4QXTA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with fc27-msp2 14-30
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fv fragment(mAb6D8) heavy chain
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxtA00
4JFDD 4EVNA 3WDJA 3GSNA 4IOIA 2J8UE 3H9YA 2C4FT 3CVHA 1IJ9A 1PY9A 3UAJD 3WO3B 5BJTB 3WFEH 1I9IL 4Z7WA 3CVHB 3C6LA 5DUBA 5F3BB 4GLRH 5IFJA 4TVPL 1BPVA 5KTEH 2WBJC 3I6GA 5I16A 4RSVA 2IQ9H 3ARDC 3WBDA 3VGAC 4UT9L 3X3GL 3OKEB 3ARGD 3HG1D 5E08H 2WWKT 4J3UA 4Z95H 2PYFB 1T22B 4N0CC 1G9NL 2DICA 2C4FU 5DUPH 4JKWA 3ZHLA 1OGTA 4L3CB 4W6YB 3V4UL 3KJ4B 4KRNA 3LEXA 1DJSA 4LLUB 4ZMAT 5MEOB 4GQ9L 2VTFA 4TRPH 3GI9H 4C83B 1VADB 1P4IH 4OCXH 1UC6A 4HWBL 3QO0B 4LLAA 5TGBA 5DWUH 3OWEA 3LEYH 5D1QC 5ANME 2P4AB 4YHLH 4MX7B 3E6FA 1XF1A 4HJJH 4NYLA 1T6WA 4F7EA 1NBVL 1A1MA 3E6FB 4N0CD 1KG0B 5GPRA 4EZMA 5LGKA 1ZT4B 3KPLB 4OIBA 1JPGB 5EZLA 1VCAA 2UVEA 1ZV5A 3L95B 3X11B 4FFYH 4LCIL 2MPAH 5AG8A 4FZEL 4XCCH 4HKXB 2CJUH 3HNSL 4OV6F 3ECBB 1QFPA 2VLME 3GNML 5DHVH 3VD9A 1T7YA 3O6FD 1GGBL 3SGJA 4NM8H 1VGEH 4ACPA 3Q6FB 2BERA 5F1OB 4ZODA 5DRXB 4NPYA 5D1QD 2W9EL 3N9GL 3FRUA 3JWDH 3T1FB 5C2BH 1FGVL 3NMEA 1KIRA 4OIAA 4QO1A 3CXDL 3KPPB 4QF1B 2MHAA 2D2OA 1AGDA 1W0YT 2JJUA 5EU5B 2IG2H 3D85D 2OL3A 3WFBH 2BOBB 3MMEA 1S5IH 4XPAH 5D6DA 5E2UL 4YFDB 5FO8B 1JWSA 1H3VA 2W60B 4G8EB 5FUZL 1F6LL 5JPNB 1CDIA 5MEQA 1ZGLM 4WI2A 1IAOB 2XYCA 2QQLL 4FG6C 5IEHB 3KPSB 3F7YB 5L8LB 3WHXB 2W9DH 3IKKA 3REVB 1G6VK 1D5MA 4ONGL 4PJXE 5DEGA 4CU6A 1B0GA 1HNGA 3SE9H 4OV5B 2C3HA 2EDOA 4F80A 1FNHA 4DTGH 4DKFL 4LCWB 2WUBH 2VB5A 1HYSC 1EEUA 4Y1AB 1NUFA 3R06A 1RJZB 1T3FB 3FCTA 4LSDA 4J3WA 5DHVB 1JTTA 5JOFA 3U9UB 1U8NA 1T1WA 3MOAL 4CW1B 4ORGB 1RURL 2BVTA 4FG6D 2I9LA 4HMCA 5CEYB 1FV1A 4LF3B 5T1LA 1JHTB 3OF6D 2JCCE 3JTSA 4JFYA 1YMMB 4TUJA 3VXRB 2K3TA 2FR4A 5C0AE 3RKPA 5GGRB 4LLDA 1E4KC 3G08B 1DBKL 1Z3GL 1HYSD 5I74B 1D3CA 3IXTB 1IL1B 3WO4B 1I9IH 2JJTC 4KK6C 4Z0XA 1I8KB 1SQ2N 3NPZB 2GSGA 3WJJC 4TVPH 4YBLC 3HI6L 1GSMA 2MTPA 3G5YA 1JYVA 4NKDA 5C08A 4ZS6C 3PWVB 3MFFB 4DZ8B 4HUUB 2V5MA 3G5YB 1L6XA 4UT9H 3X3GH 4E9LA 3KXFB 5IEKB 1LO0L 5E99H 1MEXL 1LP9E 3BKCL 2GSIA 1J8KA 3DBXA 3U9PL 4XVTL 4WV1C 5D71L 2GK2A 2GSIB 4GG6E 3NCYP 5HDQH 3V4UH 3QI9C 2Q8BL 3MUJA 1NAKL 2EE3A 1YEKH 3MJ7A 1KB5B 1MCJA 2VZOA 4GQ9H 1S9XA 5FYLL 1MAML 1LO5A 3KAAA 3BD3A 4HUXA 1PKQB 4KUZL 3CAFA 5SWSE 1LDPH 1TDQA 3QH3B 4GKSB 1MWAA 3UYPA 4UQ2B 3MRCB 1MCKA 1I8MB 1UG9A 3MA7A 4HWBH 1ORSB 1DE4B 3E1F1 5J12C 1MWAB 3VXQB 4ZS6D 2P5WE 2XWJA 3BPOB 4RFNB 5CZXC 4F9PA 2GT9B 2P24B 5I1IL 4YX2L 1I1YB 3E6HB 4NO0B 3MV9B 3UTOA 1NBVH 2IQAA 4BH8B 3U4AA 2ZUYA 1MFNA 1SEQL 3OX8A 4RRPA 4S2SA 2GUOA 2P44B 3L6FB 3CDYA 3QI9D 4LHQB 3V0WL 1T6VN 2NY6D 3CK0L 5FV1L 5CEZL 4FZEH 2PKDA 4CAGA 5JQHC 4HIJA 3MBEC 1HHJB 3FAXA 3HNSH 3MJGX 3GNMH 5C0JA 1WTLA 4J7RA 1DLFL 5C0DA 1GGBH 1GZPA 1IKNA 1NC2D 2D0GA 2DKSA 3AY4C 1CN4A 3ZE1F 4G8GB 2W9EH 3DVFA 5JXAL 3WJLC 5CZXD 2NX5D 5D2NE 5T3XE 1UEMA 4JFPA 1XH3B 2Y9RT 3BZEB 4OLWH 2DMBA 3N1GC 2BSSB 1X4ZA 2XWBB 1MOEA 2X89D 4P3CL 2GKIA 4HV8A 4OCLC 3MR9A 3QIBD 4AEFA 5J6GB 3MBED 2I27N 5FUZH 1YNTB 1NFDA 5D6CA 5IIEB 1RMFL 4JHAH 1HHHA 4R4NC 2XXMB 2GTWB 1Y6NR 1NEZA 1HWGB 2YWYA 4OF5A 1HKLH 2EIBA 4ONGH 3BUYB 4CMHC 3OAUL 4Y5VA 5GXBB 4L4TD 3DVGA 2VLKD 2MJWA 3TNNB 1G7HA 4R9HA 4ZYKA 1P2CB 1OP9A 2HN7A 1BMGA 3MRRA 2H45A 3ARFD 4WRLA 4U6XA 3D2UB 5DJCB 3IU4L 3DV6A 4Z7NF 5IMLB 1D9KA 1TJGL 2BXZA 1CDBA 3G9VA 3L3HB 4JRYA 1FE8L 4YNYA 3EJJX 3EOBB 3MCKB 2IPUK 4DGVL 4F7MB 5L88H 3QFJE 3MO1B 3DSNA 1T4KA 3MOAH 1I9RH 3TBSA 1J8HA 4JHBA 3IDNB 1RURH 3VG0H 2VDPL 4DOHE 5KSVB 2Z8RA 4K7PL 4JKLA 1CIUA 4NKMB 1AGCB 4AMKL 4MJ6A 2WLZA 3SCMB 3I2CH 4D9QE 1MCDA 5EO0B 4M48H 1E27B 1GGIL 1XGYL 3V5KA 5GSVA 5D1ZA 4L1HA 4EXPX 1SJHB 2GQHA 2P7TA 2D7OA 5DLML 1OGAE 5MHSE 1Z3GH 1PKOA 4LARH 2VOTA 1A6UL 1QBML 5J1AB 1KENL 4KRPB 5FUCC 4NNYA 1JNLL 2HTLD 3ULVF 3HI6H 3EFFB 3NIDF 4Q2ZA 1V3KA 3JZ7A 1RUQH 1U3JA 2A38A 4WHYG 3D0LA 4MS8C 2VL5B 3BEWA 3WXVH 4L8DB 2EECA 1A6TA 4MDJA 3U4EA 1MEXH 2FRGP 4F33B 3CFEA 1HHIB 3ZZ1A 2BHZA 1AXIB 3IDGA 3U9PH 3MLZL 4XVTH 1G7JB 5D71H 3ULVH 1KFAL 4HUWA 2C9AA 1AFVH 3SO3B 3EW3B 4UINL 1AI1L 2EDFA 5D4QA 4U1GC 3TZVC 3FT3B 4PS4L 4HXAL 5FYLH 2P48B 1BQHA 3GMNB 2UWEF 1NDMB 3CFKA 4JY4A 5B3JF 3BQUD 4YDJB 2AQ3A 3D87B 5MEND 3C8DA 3EIFA 4KROD 2QV2A 2QL1A 4C56D 4MS8D 3CMGA 1BD2B 2BY0A 2I25N 1UKTA 5I1IH 1JGEB 4XP6L 4JRXA 4NQDA 2VMFA 4PRIE 5CLTA 2XWTB 4FFZL 4WO4A 4C58B 1VENA 1MCHA 2LTQB 5GGQL 3V0WH 2CIIA 4X98A 1GOGA 4PJFA 4HGKC 2ATPA 3U1SL 3CD4A 43CAB 3QUML 2JIXA 4EDXB 3QNZA 1I1AB 4DJMA 4ZPVB 3TO4B 1EHXA 1FN4A 4FOMA 1A3RL 2N7AA 3DXAB 2ESVA 2CXGA 5JXAH 2MCG1 1N5YL 1CFVH 4O2EB 4R0LC 1MCNA 2YC1B 5E2TL 1EXUB 2M1KA 4HGWB 1M4KA 4MJ5B 4IIQB 1RZJC 4XXDB 1RFDL 4XNQB 4P3CH 3UTPE 4IMKA 3QUXA 1GVIA 2G9HB 3NZ8A 3V7AE 4FA8A 4G7VL 2HFGL 4DZBA 2IPTH 1U58B 1UM6L 3PWPD 1CF8L 4TN9A 1MI5D 4XZUA 4YHKL 2OI9B 5EU6B 4Z7WE 3QRFM 1CL7I 2Z91B 1OAZL 1JPSL 4GBXB 3DYMA 5F7MC 4D0CA 3AREC 3OAUH 2UWEB 5E00A 3DPBA 5F9DC 3ARQA 1JN6B 1ORQB 1U8MB 5EO1A 1DL7L 1L0YA 3VFWA 5FKAB 4FQJH 3H3KA 2VZSA 1DN2A 3IU4H 4UDUB 3FO9A 5ITFB 2R1YB 5D1XC 3G6AB 4DGVH 1VERA 1QFHA 3I84A 3V4PH 3L7FA 5HYFA 4HG4J 2PR4H 1JP5A 3BJLA 4X7DC 5C92A 1KCUH 2FJFA 1BFOA 3P73B 4K7PH 4OAWA 4U2YA 4W68A 3ROLB 3G5ZA 4XWOC 3TF7C 5IJKA 5ACZA 2DBLL 4W6XB 4HX1B 3S37X 4PJEF 3OJVC 1KC5L 2FJFB 1BWMA 1GGIH 2NLJB 3V52L 3ARED 4BSVB 2EKSA 1MHEB 2ADIB 4I3RL 3BE1H 4MWFB 4TUKL 5A2IH 4CADB 4PGCB 2IAMC 3MRQB 2ZOKA 1BJ1H 5CD3A 2VLJB 4LSSH 4C59B 2JJSC 1QBMH 4OI9A 1KENH 4PJAA 1AQKL 2ICEA 3F5WA 3QXAA 4P99A 5FIEA 5C8JA 1S5HB 5C0EB 1M7IA 5F96H 3T2NH 3HUJA 5C8JB 3KYKL 5GGVL 5B38A 3U0WL 3CFBA 2FBOJ 1YEHL 1SJVA 5CGYC 4N9GA 5HXMA 3ISWA 3S3JA 3VMNA 5ISZA 5KSAA 5BRZA 2HLAB 1KEML 2R0WL 3KPNB 3VI4F 2FYYA 2IAMD 4L4VA 1AI1H 4H8WL 4OZHA 3RIAF 4F7TB 2FYYB 2NY1D 4LVHB 5DA0B 3TESA 1QSEB 4XCYA 5DJAB 1S9KC 5DK2B 3BP6B 1H3UA 5DJZA 3VXMD 4BQ9A 4L9LC 2C1OB 1IFHL 3C60C 4JFDE 1FG2B 1KXVC 3BZFB 3L3IB 1UH3A 4Z7UF 2YD1A 1OD7A 5CGYD 3P30H 3BDYH 5I66B 2QHLA 4XP6H 3V6BR 3P0YL 2YHGA 4LSRL 3OR7A 4FFZH 2FX7L 3KWWB 1CGYA 3HMXL 3MLSL 2ITCB 5DJ8B 3ROOB 1NFKA 5GGQH 3U36A 4XNXL 1AGFA 5EWIH 1CLOH 1Q9LA 1DBJL 3QUMH 2OR9L 4OLUH 3HG1E 1RVFL 1FHGA 4JN1L 2DD8H 1CLZL 2I9TA 5GS0L 1XIWC 2P5EA 4N5EC 2XZAL 1IGYA 5EFIA 4K94H 3K8LA 3HKFA 3D0VA 3RY6A 2DLIA 4OZFA 3VWJA 5C6WH 1KTDA 1BAFH 3QWRD 4WW2A 4DN3L 1G9MC 4ISVA 1BZ7B 1U8KA 2H2PC 3AS3A 4JFFA 3B3IB 1W72A 3SKOA 3BW9A 3KHQA 1JZ3A 4N68A 4LU5L 4ESKA 3UJJL 3UYRH 2ZUQB 3BW9B 4G7VH 5MP6L 3KYOB 4GSDL 5H37H 3QULB 1LE9A 3V6ZB 5DQJB 5DYOA 1RK1A 1UM6H 1XIWD 1LO3H 4N5ED 2XN9B 4YHKH 5DRNA 2Q3AA 5IB3B 1I9JH 2X9YA 1OAZH 1J1XH 4P48A 2A9NL 3HC0A 3MRLB 2YKLL 5ALCH 5EPMA 3VXNA 4ZAKA 1U3HA 2H2PD 3T0BA 5F8QC 4IS6A 3FRPG 4OLXH 3S7GA 4NZUL 4XWGL 2BDNL 4Z7QE 3QUMB 2AJ3A 5FO7A 4ONFL 3VXOB 1F4HA 1E6OH 2WK2A 5FXCH 5D93C 3QUYC 2Q86B 3STZB 3CDCA 4HS6B 5DJXB 1G6RL 2XFXB 5H35B 5EBLA 4R8WH 2CDGB 1G7MA 3ESVF 2XT1B 3BOVA 3L9RA 2DM3A 4E41D 1J5OH 3NFNA 3B9KC 4K8RL 2DBLH 2NZ9D 3L9RB 1IC7L 2B5IC 3TVMA 1KC5H 1B0RB 5IJVB 3V52H 4QHNA 4D9RD 1JZ7A 1BF2A 4TUKH 1AXSB 3QNYB 4M5YL 4LLYA 4Q6YA 3QCUL 4QRSB 2F58H 5KS9B 2W65B 2AXFB 3EGSB 3H2WA 3IU3B 2J4WH 5I19H 1J12A 1DBMH 3QUYD 1AQKH 1CE1H 2H9GB 1F4YL 4M7LL 5E2WL 5DD3L 1J05B 3HFML 3CDGA 2Q8AH 2PYEB 3KYKH 1U8OA 4NFCA 1SJXA 2IBBA 4QXUL 4JO1L 3KVQA 5J9PA 1DN0B 3SDCA 3SY0B 1JTPA 1P4LA 1AD0A 2NW2B 1MRFL 3RTQC 4JY6A 4AEEA 4XP4H 4JDZA 4RDQG 4KDTA 4Q74A 1PZ5B 5ESQA 1YEGL 2K1MA 3ME0A 4JDZB 3UTZA 3BJ91 3FOMA 1LD9B 3PP4L 3EZJB 4UMGA 1U8HB 5I1KH 3RAJL 3MUZ1 4H8WH 3CSGA 2YPLD 2XQYG 3DUSB 3MRDA 2WINA 4IRSB 1T1XB 1Z0MA 4K3DL 3PXHA 1CFQA 2MWCA 2X4RA 1S7WA 4YBHA 5JW4Q 2NTFB 1FL5B 2F74B 2YRZA 2DL9A 1U8QB 2BSTA 1F13A 4ODVL 1DQLL 3T0EC 4F3FB 4MNQA 3QDMD 2BNRE 1W8NA 1IZKA 1OTTC 3H9SE 3S3SA 1VPOL 1OQXA 3P0YH 4ODWA 4P5TC 5E8OB 5F8RC 3RGVB 3T4AB 3RTQD 4LSRH 2FX7H 4EOWL 3MLSH 2X4TB 4JDTL 5EA0L 1I3VA 3O81A 4XNXH 2ADJB 1NFIA 2CRZA 2ITDA 1DBJH 5T5NF 1R3LB 1AD9A 2XA3A 4NN6B 3NBNA 1NFIB 3UC0H 4PG9B 1UB5B 3KDMB 5FHBL 4JN1H 3VMPA 4F15B 1CLZH 1T03L 4Z5RA 2XZAH 2X70A 4G6KL 5D5MF 2CK2A 4O51A 4JZNB 3T0ED 3BPCB 1KPRA 2ZPKH 4W4OA 2EDWA 4HJ0C 5ESAA 5C09D 2CUHA 5A16A 4P5TD 3D9AH 4N0RA 3T0VA 3TA3C 4GQPH 4U1KB 2F8VA 4XBPA 4CN4A 5SWZD 4YEEA 5F7DB 5LBSL 4LNRB 1BFVH 1ZWIA 4HWNA 3MV11 1DDHA 1H0DB 1CL7L 3OQ3B 5HYJD 4G43B 3VFNB 3TBTB 1IEBB 2A74A 1DANT 3CH8A 3HMXA 4JQVC 3SKJL 1WICA 3OKNA 1N8ZA 1S7QA 2YKLH 5IW6A 1A9BA 1I7ZA 3BKJL 2D7QA 1GGUA 4KXZI 4JFXB 3TA3D 3DMMB 4MAUL 2BDNH 1ZT1A 2SEBA 3C87A 4JE4B 2XNAB 3PL6A 2AJUL 3FFCD 3S35L 4CMMB 1JNHB 1U8JA 1E4JA 3PL6B 3VFOA 1DANU 2YUZA 1FVCB 1F45A 2R2EB 3VFOB 1ZE3C 1R3KB 3OR6B 1ZT7B 3FONB 4K8RH 5EOTA 4P5KA 2F53D 4WEBL 5ITBH 5LXGL 4JEGB 1IC7H 2IF7A 4P3DA 3TIEB 4O2CA 4F9LC 4A6YL 4IHOA 5E0QA 5F21B 4L29A 4JN2B 3PF2A 1KB9J 1WZLA 1A6ZB 5D5MB 1RIVH 1I7UA 3BYTA 3QCUH 3QIWB 4NQDE 5EDXA 4KJYA 4OUUB 3TIDA 4L4TE 2VXQH 3FQTB 3W2DL 4A2LA 4MB5A 2VUOA 1F4YH 4M7LH 5CIPH 5DD3H 1EAPB 1JGLH 3HFMH 1KT2B 5IVZB 2WBWB 4I2XB 4JJ5B 5D72H 1KYOK 1CQKA 5GGUB 4D2NA 2DQGH 3BFOA 3AB0B 3OG4B 4DKDC 4HZLA 1VKXA 5CAYB 5L2KA 2F5AL 3RWGA 5CSZB 4Y8DC 1MRFH 1OTSC 1MNUL 1TCRB 2ESVE 2XTLA 3PGDB 4FQQB 5DMJB 1Y6MR 3BZ4A 5JORA 3C6LC 1P53A 1G6RA 2ZJSH 3PP4H 5IBLC 4FQPA 5BVJB 3T2PA 4J12A 3UTTB 4C55A 3GSXA 4XP5L 2EYSA 1MCFA 5GQBA 1KBGL 3QEQA 2ATKA 1YEJL 2DB8A 2OR7A 3KJ4C 4R90L 3HB3D 4QHLA 3RWDA 4CJ0A 2X4NA 3G04B 5GRVK 4U1NB 3QZWA 5C0FA 1DQLH 2AEQL 3A6BL 4Y5XB 4X0KA 4KZDL 1U42A 5IKCB 1IAKA 5IWLA 1NGZB 3IFLL 4DK6A 4XB8A 3WE6B 2X4PA 1A7PH 1OTSD 2UYLB 4ZSOB 3SGDI 4RAVA 2KL6A 3IAQA 5HYQA 1CDHA 5EA0H 1S7SA 4XVUC 4I1NB 4RAVB 4X6CF 4XRCB 5I18L 5IBLD 5CHNA 1HOCB 2DIAA 3IDIB 5CIPB 4H88H 4LQ1A 1ZTXL 3ULUL 1T03H 3DWTA 3OB0K 5EG6C 5CEXA 1VFBA 3RX7A 1J1OL 3VGBA 1KLUA 1SM3L 2XA8H 2DYPB 5CILL 5GS2D 3SKUD 2Q6WB 4P2OB 5HHOB 5CBAA 3FN3A 4NQUA 5GRVL 1ZLVK 5FUCE 4UIKH 5L6YL 5MENE 4HLZG 4C56E 1XGRB 5FA4B 3DX6A 1T20A 5LBSH 4FMFA 3WN5B 1N5AA 4FQXA 35C8H 1UT9A 4XBGA 1I3GL 4GKNB 4Y16B 2FO4A 1JZ5A 2YMXH 1CL7H 1NMAH 2FD6H 3QEHB 3ULSA 2XKSA 4J3SA 2F15A 4PJAE 3OKMA 4PJBB 2PW1A 2X4SB 5EN2A 2XZQL 2QKIB 1J1PH 2Y7QB 4R26L 5D6DC 3RWEB 8FABA 3BKJH 5EOCH 1SY6H 2R56L 4BUGA 5IVXF 3IKCB 3TLRA 5FEBA 1K9TA 1WC7A 4MAUH 1KXTB 5L0QC 3V6OC 4WHCA 2JJWA 2AJUH 2K7QA 1S9VA 4KJPC 5SV3A 5TE4H 5LWYH 3K2UH 5BZWA 4OZHE 3PDOA 4PRPA 1TVDA 3GKWL 3A0OA 2CH8A 2PNDA 4WEBH 4IDJH 3W0WA 5JMOC 5F93C 1KIPA 5D2LF 4QYOB 5K93A 3RY5A 12E8H 3WKNA 3PWPE 3QDGA 1S3KH 3P9LA 5DO2C 2XXCB 1T1ZA 4WUUB 4Y4KA 2BC4B 4RQQB 3L3DA 1JZ8A 4Z8FH 1V7ML 1WCBB 4GAYA 1GIGH 4OI8A 1MFBH 1SYVA 1ZHBA 4LPWA 3UXFA 2DKUA 5E4IA 5K59E 4PGZA 1IRAY 1MJJA 1G84A 4EXKA 3BXNA 4LCWD 4JZOB 2J8UF 5IV2A 4PGBB 4Y1AD 1A7BA 2CUIA 1I4FA 3WO4C 2Z35B 2VDOH 2GITB 2J5LB 3FQWA 1U92A 1MNUH 2EDJA 2OTUA 3VXUB 5DO2D 3O3UN 2VQ1A 4OI7A 2AEPL 4X7SL 1BHGA 1Q72H 2VQTA 1YMMD 3F12A 1NDGA 3VXRD 5T1LD 1YEIL 3MZTA 1KBGH 4P4KA 4PJ7A 3U0PB 2OCFD 4U1HA 4M6AA 4PJDF 5IVXB 2BRRL 2O61A 4R90H 4A6YA 1DUZB 2B2XL 5E03A 4BZ1L 4GAGL 4U1LA 4X8XA 2AEQH 1WIOA 4U3HA 3A6BH 5IROA 3LN5A 4KZDH 4PB9L 1VSCA 3PJSA 2HKHH 4ERSL 1UCBL 3IFLH 1CXEA 2HFFB 3JV4B 4G9FA 3IDXL 4PRHE 2ICWI 5AUMA 5ENWB 43C9B 5J89A 4QRUA 4NP4L 3BPOC 5J13B 4RFNC 5LG1A 1AHWB 3CC5B 3KXFD 5D2LB 3QHFH 2CK0L 1XF2A 2HT3C 4LPXA 2WUCH 3AAZB 3NVQA 1DLHA 1ZTXH 3ULUH 3RPKA 5F9WC 2HJLB 4MNGB 4ALAL 1XF2B 4O2FA 5E5UB 5C1MB 5F1KC 1J1OH 1T0MA 5FCUH 3BSZL 5EH1A 1SM3H 4OFVA 3CJJA 5CILH 2AXGB 1QZ1A 2RAMA 3U83A 1E28B 1F3RB 3FOLA 3MGTB 4BFGA 4MZ2A 3VRJA 5HD8C 2CLZA 3DVNA 1B9ZA 4A2MA 5L6YH 3GMMB 3VXME 4GO6B 4KI5C 4NQEA 1P5UA 2HJFA 2VR9A 2Y5TA 3VFRB 4TUOA 2W0KA 4ZUSB 4L5FL 4M9PA 2V2WA 5SX4I 1QSFE 1G9NC 2VUYA 3W9EB 5E6ZA 2RCSL 4NO0D 2HT3D 3MV9D 4K55A 3L3KA 3MUY1 1LEKA 1HEZB 3OKDA 3ES6B 1F11A 5CP3A 5HY9A 3D18B 4U1IA 3EYQC 4HHAB 4MQXC 1Z9MA 5HHPA 1EGJL 2ZP0T 3RU8L 5F6IC 2XZQH 4W70A 4TVPD 4QRTA 4ODUB 3JV5A 3L3OB 3QQ4A 5HD8D 4R26H 1P7KA 2EXWD 5IB5A 2DI7A 2X5PA 1CG9A 1IGCL 1MREH 3IJSA 4PJDB 1VEPA 4J23A 3RNQA 2WP3T 4KI5D 3KYMB 4UUJB 1G7LB 1ZLVH 1U93A 4CDGC 1NCCL 3C2SA 1LGVA 5CP7A 1AQDB 3DARA 5F6HJ 3VFTB 2Y4SA 1Z5LA 4QRRB 5ERWA 5KSBF 3PE9A 4Y2DB 4Y5VC 2EDRA 4MD0A 5I8CA 3TFKC 4KFZC 5EIIB 3RUGF 3EYQD 4MQXD 4M43L 1PFCA 4TSAL 3GKWH 4OFPA 4OIIL 3PHOA 5HJ3A 2OX5A 2CLRA 3L7EB 4MGXA 1DBAL 1QR4A 1B2WL 2D31A 3PWUB 2Y07H 4PY8I 3PHOB 4MNQE 3HAEA 3V8CA 4MQTB 2YPVL 3QG7H 4M1GH 3PGCB 4ELMF 4ZUVA 2VZTA 5C9JA 3ARWA 1H8OA 4XCEB 2JCCF 1V7MH 1NEZG 3DX9B 3OGCA 1OWWA 2EDYA 5J11B 3I02B 5TDOA 4LHUB 4I48B 5D1ZC 1XCQB 5HYSA 1JK8B 4OF6A 4OGYL 5HPMB 2CR6A 4OCMC 3OKLA 3D2UD 1BEYH 3TBWA 3X14B 3P4OA 2BVOA 2DLFH 3LKNA 5EUKA 5FYJL 3IF1A 5FKPA 1M05A 1YYLH 2BCKB 5T3ZL 4POZD 1QSVA 7FABL 5E8EA 2ZUSA 3VFMA 3I50L 3LH2L 3HI1A 4YLQT 5C0BB 4X7SH 4Y19A 5DURB 3SCMD 1MQKL 3VFMB 1C5BH 4WI7A 1LP9F 4M3JA 1YEIH 4D9RE 3HPJB 4F57L 4JFEE 5DZNA 3RZWA 4GG6F 3JWOC 3E2HB 5DJ2B 2BRRH 2J8OA 2Y1VA 2B2XH 3U7AA 3CX5K 1I3RA 4GAGH 3X13B 2QSCL 3FO1B 4PJIA 3VDAA 1A3QA 3PV6B 3ZYJA 4LPTA 4PB9H 2B1HL 2QTEA 2XZZA 3ILQC 3OG6B 1EEQA 4ERSH 4YPJA 1GHFL 1CDGA 4R2GB 1N7ML 5FO9A 4XNYL 1DEEB 4JCLA 3G6JE 3ZKXC 3CU1A 1I1CA 3IDJA 1ETZB 4NP4H 4FTVB 1EMTL 4JCMA 4G9DA 2OSLB 3MRHB 4EKXA 2DBJA 2D7PA 1RZGA 5E9DA 2CK0H 2H1PL 4KGLA 1NAMH 3ZSSA 5TDNB 2EDDA 2NY4B 5FDWB 1OM3L 2EDHA 1P6AB 1ZHNB 2LTQC 4ELMB 4LSVL 3QFDB 3SQBA 3BSZH 4WO4C 4EI5B 1CD0A 4XH2A 2KQNA 5IBUB 4JDVA 2YPLE 4HXBL 2ERJB 3UO1L 1I1AC 4UBDC 5DD6B 2ZSWA 3TO4C 3U7WL 1NGXB 4P46A 3GB7A 3SE3A 4RA0C 2EC9T 1ONQA 3U46B 1ZGLB 1GRWA 3VXSB 4KK8C 5HGDA 3BIKB 1CR9H 4R7NA 2A1WL 2GJ6B 4KK9C 5DRWB 1QLFA 1WZ1L 2X1PA 1QFWM 4HK3N 4MAYB 2VDRL 5F89B 4YXHL 2XG4A 3MLRH 1HHGA 2R2HB 4W6WB 4N0YH 1FZOB 4XVJL 1EGJH 4IMKC 3QUXC 2OLDA 2VDML 4ZFZB 2EC9U 4ZD3H 1TJIL 1A4JB 1I1AD 2BMKA 4KXZH 3TO4D 2H3NA 2OI9C 3MJ9L 5EUOA 1BJMA 4UT7L 3T0DA 3DXAD 3MLYL 3SKMB 1NAMB 4PLJC 1BVLB 2YWZA 3O4LA 2YSSB 5EO9B 1NCCH 1JIBA 1NCTA 1RUAH 4OQTL 2Y36L 3MUGB 3DRQB 4Z7VE 4NIKB 4JG0L 3X3FL 3GMLA 4YHYB 1RK0B 1CFTB 2GK0A 4WW1B 1JJUA 2APWA 3QEQE 5FYLD 1WBZB 3BRDA 4OIIH 1FIGL 3IXAA 2DQJH 2ZUWA 4IRZL 1B2WH 4NRYB 4UU9A 5C7XL 1SVZA 3R0NA 4PJGE 4ZTPL 1FO0L 4V1DA 3VFPB 5JUEH 3RHWK 5EU6D 5HYJE 3R1GH 4GBXD 4XMLL 3RL2A 3KPMB 4PLJD 3WLWC 1YPZE 1TJHH 2LQRA 2A0LC 4F2MB 5BS0A 2ADGA 1MIEH 5CEZD 3LKPA 3F8UB 1JPST 2NXYB 4JHWL 3SEPA 3WNNA 2YD4A 4R4BA 3WS6A 1NBYA 3LKPB 5DR5H 4LIQE 5EORL 4JAMB 5CCKL 4K9EL 3KYAA 5FYJH 1FORH 5D7IB 4WWID 1VHPA 5T3ZH 7FABH 2VWEC 3O9WB 2AEIT 3NH7L 3I50H 5IFHH 4GRLB 1F02I 2WNGA 1MQKH 2E7HA 5HGBA 1INEL 3WLWD 2AKRA 4WY7H 4F57H 4Q6IA 5HGBB 4NQCB 2A0LD 3DGCR 3LD8B 3NAAL 1R24A 5HSFA 5KSAC 1NMBL 4QHKJ 1UWGH 5DD1H 5IQ7L 1CGTA 4YAQA 2A6JB 1N0XL 4HF5L 4XMKL 1F8TL 1FVEA 4LVHC 4U1SA 2HH0L 1N7MH 3MNVA 3MRNB 4S1QH 1LE5B 4XNYH 3F62A 4F7CB 2P46B 4X9GA 1XGUA 3AU1A 2LFGA 4P9HH 3TV3L 1DCLA 1EMTH 3I75B 1UYWH 1CXIA 1ZK9A 3L5HA 4XVSH 1WAAE 5T1KB 3L3GA 1NBZA 4P23B 4LSVH 4QOKB 3SDDA 3VDCA 5BRZD 2DQHL 2VKWA 2I07B 3NIFF 1YUHA 1A21A 5IB4A 4IBLT 1AIFA 3MLTB 4HXBH 1JV5A 4JLRB 4XCFL 2VLLB 4HBCH 4PRPE 3UO1H 1QSED 4NRXA 5C07A 1K3ZA 5IB4B 1JV5B 3U7WH 5DJYB 2Z0BA 2AI0L 4X4XB 3BP4A 1FVDB 2MQ0A 4I3SL 3VRLE 3QCVL 4N1EA 4D0BA 5E7FA 4M61B 4L8BB 3AM8A 1NC4A 4U6YA 2JK5A 2LE9A 4N0UB 3EOYG 1RJYB 3MRJB 3RY6C 4PJHF 3ET9F 3VWJC 1UQSB 4XT1C 1KJ3L 1OAYH 1WZ1H 4LVOB 1JGVH 3UDWA 1XGPB 2P8PB 3EJYD 3H9HA 3VE0A 4XVJH 5E2VL 3DIFB 3KPOB 5CJBA 4D9LL 3GJEB 1XF3A 2IPUG 3U2SA 5C70A 1TJIH 5IHBA 1BREA 1TZHB 4HC1H 1T5WA 1LO4H 2JTDA 3FT4B 2FB4L 4X5XB 3MJ9H 3VXTA 5ETUA 3MLYH 5DFWH 2P5ED 5IQ9A 1AY1L 5C0CA 3X17A 4OZFG 1ZHLA 5TQ0L 1U8LA 4PR5A 5A43C 4CUCA 4I4WA 2J8HA 3EYOA 4OJFL 1HXMA 1R5WB 2FHFA 4JG0H 4L8SA 3X3FH 2R1WA 1U3HC 4JFFD 1A1OB 1T7ZA 3HE7B 4JPKH 1FIGH 5F7HA 3C08L 4PRBA 1Q94B 4P59H 4N8VB 4Z77B 5L2JA 4K71C 3MV8B 4ZTPH 3PQYA 2X4QA 4MZ3A 1KIQB 2XN9D 4G7YH 1IARB 4LEOB 1LWRA 4FFVC 1KPVB 1LQSR 5JA8B 3CUPA 4G9FE 1ND0A 1WBXB 3MJ8B 5GRUH 4QCIB 1NLDL 5TH2B 2V7NB 3VI3E 1EFXB 4ZO6A 1P7QB 3OJDB 2VXSL 3U4BL 4BYHA 3O3DB 1F6AA 4OKVB 1RHFA 2E6QA 1AO7B 2WV3A 4JHWH 4ZQKA 3R8BB 4J3TA 5EORH 4FRWA 5FA3B 1YY8B 4K9EH 4PJHB 4RWYL 3O0RL 5IW1B 5JW5B 5E8PB 3UEZA 4ZNEA 1KNOB 2AQ1A 4F7PB 4S1SL 4H25B 5F9JA 3LKSA 3PWJA 1T04B 3NH7H 4OQTA 4KUCD 2Z31B 1V05A 2PXYB 4FFVD 4UV7L 3LKSB 2IANA 2FEEI 5SX5K 1INEH 1G0XA 3CCHA 2Y6SC 3DTXB 3IRPX 3ARTA 2IANB 2RB8A 5B21A 1CVSC 4L3EA 1TQBC 3RX5A 2FIKB 3O41A 3KPSE 1JWUA 4KDTC 1NPUA 3BP7A 4PJ8A 5IQ7H 5D70H 1FO0A 4XMKH 1F8TH 1HH9A 1K8IA 3OMZA 4OFYA 4IRSC 1JWUB 1CS6A 1DVFB 1R5VA 4PJEA 1H3PL 3IGAA 5INDA 3RZCA 4HSQA 1XGQB 1XFPA 3S4SA 3BEVA 1A4KA 2PYED 4IMLB 3DX8B 2CDEB 4LCWE 3TV3H 4AM0A 5B8CA 4E5XB 5JW3L 4Y1AE 2AV1A 3LN4B 2VXTL 4Q0XH 4K7FB 1QLRB 4LCUA 2AJSL 2Y6SD 1F4WL 4JFQB 4ZNCD 4J8RA 3W81A 4M7LT 1K85A 1C08A 4QHUA 4IRJB 5FGBC 5E6IB 4BH7A 4YQXL 3RPIB 5I8EB 1ZANL 2R2BA 3GJFA 4KQ3L 4LQFH 1RU9H 4HUNB 3CLFH 4ZPTA 1YMME 3G5XA 1CE6B 4XCFH 4BSJA 2FCBA 4IRSD 2E6PA 4HW6A 3ARBA 5CS7A 2AI0H 4HEPG 4I3SH 3EKCA 3QCVH 1OOAA 4NDMA 5SX4H 5FHAL 1CD9B 3L5WA 4QY8A 4TNVK 4ZXBA 2Z9TA 4XGZA 1U95A 3LPFA 1A7QL 4G3YL 5J6HA 1EERB 1MLBA 1DQQB 4H8WC 1HHKB 4P2QB 2PTVA 3CFDB 4HULB 3D39B 3MRGA 1K2DA 3GMOB 3VJ6B 5E2VH 2EKJA 3KXFE 4D9LH 2ICWB 3QXUA 2FWOB 1UZ8A 3OSKA 3LMJH 4I13B 5H2BB 3SHSA 1S7VB 3FHAA 4Z7UA 1CBVH 3QSKB 4TPRL 3O45B 5HI4C 2YZ1A 5JDSB 1QO3B 4LGPB 1OVZA 1U2HA 4F37K 3UTQB 4PJ9B 1XR8A 3TM6A 3O3EA 1A3LL 1K4CB 1S9WA 2A9MH 2VC2L 5B39B 5TQ0H 1KTKE 4YR6A 4Y4HB 4EBQL 4ZOBA 3INUL 3V6FA 4YDVB 1XAUA 1T7XA 5JIIA 3DMMC 4GW1B 3RWHB 4Z7QF 1CTOA 2CD0A 1RHHB 4CL7A 2R39A 3M8OH 3FB8B 4KMTH 1J10A 4U0RB 4NNPL 1FPTH 3C08H 4PP1C 4MA7L 5GS0C 1U8PA 1YJDC 4NOFA 1JI1A 5E6YA 1INQA 3PL6C 1FZJB 1FNFA 4JM2B 2P45B 1N6QL 5HI4D 3OHXB 1IGTB 4KY1H 2D4DA 2Z8SA 2VN7A 1KN4L 3NZHH 3RWJB 4TVPE 5CBEA 1A02N 1NLDH 2X1WL 4X5LA 1BX2A 4KI5E 3DMMD 4I8DA 1MHHA 4OGAD 3M17A 4ZOAA 1TTFA 4G8GE 4MXWL 1JFQL 4PP1D 5GS0D 4RWYH 1U2CA 5DVNA 3O0RH 4NT6A 3SBWA 1GYAA 3PL6D 1JYXA 1TVHA 3WFHB 4HUMB 2WBJB 3CZJA 4UILL 4WI3A 5IR1A 3ARDB 4UV7H 1CFNB 3AB0C 4FQHB 4JZJA 2VR5A 3MNWA 2W0FB 3H0TA 3BH9B 1ZOXA 3P77A 3TNMB 3X12A 1QEWB 3P11L 3WNPA 3QO1A 1L9MA 1TITA 1MLCB 3BRFA 3MROA 3L1OH 1ED3A 5JHLL 4DEPB 3QIWD 1QPPA 1M71A 3C5ZA 4QT5A 3LV3B 3O3BB 3VFGL 1NJ9B 1M7DB 1H3PH 4K8RC 4OZIF 3WFDL 5JW3H 1UJ3A 2O5XL 3W5MA 3ETBF 4D0DA 5I1HL 4NJAL 5HGAB 2VXTH 2CR3A 1EIBA 3ARVA 4U49A 3WDHA 2AJSH 2BNUB 4GW4B 5JIKA 3DO7B 4AH2B 5IWLC 4YQXH 3O4LE 5SX5H 4DGYL 3DYOA 5ID0B 5F3HA 4UQ3B 4M6MH 3MBXL 4XP1L 3WYRA 3UTTD 1FFOA 1G7PA 3QXDA 3LQAL 3LSOA 2DWEA 4P0DA 1HWHB 4TTDC 1D6EB 5LQBL 4K8RD 2J7LA 5BQ7A 5I71B 1LEIB 5TF1H 2AJZA 3ZE1E 5E70A 5FHAH 3D3VE 1BOGA 3HI5H 2W0LA 4P2OC 4S0TD 4UAOB 1MCSA 4M7KL 4X7CC 4V1DE 1RZ7L 2DOCA 2J6EA 4G3YH 5EBMB 1EAJA 3C6SB 3EYFA 4DAGL 5TE6L 5DXWA 1S8DA 3WIIL 2NY7H 4ONHA 3FQNB 2HJKA 2EH8L 4HUVB 1VFUA 3O8XB 5FDYA 5A3ID 5BS0E 3E3QC 4HD9A 4R7DA 3WN5C 3PXJA 4PJ5B 4TNVF 4NWTH 3B8YA 4G80B 4TTDD 1V7NH 3HE6A 1HQ4A 4TPRH 4MCYA 1ULVA 5DJ0B 2DYPD 2BNQA 2VC2H 3IJYA 4P2OD 5HHOD 3UTSA 2HG5A 4GKZB 5HPOA 4H20L 4EBQH 4WCYL 3INUH 3GMRB 3JV0A 4NSKA 5IG7B 1PW3A 2OQJA 4OZIB 3PWLB 1I7TB 4LK4A 1ADQA 4M00A 4Z7NE 3KHOA 4E42B 2O5ZH 1T0PB 3BWUC 1BD2E 4KRMB 2BOCA 4LLQB 3LN9A 1M6OB 2HWZH 1A1NB 3ZLQC 3TYFA 5EC2B 3HCVA 4Y16D 5I1JL 1N6QH 4GOSA 2KQMA 4HKZB 4HIEA 3L5IA 2BVEA 1O7VA 1KJVB 1G1YA 1KN4H 2PW2B 3H8NA 4L3AA 2Z92B 2EXYD 3GIZL 4ZOCA 1QLEL 3OAYK 5BXFB 3DXAE 1UWXK 2P49B 3NCYS 2BSRA 3WDIA 1Q9KB 2BVPB 4Y4KC 4BUHA 4HWZA 1YDPB 4KI1A 1JFQH 4P2RB 2CXKA 2IH3B 5D7LB 5CFHA 4DFIA 3ULVE 1QNZL 1P1ZB 2A6IA 5DFTA 2H6PA 4X6EB 2AV7A 5FYLE 3K8KA 2H6PB 3QNXA 1U6AL 4QRPA 2J5LC 4YDKH 2NR6C 5DJ6A 5CJXC 3SKNA 4WV1B 4NQVB 4HFWA 3UROR 3AVEA 4WUUD 1RPQA 4Q9CA 5DSCA 5EU6E 1P5VA 2VABA 5A2KH 2N7BA 1BZQK 5FB8A 4PGJA 1CICA 3VFUA 2UWEE 3KLSA 3VFGH 4DUXA 3FFDA 2XKUA 4YEFA 5FB8B 2A6KB 4P4KC 1ZEAL 3WFDH 1T2XA 2O5XH 2OXGA 4YHNA 4P2CG 2J1KA 1HSBB 5I1HH 1JGDA 3HZMA 1QRNA 4LRIA 4JB9H 2DF3A 4MDIA 2NR6D 4NWUH 3VFVB 4OLEA 2VE6B 3FJTA 3MREB 4ZUUA 3C5JB 3VXUD 5JQ6L 1JPTL 2FBJL 4YO0A 4UNUA 5LGHL 4OM0H 1KCKA 2DMCA 5J13C 1CZ8L 3MBXH 3ZDXE 4XP1H 3BH8A 1JF6A 1NCDL 3LQAH 5IM7A 3SDXA 4JANB 3EO1B 2G5RA 5F9OH 1PAMA 1IILE 5LQBH 3W9DA 3O2VL 1YEEL 1JZ4A 4P4KD 1MHPH 4XP9L 4AEHL 3IDMB 4BZ2L 2VDKL 1IAIM 4JFZL 3PQYE 5IMOB 4M7KH 2VLJE 4I9WD 4WHYH 3BRGC 5EBWB 5KN5A 2Y5EA 4R96B 1LK2A 3WEXA 3ARRA 2E5EA 4DAGH 5CJOH 1I8IB 3WIIH 4BKLA 1ITBB 4GG8A 2YPKB 1CCZA 2CDFA 2WSKA 2IADB 1YEDB 3HZVB 3P40A 4ETQB 4G6ML 1DSFH 1S7UB 2P8MA 2HFEA 4X6DB 4YE4L 4YHIA 4DUVA 1KPUA 3QUKA 2YD9A 3T65B 4LVNB 5SWQA 4NQXA 4ZNEE 2BFVL 4CMHB 3SN6N 2WZPD 2EYRA 4X6CA 3MZGB 3K46A 1T1YB 3VGFA 3GIVA 1HSAB 4J1UA 5LCVL 3WXWL 3ULUC 5FV2A 4PFEA 4L3EE 1EK3A 2ARJQ 3B5TA 3MA9H 2R4SH 5CWSA 5BVPL 1NGYA 4OCNC 3V9FA 5FFLA 1UVQB 4U6VH 2Q20A 3S34H 2CGRH 2E27L 1IM3A 3LRGA 5HHVL 1RZ8A 4YPGB 4PJEE 5DVKA 1QBAA 2C3GA 3A6OA 2OJEB 3REWB 5GZOD 4MB3A 1PQZA 3RIFK 1XEDA 3RI5K 5K9KA 5INCA 2H32A 2FX9L 4HK0A 4ZFFA 3CNKA 3GMPA 2H32B 5J11C 3ULUD 3V79C 3GSOA 1S7RB 3P0GB 1YNLL 3C8HA 4U1MB 1GGTA 2CO7B 1OL0A 2C7UA 3NN8A 4O58L 1TZIB 4QRRD 1NGPH 4Y2DD 1QNZH 5DUMH 1NANI 1FNGB 2IFGA 5GGTA 4O5LH 1NGWA 4QHMA 2PTTA 1U6AH 3K80A 1I7RA 1R5IA 2Z93A 3R4DA 3HAEG 2XN9E 4HJGB 3QHTC 1RZJH 1J0IA 3B83A 3KPRA 4U1GB 3TZVB 3N85L 1XGTA 3HRZA 4LHUG 3WFCL 3OAYH 2E9IA 1NH6A 3RBSA 4NFBA 3BMWA 4OTXL 3LDBB 4LHUD 1UWXH 1PZUB 2WMPA 4ZUWA 4X6FB 4YGAB 1JF5A 5HYSG 1L7IL 1C16A 3PHSA 4GRMB 3SPVA 5HHQA 4G8FA 4Z7UE 1PEWA 1LNUA 3M1BA 4WGVB 1YQVH 4NHCH 2J12B 1OY3B 1AGEA 2RFXB 3GGWB 1M7XA 2VISA 1JPTH 5JQ6H 2G60L 4XPBH 5F7FA 3MYJB 5DS8B 1XF4A 1AGEB 2R4RL 2WIMA 1T5XB 3L5XL 2C1PB 3N0PB 1CZ8H 3I6LD 5C0BD 2CIKA 3T3PF 4J4PA 2VLRB 3EDJA 5DURD 2XQYK 4R3SA 1NCDH 3BAEL 5JHDA 1S7TA 5K9OB 5IHZB 4K23L 2J8UA 3P2TA 4X7FC 2NY4C 5DGRA 3BVNB 1MI5B 4QXGL 2GCYB 3O2VH 1AKJB 2D7MA 1YEEH 3GSVA 2DQFA 4QXTA 4XP9H 1ES0B 5JA9A 5J1SC 1ZA6A 2X42A 5GRWA 1X5KA 4BZ2H 4LL9A 3KLAA 1EH9A 1KJMB 4NN5C 2AK4B 5KS9E 4P5MA 2ERJC 5ILTH 5DEFA 4ODTL 4G42B 5M95B 3LIZL 5FYJU 4HEME 4ZDHB 5IB2A 2PYEE 1V3JA 4FTVD 3FN9A 4P46C 1ZHKB 2YA1A 2AJXL 3BO8B 4WTZA 3JVGA 1XZ0B 3S97C 1TNNA 5KOVC 3G5VB 4G6MH 1E4WH 2NY4D 5LAXB 1P4BL 2EDTA 4YE4H 1EDQA 2HT4C 3BDXA 1A47A 5IBUG 1H9VA 5IMMA 1GZQB 1ZSDA 1JMXA 2DJUA 3VGDA 2E7MA 2BFVH 5JOPD 3CXHK 2IMNA 3QDJA 4OCRL 5ANMA 4Q97A 4OD2B 5IVOA 5J7CC 4NNXA 1X5IA 1N59B 1K8DB 3EZ8A 4H1LA 5C3LD 4LGRB 4GJTB 5F1NA 4APQA 2VITB 3GUTB 3DSFL 5D1XB 4OQ1A 2FATL 3QXVA 4FQLL 1WEJL 4KHXL 5D7KD 4Y5YA 5BVPH 4H26A 3MV7B 2GJ6D 1P84K 3IFOA 3L5JA 1UGNA 1T0NA 1XR9A 2HT4D 4U33A 1CU4H 5HHVH 3S96B 1DZBA 3T4YA 1XR9B 5HDBF 5HHME 5EZJA 3QDAA 3NTCL 4KAQH 2AXHA 1AE6L 1OAKL 2FH6A 5D7JA 3DNKA 5MI0B 2DLGA 2X4UB 4ZO8A 2FX9H 3O2DL 3EOAA 1RJLA 3GSQB 2G75B 2A83A 1N3NA 1YNLH 4PREB 4XPFL 1VESA 3QQ3B 4O58H 4MXVF 4U6HA 4V2BA 3TN0B 1FC1A 1SYSA 3VCLB 5HI5C 1FP5A 1IGMH 4UNTA 4FQIL 4RMQA 3LEVL 3HMWL 3WKMH 1OPGL 3CSPA 3OKOB 4HKBA 1FL3B 5IB1B 1QFWL 1VFAA 1UACH 3S36H 3PHQB 4GMSL 4PJXA 3O9WC 1SBBA 3MGOA 4XB7A 1NL0H 3KJ6L 3S36X 4GRLC 5KSBA 32C2B 2HKFL 3N85H 3SE8L 5ADPH 4EN3B 3TPUB 2BSED 2G5BB 3LD8C 2QBWA 4L1DA 4L9LB 2FGWL 1G7QB 2XV6B 1L7IH 4Q6IC 3C60B 1IM9B 3W39A 3WLBB 1VFMA 4ETYA 2FJHB 5I8KL 5F7EL 3TBVB 1JUFB 1Y0LA 4D3CL 1L0QA 2AJVL 2JCCA 4PTTB 4Y88A 2FL5A 1FJ1B 2EIZA 2IH1B 2G60H 3O9WD 2R4RH 3KR3H 5C0AA 5CJ8A 4PJCF 3L5XH 3NFPA 4GRLD 1X6LA 3VH8A 1XT5A 3OGOE 4KH2A 4CVXB 4NUJB 3MRMB 2Z4QA 2DWDA 4K23H 5D9SA 3IVKB 4NQCD 1IEAA 2CKBL 4LP5A 1A64A 2ZSVB 1C12A 5D5ME 3HLAB 2B0SH 2EDBA 4RDQF 3OB8A 2F9BT 1RJCA 5TDPA 3C8KA 4ODTH 2YR3A 4NZRL 3LIZH 4I18B 1HDMA 1LP9A 2YA0A 1YNKL 4I2XE 4YHZL 1CT8A 4GG6A 3QB7C 1J86A 1NGQL 2AJXH 3CX5J 1KELL 3QA3A 5GIRA 5JO5B 3VXPB 4X6BB 4XNMB 3UBXA 4NKOB 4HMDA 1MY5A 2FSEA 2GFBA 4MSWB 4LVOC 4LLVB 2OYPA 4E41B 1YN7B 4WNQA 1MH5B 4KQ4L 4QOKD 3FB7A 2PCPB 4NCC2 5FYJD 5SWSB 3UTTE 3RVTC 3JBG7 5DMIL 3SE4C 4OCRH 5T3ZD 1NCWL 1RAMA 1CXKA 1RIUL 5AWNH 2P5WA 1BZ9A 3GSNL 4HIHA 1SJEB 1I8LA 4HKJB 4JPVL 2R9HC 4PLOB 1KLFA 3UPCA 2EYTA 3DSFH 3QEUB 4FS0A 5D93B 4HWEL 2FATH 4FQLH 1F3JA 1FNEA 1N4XL 1MUJB 1OF2A 1UXWA 4K3EL 1PX4A 1OP3K 4Z7VF 4ZSOE 1QA9A 2WW8A 4MD4B 4PJCB 1NLBL 3B9KB 5JOEA 3HE7C 1MAKA 3LVEA 1L0XA 3C5SA 2BVUA 3RX8A 2KDGA 3SJVB 2HVKB 4PB0H 3RL1A 3FB6B 3RVTD 2V5TA 3AMLA 1AE6H 5EU7E 5D2NA 5DVMA 2APBA 1BQUA 3ZTNL 5KAQG 1IQWL 4PRAA 2OXHA 2R1XB 3W82A 3HPLA 3O2DH 3HR5B 3MYZA 3V0VB 1HH6A 5IF0A 2UV3A 2OR8A 1G7IA 5DA4A 4XPFH 5HHOE 3GMQA 5C0CD 4YHPA 5I2IB 1JPFA 4HCRA 4WDIB 1LK3L 2OP4L 4CNIA 4YWGH 2H2SC 4R4FL 3DUHA 3HE7D 4FQIH 5I0DA 1FFPA 3LEVH 4N8VG 1OPGH 3MLWL 3RY4A 3KS0H 4XPGH 3FO2B 4UIMB 5BV7L 1Q1JL 3MV8D 3O11B 5IT2H 3V0AC 3K1KC 1J9CT 4KTDL 2PXYC 2DMKA 3GSWA 1A5FL 2AK1H 4OZ4A 2HKFH 5FF6A 3ILPA 4RZCB 4FXKB 3OKYA 4PJBE 3SE8H 4B7LA 3NCCB 4OCSL 1DQTA 4RGNC 1KCSL 1PG7H 1EFXD 1JL8A 1UXSA 4M8VA 4M8QB 2DQEL 4JKMA 1ZA3A 2FGWH 3QFJA 4OM1H 1BECA 1AO7D 3KNBB 3DI3B 5EC1A 1U9KA 3T0EB 2H2SD 1UB6B 5I8KH 1KJ2A 5F7EH 5K9JL 1IGJB 5DDHA 1AGBA 3QRGH 2OL3L 4JPIB 1BF8A 1O5DT 1TZGL 4WHTA 2VXVL 1S7XA 5I17B 1B4JL 3RDTA 2OTWB 4I5BA 5C0IB 4WHTB 2PXYD 2XRAL 2OK0L 5J0BA 4R97B 1FZMA 1OGAA 5KW9H 1CFSB 5B8CC 3NIGF 1EHAA 2ICWJ 1OGAB 5T1DH 2IAND 1RULL 1WAAF 3DHJA 5EOQH 2FZ3B 5JMRA 4QRQA 3GBNL 4CVZB 1RZKL 4NC0B 4WUUE 4XCNA 2C3VA 3O3AB 3BP5A 2OMBA 3PWNA 2GYSA 3PNWB 3U30C 1PLGH 1MSPA 1DVFD 4HBQA 5I1EL 3DROB 4X5WB 4NZRH 2QQNH 5DQ9A 3VRLF 2V2XA 3ZO0A 3S4SG 4YHZH 4U1JB 5MERA 2RHEA 1HIML 1MVUA 5JW4N 1V8HA 1EEYB 2I24N 3FN0L 1AP2A 5DI8B 5ICZA 4EQ3A 2R23B 3OXRA 4XI5D 2F54B 1RZIA 1HI6B 4ZUTA 3EYSH 2F53B 2FLRT 1RZIB 1ACYH 1NBQA 5DMIH 4RBPK 4JPWH 4RX4D 3GSNH 3MSPA 3F7VB 3CVHH 5I1LB 5IVXE 2I5YL 2YZ8A 5ICXB 4JPVH 4X99B 3FQXB 5AEAA 4G5ZL 4OLVL 5GS1A 2CKBA 1WBYB 4PJ9C 4OZGB 1H8NA 3DETC 4PRIB 2E8YA 1FL6A 1CLCA 2D9CA 3MRFA 4MJIA 1FFNA 4JFOA 4XX1E 4P2QD 1NLBH 5E5MB 4IOSD 4PTUB 4Z6AT 3D39D 5E1AA 4ZFOB 5KVDL 4NO5A 1A14L 2NW3A 1EEZB 1WWWX 5D2LE 4XMPH 5DTFA 3B2VL 2EDNA 2XKNB 4JM2C 1MF2L 4MNGE 1JVKA 1D5ZB 5ESVB 3ZTNH 4NRZA 1IQWH 3QPQD 5GSRB 4PJ9D 5I6XB 4CVUA 2IMMA 2IBGA 3WHE0 4HLZH 4RFEA 4ZFGH 3VI3F 1NANH 3ARUA 5I76B 5JHDE 1LK3H 1KIUA 5TPWL 3V5DA 1ZLSH 1IAII 3P4MB 3QDHA 4EVNB 3GSNB 4B0MM 4IOIB 2EDQA 3MLWH 2AAVA 3OTTA 1Q1JH 3MLVL 4Z7WB 3DVIA 4JM2D 1KLGA 3C6LB 5DUBB 1OB1A 5IFJB 4KTDH 5I75B 1VACA 3I6GB 5I16B 4QHKI 4OCSH 1KCSH 3HZKA 2IGFL 2UUDK 4GXUN 2DQEH 4PJDE 1YC7A 3IT8D 2L4OA 3QG6A 2YRPA 4FFWC 4H5SA 1OGTB 2K9UA 4DEPC 5JXEA 3TH3T 3LEXB 3UJIL 1OSPL 1IVLA 4ENEC 1F5WA 4HPOH 2OL3H 4LLMA 4QRRE 4PV8A 5HVWA 2VXVH 1R0AL 2X7LA 1R3JA 2WBJD 3QDJE 5F7KC 5T1MA 3STLA 3WS3A 2XRAH 3ARDD 3B9VA 2OK0H 5FK9A 5TGBB 2X7LB 4MB4A 4W81A 4ZG1A 3Q1SL 1ZVSA 1RULH 4NYLB 4Y4FA 4F7EB 1A1MB 1INDL 3GBNH 5EZOL 5I1DA 1RZKH 4WWKA 4LCYA 1IC5L 5EZLB 2XPGA 1JNNH 3NACL 4BSWA 4WI8A 4ENED 3AFLA 3FQUA 4J6RL 5ABDE 5FOBA 5KVFL 1U91A 1Q9WA 5J56B 5ID1A 5I71C 1XMWA 1F2XK 1QFOA 1Z2KA 3QIUA 5J4MA 3C9NA 4NUGL 4OUOA 4UAOC 5IMKA 1HIMH 3I6KA 2YD2A 4NPYB 3FN0H 5AZ2H 1PYWA 1T7WA 3BGMA 2GTZA 3FRUB 5JPMA 5GJSL 3F7QA 5AAMA 1KIRB 4RNRA 1VEMA 5L8KB 2MHAB 3BYYA 1AGDB 3MCG1 3O8XC 4WEUD 3I6LE 1HXYA 5C0BE 4H0HB 4F58H 1FYTA 2OL3B 1EO7A 4JFDA 4X9FA 3P4NA 3MMEB 4S10A 1WCQA 1YC8A 4WU7A 4N0FA 1KCVH 3Q6GL 4YH6A 4B50A 8CGTA 1JWSB 1U8IA 3FL7A 4YZFF 2I5YH 3HE6C 2XZCL 1IMHC 5JR1L 4G5ZH 1L9NA 5MEQB 3CZFA 5L0QB 4WHDA 1A6AA 2HT2C 2H8PA 1D5MB 2B20A 3DGGA 5KSBE 5DEGB 1EHNA 3ARGA 5CKGA 5F88A 1B0GB 3HG1A 3RUGE 3U0TA 1V3MA 3OKKA 2P43B 3JWOL 4BK4A 5B3NA 1MRDL 1FAIH 4RMUA 3BESR 3O8XD 1A14H 2NXZB 5D8JL 2EICA 2JELL 3AS0A 3R06B 1KB5H 3FCTB 4PJ5D 5JOFB 1U8NB 5I30L 1T1WB 1MCWW 3RNKA 4ELME 2NY2B 1GPOL 2VR4A 4RBPH 3FO0H 2Q1EA 5K9QG 1MWAH 4PRDA 4RAUA 2I9LB 1YY9C 2P8LA 3MACH 1FV1B 5T1LB 5JOPE 2HT2D 3JTSB 4JFYB 1F00I 4TUJB 1RIHL 1WZMA 4RAUB 2FR4B 3OAZK 4KI5F 2ADFL 1J7VR 3DV4A 1D7FA 4NC2B 5TPWH 4LLDB 4PP2A 3EDEA 3VXSE 1T2QL 3OXSA 5DRZA 3MNZA 4RIRA 2VZ1A 3MLVH 2CMRL 2GJ6E 4BJLA 4Z0XB 2GSGB 3K8MA 3EHBC 4NKDB 3O6FA 5C08B 1YY9D 1PBYA 3D1MC 3O2WL 1G9NH 2B4CL 5D1QA 2IGFH 1NCUA 1NUDA 3DBXB 3CH1A 4HIIA 1NFDF 4MJ2A 2FHBA 2KKQA 1OSPH 3D85A 4P2RD 5D7LD 1WITA 4OT1L 5ADOL 4GS7B 3MJ7B 4KK6D 1S9XB 3QISA 1CICC 1LO5B 4HUXB 1QQDA 4HAGA 1R0AH 1HZHL 3EFDL 5KSUA 1RUML 3MA7B 3EHBD 1I75A 2XWJB 3Q1SH 5F9WB 4JHZA 4LRIC 3V5HA 4GAFB 2IQAB 1INDH 1JHKL 5EZOH 4XNUL 3V8OA 4LCIH 3OX8B 3BHBA 4S2SB 1WFOA 2GUOB 5C71A 4KJWC 1JHLL 2UUDH 4X9IA 1HQRA 3NACH 4BM7A 1A7NL 4DW2L 3O6ML 4HIJB 1TENA 4J6RH 5KVFH 2GJZA 5C0JB 3FMGL 5TE7L 3N1PC 5C0DB 2BHUA 1CVRA 1GZPB 2DAVA 1X5YA 3N9GH 3IDYC 1C5DA 3RVUC 1FGVH 3B9EA 3ABZA 3OF6A 3CXDH 5GJSH 4QTHA 5D7IE 3D69A 4JFPB 1EA9C 5ECJE 4DCQA 4DQOL 5GGRY 4KJWD 3QP3A 1J0HA 1X4YA 3EO9L 5E2UH 5FGSA 5F6IB 1OLLA 1X7QA 2V7HA 4HV8B 1I9EA 3EJZC 3MR9B 6CGTA 3U7YL 2BNRA 1EVUA 4NQCE 4G8IA 3EYUL 2QQLH 1NFDB 5D6CB 3H9SA 4NZTL 4Y8AA 3H42L 2XZCH 5JR1H 4LVNC 1HHHB 1BVZA 3WNLA 2B7DT 3MRIA 3MUHL 1NEZB 2D03L 3RVUD 6FABL 4N8PA 2CLVA 4GXVL 3T0WA 1OSZA 4LKXA 4Y5VB 1Q0YL 3DVGB 1G7HB 3LQZA 3S3PA 4DKFH 4ZYKB 3G6DL 2OM5A 2HN7B 3MRRB 3LQAC 3JWOH 3B8SA 1MRDH 4OBRA 4U6XB 3F6IA 1OARL 4OGXL 4XHQA 3DV6B 1D9KB 2AABL 1KCRL 3FTGA 4LMQI 2JB6A 4JRYB 3A6CL 4YNYB 2X4OA 3EJZD 1TQCC 1H15A 1Q9OA 1G0DA 4ODHL 3O4OC 5I30H 4R4ND 4YXLL 1GPOH 1T4KB 1DUYA 3TBSB 1J8HB 3UPRA 4UTAL 1DQJA 2CRMA 4MJ6B 4AYFA 5T3ZE 3BUTA 4F8QA 2B8OT 3V5KB 1CXLA 1DFBL 5GSVB 5D1ZB 4BFBD 5GRYA 1IAIL 2P7TB 1DBKH 1WLHA 1H8SA 3IETA 5LGJA 1OD9A 4N0UE 3WIFA 4YFLI 3QI9A 4JFHE 4GUPA 1CDCA 4PGDA 2V17L 1N26A 2YN5A 4LSQL 4ELKA 4NNYB 2IPKA 2NTSP 1H3WM 4Q2ZB 4LSPL 2HRPL 4FXGA 4S0SD 2R8SL 1A9EA 4PV9A 1LO0H 3D0LB 3BEWB 3BKCH 1NC2A 1A6TB 3O2WH 4MDJB 3U4EB 3CFEB 4AIZA 4XC1L 3IDGB 2NX5A 3LKQA 2Q8BH 2BVQA 2DQTL 1NAKH 4HUWB 4JO2L 4KHTL 2YN3A 2X89A 1W72L 1MAMH 3SQOL 4HLJA 4OT1H 5ADOH 4KUZH 3LDBC 2IEPA 5TF0A 1BQHB 3QIBA 2F5BL 1HE7A 3CFKB 4JY4B 3ZKXB 3MBEA 1OAXL 5CSBA 3EFDH 1EJOL 1I85C 1RUMH 5JW4R 3T3ME 5A40E 4YX2H 2IALA 1H3GA 3GEWB 1E4XI 3AY4A 2GY7B 1SEQH 5AD0A 3MV8E 3WJLA 4JRXB 3KGRA 4JJHA 4L4TA 4NQDB 4XNUH 2VLKA 3CK0H 4WO4B 4L8CA 5CEZH 2FJGA 1JHLH 3ZDXF 4I0PA 3TZVD 1HCVA 3ARFA 3NIFE 2CIIB 4X98B 1A7NH 3JV6A 4MJIE 4PJFB 2DDQL 2ATPB 1Z6JT 1HILA 2EZ0C 2JIXB 1DLFH 3BWAA 3JV6B 3QNZB 4KKCC 1P7HL 4FABL 5JIPA 5EZIL 1TETL 3GRWL 1FAKT 2Q76A 2YUXA 1FN4B 1MCOL 1X6NA 4HGMA 2ESVB 3H7BA 4YDLC 2B39A 4PJHE 5ELIA 5A1AA 3U6RA 4EI6A 2XTJB 1ODAA 3DO3A 3ZKMC 1SMOA 3QJHA 4MA8L 1LEGA 3HNVL 3EO9H 2VLRD 4YHML 2OZ4A 3QUXB 3NZ8B 3OL2A 1N2RA 3LKRA 1QYGL 4OCWL 3U7YH 3JVGC 1KTRL 1AKJD 4KKCD 1RMFH 4DZBB 1KSRA 3FT2A 2X40A 4NZTH 3H42H 4XZUB 2KZ1B 5DK0A 2AK4D 4M5ZL 2D03H 3BKML 5H94A 4D0CB 6FABH 4J2XA 4GXVH 3MFGB 5E00B 3ZHDA 5IHUL 5EO1B 5GGSA 5GJTL 1CQYA 2MQ3A 3VFWB 3ZKMD 3G6DH 2HA1A 1Y18A 3NCBB 5DC9B 1TJGH 4LPUA 4O9HL 4OF3A 1FE8H 4KKLC 3FO9B 2HTKC 3OZ9L 2AABH 2X44D 3A6CH 5DD0L 1A2YA 3L7FB 4Y5YC 2VDPH 2NNAA 2PF6A 3BMVA 2AXJA 4AMKH 3BQUA 4OAWB 1BFOB 5MENA 2WWMC 4K7PX 1XGYH 3G5ZB 1TIUA 5CUSL 5ACZB 4C56A 1KXQE 2V9QA 1D5XA 1DFBH 3T8XA 5DLMH 3RWCA 5MI0C 1I1FA 2EKSB 1IAIH 1N6VA 4UZGA 4X7TA 5D7JC 3SDYL 3JWNC 4N8CL 5I15L 5JNYA 3I3EA 1A6UH 5D1XD 5FECA 4Q9QL 1IC4L 2ZOKB 4ODXA 1JNLH 2HTKD 5CD3B 1WVZA 3ZMRA 2KZWA 2V17H 4UDTA 3LKOA 5I0ZA 3MV7D 3TO2A 4PJAB 1RUPL 3TN0C 3LRSA 2ICEB 3F5WB 3QXAB 3TCXA 4P2QE 4LSPH 4XWOD 2HRPH 2R8SH 1M7IB 3LRSB 2BXYA 3HUJB 4AENA 1H5BA 5B38B 2WWMD 3CFBB 3LS5L 2ENSA 3MLZH 4AENB 4N9GB 1KTLA 1KFAH 4XC1H 4OZFH 5F72S 1UCTA 5KSAB 5ISZB 1SEBA 5BZDA 4UINH 5BRZB 4HH9A 2DQTH 5D7JD 4HS3A 4JO2H 1A6PA 4KHTH 4PS4H 3Q0HA 4G6FB 4LBEA 4EN3C 1W72H 2CQVA 4HXAH 4L4VB 5BZDB 3SQOH 5EU3A 2DTSA 1EO5A 3WIHA 4OZHB 4JVPA 4M4PA 1A8JH 4XCYB 3LZFL 1FYTE 3TN0D 1E6JL 4RWHA 5DJZB 2VIRA 5HGHA 1EJOH 4NC1C 3VD3A 9CGTA 3L3JA 1RUKL 3PWPA 5IESL 1U41A 5JLZA 4QTIL 4E0RA 4YK4B 1QPXA 4NBXB 4R0LA 3VG9C 3OR7B 4KUCF 4CGTA 4JR9L 3U1SH 1BQSA 4UI2A 3U36B 4EN3D 1AGFB 1AJ7L 1Q9LB 2DDQH 5ICYA 1YJDL 2MKLC 3RA7L 5FYKL 1X4XA 5KG9A 2I9TB 5E94A 1A3RH 1IM9D 3C60D 3MRPA 4LCCA 2P5EB 1MCOH 1IGYB 5EFIB 1JWMA 4YC2C 1N5YH 1I3UA 2CRYA 5KS9F 2D9QB 3D0VB 5E2TH 5TQ2L 4M93B 4M62L 4OZFB 3VWJB 1KTDB 4I18C 5F7UA 4WW2B 1RFDH 4ISVB 1U8KB 4JFFB 1W72B 3SKOB 4MA8H 5C0AD 3EOTL 3K4ZA 1ZXQA 1GAFL 2AQ2A 1UWEL 2HFGH 3NPSC 3U48A 5CLWA 1QYGH 1OCWL 4OCWH 1CF8H 1LE9B 4LLWA 4EIZC 5DYOB 1RK1B 4JO4L 1BP3B 1JPSH 5DRNB 4GW5A 4PRHA 3HC3L 2Q87A 1EV2E 3MLUL 4P2YA 1TPXB 2YA2A 4PYHA 3BKMH 5DJDA 4MA1C 1DL7H 4KKNA 3F65A 3PABA 5I1AA 3JTTA 4KTYA 5EPMB 3HC0B 5IHUH 3VXNB 4ZAKB 1U3YA 1J0ZA 5TJWK 1U3HB 3QJFA 4IS6B 5HDLA 1BVKA 2XICA 1C1EL 3GO1L 3RWIA 4MHHG 1JF1A 1RZFL 2AJ3B 3GRWA 5FO7B 3QWOA 2X1QA 2ZG3A 3QEGL 2IAMA 2NY3C 3PIQA 2YBRA 3UBXG 4K71B 5DD0H 5EU4A 3VD5A 3CPLA 4D8PA 4GFTB 2E7BA 4K3GA 5EBLB 1G7MB 4K7PY 3VXMA 3MRBA 4BFIA 4NO2A 2PUQT 3NFNB 5SWSD 4EUPA 3GI8L 5CUSH 3TVMB 1QSFA 4I3RH 5DC0A 1MCPL 2LVEA 4QHNB 2ZCHL 2H26A 1B3JA 3SDYH 2ED9A 1PDKA 5I15H 1Q0XL 1WT5A 2QHRL 3WUZA 4LLYB 1NSNL 4Q9QH 1IC4H 1PEZA 3TBYA 3RVWC 1JBJA 3SDAA 3CXHJ 1RUPH 4MA3A 5GGVH 3FAWA 2GJJA 3U0WH 1NMCB 3B9KD 1F90L 1YEHH 3H3PL 3CDGB 3FZUC 1KUMA 1U8OB 3SJVD 5F9AC 5IOPA 3LS5H 5J9PB 3SDCB 1QKZL 1P9MA 4PJ5E 1BIIA 4MNHA 2R0WH 1KEMH 3EYVA 1P4LB 1TQBB 1AD0B 2Q7YA 3QWRA 3IJHA 4JY6B 2M2DA 4LDLB 2VXUL 1P84J 5ESQB 3NFSL 3UTZB 3GSUA 3KS0J 3FOMB 1QVOA 1IGFL 4WJ5A 3RVWD 3MRDB 2WINB 3BX7C 1IFHH 2B1AL 1E6JH 3B6SA 1CFQB 4KVNL 4OZIE 2X4RB 3T0XA 1S7WB 3FB5A 1RUKH 3QCTL 1WK0A 4M1DL 1XIWA 2BSTB 3FZUD 1E4XL 2BJML 2BY1A 4MNQB 5IESH 3DI2B 4UV4L 4Z78A 1NCAL 3BIBX 3FKUS 3KYNA 3HMXH 1HINL 2A6DA 4ODWB 4Z78B 4JR9H 4WI5A 4R97C 2EE6A 3Q3GA 5KJRL 1FZKA 2OR9H 2QADC 1AJ7H 3T77A 2ZG2A 1RVFH 2ITDB 1QR1A 3TPKA 5GISL 1AD9B 5GS0H 3LQMA 4KGJA 1YJDH 3WSQL 1YMHA 1W0WA 3RA7H 5FYKH 1FDLL 2VDNL 4Z5RB 3ORJA 2YEZA 1R3HA 2X70B 2AERT 4GRWH 4O51B 3W5NA 4DKAA 3KLHC 1KPRB 3DRTA 1OTTD 4FXLA 5D7LE 5EB9A 5TQ2H 4DN3H 4OKDA 2J3SA 4PRNA 4X4MA 1GOHA 5C0GA 5ESAB 4JO3L 5A16B 3RWFA 4NO3A 4LU5H 1WUNT 4JFEA 3UJJH 4K3HA 5MP6H 1TVBA 4XBPB 4B53A 3EOTH 2A73A 2QADD 4GSDH 1GAFH 4L9DA 1UWEH 5CZKA 1OGAD 2VQUA 1OCWH 5MHSD 1A0QL 3FQRA 1ZWIB 4JGMA 3QUYA 4JO4H 1DDHB 3KPQA 5J06A 3HC3H 3G6JA 2WIIA 2MSPA 2A74B 2AGJL 3CU7A 1K4DA 2A9NH 4HJ0D 3KLHD 1FRGL 4XC3L 3OKNB 5DMKA 5M7QA 3S5LA 1K5NA 2IC2A 1N8ZB 1S7QB 3HS0A 3TCLA 5IW6B 1A9BB 4Q9RL 1I7ZB 3Q2CA 4NZUH 2VAAA 4XWGH 4AIOA 1FFRA 4ONFH 3CFCL 1ZT1B 2SEBB 2NX5E 4YGVA 3MCLL 5B22A 1G6RH 3OBAA 2VZUA 2YPLA 4YHOL 1P69B 1U8JB 2F54D 4X4YA 5A2FA 2QR0A 4GRWB 1UZ6F 1YEFL 4MQSB 3CSBA 5D96B 4J3XA 5F71A 3GI8H 5E5RB 4WU5A 5EOTB 5C2UB 4P5KB 3DURA 4P3DB 3QDMA 3ZL4L 1MCPH 4O2CB 4UTBL 4IHOB 3K3QA 4L29B 4M5YH 3WMSA 1D5BA 3RTQA 4HDIA 3WFEL 5I6XC 2PO6A 2QHRH 2W91A 1NSNH 4PRID 1I7UB 5E4EB 5KTEL 2PO6B 2VLKE 1JE6A 5E2WH 4KJYB 1YECL 2ZOLA 3TIDB 2IQ9L 1B0WA 4QXUH 4JO1H 5GGVY 1F90H 3H3PH 5E08L 2DLEA 2EDKA 5DUPL 2E7LA 1QKZH 3GM0A 3PG2A 3ZKNC 4HZLB 1VKXB 5L2KB 3WL9A 3RWGB 5AAWA 1E0OB 1MCBA 3M07A 1J87A 1YEGH 2LAGB 5C09A 4LKCA 3BZ4B 4WI6A 4P5TA 4Z7VA 5I75C 2VXUH 5JORB 3RAJH 3NFSH 4PJBF 4TRPL 1G6RB 4LFHG 1P4IL 4K3DH 3GSXB 2V6HA 5SWZA 2EYSB 4PGEA 4LFHD 5DWUL 3QEQB 3VGGA 2B1AH 4YHLL 3C09B 4KVNH 2ATKB 4UB0L 4ODVH 4PJGA 2EE2A 3VFSA 3HZYA 1A6WL 4QHLB 3RWDB 2X4NB 5C0FB 3QZWB 3ZE2F 1E4XH 2DI8A 2VSDA 3DX7A 5HYJA 5MEPA 4X0KB 1VPOH 5F7LB 1UENA 1NCAH 3ZKND 3P4LA 1IAKB 1YPZA 4EOWH 4FFYL 3C6LD 4JDTH 2X4PB 4WGWB 1LO2L 3O6LL 4KMLB 5HYQB 4NQTA 5KJRH 1S7SB 3TA3A 1WISA 5CHNB 5FHBH 3IDUA 5GISH 4RGMC 1FLTX 3U82B 1VGEL 3WSQH 3FFCA 1J88A 1BLNA 1MAJA 4G6KH 1ZS8A 4OF8A 2KUTA 2YD8A 1VFBB 4Y4FC 5CEXB 2JJVA 1TMCB 2GY5A 1X3DA 5C2BL 5BV7C 4WWKC 1KLUB 1ZS8B 5I1CL 4DN4L 4DVBA 1IQDA 4NHUA 3LRHA 2YD6A 4P4RA 2IG2L 5CBAB 4JO3H 1BFTA 1S5IL 3ARYA 2HVJA 4XPAL 4XVUD 3IFPA 3SGJC 4MQ7A 3QIUC 2NYYC 3G9AB 4RMVA 3N1MC 3CFJA 3DX6B 2EEBA 4AT6A 1T20B 2C4XA 4FQ2L 2L7JA 4Z76A 4WEMB 1UEYA 3GSRA 1N5AB 4FQXB 4XBGB 3SOBL 2FO4B 1S9YA 4RMTA 3SKJH 3ULSB 4LGSB 3OKMB 2DQUL 2AGJH 3VWKA 1GGCL 1FRGH 2PW1B 2G2RA 5EN2B 1MFCL 3F6LA 3VRIA 2VAJA 2WUBL 3NCFB 4Q9RH 4PJ7F 8FABB 4HK3J 3BDBA 5EBGA 5EULV 1WAAA 2JLLA 1IKFL 3NCJL 1WC7B 3S35H 2NYYD 2GAZA 3MCLH 2RBLA 1MJ7L 3MRKA 1RZKC 3LY6A 4PY7A 1S9VB 3DUUA 4Q9BA 4YHOH 5FCSH 1VGKA 1W0VA 5F1IA 5BZWB 1BBJA 3PDOB 4PRPB 2E7CA 5LXGH 2NXZC 2VLRE 3DJ9A 1JYNA 5HVHB 2DL2A 4A6YH 4WI9A 3W0WB 1KIPB 4OF0A 3ZL4H 4UTBH 1MI5E 4OD1L 5BJTA 2NY2C 1TXKA 4AQ1B 1IE5A 3QDGB 3P9LB 5F3BA 1T1ZB 4Y4KB 5AYUL 3L3DB 2AK4E 1MIML 2E8ZA 2NZIA 4GAYB 2CPCA 4KJPD 5KZCD 3ZT7A 3W2DH 1SYVB 1ZHBB 1YECH 3OKEA 1G0YR 3UPAA 2PYFA 1MJJB 1T22A 3DHMA 5E99L 3BXNB 3ARZA 5DF0A 4L3CA 5IV2B 2NXZD 2F5AH 4K3JL 4LLUA 1I4FB 5HDQL 5MEOA 1PGRB 3FQWB 1U92B 2DTML 1CGUA 2OTUB 1YEKL 2NY2D 4C83A 1VADA 1SHMA 2YD5A 4AIXA 2OTPA 4XP5H 1VA9A 2BY2A 2VQ1B 1X44A 3QO0A 1LDPL 3O6FC 4NGHL 3F12B 3RJDA 1NDGB 1YEJH 4MX7A 2VDQL 2W59A 4P4KB 4PJ7B 4UB0H 4U1HB 1A6WH 1KG0A 3LPWA 2O61B 1ZT4A 4A6YB 3KPLA 4DGIL 4U1LB 5CP3H 1JPGA 3ULUF 2DLTA 4GS7C 3L95A 3X11A 3LN5B 1DR9A 3PJSB 3MV7E 4HKXA 4IDLA 3ZT6A 4W4NA 4K2UL 3ECBA 2V5YA 1LO2H 3K4DA 4FP8L 4G9FB 5AUMB 3O6LH 4M9OA 5I18H 3EDFA 3T3PE 5FOJA 2VSCA 5C08D 4QRUB 3Q6FA 5DRXA 4F9PC 2YXFA 4XNZB 1DLHB 3T1FA 4U3XA 4O2FB 2GIYA 3RBGA 5BW7A 3KPPA 1T0MB 4QF1A 5F1SA 3WNOA 4WTXA 5I1CH 3IAGC 4DN4H 5EU5A 4OLWL 2BOBA 3FOLB 4X9BA 5J57B 3VRJB 3NGBB 2CLZB 1U0QA 1MFEL 3DVNB 3VGEA 5FO8A 2HAZA 2W60A 4G8EA 1L6ZA 5JPNA 1X9QA 4NQEB 2HJFB 1BBDL 1IKNC 2Y5TB 3HAEH 4TUOB 1IAOA 5IEHA 3KPSA 3F7YA 2V2WB 3WHXA 3REVA 3BGFC 4JHAL 4FQ2H 4P57A 1I3GH 3V6OA 4RRPG 1GJIA 3L3KB 1LEKB 5JDJA 3OKDB 1F11B 1HKLL 4P57B 5HY9B 4U1IB 3SOBH 3OB0H 4OV5A 1FCGA 5HHPB 4M3KB 2DQUH 4LCWA 1JZ2A 1GGCH 4Y1AA 4Q58C 2A2QT 1BIHA 1MFCH 2R56H 4QRTB 1RJZA 1T3FA 1K3IA 3QQ4B 1CD8A 1P7KB 5DHVA 5IB5B 3U9UA 1CG9B 3IJSB 3DOSA 3UZQA 4TTGA 2I60L 3RNQB 1IKFH 3NCJH 4NC1E 4CW1A 5L88L 4ORGA 1OAQL 1U93B 3ZKSD 4PJIF 5CEYA 4LF3A 1I9RL 2EC8A 1JHTA 1MJ7H 3VG0L 2ZUUA 1YMMA 5CP7B 3VU2A 5CD5C 3VXRA 1Z5LB 5ERWB 3I9GL 5FM4A 3I2CL 4MD0B 5I8CB 5GGRA 4M48L 4N1HB 5KVGL 2BZDA 5HDBE 1D9KC 3QXWA 4AZ8A 3G08A 1OTUC 5HJ3B 2CLRB 5FGCE 3IXTA 1UKSA 2D31B 2FEDC 1IL1A 4OD1H 3T08A 3HAEB 4LARL 1I8KA 2BNRD 3TEUA 1IAMA 4NN7C 1MCIA 4RAHA 3H9SD 3PDGA 4ZUVB 4TNWK 5C9JB 5AYUH 1MIMH 2E9WA 3PWVA 3MFFA 4DZ8A 4MXVE 4HUUA 4AQOA 1RUQL 3OGCB 3KXFA 1CTNA 3Q5TA 5IEKA 5TDOB 5CD5D 3TFKD 3WXVL 5HYSB 1A7OL 2Y06L 2UVFA 1JI2A 3OKLB 1D9KD 4K3JH 4DUWA 3TBWB 1OTUD 3ULVL 4JRYD 3W11C 3P4OB 2BVOB 3LKNB 1AFVL 1KB5A 2NY6C 5EUKB 2FEDD 3IF1B 5FKPB 1M05B 2DTMH 5A2LH 4E41E 1PKQA 2AEPH 1J8HD 3QH3A 4GKSA 5E8EB 1VDGA 4X4ME 1QUNA 4PD4K 4UQ2A 3MRCA 1B4RA 1I8MA 3HI1B 1ORSA 1DE4A 4Y19B 5FAAA 3VXQA 1X5LA 4NGHH 3BIAX 3MOBL 1EVTC 2VDQH 5AZEL 2GT9A 5D1ZD 2P24A 3WD5L 3KG5A 3KPTA 1I1YA 3E6HA 4NO0A 4BZ1H 3MV9A 4BH8A 5D7SL 4CN1A 1FGNL 4DGIH 1I3RB 2WP3O 4WENB 3L6FA 5EUOF 1SVCP 4PJIB 1UCBH 2RQ8A 2V2TA 1EHLL 3IDXH 3W11D 3TP4A 5E56A 1HHJA 4K2UH 5FO9B 2V2TB 4FP8H 4PJCE 3V4VL 3QIBC 3S8WA 4M1CC 1J11A 3IDJB 3SJVE 4G9DB 1RZGB 5E9DB 4G8GA 4ALAH 4LNVA 3V2AR 5K9QI 1HNFA 4PBVC 4JKPL 1XH3A 3BZEA 1CFVL 7CGTA 2VZVA 2BSSA 2XWBA 4NN5B 1MPAL 2YUVA 3ILQD 5IGXL 1BQHG 4I0PC 4XH2B 3ARFC 4JDVB 2Q3ZA 4BQ8A 4ORZC 1MFEH 5JIHA 5J6GA 2ZSWB 4X80L 4L5FH 1YNTA 4HWBA 2Y23A 5IIEA 4P46B 1BBDH 3GB7B 4BZYA 2B4CC 3QDME 4M1CD 1ONQB 4ONOA 2GTWA 2RCSH 4FZ8L 2IPTL 3LHPL 4I77L 2ZZUT 2XI9A 3OPZL 5HGDB 4PLNC 2XTJC 5D7IF 4EDWL 4R7NB 3BUYA 4JRXD 3T1WA 4NQDD 4AY0A 2F19L 1QLFB 3TNNA 4WO4D 1D5IL 1P2CA 4RGOL 2D7NA 3RU8H 1HHGB 3AMKA 3D2UA 2VNCA 4I0PD 5DJCA 5IMLA 4FQJL 4UBDD 1IGCH 2JIXD 3L3HA 3EOBA 3MCKA 2BMKB 4F7MA 1NEUA 2I60H 3T0EE 3Q48A 3MO1A 2X1XR 2H3NB 2O26U 3F7RA 5EUOB 4KK8D 3V4PL 2HTLC 3IDNA 1OAQH 1AR2A 2ESVD 2PR4L 5KSVA 5C09E 4NKMA 1AGCA 3O4LB 3S37L 2MFNA 1URLA 4KDWA 3SCMA 1WQVT 2XTJD 1BGXL 1KCUL 1WWBX 4KK9D 5EO0A 1E27A 3RKDC 5HBBA 3I9GH 4M43H 4TSAH 1SJHA 3GJFK 1OLZA 3GMLB 4LSUL 5SWZE 5KVGH 2EIEA 2GK0B 2K7PA 3QUXD 1DBAH 3CMOL 3BE1L 3IXAB 3D3VA 4QNPF 4LPCA 2YPVH 4UU9B 3T04D 5J1AA 2NY0B 3D3VB 1DEDA 4LSSL 4V1DB 3ARXA 3EFFA 2O5YL 5IJKC 3BQUC 1O7SA 1RD6A 2VL5A 4KROC 3RL2B 4L8DA 5F96L 2QSVA 3RIAK 2MKWA 3T2NL 1OWRM 3RKDD 4OGYH 4F33A 1HHIA 5DZOA 5BS0B 2W38A 2ADGB 3CX2A 1A7OH 1G7JA 2Y06H 3FFCE 4R4BB 3UJTL 1NBYB 3MJ6A 3BT2L 4YXKL 1JTOA 4TNWF 3FT3A 3ZDZE 5E8DL 4V2CB 2F54E 3GMNA 1GXEA 3LH2H 1NDMA 2F53E 4YDJA 1EBAA 1PD6A 1H5BC 3MOBH 1BD2A 5GRJL 5AZEH 2PTUA 2AKRB 3WD5H 1JGEA 4Q6IB 3I3BA 2QSCH 1EBPA 1R24B 5D7SH 3P30L 5KAQF 2XWTA 3BDYL 4MJ4A 1FGNH 2B1HH 4OZGE 2APXA 1WF5A 3JXAA 4YAQB 1GHFH 1QP1A 1FVEB 3GDBA 1EHLH 1DBBL 1QACA 4U1SB 2JKXA 3D6GA 43CAA 1GC1L 4EDXA 2OJZL 3MNVB 5EWIL 1CLOL 3V4VH 1I1AA 5B38G 1XGUB 3AU1B 4OLUL 4ZPVA 3TO4A 4C57C 3T3MF 4CU7A 2H1PH 2DD8L 3NIGE 3DXAA 1C8PA 1OM3H 4K94L 4YK4C 1X5HA 4O2EA 1II4E 5C6PB 4JKPH 5KSAD 2YC1A 5ISZD 3L3GB 1NBZB 4GT7A 1EXUA 4HGWA 4MJ5A 1BAF