1ANUA

Cohesin-2 domain of the cellulosome from clostridium thermocellum
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
138
structure length
138
Chain Sequence
VVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cohesin
molecule keywords COHESIN-2
publication title A cohesin domain from Clostridium thermocellum: the crystal structure provides new insights into cellulosome assembly.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 28
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1anuA00
3F2LA 4N2OA 4WKZB 3GHPA 3BWZA 4IU2A 1G1KA 5G5DA 4UYQA 4IU3A 4FL4B 4WI0A 2OZNA 2VN6A 1TYJA 2BM3A 2O4EA 5AOZA 1OHZA 2CCLA 3KCPB 4U3SA 3KCPA 2W1NA 2XDHA 1AOHA 4UMSA 2Y3NA 2VN5A 4DH2A 1ZV9A 3L8QA 4FL4C 3UL4A 2ZF9A 4UYPA 5K39A 5LXVA 2B59A 1ANUA 2VO8A 2JH2A 3FNKA 1QZNA
chains in the Genus database with same CATH superfamily
3BPCB 2B2XH 2IH3A 4A7SA 5I1HH 3MNZB 4NSKA 3UTSD 4WCYH 3QISA 1EHXA 4GQQA 4DP4X 5D70H 1IGCH 1ONQB 2VDOB 1U8HA 4WNJA 5GRZA 1SUJA 3QQ9D 4JFDA 3F7VA 2C9PA 2EC8A 5ESVB 2APWA 5I75B 2NXZB 2QL1A 4HS3B 1P5UA 3ARXA 4JKPL 4KQ0A 3MJ7A 3O45B 5DD6A 4L3ED 1BQUA 1KJMB 1CD9B 5AB1A 3QZWG 4LKCB 2L4OA 4IKJA 2HN7B 1E2WA 3QRGL 4Y4HB 2HVJB 1JUFB 2WXRA 5T1LD 1ETA1 2CIIB 3LZRA 2FEDC 3HNSH 4YMPA 1K5WA 2LLGA 1YAIA 4WY7L 2WUCH 5KJ7E 5DJXB 5JXED 2F2HA 4OCMC 4WFGE 3QBTB 4U49A 2X4OB 4UMGA 1A7OH 3PWJA 2E9GA 4JR9L 3FB8A 4NQCE 4I18A 1JWMB 1MFEL 2BX5A 2Z4TA 4CVWA 1VACA 2AXFA 4R90H 1NLDH 4G6ML 2CM5A 4OZGA 3G04B 2ZUVA 2GTZA 4K4KA 2IQ9H 3T6ZA 2WXNA 4YL9A 4F92B 1FGNL 4Y2OB 2CJTA 3OAZK 4LCWE 3LXUX 1NC4B 3EFDL 2C7UB 3EFOA 3GEFA 4WK2B 3OG4B 5FECB 3LVEA 5KYNA 1U8KA 5DEGB 4FKHA 1DANU 3GMOB 1OGTB 4TM9A 4MSWB 5TDOA 3BUTA 1P4UA 4Z3TA 3C75A 2C7FA 4OI9A 1JVKA 4OZIF 2BNRA 2DTSA 1TSHA 3OLDA 1AGDA 4BK4A 3VXMD 2WXKA 2JELL 3I74A 4U0RB 1CTOA 2A6DB 4OFIA 2GCYA 1KPRA 2VNCA 1CDYA 2H8PA 5ESQB 3I6SA 3AGWA 3Q9QA 3FDWA 2VITA 4N24A 4UV4L 1RZKH 4K15A 2ADFH 4EIZC 3PJLA 3TJEL 3PNWA 3DUHA 1BCIA 3B7SA 2C9RA 5KVGH 5D71H 1OK8A 4FAAB 2AQSA 1J9CT 2FX9H 1OTUC 4PJEA 5F70A 4PRPD 4DEPC 4ODWB 1U3HB 1R9FA 1N4XL 3J2PA 1CURA 2XWDA 3TBYA 5DD3L 1ZLSH 2W0FA 1VFAB 3OAUL 5HGDA 3BUIA 4OZ4B 3VFPB 4PY8J 2E59A 2RD0A 3JTSA 1AYRA 4NNPL 3VDCA 2ZOLB 4F33B 2VO5A 4N2MA 5LWYL 4UOW0 2ZF8A 1WO2A 2A9ML 1HILB 2QVIA 4HDIA 4KKPA 3MOAL 4GRMB 1OF0A 1HHIA 1QHPA 2FUQA 5EPMB 4JHAH 5HJBA 4QLWA 1G0DA 3H3KA 3IGAA 3KBHE 1JSYA 4YZFF 4CJ1A 3RX7A 1S9KC 5DJAA 5HVHB 4JRXA 2JV6A 2X1QA 4JG0L 4G11A 2MCAA 4AVHA 1AD9A 1H8OA 3CN2A 2OSLB 1T1YA 1BXVA 3CJJA 4UILL 3ULVL 2DBLL 1KYFA 2QJDA 3FHEA 4NKMA 4X9IA 3ZT6A 3BHBB 4BH7B 1ZD6A 5FYJE 3BZ4B 4JJ5A 2X7LA 3I2CL 1AO7D 5LB1A 2H3NB 2DWTA 3LIZA 4FXKC 4NRXA 1WICA 3WEBA 2NY0C 4LDOB 2ZWNA 1VFBB 3TO4A 4YUEL 5L88H 5E9DB 3X3GH 1P1ZB 5DMKB 4L5FL 3QPQD 5IJVB 4TLKA 4KVNL 1T66C 1TJIL 1UWGH 4ZDHB 4P2CG 3PV7A 3W5MA 4TTGA 1TKWA 4R8WH 1R4XA 5EOCL 3FUDA 1XGUB 4OZGF 5CJQL 2BVQB 3HFMH 1XB8A 3RYMA 4L0PB 5GIRB 2DM3A 1I3GH 1W91A 4OFQA 3VQLA 4P99A 2Z91A 4A2DA 4RAHA 2VLRB 2JQAA 2RFXB 3OKNA 4XT1C 1A3RH 3BPOB 3TCXA 4OLYH 4PJAE 3N9GL 4RZKA 5F1OB 4FLHA 2OL3L 3S48A 4DGVH 2J5WA 3FU6A 5IHZA 1VA9A 3S36X 1N5YL 1BMWA 5JLZA 3AREC 1OZUA 4J4PA 1J1OL 4G3YL 1M6OB 1KGCE 1M7XA 3S3JA 1J8HD 4JRWA 2D3VA 4HG4K 5C0BE 1REIA 1D5MA 2ZUQB 3BZDA 4OB5L 4EDXB 5EUOF 3LSOA 5I5MA 4YHKL 1OP5H 3SY6A 3WEXB 3S36L 5T5FL 1G1KA 2AABH 3LX9A 4MZIA 4K3EL 5FCUH 3MLSH 2BSDA 4YHNB 1NLBH 2C8NA 2EKSB 3NACH 1IM3A 1DLFL 1OAXL 1TVHA 4HUXB 4HZAA 4I7ZC 2MHAA 4TKWA 1ITCA 4PJEF 4JHZA 4ELME 1HN1A 1JHTB 1QMUA 4L37A 3UC0H 1SVZA 3Q9PA 1C1EH 4FDWA 2ZCLH 2DRUA 5C0JA 4JS7A 3BX7C 3UAJC 3TZVD 4A7QA 4KI1A 3SIKA 3VB9A 1XGZA 2AQ2A 2ZXCA 1OPOA 1XGQB 3NJIA 4KAQH 5KYXB 2X6MA 1T1XA 1AI1H 4PG9B 4S0TD 3PWUA 4XXDB 3CFQA 3QULB 4H13C 1I1FB 3IAPA 1QO3B 3OJ2C 3GRWA 4LARL 4DQOH 3BWAA 4LIQE 3CHQA 3F04A 2P8LB 3LPGA 3QXUA 4NZ8A 1I85A 3ENEA 4R83A 2W65B 5ABAA 3WBDA 3Q13A 3WN6A 2QQKH 3RWJB 4RISL 2VDML 1MUJA 1Z0MA 5FGCB 4O2EB 5I6XC 2EDQA 3DXAD 2DTML 2NNAA 3BAEL 3PWLA 4IRJA 3GRBA 3ZHNA 7TAAA 5C08B 3FQXB 4TRPL 2XN9D 1GAFL 4L1LA 1DUZB 4LLVB 3MRBB 3HI1B 3QVAA 1FORH 5DZPA 3L7FB 1M2VA 5IB4B 2IANE 3SBRA 1NANI 4PW9A 4AT6A 4XNYH 2Y24A 2V2WA 4CN1A 5I1AA 5KWYC 2XXGA 5DDHB 4HZLB 3KPPB 4U6YB 3RJDA 3B9AA 1L0XA 3FU5A 4GS7B 5DVLA 4YHZL 2ZUWA 3K81A 5CWSA 4PI0A 4TL4A 2LTQC 5C3LD 1U8PB 3MLPA 1TVBB 3QEHB 5AW4B 1A6AA 3GD1C 3HMXA 2C3GA 3PXLA 3WFBL 4PLKD 5IM7B 3EBIA 3ARBC 3QDMA 5IVZB 2NOYA 5AAWC 3ZVVA 1T89C 3TJHC 4X8CA 1YEFH 2EYSB 4O00A 5L8JB 1WZ1L 2FT8A 4AGQA 4HK3J 2R1WB 2V8MA 3LS5H 4XMKH 4ZS6D 4NHCL 2NY1B 3UH8A 4DAGL 4FADA 2YAOA 4JPIA 4AYBA 5JQ6H 1G7MB 2CU9A 4HPOL 5D8JL 4TVSa 2CK0H 4L9LC 2NX5B 4JK0D 5C0AE 1M05A 3HPJA 3K72B 4JFDD 1QSVA 3FNKA 3BP7A 1BFOB 1OAYH 1TTAA 1EV2E 1T80A 4X7TA 3RWCA 1J9TA 1GYCA 4QHKI 3APMA 3IDJA 4N0UE 4WTXA 3EDDA 1GW0A 3VTAA 2NTFB 1QRKA 2BVTA 3B2VL 2C5DC 3P0YH 5K59E 2ZAIA 5CFAA 3HC3H 4W9CC 1I8MA 3KM2A 1O5PA 1GXEA 4BJLA 1AHWB 1IKFL 5LGYA 3VG0L 1QR4A 2NRDA 5LGHL 4U3HA 4Z7VF 1JG9A 1O9WA 3OLEA 2HFFB 3WTVA 5D1XB 1G9EA 2FJFB 2WBKA 3OX8B 3QUXC 3KYOA 2C3HA 3ZO9A 5J06A 1MFMA 4FLOA 4JJHA 3Q05A 2YS4A 1Y0LB 4XC1L 3X17A 4Z3IA 3QORA 1C7SA 2A38A 3CN4A 3I9GH 2IDFA 1IGJA 1HQ4B 2A74A 2OFQA 1JZJA 4X8JA 4PS3A 1M4KA 2Y6SC 1G1YA 4TQEH 1ODAA 2QZ5A 1RZ7L 1I8KA 3Q01A 3TT3H 4OJEH 1RPUA 1WAEA 2XUWA 5L6YH 2H3KA 1SYSA 4YGVB 5EU3B 4ZO9A 3KLSA 3R0NA 4LHUG 3ZMNA 2DB8A 4G6AC 2QKIB 4FYRA 3A4FA 5HJDA 4GW1B 4CN6A 4GKSA 2UZYB 5IHUL 1NFIB 5E6UB 3ZE0B 2YOCA 3ZE1F 4LXFA 4DN3H 2HKFL 2E8ZA 2X0UA 5K9QG 4B3VA 4JHBA 2JTDA 4PGDB 2JQMA 3FT2B 4TNVF 3S5LB 5EN2A 4MCZA 1CFTA 4J5VA 3X14A 4Z3FA 5HY9B 3DJRA 3QJSB 3ZOAA 1GTFA 4UDTA 4RCAA 3VX0A 3SCMA 4XCNA 1XF4A 4X9HA 3DIVA 3U25A 3D12B 3L4WA 3BQVA 3IJ9A 5HYSA 1QBLH 3IXTA 2Q76A 4PYHA 4PJ7A 1W6WA 5EZPA 1XVSA 5JPNB 1SFDA 1EJ6A 4NP4H 2RQEA 2VDOL 3KLQA 3V4VH 3T04D 3VNYA 4FNLL 3K6SA 4JCWA 2OMTA 4KQ4L 2QQQA 5GZOC 2OMNA 3CZSA 4M02A 1THCA 5AVRB 4E41A 4JRXD 5HGGS 3CFBB 2R4SH 4PW3A 1QLFA 2OMXA 5H37G 3ZE2F 3QNYA 3L4XA 3P11H 5TD4A 4YHPA 3DARA 2MOGA 4FMFA 4IOFD 1FVCB 5KBKA 1CGSL 5DR5H 3D3VA 1WFIA 2JJTC 3HC0A 4OD2B 3HS8A 5I8CB 3N42B 4WDIA 5KSBA 5KYYA 1DJSA 4GAFB 4HK3N 4UQBA 2NW2B 4HWBL 4RFOH 5ANME 2ZKHH 1KY6A 3VMOA 1J10A 1KTBA 1IJ9A 4B7IA 4JFZL 1OGAD 1UGKA 2J1WA 5MI0C 2AQQA 3RB5A 4LKXA 3IMSA 2ICEC 4IDJH 2VLME 3VXRB 1QSFB 2CDEA 2OMUB 3EF7A 3M7OA 1F90L 3KPLB 2BOBA 3DO4A 5CEZH 4NXSA 4NQXB 3RL2B 1BLNB 4WFFE 5IW3A 2XVKA 1E27A 1JXJA 1JZEA 2PWDA 2Z7YA 3CC5A 1ZLWH 4KJWD 3RBSA 1PCXA 5FYJU 4PU2A 1EEZA 4XBEL 1AR1D 3FTYA 3MRGB 1YEJL 1TDQA 2FATL 4KGJA 4N1HB 3UDWC 4F15B 5ISZB 1M71A 3ZGHA 4J4PD 5TTRA 4XCYA 2OL3A 5T1KA 5GSRB 5D7IE 1JGLL 2Z92B 3R19A 2R23A 1M42A 1TQVA 3L4TA 2JKXA 1HH9A 2CCLA 5F96L 2CKBA 1UJ3C 3D2TA 1P2CB 5GGRY 5DI8A 4NO5A 2ZXQA 3HI5H 2J8UB 1IM3D 2CMRH 3JWOC 4M43L 5T5FA 1R0AL 4FXTA 2FECL 2CIKB 5IMKA 3MV11 2EXSA 35C8L 4X4ZA 5KAQF 3MA9L 3VFVA 5GS1C 3AJ7A 2AV1A 3CPLA 1CGYA 1SXZA 1XB3A 4U6XB 3MZGB 5DUPL 3NCCB 4PUBL 3L9BA 4PJ7F 4PG2A 2PYEE 2WNKA 1F0LA 3FZUD 3K7UA 3MROA 3TV3L 5C2BL 4UINH 5FYKE 1JNHB 3QUYA 3NGBC 4CVXA 3FT3A 2APVA 5D7KE 3LXAA 4HKBB 1VSCA 1S7TA 4HMCA 1IBGL 3OHXA 2PCFB 2FD6H 3K8KA 1T3FA 2XQBH 4QRPE 4TUOB 2N0MA 2O93L 4JDZB 2YJQA 3QIUC 1ED3B 3FT4B 4MJ6B 2Q7YB 3RTLA 4GY4A 2H1PH 3RKDC 1DN2A 2VRKA 4IRJD 1PLGL 2F7RA 4DZ8B 5JW4M 5KSBF 3QJFB 1V5JA 3TC9A 4MA1C 1XR9B 1DVZA 2BWQA 4M56A 4NI3A 5H8DA 2LHAA 2GJ6A 4HWUA 1Y07A 3L8QA 1U93A 2BRRL 3L9EA 2HLAB 2JKLA 5DD1H 4DWHA 5F7KC 1KENH 5GRYA 3BVDB 3BRDA 2MWCA 1PY4A 3B3IA 5SWSE 3SE9H 4QJ5B 3QIBC 4J23A 4PRIA 4UV7H 5A2FA 3B2UD 3DROB 4M7ZB 3U9UB 4AM0Q 2ESVE 4BWUA 1FYTA 1NEZB 3LH2L 1P4IH 4D9QD 4UTBH 4JKNA 3Q6FA 2WWOA 2XKNB 1F4WH 4GAGL 4KKLC 4WWNA 3AC0A 5DWPA 1M1XA 3FK3A 5IQ7L 5I82A 4K71C 3OKKA 4JFQA 2HFEB 1L9QA 1P9MA 4JQVC 1M1SA 1RAMA 2W1NA 4C83B 5JUEL 4I0PA 1G7LA 3P1VA 3LQZB 3H9HB 5AZUA 2JIXB 4MKMA 3QDMD 2R2EB 4GXUN 3SJVE 4OV5B 4PBDA 3C60A 3CBRA 2G2NA 4YHLH 1L9OA 5K9OA 4DUWA 1DO6A 4X9YA 2VDPH 4WUKL 1GZQB 2NY4D 3KWTA 2XTJC 5DYOB 1KN2L 1H3VA 1L6XA 4YPGA 3I75A 5C7XH 3WTYA 3T0DA 3GLDA 2ALWA 3DWTA 4XB8A 3B3BA 4GLRH 5D2NA 4AZ8A 4X99A 2APXA 4UBDD 3ZX1A 2RH0A 2O5NA 4HGMA 2Z31A 4RMVA 1XH1A 4YC2C 4KFMA 3OZLA 3CUPA 2Q20A 3BH8B 5F72S 4XMLL 5J89A 1Z9OA 3H7LA 4LCUB 2D7NA 4B0MM 4OLZH 1CFMA 4FFVD 3VJ6B 4BRVA 4R26L 6TAAA 3TYGL 2M26A 3C8KB 2Y5EA 2ZONA 2PP8A 2QR0A 1NFAA 4BV1A 4Z77B 3SDXE 1MW3A 1VAHA 4HS8L 2E7DA 4CNIB 3MTXA 4ECNA 1AOZA 2YARA 1FFRA 4XWOD 5AYUL 3DJZA 1E9PB 1CI3M 5ID1B 3RL1B 3TGXA 4JQIH 2UWEE 4B9FA 3PRZA 4LASL 3L3HB 3FTUA 2B1OA 5INDB 2W38A 3TT1L 7PCYA 3IB4A 5FXCH 4X4KA 3QEQB 5C71A 2AJUL 1BF2A 4MYWB 1D5BA 4P5RA 1A65A 4XNQB 1ET8A 4LSPL 1L5GB 4AYEC 3MR9B 4YFEA 5LNGA 1WRFA 4IK7A 4JFED 1I8LA 3WHE0 2P5WE 1TZOA 2HVKA 3UJTL 4B9YA 3BWUF 4GT0A 3IFOA 2F5AL 3AU1B 3QFDB 1K85A 1IILE 2ADJB 4NUJA 4XCFL 5EB9A 5IROC 4L8SB 1TQBB 1A14L 3IGLA 2FUTA 2Y69B 2NNCA 1FZJA 3HFFA 1QG3A 4X6BA 4YSAA 1I3RA 3NJGA 5ELIA 1ULVA 2DMCA 4AL8C 2WLYA 2V7NA 4B9GA 4NENA 2K4AA 1EJOL 3LEYH 3LKSA 4P5SA 3OMAB 4V1DB 1O7DC 1HE7A 3NPSC 1PZ5A 3WAJA 4NQVA 3VGBA 1KJ3H 3UJIL 3WELA 4JFOB 1AGCA 2W9LA 3O6KL 2D03H 3CN3A 4C56B 2V9TA 3FQTA 3BQUD 4WV1C 2ZCHL 4O2CB 4QT5A 3TFBA 5AVTB 3CX2A 4HH9A 5KYUA 3FOMA 4AJ0A 1NM4A 3QNFA 3U4BH 5FM5M 4G80B 4M5YL 4E9YA 3MJ9H 3NZHH 3TBCA 1DJXA 4H88H 5SX5H 3MDJA 3BPCA 4OM1H 1ETB1 3MNZA 4UZUA 4P2OA 4GW5B 5T1DL 1ONQA 2HJFA 5AKVA 4E41D 2YXMA 2VERA 5D2LE 4LLAA 3G3LA 3N85L 2PYFA 5ESVA 5GZNC 5EOTB 2VMDA 1ACYL 3U0PB 2X3CA 3O41B 3IRPX 4PRDB 1MQ8A 3NRPA 4DKEH 1EFXA 4CSSA 4MQXD 3KPQA 3D3VD 4RBPH 5B39B 3ARGC 4N0CC 3TBWA 5BRZA 1QUNA 1EERB 3ULVD 4HT1L 3Q6GH 1Z5YD 3U9PH 5E1HB 4NEHB 4LKCA 1HKLL 3KGRA 3FSAA 3IPEA 4IJ3C 4FLSA 5FAAA 1JUFA 1PKOA 3ABKB 1YPZF 1K4DA 3HNVL 4U2ZA 2NCEA 3MV8B 1FAKT 5T5NF 3T6QC 4EDWL 2DEXX 3MI6A 3CTTA 2CBPA 5DEZA 1UB6A 4HWBA 2X4OA 4ETQB 4P46A 3MV9A 4MJIE 2EDKA 2UV3A 3L9RA 4LVHC 3G08B 1E3ZA 2R15A 4LCVA 4QEGA 1JWMA 5C6TL 3BVWA 2H2PD 1A1OB 1PG7L 2C1PB 3F83A 2CAKA 4UB0L 1MRCH 5A2KH 1V7NH 2GJRA 5L0QC 2YLKA 3JT0A 3IF1A 1JZ5A 4H25A 1RXLA 1XV8A 4F8QA 1S9VA 5E99L 3VRJB 5FO8A 1KG0B 2HT4C 2RCSL 1JZ7A 4AQ1B 1YEEL 3TYFA 4ZSOB 4RMBA 5IWLC 3GQFA 4MQSB 5DEJA 1RUML 3EGSB 3ASNB 3DURA 1AP2A 3QAZC 1KBBA 2OBGA 2ITCA 5FUZL 3T0BA 3U0TB 3P4MB 3VFUB 5HDRA 4JANB 5LQBH 3UPCA 5JZ7D 2W88A 3H0TA 5CLYA 5F3BA 2XG5B 5CNHA 5T1KD 5KSAA 1WZKA 1SY6A 2A6JA 1PNDA 4QKXB 3B4NA 2CZNA 2WLKA 3WJMB 3VB8A 4BFIB 4FXGC 3T3PF 5EULV 3F7KA 3P0GB 1HYRC 5GQBA 4MNHB 4JBSA 4YFLF 4N2BA 4TNVK 4M3JA 4GP5B 4GBXC 1NDMA 4KXCA 4PGJA 1XGYL 1MHCA 4ODWA 5IQ9B 2Z35B 4O51B 1G0YR 4OQ1A 3ECVA 1AACA 3W2DH 3MODH 1MQKH 2A77H 1PY9A 1VFAA 3A3YB 3IDYB 3MJ8A 3N91A 3PQYB 4OJDH 5ESAB 3V55A 3VFPA 5B38G 2KT6A 4M5TA 1SEBB 2PF6A 3NABL 3QG6B 1CQYA 4HJ0C 5GSVA 1XCTA 4N0YH 2EDYA 1IMHC 4GFTB 1VESA 1A4JA 4KO7A 3WD5H 5IEKA 4MA8H 5EPMA 2H0FA 4W70A 1KBVA 1A9EB 1PCSA 1XGTA 3U6XS 2XVGA 3U4EA 2Y2YA 3KPOB 5I24A 2B1HH 3HE7B 3JYCA 3MRPA 4NAJA 1OHZA 4HUUB 2NW3A 1A6TB 2HFTA 2VUKA 4JPWH 2WQVA 5DD5H 4OD3H 3GSVB 3ZDXE 1ACCA 3U6RB 4NO2A 3TTYA 4BH7A 4GJTB 4CU6A 3BZ4A 1MSPA 4PB0H 4D0BB 4F7MA 4F1SA 5EC2B 4PCKA 3TH2T 3N3EA 1HEZB 4M4PA 4NKIL 1KV7A 2WYTA 2IBGA 4X6CA 5E9DA 1BPLB 1E8WA 1IEBB 2V17L 3PWVB 4H1LA 4JEGB 2GITA 1MXDA 1OW0A 4PVBA 4X5WB 2DQJH 4PRID 4EF3A 2VN3A 4P06A 5HYQB 4FCHA 3LHAA 1BD2E 1FYTD 5KSUA 1WISA 3RWDB 4EZJA 5DHVH 2Z6FA 5D72H 3UTZB 1A4CA 1XGUA 3NESA 3FRUB 2WSDA 5HGAB 5J1TC 3E1F1 2DQCL 3PGCB 3T0EC 2E46A 4A2HA 5AAMC 2X1OA 3ABMB 5IHWA 3NOIA 3HUJB 4I0PD 1WFOA 3HR5B 4IU2A 2YUZA 5EA0H 1BBDL 3SB3A 5AVZB 1JZHA 1LO4L 4GG6E 4OU3A 4PJHB 4ZX4A 4ABVA 1EO8H 4BSJA 4WUUA 2J55A 5E9AA 5CR1A 1AVAA 1U8OB 2H0PA 3P9MA 1T6WA 3ALWA 4NFCA 3SGDI 1EDYA 4FXKA 2AS5M 3KW8A 1AGEA 2NY7H 1IEAB 1MAML 2VSKB 3ILQC 4XPHH 4R84A 7PAZA 4N8PA 1VKXB 4FJYA 4F8TA 5DRXA 1DSWA 2YC1B 1VGKB 4Z9KB 2GHZA 3ZDZB 1DFBL 4X2UA 1PYWB 4BGDA 2CO7B 5BXFA 3FONA 4PD4K 4ZZFA 3EO9L 3WAKA 2Z31D 4PJBA 2MCG1 4IU3B 4YHNA 5DURB 4LT7A 3TIDB 2EKSA 4G7RB 2BNRE 4U1HB 4UWQB 2CLZB 1XAKA 2P24B 3R06B 2HAZA 1N8ZA 3PLYA 2UVEA 1SJEA 2MEJB 2BPBA 1JXKA 2V7HB 4V2CB 2F54B 4K9EL 4I89A 4RGOH 4QUOA 3KLKA 1H8LA 5FOBB 2G9HB 4H20L 5TDNA 4BH8B 2WUBL 1RJYB 4A2LA 3DV6B 3I9PA 3EZJB 4PG9A 2A0LD 2VR3A 4XXDA 5GRUH 3MLZH 2VMJA 1RURH 3FBKA 3TEXA 1IFGA 2K6YA 4B50A 4H8HA 2BLFA 2YK1L 4UQIM 3BAWA 2CR0A 2I25N 2DIEA 3IDGB 3RWJA 5I1HL 4WCYL 5BZXA 3RDTB 2YGVA 3JWOL 2BIIA 4OD1L 5D70L 3V4VB 2WJ7A 1DE4B 2XN2A 3MUHL 5EZIH 4JJOA 3RJOA 4CUCA 3ULUC 1BQKA 2BIQA 3UBXB 4GUPB 4EUPG 4X6CF 2AJ3B 1RK0B 1DUZA 1MFCH 4I9WE 5D7LA 1IO4C 5HYJE 1A6ZB 2WSKA 4LHJB 3G6AA 4TQIA 1LWRA 3HZKB 5I8EB 3TPUB 1IAIM 4M7LT 4TTDD 1Z5HA 4TS6A 4P3CH 5FYLL 3UAJA 2QQNL 2YMOA 4HD5A 1AANA 4K3DH 2HJKB 3SPVB 2VN7A 2BY1A 4M1GH 5GGQL 5DDHA 4U6YA 3KPPA 4ZZKA 5F9JB 5KUMA 2WUCL 1VHPA 3TONA 2D2OA 1ZVSB 2WP3O 3EOBA 2ZP0T 3PABB 5CHNB 3HBZA 3LRHA 3VW3H 3ELAT 3OM3B 3BSZL 5I9QC 1WTLA 4MHHG 4FQPA 2Q86B 3L4VA 2A83B 3V8OA 2FT7A 3D39B 1HC1A 5BV7H 5LAXA 3FW6A 2HPTA 1LE9A 3D4GA 4LL1A 4WI2A 5I74C 3FFDA 3JUYA 4EI6B 3PG2A 2HSIA 2AXWA 4P2OD 5EIQA 1CYGA 2ATAA 1CN4A 2V37A 3O4LB 4NIKB 1HZKA 3GMPA 2IIJA 3KH3A 2R8SH 4N20A 4JUSA 1UASA 2GT9B 2PUQT 3GNMH 3A47A 3B6SB 3ROOA 4XZUB 1F1GA 4OFPA 2GK2A 2V2XB 1UXMA 4PJBF 4BFKA 1EFXD 3DUUA 1NGWB 1TZ8A 5BRQA 1CI5A 1I7ZA 1P53A 1CVRA 3MHZA 5BRZD 4R7NA 3MJ6A 4E5XB 2WYHA 1QVOB 4GRWF 4NS0A 4ZFZA 3VFRB 4DO5A 4JRYA 5EBWB 5GGRA 4AVJA 1T0PB 4G7SB 1NCBL 1RZKL 2N3JA 1FL3A 1X4XA 3D18A 2CALA 4IRSC 4JUTA 3KYMB 1DFXA 4Y19B 2VCOA 3HI6H 4WO4A 3ARBA 5D71L 3VFGL 5EEWA 3C6EA 1G9NH 2FJFA 4JM4H 2CHXA 4YSSA 4P46D 5EU6B 3MV9D 4WNSA 2VXTH 4KDTA 2M8XA 5FLVA 3QDAA 1RP9A 3WS6A 4RMTA 4KI5C 2DQUH 3MNWA 4Y9EA 2APBA 3HTLX 1HE8A 4KNUA 5K9JH 1RUAL 5DK0B 3U2SB 3U7WH 2O5YH 1Q9KA 1H19A 3HG2A 5DQ9B 3VXSE 4EQ2A 4JO5A 1Y6KR 5E94A 1YY8B 5AWNH 1ND0A 2WZ0A 4JHAL 1R5WB 4PBXA 4MQ7A 4ZO7A 2VERN 4BKSC 4F8NA 4YDLB 1TU2B 1Y6NR 2F1BA 3NJHA 4DETA 1N8OE 2X3AA 3NEXA 3W0WB 4YGVA 2ZOOA 3N1QC 5DFTA 5ICXB 4OCNC 1IC7L 4F7PA 4LSRH 5J13B 2YD7A 4P4KB 1CF1A 3NRQA 3T3MB 1CU4H 1K6QL 2UZYA 4MGXA 3IMTA 5KSAD 4G8FB 4QPEA 2IXQB 2FEDD 1DP0A 4OV6F 3KPRE 2Z8WC 4DPCX 4F5CA 3LMJL 1KCKA 1QABA 4XGZA 1WIOA 2J5LC 3BSHA 2GY7B 3L08A 3CVHL 4TOYH 1E43A 1X9UA 4YIQA 2A9DA 4YLBA 5L88L 5KVDE 3X3GL 4FQCH 2EEBA 6FABH 2Y1YA 3FQ2A 2PPDA 2F08A 5C07B 3LTVA 3DNKA 3MCLH 4E0RA 1GSMA 3BFOA 3DGDA 2F5BL 4ZUTA 2LV4A 2AC0A 3EYVB 3ILPB 4RAUA 2LU5A 3WLBA 1OAQL 2W92A 4N86A 4YSDA 4B60A 2HRHA 1YNTA 3P9LA 1HOCB 2VXUH 4NQUA 3RGVC 1F3DJ 4UT9H 5I30L 3REWB 5FM4A 1AKJA 1TTGA 1RIUH 1A3RL 5HDLA 1IAIH 2EH8H 4UAOC 3CFBA 1BQRA 5EEXA 1QFWI 1AD0B 2X1XR 4OGXH 1KWKA 3B9DA 1S3KL 4X5XB 5C0IB 3V7MA 3UBGA 3PS6A 3VD9A 3P4LA 1J1PH 1DVXA 5BMFH 1JXGA 2VDPB 5AVQB 3DX6B 2F74B 3GSQA 3MBEB 3MA7A 2JCCF 1T7ZA 3PP3K 3QUZC 1F58H 1OALA 2AABL 2YA0A 3MLSL 5MEOB 3CK0H 4LLWB 1IT9H 1NLBL 2EE9A 3WFCL 4IS6B 3QJHB 4F7CA 3MVSA 4G7YL 4DVBA 4ZFOB 4RMQA 5MP6H 3BP4A 4ANUA 5I16B 3STZA 1QSFA 2OMUA 3OXSA 3UC0L 4J3UA 5J56B 1KFAH 5HD8D 4Y2LA 2GK0B 3ZIYA 2ZCLL 2ENQA 2ZNWA 3ROLB 1G9MC 3OGCB 4M03A 4MNQB 3PGDB 4Y2NA 4X6DE 4KAQL 3OWEA 4L3CB 1O9ZA 1XGPA 3ETSA 1JXDA 3LPWA 1AI1L 4XE0A 3SQRA 3TWYA 1DSFH 3D0VB 4FG0A 1KPUA 3VFSB 3VMNA 5J6GA 5ETUB 3VFTA 5AZEL 3QZLA 1LMKA 4R7XA 3OKEB 5IFHL 4LBAA 4WUUD 5HI3D 1G7IB 1HTYA 3OQRA 4JMNA 3KDMA 3QUMH 5B1KA 2AJZA 2CHDA 1KJVA 2X4PB 5ISZA 1CXFA 1IL1B 1XH3A 4XNBA 4XRCA 5JIHA 4KROC 5ICYB 3IDIB 1H3XA 3QAQA 4TUKL 1L6ZA 1N3NB 1T04A 2EJ1A 4ORGB 1TOXA 2ENPA 4XI5C 1S7UB 1ZTMA 3VRLF 1LHZA 1U4FA 4UM8B 1FJ1A 5I6LA 1QFWM 4KKRA 1T66D 4YS4A 5EIIG 2P7TB 1IM9B 1ZXKA 2PPCA 4Y5XA 3EUUA 3GSNH 5H4YA 4HWZB 4MCNA 3V6OA 2OX5B 3AADB 4EIGB 5CINH 2W5PA 3SO3C 3Q5YA 2AHIA 1D5RA 5K33A 4XNYL 2VW6A 4PCYA 4DCQB 2Y2TA 4PGEB 2D4DA 4UIMB 3LD8B 1BM7A 2GFBB 3WY3A 3MGOA 2KZWA 5F9AC 2CHWA 2Z3FA 2IADB 4NYLB 3TVMC 5IUSA 1YNTF 5TE6H 4GW4B 2KPNA 5E6IC 1NCHA 1G1OA 1LD9A 3BDYH 1N9PA 1T6VN 4KC3B 3L4YA 5K9QI 3PCYA 1W72H 3NZUA 1JNHA 3NJMA 3UDWA 1T22A 5L2JB 3ARED 5E4IA 1RU9H 1CTNA 3HVNA 4P57B 3EJYC 1YEFL 4FHKA 2FL5A 5LGJB 2WHVA 1JBJA 3L3KB 1CFQA 1G7QA 3LS5L 4X4XB 3S4SB 4ZO8A 1BF5A 2ICWB 4N90E 1AY1H 5JQ6L 3LQAH 3ESPA 2H1LM 5FFLA 3BAIA 1RJCA 3HC4L 3D9AL 5HHMD 3V0VB 4F8LA 2CK0L 3ZGIA 3SHSA 1SYVB 1XCWA 5FM8A 1XTMA 2BINA 4KZ0A 4NQEE 4DZ8A 3NIDE 4WVRA 2UX7A 3FCTA 4I5BB 3X1BA 2I7SA 1WD8A 3F7YA 2ORBH 2BY2A 4MCYA 2NXYB 5DZNA 4Z95L 4ODTL 2WANA 5D7LD 4EIBA 1J1XH 3FHQA 2ZKYA 4G9FD 1D6EA 1ZWIB 4NQSA 3T5WA 4W9JC 4GINA 3ZMRA 2ROYA 1X5MA 3HC3L 3UAJD 3ECQA 4LK4A 1ZEAH 4Y2DC 2J20A 5L4JA 4WTZG 4R0LC 1E4KA 3EO0A 3INOA 2I60H 3KPTA 4PYGA 2GB2A 1AGFB 1U0QA 1KLUA 4P2RB 3V4PH 2BM3A 3TL5A 4C83A 4NC2B 2LAAA 3MMEB 3NIGE 4XNZB 1E5AA 2QVTA 3UGXA 3SDCB 3MZTA 1KXVC 2QELA 4XN7A 2FE0A 2F61A 5BUGA 4HIPA 1ZY9A 4FN0A 3BSZA 4FZEL 3ZL4H 4KNQA 4QCIA 3OAZH 4Y8DC 5JOFB 4O58L 3ZQ9A 1MEXH 3ZDXF 5MENE 4ONFH 4R2GC 2NY5C 2IWKA 4LPXA 2VLLA 1EZLA 3OVUB 2CJUH 3I3EA 4CMMB 4B0MB 1TZHB 3KJ4B 1J5HA 1YUHB 3GB7B 4OZHE 3DTXB 4XP6H 3M8OL 4PWJA 5HVFB 4AE1A 3MLWL 1YG9A 3GO1L 2EO1A 5T3XH 2P5PA 2BMKA 4JRYD 4KK8C 4YGAB 2NDGA 3H9SA 3APNA 3MBXL 3C2SA 3TH4T 4POZC 4Z6AT 3UP6A 1P6WA 1R47A 4I13B 4WO4D 3EFFB 3ARBD 3RBGA 3BW9B 5JDJA 3TJHD 4BSWA 3V5KB 1IGIH 3GMMB 5EF1A 3A23A 3VSUA 4XWGL 1T5XA 3ARDB 2H6UA 3O3EB 3QA3B 4ODHH 5JTWA 1SOKA 4JO1H 1HCVA 3TA3B 2DW5A 1JWSA 1RZIB 4HPYH 1MLCB 3IDNA 1QBLL 1GS7A 2WLNA 3NCJH 3KJ6H 3HG1E 2H1XA 5INDA 1A21A 4YBQD 2XX0A 4NIYE 4M7KL 4NP4L 1DQMH 1NCGA 2VXVH 5AB9A 4IEFB 4LSSL 4AC2A 4Z7QB 2V3FA 1ORQB 2BCKA 1GIGH 3ZQXA 5FA3B 1ZLUK 3QHTC 2R4SL 5CLTA 4G8GB 2A99A 1X6NA 3O9WC 2CG9X 4L8SA 4EE2A 3TO2A 3SO5A 1AXSB 5CZKA 1JTPA 1OO2A 4TVPL 3Q2VA 1S7XB 4HSQA 4PJDB 5E8PB 1OCCB 2QPSA 1F00I 3CFMA 3QT2A 3L3IB 4WWKB 5IOPB 4I0CC 1J9SA 2EYTA 4RFOL 2ZKHL 4QTHA 5IQLA 3RWHA 1U2HA 2LLNA 2FZ3B 2QSCH 4G6FB 3P77B 3P9WB 4W9EC 3WDIA 3CVHA 2GJ6E 2CXGA 3GI9H 5T3ZE 1NQBA 1QHQA 1YJDH 1GA2A 3TNMB 5HHPB 2Y6SD 1FVEA 4Q52A 4L8BA 1T2QH 4M61A 1NFKA 4LVEA 5HDBF 1CO1A 1MCIA 4FD0A 4N68A 3I50H 4YAQA 1IBYA 3LV3A 3ULUL 1E7VA 3LH8A 2NYYD 4UQDA 1Z3GL 1FP5A 4NLHA 5EZJA 2B59A 3X3FL 1C9SA 1XTLA 4QRQA 3VI3B 5DHVB 2J6WA 2VISB 2WBJB 3PY9A 2P42B 1UH2A 1KGXA 4G6AD 4KPHL 2IGFH 3QQ3B 1AKJD 1T7YA 4PJFB 1OCOB 4BSVB 2O1AA 4M29A 1I7UA 4S2SA 1AZRA 4GW5A 5IROA 3RX8A 1NFDE 5DK2A 1NBVH 2AJSH 2PPAA 2VQUA 3WFHA 1PKQE 2VTFA 1F3JA 2NY3D 2W81C 3KCPA 3O41A 1TJMA 1AZUA 2OW6A 1QTYT 2YGPA 5D7EA 4PJXE 1T0MA 2OK0L 4HYTB 4Q7DA 4HHAA 3UG5A 1MCJA 2H0EA 4QAMB 3UPRA 3FPYA 4LHQB 4AY0A 2WVVB 4G2AA 4P4RB 2NY1C 5E08L 4TPRL 5DRNB 3S3SA 2AFNA 2AQRA 5I1JH 3IN2A 2CMRL 1XF2A 3FTGB 4X9BA 3I9AA 5E1AB 2ZXBA 4JGUA 4PJ8B 1NGQL 2ZG1A 4MA7L 2IMNA 4ACTA 5L2KE 4A1RA 5C92A 3UCRA 1A3QA 2ZX7A 3BUYA 4PGZA 5GZOD 5JOPE 2Z7WA 3I3DA 4FQ2H 3V9CA 3BI9X 4ELKB 1I8AA 5EIVA 4C4KT 2A1WH 5F1NA 4F9LC 3MTRA 2KLTA 5K9KB 3CSGA 1V3KA 4ZFQA 3KYAA 4QXUL 1PMYA 2ZWZA 3BD5A 4RAVB 1ZK9A 4GKZB 2E6JA 3ARGA 4PWKA 2Q3ZA 4RGNE 5D1XC 2FD6L 4IIZA 5FFGA 1CMOA 3S34H 4CMHB 2XQBL 3CZEA 4UUJB 5HDOA 3VFUA 3DVIA 3UTTE 4PRHB 2ED7A 2FGWL 2GSGB 5SV4A 1ZS8A 2H1PL 4AYFB 4K5MA 3E8UL 3AS1A 1JV2A 4HUMB 1OTSC 2BSEA 4ZTPL 1ORSB 1S8DA 2JH2A 2IPKB 2X12A 3TEZA 1OLLA 4TUJB 2X9YA 2I9LB 4U6VH 3DUSB 1X5ZA 1EGJL 1EZSA 5LBSH 4MMXB 2GUYA 5EORH 4FCAA 5KVFE 2I24N 2WAQA 4UV7L 1RZPA 4O51A 1RZ8B 3B1UA 3LVTA 1GYWA 2IWFA 3NIFE 2X4TB 1MH5B 1P4IL 4ONGL 4KXZI 2YRPA 4HIJA 3LNHA 1F4WL 1R3LB 3BP6A 3OR6A 2B1AH 3VA2C 4Z76B 2XZZA 3REVA 5IWLA 2G75A 1IRAY 5IT2L 2HUHA 4P5KA 2OTUB 1HAWA 2YAHA 4OLUL 3NSYA 1A9EA 1KBGH 3MX0B 2A2QT 4YK4B 4UANA 2XWJB 5J12C 1KF9B 1QSED 4BFOA 4YHLL 1GVIA 3QCTL 3SYPA 1TTUA 2VDPL 1U4EA 2YRLA 1A6TA 3PL6C 4S1QL 3AAZA 3BUQA 3EYQC 3QYCA 4FF9A 2FBJH 1WE5A 1CLOL 1U6AL 3DPDA 5BV7B 4RA0C 3MV7A 3T1FB 3GIVA 2PW1B 1PTZA 2H6PB 4PWEA 1PFOA 4Y4KA 2W80C 4D0BA 1D5ZB 3MRMB 5JPNC 1MDTA 5E6YA 5EC2A 5H35A 1OE1A 2OMYB 3U2JA 1AS8A 1QWHA 3H2QA 2KPWA 4ZFOL 2FH8A 2HLEB 3DVNA 1ZRUA 5DRZA 1R6VA 3DRTA 2HG5B 4X5WA 2PCYA 3QXDA 3MU3A 1F3RB 1HINH 25C8H 1HWWA 4U1LB 5IB3A 1TITA 5J7CC 3QO0B 1QACA 5EZOL 2VLKA 5FYLD 4PJIA 2QADD 5D9SB 1YEIH 2R1XA 1KCSH 3EH1A 4ZUWA 4FFZH 3GBNH 1NKRA 1OARL 4XO4A 3FO2B 4MJ4A 2D9QB 2J3SA 4AXWB 5CBEA 1BYNA 4JQIL 2M1KA 3V52H 4U1JB 4ETYA 1J18A 1JF1A 3QIUD 1L9NA 3RKDD 5G4MA 3S96A 5HHVH 1U92B 1U8OA 3G5WA 1IFRA 5F88B 3F6JA 4X4YA 2WNXA 4Q89A 4ZXBC 1BVLA 1UJTA 2BVOB 2X53A 5F7EL 3FFCB 5E0FA 3S5YA 5HYIA 1ZSHA 3QDJB 2Y5QA 4DP5X 3IU3B 2OJEA 3GJEA 4LMQE 1CC3A 1FL5B 1UH4A 4L4TA 5D4IA 1MWAH 2GHWB 3L5IA 1GL4B 4N2OA 3QIBD 4XO5A 1G9ML 3OF6A 5GRVL 1NSNH 5F7LB 4EVNA 3HS0B 4EI5B 1DVFB 4M62H 2GIXA 2KKQA 3OAYK 3ARSA 1MRDL 1RJLB 3DPBB 3MKKA 4KKLD 1I3VA 1DBJH 1DZBA 4LVOB 1KCUL 3QEGL 3PWPB 4X7CC 5AW2B 5GHWL 1SRDA 3H9SD 3QQDB 3R8BB 4M93B 4NWUH 5BZZA 5C0CA 3WOVA 4GNKB 3UEQA 3RGBA 4MMYB 1KJ3L 1WK0A 3IDMA 3TOPA 5I71B 2R69L 3K71A 5BW7A 3DSNA 5FOBA 1FVDB 2DQFB 4MB5A 2HRGA 1RJYA 1C08B 3BYTA 5AOIA 1IBHA 3IPBA 5BS0B 3AG3B 1K9TA 1E6JL 3CE1A 4J3OC 3SE8H 3X1EA 1V3JA 4Y8AA 4JFPA 4DEUA 3MRRA 1SXAA 3UIZA 2E27H 2XTJD 4NO0A 3HS9A 3U4BL 4HJTA 4PJ9B 4M8UA 5EMYA 4OGAC 3MJ9L 3CZFA 3BVTA 2O5ZH 3OSKA 4ZS7H 5ITFA 1QTSA 4U31A 3BVNA 4MXWL 4XZ4A 3WNJA 2PO6B 4M1CC 3BUBA 1R5VB 3E80A 2BS71 1N12A 1NCUA 2BNUB 4M8QB 5ADPL 4N2FA 2BS9A 4CILA 1XCXA 2ARJQ 3KL3A 3LH9A 3K1KC 4GSUA 4QHMA 4GUPA 4HKZB 1ADQH 5ILTH 1M9SA 5TE7L 1OANA 1FL6B 3C5SA 4NDMB 3Q6GL 3CG8A 4GB9A 3HZKA 3NMEA 2Z93B 1F02I 3TPUA 3U9PL 4AK2A 1UM6H 2JJSC 3TLRA 3MLUH 3IM1A 5DUJA 3FN9A 2XA8L 5E8NB 2DQGH 4WZ9A 2OXHB 5IVXF 4MJHA 5DQJB 2B5IC 5GGVH 4PJIF 1TZAA 4Z0XB 2FIRT 1ZVSA 1Q9OB 3U36B 2B14A 2XQYA 2D7MA 3RB7A 1XF3A 1DQLH 1M7IB 2K9FB 3WFZA 5E9DE 3VO0A 3TU6A 4HFWB 5EIIA 1TFHA 2IJ0C 3APCA 5J0BA 2EADA 5BO0D 2XU9A 5GPRA 3CIAA 1YN7A 2WBWB 3OLGA 1V7NL 5I66A 1S7WA 1TZGH 3CLFH 4NC0B 5AVVB 1BG1A 1LK3H 2JJWA 3WHXB 1P5VB 5CBAB 5B8CC 1SHWA 1AOHA 3VH8A 4CKQA 4JVWA 4ATWA 5IROD 1J0IA 2XV0A 5LNDA 2CGRH 2ZXGA 2EECA 3QDGA 1NOFA 3NIDF 4U1KB 2VLRE 1SXCA 4NQDA 2J88H 4PWHA 4BQ8A 2E75C 1Z9LA 4IHOB 4XZUA 2F15A 3HHMA 5F44A 1XXFC 2FHCA 5LO7A 1NGWA 3QUMB 3GZKA 4PJCA 2MRYA 3MJGX 1MG2C 2JKIS 1CLYL 1D5IH 2R83A 1F42A 3B7YA 3GS4A 4WHTB 3VFRA 3LS4L 1HHKA 5CD3A 1TCMA 2FO4A 4GRLA 1JRHI 4M3KB 1D6VH 3D25B 3QUKA 4MDIB 4OCYH 5MEPA 2E5EA 1QQDB 1EUTA 1B3JA 4ORZC 4F57H 4Y19A 4OF3A 1IUZA 1E9QB 3TCLB 3GSNB 4WFEE 4DK5A 5E4OA 5C0DB 3QCVH 3NIGF 3WEOA 4KFZC 4R5VA 3MODL 3N55A 2E7CA 3DX3A 4W6XB 3TBTA 2A77L 3UPAA 3WN5C 4GQRA 4XO9A 1DVYA 2HT3C 2HWZH 3SPJA 3VFMA 3VWKB 4AG4H 4PLNC 3RKPA 4XBGB 1MNNA 2UZXB 3ARFC 1H3WM 5DQ9A 5HTSA 1WFMA 3S6CA 3VMPA 1R5IB 3WD5L 1KULA 4JKLA 5GZND 2YN3A 5E00B 3ZYJA 4LEBA 3MRLA 3KG5A 1GS6X 4N26A 4JY6B 4LNRB 3VQ2C 3NUKA 1W72B 3ARGD 4N0CD 3ETBJ 2AKRA 3X13A 1X5FA 2VO8A 3FCSB 1GRWA 3BKJH 4JPWL 4OZHF 3T8VA 2YD8A 2YGOA 5H94B 2OQJA 3K74B 2FLMA 3S5LG 4IRSA 3U7AA 4FQJH 3AABA 5DJYA 5FGCE 4PB0L 2BSED 1ZJAA 2BVEA 4KJPC 4H8QA 1UYWL 4LSUH 3PWNA 5F21B 3CNKA 1BQLH 3TASA 2X44D 3F5WB 4IMKC 5GJTH 5C08E 2EVJA 1V7ML 2GIYA 4B7LA 4AI7A 3Q8BA 1SNRA 3A67L 5ICZA 1SMAA 1Y1UA 2AW2A 2DQJL 4DFIA 4LSTH 3RWGB 4KRPD 1MCQA 1QFUH 1RPKA 3WJJC 1EGJA 1YUKB 2VW7A 3R7QA 3CSFA 4YLQT 4DKFL 4C58B 2OXGA 5IEHA 1XQ4A 4JN1H 3U1SL 4APXB 4K94H 4PTTA 1YN6A 4NN6B 3ULUF 3B9KB 3RVWC 2AJVL 1RY7B 1NMCB 1A9BB 1RUKL 3BGAA 3KPSB 3V4PB 1U8JA 4BQBA 2PETA 4A66A 1BFVL 2CO3A 2PCPB 1EHKB 1PGRB 1AD0A 2ZX9A 4B27A 3CDZB 5LNEA 4FA8A 4L8CB 2RMNA 3MV7D 1OLZA 3UO1L 3V0EA 4MHHI 4PV9A 1UXSB 4XNMB 2DJ4A 4LLYB 4Y4KD 4BM7A 1LWJA 4OCXH 3MYJB 1AG0A 4GBXD 5DVMA 3L7EB 2NX5E 2YBGA 1ESOA 5ITBH 1P0SE 4LU5H 3WGUB 5IZ7A 2VOTA 3D2UB 4HIXL 4LLWA 1MFBH 2JCWA 4YSPA 1ZV2A 4PMFA 4QIRA 3HNTL 1I1CA 5I6PA 4ZFOA 2A7BA 4HJ0D 1CZ8H 4FKKA 4N2NA 3RGVA 2NY6B 3C12A 2AEQH 5E4AA 5DWUL 1MIML 5AB0A 5D1QB 4XPAH 3P3SA 4LSQH 5AENA 5I1CH 1MHHB 3HA0A 2VLKD 3KCWA 4P2QB 1EEUA 4RGOL 4BUGA 3ROLA 3VYNA 1JF6A 4MTMA 2M2DA 3KZ8A 3A0OA 2Y7SA 3ZKQD 1F1AA 1BQSA 2VZ3A 2YXWA 1FLTX 3FO9B 5D1XE 5F7BA 1NFDF 3VFSA 1RURL 3E2HB 1F8TH 3O6LH 3CHPA 4JZNB 2OMZA 5A43C 3RFZB 1RHHB 3HZMA 1CFVH 3JZ7A 5D55A 4ZTOH 3KLDA 2AITA 4JQIA 2EDHA 2YD6A 5C09B 5I1IH 4PJXF 1IL1A 3DV4A 4RNRB 3OHMB 3PIQB 3KLAB 5KVEH 2ZSVB 3QUZA 1QASA 4NPYB 3IDIA 2K4WA 3ZRFC 1N3NA 5FB8B 5EEVA 3C5ZB 1S7UA 4Y1TA 3ZO0A 4L4TD 3GXTA 4UM8A 4AQEA 1X7SA 3EYFB 1LO0L 4I2XA 3QQ4B 4W68A 5E8EA 1G4RA 3OF6D 3MACH 4KI5F 5E2UL 1C16B 3C6LB 4OBRA 4AQ1C 5AL0A 5GGSY 3I6GA 3LIZH 1DQQB 2DYPA 2XWCA 4P3CL 4DFHA 5F7YC 4KV5E 4PRBA 4PW4A 1SDDA 2GFBA 3T0ED 4K3DL 5KZCD 2DI8A 5C0CD 1WITA 1IFHL 1NIDA 1USZA 3PJSA 4HV8A 4MNGB 2AXHA 4R4BA 2W9EH 4E9RA 3ERXA 3LKPB 3NK4A 4GEJA 1KTLA 1MF2H 2IDUA 2CLRA 1LP9B 1QKZH 2IC2A 5B3SB 4R7DB 1BEXA 3DMMA 4UTAL 1WCBA 3OC5A 4ZMZA 3FF7A 2EC9T 1GTNA 1BZ9B 2R69A 2IH1B 3V0JA 1NJ9A 4JG1L 3CLEH 4AQZA 1OAUH 4OFKA 2GTWB 5D96B 3ZTJH 4NO0D 2XWBB 4FI7A 5BV7L 3HRZC 3ILQD 4Y1AD 1GJIA 4X4XA 1MN4A 1UD2A 2PTUA 2VM4A 2Y22A 3INUL 1UWYA 2YUXA 1HHJB 4WU7A 1EPFA 3MJ9A 4HWEH 2E9IA 1ZANH 2DBJA 5FO2A 3P73B 3EOAA 1WVZA 1JV5B 3GDCA 2Y07H 3EHBB 2JB6A 4JZOB 4JLRB 3EG9A 4QRAA 3CDGB 3DHPA 5JW4R 5FUCC 3WMSA 1F97A 2BIMA 4X83A 4AIEA 2D2CC 4NOFA 1NEZG 2CUAA 3TVMA 4LLMB 3HE7C 3U46B 1PDKB 5E6IA 1GGCL 2ARWA 4H8PA 1NBYB 2WPGA 4U1GC 5EOQH 2MNUA 3GPSA 4TVPD 4FQQB 1MELA 4IBTA 3PXHA 4AQ8C 4P5TB 1JDAA 2YRZA 5B1JC 2X89D 4BE5A 4JM4L 1BVNT 3CZKA 3QHZH 1A66A 2VE6B 4OKVB 3CDCA 1HVXA 2X0WA 3DI3B 1XCQB 3M17A 4XXWC 4UOJA 4F9PA 5EO9A 5FX3A 1CWVA 1L9PA 3RPIB 3SDCA 3VXRE 1QSFE 1EAQA 5I1DB 3SKUD 3OR7B 1T5WA 4Z1PA 2G5UA 3LYRA 3WY4A 4N5UA 3GRWH 3ULUD 1Y18A 2VXSH 3K6FA 1WBZA 4KXDA 4Z7UA 1E8ZA 1IQDA 2ZYSA 4JO4L 2AQTA 5FC9A 3TTSA 3FB5A 3QDGD 4P9MH 3V4UH 1ZVHA 4QRPB 2H2SC 3DYOA 4RDQF 1J0JA 2RGSA 5HPOA 4NQDD 1HL9A 2Z34A 2X40A 3IJSA 2L7UA 3WO3B 4CMMA 3NSCA 2UZIL 3BH9A 1I3UA 1YUHA 3GB7A 4Y2DA 4MS6A 1TLKA 1O5DT 3UTSB 1IIIA 4R0LA 2CNYA 3D1MC 3IWUA 5ISZE 1WQVT 2C3VA 3EGXB 3H42H 4N6RB 3WIFB 4U2YA 1W8EA 4M1DH 1JVOA 3FSWA 5DSCA 1SUHA 3SN6N 4DPBX 3N41F 4A7UA 1MCPL 3BN3B 2FWLB 1X5LA 1MFAH 4FQCL 5TDPB 3MUGB 4LEOB 2EVHA 3SDYL 8FABA 4F7EB 3F7LA 2ATPA 3EFFA 2VDLH 4L3EB 2Y06H 3MCLL 3V6OE 2EE6A 1EEQA 3K46A 4KDVA 2J8UE 2QGEA 1T2XA 4NUGH 4AIXA 5C0ND 3V0IA 2Y1VA 5T1LB 1MCLA 4N8UA 3ZKNC 4DGWC 4O2FA 3B37A 1T20A 4GUCA 2VXUL 3FO1A 1CS6A 2PXYA 4UT9L 4R7LA 1HHGB 4KO9A 4H26B 3VXOA 1B0GB 1MCNA 5IFAH 4Z8FL 4ZOCA 4LPUA 1ORQA 4NZTH 4R96B 5D1ZC 1OIOA 1RIUL 3VFWB 1DBAL 3II2A 4YQXL 1JERA 3T4AC 3QJOA 2YEQA 1JMXA 4LRIC 4OGXL 4LCIH 1RUQL 5EU5A 5FW7A 1X5AA 3SKMB 1HYSC 1ZHLB 3LKOB 3RLSA 1OSZB 4L8DB 5ECJE 2AERT 1JK8B 3EAKA 5AFAA 4F2MA 1W8OA 1A7NL 4IRSD 1S7XA 3D69B 2WWKO 5EZLB 4HXBH 3L3IA 4WWKA 4WK4B 1KJ2L 1FNGB 1OSPL 1SQ2N 2MPVA 2X70B 5ACMA 4RWYH 2YPVL 3IFLH 3RDTC 3PUCA 1IT9L 4KI5D 4XMVA 1U8LA 5DEFA 3FQUB 3VXMB 2I9TA 4ZMYA 1VPOL 3DVGB 1BFSA 1KPVB 2YQGA 1P7KA 1OB1B 2GC4C 3FQWA 3BIKA 4DGUA 1KFAL 5T33H 3QRGH 5CP7B 1ETZA 2A6IB 5D7SH 3KVQA 2ITEA 4WY7H 5IBLC 4MD0A 1TCRB 1V54B 4LPYA 5FDWB 2KYIA 3VI3A 2G5BA 3VGHA 2WCGA 3FRPA 3L16A 1KIPB 5DHVA 4ZFFB 1DSFL 4W4OC 4ZX6A 5EO1B 4PRPB 4F20A 4Z7OE 3TBVA 4Z7UF 4BSVA 4QY8B 3TH3T 3UYPA 2DM4A 4JR9H 4YHYB 3O9WA 3QPKA 2X9ZA 2TRHA 3RHWF 1B4RA 4YXLH 4TNFA 4G6MH 5B3NA 3IEAA 1NDGA 4LDLB 1H15A 2A6KB 5B39G 2X1PA 1OWWA 3C9NA 1OT4A 1IKNA 3FH5A 4EN3C 2CXKA 4BA0A 4LGSB 2WWMC 3EFDH 3BXNB 1NCAL 1ZA3B 3D34A 2ZXDA 4CAGA 1CXLA 3P40A 2V9UA 3IXAB 4P4RA 2O61A 2MNWA 3WJLC 1XBRA 4HFUL 4HLZH 4Y9CA 3WLWC 3GZPA 4MB3A 2VQ4A 2ICWJ 2P52A 1JZDC 1L9RA 2WZPA 1MWAB 3CSBA 4LSVL 2JELH 3QRBA 5AG8A 3LZPA 1U8QA 4NI6A 5BPPA 2JLLA 1EZUA 1Z6JT 1OXYA 2ILLA 4PFEA 5BCAA 3RGVD 2Q3XA 3FFOA 1DDTA 4E9TA 1ZHKA 4DPAX 5A2LH 2PW2A 5TE6L 4N28A 3L17A 3TJEH 4HJJL 4CC4C 1GH7A 3ZHKA 4EOWL 3NJJA 3T77A 5I1GL 1W72L 5K9KA 1N4XH 4BCXA 2P9RA 4J39A 5DA0B 1T4KB 3EJUA 3PJNA 5DD3H 4PR5B 1SFHA 1RU9L 3WFDL 2IQAB 3VVVA 1KC5L 3OAUH 4HCGA 3VTTA 3B2DC 5KVGE 2OM5A 4N9OB 1AZZC 4WJ5A 3VVWA 2RHEA 2HKHL 2VWEC 5DTFB 4ONHB 4PVNA 5C0GA 2XZAL 4D0CB 3IRCA 4U6HA 3QUZD 2YWYA 5DZOA 3QEQE 1QWNA 4I4WB 2DJSA 1D7FA 5D2LB 5MEQA 5JNYA 4HEME 1MZZA 4PV8B 4OZFH 5F3HB 3A6BL 1SXBA 4JG0H 4AYMC 3HCVB 3JWDH 1TIUA 4LQFH 1GZPA 5EBMA 2VL4A 2DLFL 4L3FA 3NA9L 1DQIA 1J1XL 1MWOA 3P2DA 5A6IA 4BZ1L 4D9RD 1J8HB 4MMXA 3SGEI 1CT8B 4L2LA 4JDVB 2B3IA 2DYPD 3ZSSA 1EAPA 2RTTA 4X98B 3I2CH 3F64A 1BOYA 2G0LA 3KXFA 1JGUL 5J8OA 4FYTA 1KTRL 4YUEH 2FQGA 2B4CL 4L5FH 4V1DE 2Q7AA 4PSPA 1P84K 4OI7A 2X2UA 1G7HB 3DMMD 4UQ2A 3FF8A 3EDJA 4HS6B 1T21A 1Z5LB 2R2HB 4AQAA 2GUOB 3MX0A 4C56E 1A1MA 5IFJA 3I6LE 4KROD 4UTAA 3UMTA 2XWJA 2VC2L 5EOCH 2XPZA 2JKTM 2EIBA 4I1RA 4KY2A 4LB8A 1VRSA 3ZL4L 2MCPL 3TZVB 3B43A 2MQCA 2GABA 4XI5D 3AVEA 1H5BB 1MEXL 2IWGA 4NZUL 3QR0A 4OJFL 4KKQA 3KM1A 2EC9U 2F7IA 2ZKMX 3OJDA 2CJUL 2J1ZA 4QD2E 4XPBL 4FOMA 2OL3H 4APQA 3AACA 1PZBA 4DQAA 1FV1B 2EXWC 1GJWA 2FAUA 1J1OH 4G3YH 2C34A 3ARRA 2CKBH 3COOA 5ID0A 4JY4B 3TVMD 4X8GA 3DXAB 4QWWC 1PBYA 4OB5H 5E6ID 1VZIA 3S37H 2X0VA 4YHKH 2XN9B 3ML8A 2Y6TE 1XFPA 1RLBA 4OZIB 2BP5M 3BAKA 2DD8H 4JFUA 3D4ZA 5D5MB 1JYXA 1OOAA 3WIIL 1KIUA 3CFEB 4CRPA 3EJYD 3V4LA 4DOHB 1OAXH 4EOWH 3MBEC 3ELQA 3WNKA 3NVQA 4AUJA 1Q94A 2YOAA 3PL6A 4JO1L 4AXWA 5JQIB 1J05B 4D0DB 5DC0A 5C86A 4YE0A 4IOIA 1RK7A 3NCJL 3M1BA 3KJ6L 3KL5A 1U58A 3L2MA 4AVKA 1MJ7H 5C9JB 4UU9A 5AW1B 5MHSE 5F88A 3LNEA 1BBJA 4OIIL 4IJTA 5KOMC 3SGDH 1BVKB 3FOLB 1WAPA 2WKLA 3CBKB 4HIEA 1V10A 4ALAC 4NZRH 5I0YA 1ZLVK 2X4SB 2Y7MA 4PJ5A 3IU3A 3VGDA 2PTTA 1HCZA 4LARH 3WL9A 3LB6C 3OKLA 2J2ZB 4JFYA 1YMHA 2AZAA 4YDIL 4ZSOE 5CFHA 2CBMA 4LMQI 4M3HA 1TT6A 2MIZA 1H8NA 1M6UA 2X10A 3HS0A 2IH3B 3CSPA 4RISH 4Y2DD 4NSKB 3SD5A 1BIIA 2ID5A 4EI5A 3G6JF 1IZJA 2JWYA 3F05A 3NCBB 4ZMNA 3V7AE 2Z0UA 1U8HB 3DPBA 3NFNA 3FU7A 2DJMA 4JHUA 4ZTEA 5I19H 2G3XA 2DTMH 3X1NA 5G55A 2PCXA 1W15A 4JFDB 5AOJA 3OKOA 1HNGA 3IJHA 4TRPH 4QRTB 5FFOA 1GAFH 1U8IA 3V2AR 3K5SA 1P5UB 3BESR 5DJDB 3WV0A 4ZBJA 4BZ2L 4JDTL 3MJ7B 1EVUA 4XC3H 5DD6B 3GI9L 1DYZA 2CJ3A 1CQKA 5IESH 1FVDA 1F4HA 4X7SH 2FJGA 4ZYKA 1GW6A 3QC6X 1U3JA 4OGQC 4WNQB 1EEYA 5G4NA 4QYAA 3T0AA 3I50L 4I77L 4ZXBA 4R2GD 1PU0A 2AEWA 2PXYD 3L3GA 4GO8A 3PQYE 3CZNA 1E3XA 2BCMA 1JTOA 5CCGE 3PWJB 3RVXC 3FB8B 4HZ1A 1CUOA 1R5VA 1YVLA 2WLHA 2AQPA 4UT9A 3UBXG 3WFBH 2JKNA 2VH5H 1VACB 2AXFB 5FUCE 4OZGB 1NUGA 4GOSA 2GTZB 4DP2X 1ZE3C 2CUIA 3QWRA 1FUNA 5I2IA 3O8XC 4N2HA 1U8CA 1JNNH 1DJWA 3G5XB 1QW9A 3EFOB 4NHCH 3IJYA 2ALAA 4DAGH 2K45A 1IGTA 1PEZA 3F85A 3F7PC 1FL6A 1U8KB 4LO9A 3ZE0F 1DBKH 4HPOH 4KV5F 5D8JH 2WLJA 3HC2A 3OSVA 3ML9A 5DO2C 5TDOB 2J44A 1RP8A 5JHAA 4F3FB 3IMBA 2OXHA 4FQXA 4KJYA 1NL0H 4GAJH 2BNRB 3SSGA 5E2JA 5I1JL 1AGDB 1BZ7B 4Z0XA 2WGXA 1KJ2A 2W91A 3U36A 3FTZA 1I8IA 1M7IA 3TWCL 2YPVA 3B2VH 3MAWA 2X1WL 4FTDA 2FQDA 2VDQH 2FNWA 2H8PB 4LOEA 1WBXA 3VGEA 3LN5A 5C70A 3GK8L 3II1A 2YGNA 1ZGLB 4D8PB 3VFNB 2MFNA 3BH4A 3LZNA 4G72B 3PNWB 4BFBD 2Y7QA 1UOWA 2H9GA 1QBAA 3BGMA 4PJEB 4W9IC 4I1PA 2BY3A 2G9KA 3TBYB 2W0FB 3O9WD 4AK1A 2V33A 4XC1H 1ZMYA 5JMRA 3HUJE 3IJEA 4HWNA 2VSMB 3JTSB 4WSJA 2ENSA 3T2OA 3GXPA 4PJHE 3KAAA 5CD5C 2EEDA 2JJSA 1H0DA 3F2LA 1MI5D 3GMRA 2Q7NA 4E5XG 1GYAA 3JV0A 1HHIB 1RZ7H 3O3DA 4FFYA 3K2UH 5B3JE 1QPPA 3DBXA 3IGAB 1BAGA 1CF8L 3TF7C 5AYQA 4WHTA 5DJAB 4JRXB 4YE4L 1AD9B 2P80A 4Q2ZB 4JFFA 4X80L 1T1YB 4MDIA 1HWHB 2J73A 3D25A 4NUPA 1FG9C 1WZAA 2WZPD 3ZDZE 4NKMB 3MPCA 5GGSA 4G8EA 5IHUH 3QIWC 4N2AA 1FDLL 1UGNA 1JYWA 1E9QA 3TCLA 3CQQA 4Z7WA 5INCA 2KERA 4Y9GA 3GINA 1D3CA 1SQMA 5C0DA 4JJ5B 2X7LB 2ED6A 1UVQA 4NRXB 3KJ4C 4JGMA 5B8CA 3S7GA 2Y2WA 2F54E 3ATFA 2E7LA 3BYYA 1OGAB 4JZJC 1MCOL 3O2VH 4A38A 3V6ZA 1N18A 3BMWA 3HEIB 1BWWA 3MV01 4LF3B 4FLRA 1OF2B 1K72A 1KBGL 3SQBA 1TKWB 3PFQA 4JY6A 1A8JH 3QXVA 2NUPA 1W72A 2ZF9A 4LNVA 2BWDA 4G1EB 4MBRA 3JT2A 4UQAA 1NH6A 3FCSA 4DP6X 4MWFA 5BUPA 5KBDA 2ITFA 3ARDC 4ZPTA 2SODB 4FNLH 5H94A 3WXVH 1JDCA 1YMMA 3TA3C 2Z91B 3BO8A 4KK6C 1J8RA 3OKNB 5ES4B 4BE6A 1AR1B 1ACZA 1KDJA 4F8PA 4LP4A 3WE1A 1O6SA 3BFQG 1WV7T 2FYYA 5IHZB 2Q2LA 4OM0L 2G0KA 4J3OF 1SJHB 4J3TA 4X6FB 1TNNA 3WN5A 1CGSH 1NC2D 4XVJL 3TP4A 2WXIA 3UAEA 5C3IA 3ARFA 5FR3A 5E7FA 3LSOB 4BZ1A 4OBSA 3SYOA 4N0FA 4FEIA 3KXFD 4ILDA 4ADIA 3V0HA 1OAJA 3VSQA 1YEIL 2AQ3A 2H26A 4M4RA 2OCJA 4LCYA 5SWZA 1FO0L 1IM3B 3GBNL 1TVHB 1NAMH 3HN8A 1W80A 1NEUA 2MHAB 2ZG3A 2MMXA 1UA3A 2Z65C 1N7MH 4HKXA 4KHTL 5HGHA 1Q1JL 3AXLA 4W81A 4L37B 1F90H 1ODUA 2BVYA 1FE8L 3FC8A 5B1BB 1BXXA 1ET7A 4Z7VB 1UZGA 3CDZA 3RAJL 1OTSD 4MQTB 3HB3D 1T1XB 3D39E 1UFGA 2H5UA 3PWUB 5EFIA 3RHWK 5CEZE 2AEIT 2VR5A 4M9OA 2DQMA 4IMKA 3RZCC 2N4IA 4G6KH 2WV3A 3BWAB 1MCFA 1MWAL 1YEJH 5F7HA 1BM3L 1N6UA 4APQD 3O4LE 3JVGC 3L7EA 1SY6H 4F7TA 1TJHL 3WJJA 2JE8A 1MJ8H 1MUJB 4IBQA 4Z7WF 1AE6L 1JYVA 3AMLA 4JAMA 1LTXA 2NNAB 4IRJB 3PWLB 4HJGA 4NWUL 5D1QA 1WSST 5F96H 5LUMA 5FHBH 4RRPA 2JXMA 1HT6A 2F19L 2GSIA 1BQHA 4ZMPA 4XNDA 4H4NA 3NCXA 3ZE1B 3MLVL 1M2VB 1BZEA 4AT6B 1R0AH 4Y19E 3QFJA 1NMBL 3PL6D 3QW9A 3C09C 2V2WB 1TTRA 5I8KH 5I1AB 5EU6E 3AG4B 2YSTA 2LT9A 5C0FB 3FTVA 3IE4A 5DUPH 2F8OA 4PUBH 5CWSB 2Z8RA 3L13A 4ZG1A 1CCZA 1T0NA 3TV3H 3PIQA 3KLAA 3UAAA 3JVFC 4PEEA 4QRRA 2LFGA 4JRFA 4G8AC 1S5HB 4PJ5D 1EJ8A 3OJVC 4BD4A 3QDMB 1ZLUH 3TEWA 4NC1E 4Z5RA 4XP4L 4YX2L 2Y72A 4HEPG 3ZLQC 2CD0A 3EYFA 3W0WE 1IBGH 1DN0B 2OMBA 4AV0A 4F8OA 5KJRH 2NT1A 4JREB 4L9DA 2NY4B 4O02L 4AKOA 1E6OL 5KUKA 1SHMA 4AEHH 5GS0C 3LNIA 4JPIB 1VFMA 3T3ME 3GJFA 3SE6A 3KPNA 6PCYA 3HLKA 3ESOA 1PX4A 1UM6L 3GLEA 4GFXA 2Q87A 2P49B 1PLGH 1M05B 3HPJB 5I15H 3ZE2B 4CMHC 1CDHA 2DQGL 2WLZA 3BP7B 4H1LH 2WZAA 5F1KC 1XD1A 3V8CA 3GBEA 4X7TB 5C3TA 3RWCB 4LEEA 1MPAL 1OOWA 5CS7A 3IDJB 3RILA 3G6DH 2EDDA 5DK3A 1MFDL 1LP9A 1T4WA 3NP3A 5CJXA 1PX8A 1S9XB 4JE0A 2BOLA 1HXKA 2CK2A 3KS0H 4BZ2A 4FQLL 4YDVA 2D7QA 5IBUB 1I8MB 4GT7A 2YXVA 4PCTA 5C07E 3MXWL 4I48B 1DEEA 4ZXBD 3P30H 5DYFA 3S4SG 2GTWA 3HE6C 2XWBA 3DX0A 1G1CA 1TZGL 2R56L 5FYKH 2C9SA 1IIKA 4GAGH 3GLZA 3ESNA 1GY2A 2QV4A 4Y7OC 5IQ7H 3KYOB 1VFUA 1N6QH 5AW9B 2SEBA 5JUEH 1PD1A 4MZ2A 3MLRL 5F0LB 2DOCA 2JKJA 1KNOA 1S4IA 2CGRL 2NY2D 4W93A 1CE6B 3MRFA 4OJYA 1JV5A 1IGJB 2D7TL 2W0PA 3QZOA 4FG4A 4PAZA 4X8JB 3MRNA 2E6PA 4JLRA 3TESA 4OR1A 3CDGA 4WUKH 3FXIC 1I8KB 3DIDA 4JB9L 3T09A 1XMEB 4FL4C 2RA1A 1KN2H 3UYOD 3D05A 4JFEB 1D5IL 1SYSB 3LN4B 4LLMA 3U46A 1PDKA 2XZQL 5B7FA 3F7RA 3CGTA 1D6VL 2J56A 4OCYL 4FQXD 1D5XA 1MW1A 3ZKSD 5H37H 5EC1A 5HHOA 4J3OD 2WNGA 4P5TA 4GKSB 4GRWH 1YNLL 3APFA 4RVBA 2BO0A 3HRZA 3KBPA 3EDFA 2A4CA 2IGLA 3AWEA 4FNUA 4TYUA 1RD6A 5H2BA 5DUMH 5BUAA 3TPKA 2CHZA 4MCZB 5AW7B 3RPIA 3TYGH 1CFTB 1RIVL 3NZ8B 4AG4L 3X14B 5IBTL 1B0RB 4DKTA 2K7PA 3BEWA 4HS8H 3VXQB 4I87A 4MNQE 3VQMA 2XFXB 1PZCA 1XF4B 4XCNB 3ZYZA 2MSPA 1TQWA 4FTVA 2XIBA 5D4QA 2EDEA 4LVNB 2YD4A 1FRGL 1MVFA 2GBUA 4TNGA 2Q0ZX 5HYSB 4JFSA 1IGFH 3IXTB 1FCCA 2Q76B 4PJ7B 4EKJA 5HHXH 3BKJL 3TT1H 3BDXA 5AVSB 5HBBA 3NH7L 3K6SB 1WGVA 2AJUH 2OMTB 3L5HA 1YNKH 1N0LB 4GI6A 4PSRA 3EBAA 2JI1A 2P8PA 4LSPH 3UTSA 1IGYA 2V3EA 5GJSH 4YZWA 1TLMA 3FT0A 2ETWA 2IGTA 4E41B 5B1JA 2BHYA 1QLFB 3EYOA 1INDL 4LSUL 5DGRA 2P80D 4JFFD 1BQLL 3QNYB 5LN8A 1HDMB 3ZXAC 4YHPB 2F5AH 2PNDA 5GJTL 4OZFB 1UWEH 2IOMA 1GGBH 1CR9H 2CNZA 1A14H 3JXAA 4XP5H 5DVPA 3D3VB 3CHXA 3RWFA 5DVOA 2C3WA 3HC0B 3BPLC 4PJGA 5BZWA 4ALAL 4WDIB 5KSBB 5KYYB 4HA1A 1EJOH 2KS0A 4FQIH 4AM0B 4L29A 4M6OH 6CGTA 1DVFC 3H9ZA 3G5YB 1XR8B 3UJIH 5KS9A 3O6KH 4P05A 4Y5YC 3VRIA 2CO2A 2AXGA 2RQ8A 3SKNA 4M93C 3I6KA 3VD2A 2FX7L 5TPWL 3M88A 2BOBB 4N4YB 1TQUA 3IJ7A 2HMIC 5HI5D 4NAMA 4X5PA 1ECYA 2E3VA 3FCGA 2H3XC 2VLJA 4I3SH 4BK5A 3US0A 3CH1A 5LG6A 3CC5B 2J12B 4KTDL 1XL4A 5IW6A 4OF0A 5F7WC 1FCGA 3EXLA 3WTTA 4BKTC 1EEZB 1H9VA 2KQMA 4ADGA 2EE2A 4PY7B 2YAPA 3VDBA 5T1DH 2ADYA 3OPUA 5EZLA 5FA4A 4PJ9C 2N0KA 2ED8A 3N85H 1T7WA 1ACYH 1E4HA 1M71B 4IM8A 2H41A 3Q8CA 4FS0A 4LU5L 2JI2A 1MFBL 4XCYB 2Y36L 3K91A 3UTPE 2F53A 2HT3D 2OL3B 4G8IA 1ML0A 5T1KB 3ZUNC 3VE0A 3DVGA 3VGAC 4DW2L 5BVJA 2JQZA 3R1GL 2XCMC 3ZKXB 2R23B 4K7PH 3ARFD 3E9UA 2Y0SA 2AEQL 3CAFA 1HH9B 5FKAA 4P59H 3O2DL 2CKBB 1HKLH 4QMEA 3SODB 2NSQA 2GBAA 4LSQL 5DI8B 5CP7A 2A6IA 4NO5B 3HNVH 5BOZG 4MRBA 4N6QA 4RESB 2Y7LA 4K5NA 5SWZD 4H7VA 3T4AA 4EDWH 4ZFFA 3F7QA 5EO1A 4PRPA 4KZDH 2DQDH 1FO0A 1WYJA 4Q6KA 1Z9MA 2AV1B 1BXAA 5C6TH 5GS3A 1CFNA 3CPLB 3WYRA 4AE0A 3B9VA 4ABUA 1CDCA 2WZ5A 4P9HC 4CVUA 5L4FA 1CK0H 1PG7H 2AF2A 3WTUA 3CFCL 5I1IL 2FYVA 3MROB 4KJPD 2ZD0A 1XIWC 1KLFA 3BXNA 5E99H 3SBQA 4ES9A 5JPMC 3H85A 2RCSH 3QPXH 1P6AB 2EUWA 1KMGA 3FT3B 4KX8A 2FWUA 1S7TB 4UNUA 1RUMH 2PWHA 3SPIA 1DLHA 3KYNA 1Z9NA 1T3FB 5J1AA 1VLXA 2WINA 1MWAA 2I27N 4YBLB 1PD6A 5EO0B 1QRNA 3WFEL 4PJGF 5B7EA 3G9VA 3NCYS 4PVLA 5AOZA 1AO7A 2YPLA 1ERNA 3ECWA 4ACPA 4Z3EA 5CCJA 2FT6A 4XMXA 4MXVE 3RVWD 1OVZA 5IREA 1JS4A 2W9EL 3V0DA 1U93B 1UT9A 5F2FA 1WAAA 1LQBC 1QKZL 4MDJB 5KS9F 1G94A 3B3IB 2EDLA 3AM8C 1Z9SA 2NNRA 4PRIB 3QFJD 3S98A 3QC5X 4K5LA 3NA4A 4EN3A 1FYTB 1FIEA 4HG4J 2ZZUT 3Q6FB 4PIBA 1OE2A 4PJHF 3THML 2F7PA 1M1XB 2VDNH 3OKKB 4JFQB 4RSYA 4YSTA 1J8KA 3WJLA 2AK4D 4I0PB 1G7LB 3Q8EA 5B3JF 1YA5A 3AXIA 3Q44A 4QRRD 4YHML 3T1WA 1T7VA 2P5ED 4I4WA 3VWKC 4A2EA 4F24A 3ZSTA 4IGBC 3BZFA 4Z7QE 4UYPA 2Y07L 5K9OB 1MXGA 2X2YA 4G8GE 4WK0B 3ZDZF 3EYUL 5I17A 2XNAA 2AQNA 4RGMB 1A1NB 4UYQA 2JFCA 1J8HA 1AR2A 4JO3H 2YBRA 1Q0YH 4O02A 5D2NB 4N22A 4F2EA 1LNUA 4AZ8B 4JHWH 4PJDE 2WXMA 4ISVB 4WO0A 2Z31B 4RMSA 3FTWA 3CUPB 3K80A 3P4OA 1KELH 1GS8A 3LIUA 3MV8D 5CJOL 3QHZL 1NPUA 2OCFD 3LDBC 3BSGA 2IAMC 2BERA 1I7TB 1JZFA 2GUOA 2YD1A 1B2WL 2YA1A 1YPZB 3RZWA 3JWNC 2V0AA 3J07A 1MCDA 2BXZA 2QHRH 3GIZL 1A0QH 2DQCH 2VXSL 1HSAB 3TV8A 4AV5A 3VI3E 1XSKA 1FZKA 2WMPA 1J5OL 4FNRA 5KBLA 3TJPA 4J3BA 4YSQA 5JR1H 3V4UL 4PJFE 2P3YA 1W16A 2PWFA 2DLEA 4G1MA 2E6QA 3Q1EA 4K0OA 3B9KC 1D5BB 2XN0A 2VIRA 4ZNCD 1TPXB 2YD3A 4NJAH 3RUGA 4JY4A 1MAMH 1LK2A 4JX0A 4R97B 2HVKB 4BDVA 3GTNA 4XAKD 3IFOB 1MFAL 4LQ1A 5HHOD 1ECZA 4IIQC 4NUJB 4OZIA 3EO9H 2VDLL 1GPOL 3C08H 3CFEA 3T0VA 1QATA 1I75A 5K93A 3KWWA 1FZJB 4X6BB 5I73B 2OMVA 1I3RB 4Y16C 1L0PA 1TUPA 2V7NB 5IK3A 3DX2A 2YJLA 2CRYA 4TL5A 1LILA 1J05A 3LKSB 4NHUB 4Z0BH 2EIJB 4K9EH 3BZ5A 3T3PB 2AV7A 1PZ5B 1AJ7H 4NQVB 1NAKL 4MLIA 2P26A 1AGCB 4H20H 5EEUA 2NY6C 4A55A 3BAXA 4JPQA 1BVKA 2Q2EB 3FOLA 4J3VA 4NZTL 4FQ1L 4FTVD 4QT5B 4BK8A 1MCEA 3MKGA 4HH9B 1M7DB 4M5SA 5KYUB 3FOMB 4KKNA 5DS1A 1ILUA 2YK1H 2P4AB 3B7RL 5JHMA 2CO6B 1AQMA 3ZQWA 3FJTA 4EMZA 4GAYA 1EHAA 3JWOH 3PAYA 4P2OB 5C2UB 4XOEA 4OD1H 2ZQKA 2HJFB 4PRHE 3WO4B 4HXBL 2HG0A 5JW3H 3NQIA 3M6DA 3VXUA 2DEWX 3CFDA 4WHYG 3DJTA 2PYFB 2WQWA 3MO1B 4BFGA 4O4YH 4RWYL 4YXHH 4QRTA 1A4KA 3IFLL 1BEYL 5DJDA 5K1NA 2G30A 3D06A 1EFXB 3SE3A 2WQXA 3KPQB 1PNCA 1Z9PA 3LY6A 3C2AL 5CEXA 4U7KA 3TBWB 5BRZB 1QUNB 3ZL1A 3C5ZC 1PLBA 4NBXB 1RZGA 5FYLH 1UZ6E 4WNQA 4L1BA 4FXLA 2QQNH 1AQKH 4OLWL 4OVUA 4U33A 5T33L 3GWJA 1K4DB 3FH7A 5D7SL 5F6HI 5GGQH 4K8RL 3C6LC 3VSVA 2NZIA 5I1EL 1FNSH 4GQ9L 4D9LL 4RMRA 1R3KB 4J8QA 5CN2A 2FTAA 1UB6B 2H2SD 4P46B 3MV9B 1BX2B 1JFHA 3L9RB 1P7HL 1NAMB 3Q8AA 3BSZH 1UT2A 4ADJA 2AEOA 3STLA 4YXLL 3WTWA 2JKWA 2VLJD 2QT6A 4P23C 4HK0A 3IF1B 4LGPB 3G5XA 1N64L 4H25B 4XCCL 1S9VB 1TZIA 5FO8B 1YJDC 1BAFL 3RUGF 5D96C 3TYFB 3MRKB 3OKDA 3BUDA 5IQNA 4L18A 3DURB 1AP2B 1XSOA 2DLTA 2CH8A 2ZWLT 5FLUA 4F3FA 2ITCB 4LLDA 4YN3A 3SE4C 3D7PA 1BZ7A 1QBML 3H0TB 5KSAB 2F53D 4WSKA 5F3BB 3AQZA 2A6JB 1E5ZA 1HIML 3FKUS 5FGSA 3ILEA 1KGIA 2WXPA 4KK5C 1KIRB 3EHBC 2CKNA 1SXNA 4RFEA 4HU2A 1BMGA 1GOGA 5EUOA 1ZGLA 3GSRB 4D8PA 1NCIA 3H3PL 1YYML 4GSRA 1NCBH 3VFNA 5D1ZD 3BN9C 3O2DA 3F12A 1TSRA 3QJQB 1WGOA 3VFGH 3JTTA 1NDMB 2E76C 2HX9A 1MHCB 2JB5H 3EJRA 1MJJB 3QB7C 5E6ZA 2FQFA 1SLUA 4P3DB 5FM5O 4S10A 5F9OL 3J8F7 2UUDK 3MJ8B 4WFHD 2OYPA 2ERJC 5EHFA 3WY2A 3IGUA 1RUAH 4JFHD 5GSVB 2R0WH 3OAWA 1CIUA 1XCTB 5FW8A 4I85A 5IEKB 1A4JB 3ARTA 1RERA 1KGYE 1UM5L 2Q5BA 4XE5B 3RWEA 2FH6A 5IJBC 1XGTB 5DQDL 3U4EB 4YEEA 3VSTA 3BKCL 1EIBA 5IJKC 1W0WA 2QV2A 3HAEA 3FFCE 4MKTA 4WI8A 5JHDA 3QDJE 3DX9A 3MRPB 3O6FC 1WP6A 3JWDL 2NW3B 4LQFL 4Q2ZA 4UQ9A 4M7JH 4CSZA 1IC7H 4S1RH 2JNZA 3GJFK 1K6QH 2H0JA 2VXQL 4NO2B 4TSCL 1QRND 3A4EA 2EIZA 2VABB 4N87A 3L3OC 3LMJH 4NKOB 4F7MB 3WSQH 2YPLD 3FB7B 3VI4A 3HZ3A 4DEPB 3CVHH 1RVFH 3MSPA 1MHPL 3PWPE 3CHSA 3PAZA 4X6CB 2R0KL 4NUQA 3QXTA 4H1LB 3TS8A 1YEWA 4P0DA 1OGAA 2GITB 1KGJA 1NCWL 4ZMOA 1CG9A 4M6MH 5D1ZI 4Z7AA 1B0WA 2C26A 3RURA 4LF3A 1OF2A 2F5BH 5C0RH 4EN3D 5KTEL 5KSUB 3PHQA 5A1AA 5JIPA 2WWMD 2QVMA 5BS0E 4KZEH 1OAQH 2Y23A 4LBEA 4ES8A 4G1EA 1HJCA 2DWXA 2XLLA 1DVUA 4OSUH 2MKLC 5F3FA 1DQDL 4DVRH 5I30H 3KLHC 4IU2B 3WLWD 1T1ZB 5DJ6A 4R9HA 1P4LB 2J8HA 2DL2A 2R51A 3DRQA 4I8DA 1NGPH 4X6EA 1VB9A 3ECBA 4AL8H 2C9XA 3QIWA 4WUUB 2V2TA 1JN6A 5JHBA 3S37X 3JWNG 3DVFA 3P9MB 5EU7E 5DZJA 1PZ2A 5FGBC 1S3KH 4KITB 1SJHA 3JV5A 4A7GA 4AEEA 3BEVA 3SDAC 4X6FA 4Q9QL 4FXKB 3F00A 4KMTL 1JK9A 2CKBL 5CKGA 2ODIA 4GKNB 4XN4A 1AGEB 3UZQA 3HOGA 1AGBA 2D7OA 3UBXI 5DRXB 2XC8A 5J3HC 4QLRA 3S37L 1FFPA 4JZJA 4Y4FA 2AVFA 1GGYA 5BXFB 5DA4A 3FONB 5F71A 2DD8L 3KGSA 4PJBB 4YVUA 1S7QB 4GSQA 3U2IA 3EH3B 3WFCH 4EBQL 4MD5A 4QNPF 4G7YH 2VSDA 4GRWB 1N8ZB 4AGOA 1SJEB 4DSYA 4QOKA 1OL0A 3UOAB 1FFQA 3FUJA 3OXRA 3KHQA 1MJ7L 4Z7VA 5LXVA 1MOEA 4ZNEE 2R29A 2OJZL 3FQNA 5TDNB 2XVBA 3APDA 3BKML 3I9IA 2YUVA 4GI9A 2OS7A 4KRLB 4XHJC 4N8CL 3UJJL 1OPGH 4V33A 1W6LA 4HBQA 4NZRL 1E4XI