1ANUA

Cohesin-2 domain of the cellulosome from clostridium thermocellum
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
138
structure length
138
Chain Sequence
VVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAIYPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cohesin domain from Clostridium thermocellum: the crystal structure provides new insights into cellulosome assembly.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cohesin
molecule keywords COHESIN-2
total genus 28
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1anuA00
3UL4A 2ZF9A 3BWZA 2B59A 2Y3NA 4IU3A 1AOHA 2OZNA 2VO8A 4UMSA 5K39A 2CCLA 2XDHA 4IU2A 2VN6A 3FNKA 1ZV9A 5AOZA 4FL4B 5LXVA 3KCPB 2BM3A 4UYPA 2VN5A 2O4EA 3KCPA 3F2LA 2JH2A 4U3SA 1QZNA 4FL4C 1OHZA 2W1NA 1TYJA 5G5DA 1G1KA 4N2OA 3L8QA 4WI0A 4UYQA 4DH2A 1ANUA 3GHPA 4WKZB
chains in the Genus database with same CATH superfamily
4KH9A 4FZ8L 1JTOA 3RDTB 4W70A 2XX0A 2XACC 4HIXL 3KBHE 4TKWA 5FCUH 2NMSA 3IN2A 1R5WB 4DNLA 5F0JB 4NQXA 1CTOA 4KI1A 4LCVA 2AK4A 2B7DT 2Z34A 3TIEA 5I1CH 5IUSA 2J4WL 5G55A 2RB8A 2R39A 3X14B 3EJYD 2Z92A 4TNVK 1A1OB 3T6VA 1O5DT 5F7BA 5KYNA 2EE6A 1SDDA 2H7WA 2FGWH 3GMLA 3SKNA 1NFIA 4OF8A 4DZBB 4JFDB 1IFHH 4KV5F 3V5KB 3HAEG 4EUPH 3QJQB 3OKEB 1H19A 4JDVB 2Q87A 3S8WA 2AQSA 3ARED 3WUWA 3ZW3A 4WO4C 3HI1A 4GKSA 5GGTA 1PLGH 4ZAKD 3C5ZC 3DGDA 3F04A 4PRDA 1ZLWK 3CHOA 4J39A 3RAJH 2IFFH 4B50A 4QRUA 4QXGL 2EYRB 4M5YL 5C0GB 4PRBB 3MJ6A 1IBFA 3KD4A 3QQ3A 1RFDH 2YR3A 4G6FB 4FKKA 5I18L 3IFPB 5F7HA 3CDCA 2GTWA 3EOBB 4YUEH 5FGCE 5E6IA 3UAAA 5GS1B 5TPWL 2IADA 3FPYA 1MW0A 3SKUD 1CD0A 1HINL 4V33A 1MCBA 2O6EA 1G4MA 1YDPA 2WXJA 3LX9A 4OGAD 5G4MA 2E7HA 3IGLA 3BAIA 3VFUA 4MASA 1KCVL 1XEUA 5HHOE 4KI5C 3BSZA 5F0LB 1ZIBA 4NOFA 1T03L 2Z8WC 3T9WA 1UUSA 3ZE0E 4ONGH 5C6TH 2C4XA 3ARGB 2BX5A 2XFXB 3GYRA 4U6HA 2ZX5A 2Q9OA 3WO4B 1UA6L 4YE4L 3VXUB 1RUKH 1SXZA 4RAVB 2MHAB 3CK0H 4U0RC 1QBML 1Z7JA 2B14A 3IGAB 2AANA 3MRJB 4F37F 1E90A 3RWFB 1W9XA 2X12A 2Y5TB 3OWEA 4JREB 4OLWL 3PQYB 3Q6FB 3VXRA 2ZWLT 1MIMH 3IN0A 2X87A 3V4VL 3Q8FA 5HGBB 1C16B 3JUZA 2R29H 4HKJA 4PGDA 2IV8A 2GIXA 3H9SA 1J48A 3AT8A 4X6CA 3MV8E 3T0EA 3DXAD 5C09B 4PGEB 1XGZA 3EGXB 4L37A 1CDYA 3STLB 3VVVA 4Y5YC 2OS7A 1OAYH 4HXAH 3NBNA 1WTGT 2TRYA 5BZXA 2H45A 3MLVH 4BE5A 4AGOA 4ZO7A 4A38A 2RR3A 2R83A 4X5WB 3CH1B 3S96B 3ZE2B 3CZNA 2Y6SC 3P4MA 2CD0A 3OZKA 2H0JA 4GQ9H 3RLSA 5F7FA 3V6OC 5GZNC 4IIQC 2AK1H 2P28B 4LLQB 2VDML 3E7JA 3KVPA 4YC2C 3SDCA 2NZIA 1NCBL 4HT1H 4F7PB 4OD1L 4CN4A 1K4DB 1SDDB 1J1OH 3ISYA 2NXYC 3KXFA 4Y4FA 2AITA 4Y5XC 4QRQA 1ECZA 2WUCL 5C09E 3IJSB 4FFYL 1KTBA 3KCWA 1HKLH 2F61A 4OW6A 3H6JA 2XPYA 2BIIA 1BXUA 1ZSDB 3MV11 4G6KL 4HGWB 3U30B 1FSKC 1WZMA 4JFPA 4XO8A 1GSMA 3L95A 1KT2B 5GSRA 4NM4H 2J88H 1P5UA 3EG9A 3NOIA 1U9KA 4OQTA 5DZVA 4ODTL 2GUOA 4KROB 3WLWD 3TTSA 2QFPA 4H25A 4NN5C 1CL7H 4PTUB 3V0GA 3ZE2E 1BF5A 3HPLA 5HDWA 3ATBA 1LTXA 4EO5A 1NH6A 3NFNA 3QQDB 3A67H 5E6UB 2Y22A 5KANI 1A4JB 1UD4A 2K8MA 4MD4A 1HT6A 2FX9H 5JLZA 2E56A 2Z31A 5JORA 4BSVA 3IFOA 4N8CL 1JERA 1FNEB 4BCXA 1T3FA 1GCYA 5KYWA 1H8LA 2DBJA 2DMCA 4YHPA 5GRXG 3UYPB 3LDBB 1LL1A 2WBXA 2YBRA 1OAKL 5EOCJ 2B9BA 4U6HB 3NJKA 1RD6A 3IU4H 2AERT 4FQLL 4D9QE 1BBDL 2XKUA 2ZX9A 5HYSB 4X4ME 5KS9A 1WC7B 4L18A 2Q76B 2AQTA 1AGEB 1PX4A 3MLSL 2IEPA 5DWUH 3H2WA 5D1XD 1XSKA 3IDYB 4KK9D 1I9JL 4N2LA 5IVXE 4RZCA 2D7TL 3I9PA 2H32H 4KHTH 1XR9B 3BWAA 3OC8A 5JHDE 3WL9B 2EXWC 5DR5H 4OAWB 5AW4B 3F05A 5CEYA 3T2NH 4CBZA 4IW4C 1FO0L 1MNUL 2HTKD 2J73A 1F4HA 4XE5B 1ZLUH 5FHBH 1UEMA 4JKPH 4B9GA 2FQDA 4P4RB 2XV2A 2X5PA 3LIZL 2J7LA 3GXUB 4XXDB 2Q7AA 4LLUB 5GGQH 4M1CC 4FN0A 2DQFB 3W0WA 3KS0H 3DGGB 4OFYD 3V6FA 1LILA 1MKFA 2WOBA 5I1HH 2OK0L 2R4RH 4X5WA 1N5YL 3KM1A 4KNSA 3OKMA 3V0VB 5AAWA 2F58L 2FEDC 3T2NL 3ARZA 5AKTA 2IADB 3QH3B 1Q72L 1TJIH 3RTLA 1V3KA 2JJVA 3WAKA 4UOW0 3FZUC 4BWUA 4W9FC 2ATPA 4LEXH 3FXIC 4KXZI 3ESOA 1HOCB 3WJLC 1DSYA 3CQQA 3S48A 2NCEA 3B9EA 3EBAA 2FT7A 2R0LH 3TS8A 3Q8EA 2LT9A 1YMHB 2G2PA 2MOQA 2TAAA 2W9EH 4BQBA 1JN6A 4NNPL 5BQ7A 5K9JH 4M5TA 1HHJA 4OVVA 3N3EA 4LT7A 2DDQH 5HDBF 1SHSA 4UMSA 2PMZA 3SGDH 4JDTH 4RGOL 4C54A 1NPNA 4UT9L 5GQBA 4FNSA 4FYSA 4ZW5A 4LOUC 5CBEB 5AW2B 2EVJA 4DGYL 1BLNB 4BUQA 4S1QH 4IRSB 3FB6B 3PF2A 2CHDA 4WIQA 2OULB 1UM6L 1KBGH 4B60A 3FAXA 2Z31B 3Q1SL 5LKNA 1A6WL 3STLA 3KH4A 4JHWH 2QTEA 5ID1A 1OCOB 1A5FL 1OAXH 2WXKA 4KJWC 5CEZE 3LHPH 3V4PB 1LM8V 1AGBA 1OAZH 2APBA 3UYPA 1LE9B 1T1ZA 4N2MA 3NVQA 2YKKA 1F6AB 1REIA 2BCKB 3HJEA 3P4MB 4G6KH 5L4IA 4AL8H 1JGVH 1MAJA 4KQ4H 3C87A 2EUVA 1TG8A 4LLQA 1EMTL 3L1GA 4OLUL 4J3UA 1OCWH 1MAMH 2GBVA 1RZKL 4MB3A 1PFOA 3LVEA 4S1SL 4LEOA 3V0WL 3TEWA 1AYRA 32C2B 4GUPA 2BSEA 5F9AC 1D5IH 4CVWA 1N19A 5IWLA 4B0MB 1KIUB 4XVSL 3RL2B 4JPKH 3WLBA 2V33A 1BBDH 3OGOE 4QHLA 2WO2B 1G6RB 1JV2B 1WCBA 3HBZA 3ARFA 1WIUA 3N42F 2RCSL 4JPVH 4IBSA 3QCUH 4BQ6A 1U92B 2Z93A 1ZV9A 5SWSB 4F27A 3MLVL 1CGWA 3DJ9A 4XXDA 2X2IA 5DD6A 5D4IA 1XCTB 4FQ2L 1MI5B 5EC2A 3GSRA 3DX9A 1HILB 3MREB 2V3DA 4XAWH 1UJ3A 2BK8A 4IRSD 2X1OA 4MMZC 5TFSH 2KKQA 4FHBD 4D9QD 3KDMA 4R7VA 4WK0B 4UOW1 2Z91A 3GSNL 3A67L 1B6UA 4OTXL 5KBDA 1QSZA 3GRGA 5T1DL 4M1DL 2BSRA 3TT3L 3QUXA 2I85A 5CD5C 4C56B 3MC0A 4TTGA 1RPKA 5JHDD 1A7OH 4N8VA 1WBZB 3T3MB 1A9BB 4NCDA 4N2KA 1IGJA 4RETB 3UIYA 2NOYA 4KAQL 2YBRB 4GEJA 4QXWA 4V1DA 3NT0A 5KS9B 1G7MA 3RQ3A 5IB1B 3HI5H 3BP6A 1PGRB 1CBJA 1JG9A 1EXGA 4BINA 3PE9A 4YDIH 2E76C 2KYIA 2RTTA 4JG0H 4R0LC 3AXIA 4P9MH 5C0BE 4BK4A 5MEPA 3P77A 1JZDC 4H8WH 4NP4L 5C0AA 3QWOB 2TSBA 1QWHA 2Y36H 2WBJA 3HPJB 4QOKA 4PJ9C 5AUMB 2X1WL 1HZLA 3B4NA 3NFPA 1TTRA 3EYUL 1BQSA 3LS5H 1VGKB 3VDAA 1HDMB 1KPRB 5E2WH 5HDBE 3OVUB 1QKZH 2C3HA 2ZONA 4AMKL 4X9YA 1L9SA 1XGQB 5EZJA 5IHUL 2ESVB 3IMRA 1N64H 3U4BH 2A9BA 5TQ2L 2GSMB 1GZPB 2MPAL 3ARBD 5DUMH 1JK8A 4HS3B 1S6NA 4ONFH 4YSPA 2H6PA 4MA8L 4YXHH 3ZXAC 5FDYA 4P3WA 2K7QA 4JZJB 1AZZC 1YUKB 4NN6C 4CU8A 4W9IC 1TU2A 5DFVC 2AAAA 4Z7WB 3FUNA 4YSQA 5IGXL 2RA1A 4WUUA 4G8FA 1P84K 2LTQB 4R90L 4LBEB 1CQYA 4DKDC 5FB8B 3BYTA 4OJEH 3B6SA 3FULA 4PRIE 4HAFA 2A38A 1AQMA 1C12B 2QQNH 3ULVC 2F5AH 2ZG1A 2NY3C 3BKYL 4OFQA 3QNZA 4L4TD 1F3RB 4XBMA 5J57B 5IJKA 1RERA 4XNQB 5LBSH 5B1BB 4FLRA 5ISZD 1YNTF 3FB7B 3SBRA 2IFGA 2XKNA 1OANA 5T5NG 2P8LA 3D39E 1FBIH 1NCAH 1IC7L 1QUNA 1ZCRA 2B59A 2A83A 3BAYA 4L3CA 3MRHA 5JUEL 4GKSB 3BGMB 1QD0A 2GTZB 2CO1A 1A9BA 1F1DA 2WNKA 4F2MB 1T1ZB 4UT7L 3MNVB 3X3FH 3MJ9L 1MCNA 2V7NB 4OLEA 4JMNA 5BOZG 1ZGLM 3EDJA 4XGZB 2J72A 4FXGC 4P2OA 1CR9L 3BEWA 4JZNA 4FRWA 2D7NA 3EOBA 4XT1C 4X6CE 12E8H 3BXNB 4BQ9A 5I0YA 4RMVA 4MZ3A 5I5MA 4AK2A 4P57A 4FQXB 3T65B 1T1XB 3UEQA 1KIQB 3VFUB 1WFIA 5F7MC 5C0AB 5GPRA 3N43F 1L5GA 4AE0A 1N2RB 1XGPB 2XY1A 3JV5A 4K3GA 3NEXA 4H1LB 3JWDH 4WTXA 1VFAA 2YRPA 4KC3B 3APCA 4ZTOH 2A2QT 2Y06H 4U0QB 1H9DA 4PJEF 1CT8B 1U21A 4GG8B 4NO0B 2P45B 5E94B 1X7QA 1S7XB 4IKKA 2J71A 3V7AG 3RZCD 4P48A 4D7PA 4GG6E 1HK6A 3T0DA 4PWKA 1K6QL 5F3BB 1AGCA 3L3IA 1J8HB 4XNZC 2HH0L 4LCWA 4NB7A 3H42H 4X7EC 2C1PB 4LLYB 5MI0B 1KYAA 4EZJA 2Z91B 5JOPE 1XEDA 1HHGA 4PGDB 4I5BA 5IMLB 2ZUVA 4MCZB 1NSNL 3FBQA 3JWDL 5LDSA 5IUCA 2AS5M 4UQDA 5H35B 2F54E 5D7LD 2NZ9C 4Y5VC 3S36X 4EI5A 2YPKA 5I6OA 1MJ7L 1MRFH 1WBZA 2VITA 3G3LA 4ALAC 3V0AC 5E1AA 5BXFA 1BFTA 4F5CA 4R26L 1RZQA 4YHLH 5IHWA 4G8AC 4FQJL 4G8FB 1EJOH 2GT9A 2XJLA 2DWTA 4AYDC 3O3UN 3UZEA 2PPCA 5IY5B 4HISA 5F8RC 2DM2A 3C8DA 3QEUB 4JRYE 5EG6C 1X4XA 1E9PA 5IMMA 4HWBL 3OXSB 4P5MB 4XNBA 4U2YA 2IAMD 3NZ8B 3ZRFC 5T3ZD 4A6YB 2OP4L 4WRLA 3VFNB 1YJDC 3RGBA 4CL7A 3H4HA 4PJAE 1XFPA 2CRIA 5TE7H 3M17A 4N1EA 2P46B 4C4UA 1SM3H 3Q2NA 4P5KA 4QOKB 5I82A 4EI0A 3NSYA 1CFSA 1GKEA 3MRMB 4HUXB 1P0SE 2VR6A 1AQKL 3HG1A 4JQVA 4MLSA 3MA9L 2HG5A 25C8H 4Y88A 1U3JA 1VGKA 1DZ0A 3QBTB 1WSST 1IBGL 4JFWA 2R2CA 3VRIA 5D2LA 2PXYD 3ESUF 1TEYA 1EJ6A 1URLA 1IT9H 5KYUB 1WQVT 4LSPL 3FU0A 4XWOD 2Y72A 4D0BB 1MCLA 3OM3B 2HWZH 3NCWA 3VE0B 3QQDA 1YEKH 2QPUA 3DPBB 4X7CC 2C9QA 4IDJL 4L9LC 4MD4B 5L2KB 4U1KB 1MCHA 2NY0D 1SMOA 3Q1EA 4IHBA 5DO8A 4PJ5D 4QOKE 5E8NA 4O4YL 4DPBX 1CXHA 2HRHA 5DSCB 3UAJC 1T89A 4TRPH 1RZIB 1NCHA 1N8OE 5AWNH 1AIZA 1BGXL 5DMJB 5CF3A 4PREB 1LWJA 4G70B 4H1LA 3V6OE 3Q2CA 1DR9A 1JFHA 1WBYB 5EA0H 3B6SB 3LNIA 4P4KA 5IFAH 1NUGA 5CGBA 4YNYA 1H8OA 2CHWA 4KNTA 4MHHI 3U9PL 3QNZB 1NZRA 1N8ZA 3BLBA 3C6SA 3AQDA 5DJ2B 3F62A 4ZSOE 4PJFE 5F71A 5L8KB 1BG1A 2KI6A 2XBTA 4LCWB 2D03H 1FGVL 2D31A 2WNWA 4QTIL 5CP3H 5FXCH 5SWZA 5LVEA 2YC1B 2H2PC 2PO6D 2YXFA 5ALCL 1JXFA 1VZHA 3UC2A 1ADWA 2RFXB 1F2XK 3BE1H 2WC7A 2DLHA 4G1MB 4XMVA 4UQIM 3BGMA 2Y36L 1XL4A 2HG0A 3D85D 1A0QH 1RH8A 2BNQD 1F90L 1NLDH 3HE6B 2ZJSH 4EN2A 5ABDE 4HWZB 2H0PA 4ELMA 3KEHA 1FA4A 1EBPA 2YXWA 4YE0A 5LXGH 4G59C 3BVNB 3FUMA 5IQLA 1C5DB 1HCZA 1I9IH 3GXFA 3BXNA 2FYYA 5HY9B 2V2WB 5F21B 3FPXA 3UDWC 1HH6B 3EYVB 3HG3A 2N7BA 3BN3B 4BZ2H 4KKZA 3WXVH 1WZ1L 3PREA 4NKMA 4ODXB 2FATL 3DX3A 1PVHA 4YSRA 3VFMA 3NPSB 2OM5A 1MVUA 1RLWA 5D6DA 1U4FA 5IBTH 3BUIA 2IH1B 3N6YA 1CFSB 4YXHL 2MNJB 4NN7C 2ZX8A 1RUMH 3GSNH 3MOBH 3WTVA 1UTDA 3LZPA 3O4LA 2ZTBA 3QPKA 4JQIH 4WNSA 1SOQA 1S7XA 1CGSL 1NCDL 1FL6B 2WGXA 4OZGF 2VDLL 3RTQA 5C6WH 1L9TA 4OFDA 1Z9SA 1JPGA 1KJ2L 2C9AA 3F6IA 2JKSA 4X98B 5CBEA 3RP1A 3KL3A 3QUKA 4XOBA 4JRYD 1QFOA 2H1XA 3FHAA 2RHEA 3F83A 4G42A 2QR0A 3ZDZB 4FCHA 3EAKA 4P23B 4HUUA 1NMAL 1YA5A 3KYKH 2IMMA 2XI9A 4G7YL 4K8RD 5DZ9A 1I7UB 2PYED 1LWHA 1G0DA 5KYYB 3ZL2A 3O6KL 4Q74A 1URZA 2BSSB 4AJVA 2JFCA 3ZDYF 4X50A 3A4EA 3JBG7 2LVEA 1JZ8A 4A7SA 2C1OB 1NJ9B 3ARPA 4KX7A 2ED9A 4MA1B 4G8EB 1OGAE 4XP4H 5E5LA 5EOCL 1HFUA 4K5PA 4WY7L 3RWIB 1BX2B 2WLZA 5AVSB 2X6MA 2ERJC 5KSBE 4HJIA 4TMPA 5I17B 1M9WA 1XH1A 4LHJB 3RWEB 5IMMB 3DDGA 2HMID 4XNXH 3UC0L 1Y7VA 1BPLB 1QVOB 4MXWH 4KAQH 1J18A 4POZC 1VCBC 2DQCL 3UJJL 2JB6A 3K1DA 3MNWB 5KJ7E 4GEIA 2XIBA 2RD0A 4HH9A 1CLVA 2JTYA 4P5KB 3VXNB 1OGPA 5KVGH 2FD6L 4PCTA 1FCCA 2VJ8A 3WFHB 3C75A 3WLBB 3NSXA 4HUXA 5CGMA 2K6ZA 3OJMB 3O2DA 1F3DJ 1XGUB 5ERWA 5FYKL 3UPRA 1QG3A 2C7UA 3QUYD 4QOKD 5C0CB 2CA4A 3FSZA 2AK4E 5D2LB 5HHVH 3J2PA 1ONQB 4QGYA 3GGWA 1CO1A 3EH5B 1PLBA 2JCWA 1LE5B 4N5UA 3DVNB 1A3RH 3OZ9H 1E5UI 3DX9B 4R5VA 5AAMC 2NNRA 3Q9PA 1RIHL 1IBHA 3PDDA 4PJHA 4LVHC 4BK8A 2M2DA 35C8H 2V3EA 4KO5A 1EHLL 4U1KA 2VH5H 4FLHA 2OYLA 1EAQA 4GAGL 3T4YA 5I28A 2ATAA 5E8NB 3S98A 3O9WC 3IMBA 2R23B 4QMEA 4FNQA 2WO4A 5B38B 1WHOA 3MI6A 5LAPA 2GFBB 1D5IL 5JTWA 5EC1A 5JMRA 5IB3A 3WAJA 2IH1A 2Z6FA 4UUJB 1IGJB 3J8F7 3BDXA 4RRPG 3UXFA 2QADC 3UTTA 4JJOA 4P4KB 1TVBA 5J1AA 5FECB 1J1PL 3HMWL 1DLHB 3EDKA 4ANXA 2J8UA 3WFEH 2HPOA 1BIIA 4AKOA 3MUZ1 4I88A 5FHAL 5DHXB 4WO0A 4JO4H 1T0MA 2BP8A 2OJZL 4JHAL 4PN6A 3WSQL 3IE9A 4MQTB 5E9NA 1JAEA 5D1XA 2DI7A 1ACCA 3SOBL 1JZEA 1JZJA 2OMXB 1C5BH 2F7RA 3DIVA 5L4FA 5J1SC 2CO6A 4H8HA 4JKPL 4Y4HB 2D3JA 2MQ3A 2IANB 1S3KH 4ABWA 4OUOA 3WENA 1LDPH 1INDH 1P4UA 1BP3B 3TVMC 1CURA 1DVUA 3WEAA 4DP4X 1ND0B 1VRSA 3ZR6A 4K5MA 5IB4B 4Z8FL 2A0LC 1KN4H 3Q06A 3RY4A 1M42A 3QCTH 1FNGB 5I73B 1PCSA 3RWIA 1FP5A 2IAMA 2XTJC 4BH7A 3MSPA 3HE6D 4Y4KC 3MLSH 4JW3A 1FWXA 2EKSA 4NO2A 3H9SE 2Q0ZX 5DT1H 4Q97A 2W9EL 5LCVL 4DVRH 2M8XA 3NZSA 4WO4A 4XCYB 4NPYA 2VMEA 3X1NA 3CFJB 4PRAB 2FEJA 2VWEC 2F54A 1OCCB 5F93C 3JUYA 3Q05A 4JN2B 5JMOC 3BAJA 1O6SB 4L4VD 4ZMVA 4JRXB 2A0LD 1T5KA 4JZJA 3PAVA 2DD8H 3HC0B 1SEBA 3UTPD 4IEFB 1OWWA 5IVZA 4FNLL 4AM0Q 1K3ZA 1Z3GL 4PQXA 5CD5D 3LVTA 3WS6A 4MJ5A 3RJQB 4FA6A 2B0SH 4KVPA 1V05A 5FB8A 3U2SB 4UQAA 3UROR 4KK6D 1MJ8H 1RIHH 1A2YB 4UM9A 2GY5A 4FMKA 4OCWL 5DD0H 1M4KA 3H0TB 2G75B 2D3LA 5HHPA 4JQIL 3ULVF 1MNNA 4IMKC 4NXKA 5ESVA 4DGIH 1EDHA 3FB7A 1Z0MA 1FL3B 1KN2L 4PJDE 4P23A 2QQLL 1EFXD 3S37L 1I7UA 4G7QB 5FDWA 2FNBA 4IGBC 1X5MA 5K9OB 1TNMA 4Z7VA 5D1ZI 1D5MB 1UB6A 3HNVL 1AOZA 4UUJA 4LL9A 5EN3A 4JFEE 2J2ZA 2VDOH 1EBAA 4NKOA 1BXAA 4F2MA 1Y6MR 2IDCA 2GVYA 2AKRA 3VI4F 4ZD3H 5C0RH 3EJCA 1XF2B 5CLXA 5HDRA 1I9IL 5HHOD 1U3HC 4FQLH 4CNIA 1IM9D 1JNLH 2BXYA 3BEWB 1G0YR 3FFCB 4JZNB 2JH2A 1EVTC 4Q2ZA 1ZHNA 5B4MD 3QQ4A 4AIXA 3EIFA 2ICEA 2XLLA 4LDOB 1QSFE 3PV6A 2VMFA 4ZNEA 2HVBA 4OF0A 5CWSB 2IPKA 4JGUA 5JDSB 4RA3A 4WI6A 1SXSA 1KIPA 2W65B 3KYKL 5E8PB 1HKLL 2WP3T 3AS1A 3V6OA 3LJ3A 3ASOB 5B39A 3HC3H 3MUJA 5DVPA 1FHNA 2D03L 3HG4A 3ZKQD 3BVDB 2V3FA 5J11B 1X7QB 4MGXA 3MTRA 1N0XL 3O4LD 7CGTA 1UT2A 2HJLB 1UCTA 1BD2A 2PW2B 4FQ1L 4B3VA 4CJ0A 3PGCB 4K55A 4TLUA 4YH6A 4E9SA 2OR9L 3MLZL 1X7SA 2GJPA 2NT1A 4D9LH 3F5WB 1O6SA 1X5IA 3WUZA 2AEOA 2XTJE 2XZQH 2VXQL 4J3VA 1SFHA 5B1JC 4JO2L 5BOJA 4KNUA 4C58B 4LLMB 1X5LA 3DRQB 4DZ8B 1GY1A 2BVYA 4IM8A 5J6GA 1BWMA 3L6FA 4YL9A 5IROD 5DU7A 5GRYA 2BOLA 3KDPB 4Y2DD 1IT9L 1QQDB 3SCMD 5E99H 1FZOA 4PLJD 4IRZH 3VNYA 2IPTL 1BAWA 3C5JA 3M17B 4I18C 1OOWA 2IPUK 5MERB 3B9KC 4F7KA 2LU4A 3DROB 2Y5QA 3LSOA 1HQRA 1LK3H 5LNGA 3M86A 3IRZA 1WIOA 5K9OA 3OKKB 2BHUA 4AUUA 1D5MA 3CLEL 4M6ML 1HINH 5GS1A 2DLIA 1FNGA 1V3JA 4IK6A 1AHWA 4FD0A 1RUQL 4XODA 5MEOA 2DQUL 4K3JH 1N9PA 2EDTA 3LEVL 3HS0C 1WA2X 4LLWA 4MMYB 3KPPA 2IGFL 4YN3A 3CK0L 1Q8MA 1RK0B 4G6AC 1QABA 3OKNA 2XBDA 3OMZA 5AVXB 4F92B 5E08L 3H7BB 4ZOAA 1DBKL 3NGBB 4A66A 4HG4J 4QNPE 1DN0A 5I8CA 3LRKA 2F54B 4PBDA 5GHWL 3RU8L 6PCYA 1NIDA 1CZ8H 1XBRA 4G3YL 2VDQL 3HC0A 4RAVA 3G6DL 2IPKB 1E9OA 4Q9CA 2PWDA 1UWYA 1GGCH 4QRPB 3OAYH 2NNXA 4JG5A 3VW3H 4BFFA 3ARGD 1A4BA 4NQEA 5HD8D 4WKZA 4PREA 4Y2LA 1ACXA 2P5WE 3LPPA 4UTAA 3C60D 2UWEF 3DX6A 4J3OC 2K70A 4YLQT 1ZLUK 4EN3C 5IJVA 2AZUA 1H3PL 4LNVA 1EJ8A 3IWUA 3WNPA 5IREA 3MR9B 2OSLB 3X17A 4RWYL 4GJTB 3T0EB 3WTXA 2GCYA 4N28A 1JIBA 5BO0D 3C6SB 4KMQA 4UQ3A 5DHYB 3LKPB 3WKQA 1VSCA 4XOCA 3ROLB 2V2XB 1NFDF 4EBQH 1NCWL 4LHUB 3W39B 4EKJA 3ARGC 4HIXH 1ZJAA 1A6UH 1E8WA 2J6EH 1IGFL 4OQ1A 2JKRM 3FT2A 2VDMB 3LCYA 4FA7B 5GS0C 3DSNB 4UTCA 5TDPA 3E6FB 2W07A 2AVFA 4AYEC 1UB6B 5E9DA 2AV1B 1B0WA 1JRHH 4X0NA 5ID0B 4TV3A 2AQPA 3S34L 3HE6A 1AKJD 2EUXA 2AI0L 3GC3A 2X4TA 2P7TB 3B7YA 4G6JL 1L6XA 2KZBA 3Q9QA 1RI8A 3QUMH 1E27B 5J06A 4ELKA 3FFCA 1XH0A 4X8JA 1DJWA 5IJCC 4L5FE 2PTTA 5T1KB 2YGOA 2F0CA 1YPZF 1YMMB 3OTTA 4Y5YB 3QQ4B 4JPSA 3CFIC 3QS2A 2IWKA 4XWOC 5HY9A 4OV5A 3QC6X 5LO7A 4X5LA 1JTTA 4PJDA 1BVKB 3PV6B 4KDTA 5GSRB 1YC7A 3WOVA 1PIFA 4NZTL 4XX1E 4PD4K 3TYGH 1R3LA 1MCIA 4ZAKA 2IDTA 3AM8C 2VJ0A 4TL4A 3CN1A 2WWKO 2H9GB 1H0DA 1ETZB 3PWJB 4UMGA 2W9DL 3RWHA 1MW3A 2LGNA 1A4CA 3QXUA 5C0DA 2XZCL 2PP7A 3QG6B 4WWKC 4YXKH 4M43L 1GGCL 3APNA 3FHQA 3N1FC 1FNEA 1DQIA 4N2AA 1TQWA 1ID5I 6FABL 4NLAA 3NSDA 3PGCA 5D5ME 4AKPA 4WI4A 4YHPB 3BPLC 4EDWL 3ZTDC 3AADB 1U2YA 4GP5B 5IHZB 4G42B 1IQWH 4M7ZB 2QR0B 3ZMEA 1A6VH 1P7KA 2JKTM 4OLYH 4PLKD 5AFAA 4M93B 1NUNB 3LQAL 4ZO6A 2YLHA 4FC3E 1HWGB 1N4XL 1ZWIB 5DF0A 4A2GA 4XMTA 2Q76A 1OD9A 3IBOA 3OMIB 3QXVA 4HCFA 4AUJA 5GGTL 3ZKMC 2OJ1A 2O93L 1OTSD 4L1HA 3CZFB 2XHNA 5C0EA 5DJDA 12E8L 5IJVB 1FVDB 3F85A 3RVXD 4G43B 2JLPA 2VR3A 8PAZA 4HALA 2X4PA 1S78C 4GMSL 2I5YL 1H15B 4WEBH 5TE6H 4MXQC 3WHXB 4P4RA 2Z0BA 2EYSA 4UIMB 5FGBA 4M62H 5KJ4A 3FOMB 1WFMA 1B9KA 3QIBC 4X6FB 4NERA 4R4BA 4XN4A 1AP2A 3GD1C 1LEGB 1HQRB 5TK2A 3P4LA 2O5YL 2D4FA 5E8EA 1QYGH 5FKAB 4EZKA 4D3CL 2NY5C 5MENB 1N7ML 5CZRA 6FABH 2JKNA 3MLXL 4KTDL 3GSQB 2CJUL 1H8SA 4F9PA 3GGWB 1Q9KA 3ZTJH 4MS8C 4RMTA 4YHNA 3K2UL 3II1A 5ABZA 1U8PB 2APFA 5JDJA 3G5VA 4WFFD 1H8NA 2QKIA 4BFIA 2I27N 3OAZH 2CBQA 3RVTD 4KJYA 4JFTA 1UACH 2CHNA 4HVBA 2CDFB 1HOCA 3KMDA 2EAEA 3WXWL 3RVWC 4JO1H 2PTTB 1PG7L 5T1KA 2F53B 4G5ZH 2FJSA 3ZDZE 4NHCL 3MLZH 3L1EA 1DYZA 4A7GF 5K1NA 3WKMH 1VFBA 1HZKA 4KKBC 2CMRH 3TEXA 2GFBA 5AW7B 4BKTC 5AALA 3B5GA 1MREL 4HMEA 3B9AA 3V4LA 3HC4L 1GIGL 3DX6B 5EUOE 4HX1B 1D9KA 3DYOA 5J1AB 3O4OC 4GIOA 4YBLC 5I8EB 5C97A 1KCKA 1OEZW 4LCYB 4XBGB 1GGIL 1IIIA 2GCYB 2Y1ZA 4UT6H 5I1EH 4FE9A 5TFSL 3EZJB 1ZMYA 2EDLA 4HLJA 1X6NA 1ZXKA 5T33H 2XWEA 4FQ2H 4R5XA 4LHUA 3W39A 5EO0A 3RB7A 1C8PA 3B8YA 3KL5A 3HN5A 3FT2B 2P47B 4XO4A 1LE9A 1FH5H 4QY8B 5SWZD 3E6FA 3C6LC 1JNLL 3APDA 3DVGB 2YD3A 2AK4B 3K8KA 5E9DB 4Q9QH 2V8LA 4JPKL 5JIPA 5ID0A 3L9RB 3CXDH 3G6JA 3UABA 1ND0A 3IJEA 3VYNA 1YJDL 4XCCH 4PJEB 4LOVA 4M1CD 2PKDA 3JZ7A 3FKUS 3CZLA 4F15C 4TPRH 1UT9A 3VD4A 4ZXBA 2F19L 4JLRB 4P2RE 3K3QA 2HRGA 3K72A 3FU8A 4ERSL 1J7VR 4CBPA 1G6RA 1FG9C 3LQMA 5E2VL 3UACA 4A2FA 2WYZA 1UJTA 3KXFD 1XSIA 2F1AA 4MDIA 4AQZA 5GGSB 2P52A 4JRXA 4V1DE 5DD6B 4PRID 4ZAKB 4NGHH 4Y2NA 1HTYA 1S7QA 4R4BB 3GSWB 3IDMA 1J5DA 2CLRA 1KXVA 5I30L 4DUWA 5KVFH 4L23A 4L29B 4X4ZA 1WO2A 1K4CB 4EUPB 2W8CA 3OG4B 4AX3A 4JM2A 3CSGA 3GF8A 5MENA 5E6IB 2EEDA 3DC0A 5E1QA 1ZRUA 4P5RA 3QFJD 3MA7A 1NC2D 1Q9KB 1GZHA 1KCUL 5ACLA 2J21A 1YDPB 1FDLL 1Z66A 3SDAD 5K59F 1JZ3A 3QUXB 4KITB 2VXUL 4C56A 1S5HA 2DYPA 5HHXL 2EH7H 3GTTA 3KR3L 2WUBH 2G75A 2WLIB 3KWWB 3U2JA 3ILPA 4OGQC 2WQWA 5E24E 5A16B 3ISWA 4JJHA 3UZQB 2F53A 1IEHA 1QO3A 4JPWH 3AY4A 5CJ8A 2D9CA 4MXVE 3ZX1A 3TJHD 4V1DB 5LCVH 4OKDA 2WSPA 3HI6H 2CDGA 1I8UA 3CXHK 1FQ9C 1TJHH 4P46A 4ZMYA 4KRLB 2APTA 2XXMB 2K45A 1XF5B 2V17L 2Y5TA 3R0NA 5E2TH 1M1SA 1D3CA 3LIZA 5T3XE 1CGVA 2J2ZB 4NKOB 2G0KA 1W0YT 1BZQK 3BMVA 2PO6A 2YKLH 4G43A 3P77B 2WYHA 4XVTL 3CCHA 4JNXA 2OR8A 3H9SB 3WJMA 1FVCA 2WBJB 3ESPA 4PJ8D 4X5RA 2ZCKL 3F2LA 4ICXA 1YLBB 3ETTA 4H8WC 1QZNA 5ACMA 3ZHNA 4N87A 5MHSD 3GRWH 2Y1YA 3KPSB 1OAXL 2VXQH 2HVJB 3FT3B 3QCVH 1FPTH 4R9HA 1FV1A 1HOEA 4HWUA 1DANU 5FYLD 5SX4H 3NIGB 4BWWA 2ZWZA 1RZPA 2NXZB 3WN5A 4MWFA 3SDXF 2GHZA 1WBXB 4GFTB 3L9RA 1FYHB 1GZPA 3ZTEA 4AYID 3SKJH 5CMAA 4KO7A 3LPGA 1E67A 2AXHA 1V8HA 3HZKA 1K4DA 2F54D 4GXUM 3KXFB 3APMA 5EIIG 4JFDE 5D96C 1F58L 2FUTA 3BVXA 3ULVE 1I1YA 2WQXA 4G1EA 1II4E 4GAJL 2VUOA 1TJHL 3K72B 3QE5A 3D0LA 4U1HA 5EWIL 4JR9L 1CTMA 2ZQKA 3SJVA 1JNHB 2WUBL 5AOZA 4I1PA 3PHOA 1A3RL 3TN0D 4N0FB 5EU5B 3KPNA 3QI9D 4HX1A 3EJPA 1V7ML 2W1NA 4FTDA 4HDIB 2QMKA 3OB0H 3KJ4B 3NDZE 3N0AA 4TL5A 5TDNB 1HXYB 4UNVA 4H44C 4DN3L 5J9PA 2PPEA 5JORB 3RFRA 1U2HA 4HYTB 2VIRB 2W0PA 2B1HL 3FU7A 4ZOCA 5EU4A 1T89C 3ZE0B 1LWRA 4KZCA 4XPAH 4FMVA 4TSAL 2BINA 4ANKA 3ZIYA 1DVFA 5FW8A 3UZQA 1D5XA 5CLYA 4XVJH 4MKTA 2YD9A 2D9QB 3AITA 4MXQD 3UAEA 1J0JA 3VXUE 1NINA 2ZCKH 2FIRT 1FO0H 4HW6A 4LLDB 3O0RH 1Z9LA 1AGEA 2R69A 3PQYE 3IMWA 4N22A 4CKQA 1RZJL 1PKQA 2JTDA 3DX1A 2CK0H 1ET7A 1T7YA 2H3NA 5D1ZA 4TNWF 1AHWB 2L0DA 1LNUB 1X3DA 2YHGA 1LMKA 3RWGB 3WL9A 3ZSSA 2ADIB 2BDNL 4PJ5E 1NC4A 3L1OH 1AKJA 1I8KB 4JLRA 2J20A 4LLWB 4Q0XH 4TVPD 3KPPB 1TETL 4AITA 4PS8A 4B9KC 3CLWA 3MBEC 3MJ8A 4XMLH 4BH8A 3QFJE 3QNYB 3RFZC 4Y9GA 1MW1A 3D5OF 4ZMPA 4YHYC 1DE4A 3MNDA 1SJVA 1OKEA 5DZLA 3VGEA 3LPWA 5ENWB 2A6JB 1P4BH 4IBQA 3FCGA 1IIKA 4LL1A 4H8UA 3ZDXB 1GOGA 3KGSA 2WLMA 5KS9F 3PWVA 1NEZA 1FV1B 4I3SH 4NQCB 1L7IL 3K6FA 5KVEL 1K4CA 1KIRB 3UYRL 3G5WA 4JUTA 1LEIA 4PMEA 3QUGA 4K94C 5DT1L 1HHGB 1JF5A 4DUXA 4GQZA 5CIPB 1GIGH 5T3XD 1R5IB 3UJIL 2WZ6A 3QJZA 2QPDB 2AQ2A 1RZ7H 3DX7B 4JZOB 4EI5B 4UCFA 3QUZA 3GJFK 2OX5A 1JL8A 5LCVA 5EU6D 4R2GC 5DTFA 5FA4B 5B21A 4MJJA 3RDJA 1XIWD 1KY6A 2FJGA 4BV1A 1CVRA 3WKML 3HZMB 1MW2A 2GT9B 1U58B 3UBFA 3ZDXE 4XO9A 5FK9A 1XCXA 2CDGB 1EX0A 1T6VN 3NH7L 3M1OA 5EB9A 43CAB 5F70A 1TO5A 4J8RB 3D6GA 3CV5A 1QRKA 1XF5A 2H41A 4EXKA 1OLLA 1MHCB 3ES6A 4P3CH 4PJ6A 3VXME 1KYDA 1G4RA 3W9DB 1P4IH 2EACA 5ECGA 5EU5A 2BY0A 2WN3A 2YAQA 1DTUA 5F1KC 4A6YA 1OSPH 1WITA 2ZE0A 3FB6A 2V5TA 3N5AA 5TPWH 4F8NA 3WFEL 4MJIA 1NGPH 1S9WA 3KWVA 5B3JE 5FUZH 1JHKH 4TULL 4G11A 3CJJA 4JHZA 2FBRA 2OL3H 4YDKL 4M5YH 5DJ6B 4F7TB 2HVJA 3FT3A 3ULVD 4OLZH 4PP1D 1KGCE 4NQDB 5GS0L 3CXHJ 4BSWA 2DF3A 2J44A 1D5XB 4JFFA 5TE6L 1BSIA 2GC4C 3E38A 2BIHA 5EUOA 2H9GA 3L4WA 1WBXA 2Z64C 1K72A 4XX5A 2J8UE 5DURB 2XIDA 2RBLA 4RGNC 3TO4C 4MA3A 1E5AA 1M7DB 3PLYA 3MBXL 3QZLA 4QHUB 3O0LA 3RWGA 3G9VA 2R15A 3WIFB 3PGDA 5FW7A 1I1YB 4G1EB 1YEIL 3ZJAA 5HVGB 3D52A 3HAEA 4GLRH 4XCFH 1UA6H 3GXIA 3C08H 1DL7H 3IMTA 3HMXL 1DE4B 4BRVA 2EDEA 4NHCH 5FUCC 4ODSH 4CA4A 4AMWA 4DVBA 3S36L 2F53D 3OQRA 2XFXA 3SJVB 3BN9C 4LPYA 1GW0A 1JNHA 2NZ9D 2ZUYA 2VRQA 2MHAA 3MRJA 1ACYL 2N4IA 3NJHA 3KGUA 4R4FL 3TBSA 3Q6GH 5EZLA 1UJ3B 2MMXA 1JYXA 5B8CC 3DX2A 1A7NH 5C0EB 4E9VA 1DVZA 2FECI 4OF6A 3TH2T 3EFOB 4Y1AD 4F9LA 3G7TA 4DZBA 4HKJB 2GC7C 5DS8A 1CPUA 1IILE 3O2DL 3KW7A 2RFXA 3DK2A 2ITEA 3MOAH 2BNQA 4M7KH 4OGYH 3BUQA 3HI1B 2W92A 4PWGA 3WHXA 4DGWC 1WS7A 2BRRL 5I1DA 1DVFB 4NZUL 1MDAA 4AQEA 4E68A 4W4NA 5BV7C 4PRDB 4XOEA 4UOZA 4ILDA 2YPVL 4WV1B 5F7NC 4HC1L 2I5YH 3ARVA 4C83B 4DEPC 4L8CA 3KPLB 4C57C 3GS4A 4PRBA 2VQ1B 4IS6B 2Q8AH 43CAA 1TO4A 1DZBA 2ZP0T 1QR4A 3CH1A 2G2RA 3S96A 3BVNA 3K1KC 3IS1X 5L0QB 1OF0A 4LCCC 1MHCA 3CHPA 1G9MH 4IBYA 4I1NB 4NZFA 2OSWA 3GTNA 4XPTL 5KEZA 3GBML 5MEPB 1G94A 1Y0LB 4GXUN 3BHBA 1XTLA 1AS8A 5DVMA 1NC4B 3FUJA 3G5VB 1XGRB 2CJTA 4M6OH 4IIQA 3STZA 2XWRA 3QWOA 2F6AA 4WWID 3ECVA 2H1PL 1MVFA 1S9WB 3IFLH 5IQOA 1QSVA 2CBMA 1DVYA 1PSKL 4OIIH 3FUEA 3HG0A 5DJ6A 2WQRA 5JW4Q 2X2YA 2EEXA 1JOIA 1P5UB 3EG9B 3FZUD 1AD0A 1CICD 4JFFB 4RNRA 1YC8A 1UXLA 1PKQE 4H1LG 2P80D 4X98A 1KTDB 3OLDA 4DCQA 4EQ2A 2MQCA 3MACH 2XQBH 4HS3A 2FX7L 4EOWL 3K71A 3CC5A 1GOHA 5EHFA 3DVFA 3BDYH 3BFQG 2P3YA 5C0BD 2E4TA 2L04A 1NGXB 2RMNA 2ZOKA 1TEGA 4LCWD 4NZTH 2E7CA 1J0YA 1T3FB 4J5VA 3ZMRA 3Q44A 5EO0B 4G83A 4Z7UE 5I1GL 5D70H 2ITDB 1IE4A 3CG8A 4DVBB 5BZWB 1CBVH 1K8IA 3RDTC 4JL2A 3L81A 1BEXA 4UAHA 1X5YA 3ES6B 5LG1A 4QR7A 3ABGA 3G6JB 3WY2A 3SGEH 4W9EC 1UGNA 1BZDA 4K9EH 4IMKA 3D8MA 2OYKA 2KPNA 3VG9C 4CW1A 4L4VE 2XG5B 4M7LH 4P23C 3U0PA 2PETA 2E27H 2P8LB 2ZF8A 2ED8A 1IQDA 1E5BA 4L2YA 2WBWB 1E4KC 2XFGB 2G5BB 5AWNL 3MRHB 4QIRA 4CGUB 3QPXH 4NQDA 2E86A 1NOLA 4ZQTA 2A74C 4MX7A 1U6AL 1BFOA 1HU8A 1Q9WA 2OCFD 2X3BA 1WHPA 1XX9C 3BC9A 4KUCF 2VZVA 5E5MB 4HC1A 5I15H 1CMOA 3I2CH 5ITBH 1JGUL 1M53A 4JL1A 2XVGA 1KBPA 1H6EA 4PGZA 2APXA 4CKVX 1JNJA 1J9CT 3QDJD 4WZ9A 1XB6A 3A4AA 2O6FA 1FFRA 3BPOC 3WDHA 4ZPTA 3LNHA 4PS4H 3C60C 4J3OD 2F7IA 1P9MA 2R23A 4ODUA 2VN4A 5BRPA 3FQWA 5ISZE 3DK0A 2EIMB 4G3YH 4W6XB 1Q9OB 3GXDA 5GHWH 3RU8H 3DLQR 3C2SA 2BWDA 4W9HC 1W8OA 4NM8L 1GZQA 4D7BA 1IGMH 1F5WA 3Q43A 2BH0A 1HHJB 3QAQA 4NHUA 2ZAIA 1BIIB 3RVUC 3V6ZB 2CQVA 3TBSB 1KGYE 3F6LA 4RNRB 1GPOL 1IAOA 4LVHB 5DUPH 4PVMA 5DYOA 1KTDA 3VWJC 4MZ2A 1LQSR 3AAZA 4DW2L 3EADA 3EFOA 1W8EA 1T66C 1BFSA 3ILDA 5D9SA 5IEKA 4OI7A 2YD2A 1DN2A 2OMWA 2CO4A 1TFPA 3GWJA 4LP5A 4BZ1H 4ZYKB 2YEQA 1IX2A 3TIDB 1MH5A 3ELAT 3VFTB 1I3VA 1CYXA 2OZ4H 4TQPA 2PABA 1IUZA 4FA8A 1NIBA 4QRTA 5B1JA 1NGWB 4LLUA 3FH7A 5CFHA 4L8CB 4AGNA 3V4PA 3T8XB 2HLEB 4YDIL 1AHMA 1BXVA 4JFYB 2RIKA 4M7KL 4NRZA 3L9EA 2ZXBA 2HRPH 4OZGB 3ZQ9A 4BFRA 4F7EB 1K8IB 3QHFL 3OKMB 3V0VA 1XZ0A 4NPJA 5M94B 1E9PB 2NYYD 4WUKL 3KBPA 3TFKC 2A1WL 4AQ1B 2D7QA 5DYFA 1H5BC 2W9LA 1HYSD 1X44A 3LZNA 4S11A 4UAOB 1XSJA 4QRAA 1JVLA 5DEJA 3NACH 3FL7A 4GKZB 4CW1B 1FC1A 1OT1A 3IU3B 3TBBA 1SHXA 1P7QB 4NQCD 2Q8BL 4AIEA 4AQOA 4U1HB 2QT6A 3TH4T 4JY5H 2OL3A 3S37H 3IJHB 4NUQA 5CINH 1JN6B 2WANA 5I5IA 3MZGB 5CR8A 3P11L 3BWUC 3OB8A 2Z93B 1U92A 5SWSA 4DGIL 1YEJL 1AD9A 1AD0B 2J55A 1B88A 1MZYA 5E5UB 3H9HA 1R34A 2FIKA 1BEYL 2JIXA 4K3EH 4K9EC 5H2BA 5EC2B 4N6RB 1BW8A 4C56D 4BZ1A 4N5ED 3W38A 1KJ3L 1TZIB 4DCQB 4QYAA 3M7FB 1A1MB 1CICB 2FBJH 2NDGA 4AGQA 1XT5A 4EN3D 3K71B 1FN4A 5ITFA 2KDGA 3T77A 1HWHB 3QUYC 3EH4B 4ZNEE 3NJLA 2DEXX 3O3EB 4EXPX 4G8IA 4UT7H 5T3ZE 1CXKA 2ZOKB 2V2TB 1ECYA 2ZCLH 1I3GH 1IL1B 3QAZB 1RCYA 5ID1B 1BAFH 2CCLA 1RAMA 1UH2A 1O9WA 4WU7B 2EE0A 3BLKA 3SE9L 1AGBB 4XE0A 1QLFA 1U8LA 3GBNH 5HYFA 1OAJA 1RJCA 4NQVB 1GZQB 2WQ8A 2VDNB 1E5ZA 1IAIH 3VGAB 4HUMB 1LQBC 5E2UH 3LDBC 1KC5L 5FIEA 3O45B 3RG1C 5E1IA 1AR2A 1IAOB 5IB1A 3LKRA 4AOFA 5JHBA 1O7DC 3FQTA 1LNUA 4G2AA 3AAZB 3GI9H 2H32A 3LAFA 4PBWD 3U7WL 1J8SA 1C9SA 4P3CL 3U0PB 1NCUA 1IGIL 1B4JH 1IQDB 2OYMA 1WVZA 3ZLQC 4A63A 4WQOA 3HPJA 3VB8A 2EXSA 3TIDA 1DL7L 4LAQH 3VFTA 1MIEL 4LKCA 5I19L 4OLXL 5FPIA 2P42B 4XN1A 1IC4H 3HRPA 4PRHE 5TTRA 3PFQA 1MRDL 1IFGA 2ZWKA 4PHXA 4YHML 3MREA 3D9AL 4PV1C 4A2DA 5CGTA 3NTCL 5CR1A 4LP8A 4OZGA 5HYSG 4KZDL 4JO4L 4AV4A 5T1KD 1A47A 5F7UA 4P8QA 1CE6B 1KIRA 1XZ0B 2AV7B 4K7PL 4LSQH 3WDJA 3OMAB 1HH6A 3EYVA 3GBDA 3CFBA 1Z3GH 4ODUB 5CCHE 3BEVB 5IW6B 4MAYC 3L4XA 1JZ4A 5AZEL 1PZCA 5GS0H 1KGXA 4MQSB 2Z3FA 5J5EA 1P7QA 1D7BA 1NGQH 4KZ0A 3UGEA 5DTFB 5FA4A 2IDUA 4FTVA 4NC2B 1ML0A 1KTJA 4AG4L 4WUUB 1NGPL 2L4OA 4PJGA 3WGUB 4KKRA 1SF5A 4HKXB 4YFLF 5FFGA 1B0RB 2VUYA 1J1XL 2EXYC 1C12A 4TUKH 4P9ML 4KUZH 4NKDA 2GB2A 3SOTA 1B6DA 4HU8A 4K5LA 2CIKA 2HVKB 2VDRB 3I84A 2CJ3A 4YBHA 5LGKA 3EF4A 4PLKC 2EVFA 1JTPA 4TUJA 1OQXA 2PNDA 4F24A 3N50A 3QFDB 5HHMB 5MERA 1JPTH 3S7GA 3LB6C 1U33A 2YMOA 4O9HH 2BSCA 5LBVA 3ORJA 1MNUH 1B2WL 4Z18A 5PAZA 5C3LD 1TQTA 4L3AA 4RA0C 2N0KA 2TRHA 4Y7MA 5DS2A 2WZPD 4YSEA 5J1TC 1GCFA 3EO9H 2WIMA 5DJXB 4QHKI 3KPRB 3SGJA 4F58L 3RUGF 3TZVC 1QFUL 4KVNL 3U7WH 2K7PA 4NQCE 2EDMA 2DL9A 1B0IA 2ICWB 3LZRA 4AH2A 4YPGB 1EEZA 3VMPA 5ADPL 3UYOD 2H8PB 4XN7A 2BPBA 3TCLB 2ZOTA 1J1PH 3HMWH 3N9GL 1JHTA 3OKNB 2Y9RT 2EVIA 1QVOA 1JK8B 1P2CA 4JHUA 3V8CA 2VXTH 1XH2A 2ZKWA 4IJ3C 4WCYH 2H32B 1MFAH 3LEXA 5BNXD 1FUNA 2UXGA 1ZHKB 3FQNA 4N24A 1X4ZA 3O6KH 3SKOB 3PXJA 4Z7WA 4P9HH 2MNUA 1PZUB 4NCC1 4GRLD 1V54B 4N2FA 4C8XA 4F33A 1EHAA 4IOSA 4FFTA 3L2NA 4WWNA 1DQQA 2O5ZH 3MRDA 2LLGA 1ZVYA 3MUUA 3QYCA 9PCYA 2FAUA 1YNKL 3CBKB 2FIKB 4S1DC 3W2DL 1PMYA 1O6TA 15C8H 1CT8A 4N2IA 3QJOA 5E94A 5A40E 3AS3A 2NRDA 4RQQB 5EZLB 5KSVA 3LKPA 1A1MA 1CICA 1R3JA 1WIPA 1I4FB 1YEJH 1DJXA 1ODAA 2HUHA 5F6IC 3FW6A 3SKJL 1E4XL 5HJ3A 2V37A 2C1PA 4LLYA 1FN4B 2ICWI 5ITFB 2B3RA 3EJUA 3VFGL 4MMZB 3W5NA 4QHMA 4X9HA 1PZAA 4X6BB 3TA3C 2PW1B 2KH2B 4DPCX 2WBKA 2HFGH 4OM0H 2EUWA 2V6HA 1G6RL 4GY4A 2FVNA 5EU7E 4ZZKA 4WU7A 2H3XC 4PJ8C 1NEZG 5DC9B 1WTLA 4Y5VA 3F58L 1TLMA 3GFUA 2MKLC 1BG9A 2P7TA 4O9HL 4Y16D 1C1EL 1D2OA 1UH4A 2FTAA 2J8UB 5GRVK 4ADJA 3O45A 1MWAH 4D9RD 1P5VB 2VLMD 2O1AA 2E7LC 5IJDC 1T0MB 4PJHE 5FA3A 3QJXA 1IVTA 1LO2L 2EVGA 4AV0A 3FTSA 1UATA 3CU1A 4UT9H 5SWQB 2XXGA 1WA1X 3NZ8A 3T65A 4A37A 1A25A 3ABMB 3VFNA 5K39B 3BP4B 2QVTA 2OMXA 1HCFX 1XGPA 2IWEA 2WKOF 1O9VA 5E6ZA 1KXTB 1OTUC 2DQMA 3EGSB 4WJ5B 4YDLC 3MRPB 4PJBF 3VH8B 2YD0A 5AW8B 3UTTE 1FNSL 4JVPA 4KJQD 4LSVL 1ZD6A 4HUWA 3ZYJA 3FCSA 3MV8D 4ABUA 2G9KA 3DXAE 4P05A 4ZPVB 4PLJC 3SYOA 5E8OA 1UHVA 5IVXF 1Z5YD 3WNNA 3H3PH 3I50L 2ZPKL 4LSUL 3IB4A 1J9SA 3UZVA 2ZUQB 4XP5H 1T2JA 4NO2B 3Q7JA 3BSZH 1IU1A 1RUML 1X5KA 2AV7A 1HHKB 3DX0A 4PRPD 3BGFB 5FYJU 4I5BB 4YSAA 4NPYB 3CFJA 2K4AA 2F9BT 1E9QB 4O2CA 4RCAA 4FFZH 4JN2A 1ASOA 5SWZE 1MQKL 3LEXB 3EUDA 2D0HA 4HZ1A 4J3OG 4IEFA 5IVZB 1KXVC 5BXFB 3ULUF 4FTVB 1HJCA 4MMXB 5IK3B 4I77L 3WYRA 4N2CA 3CZFA 4PJGB 4I0PD 3EH2A 1N0LA 4NQSA 3D2TA 2JSFA 3QORB 5A2JH 4NOBA 5HTSA 5GRJL 4ELME 3QEUA 4BIKA 1KLGB 4UB0H 2WXIA 1U8IB 5JOFB 3WTSA 3N1MC 3VRJA 5LXGL 1HSBB 2UYLA 2X4PB 5DDHB 5HPOA 3BI9X 1ZS8A 4C4KT 1JXDA 4UDTA 3BPLB 3MBWA 5F3FA 2XZZA 1UVQB 4Y8DC 4KQ3H 1KC5H 1YRKA 5ESVB 1J5HA 5HJ3B 3DHUA 2BRQA 3V9CA 1JGLH 3GMMA 4YHZH 4X6FA 5SWZB 3IEAA 3VRLF 2YC1A 3FN9A 3QHZL 4A67A 5C6PB 4WK2B 5E4AA 2VL4A 1IFHL 3DOSA 4HS8H 2V5RA 2Y3NA 1G7QB 3B7SA 4FZEH 2B1AL 3BP5B 4NJ9H 4OGZA 5J13C 3DHPA 4JREC 1FGVH 3LRSB 2NSMA 4OCMC 4KK8D 1NDGB 2AEPH 4P5TC 1QPKA 5INCB 1LJMA 3JWNC 5IP4A 4ELMB 1U8PA 1KCUH 3JTTA 3ZZQA 2H8PA 3QRFM 1T7WA 1YMMD 5EF1A 2CDFA 2MH4A 4WVRA 4W9KC 1ZLWH 3AREA 3DPBA 3WLWC 2HLFD 1TJGL 1ZHNB 3PS6A 4JO3H 2IC2A 5MP6L 3AUVA 2DH3A 4HZLB 1AMYA 2X44D 2VLJB 3PWNB 2X38A 1L9PA 4MQXD 4F33B 1AO7E 3FO0H 3NA9L 5CLWA 5EFIA 4XXCC 4JFXB 4Z7NB 3SQOH 3QEGH 2DL2A 1JWSB 1NC2B 2IQ9H 4AEFA 4K71B 4JRYA 2KMWA 3H42L 1JPST 2WNXA 3QRGL 4XBGA 3G6JE 4LXFA 4OVUA 1RZ8A 3MN8A 1HI6B 1U8QB 1IKFL 4P2RA 1P6WA 4X5PA 5CJXC 2X0WA 4ZPVA 5E8OB 3VXRD 1JPGB 3WJLA 2WD0A 5C0BB 1R3JB 3BQUC 2JJTC 3NP3A 1RL1A 5DURD 3UZVB 2KHAA 2PW2A 3ZGIA 1I1FA 4FI6A 1XHHA 3RRQA 2XDHA 4NDMB 1YEGL 1EA9C 1NBYB 3L9YA 3PCYA 1ZK9A 4I2XE 3CUPB 4N2GA 3OPZH 1MCPH 4Q14A 4X6BA 4MAUH 1DSFL 3HKZA 4RESB 3RWJA 1MH5B 1IBBA 3Q01A 5SWSE 1JWUB 1BJ1J 5KYYA 2MQ0A 2YBGA 3RYMA 4AIZA 1TQBC 1NGWA 2QGBA 1Y6KR 4LLMA 1G7LB 5BZZA 2CBPA 2C1OA 1P4LA 2VSMB 4FI7A 4G71B 4GG6A 3KPOB 5J6GB 4K8RH 4DAGL 3L6FB 3WD5H 3CMGA 1E28A 4M5ZH 4ZXBB 2ZF9A 1Z2KA 4P59H 1C5DA 1U8IA 3UTTD 1HCYA 3NUKA 5I17A 4UU9A 3QZWG 4P2QA 4AUYA 4Y1SA 3NZUA 3S3SA 4DK6A 2OFQA 5DEFA 4OJFH 3MJ9H 1Q0YL 4CADB 3R06B 4FL4B 4OZFH 3NFSH 5ISZB 2VN7A 1PLAA 2AJXL 4KVCL 1JYVA 1J88A 2YRLA 1PG7X 4PRPE 3PJLA 3DROA 2QMJA 3ZKNC 3ZYIA 1FJ1A 4M48H 1NDMA 4UZSA 4DGUA 3WFCH 2Q86A 1KXTA 1PNCA 2FWUA 1XGUA 3UPRB 4OGAC 1E6JL 3GBEA 2HP4A 4PUBH 3OKKA 3MO1B 3MLRH 4EAEA 5AOKA 1SQ2N 4OBRA 4LIQE 1NDGA 3V4UH 1A7NL 3RTQB 3MA7B 4B5ZA 3H9HB 5C3TA 5MEOB 5C7XL 1KYOJ 1ZDSA 3DVNA 5DFTA 4N6RA 2NY2D 3GNML 4N1HB 4WJG3 1KLFB 3LXAA 1W6LA 3GSOB 3QUKB 5FWRA 2WLIA 3KWWA 4IHOA 1HHKA 3ILPB 2GABA 5L88H 3GI8L 1TENA 3NA4A 3SBQA 3ULUL 4UDUB 2JK5B 5DUBB 4DN4H 4QNPF 3P2BA 4LK4A 2ALAA 2EEFA 4IOSD 1J05B 2DMKA 5C08E 3OG6B 1G43A 2NY0B 3ZTJG 1LEKB 2WLLA 4LU5L 4KY1H 2BSSA 4PJIF 4CMHC 4YBQC 1I1AD 2EC9U 2VAAA 1E6OL 4Z7QB 1PF3A 3FNKA 4OJFL 4JFXA 3OX8B 3LZLA 2UZIH 2ZOUA 1NCIA 2BZ7A 2XWTB 1FGNL 2FO1A 1HSBA 2ZUSA 5DDHA 4IDLA 4OKVB 4H26A 5T1MB 3G9AB 4QYOB 3LKRB 4OCRL 1UVQA 1R47A 1HX0A 4KY1L 3JXAA 2IBGA 5E2WL 3W1ZA 4X6EA 3GMMB 1T83A 2GEEA 4HETA 2FHCA 2P24A 1V55B 3GKWL 2CO6B 5D1XC 2QELA 4PGBB 3GZQA 2DLGA 1UKQA 1NCWH 1QHOA 5I2IB 3U4EB 3B7UX 4H8WL 4AIZB 3EJTA 1KSRA 1AC0A 3T04D 3PWUB 3W0WD 3QDGD 5IZ7A 4JG0L 2QPFA 5BVPL 3ZPDA 3VM7A 1OSZB 3IWVA 1R5VA 1P1ZB 4NUJA 3UFIA 2VR8A 1XGTA 4PB9H 1CE6A 4XNMB 1A6AA 4R7XA 1JZFA 3OAYK 1OQOA 1PW3A 5HYIA 4DP7X 2GAZB 4Y4KA 3KJ6H 4PRAA 3CFBB 1XVSA 2QFRA 2XRAH 4QGTA 4PV8A 1UM5H 2A6DA 2BM3A 3QS3A 4A7TA 4OZHB 1MHPH 2V5SA 5GGVH 4KBPA 3VXMD 1FJ1B 3EHBB 4F2ME 4OIIL 4GW5B 2WKLA 1Q4NX 3PWJA 1NC2A 5FECA 2WLJA 1DLHA 4L8SA 4O02H 5F7AA 5SWSD 4JKNA 1JSYA 4Z0XB 4KKLD 5C0ND 1KTKE 1HI6A 1U8QA 5T5FH 1B0RA 2AAVA 4DEUA 2DKMA 3RX9A 3VD2A 2FO4A 4XPTH 2DIEA 2KQNA 1FZJA 4WHCA 5KBMA 5K93A 3HNSL 3QQXA 1KGCD 4TSCL 3BKMH 3VB9A 4HS8L 2VABA 4NP9A 3TWYA 1R46A 1U8KA 1MF2L 3WO3B 1K2DB 1LK3L 1MFEH 3U6RA 3W37A 3ELQA 2YEVB 3D1MC 1JWUA 4ACPA 5IHLB 2NYKA 2WLLB 3QUZD 1LEKA 3SDYH 5LWYH 3MCG1 2HTLD 1P69B 5IB4A 1TIUA 2BRRH 3KPRA 4HUNB 1O0VA 5CU9A 1NMCB 3UL4A 2H3NB 5TQ0L 3A4FA 1S8DB 2FLRT 3KPOA 5DD5H 2ICWA 3CDZA 4HUVB 3OX8A 5F7LB 3X12A 2AKRB 1AKJB 1I8KA 5FO2A 4I13B 2B08A 1SBSH 3MRGB 3MHZA 2BW5A 3SQOL 2XWTA 1ZT1A 2MSPA 1F3DH 4J4PC 3QNYA 4WO4B 3L17A 2R51A 2YN3A 3VW3L 4YK4B 5GJSH 1SVBA 3DIDA 1NCGA 5FF6A 5KVEE 4CVXB 3FOMA 3HHMA 4UANA 5FKPA 4HQQH 4UBDC 2FEEI 4GH7B 2VDLB 3SKOA 3TT3H 1NBCA 2Q86B 4JBSA 4ODSL 4QLRA 1OW0A 3NAAL 5E8EB 3T2LA 3MO1A 1KBGL 3QJHA 2PCPB 3ZUNC 2LW3A 1OSYA 3K2KA 4Y1AE 3PNRB 3FU3A 3PWUA 1R5IA 4GAYB 5J6HB 2EIZA 3SDDD 7FABH 2JIXD 1FNSH 5JHDA 1EZVX 4E41B 3V10A 4W6WB 3MV7E 1CS6A 1A6AB 4XBPA 1HE8A 3JVGC 5HHME 2VXQA 1MFDL 4IRJC 2AC0A 3WO4C 1VFBB 3BWZA 5I24A 1XAKA 3T2OA 1INEH 2X4RA 4IQHA 5DK2A 4Y19B 5AW5B 2OL3L 3W9DA 3PWPE 1QEWB 1XIWC 2NLJB 5DQ9A 4DP5X 1XF2A 5I8EA 4UOQA 4HFWB 3AQXA 1G0XA 2VRAA 1YYMH 2QADB 3A0OA 3GO1H 4OKVA 3ZTNL 4UZGA 1S7TB 1HAWA 5FA3B 5HHOA 5IBUG 4LSDA 5FO7A 4TN9A 4XWGL 5CCKH 3L45A 2QKSA 3B3IB 3LQZB 5FWQA 2Z0UA 2IBZY 2X9WA 3P1VA 3ARDB 1OVZA 1RIVL 3QJSB 4XNUH 2VABB 4I0KA 3RA7H 2VOTA 3P4NA 1KTRL 3T3PF 4APQC 3UO1H 4OCLC 2IDQA 1G7IB 4Q8BA 4Y1TA 1UM6H 4OJAA 1V27A 5DEGB 5GZOC 5I2IA 2DMBA 3U6XS 2YK1H 3NJIA 5LDUA 5ANMA 4URKA 5EZIL 4FQXD 4K7FA 5JNYB 3WIHH 5DD0L 1PX3A 1OPOA 2ZT9C 4N0RA 4DKEL 3ULVL 5D7LE 3CDZB 4J6RL 4U7KA 1GYAA 1QRNE 2C9RA 1YNKH 4ENZA 2WK2A 3QWNA 4LCWE 4MMYA 1QHPA 3CSTA 3IFNL 1NANH 2FSEB 5F9OH 3OHXA 4PJCE 1U95B 3L5HA 1TQCC 3TO4D 1QPPA 4O2CB 4P9HL 1GGYA 4TQEL 4HFUL 5GGSA 5AOLA 2XVBA 4CVXA 4NN5B 5DC2A 4Z7VE 4OZHA 4JY4B 2EE3A 3LNFA 4K23H 4AL8C 5JQ6H 3GSWA 3IDMB 5KSAB 4GS7C 1S46A 4FHKA 4KXBA 5T1LD 4LSTH 3F7KA 1W6WA 4JM2B 1N0LB 4L9LA 3N9GH 3QJHB 3NIFF 2XSKA 3FCBA 1DFXA 4NQSB 3F84A 3U48A 1C1EH 4I1RA 2J5LB 1KLGA 2VDOB 1I1AC 4Q0XL 4LARH 4DK5A 1QRNB 2OK0H 3MX0B 4J6RH 2WXPA 4OZFG 4YQXL 4YSUA 4HSCX 3PJSB 4HP5A 4UDTB 5C86A 4XC3H 4P2RD 3FJTA 4RDBA 2Z65C 4Z7OF 4XBPB 1PD1A 2HLAA 2V5YA 3GIVA 3ZDXF 5FHBL 3U6RB 3OAUL 5I1KH 1BYPA 4MA7H 4U6VH 4H13C 4HFUH 1MCSA 2OMUB 5KBLA 1BAGA 1OLZA 1T6BX 4Z7NF 3FFCD 2X4RB 1KPUB 1R3KB 4E42B 2AV1A 1AR1B 5GJTL 3BZFA 3IVKA 2QSVA 5LBGA 4AEHH 1PBYA 1QI5A 5INCA 4DK3A 5BPPA 5GRWA 2IJ0C 4F93B 4M29A 3W2DH 1MCRA 3WHE1 5ADOL 2FHBA 2KERA 4BXSV 1KNOB 4M9OA 2O6CA 4I7ZC 3BH4A 1E27A 5CHNB 3MU3A 1NFDE 1U8NB 1JS4A 3VTMA 4JVWA 5DFWH 3D25A 1RU9L 4OV5B 2ADYA 3IXTA 1CFQB 3NSJA 4OBSA 4RVBA 3UO1L 2WAHA 4XZ4A 2VDRL 1OAYL 1E4WH 2VDPH 3ARDA 3LKQB 4HLZH 3ZDYE 4CVZB 1KWGA 3P4NB 1M05A 1XMWA 3HZ3A 5D2LF 2HUEA 5FLUA 5LGYA 2XX1A 1G7IA 2Z35B 5BZDA 5F72S 5TF0A 3CX5K 5F3HA 4GRMB 5HVHB 3FO9A 2WQAA 3RWHB 1GGUA 1JWSA 4L48A 3RKDD 1JI2A 4C47A 4K7FB 1OSEA 1TTFA 5CUSL 5JNYA 1YECL 5IBLC 1BQHA 1MFBH 2NY6C 3CC5B 2EIZB 5DLMH 3OSKA 1XXFC 4P2RB 1OGTB 2NY4B 1KN4L 3PWPD 4OLWH 3LS4L 4NAJA 4AENA 1QFWH 1KB5H 2XQYG 2Y7LA 2CMRL 3KLAB 3THML 1WT5A 3MROA 4TF4A 3BVWA 4XHQA 4JN1L 3HG5A 5BS0B 2OXHB 5FX3A 3IDXH 3IS0X 2GBAA 2X0UA 3FB5B 1IKNC 1P5UC 3D33A 4A2LA 2R1XA 4YX2H 2DQJL 5HI5D 3RWJB 4PVBA 3TIEB 4AVJA 1VPOH 2AXGA 3LMJL 2WXOA 5F7DA 1PAMA 3F7RA 4TTDD 5DQ9B 5AZ2L 4L9LB 3UOAB 2JI1A 4QCIB 4XCEB 1DJSA 3GK8H 1SUJA 2CLZA 1MCJA 3RDTD 5JW3H 1MCQA 1CDGA 1E3FA 1KB9K 1YEHH 3BAEH 3N1GC 5ESAB 1NICA 3TEUA 3WUWB 5EU4B 3DJZA 4YXLL 1UENA 1BVKA 3D4GA 4ES8A 1D7CA 2MRYA 1VIWA 5AZEH 4ZMLA 3AQYA 3BISA 3L2LA 2ZOOA 1U8CB 1R3LB 2YOAA 2XKSA 5D7SH 3S5LG 2EYRA 4GMSH 2CPCA 4U3HA 2ODHA 1MXDA 1H0DB 1F11A 4LLDA 4IKNA 5TE4H 5A6LA 3IMUA 3QQ3B 2UVEA 3LKNB 4LMQI 3NCEB 5ANMB 3NQIA 4JDZB 1R3KA 2CUHA 4PRIA 5FOBB 1KELL 2DPKA 3NTCH 3QG6A 1QLRA 2HFTA 3QYMA 2MOGA 4JKLA 1MLBA 2IH3B 2PYEE 5AKVA 5HHVL 4F9PC 4ZUWA 4OD3L 3HS0B 3GLEA 1OGAD 1RJYB 4JHBA 2VLLB 5FCUL 4UDUA 5DUBA 1ES0A 4PW4A 3S3PA 5IHZA 2OTUA 5KVFL 4JRWA 2NNAB 2YSTA 1P53A 1UCBH 3EJZD 3S35H 1FH2A 1QMUA 3VYPA 5I6NA 3LKQA 4PJXB 3UCRA 4NQCA 2FATH 5JIIA 5JHMA 3NACL 2DQCH 3KJ6L 3AG3B 3PQYA 3Q6FA 2KLSA 5IQ7H 2HXAA 5DYOB 4QRRD 1DVTA 1LEIB 5HGBA 4X7TB 4OSUH 4GQPH 1MHEA 3FFCE 5D8JL 1BDYA 4XBEL 4XNYL 5AD0A 4M7JL 3C60B 1XDTT 1CGXA 4WY7H 3TASA 3D4CA 4R6UA 1OGTA 1YNTA 2H6OA 3UPCA 5BVPH 3BD4A 2QGCA 3V52H 4TVPE 1UXSB 1XF4A 1QAWA 4QRTB 3CXDL 1ZLSL 3UJTH 3T0EC 5J3HD 1QLEB 1SFDA 3QR0A 4NN7B 1JDDA 4UF7C 4PRHD 5D7EA 3PL6C 5HDQH 4FQHA 2AABH 1DBML 2OXHA 1WD9A 1U58A 1QTPA 2WXQA 1AP2B 3O3DA 4V11A 1LEGA 3A6OA 5CZXD 4J2XA 1MF2H 4BGLA 1ODUA 3EOTH 4HD5A 4F7CA 1F6LL 4KK5C 4M3HA 2YQBA 4E42A 3DJTA 4FQIL 1G84A 1KJ3H 1IGCL 2QBWA 2X7LB 3BZFB 2BNRE 5BO1L 1FCGA 1GXEA 3K80A 1BEYH 1D7FA 1OALA 5TDOA 2WNGA 2HX7A 1SBBA 4ZK8A 2OZ4A 1G87A 3DYMA 1QW9A 1UYWL 5GRUL 3RIFK 3TF7C 1OE2A 3IU3A 1UD8A 2DWEB 3IJSA 2JCCF 4OGXH 1PS3A 4GB9A 4IYKA 2CLZB 4PWFA 5T5FA 1ZSDA 4HGWA 4JM4L 2OL3B 4Y4FC 3EOAB 2WQVA 1A3ZA 3MYZA 4DTGH 3F00A 3IJ8A 3QDGA 2ENJA 3C2AL 3HCVB 1JF6A 3O6FC 1TTUA 2XRAL 3T6WA 2A6DB 1AMXA 3N0PB 3VO0A 4WW2B 4NI6A 1DEEA 3AUWB 3K6SA 1QZ1A 1GOFA 5F3HB 3NFNB 4L29A 5C3IA 1OHZA 3SJVD 3CZUB 3FU9A 2EE2A 2R4SH 1A4JA 2ZUTA 1R33A 3K91A 4OLVH 2ADGB 4PJFA 1DANT 4FS0A 3QQ9D 4ZS6D 2BERA 1MUJB 4BSVB 3EO1B 3IFOB 4DQOH 1AY1H 1JD9A 1AOHA 1RV6X 1DP0A 1S5HB 3M7OA 2V2TA 3D39B 5LN8A 1UOLA 3HAEB 3IDUA 4K5OA 4TTDC 3QPXL 3WS6C 1U8HB 4HBCH 5GRVL 5BS0A 1UWGH 25C8L 4MHHG 4S0HA 2AEQL 3MNMA 5A16A 1RJYA 2NCMA 1OM9A 5C1MB 1U8KB 1U8LB 5D72H 1EZVY 2R1XB 4AZUA 1X9LA 3HBGA 1LO3H 4Q52A 5GS3A 3DVGA 1SM3L 3S5LA 5DK0B 4TOYH 3TXAA 3BPNC 3INOA 4L4TB 3HS8A 2YOCA 3KYMA 3AZUA 1GGBL 1E3XA 5I6MA 1JGEA 1V7NH 3WE6B 4RMBA 2NY5L 3ESNA 1OZUA 2PO6B 4XCEA 1MFCH 1IKOP 3UTPE 4ZQKA 3QGVA 5DS8B 5CEYB 3BLPX 1FVCB 2FEDD 5E4EB 3MLRL 1E6JH 2IO5A 4LKCB 3B2UC 2B8OT 3K4AA 3LQAC 3KPSA 4U3SA 3UO8B 4GW1A 3B5HA 2G9HB 1BZOA 3SQBA 5ICYB 3AG4B 4HK3N 2CLRB 1AAJA 5CGYC 4MS6A 4WU5A 3CDGB 3HFFA 3FTUA 3GKZA 4JE0A 4KX9A 4K94L 4EUPA 3KGTA 1XWVA 2X6VA 2O5XH 1R3HA 5FV1L 1TJXA 3K46A 1GJWA 5CN3A 4P06A 1Y0LA 5J12C 2YUWA 3BEVA 5IW6A 5J6HA 1P7QD 3B3BA 4BKLA 3QRGH 4YC2B 3TURA 3RB5A 2WLHA 2BHYA 2DYPD 3SPCA 1QO3B 4JFED 2ITCB 4NKQB 2WTOA 5I1JL 2B4CL 5ICUA 5TH2B 3EOAA 1SN0A 4TUOB 3JWNG 4H4NA 4LO9A 3SDXE 1CFVL 1R24A 1SYVB 1YN7B 1VEOA 4JM2D 5CILL 3P9LA 3RBSA 1UYWH 4Y9CA 1XH3A 2V7HA 4D9RE 3MODL 4WW2A 3KLKA 1PEZA 2HB0A 1H3UA 2WB7A 2B1OA 4MFHA 3SGEI 1QSFD 2NLJA 1FFTB 3CCHB 4N0UE 3MGTA 5FR3A 1CDCA 3ZKXB 5EEVA 2BNRD 4MAYB 4UQ2B 3A23A 4WHDA 1IJNA 1MUJA 4QF1B 1KB5A 1AXTH 1CXLA 5CZVH 4HWNA 3MGOB 2VGLM 1EERB 1J9TA 1M2OA 3LQZA 1EXUB 3JVFC 5JUEH 4K9JA 4PGJA 1DSFH 3W11C 2B15A 5LGJB 3O4LE 4AH2B 4HF5H 2VR5A 3QFGA 1F6AA 2BCKA 1O5PA 5F1NA 1ZVSA 2BVQA 1DJGA 1I7TB 3A6CH 4WI8A 4H88H 2CH8A 3DMMC 5CMAB 4LE8A 1K6QH 3DV6A 1GS7A 2CALA 2QL1A 3HA0A 5IFJA 1IO4C 1CTNA 4TNFA 3WE6A 3IAGC 4YDJA 2DTMH 2K9FB 3GINA 3CFCL 2DWEA 1EPFA 2XTJD 3RL2A 1AZBA 3S3DB 3N06B 1WP6A 3N40F 3L3OC 3CLFL 3IJYB 2G5BA 3VGGA 3BUYB 1NWOA 4ODHL 2A6JA 1S9XA 4QO1A 3UBHA 4YSTA 4NO0D 4P5TA 3HNTL 3L7EB 2ZG3A 1YEIH 2GSGA 4KXZH 4MX7B 1XCTA 4W4OC 1YEDA 3VD3A 3PWVB 1NEZB 2X6CA 3BT2L 3BZDA 5KSAA 4N0FA 1A64A 3KPNB 1OB1A 2FT6A 1EQWA 4WU5B 2APVA 2JLLA 1AZRA 2AXJA 5FAAA 3AREC 2EDHA 4MCYA 5E08H 1QI3A 1ZPLA 4KKBD 3EOTL 2CHXA 1A14H 2ADGA 1ZT7A 4PJFB 3U4BL 5J9PB 1Z5LB 1I82A 2KBGA 2BSRB 1KOAA 3AFLA 3K4ZA 1TUPA 3FU7B 2Y7SA 3F12B 1IB5A 4XXWC 4AT6A 4BKLB 4N8VB 3NZHH 2G2NA 3QUXC 2OX5B 3UP6A 3COOA 2C4FT 2HLAB 2EDQA 4HWEL 4PG9A 4BFJA 2I07B 4OJCA 1DQJB 1JUFB 1MSPA 1MLCA 2BVUA 2FJGB 4JY6A 4Y2DC 3SCMC 2NW2B 3VQLA 2XWJA 5DK0A 1R24B 1SYVA 4RFEA 4JG1L 1OSPL 1P5VA 1PKQB 3D34A 4U1LA 2F8VA 3BP6B 2A6KA 5D1ZB 3DXAA 1UXMA 4PJHF 4NYLB 2UZPA 5HI4C 1DEDA 3CSBA 4JFZH 5CLZA 3SZKC 2ZNWA 3RHWK 5A3IC 1M7IA 4FQCH 4AVKA 4OFPA 2QLYA 2K6YA 1MCKA 3QDJE 3TA3B 4KMTH 1ZTXE 1JPSL 5AUMA 4A68A 2Y3AA 3T09A 4ZYKA 2ALWA 3PHSA 4RISL 3DX8A 4LNRB 3M88A 4WSKA 1AO7D 3BIAX 3N1PC 5ENWA 4X4YA 3EGSA 3IPEA 2WBJC 3MGOA 4MQ7A 8FABA 2EXYD 3CDYA 5INDA 1KB5L 1QFWL 2YPLA 2JVUA 4AVHA 4BEIA 4OZ4B 4F1ZA 5LHDA 1CN4A 1E2WA 5IIEA 4KXDA 2VL5B 5E5RB 4HUWB 4JFYA 1SVCP 4NQDD 1QBLH 1UZ8A 3VXRE 1EZLA 5EZJB 1QWNA 3PWPA 4HPOL 4XB8A 1KCRL 1T04A 1WD8A 3BSZL 5TQ2H 2ZAHA 4N2BA 4PP2B 4RIRB 3EBGA 3H7LA 4BZYA 3D18A 1S2EA 1M7DA 4QHUA 1RP8A 1C08B 2X41A 3HBQA 1LO0H 4Q58C 4BQ8A 2ITFA 4GKZA 4AZ8A 3EYQC 1XCQA 1J86A 2DQDL 1DVXA 3QNFA 4K5NA 3MRRB 4PJDF 2EECA 3T3PB 4YDLB 3MROB 4GI8A 4XPHH 1JK9A 5IK3A 4WWKD 4CMMB 3BUYA 4KTGA 3I9IA 3RPBA 2J1XA 2JE8A 5IQ9A 1OGAB 4OCSL 1CU4H 1AD9B 4WWKA 1XH3B 5JOFA 1USQA 4E9RA 3FUKA 4FP8H 5DO2C 4EIBA 2JIXB 5IESH 5F97E 5IVNA 1JGIA 4O58L 3ZTCC 3V0WH 3E8UH 1VPOL 2DM4A 3FUHA 4XNDA 1OB1B 2FX8H 2E7DA 5JA8B 3MBWB 2DQJH 3HB3B 2HJKB 2XKNB 3TBTB 4J27A 1JGVL 3HHRB 5LNEA 3SE4C 3O3EA 1AG0A 4KHXL 4XP6L 43C9A 3F01A 4X6DF 3DO4A 1S7WB 4XVJL 3DOSB 3JWOC 2BNQB 4AT6B 2A83B 1D5BB 3FQXA 5F1IB 4F7TA 3PWLB 4JCMA 5DRNA 3RVXC 4U1NB 5I1DB 5KOMC 2QLVB 2L8AA 4ZW6A 4NSKB 5I71B 4PG9B 1U8CA 4JHWL 4U1JB 3MNVA 1VACB 5T1DH 5KTEL 1OT2A 2KS0A 5CSBA 3JTTB 3CFDA 5HJBA 1WLHA 4JM2F 3U7YL 5EUOB 5ETUB 4AXWB 4J1UA 3GMPA 2BFVH 2MEJB 2R69H 2J43A 3UGUA 3TPKA 2EC8A 3D69B 1AH1A 2YQGA 5AVYB 1N6VA 2YGVA 2EO7A 1FRGL 2HKAA 4FQXA 2LR4A 3PGDB 3QZMA 2IVFC 1XGRA 2DLTA 4OCSH 3QCUL 4ZUWB 4QRFA 3U7AA 3DX8B 4LNRA 2VLLA 1X5AA 1OTTC 4QO1B 1EGJH 2DIAA 3C5SB 3ILEA 8FABB 3MRBA 4KNQA 3RY6C 4AJ0A 2BDNH 3QUHA 5EBWB 3I74A 3P4OA 4FOMA 4GLRI 3OKLA 3QZBA 1AGCB 2VDLH 3MXWH 4DKTA 1J8HA 4MCYB 2F7QA 4MQXC 2XPZA 2V4LA 2ARWA 4NNYB 4DP0X 4Q7DA 5D2NE 4KUZL 4UT9A 2HSIA 2BNUA 3CIQA 4NDMA 1ZT7B 1NBYA 3I3EA 4F20A 3SY6A 1TVHA 4HJUA 4XVUD 3D18B 1B2YA 4ORGB 1RPQA 2JCCB 3QI9C 4WEEA 5EIQA 3QIWD 4BJLA 2FZ3B 2QSQA 4NUGH 1BM3L 4LCIH 5DMGC 3QCVL 5I8OL 3PIQA 1JVOA 2Y7OA 4WTWA 4GFXA 4JRLA 3EKCA 2Q5BA 2F5BL 4KO6A 4L9DA 4LLVA 4MJ6A 4QHKJ 4WV1A 3VQ2C 4C83A 1JUFA 1DQJA 1D9KC 4LAQL 3IDIB 3QDGE 2IIJA 3W0WE 4EI5C 4CMMA 4PWEA 4LLAA 1A4AA 3GS0A 5EO9A 2VQ1A 2VLKE 4IS6A 1JPTL 1QFHA 2VZOA 1D6EA 3FUDA 4WFFE 3H2PA 5G4OA 1T5XA 3KLSA 4P2QD 5IQ9B 5EF3A 4WWKB 2LTQC 4ELDA 4XB7A 2J25A 4MRCA 5DEFB 4Q9RH 2VNCA 5HJDA 5JQ6L 5HYEA 3UERA 1M9SA 2BW4A 1QBLL 3U36B 2X1XR 3ZT7A 3H8NA 4JG1H 4FI8A 3GBLA 2HJKA 3VX1A 4TQEH 2VW4A 2VM4A 5EWIH 3U79A 4G72B 4N0YL 3SDDC 4BFEA 2JB5H 1MFDH 4CN1A 1B4LA 4X4YB 3HG1B 1INQA 1CE1L 4QTIH 3BWSA 3SDCC 5DJXA 2GJ6A 3VG0L 3PJNA 3QDGB 4U1NA 4PJXE 3OKOB 2VXUH 4FJZA 4LGRB 3U30C 1A7RL 2EIEA 4U1JA 4YPGA 2VRKA 5KYUA 3OPUA 3AWFA 1Q9WB 3O8XB 2ENPA 5E5MA 3CFDB 3HFMH 5B1KA 3TCLA 1DJZA 5TGBA 2G4GA 3L5JA 1CDIA 3QXDB 4IHOB 5H4YA 5I0VA 4DP1X 1IC5H 1P2CB 4S2SB 5L2KA 5F88B 5I6XC 3FQ1A 4X6DE 4S1DD 3T2PA 5HD8C 1PJWA 1HXMB 3NCCB 4K3EL 2VZ3A 4ATTA 4EZLA 1NGXA 1XCQB 3MCKA 1UWFA 1ZLDA 2FDBP 5FM5M 1FNAA 4XWGH 3KWUA 1PIGA 1ULVA 4NM4L 1WA0X 2NX5D 2IXQA 2J1WA 2NY6D 2ITDA 3HVNA 4HBQA 2X2JA 1NLBL 1GZHC 4F7MA 3D51A 3GJFH 3CFCH 4YNYB 4JG9A 4H40A 4NHUB 1DJYA 3V6ZA 2FBJL 4LEEA 4PWIA 3IGFA 3CN2A 3PP4L 4RQQA 5J4MA 1N8ZB 2QVMA 1FYTD 3IJ9A 1A4KB 3KXFE 3ARYA 1RVFL 2B16A 4UM9D 3FT4B 4HUCA 2C26A 2XG5A 2ZZUT 1YPZE 5DFAA 2HTLC 3LHAA 1JE6A 3QFJB 5D9SB 1TVHB 5HSFA 5IEKB 4BFKA 4FADA 3GBNL 1WISA 4P46C 5MI0C 4ZX5A 4IBVA 2VDKB 1FFOA 1O7SA 2ID5A 2OMYB 2CKBB 3CLFH 4HJ0D 1KMGA 3K6OA 5EULV 4A7UA 3QJTB 4U3SB 1MPAH 4GW1B 1X5JA 4Y5VB 1CD1B 5I1AB 3T8XA 4FERA 1XBDA 3MV9D 4Y8AA 1T5XB 3VAEA 1P1ZA 4GQQA 1XGTB 1ETJA 2QZ5A 3A6CL 5HHMD 5I30H 2OQJA 1WAPA 2Y7QB 2WWMC