5SWSD

Crystal structure of np2-b17 tcr-h2db-np complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
200
structure length
198
Chain Sequence
QQQVRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASEGSGSWQLIFGSGTQLTVMPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 198
sequence length 200
ec nomenclature
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsD02
1B0RB 1D6VL 3OJVC 1BQHB 5HYFA 3O3UN 3LN4B 3VD3A 3EOAB 1U8LA 4F9PA 1QLEH 4KKCC 5ECJE 4L4JA 5HHPB 5BRZE 1OQXA 3V5KB 2AJ3B 3LKRA 3T2NH 2F5BH 1OY3B 4LIQL 1NMBH 3TVMD 1T5XB 4APQD 4M62H 1MCIA 1U95A 4JRXA 2NY2D 1FZMB 3MRGB 5DC4B 4Z5RB 5B8CC 1NCWL 5CJOH 1KN4L 3QXAB 2NY7H 2X44D 4LSSH 1DDHA 2D9CA 5FA3A 1I1YB 4GRLD 4PB9L 1M7IA 2PYFA 5HGAB 2D7TL 5FO8B 2HLFD 2R8SL 3VG0H 5FYLD 2F53A 1RUAH 4X6BA 2GAZB 2IQAB 4IRSC 3N85H 4HV8A 3UYPA 3BP5A 4XPAH 1YNTA 3D0LA 3KPQB 4EDXB 2AI0L 4Y2DC 5GS0L 3NCYS 4W4NA 2GT9B 3L5HA 5DJ8A 4AH2B 1IGYB 4RFOL 2LV4A 3WN5C 3MMEB 4OUOA 5CFHA 5I18L 1R3IL 3UJIH 1MLBB 2OZ4A 5L2JA 4GQPH 1EEUA 4P57B 2GYSA 2UY6A 4XCYB 3AC0A 5C0JB 1H3GA 1FVEB 3N06B 5L2KE 5J11C 4O51B 3DVFA 2WLZA 4LDLB 4X8XA 4CRPA 3GI9H 1HNFA 1MHHB 3VXRB 1G7IA 4O4YH 5HHXL 4BJLA 4C83A 4R4BA 1UM4L 1LO0L 5F8RC 1AXSB 4G6JL 1D5MA 3NACL 3VU2A 2V9RA 5E8OB 5HI5C 4OD3L 4XC3H 5EULV 4X6DF 3QEQD 1SJVA 4GBXD 3VD7A 2BVPA 3AREA 3BKJL 3KPRA 4TTDC 4DK6A 5GGRY 2CR3A 3ARDA 4NYLB 5F72S 2OX5A 4NDMA 4OGYL 1NFIA 4OD2B 5A16B 3EAKA 3H7BB 1JHKH 3HB3C 3S8WA 1G6RB 1NQBA 3RWIA 2XN9D 3A67L 1I8MB 3NFNB 3FOMA 3MFFB 2MCPL 2AABL 1JP5A 4I48B 2FHCA 1FNAA 4WV1A 1X5YA 4JDTL 1UM6H 1UKTA 4ZAKA 1VGEL 3V79C 4S10A 4ISVA 4F15B 4KJYA 1JPTL 4PJHA 4XXCA 5I8CA 1MI5A 3IFOB 2ZCLH 2NTSP 4JQVA 5J1AB 2ICWI 5D7IA 2PYEA 3DECA 3MGOA 4NKDB 1HQRB 1BVKA 1FJ1A 4HJJH 4QT5A 4ZXBA 4WHCA 4IJ3B 2ZNWA 5HXMA 1MCKA 4OLVL 3EDJA 4L9LA 3TP4A 1AIFA 1YQ2A 5JIHA 3VGDA 1IKNA 3GGWB 1LO2H 3MGAA 3PG2A 3VD5A 3HI5H 2D31A 4RAVB 1ZSDB 3HR5B 1T5WA 5IVNA 3P9MA 1H9VA 1W0VA 3EIFA 2XWTA 3FZUD 4PRHA 1FCCA 5I1EH 4WW1A 3ULVF 1PDKA 3BWUC 5HY9A 1JF1B 4XP1H 5KSAB 1KN4H 3DV4B 4JG1H 2B0SL 1YPZF 4Q9RL 1A6PA 2E8ZA 5KAQF 3PIQA 3TO2B 3DXAB 1FYTD 4QHKJ 4LLYA 5DI8A 4Y7MA 4PRPD 3GSRB 1FRGL 3BUTA 4QY8A 3BYYA 4GKOA 3BQUB 1HSAA 5CEYB 4Z77B 5BOPA 3D0VB 1QRNE 2HTLC 4RCAA 5DYOA 1LP9F 4HDIB 1JPSH 3LDBC 2BDNL 4JZJC 2VSCA 1DLHB 3CSYB 1UCBH 1ZVHA 4NGHH 4MJIE 5MERA 2EIDA 4ZQKA 4UTBH 1PYWA 3BIBX 3BZFA 2G5RA 3EYSL 2EXYC 3MOAL 3QFJE 5HHQB 3FFCB 5IKCA 2X4SB 4M6OL 4QOKD 3SDDC 3RU8L 2FD6L 5J89A 3HPJB 4TOYH 5B39A 1AJ7L 4MNQE 4XWGL 4CBPA 3TBYA 3QQNA 4TSCL 4M93C 4RFEA 5CLTA 2BSRA 3ECBA 1WC7B 3SCMC 1R3KA 3PWPA 4PJFE 1Y0LA 4GOSA 2GI7A 3FT3B 1ZS8B 3DUUA 3BKJH 2G9HA 3MLUL 1NAML 3DARA 4PD4J 3S36X 4ELKB 4G6AD 4OGYH 2OXHA 4KK9D 1I8IA 1WAAE 2CLZA 5F6IC 3FOLB 3IKKA 2KZ1B 3L5WB 5FGBA 3NZHH 1TPXB 1H3PL 2ZCHH 4KROB 4XAWH 2EIEA 4PJ8C 4NO2A 5E94B 1W0WB 2OTWB 4HH9B 4GT7A 4Q0XH 1VA9A 3LAFA 5FYJU 5JDSB 4I3RH 3T1FA 3BGFC 3R06B 3DMMB 1FORH 3H9HB 2QQQA 4C56B 5FYKL 1C1EH 2IAMA 3ULVC 4QXTA 4HIHB 2R23A 3G9AB 5EU4A 4UTAH 5IHZB 2H32A 1CFQB 3K4DA 3TBSB 3FQWA 3ZTNL 3O2WL 2D7QA 2I9LA 1BIIB 3UBXB 1DBAH 1T1YA 2IFFH 4AEIH 5TE4L 3FO9A 5C0AB 3LPGA 3MOBH 4L4TB 5EU7E 4FQ2H 3KXFB 4G43B 1F13A 2XTLA 5AUMB 1KIPA 3MREA 2D0HA 4N8CH 3MO1A 5DMIH 5ABDE 5BCAA 2EDLA 2GEEA 2VAAA 4PGJA 2NXZC 3O8XB 1JI2A 5C08A 1QBMH 5CSZB 3S3JA 3BD5A 3PXJA 2F54A 1GAFH 3MUHL 1R3JA 1E0OB 1N7ML 3HZKB 1NL0L 1Y6KR 3LKQB 3SE9H 4KHTH 3W0WD 2BP3A 3MBEB 1NBZB 4M7KL 4WJ5B 4YUEL 3F7VB 4YEFA 1I7RA 2PO6C 3S4SB 4XI5D 1P7QB 2E7BA 5EDXA 3MLTB 5BRZB 2FJHA 3HNSL 4JFYA 2P5EE 3QAZB 3AUVA 3DLQR 1C08A 1KB9J 1VPOH 4PJ9B 3L3OA 3BP7A 4TPRH 2P42B 4HZLA 1U41A 3T0EA 4LLAA 2AKRB 2PN5A 2KUTA 3R8BB 1AGDA 1I9IH 4LPWA 3MRRB 2VR4A 5IMLA 3X13A 3HZVB 5BJTB 1B4RA 4G8IA 1KEGL 5HYJA 5D5MA 4HFWA 4YPGB 5IMOB 5I19H 2VDKL 3AS3A 3C2SA 1FBIL 3NCJH 4JZNB 3SGKC 1CGUA 5DJ6A 2V2XA 2ZPKL 3I3EA 3C5JA 3MRDA 4QRRA 2VXTL 4ODSH 1JPST 1YN6A 3D9AL 1XR9B 3LN5A 5EOTA 1CICC 2DQCL 3RVTC 2H1PL 4MJ5B 5TQ0L 3AS0A 3IDNB 3MLZH 4U6XA 4D0CA 2E7LA 6CGTA 3ILPA 2YKLL 1AI1H 1TITA 5HD8C 2YBRB 4JRWA 2L0DA 2I24N 4WHDA 4XX1G 1I8KB 3W5NA 1DQQB 3SDCA 1A1MA 4KWUA 2Q8BH 4M4RA 5KW9L 1PQZA 5DHVB 1MCSA 5FF6B 3BO8A 3NA4A 4Y2DD 2X4RA 3OKOB 5I1JL 2QSTA 3P30H 3BP4B 3VRJA 4KFZC 5KSBA 4ZFGH 5FYKH 3EFFB 3WUWB 4ODHL 2VXSL 1A4KB 5FYKD 3EUUA 3CDGB 3O2DA 4BKLA 3LRSA 1SMOA 4XCFL 4XHJC 4LP5A 3U0TB 1PX4A 4TYUA 4Z78B 2AXGA 5EU3B 3RZWA 1HINH 4NNXA 3PHOA 4WI9A 1MFEH 1GC1C 5HI5D 3QFDA 3X14A 4MJ6A 1BM3H 4LLUB 3QDGD 5EO0A 4NZUH 5DJCA 4LBEA 1INQA 1NKOA 5EB9A 3ULSB 3HAEB 5CJBA 1IFHH 1U92A 3NFSL 3VWJB 4OI9A 2RCSL 2AEQH 4YHMH 3HB3D 2HJKB 3LEXB 4OZFG 4F7PA 2XQYK 4QRUA 3MA9H 5BZDB 1LEKB 3QO1B 2VE6A 5EZOH 1GVIA 4NP4L 4JY6A 5CILL 5I71C 4WWKC 4PJXA 1N7MH 4PJ5A 1CT8A 4L3CA 4NHCL 2D0GA 9CGTA 3VG9B 3ULVL 1OSZA 2XQYG 3EYFA 4PJGE 5D7JC 4NFBA 3DVNB 2HWZL 2DYPD 3QEHA 5IBLD 1ZHBB 5KTEL 3QPXH 1FL5B 1MNUL 2Z91B 3FQTA 1A1NB 4OLWL 3S7GA 2AV1A 2JCCF 1XF2A 4P4RA 4LKXA 5E2VL 3WJJA 5IROC 3HC3H 4F7EA 1NAKL 4KK5C 5C0EB 4XH2B 2DMBA 2OTUB 1EZVY 4LEXH 4NQEE 5BS0A 4KXZI 2FDBP 4Z76A 3TZVB 1RUPL 3LKOA 5D96C 3VFVB 1UADC 4UT7H 1KEGH 3D3VE 1RJZB 1U3YA 2BNUB 4U1HB 4R4FL 5E7FA 3MLSH 2B1AH 2G75A 2X7LA 3L3IB 4HGWA 4IDJH 3O6FA 1VFAA 5CWSB 5E99H 5IV2B 3Q6GH 4OBRA 3PL6C 2BZDA 1QRNB 3IDJB 2DQCH 3UXFA 1BQHA 1QSEA 3IDMB 4FXKB 3LN4A 4DW2H 3ARBA 1YECL 5GISH 1YZZA 4L8BB 2YPVH 3PHQB 4MJIB 1JZ5A 4DGIL 4MD0B 2AJ3A 3V5KA 5CZKA 3RZCC 4R8WL 3WXWH 2A9MH 5DQJA 4WCYH 5L88H 4XNUL 1W72B 1BD2E 2PW1B 3EZJB 5KW9H 1MY7A 3QFJB 2YZ8A 1XAUA 5D70H 2HTLD 5GRXG 4P9ML 3MRGA 3I75A 3P73B 4Z5RA 5JUEH 4PJBE 1IQWL 2VXQH 3L1OH 3QXAA 2FJGB 1SVZA 4MNQB 5FCSH 1I1YA 4U33A 5CIPH 5I8OL 3IU3B 5HGAA 2GCYA 5FO8A 3OPZH 4I77L 4YO0B 1T7VA 1YQVL 4UDUB 4PJFB 1ADQA 2R39A 2EXYD 3FQXB 4CVXB 1QBAA 1TIUA 1IGCH 1HNGA 1UT9A 3KPQA 3SDDD 4EDXA 2GT9A 2IBBA 3UDWA 4RWHA 1A14L 4F37F 1FPTH 1IGYA 4KI5C 2D03H 1UZ6F 4UIMA 2CIKB 4GXVL 1RULL 3MMEA 3SCMD 1Q0YL 1YMMD 4OV6F 3MNWB 3EDEA 2UVFA 3UJJL 1MLBA 5C0BD 4HWBL 1U8NA 4JQXC 4IMLB 1KGCE 3TO4B 4EI5C 2EE6A 1F4XL 4XMKH 5C0JA 1FVEA 5J06A 3OG4B 3VXRA 4F8TA 3N50A 2VSDA 5D1ZB 3WD5L 5JLZB 3BJ91 3WJLA 3HMWL 3SQBA 1ZEAL 4LLVA 4PJ8D 2BNRE 1DBKH 4FABH 3TIDB 2AS5M 2ATPB 1CL7I 2LU3A 3G6DL 3L5XH 4GW5B 4WUUD 4JM4H 1KYOK 4NYLA 4K2UH 3ULVD 4OD2A 3H7BA 1G6RA 3AM8A 1HIML 4FQHB 3EZ8A 3GBNL 6FABH 1N0XH 1I8MA 3NFNA 5ETUB 1K4CA 3BEWB 1JJUA 4I48A 5EPMA 1GGUA 1GC1L 3I6GA 5I17B 2BNQB 1DBJH 4EOWH 5LGHH 3W39B 4PREB 4S2SA 3EDDA 3P4MB 4A6YL 2R29H 2KDGA 4HF5L 5DD5H 1JGVH 5J1AA 3QZWB 3V95A 5K9OB 4R4FH 1E4JA 3EJZC 4E5XA 4UT6L 1JNNL 5DD1L 3E2HB 2NXZD 1HQRA 2ZOKA 4YHZH 1LMKA 1G0XA 2X4OB 3HS0B 5E9DE 5KVEL 5EH1A 4YH6A 5CBEB 2VISB 1WFUA 4YFEA 1CR9L 3X11B 4DUVA 1BVLB 3DV6B 1YECH 4HW6A 2R1YB 3CIQA 1U8IB 4RAVA 1ZSDA 3PDGA 3ZE1E 3HR5A 1A9EB 3ZKXB 2PO6D 2R9HC 5IESL 1BP3B 3QXWA 2EICA 2VR9A 2I27N 4EI6B 4XCCH 5EUOF 2Y36H 1JF1A 3DV4A 5D8JL 3WYRA 4GW4A 1MREH 1TJIH 4KXZH 4K8RC 4WEBL 3TO2A 5C0GB 3DXAA 3MODH 2AW2A 2IAND 4PV9A 3UYRL 4KU1A 2YPLA 4R2GB 1FQ9C 5DJ2B 1MHPH 3GMNA 4P2OC 5CEYA 4Z77A 5I73C 3EHBC 2YN5A 2X4UB 4C54A 4J2XA 5I75B 4HDIA 3W81A 5HDBE 1T21B 1XH3B 3BXNB 5D6CB 2E6PA 2J1KA 3AGVA 1RULH 5IIEB 1D9KB 2YOCA 3RVTD 1ZVYA 2XQBL 1NC2D 1GPOH 5I66B 5HD8D 4Z7WF 1AE6L 3JV4B 1N4XH 5HHQA 3FFCA 5MP6L 2X4SA 2XZZA 5E5MB 1TQCC 3TV3L 4YHPB 2ZUQC 4Z7NE 4Z8FL 1G7PB 2EDEA 4M5YH 4TNWF 1WC7A 3KPOA 3PQYE 1NFDF 4HMCA 4RAUB 2X1PA 4IRJC 3NAAL 3OKMB 4LVNC 4ELKA 1QYGH 4PJDE 2DIAA 4ODTL 3FOLA 3MRIB 2HFEB 2NR6C 5IW1B 2BVEA 4P2RE 4ONHB 2DQFB 2X89D 2G5BB 1P2CA 1W0WA 2OTWA 4HH9A 1K4DA 2QQNH 4NZRL 3R06A 4Q7DA 3DMMA 1B2WL 3H9HA 5FHBL 2ENYA 4JPWL 2VIRA 3CGTA 4HF5H 3MLWH 4HIHA 5B22A 3OXSB 1T04A 3U4EB 5IHZA 1CFQA 4K9EC 4M3KB 3T0BA 3MZTA 3QHZL 4YX2H 3IS1X 3UBXA 1CDYA 4G6FD 3SDAB 4LCWE 3D87B 1RZFL 1X4YA 3OR6B 5JXAL 2RAMA 4GMTL 4Y19D 2CIIB 1CL7H 2CKBH 2O5ZL 4I0PA 4MJ4A 4L4TA 5GGTH 5GS1A 2FWOB 3KXFA 4G43A 2EH7L 5F71A 5AUMA 3U7YL 2O93L 4NQEB 5D7JD 4F7TB 1VCAA 5JORB 3CK0L 2OBGA 4S0SD 2Y1VA 3FKUS 5E6IB 5M95B 1V7MH 3O8XA 2AK1L 3D3VB 3EYQC 3OXRB 5HGDA 3QXUA 3MNZA 3F7PC 5IHUH 1SEQH 1I7UB 2AJSL 3HZKA 3LKQA 4KK5D 1HKFA 3BVNB 2MPAL 5E6YA 1M05B 3MBEA 1T1ZB 1NBZA 2O5XH 4WJ5A 3F7VA 3UYRH 5DURB 3S4SA 2Y23A 2OP4L 5DLML 4I4WB 2QQKL 1P7QA 1Q9WA 4FXGB 3MLTA 5CSBA 5F70A 5BRZA 2GITB 3F58H 1AGBB 3LEVL 3VXSE 1UB6B 2ZG2A 2WWMD 3PHSA 1BD2B 4C55A 2MHAB 1IARB 3PL6D 1YEKL 5I1LB 2AKRA 3VRIB 1LE5A 4WV1C 4YHOL 1E4XL 1WBYB 3K0WA 1XGPB 4FHBD 4PJBB 2FH6A 1YY9C 2DOCA 2C26A 2WWKT 4UT9H 3OWEA 4OQ1A 4K7PH 1N6QH 3RZCD 4G8FB 3Q6FA 4ZOBA 3EO1A 1YY8A 4JZNA 4LVOB 4TN9A 4P5KA 4K3EH 5I1HL 1JZ4A 4RGOL 2VN7A 4OLYL 3JWNC 2VDRL 4M1CC 3RGVC 3D5OF 1XR9A 1BFOB 2JJSC 4MJ5A 5JIKA 4WU5A 3IDNA 4HLZH 3IU4L 3OJDB 1FG9C 4JJ5B 2H3NB 1ZGLM 1IKNC 4P5TB 1I8KA 5GSRB 1RZJL 1DQMH 4IMKC 1BVZA 1J1XH 1EAJA 1A5FH 5L2KA 5DHVA 3GK8H 8FABA 2VXVL 1JFQL 1DP0A 3OKOA 2FZ3B 1RFDL 3U1SH 1LHZA 3BP4A 4X6EB 2GQHA 2GTWB 3NCBB 5FYLE 1NMAH 5GGVY 4U7KA 5SWSA 5GRWA 3EFFA 4PG2A 2JB5H 3LEYL 1BJ1J 2BNRB 3TBTA 1CFBA 5DRZB 4EI5D 1A4KA 3A6OA 3BWAB 4F80A 5CD3B 3OAYH 1CBVH 4PG9B 1MJUH 3CDGA 5DJYB 5CUSH 3Q1SL 2EEAA 4LNVA 5IB5B 3QUKB 4KJWC 4FFYL 5SX4I 1BGXH 4EJ1C 4WRLA 4GMTH 2W07A 1N5YH 1YEIH 5ESVB 2JK5A 3RWDB 1IAII 4KMQA 3WSQL 3HAEA 2BCKB 2GY7B 3CU7A 3VWJA 3JWDC 4UMGA 1JNLH 3AAZA 5GGQH 3WDIA 2H2SC 4XVJH 1MIML 2HJKA 3ZE2F 3LEXA 1JBJA 2X1QA 3QO1A 3T0VA 2O61B 1JHTA 2DLFH 1FE8H 4K07A 3QEQE 3WXVH 5E9DB 1E6JH 4Z7UF 4ELMF 5E56A 4M7LL 5F9WC 1ZVSA 5CINL 1K6QL 1A3LL 3DVNA 2WUBL 4K9EL 4XZUB 1RJLA 1YNLH 2OP4H 1ZHBA 2XN9E 2AJXL 3V6ZA 1RZKC 1FL5A 2Z91A 1A1NA 3EJZD 1WK0A 2EIZB 3LEVH 4JFQB 4MB4A 1YEEL 5IEKA 2DQHL 5IHLB 1LO3L 4LNRA 2EO1A 4XH2A 4DFHA 1NANI 4JLRA 5CSGA 3TZVA 1GHFL 4WW2F 3VFVA 3MLVH 1RJZA 3ZE0F 2IAMC 4U1HA 2AEPL 4HLZG 4LK4A 3SOBH 4G3YL 1U8MB 4Y8AA 5TF1H 4OM1L 4H26A 2ATKA 5IV2A 1D5XA 4Y5YB 2IBZX 5TPWL 1QRNA 4NC1C 3IDJA 4K8RH 2DBLL 4JZOB 4DUWA 2OK0H 3IDMA 3F7QA 5T1DH 3IU4H 1A7OL 1YYLL 1QFWM 4KRMB 1U3ZA 4LLQB 3KYOB 4MJIA 1QLFA 3ARGB 2YN3A 4W4OA 1Q72L 4IOFD 3OF6D 4LIQE 2A2QT 2APVA 4X9GA 3PWLB 5EBWB 1W72A 2PW1A 3S5LB 1IAOB 3CFEB 3B6SB 4P2OD 4QHMB 4DVBA 3QFJA 3EHBD 4XNQA 4PY7A 1NBYA 3L6FB 2EYRA 3P73A 1MF2H 4KUZH 1UJTA 5FGRA 2FJGA 4ZTPL 4MNQA 3G6AB 1FYTE 3QXVA 2X42A 2XIDA 4PRPE 2OI9B 3IU3A 5K59E 1FLRL 4W6WB 3MUY1 3PQYB 4MDJB 4Y4FB 4UDUA 4PJFA 4YGVA 4FS0A 1CWVA 5KS9E 4EUPH 1MAML 5J8OA 4DCQA 2XKUA 4U1LB 3B2VH 4LLMA 4X80L 3BIAX 1JGEA 1MFCH 3CLFL 3FQRB 1T7YA 5IVOA 1WAAA 3B5GA 1AY1H 1MRDL 2JTDA 3HHRB 1EHXA 2CIKA 3NVQA 1EHLL 4P2RB 3MNWA 2HMIC 4NWUL 1NSNH 1U2CA 3A0OA 4UV4L 4IRJD 3TO4A 4MQSB 5BV7B 4OUUB 3L3JB 2V7NB 2AEIT 4QOKE 4UILH 4JHBA 3H8NA 3GB7B 3R0MA 5CBAB 3DSFL 2NR6D 4AQ1B 2Q76B 5JLZA 2LFGA 4UUJA 4JRXD 4LCWB 4PRBB 1LDPH 4L4VD 1FFPA 4Y1AD 5DXWA 2HAZA 3TIDA 1DANT 5T33L 3GI8L 1XGQB 1K6QH 4FQCH 2E7LC 2ATPA 1JV5A 4F37K 2X4QB 4GW5A 4K9EH 3UTSD 3ZKSD 3L7EA 4Y4HB 1OP3H 2AK4A 2V9QA 4V2CB 4FQHA 1U8OB 3V6OE 5SX4H 3RVWC 2LU7A 4QCIB 2XV6B 1UEMA 5HJ3A 2A6KA 3PE9A 3U48A 4K7PX 3IJHB 4HFUH 4XX1E 3W39A 2OZ4H 4PREA 4PP1C 5BMFL 4FFVC 5D7KD 1IAIH 2EC9T 2F58L 2DQTL 4G5ZH 3ARXA 4XC1H 5EA0L 1HHKB 3JWDL 1M1SA 3QZWA 4X4ZA 3OHXB 4GAFB 5K9OA 1ZGLA 1I7TA 2E9IA 2NZ9C 3BSZL 3JV6B 3RUGE 3QISA 3VI4E 1TETL 4YDIH 4OCRL 3EYQD 1V3LA 1K5NB 4N0FB 2X4OA 3HS0A 4M6AA 2DBLH 2P5EA 3T04D 3EFDH 5FM8A 2VISA 5CBEA 3VXSB 2W9EH 3X11A 1BVLA 1YYLH 3DV6A 5EOCL 2A73B 2JELH 4KTEL 3V7AG 1T03L 4OZIE 1T2XA 1I1RA 1TVBB 4GS7C 4X8JA 1R24A 5DMJB 5B4MC 2DQEL 2VJXA 5DEGB 4OZGF 1U42A 4XP4L 4HUKB 3EYUL 4WWID 2Q7NA 1NANH 4EUPG 1GSMA 4PB0L 4KZDH 4MXVF 3W0WE 3BAEH 2OQJB 1EERB 2DMKA 3FHQA 5C0GA 2W9DL 3MJGX 3SE8H 5ALBL 1KCSH 1RIVL 4F7CB 1CU4L 1YY9D 3U6RA 4FZ8L 5J7CC 3WIHA 4HAFA 4X80H 2Y7QB 3CXDL 2X4UA 2A6JB 3TVMB 3CLFH 4APQB 1XH3A 2NW2B 3RA7L 3VH8A 3E8UL 1J0IA 2QTEA 3BXNA 5D6CA 3SO3B 4AJ0A 1H3WM 3E0GA 3RGVD 5K33A 3WJJC 4IHOA 3B9EA 3L3KB 5I66A 4U6TA 3TJHC 3C60C 4DKEH 2EZ0C 4NZTH 4NFDA 1SEBB 1FL6B 1JGLH 1RU9L 5E5MA 4HQQL 1NCDL 2Q7YB 4EIGB 4MVBC 4YHPA 2IALB 1LK2B 4G42A 12E8L 4O2FB 2MTPA 3ZLQC 7CGTA 1UKSA 1AGEB 3ARBC 3OKMA 5T1KB 3LHPL 1BMGA 3H42H 2H2PD 1QO3A 3V5HB 4K23L 3QQ4B 3MRIA 1A6ZA 5AAMA 4EVNB 4QWWC 2HFFB 4TSAH 4BSJA 3K2MC 5IW1A 4LVEA 1X7QB 2G5BA 1DQLL 1JTOA 3KHQA 4LAQH 5GIRB 4QRSB 1RIUH 2H8PB 4TUKL 4OKDA 2SEBB 5D7LD 4H1LB 4GBXB 3T1WA 3OGCB 4M5ZH 5FYKE 3VWKA 1KT2B 3U4EA 4PJGA 4WI2A 1BOGA 5E2TL 4TQEH 4KMTL 4LARL 2H2SD 2XN9B 5EZLA 2YD6A 4H5SB 3SDAA 3QWRA 1YEJL 1J0HA 3CXHJ 3JTTA 5F9AC 5ISZD 2BHYA 4HC1L 3TN0B 3UDWC 4OD1L 3ZSSA 2A1WH 1F90H 5C6WH 2HVJA 4JFFD 1HK6A 3B43A 1F8TH 4KVNH 3QDGE 3ULUC 4QXGL 1UYWH 4X7FC 2FWOA 4R4ND 4I3SH 1G6VK 3DOSA 3K80A 4NQEA 1T03H 4F7TA 1RZKH 3LRHA 1B88A 1EMTH 4RRPA 5E6IA 4U0RB 3G6JF 3D3VA 2BSED 1KJVA 4OB5H 1CXKA 2DQJH 2CRYA 2VRAA 5T1MB 3TWCH 5I8KH 4UV7L 2VDNL 5BVJB 4JFXB 4KJPC 4JDVB 3BVNA 2R15A 1L0QA 1CDJA 1UM5L 4IOIB 1Q9OB 1TZHB 1J7VR 1T1ZA 3MNVB 3DO7B 2K7QA 3HLAA 5EU5B 1I85C 4RMVA 2H32H 5FUCC 3MRFB 4I4WA 4FXGA 2XZAH 4XGZA 3DTXA 2B1HL 2KH2B 4P9HC 4HUMB 3CXDH 2JIXA 1AGBA 4R9HA 3AM8C 4X0KB 1CLYL 1M7XA 1K3IA 1UB6A 4D8PB 5DQDH 5T5FH 2HRPL 4XCNB 2XA3A 4Y16C 5I1LA 4XXDB 1XGPA 4PJBA 1RZIB 1QKZL 3HC0A 1FYTB 1D5IH 4PRPB 5FYJL 4G8FA 1JMXA 4WVRA 5CD5C 1NCDH 4OCSH 5KS9B 3UTTD 1OPGH 4WY7H 4NFCA 4PS4L 1BFOA 1QR1B 1VFBA 3ZO0A 5C0RL 12E8H 3C2AL 4WFHD 2AJUL 3JZ7A 2JLLA 1XF5A 2CMRH 2QJDA 3OJDA 3KPMB 4WFED 3VGGA 1R0AL 1DLFH 2X4PA 4JHWL 3MBXH 1MHCA 1A6WH 3ARFC 1OF2B 4P5TA 4PIRF 1T6WA 3MLYH 3WFBH 5IQ9B 3LHPH 3LD8B 2EDTA 1BBJB 3O11A 1KJ2L 4WNQB 4X6DE 4QOKB 2EEDA 2XXMB 1HXMB 2V5TA 1LNUB 2V17L 2FZ3A 4Y8DC 5H94B 3NZ8B 3WFCL 1OAQH 1WUNT 2DJUA 2IMNA 5INCB 3IRPX 4PRAB 4LLWB 4EXKA 5B39G 4FP8H 3P4NA 3MRMB 2HMID 4OCXH 5T3ZL 3P0VH 3WKMH 4Z95H 5FB8A 4U31A 5DRZA 2R4RL 4BFEA 5ICZB 3BWAA 1AP2B 4PG9A 3W82A 1G0DA 5IB5A 1LK3H 1A02N 1FNFA 1E6OL 5A1AA 3QDMA 3FL7A 2R0ZL 1WSST 1YMME 2HT4C 2D7OA 4AZ8A 4N0YL 5C0BE 5B38B 1MCWW 5ESVA 3WS6C 1CG9A 4JO1L 4Q6IC 2FX9L 4R97B 4HIJB 3RWDA 5B3JF 1RJCA 3G9VA 3JWOH 2BCKA 3MCLL 4JB9L 4JKPL 4NOBA 3RX8A 4MS8C 1A0QL 3IDUA 3RVWD 5DVOA 4PBXA 3RUGB 1XIWC 5IFAH 5IM7A 1DFBH 4CJ1A 5J4MA 2R56L 4WTZA 2Z4QA 1WZLA 1I3GL 4XBGB 2XRAH 1IKFH 4HPYL 1HWGB 3OR7B 1HE7A 4WUUE 1U8JB 4PP1D 2ARJA 4MGXA 3ULVE 3MUGB 4XZUA 1B4JL 2KQNA 5I1DB 2VWEC 4H88H 2B1HH 1EO8H 1TENA 3O2DH 5FK9B 1ZTXH 2NZ9D 3UP1A 1YPZE 4OZIB 4U05A 3DX8B 1P6FA 1TJHH 2HH0L 1EEQA 1TPXC 4D94A 4OZ4B 5ILTL 4GLRI 2FRGP 4YK4B 3W0WB 1QR4A 4ZUTB 2Z31D 5F8QC 1RIHH 5HPOA 1OARL 3HFML 4HKZB 4Z7VF 4PYGA 3OKLB 2HFTA 4OZFB 1KLUB 5FYJD 1U8MA 4GQ9L 4ONFL 3TFKC 4DQOL 5B4MD 4Y5YA 3MJ9A 4R96B 2OXGA 3QRGH 1MFBH 4MXQC 2M26A 2V5SA 5ANME 3NPSC 1T0MB 3FFDB 2AJUH 5IVXE 4RZCB 2Y6SC 1D7FA 4LLQA 4I0PC 3KYOA 2XWBB 2DLTA 1MCJA 5J56B 3ARGA 5GS1C 5KSVB 4P9HL 4U6VL 5IMMB 2CUHA 3S5LA 1YEGH 3PWLA 4GAYA 3CFEA 4QHMA 3TBWB 3MLPA 4LKCB 5IB3B 4GRWF 3L6FA 2DQIL 2V17H 4LRIC 5B8CB 2IANE 3WFEL 5DTFB 3PQYA 4MDJA 4Y4FA 3VFPB 2ZCKL 3C60D 2EZ0D 4ERSH 4PJDA 1NAMB 4FA8A 1HI6B 3EYOB 4IRSB 4NWTL 4AT6A 3GMMA 5DJDB 2V5MA 4MVBD 3GEWB 5DJZA 5F7YC 2ZSWA 3LMJH 4NO5B 4IEFB 4Y2DB 1WZ1L 5D71H 4I3GA 3RBSA 2FBJH 2QQLL 1RUKL 1P9MC 1OVZA 2OR9H 3WN5B 1QSED 1F58L 4KKAC 1AD9B 1I8LA 3ZDYE 3ARBD 2EDYA 4OUUA 4J7RA 3L3JA 1KIQA 1NDGB 3GB7A 5GS3A 1EDQA 3D39B 4JRYD 5J11B 3IF1A 1S7RB 2DRUA 3ETBF 3O3EB 2Y4SA 4PJAF 3NTCL 4DAGH 4DN4H 2YEZA 4ZG1A 4LCWA 5EZJB 3UPRB 4TSBL 3LS5H 3GSNL 3EKCA 4P3DB 4PRBA 3UAJC 1X5AA 2ED7A 3FN3A 4OAWB 1XGTB 3JVGC 2X4QA 1SY6L 3BRDA 4QRPB 1ADQH 4OCWH 4F2MB 1WLHA 3QDGB 4Y4HA 3VFTB 4X7TB 1C5BL 4FNLH 3L5IA 1OT2A 4D3CL 3N1PC 1DL7H 1D5BA 4QCIA 1PZ5A 3WE6B 3V6FA 1E4WL 3IJHA 3ULUH 3HNVL 4JQIH 1SJEB 3ARQA 4GG6A 2BOBA 2VLMD 4D9RD 4NQUA 5JPNB 15C8L 4LL9A 4UB0L 4H20L 4XPBL 1RMFH 1XZ0B 4PJCF 4W6XB 1OARH 5E08L 4YHKH 1HHKA 3BKMH 3OHXA 5C07D 2P5WD 3JV6A 3RIAK 3T08A 4Q9QH 2DWEB 2J8UF 2HN7B 1K5NA 4N0FA 3UBXI 3RAJH 2FX7L 3RHWF 5KG9B 1SYSA 2R69L 3IETA 4Y19E 3VCLA 3CNKA 2G60H 4KJPD 4YXKH 4LCYA 4OTXH 3FONB 4KKNA 4P9HH 1CGVA 4U6VH 3I84A 1N59B 1PG7L 5ERWB 1TVBA 4AEHH 1G6RH 4Q74A 5F7LB 2I07A 3I6LD 3T8XB 1HXYA 3L3HB 2V5RA 1X5HA 1KJMA 2ZG3A 3A6BH 3BDYH 5JDJA 5DC9B 4HIIB 4GLRH 4HX1B 4Y16D 5B3NA 4YIQA 1AGCB 2OQJA 3T0DA 4L1DA 4OJFL 2DI8A 4HPOL 3AFLA 1IC7H 5LBSH 4QTIH 1ZAGA 3VW3L 2OTPA 3GMOA 2HKFL 1CDCA 4YBLC 4ODVL 4OCMC 3VE0B 5TE7L 5GRUL 1T0PB 1OCWL 2W0KA 2A6JA 1JRHI 3TVMA 5CD5D 4APQA 1A6VL 5ELIA 2F15A 5DA4A 1IZJA 2NW2A 4X7DC 5I1IH 3HE7C 5F7DA 1WZ1H 1MFDL 5DT1L 5A2IH 3LDBB 4JZJB 1P7KB 1FGNL 1J10A 4WTXA 5J6GB 2FGWL 3H2WA 4MA7H 4GRLA 2DM7A 2XY1A 3ARFD 5FGSA 3AY4A 4O5LL 2VDPL 3QUMA 5CIPB 1H15B 1F45A 3T0WA 3HE6C 1N6VA 2AV7B 2Q7YA 4JFZL 4CMMA 4U6HB 2NY4C 5ALCL 3O6LH 2IALA 1BEYL 1LK2A 3SDDB 1BBDL 1TTUA 3V4UL 1OAUH 2MSPA 4M93B 3F12A 4MA3A 1E27B 3SCMB 1YMMB 5I0ZA 2EDXA 3H9ZA 5FHAH 2WQ8A 1EK3A 1C5BH 1DQDL 5ICXA 3BE1L 5E8NB 3UTZB 1T89A 1HYSC 3CX5K 4EVNA 4U1KA 3VJ6B 1JUFB 2IC2A 2HFFA 4TULL 3WFDH 3RWEA 1T1WB 2NQCA 4Y2OA 3FMGL 5F6IB 1J9CT 1MRFL 5IF0B 4OFDA 1X7QA 1V3MA 2F8VA 2OMNA 3W2DL 3U82B 5AWNH 4ZUUA 3UC0H 4KTDH 4L29B 4QRSA 3RWFB 2H8PA 2HT4D 3IFLL 4X4XB 4PJ8B 2SEBA 15C8H 3QULB 2W60B 4H1LA 4KPHL 4CVZB 3QEQA 3OGCA 4HUXB 3BGFB 4ZNEE 3ZT7A 3CH1A 1KT2A 3MRPB 4WUUB 4JJHA 5EZIH 1R5IB 2AJZB 3U2SB 1AFVL 3HI1B 2XN9A 4JPKL 4MS8D 4Z7QF 1Y18B 4UAOC 1FIGL 1YPZB 1ZT7A 3V9FA 4GKNA 4U1IB 1XIWD 1NLBL 1NGQL 2XKSA 3MLRL 1HCFX 2FL5B 1G9MC 4JFDB 1FFOA 1PVHA 5GGUB 3O0RH 3CFCL 4UOW0 3RI5F 1N8ZB 3FCTA 1SM3L 4FQ1L 3S37L 4NKIH 1FZJB 4JO3H 3QDJB 3ZYOA 5JXEC 3O6KH 3CVHL 1PKQE 1QHOA 2VLJB 2NTFB 2NXZB 4HT1H 4L1HA 1KN2H 2PTTB 5AG9A 3W9EB 1JF5A 4JDVA 4OJFH 4NN5C 5ANMB 1G9NC 1MWAL 4IOIA 1Q9OA 1TZHA 5IVXB 3MNVA 3VW3H 1HH6B 2NLJA 3DO7A 3LB6C 3RIFF 4G7VL 2Y07H 4OIBA 5I74C 1X44A 1Z9LA 3IYLW 5F9DC 3F7YA 4PJHF 4NM4H 2IG2H 3DWTA 1J1PL 3SDXE 1M4KA 2PO6B 3D1MC 4UIKH 4AEFA 1IE5A 4X0KA 1A3RL 3U7AA 4X99A 3TFKD 3JSSA 1KIUA 2BHZA 4MXQD 1MFDH 3QCVH 2BOCA 2HTKC 5TJWK 1UH2A 3G5XB 1RZIA 4U6YB 2Y6SD 4W81A 5H8DA 4BUGA 1FYTA 4I0PD 1G7HB 1F02I 1NGWB 4PRPA 4XVSH 4YXLL 2IANB 3CDYA 4OIAA 1KEML 1UZ6E 2C4FU 4JFZH 4ZUSA 3EOBA 5KS9A 1MCLA 3KS0H 4PGBA 1BEYH 2HYMA 3FN9A 3E2HC 4HIEB 2AJYL 5DQ9B 1S7XB 2QV2A 1QR1A 1T20B 1BBDH 2HJLA 3ZDZF 3BZ4B 1HHHB 2DTMH 3D25B 1CICB 5LJYH 3MV11 4ONGL 3QDAA 1OF2A 5IQ9A 1NC2B 5MENB 4FQJL 1BBJA 3CLEL 4HHAB 2Q6WA 4X6CF 4MCYB 5ITFB 4JVPA 1GOHA 1LNUA 3QYCA 3KYNA 4LGRB 2EDQA 5H94A 2BSTB 5FO9B 2Z8VC 5INCA 2VAJA 5KSUA 2E8YA 1EXUB 1YEFH 3MRMA 4F3FB 3CFDB 1IQDA 4KKAD 3DIFB 3HUJF 5ICZA 1AP2A 3FO1B 2EECA 3TT1L 3VD4A 4KHXH 4ALAL 4AMKL 3QWOA 5JW3H 1PY9A 4WGVB 5I30L 2Y06H 3V6OA 1L7IL 1NGQH 1UB5B 5KJRH 1TZGL 4P4KD 1EFXD 5C7XL 1ZLVK 4RMWA 5B38A 3R1GL 4OCLC 5DMGC 3P11H 3UAJD 4HIJA 1H5BA 3U46B 3ME0A 4UQ2B 3SHSA 3MA7B 4OF6A 3IXTB 2BC4B 5DHVH 1NEZA 3KNBB 4A6YB 2CDFA 4MNHA 1S7UB 4J4PA 1HOCB 3C8KA 4NN6C 4FFWD 4XPTL 4NQSB 2B4CC 4FQXC 4JRXE 4G6FB 1GH7A 5ACZB 3OKYA 4L4VE 4Y1AE 5HYQB 4FQPA 4XBGA 5I71B 4WWKB 4N5UA 3OR7A 4Y19B 1U8JA 3UTSE 5EUKB 3THMH 3MUGA 4RFNC 4LVHC 3S6CA 4CDGC 5SWSD 1BF2A 1TNNA 3FHAA 1FNGB 5D7JB 2A9NL 4KGJA 2YC1A 5ESAB 5DUPL 5FK9A 1T6VN 5EBMA 1KB5L 2HP4A 4GG8B 3DX8A 2B7DT 2GJZA 1A4JB 4OZ4A 3T3PF 2GK0B 4JFHD 3U83A 5D7KE 5C09A 5LCVH 2XZQL 3KR3L 3PWJB 3B8YA 4ZUTA 4LSRL 3HAEH 2R2CA 5TDPB 3QEUB 3VWKC 1CD1A 2R0KL 5D96B 1LEGB 2FBOJ 4OZFA 4MZ3A 1MIEL 1A6UL 5E2WL 2AJYH 3CFIC 5EIIB 3MROA 3AS2A 1N3NB 4LSTL 3QWQB 1X4XA 2EDBA 5F93C 3FFDA 2CKNA 1QFUH 1WBZB 1WTGT 3RFZC 1G9NL 5L7XH 3PL6B 5E7BA 1BFVH 4JG0H 2E7CA 3VD9A 2XWBA 3BX7C 3BH8A 5KSVA 4Y5XA 1PAMA 4UOJA 4MA8L 5A43C 4G9DA 1B0GB 4H8WC 1NFDE 3RZCB 3TBWA 4LKCA 1FVDB 4U1GC 4PP2B 4G6ML 1BX2B 1T2QL 1MCEA 2X09A 3HE7D 2EDWA 2J6EL 5FOBB 1XGYH 2Y72A 4K7FB 4QTHB 5DTFA 2GSGB 3IDIB 3VFPA 4LDEB 3INUH 3NIGE 3HG1D 5ITBL 1TJGH 3VFNB 1RVFH 3TT1H 1NAMA 1HI6A 3EYOA 3HE6D 4B41A 4AMKH 1YYMH 4LSVL 5DJDA 2NY4D 5CHNB 4NNYA 1S9YA 1RURL 4Y2DA 5MEQB 3WNNA 3GHEH 5IQ7H 3BUYB 1TZIA 2VZVA 3WN5A 1INEL 2OR8A 3N1QC 5IMKB 5TH2A 5E00A 1MLCA 2CO7B 4CJ0A 1V7NH 3ZT6A 3SKMB 3VA6A 1NDGA 1W72H 4EI5B 1X5KA 4I13B 5DK0B 1KPVB 4M6MH 5DVMA 5EOQL 5C8JA 4PYHA 5EZJA 5KVFL 1A47A 1UH3A 4P3DA 5JOPD 4PGCA 2V2WA 2FATL 4HG4K 3UTQB 1XGTA 3QXDB 1N64L 2BSSB 4F2MA 2ICEA 3QDGA 4X7TA 2QSCH 1JN6B 2DTSA 4AK1A 5KOVC 1DBBL 4H25B 4HS6B 2ZG1A 2X6MA 5I1AB 2FO1A 3WE6A 3VXTB 4QHLB 1G9MH 1GGIH 1AR2A 1PKQB 1SJEA 3HRZA 5D7LE 4YHNB 5IBTH 3C09C 3KYMB 5ADPH 1A7RL 5E1AB 1YDPB 1XZ0A 4LSRH 1DSFL 3HZMB 2DYPA 2R0KH 5D2NC 3DVGB 3X3FH 4GRMA 4RMRA 2B4CL 4GW1B 2HN7A 3I50H 5ISZE 3M1BB 4NQXB 3SDXB 5JXED 1TVHA 2MQ0A 2AP2A 3NFPB 1C7SA 4JFFE 4P23C 4PLOB 4R3SB 3KPNB 1I9RH 3DGGA 2AERT 4ZFFA 2QLVB 1YNKL 4CU7A 1WFNA 1QACA 3H9SD 2FB4H 5GGSB 4ZPTB 3HC4L 3LZFH 3LB6D 1N59A 3U4BL 5ERWA 4MB3A 2DLGA 3L7FA 1FSKC 3WLBB 5BZWA 3T8XA 3CUPA 3RNKB 3S9DB 5LWYH 2AK4D 1D6EB 5EG6C 2IWGA 1R6VA 3MV7D 4D9LL 5C0FA 1YJDC 1RK0B 4PGEB 4WU7A 3AU1B 4ORGB 1KTKE 3HRPA 2Z92B 2NY0C 3FTGB 1QFWL 1JHLL 5L0QC 1KTDB 4DTGH 1EJOH 4YAQB 1DUYB 4NJAL 1G0YR 3VDAA 4P2OB 5GHWL 5I73B 4NC1E 4S1SH 5ESQB 3AS1A 2ORBH 4X6DA 1M71B 4JHAL 1RZ8B 2J4WL 5GZOC 3BT2L 2DAVA 2YXMA 5TFSH 1P7KA 1J05B 4D9QD 5J6GA 4NO0D 3UO1H 4Z0BL 1KELL 2NNAB 5DUMH 3DUHA 2PR4H 3FQUA 4JFPB 5ICYB 1WICA 1QD0A 4H8WL 1H15A 4Z7OF 1A8JH 3HTLX 3UTTE 1TQBC 2AV7A 1SBSL 4G6KL 4O02H 4U6HA 5IJKA 4U1MB 3SDDA 1TQCB 4EUPB 4WFHE 4KUCF 4WFEE 1XCQB 2ZUQB 3K74B 1BF8A 2VN4A 1KTLA 5C0DB 3SCMA 2Z9TA 5IT2L 1YMMA 1N64H 4OF7A 3FO0L 5C0BA 2MQCA 4IRJB 4G7YH 5E8NA 3UTZA 2P46B 3CZFA 1RD6A 1P69B 2DQGH 1GIGH 4LVNB 5CJ8A 1P4BL 3VJ6A 3IDYB 1JUFA 4ELME 3LKRB 3IDGB 3V0WL 3VA2C 1T1WA 3T77B 1CGSH 3FB6A 3SKUD 5JMOC 1H8NA 1MY5A 2BFVH 4DKAA 1MUJA 4L29A 4JRXB 3RWFA 4M1GH 4X4XA 4PJ8A 3QULA 2W60A 4L4VB 4Y1AB 5DMGD 4LSQL 4CVZA 5DZLA 3WV0A 3IDXH 2BVTA 1DDHB 1NUNB 3MRPA 1UFUA 3I9GH 4PBWD 1AH1A 3UTSB 2PYFB 4LHUD 5D5ME 5JR1L 5K9QI 4EKXA 5H35A 3HI1A 2EDOA 1PBYA 4X6BB 4HV8B 1Y18A 1FL3A 1YPZA 4U1IA 2LABA 4FQXD 1YNTB 4HXBL 2I60L 3D0LB 3ZE0E 1I7ZB 1ZWIA 4OKVB 1P5VA 4Q9CA 3GZKA 1X5IA 1NGYA 4OSUL 3G08B 3DYPA 5DJXA 1I8LC 1OW0C 3CSPA 1CE1L 1N8ZA 5BV7C 5F97E 4XRCB 4BZ2H 3FRUA 3P9WB 3QZWG 4Y4KC 5IG7A 4D9LH 2XA8L 1G7IB 1KXQE 3W9EA 3P0YH 4C83B 3UMTA 5ANMA 4R0LA 3TESA 4XNYL 5IVXA 4AL8H 5KSBE 1MFAH 4P59L 1OAZL 1HH6A 4DN3L 1NCAH 2XNAB 4K3DH 5B21A 5AYQA 4UQ3A 5I15L 4LDOB 1M6OB 2BVPB 2FX8L 4DUXA 3VWKD 2P49B 4DZBA 1OQOA 3KYKH 4DKFH 3IJSB 3T0XA 1F5WA 1NFDB 3RWIB 4NUJA 5EORH 1W8NA 3FOMB 2EKSB 3LQZA 3MLXH 4U6YA 2FGZA 1A7NL 2HVKB 4WFFD 4K94C 4WV1B 3GMLB 1G7HA 5F3HA 1NGWA 4K3JH 3MRKB 4P5MB 2FEDC 1L6ZA 2GJ6D 2DQDL 4M7JH 3OL2A 3RJQB 4ISVB 4X83A 4KJYB 3ISWA 5FYJE 3D48R 1SBSH 1CGYA 5JOFA 5MHSD 2IJ0C 3RPIB 1NKRA 4ZS7L 1GGBH 5F96L 1S7XA 1T20A 3SGKA 1ZANL 2PYEB 3SGDI 3ILQC 3BZ4A 1X9QA 3RGVB 3MGOB 1HHHA 2AGJH 2R0LH 3D25A 1FJ1B 1IC4L 3VH8G 5TF0A 1AKJD 1NC2A 4ZUWA 1GGCL 2HG5A 3ZYJA 4HWBA 5ITFA 2QKIB 1T5WB 3WFZA 3GBML 1W0VB 2MMXA 4TNVF 5HSFA 1AC0A 2OJZL 1QP1A 4L3EA 4U1SA 5FO9A 1RJYB 4ONOA 2YRPA 5HY9B 1UWEL 2DWDA 4F3FA 3CFDA 4NQCA 3DIFA 4RISL 1U93B 3LH2L 1MPAH 4M6NL 3FO1A 1P84K 4OFIA 4DGYL 4X5XA 4Z9KB 1MCOL 3MACL 1F6AA 4QY8B 4DEPC 1IM3A 5I1GH 1HSAB 3W5MA 5HI4C 2I60H 2NY2C 3BPCA 5DYOB 2X89A 3VFGL 1QSEE 2NY5H 4LU5L 4QO1A 3JV5A 3SN6N 4D0DB 1KFAH 4LFHD 1NFKA 5D7LB 3MA7A 4GRLC 4Q97A 1T7ZA 3BPNC 4OBSA 4OLUL 2BC4A 3AY4C 4JRYE 2VZ3A 4I2XA 3QG7H 4A6YA 4J3OC 1LO4L 2Q8AH 1HOCA 1QSZA 5IKCB 2BVQA 2P48B 4NQSA 2ZP0T 5E03A 5FA4B 5ACZA 1HILA 2HFGL 3Q5TA 5ISZB 4OV5B 5HYQA 5I1CH 4JM2F 5B39B 1QSFD 4XNYH 3SKJL 4JFFB 5LXGL 5E8DL 4RFEB 4Y19A 1SBBA 5L9DL 4OZGE 1J88A 2OSLA 4MCZB 1CFVL 5F9WB 3PWPB 1WEJH 3Q48A 1Y0LB 3DUUB 5D7JA 3C5SB 5C3LD 5ESAA 4J6RL 2NY3D 2VDOL 3FN0H 4GG8A 5EWIH 5FM5O 1I8IB 1XCTA 3GHBL 5ID0A 1NGPL 3GJFA 1A4JA 4RRPG 4P23D 4NKMA 3QDMD 3FQNA 2GK0A 3B2UC 4UNTA 2VLME 1C7TA 1HYRC 4D9RE 5IROA 1TXKA 3V2AR 2ESVA 4OI7A 2YD8A 5D7SL 4XNXH 5C07E 2P5WE 2GSIB 5TDPA 3K2UH 3QEUA 3T1FB 1LEGA 3DRQA 2IAMB 1RSFA 4QXTB 4A2LA 1V5JA 2R23B 3OZ9L 1N3NA 1YJDH 5L8LB 4MAUL 1JZ3A 1KG0A 1FIEA 1WBZA 2D9QB 3PL6A 4C58B 4PLKC 1Q0XH 1T1YB 1CD8A 1XR8A 4WUKL 4P3CL 4F58H 5GGVL 5HGHA 3MUJA 3RL1A 1GGCH 5MI0C 3MRBA 4F33B 3BHBA 3I6LE 4P99A 1AQDA 1B0GA 1JTTA 3RZCA 2IPTL 1SJXA 1FVDA 2WIMA 3RPKA 3I85A 3JTSB 3MREB 4XP9H 2OJEB 3UTTB 1MCDA 2GFBA 4WHTB 4ZDHA 5C08B 4K94L 3REWB 4PLNC 5DRNA 5GZOD 2VDMH 3H3PL 4OM0L 3B4NA 4LHQB 3LS4L 4ZS6C 3IDIA 2HT2C 4GAGL 5ADOH 4LFHG 2RGSA 4JM2C 1MHEA 1I7RB 3MACH 3MJ9H 5CHNA 3O4OC 3AMKA 3SGJA 5MEQA 2QBWA 4JO2L 1VEOA 2VYRE 4WO4C 1P4LB 4X7EC 4FRWA 3BUYA 3NGBC 3L3OB 4WHYH 5KN5A 2BRQA 1PSKL 5GJSL 3J8F7 5IMKA 1LEIB 4HZLB 5DVLA 4ZOCA 4U3CA 1AGDB 1T83A 1A9BB 2V7HA 2IGFL 3SKMA 5HYSA 4EI5A 5IMLB 3V4VL 5HDOA 1OM3H 5F9OH 4ZNEA 1OAKL 1OT1A 5DK0A 1ODAA 3B9KC 4JDZA 3QNZB 5HYJB 2X4TB 3V52H 2NYYC 5D5MB 4HMEA 3QNXB 1NCCL 4JR9H 4YBQC 1LD9B 1G1CA 4HFWB 4MSWA 3Q2CA 3SE4C 4BFIA 1CZ8H 3DX7A 3C5JB 3MRDB 3KPLB 5F7EH 1YN6B 5GS0C 4ZOAA 3LN5B 5EOTB 2ED8A 5IGXL 2NY6C 4I0KA 1CFVH 2BSSA 4D0CB 2UY7A 4CMHC 2WP3T 1JN6A 5SV3A 4J6RH 4GAJL 2VDOH 4H25A 4XPGH 2KZWA 4HS6A 1SYVA 3O3BB 5I1AA 2R0WL 4JKWA 1PQZB 1INDL 4YC2C 1PKQA 3MXWL 4YHNA 1I3VA 3BO8B 3ARUA 3KYMA 4GMSL 2WWKO 1ACYL 1YDPA 3H0TB 5BV7H 2AXJA 5D7SH 5AYUH 3VRJB 2VABA 5KSBB 3SDYL 4WTZG 4KDWA 3DVGA 3BFOA 4G6AC 1BQLL 4HKXA 2CSPA 3NFPA 4Y4KD 1IJ9A 3VFMB 4R3SA 3KPNA 1RZGA 1Z6JT 5FKAB 2CPCA 3CMOH 3RVUC 5GGVH 5GGSA 4ZPTA 3W11C 3PHOB 1H5BC 3GBLA 4BUHA 2VWEE 1KYOJ 3RNKA 2XT1B 4ZTOL 2FLRT 3CVIL 4X9FA 1JK8A 2WBJC 4LBEB 4GS7B 4NNPL 1D6EA 2K1MA 4LSUL 4J4PC 5BO1H 35C8L 1KBGL 1MQKL 1RK0A 3NPZB 5M94B 5DD3L 1BQUA 2QEJA 2DS4A 2VE6B 4JY6B 3AU1A 3O6ML 4ORGA 3KJ6H 2Z92A 2R4SH 3FTGA 3A6CL 4LSPH 4NKQB 4KDVA 4ZD3H 1DVFC 4ZFOL 2FEDD 2R2BA 4YAQA 5LQBL 2ZKHL 5D72L 2WINA 1F6LL 4WHYG 1DUYA 3OF6A 1NDMA 3QEHB 4P2OA 1M7DA 5ESQA 1NBVH 3IXAA 3S5LG 1KJ2B 1J1OL 2C9AA 5T1LD 1XF2B 1IC5H 2IQ9L 5EN2B 1A6AB 2MNUA 5F7NC 1UA6H 2IGFH 3F8UB 1Z3GL 1KCVL 5BS0B 3BIKA 3C60B 1OAKH 3RKDC 3VXPB 5F7MC 1JI1A 2EDRA 4M7ZC 4XI5C 5C6TH 5JNYB 3MJ6A 1RUQL 3S35H 4AM0B 4L8CA 5AG8A 4YDKL 5B3JE 2HKHL 2G75B 2IMMA 4KAQL 2UZIL 1XCQA 4F57H 3NH7L 3CDFA 2ZJSH 1JIBA 5C0DA 5F1NA 4Y89A 3C6SB 1QSEB 5KBNC 2VITA 3FAWA 4IRJA 4Y5XC 5L8KB 1CFTB 2DIBA 3ARBB 3TF7C 4GAJH 4PJFF 3IDGA 3T77A 4MDIB 5DQJB 4JRYB 2YA1A 4P48A 2R0WH 3CFKB 5D93C 5HI4D 4FQQB 4PTUB 3CFBA 3I75B 3ZL4H 1L7TL 3H9YA 4L4VA 4Y1AA 3VXOA 1WZKA 1GCFA 5FYLH 1CN4A 5HYEA 3QUMH 5CCKL 1QNZL 5BOZG 3UTSA 3EDKA 4OZGB 5EUOA 3DHMA 2GCYB 3OKNB 1IL1B 4S1RH 4ETQB 1MJ8H 3T2OA 1WWAX 5DR5L 2DKUA 3WCYA 4OLXH 3HI6L 1I7ZA 4OKVA 2EE3A 3F6LA 4E41D 4YDLC 1BWWA 4KY1L 3DETC 2J3SA 1RUML 4HJ0C 2IBZY 2B2XL 3UCRA 3L3GB 4UIMB 4JY5L 2WLYA 5DS8A 1JWMB 1OP5K 2I5YH 2XKNA 3G08A 3GNMH 5KVGH 1DUZB 3PGDA 5FUZH 1U8NB 5C07B 2YD4A 4XRCA 5HDQL 4NNPH 2YMXH 3V5DA 5KSAD 1IT9H 1V8HA 1OTSC 1CLZL 3ZTJG 5SX5H 4XPHH 2GJJA 1OSPL 1F97A 3EYVB 4JE4B 3HN3A 3B2UD 1CFNB 4H1LH 4CU8A 3O6MH 1IGIH 1R3HB 4RBPH 1JRHL 5SWSE 4LLVB 2XNAA 5AZEL 3KJ4C 2H6PB 4M1DL 4ZSOA 1M6OA 2VLKA 2Q3ZA 4HS8L 4LPXA 3IJSA 3LQAC 5FEBA 1NFDA 3QPQC 1AHWA 1P7HL 1XF1A 4JFHE 3TNNB 5E24E 4HCRA 2EKSA 1K4CB 3S88L 3D85D 4KV5E 5K9KB 3C8HA 4Y16B 2DICA 1KENL 2HVKA 4PLKD 3PGFH 5EPMB 1C12B 2AJVH 3GMLA 3I6GB 4P5MA 5E5UB 3MRKA 3PUCA 4OGXL 4DK3A 2LTQC 2VXUH 4S2SB 5I6XC 5E4EC 1I9JL 4JREC 5IBLC 3RPIA 3GIZL 1JNHB 4R26H 4U1NB 2ZUTA 1RUQH 4ZMAT 4YDKH 4DJMA 4E5XB 1J5OH 4IDLA 2P7TA 3NH7H 3RGVA 5DJ0A 2ZOKB 2JJSA 3PNWA 4LASL 3QUYA 1LGVA 1XEDA 1D6VH 4DOHE 3HKFA 4IRZL 4ZS6D 3GJEA 3GKZA 1RPQA 3ARFB 2HT2D 3O3DA 1U91B 2MCG1 1YEHL 2OS7A 2QKIA 4LIQH 1BFTA 4IMKA 4JM2D 2X9XA 3RTQA 4FMKA 1RJYA 4WO4D 4C56D 1PG7W 1QUNA 1NCWH 3HG1E 4GW4B 3S97C 2DDQL 1U93A 3GSNB 4PB9H 4K7PY 2D7TH 4JN1L 3ZKQD 2R8SH 1CVSC 3IAQA 4I18C 4RMTA 4PV9B 4QGTA 3B9KD 4XVTL 5CEXB 2YPLB 1Z0NA 3FT4B 1CIDA 2NYYD 3GMNB 5SX5K 1VENA 4YBQD 4H0IA 5C2BL 2AI0H 3K4ZA 5GS0H 2P24A 2EE9A 4RBPK 3VXNB 4HUVA 4RFOH 2J8UE 4D0DA 1OAXL 1J8HA 5GS0D 4KKLC 5D7LA 2NY6D 4TVPL 3PV6B 5I18H 1R3IH 1L6XA 1PGRB 4Q6IB 3BN9C 4H1LG 4UNVA 5IJKC 5FA4A 5J0BA 3IVKA 5F1OB 5ID1A 5ISZA 4OV5A 1OSPH 3BZDA 5HHXH 4IS6B 5JOPE 3WHXB 1XIWB 4NOFA 5DRXB 1UM4H 4M43L 1LO0H 4JFFA 4JPIB 3UZQA 1WWWX 4G6JH 2ADGA 3NACH 1FAIL 4MCZA 4UU9B 1ED3A 4XPFL 3KPOB 4OD3H 2WZPD 3C5SA 2A6IB 3TIEB 2D0FA 2YD7A 3IAPA 4PJ9D 3OKEB 4MXWL 3DO3A 3HCVA 5CAYB 4S0TD 3MRLA 3A67H 1BIHA 1OD9A 2MCPH 4HKBB 2AABH 3C5ZA 3NN8B 1D5ZA 5IB1B 2X40A 1ULVA 3QDHA 5T3XL 1GXEA 2WUCL 4JDTH 4MX7B 3RVUD 2C3XA 1P2CB 1VGEH 2VDLL 3W11D 1K4DB 2GSIA 1JPTH 1A7BA 2FEEL 3OB8A 2VIRB 1I9JH 1KV3A 1EVTC 1IGFL 1T04B 2WBJD 5JW4M 4YQXL 2FHFA 4J4PD 4ZPVA 3H9SE 4X5WB 3NPSB 3P3YA 4NRYA 4BYHA 5JMRA 1X5FA 3OBAA 4MWFB 4OLVH 4KQ4L 1JGDB 4PY8J 4F33A 4I0PB 2WM0A 1ZK9A 5GS1B 1DVFD 2XZCL 5BVPL 2AK4E 2DL2A 3LQAL 4CL7A 1T66C 5GGRB 1WQVT 5F7UA 3JTSA 3OTTA 3RDTD 2EH8L 3MV7E 3VGEA 2OJEA 3UTTA 2H9GB 5HVGB 4M02A 5FM4A 4WHTA 5HGDB 4C57C 3REWA 3MNZB 3PDDA 4KRLB 2W92A 4R0LC 3LKSB 5F7WC 2B0SH 2DMCA 5GZNC 5C09D 1HKLL 4Q9RH 5CP7A 4OZFH 4QNPF 3NIFF 1FRGH 2XPGB 3EJJX 3RKDD 1EPFA 1UEYA 3CPLB 5IVZA 4TTGA 1Q9WB 2Z35B 4P3WA 4ELMA 4OQTL 1P4LA 4D9QE 2BDNH 4KC3B 2C3VA 5T5NG 1LEIA 4TUOB 2NW3B 3QQ3B 3PABA 1LE5B 4TVPH 4Z7QE 1A9BA 2Y25A 2ICWA 4GJTB 4IM8A 1FFNB 5KVDL 5I1KL 1RZ7L 1I1AC 3EYSH 4TVPD 1ZLSL 3QNZA 3MOAH 3VFWA 2X4TA 2BJML 3RWHB 4L3AA 4M6OH 3QNXA 1LD9A 3Q6FB 2E9BA 3EO1B 1YY8B 3QIBC 3RU8H 1G7MB 2FD6H 4NZJA 4P5KB 2CO6B 3STLA 3KPLA 3BPLC 1AJ7H 3MGTB 4WW2A 4XWGH 2CJUL 3MQIA 1A7QL 1EFXB 4TSCH 2YHGA 1WIOA 4HC1A 4WU5B 3B9VA 1S9XB 4UINL 4EXPX 3MLUH 4UI2A 1NAMH 5B38G 3VFOB 2W65A 5DK3A 3O3BA 1CLOL 5L2KB 1NEZG 8FABB 4GH7B 1H3PH 3CVHB 5HVFB 3MJ8B 1NLDL 1DE4B 1FG2A 3R8QA 3DETD 3H0TA 1MEXL 4HJ0D 1HHJB 2EXWC 1IEHA 4LPVA 3RL2A 2DLEA 5T3XD 1BHGA 5SWSB 2VZOA 4LCIL 4LPCA 3TBTB 1IMHC 1EUUA 2QL1A 3STBA 5DFVD 4YQXH 3ZTNH 3O2WH 5F44A 3VFMA 1OTSD 3ROOB 3QHTC 5FKAA 1A7PL 2ADIA 4K3GA 1EHAA 5TE4H 3PP3H 4CKVX 3N1FC 3WUZA 3LKNB 2Z31A 4P2YA 3BPOC 3RVVD 2R1XB 2EEBA 2JK5B 1SMAA 1ND0A 2AQ3A 3ZE1F 1QA9B 1WISA 3AAZB 3QPQD 5GS2H 2CGRL 2A38A 4WI4A 1VB9A 1V3KA 1TCRB 4X6CE 1U3HC 1FN4B 3GIVA 1JHTB 5GS2D 4MD4A 1HKLH 3NCEB 4CADB 4AY0A 1NL0H 1L9MA 4MA1C 3ZKNC 1T80A 4LMQE 4DOHB 1ZVSB 1QG3A 1FO0L 3C08L 4M7KH 4YBLB 4YUEH 1XFPA 1RJLB 3GSQB 1C16B 3V6ZB 3HNSH 1KJ2A 1PEZA 4WFFE 3HE7B 3NIDF 4N90D 1OB1A 4NRZA 5EN2A 5IEKB 1A6AA 4NBYB 4LNRB 2GJ6E 2CQVA 1EEZA 2VOTA 1IBGL 4JLRB 3QCUL 3T4AB 2D4FA 3HNTL 1BAFL 5KVDH 3HG1B 1I4FB 5MHSE 3C60A 3VXPA 5JNYA 4HJGB 3HE6B 4AM0A 2VDKH 1WBXB 1FBIH 3WMSA 2NY4B 3D18A 2WWMC 2ZPKH 3L95B 4H26B 2ATKB 1D5XB 2VXTH 2CJUH 2RHEA 4XP5L 4XT1C 1MJ7L 2BXZA 3D9AH 3B9DA 1MELA 5DVNA 1KC5L 1WT5C 2H1PH 3C6SA 5TQ0H 4Z7NF 1BPVA 4H0GA 2YKLH 1CFTA 4GO6B 1IGJB 5JW5B 3ABZA 3CD4A 1QLFB 4NM8L 3MUZ1 4YHYC 1JL8A 4MDIA 4JRYA 3EO0B 3UPAA 2C5DC 2C4FT 2BNQD 1U8HB 3CFKA 4DVRL 3GKWL 4DVBB 4X4YA 4FQQA 4PTUA 1IEBA 3ARYA 4XNQB 1UENA 4PY7B 1XGUA 1NBYB 2B5IC 2EYRB 5I1JH 3MYZA 3RY6A 1NCNA 3T3MF 4N0RA 5DFWH 3PP3K 2O26U 2V2TB 2CDGB 4KKLD 5IFHL 3UROR 4RGNC 4OZGA 3OKNA 3O4LD 1S7VB 1IL1A 4OT1L 1ZLWH 4ODHH 3BN9D 4ETQA 4YGVB 5HYIA 1IEAA 2AQ2A 2VXSH 3CC5B 4LRNL 4YPJA 1MVFA 1MJJA 3RNQA 4DCQB 4LLMB 3SKNB 1QEWB 3SGJC 4XCFH 1JGEB 1AQKL 4UAOB 3J7HA 2UYLB 3NA9L 3GUTA 2EDJA 3L3GA 1JWMA 3DURA 1T83C 4DWHA 1DUZA 1I75A 3P9LA 2XACC 3U9PL 3I02A 5C07A 2D7NA 2P5WA 1HEZB 2UWEF 5BQ7A 5A2FA 1IM9A 4UZGA 3NFSH 3C9NA 2RCSH 2YD9A 2D3VA 1QSFE 2EYSB 3EYVA 4NP4H 1CFNA 3ALXA 5CILH 1R3HA 5LGJB 1UJ3C 4UUJB 1JZ6A 2VO5A 4NN5B 3H9SB 4NHCH 3SPVB 5C9KA 1FFPB 5L8JB 2H6PA 3ULVH 1S9WA 5D2NE 1JV5B 2A77L 1I85A 5I74B 2HWZH 1UWGL 2CRMA 4RIRB 5D2LF 3L7EB 3BJLA 5J12C 5KTEH 1HWHB 5DHYB 2AK4B 1D9KD 1MNUH 3QDME 2RJMA 4OLWH 3TNNA 5GQBA 3MV7B 43CAA 5K9KA 2M2DA 1DZBA 4Y16A 5E2VH 1XT5A 2Q20A 3IFPB 5HJ3B 4RWYL 2A6KB 3F5WB 1U6AL 4XMLL 1C12A 1NAKH 1IBGH 5CLWA 4M00A 5DO2D 5HHVL 1FP5A 1FFQA 1UCTA 1RUPH 4CN6A 3S98A 1CD9B 1AC6A 5DGRA 2VC2L 4TRPL 2NCMA 4BQ8A 3VGAC 1JNHA 4U1NA 1T66D 5JIIA 1ZGLB 2CLRB 1U0QA 1I7TB 2Z93B 2LVEA 4HBCL 1PX3A 1IGML 2W0PA 3GFUA 4HWNA 1BZQK 4B7IA 2P5EB 1UC6A 3O2VL 5E4IA 1IGTA 5GZND 2FHBA 3ES6B 3PWNB 4M9PA 3ARFA 1C5CL 1U91A 1ZLWK 4DGIH 3NCYP 4R8WH 1HCVA 4PY8I 1FNHA 4ZUVA 4X8JB 1R24B 4XNUH 4LSDA 4YFLF 3GMRB 1FHGA 2WAHA 4P9MH 5CEZL 1HHGB 2WBKA 2FNBA 2J2ZA 5ACMA 1IQWH 1F00I 3CMGA 4ZO7A 3GSNA 5I8OH 1OL0A 4N5EC 3UZEA 4BZ1L 1J18A 2AXFA 4I77H 4PR5B 1YQVH 3U6RB 1SY6A 4LRNH 1I1AD 4IOFC 3VI3F 2GUOA 3U30C 5CEXA 2ILLA 3FT4A 1RZJC 4X98B 3VFUB 3QIBD 3OAUL 1AD0A 3QIUA 3VH8B 1A14H 4CW1A 3VXNA 4GXVH 1DEEA 3WS6A 1Q0YH 3PV6A 1N2RB 4Q6IA 4RMQA 3UJJH 1WTLA 4IHOB 1UVQB 4HWBH 1FGVL 5GRJL 2LAAA 3L9RA 4PJ7E 4LHUB 5J3HC 1F4XH 1QHPA 4U49A 4JANB 1WGOA 3JBG7 4RX4D 3VRLE 4RQQA 5C2UB 4NN6B 4XBEL 4IS6A 3V0VB 3WHXA 1T0NA 1XIWA 4FQXB 5DRXA 3WD5H 4JPIA 4L3ED 2LVCA 4G42B 1EO7A 3HMWH 1ZEAH 3IJYB 5KAQG 1U8KB 4UU9A 1KNOA 2XWJB 2EXWD 1DQTA 1G7JA 5AZ2L 4NQCD 1QZ1A 2A6IA 5DEFA 3TIEA 3G6DH 4RFNB 1KCRL 4LVHB 1IRAY 2CXGA 3OKEA 4Q2ZB 2K7PA 3IDYC 4FTVD 4X6FB 4HEME 1QO3B 3LV3A 1HIMH 2XYCA 4KKBC 3GBNH 5HTSA 5IHBA 3HMXL 4HWUA 1A6ZB 5JQ6L 1MCPL 4HKBA 3NN8A 1OGAD 5IB1A 2PUQT 2QADC 4XMLH 2COQA 4MX7A 1GC1H 1NCBL 1RQ5A 3FO2B 1OTTC 3OSKA 2VC2H 4A6YH 2P47B 3VWKB 5EC1A 4PJGB 2OR7A 3S3SA 4UT6H 1BOGB 1JNNH 2XY2A 5DD1H 3CCHB 4QHNA 5EZLB 1RY7B 4X5WA 4Z7OE 3I3DA 5KVEH 2ZSVB 3JTTB 4MWFA 3ALPA 1U3HD 3O2VH 1CQKA 2YK1L 1HZHL 4W68A 3T2QA 1Z0MA 1CR9H 1JGDA 2HVJB 1XMWA 2WSKA 4NC0B 5DWUL 1C5CH 2FSEB 2RFXB 1F4YL 3ZKND 1LWRA 2QHRL 3FJTA 3PP4L 5GRVL 5GGRA 2VZSA 5CZVL 3RP1A 5IESH 5C6PB 3BEVA 2H9GA 3GJFH 1S9VB 1U36A 2EC9U 3S3PA 3EO9L 1KJVB 4U1GB 1K8IB 2P8PB 4LRIA 2LAGB 4GG6E 2ZUYA 3IKCA 3TYGL 5D8JH 3LKSA 4YXHL 5CEZD 1VGKA 1ZA6A 2NX5D 2ESVD 4WEBH 1AKJB 2O5YL 5C86A 4NT6B 3BZEA 2XPGA 3HLAB 2ERJC 1CFSB 1OLZA 3CPLA 4XMPL 4J3WA 2N7AA 5EU6A 4XGZB 2Z35A 3DTXB 5KS9F 4O9HL 1DR9A 2JIXB 1ES0A 3RY4A 3OAZH 1J11A 1AHWC 3GMQB 2KPNA 3KPSD 1RHFA 2IPKB 4TUOA 2NW3A 3QQ3A 3SQOL 4HEPG 3G5ZB 4N0UE 4U3HA 1J8KA 1P9MA 2XQBH 4DGVL 4PFEA 3QI9C 1FFNA 1FGVH 3X12B 1ACZA 4YWGL 4I0CC 1AE6H 1UG9A 3HC0B 4CDHA 3U0WL 4M48L 3RWHA 5MP6H 4CN4A 1G7MA 4XBEH 3TV3H 3MGTA 3K4AA 4P4KA 1EFXA 4Z8FH 2CXKA 1VFBB 4S1DC 3QUYC 5ENWB 1FDLL 1XF5B 5E2UL 1F3DH 1S9XA 4KVCL 4ODWA 3JVGA 3V4PL 1KUMA 3RX5A 2X4PB 3NAAH 1L0XA 3VFOA 4RGND 1MHCB 3ZYIA 1QVOA 5AEAA 4ODTH 3N9GL 2W38A 3WIFA 2HT3C 3DROB 3O11B 3KDMA 4A2MA 3RTQC 1MCPH 1A6TB 3VXUD 5CMAA 1JMZA 1JPFA 1IAIM 3CVHA 3LIZL 3QUXC 3DX9A 3MJ8A 4OZHE 1DE4A 1QSFB 2IBGA 1F4AA 4C4KT 1HHJA 3TH2T 3C09B 4M03A 4NZRH 3Q3GA 1B2WH 5BXFB 1MWAA 3IFNL 3P4NB 5FHBH 5IP4A 4JPWH 3MV8A 3TYFA 5HHMD 5FB8B 5TQ2L 2H2PC 2NY3B 4FQIL 5D2NB 3GJFK 4OCYL 3S36L 3QHZH 3ROOA 4E41E 4KZEL 3RUGF 4ZO6A 1II4E 4P23B 3QDMB 1RZFH 1HZHH 1AO7D 2UZYB 5JXAH 3GRWL 2I25N 5J1TC 3TCLA 2O5ZH 3LKNA 5IWLA 5FDYA 1CG9B 2R1XA 2EH7H 4OFPA 3U7YH 3U7WL 2CD0A 5CZVH 1FSKB 4GSDL 3CK0H 4L5FL 3T2PA 4OZIF 1QA9A 2NXYC 5CJQL 2AK1H 3OAZK 1I3RB 3CU1A 2E3VA 1TCRA 1FN4A 4NKOA 4CVWA 5IM7B 1XF3A 1QLEL 4CADA 2AJSH 4JFOA 2Z4QB 5I16A 1P1ZB 2FYYA 3K8MA 3T2NL 2F5BL 1Z9SA 2MPAH 4R4NC 4EZMA 1NMBL 2NY0B 3ZHKA 2ARJB 4M62L 5L0QB 3FT2B 1DQJA 5DLMH 4RGMC 2QQKH 3GSQA 1C16A 1B9ZA 5TDOB 1OWWA 5DK2B 2KKQA 5CJOL 3CSGA 2NY7L 3O3AB 4LSSL 3C5ZC 3HE7A 4ZO9A 2IH1B 5D1XA 1YEKH 1T22A 2WIIB 4YHOH 1X5GA 1E4XH 3VG0L 1RUAL 2BK8A 3T4AA 5JZ7D 3HG1A 1I4FA 4X9HA 1DBML 4XCEB 5HHOD 4M48H 2H41A 4XPAL 4HJGA 1CE6A 2NY1C 1MCQA 3HE6A 5A2KH 1TQBB 1WBXA 4RNRA 5I76A 5I1HH 3L95A 1OWRM 4RGOH 5C0IB 1T4KB 4OLYH 2VDRH 3WNPA 4NO3A 5E6ZA 3ESVF 3UJIL 4R7NB 3EW3B 3O9WC 5JHDD 3QT2A 5E2UH 4D0BB 2J8UA 1IGJA 5CJ5A 5JW5A 2K9UA 4N5ED 3GI9L 2OYPA 4YFDB 1YUHB 3WBDA 1GGTA 1RZJH 3N9GH 1G7QB 3VFRB 4P2QA 5SWZD 1KCLA 4PJ7B 3EO0A 5JTWA 5HYSG 4GAYB 1U8HA 1A22B 1AGFA 25C8L 4HCRL 1FCGA 2P4AB 2VXVH 4YR6B 1F11B 1JFQH 4XC3L 3Q5OA 1RFDH 2WMPA 3LPWA 2V2TA 2CDGA 5F7KC 5TGBA 1S7VA 5LVEA 3LEYH 1JHKL 5J9PB 3CC5A 5J3HD 3S36H 2X1XR 2AAVA 3Q1SH 5F88A 4PJDB 3QIWC 3SKNA 1QEWA 4AT6B 3GMMB 1KB5A 1UM6L 4FFYH 5DJZB 2UYLA 2ZSWB 1UXSA 3QUZA 4XNZC 4BSWB 1ORQA 2ZCLL 1HEZA 3WSQH 3CX5J 1EBAA 5JHLL 1KIQB 1UQSB 4HJJL 2BMKB 1MIMH 5JXEA 4KKBD 5IOPB 2EYSA 3IF1B 4Y4KB 4EN3C 1VESA 4HKJA 1N5AB 4WW2C 5I9QC 5LGJA 1JTPA 2YEZB 2QADD 4KK6C 1LO2L 3H9SA 3HI5L 3SPVA 1J12A 4M7LH 3PWUA 1OTTD 5CINH 1PY4A 1A3LH 2N1KA 4BSVB 2WUBH 4RIRA 5I1EL 5J57B 1OOAA 2AJXH 3DYMA 4L8DB 5DHYA 1R5VB 4YNYA 3MRHB 2X1OA 4XP1L 1OTUD 4YZFF 4JG1L 3MV7A 1YEEH 1D5BB 3IFPA 2DQHH 4LEOB 5CP3A 1LO3H 1PZ5B 3F5WA 3V6FB 2WV3A 4AIXA 4GG6B 1CGTA 4QXWA 2BOBB 4ODBD 2J6EA 3IGAB 1DBMH 1GHFH 2X2YA 3BW9B 2UZXB 3BMWA 2CLRA 2AEPH 2Z93A 1EH9A 1JPSL 5E70A 4L8SA 4G3YH 3BI9X 4JKMA 4OM1H 3UX9B 1CXHA 3UJTL 1UCBL 5TPWH 4NGHL 4HAGA 1B6DA 5T1LB 4UTBL 5T1KD 4JAMB 2W9LA 1SYSB 3IETB 3STZB 3VCLB 5SV4A 1A7OH 4NO0A 4HMDA 1G84A 4MB5A 3ES6A 2A83B 4GUPB 3PWNA 4LCYB 3WO3B 4N0UB 2Z31C 3ZDXF 2VL5A 2VLKD 4JCLA 1Q72H 4TOYL 2J12B 2R2EB 4XAKD 2I07B 2IPUK 3GMRA 25C8H 4HCRH 1HXYB 2EDDA 1HHGA 2A6DB 1KJMB 5C09E 1WVZA 1JCKA 4ZTPH 4YIQB 5FO7A 3NCMA 2IPUG 1FLRH 4MAYA 1WCQA 3QI9D 1K3ZA 4PR5A 1B3JA 1QLRB 3GMOB 4HD9A 2MWCA 1MAMH 1LILA 3NZHL 3PXHA 3TN0D 5KANI 4X98A 4Y5VC 4CVUA 2ZCHL 5KZCD 4DEPB 2YUZA 3VFUA 2LE9A 4XAWL 2KBGA 1MRDH 4Q0XL 2GY5A 4I3RL 4ENED 1FORL 2NY2B 2ZOLA 5F7DB 1EHLH 3O45B 2F9BT 1C1EL 4S1DD 4OZHB 3QUYD 1N2RA 4NWUH 1UVQA 4UTAL 3LY6A 5DUBB 4TVPE 4UV4H 2I26N 4GRLB 4LHUA 3BPNB 5JHLH 3WO4C 2C7UA 4JANA 1DBAL 3QUMB 4HK3J 4PJIE 3TA3C 4E42A 2HT3D 2IFFL 1U2HA 4AEIL 1UXWB 3B8SA 5FKPA 2CRIA 1TTFA 5E2JA 2VDQL 3V0VA 3DSFH 4GXUM 3RTQD 4CMMB 1MFNA 4FQXA 5K9JL 3MRJA 1E28B 3MOBL 3QUXD 3DYOA 1KF9B 4E41B 3IJYA 4FQ2L 1U8KA 2XWJA 4N1EA 5HVHC 5T33H 4PJEF 5LAXB 3GI8H 4CU6A 3F12B 4NN7C 4MA3B 3EOYG 4N8CL 5DMIL 4Q2ZA 4XBPA 5ICXB 4X6FA 1QBML 4AIZA 2HLAB 3M07A 4U1KB 1GAFL 4RSVA 4F8QA 3RWEB 4OCNC 3SE9L 4KHTL 2Y5TB 2UV3A 3RY6C 3E1F1 4X6CA 5T3XE 5A40E 3FO2A 1EBPA 4ZUUB 4M7LT 1P5UA 5BMFH 1J8HD 3EDFA 1YN7B 2F58H 2YPKB 2DQTH 3QEQB 4TNWK 5EA0H 4LGPB 3JWDH 1K2DA 3CH1B 1VPOL 4ZFOB 3VMOA 1CDUA 3BSZH 4ODXA 5GRYA 1Q8MA 1TETH 1CDIA 2P8MB 4OCRH 4TPRL 2NXYD 3CCHA 1S7TA 3UJTH 3LRGA 1I9IL 3HUJA 1N0LA 2ZSVA 5IW6B 1ZT7B 4GKNB 3D85B 4NCC1 3TT3L 1CDHA 5IVXF 3D2UA 3PGCA 4NHUB 2FSEA 2RFXA 3BDBA 4U4BA 5EOCH 1FFOB 2GJ6A 5MI0B 2BY2A 4KTEH 5I19L 4ZFZB 3NCJL 3VFSB 4J3VA 3KS0J 4MQXC 2CK0L 1S9VA 3FCTB 4ODSL 2DQEH 4JKKA 1LO5B 2GTZB 5DRWB 4XP4H 1K8IA 2P8PA 3EYUH 3MLZL 3C6LC 1AI1L 3C5ZD 3VXMD 5MEOA 2Y9RT 4PB0H 2APXA 2A0LC 5EBLB 1AKJA 2W9DH 4QYOA 5ALBH 5I8EB 4NT6A 2YS4A 3MV9D 1RIVH 5DC0A 1CU4H 4FZ8H 2NLJB 2Q8BL 4XVUC 1CFSA 1EO5A 3F7YB 3RQ3A 2NY1D 1K85A 4JM2B 3P2TA 3C8DA 4RMSA 3DVIA 4B5EA 4HGMA 3O4OB 3GMQA 3P30L 4N90E 4X99B 1BJMA 3RA7H 1S9KC 3E8UH 3U9UB 4ZFGL 3WEXB 2IPKA 4WO4B 4Y0GA 3G5ZA 2BOCB 3NGBB 5FDWA 1LE9B 3O9WD 4PRID 5H2BB 1SHMA 3X12A 1E4KC 3FRPG 3AB0C 3RWCA 3ZDYF 1RU9H 2X05A 2XXCB 3B9KB 4HQQH 5JW4R 4ZUSB 2VDQH 1HINL 3EOBB 4I5BA 4PGBB 5K9JH 2XI9A 1MFEL 1MCFA 1TTGA 1BM3L 2HJLB 4P0DA 2YWYA 5ENWA 4NZUL 2NY6B 3WDJA 1F6FB 1IFHL 1VFMA 2AEQL 4CMHB 4YHML 3MA9L 3DROA 2BNQE 2Q6WB 4NPYA 4K23H 5EZOL 2GW5A 1A6TA 1XF4B 3BH9A 1AXTL 3QIWD 3GSWA 3CFJB 3KYNB 2DF3A 3EOTL 1QSFA 4YC2B 4N8PA 1DQLH 2GKIA 2YD2A 4NJ9L 3O4LE 4TUKH 4DZ8B 5BXFA 5KSUB 4V1DD 1IILE 5IFJB 3QPXL 2OL3L 1IQDB 3ARTA 1QFPA 1CD0A 5D2NA 2VLRD 4CUCA 1BFSA 5E2TH 4KMTH 4LARH 3ARRA 4EQ3A 3QWOB 1RHHB 3HC3L 1YEJH 4P23A 4MNGE 4LEXL 4WENB 4MYWB 4EN3D 3QIUC 4HC1H 4OD1H 3TT3H 3LVEA 4KKCD 4HG4J 4UT7L 4QEGA 4KK6D 4QXGH 3D6GA 3DX6A 3F65A 1KTRL 4JGJA 3MLSL 1H5BB 2B1AL 4PGDA 4IDJL 2P43B 2CK0H 5E99L 3RWGB 3Q6GL 4P46C 2WBJB 1I3RA 3U79A 1NEZB 4WDIA 5IW3A 2CDFB 1P4IL 4MNHB 3C8KB 4N0CC 4DW2L 4UV7H 2VDNH 1EV2E 5GISL 1H0DA 2YPVL 5D1QC 4JKLA 1ZHNA 1P1ZA 1HH9B 5DFTA 1UM5H 4UDTA 3WXWL 2A9ML 2JB6A 4IRSD 3MRNA 4WCYL 5L88L 2EC8A 4PGZA 3FT2A 1DVFB 3REVB 1W0YT 1R3LA 5D70L 1IVLA 3IB4A 4K3HA 1RAMA 5TDOA 2YC1B 4XTRC 3RDTB 4POZC 2ICCA 1Q9LB 5DK2A 5EBMB 3MSPA 5JUEL 1CLYH 2VXQL 3L1OL 3O3AA 2HRPH 2IH1A 2GJZB 5FCUL 3QBTB 2WIIA 3OPZL 2X9YA 2VL4A 3KLAA 5C09B 2VQ1B 1QKZH 3D39D 4XCEA 3TLRA 1IGCL 1LP9E 5FYJH 2HRLA 1ZKAA 5EIQA 1CD1B 5CJXA 3ALWA 4M7ZB 1FPTL 1CIUA 2D03L 5C0IA 1T4KA 3MROB 4PS4H 3NOIA 5EBGA 5KANG 4QRPD 5C0RH 1KIRA 3C2AH 4R7NA 4TTDD 4HIXL 4HS3B 4D0BA 1R0AH 2WK2A 4XMKL 4JHWH 5CGMA 4R90L 1I9EA 2FO4B 3BH8B 1KXVC 2LQRA 4Y5XB 1YUHA 1CCZA 2J7LA 4CAGA 1G7QA 3VFRA 1J0JA 4PJ7A 4G9DB 1KJ2H 4O2CB 3U0PB 1AXTH 4YR6A 1F11A 2ZUUA 4PJIB 1DBKL 4FABL 3WFCH 3EOTH 5D93B 4BH7B 2VLLB 1CGWA 3L5XL 5D4QA 5J13C 4NJ9H 4KI5F 3V8OA 1JVKA 4B50A 5FGCE 4JM4L 4K2UL 4G8GD 5T3ZH 2OL3H 4GKZA 5C0NC 2OMBA 5J9PA 4J23A 5JOEA 2R4RH 4B53A 1N0XL 6FABL 5AD0A 5T3ZD 4KGLA 1EX0A 2DI7A 3TA3D 1E6OH 5C92A 5JW4Q 1G9EA 1DBJL 1DN0B 4EOWL 2R0ZH 2F8XC 2I9TB 4NNYB 1S9YB 5LGHL 5FV1L 3TPUB 4XB7A 1QBLL 4YDLB 2R29L 4BSWA 2VQUA 4N0YH 5DD5L 4BZYA 1JGVL 3QP3A 1TZIB 3MRCA 4JO1H 5J6HB 4LCCC 2FX9H 1OHQA 5TH2B 5E00B 1OW0A 3SJVD 1MLCB