA 4Z7QB 4IMLB 3HE7C 1OD7A 4EUPA 4X4YA 1U3HB 2AP2A 4QXUH 5DHVH 2V5TA 3MRMA 2CDFA 2DLTA 3QWOA 3FU8A 1HHGB 3EJYD 3GMMA 3QIBD 2FCBA 1JPFA 1CG9B 3HE7D 2OCFD 3HS0B 4URKA 3QIWD 5D7IA 4ORGA 4OCYL 1E28B 1H3PL 1S7WA 1J1PL 1PIFA 2FJGB 2KBGA 5GZOD 1JPTH 2PYED 3DGGB 1NL0L 1FAKT 2AMUA 3OL2A 4XPGH 3CLEH 2WV3A 4LSTH 2R1YB 2RA1A 4XPHL 1PYWA 3TVMB 1KEGH 3TH3T 1T1YB 3BWUC 1TVHB 3VFVA 1CDUA 5BMFL 1SQ2N 1JFQL 3AXLA 3EUDA 1N59A 1QX1A 1WAEA 3U1QA 1C8PA 5I71C 4MVBC 2PTTB 1KGWA 3EHBD 5I8KH 1QAWA 3RZCA 3N04A 5HHNA 2APTA 3QDHA 5KSUA 1NCIA 1O7VA 2J4WL 4FFZL 3SY0B 4HS3A 5EU5A 4QHKJ 4M8UA 3DHPA 2FDBP 4NRYA 4JMXA 1EJ8A 2NXYB 1DSFH 3MZGB 3P54A 3OR7B 4HKBA 5TFSH 3MJ9H 1USZA 1Z66A 2IBZY 4Q8BA 43C9B 3QO1A 3PHAA 4IS6A 4XPTL 2IALA 3V7AG 4LKCB 2BXYA 4R5XA 1QFHA 1C7SA 4ZPVB 1L6ZA 5IQMA 4QWWD 4DPCX 2WXMA 2APWA 3NFSH 1IFGA 5JNYB 3GK8L 1JI1A 3T4AB 4D0CB 4HHAB 5HI4D 2NY2D 1N8ZA 1FE8L 1KIRA 1PU0A 2AJUH 2GI0A 5ANHA 3VE0B 3ZE0F 3CXFA 5E4EC 3SE6A 4C56B 3CFUA 2JB6A 3SPVB 2VAJA 2V7NA 3AY4A 3N9GL 1GMEA 4KKZA 4W6WB 4JFQB 1QR4A 4QXTA 3DHUA 3E2HB 3Q8EA 5IMLA 2MIZA 4UQBA 3S4SG 1KIQA 5DVLA 1FJ1A 1F6FB 3VX0A 3L6FB 4RSVA 3NIFE 4AT6B 4KKLC 5ALCH 4EPSA 4IMKC 4A1RA 5T1KA 4DFIA 5D2LB 2IADB 2ZYSA 1Z5YD 2RFXA 5C0GB 4PS7A 1UWGL 3NPSC 1JK9A 1CXEA 4TM9A 4D0BA 1N0XL 5ISZE 1XEDA 3EYFA 3QUZC 3LNEA 5KVFE 1TCRA 4FJ6A 5F7DA 5KG9B 2W9EL 5C08B 5HVHC 1G1OA 3N85L 4CU6A 4Z3FA 1J8HE 3DJTA 1HL9A 3JT2A 4XNUL 2VDOH 3ARYA 4YEEA 3LH9A 4K3GA 1HL8A 2YGNA 4OGYH 1BWMA 4MXVF 4P48A 2G3MA 1UD8A 2HJKA 4PS3A 1VESA 1KELL 5EU6A 5GRUH 3VXOA 1DN2A 2Z9TA 4WTXA 3DGCR 3PNWA 1GGCL 4XGZB 5JA8B 2E27H 3O81A 5JZ7D 3ARDD 2EXWD 2AJ3B 1TYEB 4GXUN 3IDIB 4H1LA 4K8RL 5DQJA 3DKHA 4LESA 3R8BB 3DX6B 4P2RD 4AQ1B 2FD6L 2YAPA 1UM6H 4LHJB 2AXFA 5D1XC 3W9EA 5HHOA 2HB0A 3NJIA 1BFVL 4NENB 4R7VA 1VF5C 4JZOB 3SN6N 3SGKA 1S8DA 2GT9B 1KXTB 4R26L 3DA0A 2WWOA 1P84J 1U42A 1W72L 1O75A 4NKDA 5F3BA 1BOYA 2VLRD 5E2UL 4UT6L 3E6FA 4NB7A 5DHDA 1RD6A 1WK0A 1A6ZA 5K9JH 5CO1A 1H3VA 1UA7A 1EGJA 3HS0A 2EO7A 3DOSB 1T1ZA 1M3JA 1RZKL 1WBYA 1X4XA 2BHUA 1JNHB 3GIVB 4RGNE 3RGHA 5KSAA 1PDKA 2AZAA 2YRBA 4HUXA 6PCYA 3BP4A 1H5BB 3QP3A 2FEDD 3MGTB 2X10A 4W9ZA 3FBKA 1A4JB 3MTRA 3T2NL 4PWFA 3DMMC 4PJIF 1H19A 1KYUA 2DV6A 3CSTA 1S9VB 2VRQA 1N19A 4H0IA 1G7HB 4L29A 4HPOL 1HJBC 2JJTC 5C07A 4ADGA 1W0WA 5DO2D 3Q8CA 2EUZA 1MFCL 4Y2OB 5I8CB 2J5LC 4HVBA 2A5UA 1JCVA 2HCZX 1DQMH 2A9ML 2P9RA 4JL1A 4OZIA 3D07A 4JY4A 4Q58C 1ACYL 1CF8L 3NOIA 2DQDL 3VXUD 2Q0ZX 4OF7A 1WZMA 1KPUB 3PABA 5KS9B 2CR6A 4WV1B 2A3TA 4FXGA 3HBGA 3MACL 2BNUB 2WWNA 2KQMA 1OCOB 1WBZB 3B7UX 4OQ1A 3HI5H 2FYYB 2X89A 5IHUL 3P73B 2I24N 4F37F 4CRPA 4NKIH 3ECWA 5B7FA 3FFDA 1GIGH 2QADD 2QSQA 3IF1B 4OGXL 4XC3H 3GSWA 4XCNA 2EDDA 2NDFA 1F6AA 2C9VA 5CCKH 3QR2A 1R3LA 2B0SH 3G5VA 3MO1B 4MJIE 3LNGA 1RUPL 3FRUA 1SEBB 4AZ8A 1R24A 3OMNB 1CUOA 4TNVF 1YJDC 1ETJA 3LRKA 3FQTB 2WMPB 1ASPA 2H1LM 4PJBF 4MMZC 3UTOA 1KFGA 3MUJA 4KVNL 1OL0A 3ARBC 4P46B 2HRGA 1IAIH 2IPUK 3FT9A 3AT9A 3FONA 1CXIA 1S7TB 5HHQB 3PWPA 3H9ZA 5EULV 5JQ6H 1SRDA 3CVIH 2BY3A 2XG4B 1THAA 3A4DA 3MLVL 4AEIL 5C0JB 5DJ0A 4ZO6A 2QELA 1XL6A 3FO9A 3AG4B 3K1DA 3OKNA 1BF5A 2C3HA 2R9HD 1NCAH 4IGBD 3PUCA 5FX3A 3CC5B 4BKLB 1ZLWK 2G2PA 2DM7A 2E9WA 2GIYA 2K78A 4J4PD 1LNUA 2ITDA 2K6ZA 2Y24A 2JLPA 1AR1D 3QNXA 4N2MA 2GJRA 4N8VG 1MHHA 1HEHC 1UGKA 1YEJL 2WLIB 4APQD 5GRVL 3G5ZB 2UZYA 5H4ZA 2HN7B 2VH5H 5BUPA 5LDUA 1NSNL 2QTVA 4V33A 3M1BA 4R2GD 1KJ3L 1MVYA 3ZKNC 4RQQB 4AC4A 5I6XB 1N5YH 3RTQA 3FUNA 4PJBA 4F7TA 3EDJA 3GKWL 3QUYC 1OSEA 1V5JA 2JLLA 3P0VL 5C0CB 3EOAB 2X4RA 4PBVC 4E5XB 5D71L 4RAUB 2LFEA 2ATKB 4K73A 1I7ZB 5F1KC 1CIDA 2E9GA 2HFFB 3HNVL 5C0AE 1I9IH 3DV6B 4JN1H 2E59A 3MV8D 2YD7A 2O6PA 1LO0L 4HD5A 1YEFH 3HE6C 1MCKA 1JFQH 4P5KB 1JD9A 2I7SA 1JYVA 2FJGA 1QBAA 4BQ8A 1A0QL 4G9DA 4KMTH 4X5RA 4PRBB 4ODUB 1YEKH 2ADJA 2VIRB 4L1BA 1CD9B 5IB5B 3U2IA 4JBSA 5JHLH 4MXQC 3D85B 3BWSA 5ESQB 4L1DA 3SOBL 2X1WL 3TM6A 3IXTB 1KY7A 1NMCB 2ZUSA 2D3VA 3QNZB 1QSZA 4XPBL 4LCYA 3IVKA 4PJDA 4ANVA 3CVHA 4BYHA 2EDEA 5EOQH 3WYRA 5LHDA 4J3WA 1OPOA 4M6MH 2W0PA 1GVIA 2GCYA 1OHQA 2E4FA 1MVFA 1LXMA 1EBAA 4FHJA 1LEGA 1OCZB 5E5LA 4KROD 3KS0H 1KMGA 1A22B 1YHPA 2A1WH 5T1MA 5CP3A 2JELH 1YC8A 1IE5A 4YBLC 5C7ZA 4HZ1A 1IC0A 3K2MC 5I1DB 1BX2A 2YJLA 3EBIA 4WWKA 3KMDA 4HQQH 2PO6D 1R19A 1INDH 2WJ7A 5LG1A 4JRYA 3VXSE 4HMEA 4XCNB 3S97C 4NRXB 4ZI8A 3NP4A 4G82A 4R7DA 3DK2A 2C8NA 3U36A 4IOIA 2QSCH 3OC5A 3JBG7 5D72L 4L1SA 4RFOL 1TXKA 4UOZA 4V1DE 1UASA 4UQ2B 2AXGA 5TPWH 2WMPA 2BNUA 3VFUA 4BFIB 4H0HB 1Z9PA 1AOHA 2JQZA 5KANG 1QQDA 4HA1A 3V5HA 5GXBB 4NQVB 2FNBA 4F20A 2F8XC 1XT5A 3CFEB 1IARB 3VA6A 1HI6B 3BE1L 1UWYA 4ZOBA 5D1ZB 4HKJA 3FS9A 4F37K 4UT6A 5I17B 3MRDA 3NDZE 3ULVL 4B9IA 1ZT1B 4LSPH 1A14H 2C9PA 1XCQB 2IQ9L 3L1EA 3WFHA 1KXTA 4Y4KB 1G7MB 1PX8A 2Q7NA 3WDIA 4UWQB 4ODVL 3R19A 1U91A 3NZHL 4XNUH 3RAJL 4QOKD 4PJ5D 5CGYD 4QYOB 1XTMA 2Z7WA 3GZOA 1P1ZA 5IW1B 5FUCE 3LQAC 1AO7A 4NI3A 3CLFH 4OV6F 1Y18A 2GSIA 1FLTX 4AK2A 1CFVH 3KDMB 4ZFOL 3FFOA 1NAKL 3GGWA 4P2QB 4AK1A 12E8H 2BH0A 3NSJA 4YHOL 3T65B 2NNAA 2H6OA 2OA9A 2VDMH 5E9DA 3UAJA 4PJFB 2QFRA 4I77H 3VXOB 4AGLA 1VPOH 2VW4A 1P2CA 5ERWB 3UDWA 4FTVA 4ADJA 1BGXH 4EJ1C 3QHZH 4UQ3A 3ZY7A 1W2KT 5CJOH 1BFVH 4IU3A 5AAWC 2NXZD 5G2NA 4K3DH 3VI3B 1IGFL 2QJDA 3SD2A 3DJRA 5I15L 3P2DA 3HN5A 4ZDHB 1D5IL 2F61A 4IIQB 5LG6A 2QFPA 3V4UL 1XD1A 3L1FA 4WFED 1LO4H 4KO7A 2Z91B 1MCNA 4O5LH 3SB3A 4E9LA 5KVEH 3L3DA 3SCMC 3WIAA 2LR4A 4JPKL 4MRCA 3RUGA 3VSQA 2ESVA 4GQPH 1L7TL 3ZTDC 3ULUL 1TJHH 4RNRB 4XN2A 4JRYE 1ULVA 4FXGB 4IOFD 4B0MB 1Y6KR 2WZPA 1OF0A 1JPGB 3BPCA 4IEFA 1CGYA 2W0LA 4J6RL 3V4VB 2BOBB 1CQKA 5CM1A 1OKEA 2IVFC 3IMUA 4QHUA 1H8NA 5C0BA 2CLRB 3E1F1 2EVFA 3ZQ9A 2X4SA 2NY3C 4OI9A 4LSSH 3DDFA 3D4CA 4PHXA 2UYLB 5AUMB 3MNDA 4AKQA 2FIRT 2YPLD 4BXVA 3GBDA 1FIGL 5JIHA 2OL3B 1JZ5A 2FBJL 4XO8A 3H9SA 3S35L 4RAHA 1AZVA 3VRIA 2PETA 3HUJB 5IVXB 4IGBA 2R4RH 1TETH 4JM2C 2XG5B 1Y6NR 3T0BA 3CFQA 2E7MA 2L7UA 1AIFA 1RLWA 1ESOA 3AB0C 5E00B 3ZK0A 2WLLB 1NFDE 4JQVA 1TQCB 2YAQA 1S9XA 4MCZB 4YBQD 5DR5L 1IGCL 1OP5H 4BHUI 2BSTA 1RIUH 3EGSA 3IDGA 1N2RB 1I7ZA 4X9GA 4BFJA 2WSKA 1KCLA 2B0SL 2KUTA 3CHRA 1T5XA 2Q8BL 4I85A 3BI9X 1ZS2A 5FV2A 1B2YA 3MRHA 2DMCA 5F9WC 3AABA 3ZE2E 1DCEA 3GRBA 4C59B 3SDYH 4LBAA 1KULA 2G30A 1M53A 4NT6B 3LS4H 4NQEA 4HF5H 4HXAL 1E3XA 1TVBA 1MHEB 1T3FA 2FHBA 4E9YA 1YPZA 5LGJB 4DZ8A 2OAAA 1UD4A 4HT1L 1MH5B 4BZ1L 4QTIL 1G94A 2NR6D 4YGVB 4PRPA 3MRLA 1T4KB 2BWDA 1DJYA 2E7DA 3MOQA 4H25A 3EHBC 3BVXA 4M3HA 5J6GB 2EXYD 3NABH 5ITBH 3Q8FA 2YFOA 4PGCB 5JW3L 1JDAA 2DKUA 4PJXB 3J27A 2AS5M 4OQTA 3KPSD 2G3XA 4ODBD 1CXHA 5B1AB 4I88A 4DIXA 4H8WL 4M5ZL 3S6CA 3MJWA 1JTOA 4APXB 3L3GA 1NCGA 1F5WA 1R5WA 1U92B 2Z92B 3RDTB 1N5YL 1HNFA 3FQUB 1MW0A 3HS8A 4ANXA 3CZSA 1PGRB 3FUKA 4HU8A 1W16A 1INEH 1TT6A 2VQUA 1XAUA 2IH8A 3SJVE 2OTPA 1GJUA 4UQ3B 4HWEL 1H15A 1UYWH 4ZQKA 1I7TA 3BGAA 1UUNA 1E40A 3VVWA 1T1YA 5IB2A 3EYSL 3FU3A 4C54A 4RFNC 4OLUH 3BVUA 4I2XE 5E0QA 3ZKMC 5IM7A 2C9QA 2CQVA 4O2EB 4B96A 5EUOB 3PDOA 4XNXH 4OM0L 2GBUA 4H8QA 2IOOA 5ALBL 4NDMB 2AK4A 1S78D 2PR4L 4W9GC 2JXMA 3DURB 4CSPA 4HALA 4I4WA 3G9VA 3QUZA 4R0LB 1HC1A 1T5WA 4BSVA 5I0XA 2XQBL 1RZIA 3BAWA 4TVUA 4U05A 1DDHB 3VAEA 3N1MC 1U91B 4ATTA 5TQ0H 5JW4R 5GJSH 1QFUH 1LO2L 4MNQB 5ABDE 1YYCA 3BHBA 3VI3F 3C8KA 3HKZA 5JHAA 3CSYB 1F8TH 4GSRA 1WGOA 5DTFB 1WWAX 1B3IA 2P47B 3QYNA 2Z65C 3U9WA 1JF6A 1KB9K 4JDVB 2PLTA 1VERA 2X4OA 2DYPD 3HG1E 3QWRD 2WCSA 3NT0A 5K1JA 3VGFA 4K7FA 1HU8A 2P44B 4GBXA 5D7LE 2XG4A 1VFMA 2YN5A 5CCHE 3D18A 3ES6B 4M03A 2NY4C 4OLWH 1L9MA 2ROXA 3X11A 3VRJA 1MWOA 1YZZA 3AM8A 2V5RA 3QFJB 3CWGA 3IFNH 2DQCH 4X6CB 4HAGA 3W39A 4OB5L 5J3HD 1OP4A 1L7IH 2QSVA 4YUEL 1QOKA 2F53D 3HE6D 3H0TB 2J73A 1KIPB 4LBEB 4HGWB 5H37A 4JKLA 5HGHB 3D0LA 1N2RA 2BNQD 4PLKC 3ZMRA 4AYBA 3A22A 4F92B 2HFFA 3IRPX 3QFDB 1OZTG 3K91A 2VISA 4N2NA 4U49A 3GWJA 3QJOA 1AQDB 1D5RA 3NIGF 4KI1A 3D8MA 4GRLC 3MFFB 1BD2D 3WO3B 4PJ8A 5K1VA 1INQA 1AS7A 1RHFA 3O2VH 3GSNB 4M8RA 3U1PA 2GTWB 2ZKHH 1X5XA 3JWNC 4DOHB 1A8ZA 1G6VK 2Y2YA 2YPLA 3RKPA 2X9YA 3NH7H 1IGTB 4TN9A 1GZHA 3ATAA 3DUUB 1A4AA 5E9DE 3L5IA 3QDGB 2CIKA 1WH0A 4P8QA 4XCFL 4K2UL 5GZOA 1WUZA 2FQGA 1MLCB 3RA7H 4ZTOL 3PP3K 1HOEA 2QLYA 4ZYKB 1FVCB 3R1GL 2F5AL 5D70L 3ESPA 4N2BA 4TUJB 3EYUH 4U1HB 3VDBA 4YLQT 3V4VL 5EIQA 4IBTA 2FQFA 1ZLVH 5FA3A 2VZUA 4XZ4A 4KJQD 5C0BE 1NGYB 3STZB 2ROYA 4A2DA 5SV4A 1Y18B 2KKQA 1OP3H 1RHHB 2AK1L 4HYTB 5EOCJ 4KITB 5IMOB 1X5KA 5DD5H 5C07D 5JIQA 3QUMH 2F54A 2D7OA 4PJDB 5HPOA 2H3NA 1T21A 1HSAA 1PL3A 1JGEA 2VDML 1MFEH 3UTZA 2D7PA 2WBJA 2OMZB 3MRNA 4DH2A 2ZCHH 1NCOA 3GB7B 1EANA 2ZT9C 1U8MA 4NQED 5FC9A 3VI4A 3ABLB 5LXVA 5EZJB 5A6MA 5K93A 1L9NA 4OBRA 2VMDA 2PTVA 5I1EH 4JANA 4HUCA 1HI6A 4JFDB 3KLKA 4U0RB 1R3JA 1U93A 4KKBC 2FX9H 4IU3B 3QQ4B 4P5SA 4WO4A 5ICUA 3TBCA 1AY1H 1XH3A 3ZTNH 3NIGE 3O0LA 3N42F 3VRIB 3MJ9A 5I1GH 3FQYA 1J0IA 2Y0SA 4PREA 2QEJA 3QC5X 5SWQA 3H55A 4KRPB 4CKVX 1EFQA 4OGYL 3HRPA 4M62L 4Z7WA 1T20A 2WZAA 1PZ5B 5AOMA 3TX4A 2XA8L 5GRJH 1PNCA 4B41A 3MGOB 3H9HA 4HUNB 1JPTL 3MGAA 4X5WB 3D39A 1WO2A 2FRGP 5CJBA 5DEZA 2GBAA 1NKOA 1FZKB 4Y4HD 1IAOB 3CSBA 4Y16A 3ZDYE 5ADPH 1MRFL 2P80D 1PLBA 3CN1A 4XBPA 2RCSL 4I9XA 3ASNB 4L4VD 3VI3E 2WTPA 1WZ1H 3J2PA 2VR9A 4EO5A 4LGSB 2BERA 3QDJE 4QR7A 5DVKA 4DAGH 2CUHA 2ED7A 5HHOE 5FCSH 1K4DB 2D7TH 2J72A 3NPZB 2PN5A 5C2UB 3FDWA 4GIPD 1JCKA 1UEMA 5GS1A 4R4NC 2DJUA 3RVTC 1DR9A 1OAUL 4AZUA 4G3YH 4OGQC 3RVXD 3FUFA 4S1RL 2L04A 3MLSH 3EJUA 3KLQA 3MLUH 3QXAA 4Y9EA 4WJ5B 5K9JL 3F62A 4O02L 3CVBA 5IF0A 2ZSVA 1CR9H 3BDBA 4NO3A 1NCWH 2VDNB 3U1SL 4QHKI 3QJQB 4AT6A 3CUPB 2PXYD 1MLBB 3NTCL 4XNZB 1HIML 1NPUA 3ALWA 4OIFA 4EN2A 3K81A 1YMHB 3QS2A 2NNCA 2NYZA 5HD8D 4PH8A 2N56A 3NCWA 3M1OA 4FG6D 2F58L 5AAMA 2VDLH 3VXPA 1A6UL 1OT2A 4WW2B 5IBTH 2X3CA 3RTLA 1WFOA 2V7NB 1BVNT 4Q4IA 4OLVH 4OZGF 4PSRA 5LWYL 4NHCL 2EC9U 1IKNA 4F27A 4WHTB 4PRIB 1U95A 3II3A 5AG8A 1FIEA 3QCUL 4PVLA 1IO4C 4Q9RL 2PYEB 1DBKH 2ENJA 4I0PA 3TBVA 2QSTA 3LS4L 2J88L 5EO1A 1YAIA 3QHTC 3V0DA 5EO0A 1KJVB 3WMSA 1UXSB 3DARA 2GBVA 4TTDC 4OH2A 5I6KA 2F1EA 3FHEA 1JWMB 3H6JA 2HJKB 2OMTA 2FX7H 4ONHB 4R5VA 5I75C 2XI9A 1HAUA 4UDTB 4TSBH 3CFKB 3T0EE 1FGNL 5E8DH 1ZDQA 2DOCA 4NO3B 4NJAH 3DURA 5D5MA 2EECA 3X1GA 1N9PA 4N90E 5HVWA 1N6UA 3UJJL 1KLGB 2COQA 4IIZA 4GQ9H 1T4WA 4ELME 1BFOA 4F58L 1R75A 5EH1A 2FX8L 3B2XA 4G8GD 4WWKD 4G1EB 4GT0A 5HGHA 3CJJA 5GRUL 2VSKB 4HIJA 3UBXI 4JRYD 4YC2C 4LFHG 5SWSB 3BZEA 3T4AC 1YQVL 4Y5VC 5C0CA 4X8XA 3RIKA 3VXSD 2YEVB 5IT2H 2XWZA 1OGAA 5J56B 1NCNA 4UYQA 2ENSA 5DXWA 1ZRUA 1VA9A 4N5UA 2B5IB 1QHPA 1GGBH 2ISDA 4ABQA 5IR1B 1A6ZB 1KTDA 3UAJC 4JO3L 1MY7A 1JPST 2Q2EB 3Q3GA 3FQ2A 1ZJAA 3OHXC 4BSJA 3PUUA 2JK5B 4PD4K 3VG9C 1S7XB 4CJ1A 2Z93A 1U4EA 2E74C 4L8SC 4Q56A 3EZJB 3KPSE 4TLTA 3ARGC 1E9QB 4KROC 2E6JA 1B2WL 4KDTC 5LBVA 3QORC 2QT6A 2WZ6A 2E9IA 1U8JB 5D1ZD 1NIBA 2Q1EA 3FTZA 4AVKA 1PQZB 2JXMB 2OMWA 1IBGL 3W57A 2F7OA 5FECB 4XMKL 2QQNH 1WTGT 1U3ZA 1YEJH 2QR0B 5HHQA 5ICZA 3LQAH 4X6BB 2J44A 2CAKA 4OFPA 5FLVA 5GSVB 1E6OH 2WVTA 3PGCA 1J1XH 3LIUA 3S96A 4GUPB 1EFXD 3HG2A 4ONFL 5E2JA 1EHLH 1WFTA 1KJ2H 1HHJB 4WIQA 4BWWA 1KCVL 5BUAA 2DQCL 2R0ZH 1KBBA 1KV7A 1MG3C 1KIPA 1IGML 4LBEA 2BVTA 3LRLA 3RX5A 4KAQH 4MDJA 3ARXA 1JWUA 1U4FA 2F8VA 2ZONA 2L8AA 3X13B 1DSWA 2DTML 2FNWA 1YC7A 2I60H 4PGBA 1TZGL 2WKGA 3EGXA 4QRQB 5DJZB 3WNPA 3L9YA 4DSYA 2P80A 1U21A 4QRPB 4U7KA 3LZFL 3FB7A 3U9UA 4F2EA 1TEGA 3UTPE 5I18H 1S3KL 3UTSB 1F3DH 2WQVA 3JWNG 3L1OL 5KSBB 5I28A 2ZKHL 4XN7A 3PFQA 5AVZB 3QFDA 1MFDH 4A7GF 3BAIA 5A7EA 3Q13A 2OMZA 5EBLB 3GINA 2JKRM 1AVAA 5E1AB 4JM0A 4X7SH 3SGEH 1TCMA 1I7UA 4IBQA 1ID2A 4KKBD 1KXVA 2P5EE 5CJQH 2HPTA 3ZPDA 1UVQA 3P3YA 4KVCL 4Z8FL 2P5EB 5CFHA 1GIGL 3V6ZB 5F8QC 2QPUA 4Q9CA 4E9TA 3E6HA 3VG0H 4NKOB 1NOAA 4JFXB 4K7FB 3LZNA 5F7KC 2JCCB 3TA4D 3RGBA 4PPTA 1U3NA 3OG6B 1KG0A 1AJ7H 1COBA 1D2PA 5FA3B 4ATWA 1WC7A 5I19L 1SHWA 4GAFB 4JPWL 3HI6H 1CVRA 4AH2A 1CICD 3ARGA 1EO5A 1CTMA 4OKVA 4LEXL 4ZW3A 1SMDA 1JZ6A 4D0DB 4DGVH 2BP5M 1ROCA 5ITFB 3MRQA 3P3UA 4Y5XC 4ISVA 4J6IA 3HG1A 5FFOA 1T6VN 3MV7E 4RFOH 2FJUB 4ALAL 4HWZB 1PZDA 2V5MA 5HHPB 1O9VA 2HLFD 3PQYB 4ZZFA 1BLNA 5AZEL 5JOFA 4AI7A 4ZBJA 4M4RB 3ULUC 4IBLT 1CGTA 1EJFA 3MLYH 3FYIB 1ZGLM 1BBDH 2D31A 4IIQA 4M3JA 1YPZE 2GJZB 4WNQB 1ICTA 3D08A 4HK3J 2X9XA 3ILDA 2DIJA 1IT9L 4GAAA 4YDMA 4G1EA 3TZVB 4ZQTA 3BRDA 1AS6A 1SMOA 5IW6A 2D8KA 4JM2B 3RNQB 2GTQA 3QDMA 3V6OC 3N41F 1MHHB 2M26A 2MOQA 3TVMA 3N85H 5DRXB 3WLBB 2CJTA 4PW4A 2R56H 5GHWL 4OKVB 3C9NB 3WEBA 2CCWA 3SJVD 4UIKH 4FYRA 1J5DA 4KNSA 5A2LH 1OAXH 1G7LA 3FQWA 5CP3H 1KLFB 2H26B 3I6GA 5HD8C 4GAJL 1UQSB 3ARTA 4OR1A 5MEND 4KQ0A 3HB3B 3EJSA 4M5YH 3SBQA 3TJPA 2XJKA 2E75C 1BQLL 3M1CA 3S5YA 2BHFA 1A1NA 3VB9A 4BA0A 4A67A 4K55A 4NQXA 4U3CA 2ZCLH 2NTFA 5H4YA 1UM6L 5EDSA 3GRGA 4WSJA 3B1UA 4EI5B 1NEPA 3ZE1F 3SOBH 4ZW6A 3GD1C 2W5PA 4ZDHA 1L9RA 4NQDA 4PW9A 2R23A 4QAWA 4Z5RB 3LPFA 3F7YA 1KFAH 4JGJA 5CILL 1MCDA 4NC1C 2H0PA 3FBQA 2A6JA 1LO4L 1YUKB 5AW7B 1UZ8A 1RK0A 5H35B 1Z5LB 3LKOA 3WUWG 5T3XH 5ERWA 1LMIA 4F5CA 1E5CA 4G7QB 3EZ8A 4NO0D 4UANA 2BX5A 1GXEA 4XCYB 2KMWA 2NR6A 4RWHA 3MXWL 3RTQB 2D2CC 3O45B 4PP2A 3NJLA 4EUPG 4WO4C 4DP1X 1EERB 2R29A 1J1PH 3ROLB 2H9GA 2WAQA 2QGEA 3SBWA 3PPEA 2P42B 4DKEH 2KZ1B 1EAQA 1LD9A 4YHPB 4YK4B 4AYSA 5AD0B 1X5HA 1R46A 5BMFH 5FO9B 5ISZB 3VDAA 2ZXWB 4XMWA 2CXGA 4Y9FA 2LHAA 4POZC 1OSYA 9PCYA 1D5BA 4N0UE 3ARGB 4TQEL 2CA4A 1U8JA 2CUIA 2DD8L 2WNKA 3BKYL 4JKMA 4X4KA 4KMLB 4P49A 4S1DC 4ES9A 1J9SA 4KTEL 5KVFH 2VJ0A 4ANKA 2VMCA 4G8IB 4WHTA 3GMPA 3SPCA 5IUSA 1KZYA 1Q0XH 5I30L 5D1ZA 1OM3H 4PJ5E 1HKFA 2D03H 4AVIA 4OKDA 4ZXBB 1TETL 4NPKA 1ZLSH 3P4OB 4FXGC 4NJAL 3CAFA 4LCCB 3ZL2A 2H7WA 4CMMB 3TFKC 1IEAB 1NAMB 2IBGA 1RCYA 2ZUWA 3ZJAA 3PCYA 1JHTB 4P57B 2YAEA 2IH3B 2XLLA 2Y5TA 3QZBA 4GFTB 5C0AA 4AQAB 3HLKA 2YSTA 3BFQG 3UGUA 5C07E 4ZS6C 2Q3ZA 5GZOC 2AVFA 4MJIB 4PV1C 2CU9A 2WLNA 1MREL 2CBQA 5TDPA 3OQ3B 1GGCH 4XMLL 3K6OA 4X6BA 4FNSA 4U6HA 3BZFB 3D69B 1I85A 4OFVA 2HJFA 1WF5A 2DQTH 1AXTH 1HHGA 2LU7A 2A6IA 3UPAA 3LPPA 1MFBL 4LCWE 5HJDA 4IRJB 4J3VA 4QXGH 1OTUC 5D7SH 1D7BA 2GG1A 4OIIL 1AHWC 4U1MA 5DFTA 3C08L 1LO5B 2NY6B 4Q9QL 4X8CA 3PAZA 4UV7H 4UT9H 2WQAA 1IB5A 3UCRA 3RWIB 2FQEA 2Y7LA 1EEUA 1TUPA 4EDXB 1N0XH 2XBTA 4OUUB 4QRAA 2J12B 5CNHA 3MRDB 3VCLB 1M71A 5EC1B 3BKJL 2V5YA 2FEEL 2YRLA 3O6KL 3TT3H 3B7RL 1RZKH 4U1GB 5M95B 1M6UA 4WK2B 3G6JA 2Y7NA 4ZFGL 4BFIA 5BV7L 1I7UB 4X4ME 3WTSA 1YLBB 2FSEA 5EO9B 3VFOB 3Q43A 4JO5A 3CQQA 4TUKH 4LMQI 4NWUH 3GJFK 4LXFA 1KJ2L 4RGNB 1AAJA 4PJEF 5E6UB 4G5ZH 5FGCE 2A77L 5TD4A 3RVUC 3BFOA 5E0FA 4PJDE 5DA4A 3B56A 3OJVC 2X0WA 5EUKB 3AWFA 1NLDH 3IEAA 4QRQA 1JPFB 5DJZA 4MNQD 2H3XC 3P30H 1TZGH 5I6OA 2R2EB 2L7QA 4JKWA 4XNMA 3UPRA 2C1OA 1XHHA 3VSUA 3ILQD 3H9SB 2P8PA 2MPAL 4NNYA 3SO3C 1ZHNB 3P9MB 2NXYD 3L2NA 3O6FA 3JWOH 3P40A 4Y4HA 5D1QD 5ID1A 4DN3L 2WYZA 3VGEA 4X6DA 4WVRA 1G1KA 4BE5A 2P48B 2NNAB 3P0YL 5TGBA 3NFPA 3ZYJA 4NWTH 5HY9B 3K46A 3FJTA 3DX9B 3VFSA 1JNJA 5T33H 1U2YA 3BIKB 5FECA 5IMKB 4OQTH 5HJBA 3IM1A 2EDNA 2YBGA 3L3JA 3MGOA 2CM6A 4U7MA 5BO0D 3FZUD 3KPQB 4JCMA 3U7YH 1A4KA 3T3MB 3GNMH 1LP9F 4PJEA 3MJ8B 3ARRA 1MFAL 4C56D 2W59A 4OZHA 3D39D 3OB0H 3ARFC 3HI6L 4TNGA 1E43A 1JZ2A 2PPAA 2P5WA 3EFFB 4AJ0A 2CR0A 4CVZA 4CDHA 3JYCA 1MIEL 4TVPH 4XNMB 4WFFE 1ZSDA 2O5ZL 3SDYL 3BUDA 4CBPA 3H54A 1V05A 1KEGL 5A6LA 3EH5B 1L4IA 3BCFA 3EGXB 3MREA 1ZANH 2CLZA 2NX5E 2A9MH 4L18A 4NN5B 2A6DB 1JTTA 2BPBA 2XWJA 4RQQA 5AZEH 4C57C 2V17H 2V2WB 3MXVH 2G4EA 5DC2A 3SD5A 2ZICA 3HAEA 4G42A 2V7HA 2BNQE 4XO4A 4A6YH 4GRWE 5FYJD 5C70A 1HHJA 3NZ8A 4HJ0D 4LLMA 1YEHL 2CHWA 4ZMVA 3KCPA 3EOBA 3GUTA 5F8RC 5AVYB 3H0TA 3GLDA 4P59L 1OF2A 3OGCB 3IDXH 3BD5A 2VXQL 1ETZB 4X4XB 1ORQA 2BS9A 2DMHA 3V5DA 3GI8H 2QADC 2ZWZA 3JYBA 1CO1A 5I16A 1JHKH 3SKNB 5EBMA 4Y1AA 2OK0L 2BS8A 3ZU8A 2B1AH 4JFXA 4YHZL 3NZHH 3RAJH 3VCLA 4Z7VE 1XCTB 2GBTA 3V0JA 1N12A 3ZE0E 3L4WA 1HHKB 5IB5A 3E9UA 2EVJA 3CXHK 3N44B 1A6PA 4B50A 2CJ3A 3GJFA 1D5BB 2FWOA 4HKXB 3BVTA 1NCDH 5J12B 5CKGA 3RJQB 1YA5A 1RU9H 2QGBA 2LU4A 4HV8B 4LCYB 1JVLA 1TYJA 3IVKB 3GZKA 3VYNA 4AMXA 4G42B 2C1PB 4L9LB 4ONGH 4XH2B 4P9HL 4AM0A 1WD9A 4HSCX 3ROLA 3N06B 3F64A 5JOPE 3DTXB 2X4PA 4KK8C 3LYRA 4PIRF 3B3IB 2GJ6E 2XSKA 4OIBA 3IFPA 3GSOB 2Y25A 2NY1D 1BM3L 2A9AA 1SN5A 4QHLB 2BZCA 3TIEB 2H3KA 4QO1B 4NM8L 2I7OA 4LGPB 3FB6A 2Z7YA 4S1QL 8CGTA 4P23D 3PXHA 5JOEA 2AGJL 3KLSA 4NENA 2X88A 5CWSA 5AW4B 1G4MA 4UZUA 1IRAY 1SY6H 5IF0B 1JVOA 4JVWA 4Z0XA 2FWOB 1KENH 4HKXA 3WKPA 2AQSA 2YK1H 5FPIA 3SQRA 1RIVL 1Q72H 2J25A 3C12A 3M8OL 4O2FA 5DJ6B 5AVQB 2DQMA 4GI9A 2GC7C 2Z7UA 5TF0A 4L3CB 1J11A 1DCLA 5BRZD 5IEKA 1U8KA 4OCYH 2J1XA 3QZOA 1CI5A 1OW0A 1A6VH 2H41A 2CSPA 4FNRA 4K5NA 4PV8A 4E42A 2JSFA 1PSKL 1JRHL 1KCSH 3EF7A 1I9IL 3ETBF 1XDTT 3QRLA 3V0GA 2XKUA 3LN4B 3MJ8A 5ESAA 1HE8A 2K8QA 3LPGA 1QTPA 4Q0XH 3G6AA 1R6VA 1AQHA 2OSYA 1LGVA 1SYSA 4GKSA 4TLSA 4RA0C 2XA3A 4R83A 3Q8AA 3EFDL 2MNJB 2ZTBA 3CN4A 2CO3A 2LU3A 3SO3B 4I4WB 4R0LA 5DLLA 1JZGA 2FBJH 1WFJA 2JI3A 1EHAA 2ERJB 2Y22A 5LGHH 4C8XA 3HI1A 1N0LA 1GJIA 3X3GH 2D7TL 3BZ4B 4JVUA 3PWPB 2B1OA 2Z1PA 3MVSA 3PAYA 5L8LB 1ZOXA 4YHIB 3S88H 1G9NL 3FL7A 4GW4B 5GIRA 1VCBC 1E5UI 1G5AA 1FYTE 3ILPA 1W0YT 3QGVA 2TRYA 1TU2B 2X3BA 2N1KA 1Z5LA 3V0FA 1KIUA 2CMRH 2EDRA 2E3VA 5EN2A 1CR9L 3O4LB 5EZOH 2W95A 1XGUA 4JREC 1OTTD 2DQFA 4ODWA 3SDDD 2H32A 4M7KL 4L8BA 5MI0C 1F42A 3LXBA 4MAYB 3ARVA 3JWDC 3OKLA 3DETC 3T2OA 1WIUA 3ZE2B 4HUMB 4J4PA 4WNSA 1L9OA 1NOFA 2YO3A 5LCVH 2ZAIA 3IF1A 4M8VA 4KV5E 5IZ7A 3GXDA 5KVDE 5A16B 3PGDB 1JNLH 4PTUA 3D0LB 1J0YA 3CSYA 5DTFA 4AUUA 4CMHB 4TVSa 2Q9OA 1YUHB 5CBAB 2CUMA 1P2CB 4DUWA 4KHTL 3BIBX 2NDGA 4E0RB 4MZIA 3BEWB 1MFCH 2DY2A 5DFVD 4NX0A 3K2KA 1MJJA 5FDYA 2DEWX 2GSGB 3HVDA 3ZDXF 5I1AA 1B0IA 1V3LA 3MRJA 3GMPB 1RVFH 3QNYB 3WJJC 4LDCA 1HQ4A 3QPXL 5D4HA 4PS4L 1P4IL 2XXGA 5K33A 5E8OB 1AI1H 2YEZA 4ODUA 5F2FA 1GZPA 1LE9B 4GI6A 2EE3A 4PAZA 4ZS6D 4GMSH 4IJ3B 4PY7A 2FBOJ 3OMIB 2B2XL 4I5BB 5CLXA 4RBPH 5I1KL 2DYPB 2HTLC 3PWPD 2BP8B 4BQ6A 1ZT4A 2G5BA 4LL4A 1CYGA 3BN9D 2NY4B 4XVSH 1BYNA 4LLDA 1P7QA 5E6IA 1KNOB 4H8HA 3MAWA 5EO9A 2ETWA 1S78C 3E80A 3NA4A 4LNRB 2CDEB 3CDZA 1EX0A 2F15A 4UINH 2CLZB 1WBYB 4PJCE 4YXHH 1JBJA 3IFPB 2VN3A 5F9DC 1XXDC 4K8RH 4D8OA 3D18B 3ES6A 4AYFB 5JOFB 3V0HA 2WWMD 2E76C 5FFLA 2HFEA 1QLFB 1THCA 5KVMC 5D2LA 1OAYL 2YEQA 4IM8A 4NCC1 1DVYA 2R27A 1LDPH 2YUWA 1NOLA 2P5WB 3EFFA 4TMPA 1FO0H 3O11A 1AG0A 4JN2A 5FXCH 3WNKA 3U0WH 5L7XL 3TA3D 4HGWA 2F9BT 2CM5A 1BXAA 4GKLA 4HJJH 1BMWA 4H2AA 4H26A 3DV4A 1MCBA 1E42A 2VQ4A 2XWEA 1TSRA 5KEZA 4OJYA 1CFMA 4U6XB 5GSRA 2MCMA 2FLRT 4N0UA 4LCUB 2YPVA 3BAXA 5KZCB 2CDFB 3D3VE 1WZKA 4FHBD 4MA7H 3RDTD 1WA1X 4YFEA 2ITCB 1K8IA 1JYXA 4YO0A 1G6RA 1YNKH 3FO2B 3FT1A 2IBZX 3K0YA 1YEWA 5FGCB 4DT2A 1CYWA 4WCYH 1CGUA 4QRRA 1FHGA 4JO8A 4UTBL 3VD3A 1ZLDA 2B14A 5SWQB 3ZKQD 1OF2B 1G9MH 1EJOH 3OGCA 4IHOA 3B9VA 3QNZA 3N5AA 4HJEA 1OV8A 4HKZA 2YMOA 4IU2A 2XWTB 3WFHB 3S3JA 3GNML 2X2IA 1I8LC 1XIWB 2FJHB 2H0FA 2YPKB 5AKRA 2B16A 1UENA 3TIDB 3QCVL 3VWKB 2ARJQ 2CBMA 4AOFA 1KBVA 5LWYH 2EXWC 1DQJB 3G04B 3ARWA 3QPKA 2CUAA 4HS3B 4LSSL 3MHZA 5CFAA 4M1GL 1F4WL 3HRZB 1W6WA 1PW3A 5IVZA 3FNKA 3UZEC 4R97B 1JPSH 1ZA6B 2GITB 4HPHA 1I1AB 4EQ3A 4JFZL 4Y4FA 2A6JB 4GH7B 1YEKL 4IOIB 4KOCA 1KPRA 1MCPH 1NUGA 4XXWC 3MOBH 3NABL 2BSED 1P69B 5AAPA 2AEWA 4FTVB 3P4NB 2LLNA 1X9UA 3DHJA 1CL7H 2WYTA 2NUPB 3VQLA 2OXHA 4PLNC 3VYPA 4QJ5B 1AQMA 1OHZA 3ZN6A 1WVZA 4DP6X 1RAMA 5F89A 2D7QA 2GFBA 4DUXA 4H8WH 4KY2A 5HP5A 3V6ZA 3M46A 2EO1A 3WFCL 5JPNA 3W5NA 4KTGA 3NA9H 3NJXA 3INOA 1AKJB 4HS6A 5ILTH 3T3MF 1T0PB 1SXAA 4QF1A 4P5TA 1AD9A 1M2VA 2A4ZA 3EYUL 2IGFH 1XCXA 3DYMA 2OP4L 3DROA 6PAZA 2WW8A 1BCIA 5I5IA 1HILA 3WEAA 4F7CA 3ARFB 1ORSB 4PREB 4XO9A 1N4XL 1AHMA 2FTAA 4H88H 1BVLA 3EOTL 1ZA6A 3O9WD 1I1AC 1QNIA 2FT7A 4AIOA 4YBQC 2X4TA 3HHMA 5DEFA 2OR7A 3IDYB 2V2XA 1M7DA 2IOIA 3N6YA 2BOBA 1GY1A 4NRYB 1AYRA 1NBYB 3HC0A 4X6CF 4DPRA 3PQYA 1E4XH 3RL1A 1OAKH 3GHEH 4ZMOA 2J20A 2IFFH 3NJHA 5T8IA 4NOBA 3IAQA 3S36L 3QQ3B 3FQXB 3BUQA 3UYRH 1N7MH 4RX4A 5C0EA 4EF3A 2WJ5A 3F6IA 3IGAB 5EORL 2NW2B 4BINA 2XICA 1B4TA 1F6AB 2FEEI 3SPHA 3ZOAA 1ID5I 1QBLL 4M3KB 1FV1B 3NCJL 1FNEA 2RMNA 3TESA 5CUSL 4B60A 2FK9A 2QR0A 2LFGA 3QWRA 5HHMD 3U7AA 4JG5A 1I75A 3N0AA 3U82B 3WXWH 1OE1A 5AOZA 4WU5B 3QDGD 5AYQA 3RWDB 2R7EB 5I5RA 2EDTA 4AGOA 4HWBA 3CTTA 3FH5A 1MCJA 5D93C 2XA8H 5FUCC 3JWOC 4GINA 3DVGB 4KK8D 3KLHC 1YN6B 1OTSD 3OXRA 4U6YA 4ABUA 1VCAA 1WFMA 1XR9A 5AD0A 3PY9A 5I6LA 3BUIA 2CIKB 1CFNA 3ZZSA 4OT1L 2DWDB 3IMRA 3QIWC 3KYAA 3Q3GB 3L4CA 3O2VL 5DJDB 3OD3A 1E30A 3ZRCC 4IKLA 4NKOA 4N0UB 1X6NA 3IS0X 1MCWW 1WZ1L 2Z91A 1M6OA 4PY8J 1BP3B 4ZRGA 3HE6B 4O51A 4PBDA 3FU9A 2BW5A 4YQXH 2OPCA 4HOWA 4H40A 4E0RA 4K3DL 3A6BL 1UC6A 4IJ3C 4LNVA 1L0PA 2ICWJ 4Q6KA 5A2AA 5TQ0L 2EDLA 2CO1A 4PJ8C 3KXFE 4G8EB 3Q2CA 3V4UH 1KYOJ 4E36A 1H6EA 2O5YL 4OAWB 4UV4H 1CCZA 4JM4H 1N10A 1JF1B 3RUGF 4N2FA 3ZHNA 3CMOH 5DD6A 2V3EA 2H1XA 4PB9H 5HI4C 3M88A 1RULH 5D4QA 4J2XA 4RBPK 1M9WA 5F7AA 4DWHA 1NM9A 5HVGB 1N3NB 4AG4L 4V2CB 2D4FA 4PWJA 2SEBB 1QA9A 5KBNC 5TE6L 5K39A 5BNXD 3H4HA 4MD0A 4W6XB 4XPAH 2G2RA 2QKIA 3R8QA 2JKJA 5EPMB 1HXYA 3ZE1B 4PJ9A 1Y1UA 4BCXA 1P4UA 4OZFB 1MXDA 5EEUA 1SEQL 1JYWA 2OMUB 4KHTH 2R0LH 4KJPC 1OY3B 2QKSA 2J88H 3MRBB 1PFOA 1C08B 4UZSA 4CC4A 4ZTEA 5TGBB 4UZGA 1KTDB 2KYIA 4IRZL 5CLWA 3MBED 4U4BA 4XN4A 5CMAA 5F0LB 5TH2B 1XFPA 1G7IA 5DJAA 2YPVL 5I0DA 3VM7A 3W0WD 5L4MA 4FTDA 3GXFA 4EIUA 3V79C 3ULVF 4LSPL 1DVFC 2R51A 1OXYA 3RNQA 3S37X 2ALAA 4G1MA 5HHXH 4G7VL 4KROB 3DBXA 3WKMH 4FOMA 3AG2B 3REWB 3OAWA 2EIZB 3KPSB 5KSAC 3STBA 3Q8BA 1TCRB 5F7DB 2NQDA 2C3WA 2H6UA 2OR8A 3E3QC 1TF4A 2ZOKA 3KJ4B 1XF2A 2EIBA 2PO6C 3VXNA 3HI1B 4B6ZA 1AZUA 3K7UA 2VSCA 1JGVH 1HOCB 5CEZL 1I8IB 1FG9C 1AFVL 1DANT 3RTQC 4OVUA 2J43A 1G5GA 3UO8B 1BQLH 1XGPB 3AS2A 3WN5B 2ICWB 3PV6B 5JXEA 1A1NB 3CZUB 4ZMAT 3ZSSA 3GTVA 4CGTA 1SHSA 4YHMH 5EZIH 4ZAKA 1KG0B 2YPLE 4YFDB 1XBRA 5I73B 2Z64C 1EMTH 2C5DC 1OE2A 1PLGH 3Q6FA 1REIA 5I16B 5D7LD 1VEMA 5GSRB 1FRGL 1V3JA 2BSDA 4NKQB 4WW2A 4DEPC 3GZQA 1IGIL 4RH4A 5CINL 5HI3C 4PRBA 1BMZA 1C16A 1AP2A 3QQ9C 2AQRA 3LMJH 3I3EA 4PCSA 4TYUA 1IBGH 1YUHA 5CBAA 3WIHA 2HMIC 3WUWB 4NAMA 1HHHA 3PDGA 1X5FA 2WZ5A 5IIEB 3OZ9H 3ZIYA 3RL2B 3MRFB 4MB5A 2CLVB 2Q76A 3GMLB 5BO1L 4LLUA 5EWIH 2I9LB 4QT5A 1AZCA 3VD5A 3FT2B 1S7TA 3DUHA 3GIZH 5CSZA 3CHPA 1QSEA 4HWEH 1DE4B 2WTRA 3PPSA 4XP5L 4XI5C 2EAEA 1EH9A 3I6KA 3KPMB 3FQXA 3T6ZA 3KBPA 1NUFA 4TUUA 4J5VA 2G5BB 3VFTA 1JHTA 3HKFA 1GGIH 4N1EA 5CLTA 3WEXA 4XCEA 5DD3H 4NRXA 4P2YA 2ITDB 5CJXC 4HEMA 1JWMA 5C0RL 3MMEB 5FM8A 2QQKH 4ETYA 1A1OB 1JNNH 2WVVA 4UT9A 5D7JC 5BOJA 4BZ2A 4UIMA 1M7DB 4GP4B 4Y19B 3VFMA 2K3HA 3AMLA 2UV3A 3CN2A 3L4TA 3LKNA 2AQPA 3LZOA 4LPVA 5AENA 1CICC 2XN2A 3FT4A 4B5EA 5D2LE 4H1LB 4N0CC 3RPKA 2VL5B 5CIPH 4O02H 3QW9A 5CJQL 3GQFA 4KZDL 5IESH 4F2ME 1RJLB 2X1OA 3C60A 4N2KA 1H3GA 2HKFL 1H8SA 3DVGA 1LNUB 4OCWH 4R90L 3X17A 4WHYH 4Y89A 5F0PB 4D9RD 4HBCL 4LLQA 2IGFL 3T8XA 2Q8BH 4AGMA 1F18A 2NQCA 4NP4L 3VXSA 5DUBA 4AL8C 3D87B 3VWJA 2WXKA 3TV8A 1N4XH 4POZD 2BIIA 3ZDYB 1JDDA 4LEOB 1DBML 2ADIB 4N9GB 4XWOC 3QCUH 3EH4B 1DO5A 1A3RL 3KJ6H 3M17B 4ZO8A 3QJUB 3VQ2C 1GTFA 1GZQA 1TVDA 1VRSA 3P4MB 4XXWA 5CZRA 3UTQA 1FFPA 3ARBD 3LEVL 4X7TA 1V7ML 2D9QB 5SWZB 3QS3A 5G55A 4EMZA 3MBXL 4JFVA 4OJDH 3SKMA 2CNYA 5A3IC 1SBSL 1VACA 2ED9A 3H53A 4ODSL 4X6DE 2G4GA 3MCKB 3P4LA 1A8JH 4U1NA 3TO2B 5E5MA 3G04A 2J8HA 3I02B 2G75B 3QG6B 1MAKA 4TPRH 3ETTA 3O2DL 1XSJA 1OB1B 1XB8A 4UB0L 3VD1A 1CGSL 1NCUA 5EEVA 3FTGB 1JHKL 3MRMB 1R1CA 1OSPL 1FNGA 2H3NB 1LLAA 2C9XA 2DI7A 1YQVH 4N87A 3PS6A 1I82A 4E41D 1H0DB 1PKQA 3QEQE 5TDNA 2IQAA 4K71C 4RMVA 3CQFA 1A6WL 4B7IA 2XX0A 2KQNA 1XCWA 5DQDL 2AK1H 4MB4A 1CE6B 1QBBA 2A6IB 1JYNA 1SHXA 4GNKB 5DK2B 3ZT7A 2GFBB 2WOBA 3P30L 4FE9A 5ICYB 5IMMA 4X8GA 1HWHB 4ANUA 1HWWA 3QZLA 3TO2A 5I73C 5LBSL 2I9TA 1USQA 3LEYH 3B6SB 5IQNA 1ZHNA 3DV6A 3P9MA 5FW6A 3UP6A 2HJLA 4F93B 1I1RA 4S1DD 4MQTB 1NBZB 3W3BA 1IFHH 2PMZA 2QVIA 5L4IA 3APMA 5F1NA 3QDGE 3VXUE 4QAMB 4ZUTA 1QFWM 1DVFD 1KTBA 1B9KA 2EYTB 1IJNA 2V2XB 5AVRB 4I3SH 4F8PA 4RMSA 4HUUA 5B7MA 2ZX6A 5HHPA 1J1XL 2P8MB 2V37A 3G08B 1W15A 1MJ7H 5IJBC 4HK0A 1OTSC 1BVZA 2BHYA 3BYYA 3Q5YA 5JNYA 3C6SB 3KPLA 2QDWA 1SXCA 4F80A 1YMMA 2CKBA 3C2AL 3X1EA 3L16A 5E08L 5IHZB 1MIEH 1KTCA 1TMCB 2VZVA 1A64A 4GO9A 4MJID 4D0DA 1KCWA 1MJUH 5F7MC 4CU8A 4XBEL 2BSSA 1QKZH 3MRIA 1BAFL 1KBKA 3BZDA 2VLKB 2HX9A 3BOVA 3Q5OA 4LCWD 4XXCA 4BSVB 1LMKA 3GXNA 4LASH 4PWKA 1KIRB 5DJDA 1DUYB 1MCOH 4PJ7B 2WXLA 4WUUA 2UZXA 4F2MA 2ENPA 4FG4A 1HZLA 3EFDH 4FX5A 3MLYL 4R96A 4P3CH 2B59B 2E4TA 2KDGA 4YSOA 2FJFB 4JE4B 4PTTB 5CZKA 3OXSA 1AMXA 4J3XA 3WY3A 1U2CA 3CHQA 3QPQC 1SLWA 3POHA 4YHLH 3WE6A 3MRKB 3V0VB 3I9GH 2WBKA 4WW2F 1H3TA 4WY7H 5CGYC 1OAUH 1VFAB 1SN2A 1IBHA 3V7AE 2R56L 4XN5A 4I0PD 4NERA 3H2WA 4IBVA 4JFDA 4JEGB 2DIAA 1CGXA 2ZXEB 1UGNA 4U1NB 1X7SA 3GPEA 2XZQL 1NAMH 1J8SA 2IG2L 1GGTA 2H32B 2Z8RA 2B15A 4GAGH 4EQ2A 4JGNA 1QWNA 3ABZA 2ZX9A 4I2XB 1GAFH 1AKJD 3FFCA 2VM3A 3FUHA 3QUML 3U25A 5I1JH 3MRFA 2VO5A 1FYTB 4AGNA 3VFGL 3UZVB 2H8PA 2HVJB 2O6CA 4ONGL 5C0BD 3SJVB 4GXUM 2EUWA 3QEQB 1NM4A 3LRSA 3HMWL 4U1LB 5D1XB 1VZIA 1W6LA 1I53A 2PCPB 4P46D 3LZRA 1ZLUH 3O3AB 5BOPA 3GEWB 4IOSA 2G3NA 2WZPD 1CE6A 3IT8D 4FA7B 2FIKA 2H6PA 3B2PA 5C6WH 3LKSB 3B83A 3O9WA 4X2UA 5FF6A 5I71B 3OBAA 2HLAB 4YSAA 3T08A 3BISA 2N0KA 5SX4H 4U1GC 3G5YB 4N8VB 3Q1SL 4KNQA 3KBHE 3UTTB 3RWEA 1UXMA 2R69L 4JM2A 4FABL 4YO0B 5KG9A 3LKOB 2XN9B 3VXRB 4YDLB 5C1MB 1JXJA 3DWTA 5E7BA 3OX8B 1H3WM 4NC2B 1HYRC 2YOCA 5DHYA 4O2CB 4O2FB 2B1HL 4XVSL 1LE5A 1YRKA 4HIXH 4WWOA 5E7FA 2UUDK 3EDEA 3KJ4C 2H32H 4JKPH 1SHMA 5D7IB 5D7LB 5FYLD 4ZG1A 2EH7L 1MF2L 5ANMB 1PSKH 4K23H 3W9DB 4WSGA 2R0WL 1WICA 2XZAH 4JO4L 4HJSA 1U8MB 4PV9A 4KGJA 5KN5B 1IIIA 4X7TB 1RZKC 3OWEA 2A77H 3L5WB 4HJGB 4OCXL 1TU2A 4F8LA 1HCZA 5I66B 4X9HA 3EF4A 3BKYH 1W91A 2JTYA 4HUKB 5CBEA 1A02N 1JV5A 4HAFA 4U6VH 2Y9RT 5JW5B 4AMKL 2WNWA 3OKMA 3GSOA 3N42B 2UY6B 1MRCL 2G2NA 2O72A 3FN0L 5J6HB 4X99A 4HHAA 3MV11 2AEQL 1DVTA 3GSXB 1NCTA 1TVBB 2MRYA 3V4LA 2EVGA 5E6ZA 2NZ1A 4A04A 5A6IA 3SDAC 4HSAC 4DGYL 4NSKA 4NUGL 3KHOA 4GMTH 3O8XC 3PHOB 5T3XL 3P0YH 4U6TA 5DRZA 3QRBA 4JY5L 4TNEA 4EN3D 1FPTL 3V4PA 2VN6A 3GXMA 5FYLL 1KTLB 1NDMA 2BSCA 3NVQA 4P5RA 3TZVA 3QUYA 1G9ML 2BY2A 4KKAD 4S0HA 4G72B 2X2UA 3V6FB 1TENA 1F11B 3FF7A 4PP2B 3T8VA 1PVHA 5MEPB 1EHLL 2DQTL 1IBDA 5HGGS 5L88L 2BMKB 4QXGL 4WQOA 1U8LB 1U8OA 2YKLL 3VXME 5HXMA 4FF9A 5KW9H 3BMWA 3L08A 3RWGA 4KI5D 4DVRH 1R3KA 3ZYZA 1VAHA 1O6SB 3IRZA 2ZJSH 5IQ9A 2XN0A 4BM7A 3DHMA 2MCG1 4FFYL 1YEGL 1FVDB 3UAFA 1GY2A 4HMCA 1Z9SA 2IIJA 3KYOB 5ID0B 2YBRB 1TYRA 4N5EC 3MXVL 2I07B 5HYEA 3K8LA 5IMMB 5G4NA 2WGXA 2FATL 3MCG1 4NHUB 3EJYC 3QIBC 3VM5A 1NEZA 2I25N 3BDXA 1KDJA 5IFAL 5D96C 4P59H 3CVHL 2B2XH 5DVOA 5F9JA 4KRNA 1NCCL 1ACXA 3ATDA 1E0OB 4YZWA 5F7WC 1R3IL 4QI3A 4F58H 2EE9A 5J6GA 4XVJL 5MENE 1UFGA 3SDXE 2ITFA 3NJJA 1BQUA 3X2QB 1H9DA 1EGJH 4ZPVA 1ZHLB 4NZJA 3MDJA 1E67A 5KVDH 3RIAF 4XCCL 2CHZA 3MUGB 2WLMA 1MAML 4Z7VA 5ICZB 1XV8A 2H47C 4WI2A 5EU4A 1BD2B 3HNTL 1I8KB 3MKGA 3RBSA 1KC5H 3TFKD 1A7NL 4ICWA 3BO8B 1BZ9B 3LSOB 4TL5A 15C8H 4RMQA 1RU9L 1U8QA 1AIZA 3RFZC 4H20L 3FQRB 5JORB 3DX7A 1HINL 3C60B 3U0WL 5FO8B 3O4LA 3O6FC 2YGQA 2DM4A 1UWEH 4LSVL 4ZQKB 5BVPL 1JHLH 3GHBL 2VLJE 4H8WC 5C7XH 4L8CB 3GHEL 4RAVA 3AG1B 2OMBA 2AK4D 3ISRA 4RIRA 5FYJL 2P8LA 1HFUA 1K4CA 2OTUA 4MA1C 2OMYA 2VQTA 4LEOA 1JZDC 4Y4KD 5CEXB 2NZIA 3BSZH 5H37G 4MLSA 4XMKH 4HCIA 1C12B 5ACZB 3A5VA 1RUAL 4DKFH 1XIWC 3FO1B 3HHSA 5CUSH 2CRYA 5F1IA 5AW5B 1XEUA 2A6KA 2YD1A 5FUZL 2NY0B 3VH8A 4KNUA 1DQVA 1FC1A 1QUNB 4JFFB 1C7TA 4PJHA 3UOAB 1MFAH 4X98B 1Q9KB 1JWSB 1XTLA 3M8OH 1J9RA 5LN4A 1MRDH 4GSDH 1BZEA 3T1WA 1BAGA 2VN4A 3FU0A 4N2EA 3QUMA 3S37L 5F71A 1VKXA 4JRYB 2CIIB 2OJEA 1LL1A 3GI9H 4PGEB 3TNNA 5E08H 5KUKA 1MCCA 2P3YA 2P24A 3BYTA 3NSDA 1EUUA 2AJ3A 2F54D 2X3AA 1EEQA 4V11A 4PJAB 3KPRE 2UZYB 2CGRL 4NO2B 1UOKA 4Y8DC 2OMUA 1G9MC 3LZFH 3ZHLA 2DL9A 4PVMA 3OKKB 1SLUA 5D2NA 1HYSC 3EJZD 2X1QA 1N68A 5AW6B 1QQDB 4EOWL 2FWUA 3SDDC 5I1CL 4NNYB 4X9BA 3MU3A 2J8OA 4GP5B 4JJ5B 5D1ZC 1YEIL 4F8TA 2O26U 2AXGB 1KPVA 4GEIA 3TYFA 3R0NA 5HDOA 3IMVA 1NQBA 5AB9A 4HEME 2XU9A 4AYFA 4W9DC 5BZWB 3FTWA 4GG8A 1OT4A 4JM4L 3AXHA 3FOMB 1FYHB 2ICEC 4L4VB 3WUZA 1T04B 1J86A 5DS2A 1A9EB 3LQZB 5JO5B 4PWHA 2BSRA 3F01A 3PJLA 3II2A 1DVZA 3QJZA 4UT7L 4F33B 3QIUC 4UTAA 2ADYA 2V9UA 3FUDA 3MLWL 1D5ZA 4ZO9A 1M57B 3K8KA 3LHPL 1HOCA 4PVBA 3VXTB 1U58B 2QVFB 4IRSD 1ZS8A 4ZUUA 3NCXA 3DXAB 4K3HA 3SE9H 3RWFA 4NXSA 4LRIA 5CD5C 3VD0A 3DECA 4JQXC 1JPEA 1YSOA 4YXLH 3Q7JA 1TZOA 2X4TB 3NDYE 3P11H 4U3SA 5DEFB 4HLEA 1NGQL 4GBXC 3FZUC 3OAUH 3NSCA 5CZVH 2GSIB 4UTCA 2PKDA 4L0YA 4RLDA 4L37B 1MUJA 3GMQA 1TKWB 5JHDE 1L5GB 5CN3A 4LLVB 1C9SA 1Q9WB 1R3HB 3SDAB 4IMKA 5IBUG 2D4DA 3ESVF 5AVTB 3ZHFA 1Z32X 1N7ML 5D5MF 3BSGA 4XBPB 5FDWA 2JJUA 4LSUH 4BKLA 3GUTB 4FQXB 2FO4B 1DFBH 2Z93B 1J5OH 4PGZA 1CD1B 2Q2LA 4LVOC 5C6TH 3RVVC 3QEUA 1RUML 4R8WL 2C9RA 4X99B 3G3LA 2OZ4A 2JI2A 4UF7C 3VVVA 2XTJE 3S3CB 4Q9BA 3ENEA 3SKNA 2Y23A 3TZVC 5BJTA 4Y7OC 5I1KH 2BIQA 4N0CD 3V6BR 1K4CB 1MCLA 2OTUB 3GSWB 2VDOL 4HOMA 3V0WL 3B7SA 1E4XI 1BQSA 4LLWA 4UYPA 3MA9H 2IWEA 3RZCB 4PJBB 3LIZH 3IU3A 3T4YA 2I9LA 4QT5B 3VWJD 3RU8L 2IAMD 4L8DA 3DMMD 3LKRB 3MBEB 4XT1C 3GDCA 3FQTA 4H7VA 1QTYT 3GMNB 3T09A 1BIHA 1P9MC 2GEEA 3CLWA 3QRGL 2ZUTA 4JO4H 3ARDA 2ICES 1AXTL 3I6KB 1MI5A 2ZUQC 3MLXL 1HQRA 3TA3B 4NO5A 4Y5XB 4BQCA 3BEVB 1DZBA 2DICA 2I5YH 2X6BA 3PNRB 4JG0L 1T7XA 2WINA 2Y6TE 1UT2A 1VDGA 3S4SB 1P7QD 4UV7L 3UPCA 1TQWA 4H5SB 2GAZB 4HX1A 3FCBA 3L9BA 1TQBB 2YQBA 4FYSA 2C4FU 3OF6A 1RK1B 1OK8A 4QD2E 1KFAL 4QHMA 4O58H 1OGPA 3G6JB 3RVWD 3G5YA 1E6JH 2ZKMX 4CSTA 1JZ8A 1JWSA 4D9QD 5C0IB 2AABL 2P8PB 4XHJC 5ENWA 4LKCA 4I13B 3H3BC 3IETA 5L9DH 1EIBA 2YGOA 1ZA3A 3OKEA 3L4ZA 5JXED 3JWDH 2W0FB 2UVFA 3MV7D 1N3NA 1WGVA 2D3NA 4YR6B 5FYLH 5DGRA 4GYBA 4NZRL 5GISH 3K4ZA 3BWAA 3HCVB 3BPCB 2Z8VC 3CFEA 5C0GA 1SYVA 5KYYB 1BM7A 3KLLA 5EU6D 2ZOLA 3MJ7A 4F3FA 1HXYB 4L0PB 2W94A 5HDQH 3D1MC 4HIJB 1ZJBA 2ZNXA 5E2VL 3E8VA 4XXCC 3OQRA 4FG0A 1PPIA 2X44D 3MTXA 2F1AA 1YNTF 2WSPA 3QULA 4GAYB 5L2KD 4Z3TA 3F83A 1CK0H 1KBGH 2WBJC 3JTSA 4KTEH 3IJEA 4U1IB 1HSBA 5AVUB 4BGLA 5AAWA 3ZKXC 2FAUA 2ZWLT 1MZZA 2VDQB 2ZOKB 3TEUA 1ADQL 2MNWA 3LRHA 3MX0A 4E41A 2DLFH 3FB8B 4NOFA 3L81A 4WEEA 3LNFA 1KGJA 1B0GB 1LYQA 1AGEB 2D03L 3FSZA 5DQ9B 1GHFH 4OFQA 4Q2ZB 3D6GA 4CSSA 4LCWA 4G8EA 4MMYB 4G7VH 3MACH 4NYLA 2JQAA 4BH7A 1P4BL 2FO8A 2J6WA 3T0XA 1TTFA 5IHUH 2N7SA 3W39B 4WFGE 5EZOL 4L4TE 1PEWA 2AXFB 3H3PH 3MPCA 1ZIAA 4HUVA 3HZKA 5KTEH 5EC1A 2C3XA 4OCWL 3EBGA 2Z4QB 2F53B 2YLHA 4FLQA 3ULUE 5EOCH 1JXGA 5LCVL 4UINL 1RUPH 3QVAA 5JOPD 3WTVA 4Z7OF 1PKQB 1JZHA 4GKZB 4UILH 5AOIA 3UEZA 1WP6A 2DQJL 1GYCA 1SUHA 1MFBH 3AY4C 4J3UA 1ZHLA 1DVFA 4MQ7B 5GQBA 4OIIH 3QIUB 4IDJH 2N0MA 4BGDA 3BESR 3APFA 5F6IB 3IWVA 3QG7L 3LVEA 1D5XA 1WYJA 2CZNA 2DEXX 4J3BA 5BRZA 2DQEL 2AW2A 3AU1B 1QA9B 4XP6H 3VXQA 4CC0A 4W1TA 5DUPH 1BQKA 3OAZK 3QPXH 3FOMA 3ETSA 3MBXH 5IM7B 3BRGC 3QDJD 2A2QT 2DI8A 1QLEB 3IBEA 3CFBA 2VTFA 2H2PD 3H56A 2WKLA 2PTTA 4FNLL 5HGBB 4LAQL 5EORH 3VXMA 5BRZE 5LNGA 4KI5F 3HC3L 4JJ5A 1JZFA 4OZGB 4UQDA 5J7CC 5IMOA 4QXUL 4YEFA 3JSSA 3OKYA 3KYNA 1R5WB 1U92A