4QXTA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with fc27-msp2 14-30
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fv fragment(mAb6D8) heavy chain
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxtA00
1FPTL 1YA5A 3ARSA 4AIZA 1G7QB 4FQXD 5D2LE 2C3GA 3MRCB 4MNQD 5MHSE 2NTFA 4KDVA 3ZHKA 1FZMA 1IQWL 5JDSA 1NAML 2JCCE 3FOLA 3I84A 4J3XA 1C5DB 1OVZA 2XTLA 2XZZA 2G60H 1WGOA 1KTDB 3TVMA 1LE9A 3HI5H 3KWWB 3SQOL 4XI5D 1A6UL 4G43A 3IDGA 3U48A 1U3HD 3U1SH 1T1XB 1FNAA 5J6GB 4C4KT 4TQEL 3KS0H 4HQQH 3IFOA 3K2MC 5J6HB 3T0WA 2AXGA 4U6XA 3DYMA 3FQNB 2ADIA 4HV8A 1UB6A 1PYWB 1BIIA 4Z77B 4O4YH 3BP7A 3W81A 2D4FA 4KZDH 1CU4H 1RJYA 4FMFA 4OGYL 4HJ0D 2DQIH 1X5KA 3KYNB 3STLA 4ZPVB 5KS9F 2A6DA 3FKUS 3K4AA 3QBTB 1Q0XL 4Z5RA 4AENA 2IFFL 3PP3H 4WO4C 5KZCB 1W0VA 2WBJA 1M7IA 2DQDH 3DVFA 2ITCA 1KCSH 2XXMB 2PO6D 4R3SB 2WINA 1S7QA 1FNLA 2K3TA 1Z9MA 3W5MA 4XPBH 4X6CF 3BD4A 4LRNL 4ODTH 3V4UL 2DS4A 5DLML 3M1BA 2OX5A 1WITA 4ZDHA 2C1PB 1F2QA 4OF5A 4XNXH 1MY7A 4UTAH 4HLJA 1FZKB 3SE4C 1JUFB 3TCLA 1F3RB 2FJGA 6CGTA 2E6PA 3SPVA 2LV4A 1QHOA 5C0FB 3VWKD 2ZOKB 1WFNA 4TSCL 4UOW1 3SKMB 3FT2B 5HI3D 5EIVA 1RURH 1ZHBB 1ND0A 2OQJA 5GS1A 5F7EH 4XNYL 1LO2L 3QDGD 3BQUB 4PJBA 4MLIA 1WWBX 4G6FD 1JGVL 1PQZA 3VFRA 4Z7WE 1CF8H 1GZPB 2OJEA 3GSQA 1J8KA 1AI1H 4S11A 5KG9B 3HLAA 2MWCA 1J05B 3QEGH 4S1SH 1ZS8A 1B3JA 2EO1A 1KOAA 5M95B 1P84K 4APQB 1KCUH 5I9QC 4XCEB 3FONB 3K8KA 4I2XB 4JANA 4P2OC 4LOUC 3TNNA 4ZUWA 1CFTB 1OAUH 3MLUL 1NUGA 3C5SA 3VWJA 3BKYL 5C1MB 3B6SB 4H8WL 1PSKL 3RVTD 1F4WL 4H1LB 4XP1H 1EGJA 4PRBB 3IU4H 5F44A 1I7TA 3HE7C 2VQ1B 4MD0B 4NO3A 2CO7B 1H5BB 3NFSL 5B8CC 3I75B 1NDMB 5JOEA 2OTUA 2W0FB 1SY6A 3NZ8A 1TPXC 3RZWA 5TF0A 1WV7T 4NQEB 3GI8L 5INCB 4E41E 3HC4L 3GM8A 5CP3A 2F19H 2O5YH 3HB3D 1OGAA 2ATKA 3TA3C 1FZOA 2UYLB 1WAAA 1ES0B 5FO7A 2ZSWA 2CDFA 4YK4C 1A3RH 1LNUA 4GMSL 1WTLA 4XPTH 5HYSB 1NJ9B 2XA8L 4B7IA 1WCQA 3W9EB 4F7CB 2EXYC 2P5WA 3ILQC 1CT8B 3LV3A 1CE1L 4G9DB 5E94A 1YQ2A 1CVRA 3VXRA 2YD7A 4QRTA 3EZJB 2M1KA 4C56B 1OM3H 2EKJA 1DQML 2FATL 1G1CA 5C0CE 1VPOH 4G5ZL 1WCBA 4UT7L 4GG6E 1R3HA 1EGJL 3PWUB 4HKBB 3TZVC 43C9B 3HAEA 5GRZA 1GZQB 1DZBA 4J3VA 2EH7H 3DX7A 5D2LA 2ICEB 3QZWG 4PJ9B 4ZO9A 3WFZA 4JZNB 4OZFB 4M7LH 1SY6L 5HPMA 5C6PB 2JCCA 1CDGA 3JUYA 2P4AB 3G6JB 3M45A 5ICYA 1HHGA 4KKCD 3Q6GH 5CGYD 5DJ2A 2NX5A 4MCYB 5J56B 4I8DA 3K1DA 3AS1A 2XFXA 5HHOA 3QIWA 4P2QE 1A3LL 1CDCA 2WW8A 3TF7C 4R90H 1AKJA 1A1MA 3O8XB 3KS0J 3D0LA 1UYWL 4HK3N 3F7YA 4BZ1L 2FYYB 4M4PA 5IBTH 3HMWL 3RBSA 4K8RC 1HH9B 1IRAY 1LVEA 1ORSB 4X8JB 2OZ4A 1MVUA 4Y4HB 3STZB 2ZCKL 3B8YA 5E1AA 3GKWL 5I6XB 5TJWK 5I18L 4X5WB 1LP9B 4D9QE 4Q2ZB 1XAUA 4HEME 3RGVB 1VACB 1YY8A 1MHEA 4G8EB 5FUOL 4XP9H 3W11C 2HKFH 1BM3H 3MRPB 1D6VL 4JG0H 4D8PB 4YHOH 3ARBD 2PW1B 1D6EA 3GMOA 5E2WL 5BRZE 1BFVL 2MKWA 4K55A 4CDHA 4LNVA 1MSPA 2OI9C 2R4RL 4LBEB 1TTFA 2NY0D 4PP2A 3X14B 2FWOB 3RIAK 4X6DB 3D85D 5A2JH 15C8L 3J7HA 1EA9C 4ODSH 5EU7E 4LARH 1NBYA 3GJFH 5F7YC 2NZIA 2OZ4L 4LPYA 1OTSC 4XNQB 2QSVA 2CKNA 1WBXA 4P0DA 3NCEB 4ZSOB 3VFGH 4OKVB 3ZT5A 1XGYL 3QEQD 3QUXC 1R3IL 3P9MA 5DVNA 1YNTA 4U1HB 4NDMA 4N68A 1ERNA 2I07A 3VE0A 3UTTB 4ONOA 4Q9QL 4MCZB 2YPLD 3STBA 4U1LA 3QH3A 2FLBT 4JPVH 5H8DA 4PJCB 1OTUC 1UJ3A 1YZZA 1WIUA 3I3BA 2YD4A 2LU3A 5IVOA 1YNKH 2APBA 4KY1H 2XV6B 2F74A 5DJCA 4UDUB 2ESVD 1MJUH 3FQUA 4HAGA 4CVZB 5ERWA 4KUZL 4QHNA 3BN9D 5DQDL 5E6ID 4JREB 4P23D 2P5EB 2EIDA 4WWKC 5J1SC 2HFEA 4LCCC 4MXVE 5DJYA 4TTGA 1KB5B 4UDTA 4Y19A 2VDKH 1I9IH 5I74B 3K46A 2A1WL 2DICA 2XTJC 2CSPA 2MSPA 4N5EC 3QHTC 4HWEL 1JZ3A 2C4FU 3FCTB 3FFCD 1XZ0A 3QPQD 1E4WH 1C5CH 4V2CB 1TQCC 5C0AB 2BRQA 4JO3L 4WUUD 5CIPB 4Z7OE 3NCJL 4J23A 5E08L 1PZ5B 5C0CA 2YSSB 4NPYB 2WNGA 4PRAB 3IS1X 3OKEA 4G9FD 4RAVA 1QR4A 3QEHA 4X4XB 3IF1B 1FVCB 5HJ3B 4UNVA 4OZGF 4I0KA 3DETD 5HY9B 1OL0A 2PR4L 2XN9D 3UTPE 3KJ4C 4TVSa 3GSRB 5SV4A 5E4EC 1L0QA 2PXYA 2VABA 5ITFA 1XGUB 5HXMA 5JR1L 3NTCL 1FL5A 3EHBC 4QRRB 4AG4L 2X9XA 1OWWA 2SEBA 3RBGA 3SDDC 43CAB 2JTDA 2GUOB 4JAMA 3GSNB 1RUKL 4LCUB 5T5FL 5SWZA 3TNMB 1XH3A 4HKXB 3VFTB 1HXYB 1KCRL 3ET9F 3JUZA 5A40E 1FIGL 1RZGA 4MB3A 4UNUA 5FB8B 2AJ3A 4PJGF 4ZS6D 4POZD 1LEIA 1L7TL 2RCSL 4NC2B 5IMMA 4JHWL 5D6DC 3MRNA 5FKAA 3X11B 3PV6A 1XCTA 4HS3A 2KZ1B 4L29B 5F1IA 5KW9L 1CDIA 5F88A 4YHKH 3TPUB 5L9DL 4JKWA 2OTPA 3O2WL 3CUPB 2NR6C 3MJ6A 4NQDE 1JYXA 5KVDL 2A6IB 2X4TB 1T1YB 3FRPA 2UWEF 4LLYA 2Z31A 4OZHA 5B39B 5E03A 5HHME 5BXFB 3IXAB 5D8JL 5GGSY 2EIEA 1GCFA 3DWTA 1TNNA 3FB5A 1E4XI 5AWNH 4DKEH 1AQKL 4L4VB 1MCKA 3IJSA 3RWEB 4RA0C 1YY9C 4JFDE 4MNGB 3NIGF 1K8DB 4Z7UB 2BNQB 4ELME 2P24B 3SOBL 3PIQB 4GW1A 4OUUA 2VXSH 4WW2F 4JQXC 4TVPL 3TESA 3HE7B 3PJSA 1WZ1H 2VDML 5D96B 4CN1A 5T33L 5I8EA 3CFDB 2GT9A 4XRCB 5B8CB 4UOJA 3KPRE 3MLRL 2MQ0A 3JZ7A 1M71A 3PDOA 3ULUD 1TPXB 4NQCA 5T3XE 2IFGA 3OX8A 1K5NB 1T7WA 3EO1B 1Y18A 2CRIA 1JGUH 3KPMA 3CK0H 2VQTA 3LB6C 5DD0L 3ROLA 3TA3B 3CX5K 4JRYE 5EOQH 4KJYB 2VWEE 5C09B 4NJAL 3SGEH 1DLHB 2QLVB 5DGQA 3B3IA 4QRSA 4XP5L 2OS7A 3U0PA 4L8DB 7FABH 4YHYC 3LKQB 1F02I 3MOQA 4L8CB 1XR8A 4JHZA 1T89A 4U1MB 3DIFA 5DR5H 4WDIA 4PJAE 1NANH 4NZTL 4WGVB 2V5RA 1ZGLP 1YEHH 2VERN 3HR5A 4YC2B 2DQGL 3OKMB 1UACL 3FOMA 2RAMA 4ONFH 3TZVB 3G5XB 1MCOH 2ARJQ 4HBCL 5DYOA 4FFVC 3PL6D 3HPJA 3ALXA 3ZYOA 3VXQA 4F9PC 5DD3L 3V4PH 1HI6A 3G9VA 3WE6B 3MNWB 4LAJH 4GUPA 1FDLH 1BWWA 3T1FA 1BAFH 4RAUB 1TITA 4WV1C 3EGSB 1PX3A 1UKQA 4JY4A 2CDEB 2WWMD 2DYPA 3P30L 4BH7A 1VSCA 3QXTA 5CD5D 4PJFF 4NNPH 2XPGB 4NWTL 1G7LB 2Q6WA 1A7BA 4KTEH 3WS3A 3FFDA 2A9NL 2VLRA 5D93B 2DTSA 1RSFA 2Y6SD 3VXNB 1F97A 3R1GL 4OV6F 3N1QC 3QIUD 4WHTB 4LCWA 1HKLH 4U3HA 5EBGA 4WI8A 2KH2B 1S9KC 4PR5B 1TTGA 4ORGB 2XWJA 2IPKA 2ZJSL 4MZ3A 1Q8MA 5L88H 1A4JB 4MQSB 5C0NC 1XR9A 5DA0B 2X1QA 3MV9E 4I4WB 3IKCA 5IB5B 3WFCH 2IWGA 2I9TA 1MCPH 4DWHA 1BD2E 2DQCL 4IRJB 1EEYA 1IC5L 3D39E 2BOBA 5D7LB 5C0JB 4N9OB 4PUBH 3BE1H 3S4SB 4AYFA 2GHWB 3QQ9D 4IMLB 2HH0H 2OI9B 1YEIH 3O6LL 1CLYH 5MEPB 5CKAA 4QHKI 1C12B 4GKSB 4F7TB 4Y1AB 1KCVL 1QBMH 2G9HB 4FABH 3R06A 1BP3B 4O9HH 2BOCB 3KLAB 2HN7B 4JQVA 2E9BA 1T1ZB 2J7LA 1QUNA 3GO1H 1I1AA 2HKHL 3QUXB 3LHPL 2QSCH 3LKPB 2B0SH 1DANU 1KCLA 1J0KA 4G80A 3EDFA 1DBBL 3TVMC 3LQMA 2WANA 4TRPH 3GBNL 2YPKA 1J11A 1MIEH 1QR1A 3NACH 4JFDA 3RL2A 1IAKA 3C09B 1JV5B 1OAZH 4R7NA 1UGNA 4Y5YA 4EDWH 5DFTA 5J4MA 1DUYA 4P5MB 4JFPB 4GLRI 3U9UB 4LKXB 1A2YA 2GJ6B 4JN2B 2APXA 5SV3A 1RZFH 2BSSA 4C83A 2DIJA 3C5ZD 3F5WB 3OKLA 4LCCB 2D7OA 5I30L 4MNQE 5ALCH 5TPWH 4O2FB 4CNIA 1FPTH 2R0WL 3MJ9H 4TNWF 3V0AC 1YQVL 1A7QL 3UMTA 4I13B 4O5LH 4NKOA 4AM0A 1EEZA 1JK8A 2B1AH 2XTJB 3BAEL 1NAMH 4TSBL 2YUZA 1EFXA 2IANB 3QXDA 2EEBA 1A7NH 2EDEA 3BISA 5EZOL 1S5HB 4WI3A 4JR9L 3ARQA 3BPNC 3ARDD 1YN6B 4X5LA 2AJYL 2ZCLL 1HIML 3HNSL 4U6YB 3VGDA 5JUEH 3TH3T 2AJUL 1D5BB 1MFCL 4YFEA 3TFKC 1KIPA 3HC0A 3IJHA 4XCCL 3E2HC 3CSGA 4OLVL 5E4EB 4JHAL 2VE6B 1EEUA 4UINL 1JZ2A 1Q0XH 3CFCL 4J1UB 3U36B 2E8ZA 4FTVA 3O45B 5HDBF 3SDDB 3PWPD 4KKBC 5IFHL 3RPIA 1G9NC 4NNXB 3B9KD 4JDVB 3K81A 4WU7B 1REIA 2IH1A 4PJ5D 1TVBA 3V4UH 3KLHC 4HKJB 2WUCL 3QIBC 3HZKB 4J4PA 1A9BB 3VWJC 1BLNB 2L7UA 3QRFM 5HGHB 4LSPL 3TT1L 4CRPA 1U3ZA 3MFFB 3S5LG 3W5NA 1U8OA 2VNCA 5IWLC 3QDGE 3TWCL 5J9PA 3RUGE 1BQSA 4X6CA 5BV7C 3BYTA 2DQEL 2FD6L 3UTSA 1HOCB 5DJ6B 3JWDH 3O3EB 3ULVD 1YEKL 1SJHB 4LGRB 4U1IB 4XNYH 4P5TD 4ETYA 1LO2H 4YPJA 5DWUH 1JGVH 5CBEA 3MV9A 2XKSA 2NY4B 4GRLA 1ZA6A 5E8EB 1KPRA 4M4RA 3LVEA 4M8QA 2Z9TA 4PTUB 4EXPX 3D39A 1H3UA 1W8NA 4RWHA 5SX5H 5SWSD 4M61B 1Z5LB 4JFFB 4O58L 5K9KA 3X3FL 4KGJA 2Q7NA 1BVLA 1MRFL 2X42A 4YUEL 4ZOEA 5FKPA 3I6GB 3O4LA 3BVNB 1VGKA 4MA1B 2GQHA 4M9OA 3BKYH 3R0NA 5I15L 1FNSL 4XH2B 1PSKH 4JZJC 3BGAA 2NY6C 2DBLH 4K3EL 3MRGA 2JJVA 1XF4A 1ZOXA 3RZCD 1IAIM 1ADQH 2RB8A 1RZJL 5I1JL 4JPWH 3U9PH 5DJ0A 2I60L 2V9RA 2H1PL 4W70A 3GI8H 2LU4A 4I18A 3HC4H 4YXKL 4YHYB 4F9LC 4Z76A 5BMFL 2P8LA 3QIWC 3RRQA 1UXWA 4ZFOL 4U33A 3QQ4B 4U3CA 1QEWA 2XA8H 1G9NH 2CK0H 4YDIL 1U36A 2WQ8A 3UTQB 4TUJB 1CE1H 1K8IB 3TJEL 3V95A 2MHAA 4J3WA 2AS5M 1SBSL 1X44A 3HMXA 3LH2H 4ZAKC 1CGYA 3LPFA 4OD2A 1BQHB 2XNAA 3DX8A 2EDYA 5ADOH 2Y5TA 2HT4C 1JRHH 1DQMH 5FO8A 5DMKB 2JIXA 2FATH 5TH2A 4DGVH 1GGBH 2EDHA 3GSWA 4L3ED 1YECH 3NGBC 5F70A 2OR9H 4TULH 1HHIA 4U7KA 2XACC 1UB5A 4QWWD 4PLOB 2DJSA 1K4DB 2HMID 1QVOB 5I8CA 1QLFA 3SCMB 2Y1VA 5AD0B 4UT6H 4QTHA 3RVWC 4R4ND 1MH5B 1NCBH 2HRLA 2D31A 2JJSC 4WV1B 1SY6H 4OI7A 4H26B 2IAMD 4ONHB 3EJYD 1AGDB 1S8DA 4KK8D 5KSUB 5GS0C 2K7QA 4Z7VE 1MCJA 5J13C 3M8OL 1S78D 2CIIA 4Q74A 5CP3H 5DT1H 5ACLA 2CIKB 4IOFD 5C86A 3AREA 3BH8B 1AHWA 5C0EB 3F65A 3K4DA 1Q94A 4Q6IB 1SM3L 2AK4A 4ZD3L 4NO5A 3V5HB 1JNHA 5JQ6L 4KK6C 5L2JA 4I48A 1VERA 3MQIA 1EXUA 5CZXD 5A2FA 3QG6A 1OAQL 1QSEB 4DFHA 3HMXL 5T1LB 1GOGA 3CGTA 5EIIA 2AI0L 1EVTC 3ETBF 2LTQC 4BZ1H 5MEOB 3L3DA 5JHDA 3KPTA 2N7AA 2VIRA 1FBIL 4IS6B 1MQKL 3QDMB 1A6TA 3OV6A 2GW5A 1HHJA 1FE8H 5E2TL 1KT2B 2J8UB 2PO6A 3G08B 4NHCH 5IB2B 5DJ8B 5IESL 1FZJB 2F53D 3AXLB 3AS2A 4KDTC 4GOSA 4F57L 1KNOB 3DI3B 2W0PA 5F3BB 5INDA 3V6OE 3VFSB 4XNMA 3IDUA 1D6VH 1VEMA 4NSKB 3EW3B 4Y8AA 2EKSA 4ALAL 3L1OL 3VWKA 5IGXL 2EECA 1ZT4B 2H8PA 5FYJD 4OCYL 4PV8A 2HVKB 3OAYK 3ARFA 1NGWB 1BFVH 3RUGA 4FNLL 1RU9L 2H2SD 1GRWA 2OLDA 4MYWB 3QDJA 4OLZH 4OT1L 5CZKA 5HHNA 3MR9A 2Q3ZA 4X7TB 4MJIA 4HH8A 3H7BA 3QEQE 4JFED 2OZ4H 4OZ4A 2LAAA 3I9GH 1MCSA 3MV7A 2WBWB 4ODWB 2YS4A 3PWJA 4UV7L 2YPLE 4I9WD 1MCQA 5CP7A 1MAML 5L7XL 5D1XB 3E6HB 1VADB 2Y07L 3KPQA 2YBRA 3SY0B 4NZDA 2VL5B 2VJXA 1AJ7H 3C60C 4DKDC 3LS4H 2BXYA 3CCHA 2R0LL 4LLAA 5GS0H 2ESVE 1IGFH 2F15A 4MA3A 3BO8B 4R0LC 3V4VH 4PJEF 1U8NB 4JRXB 1MELA 2BSTA 3JTSB 5JHLL 1PBYA 7CGTA 2XI9A 4ZODA 3HCVA 1MFEH 3MRFB 1XFPA 2YWZA 4MB4A 4DJMA 1KPVA 2HT3D 2JB6A 2LAGB 2PXYC 4EI6A 1G0YR 3TJHD 3BP5B 2D9CA 1DVFC 5EO1A 4YHIB 3S3PA 2I26N 5KZCD 1WBYB 5KSAA 4WI4A 5CJOH 1N0XL 2BVQB 1E6JL 1FN4A 4EDXB 1ZVSB 1CN4A 3FFCE 1NCAL 2VUOA 4WHYG 1S7WA 1YMMA 3RKDC 5T5NF 3SO3C 2Y5EA 4WUUE 1N3NB 4PLNC 5I75B 4HWEH 1IBGL 1X9QA 3WFEH 3L7FB 4HIJA 2IPUG 3AM8C 5ALBL 4YHZL 4JB9L 4LSDA 3VFNB 4UBDD 4DFIA 4JVWA 4XGZB 5E08H 3LRGA 1T5WB 3MRMA 1VFMA 4AIXA 2ERJC 4FQHA 3ZSSA 4NBYB 3IU3B 3WFBL 2XN9E 4JRWA 4HUVA 4BA8A 4U1NA 3S4SG 3I6KA 1F8TL 2DI8A 1VEPA 4IRSA 3QNZB 3GSXA 1HHKB 4HUUB 3TT3L 2DQJH 1GYAA 2AJSL 5J1AB 1TZHB 3NTCH 4E0RA 2A0LC 4U0RB 5CJ5A 3AB0C 5DRXB 5DRWA 3DXAB 2DQTL 2LABA 1NCDH 4MHHG 3QIBB 4LHJB 1D5XB 4OZGA 2YEZB 3MJ7B 1DN2A 4L9LC 4DN4L 3LKRB 1XGPB 1DBJL 4E5XB 3O0RL 1T4KB 3IKKA 4Z8FH 1CFVL 4KI5D 2CH8A 4OUOA 4YO0A 5EU7C 1TJHH 1W72B 3C8KB 1A0QL 3U4EA 5BV7B 5IMKB 5E1HB 1W8OA 2GAZB 4JHWH 2GY7B 4R7DB 3KPPB 4P5KB 4ZXBC 3BP6B 5I1HH 5EO9A 5KW9H 3SKJL 5ID1B 5CILH 1WK0A 4NQED 3RAJL 1RHHA 1L9NA 4PJGA 2ENYA 2EE9A 4ZS7L 3WLWC 4PG9B 3BPCB 2ZG2A 3F58H 4X5XB 3U0WL 3ZT6A 2R8SL 1CXIA 3L5HA 4LPWA 4A2MA 1T89C 4Y5VC 5D8JH 3IAQA 3QT2A 2MQCA 3MGTB 5C8JB 1UXSA 5GRVK 4EI5B 1B6UA 5EPMB 5K9QI 3MREA 4UU9A 5DO2C 4GKNB 1Q1JH 4G8IA 3VGBA 4YZFF 2I24N 4D2NA 3CPLA 4C56D 3SOBH 2DWDB 3PHQB 2UWEA 5C71A 4JZJB 2V7NB 4FHBD 1J1PH 3FB6B 3ZLQC 3MROB 2NY6B 3C8DA 4LSVL 3ULUE 3OG4B 3FZUC 1K9TA 2FBJH 4HCRH 2VDMH 5T33H 3MLSH 3QWOA 5KSVA 4LQFL 4LNRA 5TDOA 4EBQL 4XZUA 1KEMH 3MLRH 3MLTB 4R26L 3ZDZF 3NH7L 2DMCA 4KJPD 1F4XL 4I3SL 5B3JE 4U2YA 5EZLB 5JPNA 1EHNA 2CR6A 1AGFA 3ZTNH 1JHKL 1RIUL 3CFEB 4WW2A 5CEXB 3DMMB 5DD0H 1FCGA 4HXAL 3VJ6A 4LLMB 4NYLB 4NJAH 4H0HB 4NO2B 1A47A 4HUXA 1IM3A 2E5EA 1FVEB 1TVHB 4LASL 2BMKA 5HGGS 2HFFA 3EYFB 4KRPB 3ZO0A 1A6AB 1RZIB 1QPXA 4ZAKB 1ORQB 2E9JA 3PGDA 4XPHL 4ONGH 3SDYH 5E6IA 2V9TA 2HT2D 3BOVA 2AABL 1YMHA 3MA9L 3O8XD 5IJVB 3IDJA 4Y2DA 1UACH 1F00I 4MLSA 3E1F1 3HZVA 3WEXA 3WYRA 2FX7L 1KTLA 3P4MB 2MQ3A 4Y4HD 3VH8B 4HIIB 5DZOA 1QACA 4CGTA 1T6WA 3UC0L 5BW7A 3LSOA 4PJIE 4H20L 1W0YT 4HJGB 3L95A 5H35A 2DL2A 5F9JA 5BS0A 5J13B 3RGVD 1FYHB 2X4RB 3WLBB 3QPXL 1UZ6F 4UTBL 4Q6YA 1KELH 5EOCL 4E9LA 2X4SB 1I4FB 1SYSA 1MCLA 3P30H 4LEXH 3RTQB 1KJ2B 1QYGL 1AGBB 3CFKB 3MCLL 1TDQA 4G9FA 4JLRA 4L9DA 3W2DL 5E6YA 3BYYA 3ZDYF 1OAYL 2QHRH 3SDAD 4D0CB 3OXSA 5J3HC 1QFOA 3LZFL 1XIWB 2YRZA 1E27A 3B2UD 4X9IA 2XN9A 4OJFH 4Z7WB 4QYOA 4YBLC 5IHLB 3B9AA 1G9EA 4KQ4H 1AD0A 2DLGA 1PEWA 1H8OA 1EAPB 3REWA 4BM7A 4QRUA 4JFXA 5C2BL 3IDMA 1HYSC 5ICXA 3TGXA 1KLGB 3ZE1E 1BREA 2L7JA 3U7WH 1M4KA 1WBZB 2EDFA 3KPSA 4MHHI 2APWA 3VGHA 2EDQA 2AV7A 4NM8L 1TVDA 5IMOA 4GAYB 4Y5YC 3ZKND 3OAUL 1HN1A 3ZMRA 1IC5H 2J3SA 2H41A 3CMGA 1JZ6A 3MLPA 3WNNA 4DGIL 5HYJB 3Q1SL 4OLUH 3EO0A 1DUZB 2ADGA 4Y4KB 3TBWA 3QUZB 2UV3A 3WIIL 1KEGL 5IOPB 2CLRA 4O02L 3T08A 1MREH 1G6RH 5AAWA 4RGMC 1NLDL 1QRKA 2DBJA 4M1GH 5LCVL 4X7EC 4ACPA 3HNVL 2AVGA 1F4YH 2VWEC 1S7XB 3UBXG 5CHNB 3NCMA 5ACMA 2HKHH 3WUWA 5EC1A 3LHPH 1I8IA 1IGIL 2IQAA 1P1ZB 2QADC 4J8RB 3C60B 4WJ5B 1A4KA 2KZWA 4GBXB 5JW4N 5E8OB 3G6JF 2IALB 5HGAA 4R0LB 1XF3B 1M7DA 4GG6B 1MCDA 3BKML 1TJGL 2E27L 4M93C 3QYCA 1CIUA 3QNXA 5E9DA 1T2QL 1NLBH 3G04A 4X6BA 3FQWB 3ARYA 2QQQA 2NY3C 4B50A 2FB4L 5F9DC 2G75B 3GHEL 3FMGL 3U7YL 1F3DH 2FJHB 4XWGL 4AY0A 2FR4A 5I1EL 2BP3A 3T0ED 1TJIL 4F3FA 1T03H 5I30H 5IB3A 1QRNB 1Z0NA 5F6HJ 1NUNB 2R0WH 3AY4A 4JGJA 1U8MA 2EDJA 1XGRB 2B4CL 4P2QB 1KPUB 4YAQA 2OJZH 1ZLUH 1MFBH 3CNKA 5JXAL 5JO5A 4J4PC 3L3GB 3T2NH 1LO3L 2EC9U 3MRLA 1UM6H 2YD3A 5F89A 5EZOH 4LSRL 5GRYA 5EUOF 3SE8H 3IFLH 4S1RL 2GEEA 3CD4A 1ZTXL 4WFFD 5F9OH 3CZJA 4QNPF 2V9QA 2ERJB 5C7XL 1HIMH 1IGTB 5A3IC 1T7ZA 1MI5D 2R1XB 5A16A 1CL7L 3B5HA 2EE2A 1U3YA 3DUHA 5I1GL 3KYMA 3RU8L 1WWAX 4ZOCA 1K4CA 2PYEA 4ZFZB 3KPNA 5T3XH 3V5DA 1HQRB 4ZUTA 3PWPE 4N9GA 5E8NA 4JHAH 1DN0A 1OW0A 4LRIC 4UB0L 4E42B 4Z0XA 4X6EB 4HPYL 3ARVA 3AB0B 2FX9L 1HDMA 4ZQKA 1EERB 1ZT1B 5IFHH 1XEDA 4HWZB 4PJ5E 3EYOA 5LXGH 5HDQH 5BRZB 1EJOL 3CH1B 1HH6B 4L4VD 3S88H 4EQ3A 1YYML 4LOUD 4QO1A 5EO0B 8FABB 1DEEA 2BNQD 2W9EH 2PUQT 3QCUH 1YDPA 2V2WB 3BEWB 3R4DA 4PJCF 4JDZB 1MHCB 3L3JA 4ZXBB 2VLKB 4QCIA 3GUTA 4G3YL 1ONQA 4JM2D 3TWCH 1H3PL 4PJXE 2FD6H 3GZKA 4K3GA 1WT5A 5H2BA 3O3DB 5DUBA 3CVHB 3RVUD 2IH3B 5E8DH 4LKCB 3EO9L 1FORH 3TA3D 3P9LB 2C3HA 5I1CL 5C09D 4PGJA 4R4FL 2A6KA 3DOSA 1WSST 1FYTD 5IW1B 3W9DA 1P4BH 5SWSE 4M3KB 4GW5A 2WIIB 3ILQD 2IADA 4LCYA 1WVZA 3TBYA 1C1EH 3HFML 2BSRB 4N90D 2ORBL 4OBRA 2A83B 4FQXC 4YUEH 2A77H 1MPAL 1NCWH 4JFYA 2PNDA 1FNSH 3UBXI 2FHBA 1QOKA 4X0KA 4CW1B 2ADJA 1BZ9B 4K3EH 4V1DA 1I1FA 2YD8A 2W9DL 4MQ7A 5DMIH 4XI5C 3CJJA 3MO1A 3GBML 5CCKH 5I1JH 1OY3B 1U3HC 3RWDB 3ZE0E 4HDIA 1NAKL 1D3CA 1F3JB 2I60H 5KVFL 3OXRA 3P40A 5B38A 2J6EA 4NUGH 1I85A 5DHYB 5KSBE 2Q8AL 3NCCB 1MCFA 1RFDL 1C16B 4RQQB 1ZHLA 3GGWA 1T6VN 5JPMA 4LHUD 4UIMB 1G6RB 4M7ZC 4HJ0C 2FGZA 5DJDA 3ESUF 3WO4C 3FB8B 4YDIH 3BKJL 4QXTB 1L7IL 1CG9A 3BWAA 3C5ZA 4L3EE 5F7KC 5LGKA 4LPUA 3RY6C 4YHPB 1CGVA 5CKGA 1AGCB 2OK0H 2B1HL 2ITDB 1E28B 1CFSB 5EFIB 4EUPA 4K9EC 2NCMA 1J87A 1FO0A 3NCYP 3KG5A 5ESAA 1OD9A 2PW2B 2JK5B 1NDGA 3W11D 1ZXQA 1WUNT 1A6VL 3M8OH 4F7MA 5JLZB 2J6EL 4OM1H 3E6FB 5TFSL 3QZWA 1HKFA 4IRJD 1Z6JT 5HI3C 3RQ3A 3GJEB 2ZUXA 5D7LD 4YHNB 1T83A 1SM3H 4PJ7E 2D7TH 4ENEC 2P7TB 1M6OB 3RGHA 1CFQA 2P8MB 5IK3B 2Q7YB 5DDHA 4YBLB 1OAQH 4LMQI 2R9HD 3LEXB 4NQDB 3TBTA 1KIRA 4N8PA 1B9ZA 2AJZA 1FBIH 4HF5H 1R5IB 1JJUA 1I9RH 5D7IF 2R1YB 4KJQC 5E2TH 1NBQA 2F53E 2C3VB 3GB7A 2Q76A 1WWCA 1GGUA 1FO0L 1MRCL 3INUH 4RRPA 4BUGA 4ELMB 4QF1A 2PF6A 4S0SD 2IF7A 5BVJA 3OHXB 5L6YL 3LKOB 2FSEB 4XNZC 3RVTC 3B8SA 3Q5OA 1MCNA 4OLWH 4OF3A 4HIEB 5FYJE 3KPRB 2VXQL 3Q5TA 1I3RB 2IGFL 1JNJA 3QA3B 2W91A 4OCYH 4ZPTA 2HLAB 5IFAL 3L5XL 1U95A 4P5TA 3HB3C 1J1OH 4JFEE 4JRYB 1EBAA 4FNLH 4QRQB 4NWUH 4EQ2A 1S9WB 2XQYG 5IFJB 4OT1H 3O2DA 5D9SB 1ZGLB 4RGOL 2VISA 5TDNB 3R8QA 4TNVK 4I9WE 5DURB 3IVKB 1FGVH 5DZLA 4Y16A 3KNBB 4PJAB 1AR1D 2VDQL 4UV7H 5F1NB 3UEZA 2IAND 4N5ED 3WL9B 2XQBL 3VH8G 4K9EH 1N5AB 4H88H 1T22A 3IB4A 3I2CL 4Y4FB 4M93B 4IDJH 3EOAB 4TUOA 1U2HA 3JVGA 2R0LH 2J5LC 3ME0A 3PDDA 1LE5B 2YHGA 2NY3B 3BZEA 3SGDH 4PJHE 3VCLA 1YEFH 1JF1B 4YR6A 5AZEL 4QTIH 4LSQH 1CGTA 2K7PA 3ECBA 2CDGA 4L8BA 2UVFA 3LQAC 5TE7L 4LLVB 3SKOB 3ULVL 4KKCC 4LSTL 2NXYD 4OCXL 5ADPH 1OARH 1IM9B 4U4BA 1VFUA 1IKNC 5AZ2L 2DQFB 1JF5A 5MP6L 1X5JA 4XPFL 3D18B 4PJEA 3X3GL 3S37L 2FJFA 4ODHL 3PQYB 2VDLL 3NN8A 5F9WC 1N0XH 3GSUA 5FYKD 1D5MB 4PIRF 4XP6L 2IPTH 4LF3B 4KZEL 3D48R 2R69L 3L5IA 4X7DC 1RULL 2ZUQB 1ZVYA 4LLDB 5DEGA 4HIXH 4LU5H 1JGEB 4XP4L 3A0OA 4GAGH 1IFHL 3FHAA 4QT5B 4YHZH 4JB9H 3FTGB 1VGEL 2P47B 4YBQD 3IFNL 4F2MB 5FA4B 1JPTH 2A6JA 1LILA 4PP1D 3GNML 1U58B 4M48L 3GMMA 1QO3A 4OLEA 4Z78A 4OAWA 5ETUB 2N4IA 5A2IH 3MYJB 3O6FA 1DSFH 1YEDB 1R3JB 1N2RA 2ZSVB 1BD2B 3MUZ1 5DD1L 4D0BA 3HC3H 4HZAA 1IAIL 1F6AB 2BY1A 3ARBC 5F8RC 3V6OC 1JGLH 5FGBC 3S8WA 4XBGA 2ID5A 2NY4D 3FT3B 3P77B 3BKCL 3MLVL 4UILL 2Z91A 3V6FA 4I2XE 1CLZH 1YY9D 2NY0C 4BKLB 2X4OB 3F12B 4LFHD 4KI5E 4JFFD 2VKWA 2Y7QA 3MTRA 5DSCB 5LQBH 4U1KB 5K9JL 4N5UA 5IB4B 2JJTA 4URTB 1BBJB 1FG2B 3U4BL 4HAFA 3VW3L 3QCVL 3VFOB 3DBXA 5IW6B 3MRQB 5GJSH 1O7VA 4X6FB 2NY7L 4NQEE 2BCKB 3VMPA 3KYKH 4OIBA 4N8CH 4X4YB 3LB6D 3SKJH 3VXPB 4HS8L 3MX0A 1P2CA 1NCTA 4QHLA 4M6OL 5CWSA 2APVA 1HWGB 3LRHA 4L3CB 3N1FC 2AW2A 3FQTB 4WY7L 5GPRA 3VI4E 3U0WH 4MXWL 4MQXD 1CXHA 1DDHB 4NRXB 3RWFA 4KFZC 5GGVL 4RA3A 3BN9C 3IXTA 1JZ7A 1S9YA 4BQCA 4OZIB 1UZ8B 1CGXA 4C56E 1KXVC 1T0NA 4P23C 5D5MF 4FQXB 3S3SA 3RIFK 4R9HA 1FNFA 3QUKA 4NBXB 3VXUD 4GXUN 2CUHA 2VXTH 1UA6H 1IL1B 4JY6A 4MNQB 4NT6A 5GJTH 4MD5A 3VXSB 1CFNB 1SVZA 4Z7QF 3I3DA 1G7QA 1J8HB 1G7HB 3HE6C 4LSVH 4N0CD 3MRCA 4DN3L 4CMMB 2XWBA 3N85L 4EBQH 5BZWB 1KACB 3SCMD 1AR2A 1T20B 3NH7H 3TN0D 1U3HB 1C5DA 1URLA 3G5YB 4I3SH 4OFVA 2DWEB 1S9XB 1KTDA 3QPQC 4NN7C 3KWWA 4PRPB 3QUYD 5DFWH 3MLXL 1B4JL 4RMRA 4P57B 3MCKB 2FRGP 3MPCA 3VFWB 1T1XA 5J6GA 5DD6B 5CEYB 3FRPG 4M7ZB 4P48A 5J6HA 1OAXL 5IJKC 1E6OL 5FYJL 3WO4B 3FQNA 2ED7A 3UPRB 3ZE2F 1PYWA 1FH5H 2BX5A 4YFLI 4MD4B 5IMLA 2OR7A 2WP3O 4XPHH 3DETC 1MIML 1QSED 4ZPVA 5E2VH 2AABH 5T1LD 4WHCA 5CJXA 2H9GB 4GXVH 1IC4L 5C6TH 5AYUH 3QDMD 5BO1L 3LQZB 2RIKA 5IEHB 1LP9E 1A7OH 1WLHA 3UC0H 4R3SA 3WXVL 4H20H 1U93B 3RI5K 3H9HB 2MJWA 4M7JL 4RMVA 1JE6A 3SGJA 3IDXL 3AAZB 35C8L 5JIPA 2C1PA 3SE9L 1DBAL 1FAIH 4UTBH 1FZKA 4HW6A 1JUFA 4ZS6C 4POZC 5CINH 3QDGB 4JGMA 5IB1A 5C0FA 1MJ7H 2ZOKA 3SKMA 1MJ8H 2X05A 4G6FB 5J1TC 4M9PA 1ZHBA 4X6DE 1ZLWH 3LZFH 3T3PF 2PN5A 4K71C 3BQUA 4PGDB 4CVXB 2IBZX 2YN5A 3I50H 4HFUL 4ZSOE 1GZPA 1RI8A 5IVXF 4ODVL 1WEJH 1I3GH 4XMPL 5KG9A 3WSQH 1L4IA 1J05A 1QKZH 2IJ0C 5C2BH 5HYIA 2YPVH 3MC0A 3RY5A 4KXZH 5E24E 1U2CA 5EBWB 2GY5A 3DUUB 4APQA 1OAKL 4HH9B 1A7RH 3LY6A 5DUMH 4FQCL 1F90H 4IHOB 5D1XD 3T65B 4ZTOH 4I2XA 2VAJA 4KTDL 3HR6A 5GRWA 4K23H 1CFTA 4CN4A 2Y23A 1AD9B 4UMGA 5CSBA 3B6SA 3IYLW 4H1LA 4PRHB 4PRBA 1LO0H 4X9GA 4JRXD 4OCRL 2VQ1A 4H0IA 3ARRA 4DGIH 4MD0A 1H5BA 4G6ML 3I75A 1D7FA 1NDMA 1J5OH 1MHHB 2W0FA 1QQDB 1Q9KA 2R29H 1MCWW 3KVQA 4NQEA 4ZO6A 3S34L 3RWCB 1HSAB 5DEZA 1NFDF 5KVGL 5INCA 4GO6B 3GHBH 1NLDH 1X7QB 3AY4C 5LCVH 1J0IA 4DTGH 3ROOB 2UYLA 1ES0A 4NM4L 1GGIH 4R4BB 1CXKA 3MACL 5B21A 3W9EA 4F7CA 2HTKD 3ZDXE 1IGIH 3FB7B 4MB5A 3HRZB 4G9DA 4JFHD 4PG2A 2BDNH 4PB0H 2NMSA 3N9GH 1PX4A 4C56A 1UENA 4L3AA 4MDJB 4HWNA 3PL6C 2E27H 3PWUA 4HKBA 43C9A 1T2QH 1DANT 1R0AH 1A9EB 1IGMH 1GZQA 5T3ZL 1M1SA 3CVIH 2FB4H 4JM4L 2ICEA 3MRJB 5J57B 3CXDL 4PJ9A 8CGTA 4JPIB 4JZNA 4OZFA 3T0EE 1GHFH 4XWGH 3MOAL 1BOGB 4Z7VB 5MI0B 1W0WB 3G6JA 2WWMC 3T1WA 3LOWA 2AJXL 5CD5C 5E5UB 4MDIB 4RSVA 2BNUB 1PVHA 1RZKH 5F9WB 4MCYA 5FEBA 2AV1B 3IGAB 2J1KA 3NAAL 2Y6SC 3DXAD 3KLHD 3UJTL 1NGXB 3QIBD 4YBHA 1I9JH 3QIUC 3O8XA 4WFFE 3BPLC 5FECB 3QG7L 2EEAA 4YEEA 2FYYA 3UAJC 1CZ8L 3BESR 3GIZH 4LSRH 4ZUVB 3OJDB 1MI5E 1HH9A 1ORSA 4X8JA 4S1RH 4KHTL 3V52L 1MFDL 4Y4HA 3STZA 1PG7W 4N0UE 1P84J 5D2NB 3ALWA 5C7XH 4YE4L 4FXLA 5DJZB 2APTA 3W0WB 1LE9B 1WT5C 1CL7H 3ULUH 4X5WA 3SDXF 5ID0A 1KJVA 1LP9A 3IDGB 5I1GH 3MLYL 4Q2ZA 3RGVA 4W4OA 4LEOA 3U0TB 2XY2A 4FFYH 4G8EA 1P53A 3ARBB 1JIBA 3MRPA 5I71C 4HZLB 4Y5XC 1BZ7B 3BP7B 4D8PA 3GMLB 3QQ9C 4UI2A 1GGTA 3GSOB 5IF0B 4L4VE 2MCPL 2A2QT 2FX9H 2NY0B 3NMEA 3VMOA 2MNUA 3WHXB 2PW1A 4MNGE 1YC8A 1FCCA 4Z7UE 2BNQE 4EI5D 2FIKB 1EJOH 5I76B 4LBEA 5HD8D 4X6DA 1V3MA 5C92A 3BHBB 3QEQB 3L5JA 4XNQA 2NY6D 2G60L 4OKVA 4HMDA 4G3YH 1GC1L 4ZDHB 3GK8H 2YPLB 3HA0A 3LCYA 3P4LA 5C07D 3TCLB 4U1HA 4MAYD 4HQQL 1HXMB 3UTTA 1FYTE 4MCZA 3EKCA 3SE3A 2VXVH 3DMMD 4PJCA 1JL8A 4O4YL 4CMHB 5I1CH 5ICZA 4KZDL 1CU4L 1ND0B 1T1WB 5GS1B 2DQIL 3PHSA 4N90E 4UDUA 3MNZB 4P23B 4CVZA 5KTEL 2NLJB 4KRPD 5CMAB 2ARWA 25C8L 3UJJH 3KDMB 1U8PB 3HLAB 1NCNA 4PJFE 4PV9B 4LVNC 2P5EA 1KCSL 3HE6B 4NHUB 3V6BR 4ODTL 1DCLA 1LQSR 3V0VA 1KB5A 4KK9D 1NUFA 1MCRA 4P9ML 3TNNB 1U8LB 4XNXL 1GVIA 3FFCB 2UZXB 3PP3K 4G8FB 4UTAL 1AXSB 1MUJA 5ENWA 2EICA 2W9DH 4WUUB 5JXED 4YX2H 1UFUA 4YLQT 4KQ3H 3ARDC 3RL1B 2IC2A 3FCTA 3NFPB 2D03H 2X89A 3MRBB 3QO1A 1RURL 5C0AA 5CIPA 5IEKB 4RBPH 3RTQD 3D69B 1RFDH 1PZ5A 2WUBH 5C3LD 2YSSA 1OSPH 4NPYA 1ZSDB 4PRAA 4X4XA 3O2VH 3IF1A 3GMNB 1FVCA 1SYVB 5HJ3A 1XIWD 1G9MC 2OP4H 1L7IH 3BKJH 3ARWA 2X4UB 2VZSA 3BWUC 3QEGL 4WO4A 2CDFB 4DW2H 1MLCB 2Q20A 3I85A 4YPGB 2X44D 3GSRA 2EXWD 1HQ4B 1KCUL 1XGUA 2X9YA 3B9KC 4QRRA 1JZ4A 4QRTB 43CAA 2GUOA 2B8OT 3GSNA 1OAUL 2H2PC 4LCUA 3QXUA 2VLJD 4NKQB 5F7NC 1FAKT 1RIHL 3ORJA 3SE4A 1X4YA 3VFTA 1HXYA 3JV0A 1WAAF 5D7LE 5BCAA 1ITCA 2EDLA 3L3KB 4LK4A 2W65B 3O6KH 5FB8A 3DX7B 5TFSH 4HPOL 1H3WM 3FRUB 3H9SD 2DL9A 3LN5B 5HYJD 3X11A 4O51B 1PLGH 4Y4KD 5ICYB 1FSKC 2O5YL 3QUZD 4ISVB 5GZND 4L29A 2F8VA 2XYCA 5DJ2B 1A1NB 4XXCC 2DKUA 3ZYZA 4ODXB 5HVGB 4XPTL 4OF8A 3CUPA 5HHOB 5I66B 2P8PB 1J12A 4YIQB 5HHPB 2A6IA 1T1YA 1GIGL 5B39A 5BXFA 1H3GA 3IXAA 4YXHL 5D2LF 3RVVD 2HVJB 5J7CC 5FF6B 1OM3L 2JCCF 4EUPH 4L4VA 3RWEA 4P59H 1SJEB 4YDKH 1VPOL 5JIIA 4MNGA 1K8DA 4GBXD 2BNQA 3D9AL 4Z7UA 5A1AA 4AH2B 5CD3B 2P24A 3PIQA 3RY4A 4Z6AT 2EH7L 1IILE 5MENB 2FH6A 5IM7B 3HE7A 3ZYJA 4M7LL 3CFDA 5EU3B 3DX6B 4XRCA 5B8CA 3RZCC 1MHEB 2VXQH 5DMYA 1SEQH 2P46B 4FP8L 4NQTA 1FIEA 3QFJA 1K5NA 3EO1A 4H25B 5I0DA 4LLWB 1G7IB 2O5XH 1OT1A 3VA2C 2DQUL 1DE4A 2NQCA 3TA3A 9CGTA 4KJYA 1S5IL 3WDHA 5C09A 1JPGB 3SGKC 4LP5A 3IRZA 1DLHA 1QRND 4PLKD 3GMOB 4L8DA 4MA7L 4U6TA 3LKQA 5I0ZA 4L8CA 4U1SB 4U1MA 1HNGA 4NQVB 3RKDD 3VRIB 1NBYB 1WC7B 2XQBH 4PRIB 1WQVT 3OKMA 3BSZH 3PL6B 3RX5A 4RISL 3TZVA 3G5XA 4QWWC 5FA3B 5GSVB 2FGWL 1KGCD 2FECL 2D7QA 4R4NC 5ACZB 5AZEH 3QH3B 3L7EA 2IAMC 1BM3L 3EJYC 4KK8C 3ULVH 4JG0L 3WE6A 3E3QC 4G42B 5KN5B 1P7HL 1S78C 4GRMB 4YHOL 4I0CC 4OCXH 4RAUA 1TZGL 3EGSA 4IOFC 2J2ZA 4LDEB 4Z7WF 2CDEA 1KTKE 4OIAA 3O2DH 5MP6H 5FYKE 2A0LD 3IDNB 5JW4M 1IEBA 3B9EA 4XPFH 3VXME 1JZ5A 2XPGA 1G7LA 5CZXC 2VDLH 5C08A 4EN3D 4ODSL 3FO9B 3BPLB 1ZVHA 4LARL 3VXNA 4CADA 4DUWA 1FLRH 1ITBB 4TYUA 5F8QC 5EN2B 4S2SB 3VFGL 1V3JA 5DRZB 4WHTA 2VDNL 2GJJA 2LE9A 3BGMB 4XP4H 3EDDA 3WHE0 1EDQA 3D2UD 2VLKD 1VGEH 3WN5C 4PR5A 1N0LA 3GJFK 1XZ0B 1Z0MA 5CLTA 4JVPA 2JLLA 3VG9B 2F58L 2YXMA 4I4WA 5IB5A 5I71B 4OGXL 1UM4H 1WIOA 5DD1H 1AC6A 1MJUL 4IRJA 4N8VB 2DF3A 2FEDD 2XWTA 5LKNA 4KMTH 5D7LA 1S9VB 2ED8A 5C0JA 1KYOJ 3WKML 5GS2H 4GRWB 1YPZE 3S4SA 4N0FB 4OFYA 2O93L 4JFFE 1HILB 5DS8B 4UILH 4ZUSB 2UUDH 3P4OB 1BPVA 1U8HB 5MEPA 2H2SC 4AEHL 4GKSA 4F7TA 4Y1AA 5F7UA 4TOYH 1FL5B 1YEEL 4K8RL 4U2ZA 1FFRA 2G9HA 1FG9C 2VDKL 1I9IL 2FO4B 3VRLE 2X9WA 2BOCA 4JAMB 2HN7A 1ZA3B 4GG6F 1SMAA 2A74A 3QUXA 2IQ9L 4NZJA 2VH5L 4PJDB 3LKPA 4WI5A 3VDBA 1RK0B 1R5VB 1E4WL 1C5CL 1MLBA 4MS8D 4OF7A 4M6OH 3PWLB 4QKXB 4X80H 1JV5A 4HS3B 2JELH 4XMKL 2WWKT 3QJFB 1G84A 3X12B 2XZAL 4GAJL 3VXUE 4P5MA 4D0DB 2IPUK 4JFPA 3U9UA 1C5BL 2NY1D 4LKXA 2GJ6A 1C8PA 2HT3C 4F8QA 2R2BB 4LLYB 2Z31B 3TJHC 4WWKA 5IW3A 3F5WA 4LCCA 2A73B 5LBSH 1GOFA 4O2FA 3ARZA 2NW3A 4I5BB 2ILLA 5JNYB 4KTYA 3KR3H 2RHEA 1NEZB 3ARGD 4GQPH 4MJ6B 5CEZD 3TIEA 4X4ZA 3WKNA 5I1LA 3GM0A 4KV5E 4OUUB 2IANA 3ARDB 1BFOB 4OLYH 3DX9B 4ODUB 5KBNC 1JWUA 1S5HA 4OQTA 2DM4A 1AC0A 1NUDA 5L8LB 4UBDC 4EVNA 1HK6A 3FAWA 3PDOB 1YN6A 4BSWA 2HRPH 2KPNA 3RHWF 4YHKL 4U6YA 1JNNH 3F7VA 1D5BA 1QSEE 5FYJH 3QHZH 1LHZA 3C5JB 5GS3A 3B3IB 3QDME 3N0PB 3PWPB 5LGJA 1HINH 3VFUB 5D1ZC 3B9KB 5AWNL 4DKEL 3U82B 4J1UA 2J8UE 3U36A 3O45A 3CSYB 3SDDA 2R2EB 2ZP0T 1NCUA 5CJBA 4NNXA 4F37F 4L1DA 4JDVA 2VXSL 1AFVH 3WXVH 1T04B 2PCPB 4WU7A 4XC3L 2W07A 4UT9H 1IKFH 4HKJA 3MODH 1EK3A 4KI5C 4PS4L 3HZKA 4BFIA 4K3DH 1A9BA 2XY1A 1BLNA 2ZZUT 4OQTL 2VN4A 2XG5A 5HGHA 2VSDA 5EBMB 4WI2A 4MZ2A 5D6DA 5HSFA 3MFFA 3S37X 1RD6A 3WS6C 3LS5L 4FFWD 5TQ2H 5GHWH 1FSKB 5K59E 1JGUL 1YJDC 2V7HB 2VXUL 3CK0L 3QFDB 3T1FB 4RZCB 4PJXB 1N4XH 5EOQL 5DJ6A 1ZGLM 1SJHA 3W39B 4U1IA 4BH7B 4WEUD 7FABL 2QQKH 4FQLH 2CPCA 3RWGB 1WTGT 1CDYA 4JEGB 5DR5L 3LKNB 3MXVH 1BOYA 5DMJB 5SWSB 3C9NB 4MXVF 3DVIA 4XMPH 5E8EA 1YEHL 1EEQA 4JJHA 4PTUA 3QQ3B 4PG2C 4W68A 3D0VB 3GBLA 4NOFA 5GGTH 2CLVB 3SJVB 1MCOL 1Z5LA 4JFFA 1CGWA 4CN6A 4JQXA 4FZEH 3I6GA 4Y4FD 2N1KA 4IBLT 3BVNA 3PABB 4JRXE 2QKIB 2HTLC 1CS6A 3V4PL 3RZCB 4Z7OF 4XH2A 2NY3D 3TV3H 1FDLL 4KJPC 1RMFL 3IKCB 5T1MB 4WEMB 3GMPB 1CDJA 2KBGA 5SX4I 3LRSA 1EO5A 5T1DL 3NIFE 4NNPL 3ZT7A 1IM9D 3S34H 4QRPB 1YC7A 5KVGH 5KSBB 2YKLH 2VZVA 2J8HA 4K3JL 4UAOB 1F42A 3M07A 3NA9L 4K07A 4JFHE 3UO1L 3PQYD 1L9MA 4MJ2A 3MACH 2HT2C 1OSZB 5ISZE 3R06B 3UTQA 3QDHA 4TUJA 4TSAH 1HKLL 1NFDA 2A9MH 4L3EB 5IUSA 5KJRL 1BQHA 2RBLA 5FO9B 4XNUH 3FO1B 4I0PC 5DMKA 5ECJE 1R3KB 1F4AA 4P2RB 1B6DA 5L88L 1RUMH 1U8KB 4H1LH 2FDBP 4F9PA 4P3CH 3ZKXC 3WFCL 5KANG 1K4DA 2IAMB 5FOBB 5FGSA 1MCPL 4YHLH 3H3KA 5B22A 2EDWA 3SCMA 5AD0A 1EPFA 1UCBH 4WV1A 1MAJA 4R7NB 4H26A 3MOAH 5ESQB 5HGDB 4ONHA 3VFVA 1AGDA 3DO3A 3KYOA 3BE1L 4HHAB 4PUBL 5KSUA 2GSGB 3T8XA 3W82A 4OV5B 1Z2KA 5EUKB 1RZ7H 1CD1B 4M6AA 1RK1A 2CIKA 3QI9C 3T0XA 1YEIL 4RMUA 5C0EA 3DXAE 4Q6IA 5IIEB 5EULV 3QRGH 3SDAC 3V5HA 3WD5H 2QV2A 3NAAH 4A6YB 1QBML 5IBUG 1TXKA 4PJ7B 4CNIB 1XCQA 3B2UC 4O9HL 3EYQD 2VR4A 5JW3H 1QSEA 5DHVH 3GO1L 3PWVB 2AERT 4ELMF 4KKLD 1WIPA 3QG7H 4P3DB 4JG1H 2QSCL 2BJMH 2B0SL 5FUZL 4IS6A 4M7KH 3TP4A 3QDMA 2AJVH 2D3VA 1QNZH 3WN5B 4TRPL 3WFHB 1KT2A 3I6LD 4XPAH 2J8UA 1RJLB 3G08A 5L8JB 3NACL 5IB2A 5DJ8A 1FZJA 2QSQA 2D7PA 1ZANH 2EC9T 1OAZL 1RUQL 4OZFH 1LO5B 3AXLA 3GMRB 2H6PB 4HWBA 4JKLA 4EDWL 1KNOA 5BOZG 3ZKNC 4RWYH 3ZSTA 3L3IB 1VFBB 5F3BA 1LEGB 3VFSA 3ELAT 4JO1H 4NSKA 2F54D 1KIPB 1RZFL 1A21A 1ZT4A 2MCPH 3ZKSD 1JHTA 1P4LB 1WZMA 2HVKA 3HS0B 1TFHA 5ALCL 5TPWL 3MJ8A 3MJ9L 1NGWA 4BK5A 4JFEB 4FTVB 5GQBA 4O5LL 2D9QB 3VXSD 2K1MA 2B1AL 4LPCA 3RVXD 4X7TA 1JYWA 4LSSL 3GKZA 1J8HD 1SEBB 1UQSB 4R96A 4UIKH 4LIQE 5C07E 4HIHB 4OB5H 5I74C 5KS9B 5LVEA 1TVBB 1A7NL 4PGBB 4ODWA 4IIQC 3KPOB 1H0DB 1GC1H 2VAAB 1I7UB 4KXZI 3AROA 3E6HA 1VADA 4FQPA 3SY0A 2VL5A 4PRPD 5JUEL 4M5ZH 5FFLA 5J9PB 2COQA 2X4QB 4U49A 1U8QB 1HE7A 3MMEA 4PJHB 3BO8A 1QFPA 1IGCL 1BF8A 4JRXA 1WFTA 1JN6B 2R4SH 4HS6B 3JTSA 3TBVB 4R2GC 3DARA 5IT2L 2X7LB 5KTEH 5CBEB 25C8H 3MRFA 3T0EC 2BFVL 1AGEB 5C0IB 3VI3E 4ZFOB 4ZYKB 5D7KD 3RWJB 1JPFB 3BP5A 3OJMB 4YHIA 1WBYA 4YGVA 1CLOH 3BRFA 2CGRL 5K9KB 4P9MH 4EDXA 3KLDA 1ZVSA 4OTXH 5DJXA 1VGKB 3B4NA 2Z93B 5GSRB 4V2BA 2E6JA 4J6RH 4PY7B 3TYFB 3MRGB 5JQHC 5DTFA 1ACYH 1XF4B 3L7FA 5IQ7H 1KJMB 3TPKA 2NNAB 4GXUM 3JWDL 1U42A 1ADQA 4XGZA 2OCFD 1YYLH 4OSUH 1XF5B 1T5WA 5DWUL 4ENED 4OIIH 3IU3A 4ERSH 4AEIH 4RX4D 5D1ZB 1DBKH 3EFFB 2BNRD 1UH4A 3QNZA 3VDCA 1HHKA 4HUUA 5J1AA 1J10A 3BPOC 4KJQD 3TO4B 1TZHA 2MHAB 2VLJE 1BVKB 1DQDL 1KB5H 5DRXA 1MWAH 4OD2B 3KLSA 4NKIH 5EBLB 1JF6A 3QIBA 3THMH 3JWNC 5FO8B 3A6CL 3GSWB 1RIHH 3EJJX 3TLRA 1U92A 5D70H 3LKRA 1XGPA 4E5XA 1T4KA 1FHGA 2DOCA 2DBLL 2FIRT 3H9SE 5SX5K 5D96C 4WHDA 2VITB 5HYJE 5B38G 2AK1H 4O2EB 5CIPH 1ADQL 3C8KA 5IWLA 4HPOH 4JM2C 3GRWA 3PHOB 4PRHD 5IMKA 4JPWL 3U9PL 2GAZA 3P0YL 1PJ9A 3KPPA 4P5KA 1IT9L 2P42B 1CDUA 3BP6A 4CBPA 4Y88A 5DVOA 3RVUC 1CL7I 2ZOLB 1FGNH 1E4KC 32C2B 5ID1A 4U6VL 2AK4B 2GTWB 2C1OB 4H0GA 4PG9A 2OTWA 3BPCA 4X5XA 1G9NL 2CK0L 5F7LB 4JY5H 1GIGH 3QG6B 5DMGD 3QHFH 4QHUB 4YXHH 2Y25A 3LH2L 3LD8C 5DHVB 3MGTA 4LVOC 4EI5A 3KPLB 5EPMA 4EUPG 3GSNH 1G7JB 5ADOL 1JRHL 5FYLD 3UTOA 4GKNA 4YC2C 2ICWJ 4DGVL 1GGBL 5C2UB 4XCNB 1T7XA 1PKQE 1YECL 2OR9L 4TULL 3D9AH 4XVTH 3BMWA 3PHQA 4JZJA 3DO7B 3FB6A 3MROA 4UT6L 1I8KB 1NCBL 4Z95H 3GRWL 2IBZY 5BV7L 2Y72A 3D1MC 3MLTA 1HCVA 4FP8H 5E5MB 4LQ1A 1WICA 1X4ZA 5DT1L 2ICWB 3RPKA 1CD0A 5EZLA 3BZ4B 2R0KH 1QRNE 1U3JA 2F8XC 4F9LA 1OCWL 5CEXA 2DQUH 3DMMA 1S5IH 5T1KB 4NYLA 4PV8B 4HC1A 2D4DA 3HZMB 4NO2A 1UM5H 1ED3A 4MA7H 2WWKO 3RKPA 4L4TB 2YWYA 3GFUA 1FVEA 5D93C 4IEFB 1TVHA 4CL7A 3EYFA 1CWVA 1MAKA 4ZAKA 1ORQA 4LSUH 5L0QC 3SKNB 4RRPG 5IJVA 4I0PB 1FE8L 1KGCE 3OAZK 5CSZA 1BEYH 4NHCL 3T3ME 4RISH 3ZKXB 2FGWH 3VH8A 2ICCA 4HIIA 5FIEA 2WM0A 5J12C 3CZFB 4OGAD 2YBRB 3RUGF 1KB9K 4LPXA 2JJSA 4HJGA 3W0WD 3MA7B 4HWUA 2VN7A 2X4RA 3WLBA 2BRRH 1ZLVH 1Z3GH 4MA3B 1R6VA 3QI9B 1TZGH 4IRJC 3PP4L 2X4SA 1I4FA 3RNQB 3SDAB 1T66D 5IG7B 1KJ2A 3DVGB 1KULA 2OL3H 3CDGB 3MOBH 1AGBA 3CFKA 4CAGA 5GRXG 3EDEA 1H9VA 4D0CA 4OLZL 2R9HC 1BHGA 5I1IL 1XIWA 5IR1B 3I9GL 4YDJA 3HNTL 5KSAB 2PTTB 1BECA 2WBJD 4Z7WA 5H94B 4K7FB 3P4NB 5DA4A 5TGBB 2VLKE 2VDNH 3V5KB 3LMJH 1EAPA 5DI8A 4HK3J 3BI9X 4HXBL 4G6JH 1KLGA 1YMMB 4OM0H 3VU2A 2XQYK 1AJ7L 1WBZA 3LS4L 4KDTA 2IG2L 3G5VB 3N1PC 3EBAA 5GS0L 1TCMA 4PLJD 2F58H 2Z8SA 3DJ9A 1IGFL 4PYGA 3C09C 3V4VL 3R0MA 4G8GB 4OGXH 2AGJH 4B0MM 4GAYA 1GGYA 1F11B 3DNKA 4Q9BA 1J1XH 3OMZA 4GW4B 3MV11 3EAKA 1KJ2L 4HUVB 1MFEL 3WKMH 3S35H 5HYJA 1DUZA 4Y4KA 3QUZA 1ZHKB 1PY4A 5F1SA 1JWMB 4L4JA 5GXBB 5IOPA 5AUMB 2MTPA 4AEHH 4E41A 5J0BA 1AY1H 1YEEH 4K8RH 5CJOL 1A6ZA 4KMLB 2DLFH 1JP5A 3HE6D 2DM7A 1MWAB 5DRWB 1AQDB 2FX8H 1S7XA 1S7VB 4IIQB 4OZGB 3CLEH 5DZNA 2IQ9H 4AK1A 1AR1C 2VH5H 3QNYB 1P1ZA 3WFEL 2UY6A 4J8RA 4DZBB 5T5NG 3C60A 4WJ5A 4GBXA 4O00A 5ESVB 1INDH 1HEZB 3S97C 4ZFGH 2IALA 1TTUA 1ZLSL 4GQ9H 3QCTH 4R0LA 4GG6A 2P1YA 5EO9B 1AXTL 3UYPA 3DV6A 4R2GB 4XMKH 4RMWA 3TO2B 3V7AE 3FQWA 2HJKA 4KH2A 2XZAH 4FXKB 2CUMA 3S96B 3V7MA 2G75A 4GAJH 2NXYC 3T0EB 2FJHA 1PGRB 2DQJL 1GSMA 1RUAH 1DQTA 1C5BH 1OGAD 1MHPL 2QL1A 5GISH 5CGTA 3BX7C 4D3CH 1DVFA 1IJ9A 2RGSA 3ZHLA 5CEZE 1NCDL 5GGRY 2P5WD 4UV4L 2UVEA 3VGEA 1K6QL 4U7MA 1HZHH 1XGRA 1N6QH 1BQLL 4P2QA 5F7WC 2XICA 1KPUA 5J06A 2FLRT 4Z8FL 4M62H 1TJHL 2WIMA 2QQLH 1I1YB 3LN4A 4HCRA 3AM8A 1MI5B 4BK4A 1CCZA 4YBQC 5I1HL 4N0UB 4PP1C 2EDKA 1IGTA 5CILL 5JPNB 1CE6B 2R1XA 1EV2E 4WW2B 2F5AH 2BSED 1B4RA 2Y36H 3JWOC 4P99A 3F58L 3VJ6B 2CLZA 3KJ6H 4JFZL 2NX5D 1VCAA 5HPOA 4ZFZA 3O6ML 5C0RH 1HQRA 3DYOA 3BPOB 5HHOD 2PTVA 1TETH 4E42A 2NY4C 4X6EA 2XKNB 3BGFC 3NOIA 1Q1JL 4NZUL 5HYQA 1XF2B 1AKJD 1ZT1A 5E6ZA 4NN6B 4HWZA 5GGRB 3NFNB 5F7DB 3IDJB 3OKOA 3JV6A 5BRZA 3CH1A 1HH6A 3DV4B 4MWFB 1J1PL 2XIDA 4L9LA 3UZQA 1GXEA 3HZVB 4XC3H 8FABA 1WJ3A 2FBJL 4HCRL 3IETA 3MLSL 4MA1C 2FZ3A 4PS4H 5D6CB 2YZ1A 4OQTH 1KEML 4MAUH 4JM2B 2V2WA 3BEWA 1K3IA 3OKNB 5MEND 1MHCA 4ZXBA 1JPSH 3ZTNL 1D9KB 3LS5H 2DDQH 2DLEA 2VXUH 4KRMB 5D71H 1T3FA 3O3DA 1KLUB 1FYTB 5AG8A 3VXOA 1CFBA 1HSBB 4P4KB 2H32B 2OL3B 2VR9A 2BVYA 2IH3A 5E99L 4LKCA 2WBKA 3P9LA 1OPGH 4MQXC 2Q86B 2VR5A 1OB1B 1OD7A 4Y5VA 1PKOA 1NFIB 3P73A 5GGSB 3SDYL 3ES6A 3LD8B 4ONGL 4KVNL 4BJLA 5BVPH 5IW1A 1IAII 1UWXH 4LVOB 4WWID 3AUVA 4X7SL 5FYKH 1J0YA 4QYOB 4U1JB 1AD0B 3RJDA 4PJFB 3NIDE 2BSRA 4PRID 4EOWL 2HJLB 4PBXA 5D7JB 2A83A 5ICXB 2J88L 3C2SA 4OCWH 3S36L 3RHWK 4N0CC 3KAAA 2QSTA 4ZFFA 3DGCR 3FQRB 3E8UH 4FQIL 4OLXH 3SCMC 3TN0C 4CW1A 1ZMYA 5SWQB 1RMFH 1BZ9A 1KELL 5IMOB 2CXKA 3MRHB 3QUYC 1NMCC 5JORB 2JE8A 4LEXL 4C4KO 5T1DH 3EYVA 3V2AR 3U46B 3RWDA 3L5WB 3UYRH 1F3JA 2DIBA 4J3OC 5EU5B 1G1YA 3EO0B 2ADGB 1KLFA 4LHUB 2QHRL 3PQYE 4Q6IC 3ZKMD 5DHYA 3V9FA 4F37K 4K3JH 3NA9H 1C16A 4RQQA 2CLRB 1JHLL 3UO1H 3DYPA 4OJFL 4UIMA 1G6RA 3CXHJ 4KQ4L 1PG7H 5L0QB 3FB8A 3WNMA 4QXTA 1JYNA 3UAJD 4F33B 5DQ9B 4S1QH 5KJRH 4IJ3B 3WUWB 3U7WL 4BELD 4I1NB 4Y19D 3TCXA 2PETA 5J12B 4YHPA 1RAMA 1SVCP 4H1LG 1VFAB 5C0BB 2ITDA 1E28A 1CFSA 2Y4SA 3UP1A 3WIFA 2PW2A 3RIAF 2JK5A 1BJ8A 1HHHB 2XA3A 1PY9A 4OLUL 3T04D 2ATPB 5JLZA 1QBBA 1EO8H 3NCYS 2CRMA 3GJEA 4YHNA 1MREL 5AG9A 2W38A 5HYSG 2WLYA 1G6RL 2W1NA 3NPZB 4M1GL 4F3FB 2P7TA 1JMZA 1M6OA 5IB3B 2P8MA 5IK3A 1F4YL 1T5XB 2EO9A 4LLQA 5F1KC 4XVSH 3LEXA 4NQDA 3PXJA 2R1WA 4M7LT 3I6LE 4WVRA 5FUZH 5JOFB 3H3PL 1S7TB 3ULUF 4OFKA 3REVB 1N6UA 4XPGH 2R1YA 3O3AB 4ESKA 2C3VA 2AAVA 5EB9A 5SWZD 3B9DA 1X5FA 5D1XC 3IAGC 1JI2A 4TVPD 4OZFG 4ELMA 5B3JF 2WMPA 4DVBB 1RUQH 1AO7B 1NLBL 4KJWD 3OHXA 5LAXB 2FSEA 2F54E 1SBBA 5EORL 1MY5A 4HIEA 1C7SA 3LKSB 1KIUA 3V0WH 4OZIE 3KPRA 3RWIB 3HUJE 1I3RA 2J8OA 1QFWM 4S0TD 4JDTL 3QA3A 3GEWB 1DQQB 1T03L 2HLAA 3VXSE 4X98B 2Z31D 3TBSA 4JRYA 1J8HE 4Z0BH 1HDMB 4ZQKB 3OGCB 1E4XH 4QRQA 3UJIL 1S9WA 5IFJA 2OJZL 2MCG1 5D9SA 1MFBL 1ZGLA 3BZFB 5TDNA 3QEUB 4LSSH 4MVBD 2Z35B 2HTKC 3BDYL 3T2NL 4B41A 3IVKA 3EFDL 1UM6L 5D1QB 5HHQB 4PJIF 3KNBA 4PJAA 1MCBA 3SE8L 1UEMA 4PRPE 3IFLL 5F1NA 5EDXA 3T2QA 3LDBB 4RNRB 5F9OL 4HULB 5I75C 4HWBH 2V5YA 4Y4FA 3IDYC 1ZLUK 3GDBA 3EOAA 1ODAA 3N1GC 5F96L 5ANMB 3AFLA 4NQCD 1KIQB 3CX2A 5LWYL 4YNYB 1UWEH 2NXYB 1IGCH 1JF1A 1WZKA 3B2VH 2N7BA 5T3XL 3TH2T 3MXWL 5EC2B 4GH7B 3ZYIA 5IT2H 3BH9B 3SKOA 4LLVA 5DGRA 5D7KE 3VXTB 1I75A 4WCYH 2BFVH 1IM9A 3RNKB 2IADB 1RUPH 3WDIA 2DQFA 5K33A 5LXGL 5HDQL 2YA2A 3VXMB 4U0RC 3S88L 3T3PE 3O9WC 3PQYA 2CGRH 2H2PD 3ZE1F 2W9EL 1D5MA 3QCUL 1B0RB 5F3HB 4IMKC 4WTXA 4ZOAA 4JCLA 1OP3H 4LF3A 1ZK9A 2YK1L 4LLDA 1V7MH 3EUUA 1F2XK 3PGFH 3S3JA 2IMMA 1JGEA 2CD0A 4F2MA 1FL6B 5FA4A 2ZUUA 1U58A 4KUCD 5E2JA 5E8DL 3OTTA 1FORL 3IDIA 1QA9B 3MNVB 2BNRE 1A64A 1JI1A 3I02B 2DD8L 4D9LH 2DYPD 4NO0B 1P4BL 3MYJA 3CFIC 4LRIA 1YEDA 1R3JA 4KAQL 5CJQL 2ZSVA 1BD2A 3BGFB 1F6AA 1TCRA 2YA0A 1C1EL 1IEAB 3LPWA 2VLRD 2E9IA 4JPKH 1P9MC 3FT3A 1YPZB 2WQRA 3P77A 4EI5C 1DQDH 1EZVX 2A77L 3EYSH 1IGJA 1NC4B 5HD8C 3AS0A 3F12A 3SJVD 4LCWD 1HYRC 1NCWL 1QSFB 3EJZD 4KRLB 3A6CH 1I1RA 3WMSA 1K3ZA 1Q72H 4I3RL 1WISA 2MMXA 4PRHE 3MRDB 5IB4A 1BBJA 1S7UB 1FG2A 2EYSB 5DMIL 3L3HB 1II4E 3VFOA 1KFAH 5IKCB 5CCKL 3BRGC 3GSVB 5IW6A 5AYQA 3PDGA 3MRQA 3P0YH 3P11L 1QD0A 4CU7A 2QR0A 3DUSB 4X6FA 1IT9H 4MAYC 4NUGL 3OF6A 2BCKA 4RIRB 3V6ZB 4F7EB 4X4YA 3QZWB 3DMMC 3K2UH 3VXPA 5MERB 1NGQL 1Y0LA 4U6VH 1AIFB 4JKPL 2I9LA 2YOCA 4Z7NE 5TE6L 1FNEB 2EZ0C 4QRPD 2L0DA 5GZOD 1QLRB 4L3CA 1JNLH 1EMTH 3GIVB 4NRXA 1DDHA 3FHQA 4MMZC 2KQNA 2RJMA 4P9HC 1FVDA 5FYLE 4KRPC 3WIHA 3FL7A 5DC4B 3VXUB 4HG4K 5GRUH 4OZIA 1UZ8A 4XAKD 1YUHB 1N64L 4FQXA 1W2KT 6FABL 2AJZB 2NY2B 2OK0L 2EEDA 4MX7B 3K8MA 4J2XA 4MNQA 3VXSA 1BGXH 3L3OB 2X70B 5AAMA 4BQ8A 3HG1B 3VDAA 1G7HA 4KK9C 4FQJH 1W72H 4P2RD 3TN0B 4AMKL 4A2LA 2X1PA 3GRWH 5BV7H 4CMMA 1R5WB 3QUYB 1NMCB 5BZWA 4RAHA 3UDWC 5JXEC 5A2KH 1T20A 4OM1L 1S7SA 1U3HA 5HGBB 1Q9LB 2FH8A 3G5YA 2DWEA 1S9XA 2CKBB 4LMQE 1MFAL 2H3NA 1OCWH 4NKMB 5EG6C 3MCKA 4GLRH 3RTQC 2XZQH 3VFWA 3SDXE 5CEYA 2D7TL 3N50A 5B39G 2ICES 3UPRA 2R2CA 4OKDA 5KOMC 1XIWC 5I2IB 4MD4A 1NH6A 1KJ3L 1ZAGA 4HF5L 1D5ZB 1I9RL 3OKDA 4NKDB 5D7SH 3MBEB 4B53A 3RY6A 2EXWC 3T0DA 5TE4H 5BOPA 3B5GA 2UZYB 2DKSA 5FM4A 5D2NE 1CICB 1UJTA 1JPST 3W0WE 3INUL 3LQZA 1N7MH 4L8SB 5IEHA 3G9AB 3ULVF 4DAGL 2NTSP 3O3BB 2E7CA 1T22B 1U9KA 1IC7H 4LIQH 5I17B 3H42H 1QBAA 1U93A 4PJXF 3H9HA 4OLWL 3K0WA 4TUOB 5FK9B 3AAZA 2HJFB 3AGVA 5F71A 3C6LC 3PP4H 4NZRH 4HC1H 4M43L 1KF9B 2CJUH 4M8VA 2EYTA 4Y4KC 3QDGA 1NCCL 3H8NA 3QUZC 5GZNC 1J1OL 3DGGB 3QUMB 3Q6FB 4P9HH 4HJJH 5MEQA 3WNPA 4NWUL 4O2CB 3O11B 3SDCC 3X13B 5GGVY 5E00B 5I1IH 2QTEA 2V2TB 4FTVD 1OT2A 4PGDA 4IRZH 4RX4A 5IHUH 2NXZD 2Z8VC 4CVXA 1QLEL 4NRZB 3HNTH 1N6VA 1FGVL 5DK2B 1WF5A 3RVVC 4DK3A 5E7BA 1CXFA 1UVQB 1U6AL 3VGAC 2NZ9C 4K9EL 4H88L 4HXBH 12E8L 4U6HB 1Q0YL 3DUUA 4IDJL 5EU6B 4GBXC 4HH9A 1EFQA 2IG2H 1Q9WB 3H6JA 4IHOA 3T65A 1KTRL 2F5BL 3QULB 3UXFA 1MNUL 3BDBA 4HLZH 1YEFL 2Y06L 1L6XA 5DUPH 4QTIL 3SBWC 4LSQL 1AD9A 4PJBE 1I3VA 3QJHB 5KSBF 3UTSD 1A1OB 1PZUB 4OAWB 1KJ2H 4PRHA 5GGUB 3O6FB 5ADPL 1KENH 1FJ1B 1OARL 4NOBA 4LHUG 1MFNA 3DVNB 4D0BB 4XMLH 3FT4B 5EZJB 1QQDA 5CUSH 3RWCA 1HSAA 4GRLD 4PLKC 1A14H 1RJZB 4POUB 1E4JA 4DKFH 2Z91B 4HFWB 3WNLA 3ROOA 1JTOA 2NY5C 1U8IB 3OPZH 4R4BA 2VZUA 2IPTL 2JF1A 4K7PL 4MJ5B 5ISZB 2AXFB 3C6SB 3FB7A 3O4LD 4HIXL 3HRZA 4LU5L 4BUHA 3IDYB 2Q1EA 4GAGL 3K74B 5K93A 3K4ZA 5H37H 3OZ9H 1JPTL 4ZUUB 4MDJA 2GCYB 1ZLSH 3LAFA 1AXTH 1DSFL 4XX1E 1V8HA 1A9EA 1OGAE 1YNLH 3HZYB 3UX9B 3HC3L 1WAAE 3MRJA 1QSZA 4PJ7F 1ZWIB 2FHCA 4JPIA 3A6BL 1JGLL 1BOGA 4WTZA 1OQXA 1IKNA 4Z7VA 1W0WA 3RWFB 2P5WE 1MHPH 5HHXH 5D1ZD 4JJ5B 4MDIA 1CLZL 4Y0GA 1S9YB 3O9WB 2BNUA 3SHSA 5CAYB 4WFGD 4UV4H 4EN3C 1K6QH 4NCC1 3TO4D 2AV1A 3IGAA 4YFDB 1GH7A 3BJ91 1BQLH 3QUKB 2EH8H 4JE4B 3ZTJH 5LQBL 4JY6B 1P6AB 1NGXA 2PKDA 5TF1L 2JIXD 3JV5A 4M03A 1KG0A 4IOIA 4YXLH 5FECA 5J11C 4FRWA 1CQKA 1T21A 3B83A 2XWBB 4ZUVA 5JA9A 3OJDA 4EIZC 3NZHL 1H8SA 5GJSL 3O81A 5E2UH 3KHQA 1X4XA 3WO3B 1CD8A 4WUKL 5ILTL 5E8PB 4HUWB 3KYKL 4N8CL 1A5FH 5C9JA 5D2NA 2W60B 5GGQH 5DJZA 3LQAL 2EYRB 3EDJA 1RIVL 3W0WA 2NX5E 2DQHH 2FECI 2CQVA 4HKZB 3GMQB 5HHOE 5IROC 5FCSH 4JFZH 1OGTB 3U0TA 3ARED 1FQ9C 4BH8A 1GGCL 3ARBA 3V6OA 2AK4D 3O6MH 2FEDC 5FGBA 4M6MH 5EU4B 4HZLA 1BZ7A 3GMLA 1LK3H 1M7XA 4NQXB 5IMLB 3GSOA 5IF0A 4NZUH 2BC4B 2I5YH 5HVHC 2NY5H 3IJYB 3WHXA 2VXTL 1UA6L 1S7RB 3D85A 2X6MA 5GJTL 3ESVF 2FIKA 3L9RB 5JHDD 5I76A 4PGCA 4XHJC 1IQDB 5MENE 5DVLA 1CTOA 4WU5A 2HTLD 3BHBA 5I8KH 3QEQA 4XAWL 5C07B 4PFEA 2Z92B 3VG0H 2VMFA 4JN1L 1F13A 4YDLB 4MAYB 4PJHF 3PNWB 3T77B 1VESA 2YPLA 4MS8C 4UUJB 1V3LA 3ULSA 1DQLH 1HXMA 3MUY1 4IDLA 5IB1B 3OJ2C 5E99H 1JZ8A 4RFOL 5ITBH 2ESVA 3MGOB 1FH5L 5T1KD 4DZ8B 1ZT7B 1P69B 1T1WA 4HUNB 3UCRA 4KVNH 3ARFD 5E2VL 4L4TD 1IAOB 4L5FH 2D0GA 2NY1C 3MNZA 4P23A 5FHBH 4PRIE 3DTXA 2NLJA 4X7SH 3TYGL 5CMAA 3WJLC 2GJZB 2FEEL 4GXVL 4FFZL 3PGCB 5C6TL 2ADFH 3QDJD 4RMSA 5AYUL 1KC5H 3C08H 4MJID 4DUXA 3KDMA 1U8PA 3MBXH 4PV9A 3OG6B 2ZKHH 4I0PD 1A7OL 4EOWH 4BZ2L 3U6RB 3HE6A 2J88H 4NHUA 3MV7D 3S36H 3ARGC 5FGRA 2GFBB 1XGTB 1BX2B 1TENA 2BHYA 1KCKA 4FQIH 1U8LA 4P46C 3JV4B 1FAIL 5CBAA 1LD9B 3FFCA 3HPLB 4G8FA 1AXSA 3D87B 3JTTB 4OI8A 5F6IC 4WUUA 3RDTB 2P49B 5CINL 4LCIH 1WWWX 3CLFH 4QEGA 3RL1A 1MJ7L 3CVHH 3QI9D 3NFPA 1MJ8L 4G7VH 4YWGH 4MSWB 3MRBA 2DJUA 2BVOA 5IEKA 4HT1H 5IJKA 5E70A 4NQSB 3D69A 2IEPA 1Q9KB 1JHLH 1ZSDA 4MA8H 3I50L 5CZVH 4HGWA 3GMNA 1WEJL 2P48B 1I3GL 1SYVA 4LFHG 4Y19E 3T4YB 3WSQL 4ELKA 1NGZB 4KI5F 2X4UA 1G6VK 1QKZL 4LL9A 2YPVL 5KSAD 1MLCA 3V79C 4YPGA 4Q0XL 1ZLWK 2AEWA 2GITB 3LEVL 1HQ4A 1A7RL 2VLJB 5DUML 1F90L 4PJ8C 4UQ3B 2OSLB 4ZTOL 1YMMD 1ETZB 4K23L 4X9FA 4WNQB 2EDDA 4FQQB 4UQ2B 1U91B 4ZTPL 5JA8B 3FO0H 2HFGH 3C6LB 3H9SB 1LO0L 1V3KA 1PAMA 3B43A 4KROB 4G8GD 1YEGH 2V5MA 4GRWE 2J4WH 3L3KA 4FFWC 2W65A 4PGEB 2BVPB 3VI4F 1J5OL 1IE5A 2B5IB 3FRUA 1MRDH 2R29L 3LN5A 4O51A 3SDCB 2DTMH 3GHBL 4IRSD 4ISVA 4LAQL 4KWUA 1A1NA 4DTGL 5HDOA 4ODXA 5LJYH 1GGIL 4UOW0 4C54A 5HHVH 3OL2A 5I66A 2P8PA 1BQHG 4YIQA 3VGAB 5HHPA 4PBVC 4PYHA 5SWZE 4PJDE 1LDPH 2BDNL 3H3PH 4PB0L 3N9GL 4ETQB 2HVJA 3Q48A 4PRDA 5CEZH 5FF6A 4TVPE 2UZIH 1X5IA 1SJEA 1PKQB 4N1CA 4Y4FC 1DFBH 4AH2A 1I8LC 1T0MB 3F62A 1RJCA 5CD3A 4CU8A 5IP4A 1R0AL 2ED9A 5IVZB 1Z9LA 1IGML 5DXWA 3CVIL 5EORH 5DRNA 1I9EA 4XB7A 4L1HA 5MENA 2V5SA 3AMLA 1MCHA 1FC1A 5FDWB 5ID0B 5IM7A 1KJVB 5EU3A 1GHFL 4PD4K 4R2GD 3DX6A 4BSVB 4LEOB 2R39A 4LLUB 5EUOB 4OZHE 4JDTH 3RA7L 1NGYA 3QSKB 4DGYH 1CI5A 1RZKL 4H25A 3D6GA 1G7IA 4LLWA 3BIKB 4NQUA 4EIGB 3SGEI 4U1GB 2YMXH 5DJAB 1UC6A 5FM8A 3UJIH 1JPGA 5EWIH 3VRJB 2C7UB 3RFZC 3QWRD 4QHMA 3U2SB 1I9JL 1LP9F 3BDYH 4U1SA 1AH1A 1NANI 5I1KH 3EFDH 3H0TB 3CAFA 2VZTA 4NQVA 3GIZL 1KUMA 1YN7B 3VRIA 2ZUQC 4JFQA 5EA0H 2HWZH 1WC7A 4GSDH 4PRIA 3S98A 5I16B 4QY8B 4NQCE 2JB5H 3PL6A 3ULUL 5F96H 5CS7A 5C9KA 5FA3A 5GSVA 5LWYH 3HI1B 3S5LB 4PJIA 4FFYL 5ACZA 1F5WA 4FZ8H 1NMAL 3S6CA 2D0FA 3MXWH 5FCUH 4AQ1B 4X6DF 3MRIB 5JZ7D 1VKXB 4G42A 5KN5A 5ICZB 2VO5A 4GRMA 3U7AA 2DRUA 3G5ZB 5HI4D 3QDAA 4XBEH 3S36X 4OCNC 1P7QB 1D5IH 5EIQA 4EN3B 2VYRE 1A6WL 3IDNA 4X8XA 4XHQA 2ARJB 5JTWA 2YRLA 5BJTA 3PF2A 3EYQC 3QIUA 4Y2DD 3FO9A 4M1DH 5J11B 4KKLC 5EH1A 4JZOA 5EN2A 3V0VB 3IRPX 4S2SA 4FQ2L 3VMNA 1OTTD 3D2UB 5DRZA 1L6ZA 2YK1H 1N5YH 3GK8L 3LEYH 3MRRA 3BGMA 4RMTA 3UTZB 1MUJB 5ENWB 4WHYH 5BS0D 3AMKA 2R0ZH 1D9KD 3FAXA 2HLFD 2VXVL 4TNWK 3WNKA 1EJ6A 1P7KB 2EDBA 4F58L 3QO1B 3QO0A 4R97C 2DD8H 4HSQA 4P4KD 2VLRE 5CJQH 4KAQH 4Y5XA 2EIBA 2RQ8A 2FNBA 4HUKB 5JOPD 5F7MC 1LMKA 2M8XA 1RV6X 3DRQB 2G5BB 1FNHA 4N8VA 4W6XB 3UJJL 1G7PB 5HVHB 1S9VA 3LIZH 1ULVA 3SJVE 4LCWE 4N0FA 4XVJL 4XCFH 1CGSH 4WO4B 4DOHE 1HILA 5DS8A 3PWNB 3ZDXF 1G7MB 4ZUSA 3P4OA 3RWHB 5IV2B 1U8HA 2BHUA 2B20A 3RVXC 1MCIA 1BIHA 2FL5B 5D7JD 5F7FA 2FO4A 4I3RH 1UEYA 1FFPB 3MV8B 5LGHH 1ZHNB 1ZA3A 2E3VA 1Q38A 4FMKA 1CBVL 2H26A 3KPSD 4YX2L 4GG8B 4KQ3L 4PJDA 4QXGH 3P11H 1RK0A 2D03L 1R5VA 4QRPE 1NC2B 4WW1B 2VKXA 2YN3A 1NGQH 2WUBL 4PTTB 1OSPL 4CDGC 4JKPH 1BBDL 5TE6H 5I8OH 3PWLA 3O2VL 4CJ0A 5JDJA 2CMRL 2NY1B 2G2RB 1XGQA 3QJFA 2OP4L 4XAKE 3X12A 4DW2L 1FV1B 2GSIB 4D0DA 5DQJB 4RBPK 3ZHDA 3OR7A 1N64H 2R2BA 6FABH 2GI7A 2L4OA 3MRKB