4QXTA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with fc27-msp2 14-30
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fv fragment(mAb6D8) heavy chain
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxtA00
4X5WA 1H5BB 1NBZA 1I1AA 2ZG3A 2VR4A 5CJOL 5TE7H 2AK4D 1MRDL 1T1YA 3B5GA 3ARYA 4G8EA 1J1PL 2E7CA 1FNEB 4X6CF 3H9SA 1WZ1L 3BT2H 5BS0D 3I6LD 1L6XA 4JO3H 4DWHA 2DMKA 4L4TD 4OAWA 3W9EB 4RWYL 5D8JL 2B4CC 5E94B 4CUCA 1KCSH 3WXWL 3MR9B 3T2PA 5JXEA 4NQXA 2F19L 3G5YA 2W0KA 4PJ9A 3OZ9L 1XGQB 3MV8B 3WXVL 1KIPB 3MV7E 3S96A 5BZDA 1HN1A 1T1WB 5EA0L 1U8KB 4PGZA 5GS0C 4F2MA 3U0TB 4HEPG 4HK0A 1J1OL 1X5KA 4P59H 3PF2A 3VI3E 2NYYD 3LPWA 4OUUB 1GSMA 1KJ2H 4NKOA 1QUNA 2BY2A 3PL6B 2R23B 3VD7A 5IJVA 4FZEH 4IIQC 1KOAA 4HG4K 2VR5A 1RZJH 4JY4B 3RFZC 3N06B 3HNTL 3RWIA 3AVEA 5CMAA 1KN4L 5IHUL 5D71H 2Z31A 1JF1A 5EIIB 2X9WA 4XVTH 3T0VA 3PE9A 4WW2A 2RB8A 5E5RB 1AIFB 3KPTA 1K2DB 2C3GA 3D85D 1AGFA 4UT7H 4RAVA 3ALXA 3EOBB 3MV9D 1ZAGA 1FBIH 3HAEH 3V5DA 5HHOB 1ZOXA 4PTTB 4L8BB 4HCRA 4LOUC 3QDMD 3VGAB 1YEKH 4D9QD 3PWUB 4F3FB 1G1CA 5C0IA 3MRDA 3H3PH 3FT2B 1WSST 2DM3A 5H35A 1BVLA 1Q8MA 4R3SB 1X5LA 1F42A 1ZEAL 2AJUL 1ROWA 1CDIA 1KTDB 3HE6D 2MHAB 5D2NC 1RUAH 4LASL 2A9NL 1WTGT 4J4PD 1HHGB 2W07A 4YQXH 1MI5E 3QDJD 4EVNA 5I6XC 2QHRL 1Z3GL 3HZYB 3BKJH 3PWPD 4EI6A 2P45B 3TCLA 4I0PA 1XGRB 3VMNA 1QSEE 1A5FL 2DDQH 2A74A 3VFUB 1UC6A 1A3LL 4WDIA 3SDCD 1UB6B 3B43A 4PJ5A 2FRGP 3NVQA 3WE6A 1NMAL 5T33L 3IAGC 4JFFA 4PJXA 4K3DH 2VDRL 5D72H 1YYLH 2X70A 2AP2A 4KY1L 4MSWA 2YRZA 5I76B 4LK4A 5MI0C 4G6FD 3C8KA 4OZFH 2D9CA 2MJWA 2CRZA 1R3IL 2VN7A 3GDBA 5IQ9B 3QIWA 1CTOA 3QDAA 4RNRA 3SKUD 2PYEA 1KLUA 2MKWA 3X3FL 2XPGB 3GSQA 3P9WB 3NMEA 4QRTB 4NJAL 1FNLA 1WCQA 4HFUH 2X05A 3RBGA 4BSWA 1A6PA 3WFHA 3QXAA 1SJHB 5HYSG 4XCYA 3SCMD 5E08L 2BXYA 1U6AH 3JV4B 1AXTH 2NX5D 4M48H 1VFMA 1A21A 4I77H 2G5RA 1TCRB 2C1OA 3IFOA 3NIDF 4HWZA 3EO0A 4L8SA 1A9BB 3RWHB 3GIZL 2VITB 1BF8A 1HSBB 4ODVL 1ZHBB 4KZDH 2X89A 4TVSa 5AAMA 3ES6A 4N8PA 1T4KB 5DXWA 4QYOA 1PG7X 1GGCL 5AZ2H 1KTLA 3A6OA 2B2XL 2P7TA 3C5SA 2HG5A 1HH6A 1XZ0A 2WMPA 1A7QH 3AY4A 3FO0L 4NO0D 3MLVL 5E70A 5FKAB 3UBXI 5I1EL 5H37G 2AQ2A 5BMFL 2ADGB 2H1PH 4MDIB 5GGUA 2EXWD 2VDKL 2Z35B 2OR9L 3BESR 4MXWH 3W2DH 4ODTH 3L9RA 4ODXA 3PHQA 4N9GA 3HC3L 1CE1H 1PKQB 1RHHA 2GAZA 1AHWC 1JZ2A 3V5HA 3TN0D 4W4OC 1IC4H 2VABB 3MUZ1 1G1YA 3KWWA 4H25A 3TNNB 3SO3B 2F8VA 5EORH 5DMGC 5DUPL 1MHCB 3ZZ1A 1QFWL 4JO1L 2VDMH 1A7RH 5TFSH 5HI4C 1A7OL 4LSPH 1C5BH 2I25N 2W0LA 4Y4FC 1DQQB 1OB1B 5KG9A 3QISA 1QPXA 5E7FA 1JGEB 5FYJD 1MCHA 5CP7B 3SKJH 1J7VR 3WEXA 3NCFB 5ICZB 1CU4L 4I8DA 3BQUC 4ZNCD 3B9KB 3VFGH 1MCNA 2UWEF 3O4LB 3ARQA 1BLNB 2YD1A 1QYGL 1X4YA 3FB5B 1MIEH 2ITDB 4P3DA 4D8PB 3CUPB 1HEZA 4FXGA 1NDGB 2AJYH 2GITB 1FFNA 5C7XL 1HZHH 4GW1A 3U7YL 5KSBF 2IANE 1NL0H 4JHBA 5IWLA 2A6IA 3EW3B 4NQEA 4Z7VA 1G7LA 5D5ME 2HT4C 5EOTB 5C08B 1C5CH 3EYOA 3HI5L 1QBMH 1T7WA 1S9XB 3IXTB 4OZIE 4K9EC 3H7BA 2P8PA 5TE4H 1K3IA 3D69B 3UTQB 3N0PB 4HFWB 4NYLB 4LCWE 4G8IA 4LP5A 3VFNB 4HKBA 1EZVY 1ZHLB 4LPXA 2DM2A 4AENB 3SGEH 4YXLH 3EYVA 5EU7C 3REVB 4YPGA 4ZSOB 1IEBB 1QBLL 2EECA 2WUBL 4N0UA 5C2BH 1EAPB 3DX9B 2NZIA 4KK6C 5DJDA 2FNBA 3QXVA 3L3DB 3F7RA 4PJEA 2VDQL 4U1JA 4PJAA 2H26A 3G6AA 4FQ1L 4YHYB 2JJUA 4AEEA 3UPCA 5FUZH 4DVBB 2R2EB 1YEGL 5J9PB 1AR2A 3ARDC 4GG6F 2PXYD 3P4OA 4QO1A 1B6DA 1FFOA 3E8UH 4Y5XA 2R8SL 3U30C 1EK3A 1SJVA 1UKTA 3UTZB 5C0FA 4E0RA 2HJKA 2P47B 1KELH 3EDFA 4G7VL 5DEFA 3TBVB 4XP9L 4ZAKC 1SM3L 4LKCA 3QAZB 1OM3H 4LLYB 4OQTH 3BIAX 1IM3B 3O6LL 4C57C 3FFCA 4JFQB 3OB0H 4B7IA 2VXTL 3TIDB 5J1SC 2GW5A 1NGXA 1NC2D 3O2DL 2YK1L 4PR5B 3IS1X 5DRZA 4M7JH 2L4OA 3TZVA 1LD9B 1RJCA 3BPNB 1B0GB 4Y5YC 3RWGB 4X6CA 2AJXL 1CYGA 1AP2B 4RAUB 5J6GB 4OD3L 4OCYH 3MCLL 4WUUA 1JYNA 2BMKB 3HMWH 4E41A 4P5TA 3QR2A 5TQ0L 2V2TB 3LZFH 4TVPL 2OP4L 2YWYA 4HX1B 4JZOB 4KH2A 1ORQB 5IBLD 3WLWC 1I7ZB 2XZCH 4TULL 4XZUA 1UXSB 3HB3D 4PRNA 1W0WB 3PABA 3KLHC 4BZYA 3H2WA 5E4EC 4PLOB 5FAAA 4OZGB 4XWGL 4NWTH 2X4NA 2DKMA 2CO6B 2VB5A 5JW4N 1ZE3C 1Q9LA 5E5UB 1SMOA 3AXLA 2Y7QB 3IDMA 5C09E 3HLAA 1NLDH 2DD8H 4OV5A 1KIQB 2W9DL 4UQ3A 4LSVL 1D3CA 1WUNT 2H2PD 4ZUUA 3JWOC 2GTWB 2PW2A 2XKUA 5LVEA 3VXRA 3ULUE 4JG1H 3B9KD 5DI8A 2YSSA 5EUKB 3E6FA 5SWZB 5ANMA 3VXUB 3HHRB 4QRRD 3TV3L 4QHNA 5L88L 1IT9L 4UIMB 2FYYA 4P23A 5FKPB 2KZ1B 4XCNA 3BXNB 1WGOA 4P3WA 1CFQA 5LG1A 2RJMA 1B0RA 3DIFA 5ALCL 4LQ1A 5J3HD 4NQSA 4FTVA 4M62H 1XEDA 5IFJA 3F7YB 5EN2A 3OXRA 1MJJA 2X4SB 4BQ8A 3A6CL 1G9ML 5I8OL 2FECL 3ECBA 4LSUH 1BEYH 3GSNH 1I9RL 5IV2A 3NFPA 4O2EB 5IEHA 4MAYD 5C0CA 3DVNB 5MHSE 2DM7A 4DGIL 1FO0B 4WU7B 3LS5H 4OKVA 5FO9B 2B39A 4Y89A 3DUSB 3LKOA 3D25B 5E00A 4Q6YA 4YEFA 1M05B 2WBWB 4LHUD 4X5WB 2ZPKH 1NBZB 1P5UA 3BMWA 4MQ7A 1FZKA 1TETH 2DQTL 4WWKC 5ESVA 3KYOA 4WO4A 2BNRA 1T1YB 4G8EB 3F5WA 3GMRA 1ADQL 1KEGH 1PLGL 3H9SB 2YD9A 5A2JH 2Q7YA 3ROLA 2E8YA 1MHPL 4EXKA 5C0BA 1L0YA 3SKMA 3KPLA 4XRCA 3RU8L 5EZJA 4NQCD 3FONA 2DQDL 1MNUL 4HV8A 4UOW0 1J18A 4NQXB 2MCPL 3G5YB 4UNUA 2VXVL 1OW0C 4OM0H 3E3QE 1X5HA 1YEJH 1GJIA 3Q2CA 1KB5A 4IMLA 4MHHI 3S96B 5BZDB 2DIAA 5KSVA 1KGCD 2D0FA 1HINL 5E4IA 3MUGA 4F2MB 1OY3B 5IQ7L 3FQTA 3IJHA 4HK0B 4R90L 3TCXA 5L2JA 3T1WA 1TZHA 5M95B 5L8JB 2F5AL 2HWZH 3K4AA 3TO4C 5ADOH 1EBPA 3CJJA 2UVFA 2V9TA 3KR3L 2BNUA 2XA8H 4NKOB 1UGNA 3MV8E 4JZJA 5F9WB 3CFKA 2ENSA 3OR7A 4OBSA 3O2VL 5IJVB 2V5MA 5JR1H 3KGRA 1DQTA 1SVCP 5E8EA 1MRCL 3MJ9H 1WTLA 1T83A 2ARJQ 3QHFL 4Y4HC 4QHKJ 3BT2L 3RWIB 2D0HA 5KTEH 5CMAB 2Z31B 3KXFD 3OBAA 4JO3L 1JF1B 1ZA6A 4QTIH 4WW2B 1CE6A 3VGBA 3DSNA 1PEZA 1AKJD 2VXUH 1AGFB 3FB8A 2VXSH 1A6WH 3CXHJ 4RAVB 3DETD 1WT5A 2AAVA 4YK4C 3GI9L 2NY4B 3BH9A 2ZG1A 3PQYA 3V5DB 1FO0L 5EU6A 1MCOL 3BW9A 3VFRA 4UZGA 1YYML 5FDWA 1DE4A 3WFEL 3S97C 4FQCL 4PRHB 5DGRA 5C0IB 3MRDB 3GK8H 2V9QA 4J3WA 4NN6C 4HWEH 2ZUUA 3AC0A 5H35B 1BVLB 3ULUH 3GMMA 2O5XH 2FHBA 4F7MA 3SJVA 5JORA 3WFBL 3EDKA 3V4VH 5HHXH 5HHOE 1N6QL 3HMXH 3M07A 3VXUD 4X7EC 5KVGH 4IRSA 3WO4C 4U4BA 2FO4A 3G5VA 3IFPA 4E5XA 4QHUA 1PFCA 4QHKI 5E8DH 3OPZH 4LF3A 3TCLB 4I0PB 4LHJB 4BYHA 4JR9H 1U3JA 3GJEA 2A74B 2UWEA 2ZSWB 2IQAA 1AJ7L 1N0XL 2V2XA 4WDIB 1FLRH 1YMME 2KZWA 4PJ5B 1M7XA 3WE6B 4JFFB 4PJXB 4RZCA 4MJID 2X70B 5E6ZA 4MSWB 5KSBA 1YEKL 5JPMA 1JUFA 3C8KB 4XNZB 1QRND 2V5RA 2Y1VA 2YMXH 3MRMA 4OTXH 2EXYD 4RNRB 4RX4D 2X4PA 4V2BA 1KLUB 2FGWL 1JWSA 1AR1D 1I1AD 1DFBL 1RUAL 1LK3H 4GQ9L 3WFHB 3QXAB 2F58H 4XCYB 3EDEA 3H9SD 3P0VH 3MREB 3NTCL 4HS6A 3RY6A 2C1OB 3IFOB 4HWZB 3EO0B 4PUBL 4L8SB 3FAXA 1VDGA 3WIFA 1C16A 4PB0L 2A83B 1BD2B 1FFQA 4EDWL 4PJ9D 2J88H 4HCRL 4HUXA 3GZKA 4WI2A 3ES6B 4X9BA 4QYOB 1J86A 1N6UA 4KJPD 1KTLB 1T5WA 2P7TB 4X4YA 1CCZA 1IEHA 2HG5B 1HH6B 1XZ0B 3K80A 5GGSY 5GGUB 1OAUH 2APVA 4GG6A 3V52H 3GHEL 1ZLUK 4M6NH 4BH7A 2VZTA 3L9RB 4ODXB 4N9GB 2W65A 1RHHB 4PRPE 2E5EA 3MLWH 2GAZB 4OLWL 1VB9A 3V5HB 3L7EB 3LDBC 5DYOA 3QUXC 1J05B 2ITCA 1RI8A 1Y0LA 3KLAB 4OSUL 4NUJA 4U6XA 3U36A 1GOFA 4R7DA 5D2LF 4YHMH 3K1DA 1OTTD 5JOFA 5KG9B 2JKXA 2QHLA 1ERNA 5CIPA 5SX4H 1HCFX 1T89A 2K1MA 4DTGL 3WEXB 2QSVA 2NXZB 3QFJD 5KAQG 1CK0L 5GQBA 5M7QA 3UDWC 2AABL 3SKOB 4J2XA 4G7YL 1PEWA 1EEYA 2UYLA 4C56D 3ZL4H 3LRHA 4P3DB 3Q3GA 3KJ4C 4P2OA 1HEZB 4FXGB 5F7UA 2H1PL 1FFNB 3K46A 4GW1B 4OI7A 3KVQA 2EDNA 3T0EC 4I3SL 3BZEA 2A6IB 4NQEB 3N85L 1G7LB 5DGQA 4JO2L 3WFCH 2ZUQC 5C0EA 5IROA 2APXA 4M7KL 3STBA 3EYOB 4NOBA 3SDXF 3M1BA 2H8PA 2BRRH 5BV7B 3H7BB 2P8PB 1PG7H 4Y2OA 1C8PA 1EZVX 2IFFL 4G8IB 5DJYA 4HLZH 4HKBB 2V7NA 3PUCA 1LHZA 4H8WH 3EYVB 3WIIH 3UTSE 5C0JB 2I26N 5D93B 4EOWL 4PYHA 3MLUH 4YPGB 3PGDB 4N0UB 4LCUB 1EUUA 4U2YA 4ZFOA 1NCNA 5F8QC 5C08E 3ARFB 4Z7UE 5BVPL 4PJEB 1NUNB 1FIGL 4OLYH 4U1JB 5JPNA 2H26B 3G6AB 4JCMA 2PR4H 1R3LA 4P2QE 3MV7D 4JFFD 4DN4H 1RZKL 2NCMA 5HYJA 2FSEA 3BRGC 2JCCE 2Y72A 3P4OB 4OIAA 4UQ2A 1FFOB 3EYSH 1V3JA 2R69L 1JZ3A 3RGVB 3QIWD 4ZSOE 2W91A 4PRAB 2PYED 4R8WH 5I74C 5C0FB 4E0RB 2HJKB 4AMKH 4KHTH 2NR6D 5ILTH 1FL5B 1KXVC 4M9OA 5DEFB 4LKCB 5IVZA 32C2A 4Y2DC 3VMPA 4AEIH 1DDHB 3BZDA 1IVLA 4Q6IC 4OKDA 5IBUB 1N4XL 2VE6A 3FFCB 4HXBL 1NCWH 4KRLB 1DBMH 2F74B 3IFLH 1JWMA 1NGXB 5CUSH 1N7MH 3AAZA 3QRFM 3TZVB 1CQKA 5C2BL 5CEZL 4YHLL 5EWIH 4ZXBC 5F21B 4GXUN 4WJ5A 3BZFA 2EO9A 4X6CB 3EO1A 3ET9F 1N8ZA 4WVRA 4DGVH 4ORGA 4WUUB 4NM8L 4E41B 4P5TB 3KPRA 4KUCD 3KG5A 4NM4L 3GSOA 2VWEE 5D7JD 2R0LL 3MJ6A 4QHMA 3R1GL 4XZUB 4PRNB 1XIWC 3PABB 5BV7L 1DQMH 3WJJC 5MEOA 4Q9BA 3ETBF 5KSAC 4G43A 4PBVC 2X4NB 1KELL 4X4MA 3HZMA 5TDOA 5HGGS 1Q9LB 3AXLB 4ALAL 4ZFGL 3IDMB 1CDJA 3RWEA 3HLAB 4OV5B 1EX0A 2R0KL 5DVLA 4UQ3B 5JW3H 3NCMA 2OMBA 3B3IA 1MI5D 3LS4L 4POUB 3CFBA 1MQKL 3CIQA 4XC1H 4X6FB 3OSKA 1RZIA 1B0WA 5FM5O 1FHGA 3VI4F 1LK2A 4ZUUB 2PW2B 1DJSA 3T8XA 3VXRB 4ZYKA 4X4ZA 3QIUC 4HK3N 2YBRB 2NXZD 5DI8B 2YSSB 5TE6L 4X7DC 3RY4A 4PGDB 3E6FB 1HXYA 3HS0A 5ANMB 1FGVH 4D0DA 1FP5A 4QHNB 4P23B 4M1CC 4L4JA 2JK5A 5CEZD 1JCKA 4XCNB 1WBYB 2XIDA 3T04D 1CFQB 1NGWA 1B0RB 3DIFB 1DBAL 3VD5A 3CLEL 4NQSB 4FTVB 4DKDC 2WWMC 1YJDC 2R29L 3OXRB 5EN2B 1MJJB 4OLVL 2WIMA 3TGXA 4TSCH 1SEBA 4JPIA 5KS9F 3L95B 3GBNH 3ECBB 2DKUA 5BQ7A 3NA9L 3RX8A 2Y23A 3LMJL 3NFPB 5IV2B 4LDEB 1RMFH 5IEHB 5C0CB 3NCBB 1ED3A 5DD3H 3NCCB 1OGTA 3Q5TA 4HWUA 1NCCH 3OAZK 4OKVB 2I5YL 5EC1B 4LVOB 5KOVC 3RVVC 3B5TA 3LKOB 1HHJA 4ONOA 1ITCA 2BC4A 4JHAH 5T3ZL 2I9TA 4RGNC 5E00B 4Y8DC 3IDYB 3C9NA 4Q9RH 4YEEA 2FH8A 5CWSA 1FORH 1VFAA 4AK1A 4MQ7B 2VLJE 1PY4A 3EJZD 5CEXA 3T2NL 1MJUH 1MAMH 3KYOB 5E5MB 3QJFA 4WO4B 2W9EH 2BNRB 4NZJA 1QR1A 1P53A 3EOAA 3F5WB 3GMRB 1LO3H 1YNTA 2Q7YB 3ROLB 5C0BB 4ZS7H 3SKMB 3U4BH 4XRCB 5EZJB 3AMLA 3FONB 2G60H 2XY1A 3EZJB 4JREC 4HV8B 4HUMB 4K8RH 2ERJC 2C4FT 4X6DF 1FDLH 3L5XL 1SHMA 4R6UA 5LXGH 5T1DH 4FXKA 3VWKD 4WHYG 2CH8A 1KB5B 4BQCA 3EYQD 5CP3A 5KSVB 2HFEA 1K6QH 2IAMA 4LSUL 3BD4A 3MUGB 3FQTB 3IJHB 2YS4A 2WW8A 1YMHA 3QDGA 4UINH 4K94C 1TDQA 3ZYZA 1TZHB 4QEGA 1ZTXH 3FFCD 6FABL 3OB8A 2J4WL 5GRVL 1OD7A 5GGVL 1F4WL 3VXQA 1ES0A 4ZODA 2ZPKL 4EIGB 4I3RL 4OIIH 4FQJL 4HS3A 1V3KA 3CFKB 3OR7B 4NP4L 3TZVD 1RULL 5DC4B 5E8EB 2IG2H 1CFVH 3SKNA 4KDVA 5DTFA 3LHPL 5GJTH 2CMRH 3IFNH 2VDOH 3A67H 1IFHH 4UOJA 4H88H 5I8KH 1ZA6B 2C3XA 1MY7A 1CE6B 2YXFA 2EEAA 5ITBH 4LVNB 1VENA 4G6JL 3FB8B 3PV7A 1Q94A 1SBBA 5D1XD 2APFA 3BH9B 4JM2F 1JHLL 3NCEB 4G8GE 5EU6B 1RQ5A 3BW9B 3QUKB 5EBWA 1AE6L 1T80A 3VFRB 3CSBA 3RZWA 1UM6H 1DE4B 5FGCE 1Z9SA 3QB7C 1FZOB 1FSKB 2O5YH 4Q9QL 4NJ9H 4LCWD 3JWNC 4J6RH 3GO1L 4Y1AA 4KVNH 3N9GH 3RUGE 4LAQL 4U49A 3TO2A 2XG4A 4F7MB 3SJVB 5ICXA 5L9DL 4LSRL 2LABA 4X5LA 3UTTE 5JORB 3V0WL 4IS6A 5EUOE 3VH8A 5ALBL 2VZSA 4UB0L 2QLVB 5F96H 5D2LA 2OM5A 3U1SH 4PLKD 5E6IA 3J7HA 2FO4B 3G5VB 2DBLH 4JKPL 4E5XB 2D4FA 4PRHE 4QHUB 1MF2H 5JLZA 4P9ML 2AXFA 1NMCB 1KB5L 4LF3B 1CXHA 1FG9C 3EO9H 4RBPH 2AJSL 4NQDE 3GJEB 3CCHA 5CHNA 2UWEB 1ZSDA 2IQAB 3NIGF 3D9AH 3QP3A 2V2XB 5E95B 3MZTA 3DX7A 5TGBA 2NY1B 5D1ZA 5D7IE 4TSAH 2P46B 5HYQA 4DUVA 4HF5L 1BVKB 3NCYP 3MOBL 3HA0A 1FNFA 3D39E 4MS8C 5KSBB 1K4CA 4B50A 5AEAA 1T6WA 3GK8L 4UIKL 3PWVB 1SYSA 3RAJL 2OQJA 3VXPB 2X4PB 5DFVD 5IKCA 3SDXA 4PJIF 5A2LH 3ABZA 1DQDH 3V5KB 1CD9B 4WO4D 3V4VL 3EDDA 2PUQT 1YC8A 3MGTA 5GIRB 3A6BH 43C9B 5GSRA 3V79C 1P7KA 2IPTH 3GUTA 4TNWK 3SDDA 4HS6B 5T3XE 4I5BA 3MOAH 4ELKA 4HC1A 4X9GA 3WIFB 1C16B 1KXQE 1VPOH 2YPLA 3BH8A 3TYGL 4U1MA 4HUXB 1RIUL 1OP5H 4G9FE 4HIHA 3D3VA 3CDFA 4HKXA 3T0WA 1FLRL 1N59A 3O6FA 4JN2A 4UDUA 4DVRL 4X4YB 2VZUA 3U9PL 3W82A 1RZGA 3Q5YA 3L5JA 1M4KA 2JF1A 3IJYA 4GG6B 4OFKA 1U8JA 4Y5VB 2N56A 4BH7B 3N1FC 2NTFA 5D96B 5C09D 3CFCH 2W65B 3OXSA 2PCPA 2X5PA 5B39G 4LCCC 2BSTA 2IJ0C 1JE6A 3AB0B 1SVZA 4ODHL 3QCUH 1BD2E 1A14L 3UO1H 5DYOB 3AREA 1D9KD 1MOEA 4M43L 2VH5L 1A3RH 2GJZA 1SY6H 4NUJB 2B5IB 4U6XB 3U36B 1VACA 2NXYB 4R7DB 2PTVA 1EMTH 2WBJD 5JOFB 2WUCH 5CIPB 2D31A 1CDHA 2F9BT 2C4XA 5F88A 1NGQH 4JANA 1JHKH 4DAGL 5IOPA 1T21B 4KTDL 3V6ZA 2EE3A 5MEPA 3PQYD 1EEYB 1WV7T 2UYLB 3ULVC 1N6VA 3VWJA 3Q3GB 4P2OB 5DEGB 4K7PH 1IE5A 3C2SA 4NCC2 1SYVA 3SGEI 3IU3A 1MHEA 4P49A 3C08H 5MHSD 3BZEB 1QACA 1LP9E 1JPFA 3DARA 1G6RA 3MLWL 5C0EB 3I6KA 1YN7B 4XAWL 2HKFH 3M1BB 3UJIH 1S5IH 2H8PB 1U41A 3VD3A 2EH8H 3B4NA 3ZHLA 3HI6H 3SQOH 3HG1A 1ZANH 1QR4A 1R5VA 5C3TA 3RTQB 4FXLA 5DJYB 5HHMB 4IRSD 1LO2H 1LQSR 4L29B 2V7NB 2VLRE 1FAIL 1I8LC 3INUL 4TPRL 5ITFA 1V05A 2WSKA 4L9LA 4PRIA 4QLRA 3BKYH 3QIBD 2H3NA 1MLCA 3TJHD 3KHOA 3IYLW 4G6ML 3L1OL 4ZFOB 15C8H 4GAJL 2H6PA 5JPNB 1F4HA 4ZFFB 4WFEE 1DVFA 1R3LB 2R4SH 4JDZB 1U92B 4YDLB 3ARGC 5HYJB 2C26A 2FSEB 1G6RH 2DOCA 1IBGH 2IEPA 4R4FH 1GAFH 3QWOB 1IM9D 3CD4A 3RIAF 4UQ2B 4ZNEA 3E2HC 3EGSA 4RMUA 3ZT5A 5KS9A 5B3NA 2JELL 1RIVL 4RISH 4DCQB 1TITA 4YDJA 5ICYA 3VH8G 3DLQR 1M7DA 4APQA 1EA9C 5IVZB 32C2B 2BRRL 4WTWA 4P4KA 1ZLSL 3KJ6H 4OM1L 1OAXH 5GRJH 5KVEH 1G0YR 3IDXL 2VXQL 25C8H 4XCCH 5T3XH 2VE6B 1FCGA 2HMID 1IAIH 1P7QA 1JWMB 1KNOA 2IGFH 3IDGA 4PY8I 3AAZB 3CFDA 4J3XA 3O8XA 5AYQA 5D7LA 3BIKA 1I8KA 2MQ3A 4WJ5B 4WY7H 1EHLH 3W0WA 2Z92B 4QXTA 1N8ZB 4MDJA 4QF1A 5J57B 1FLTX 3O2WH 3OGCA 4HH9B 4ORGB 1OLZA 4YDIL 1CXFA 5E9DE 3KPRB 5ADPH 4RFOH 3WFDL 3GSOB 5HHVH 3DSFH 4QHMB 1AI1H 4X6DA 1AD0A 1BJ8A 1Q9OA 1WIUA 5F7DA 5MEOB 3L6FA 4G43B 3HC0B 3SE4C 5SWQA 4BELD 4R8WL 1DBBL 2OI9C 3MRLA 4ZOEA 3BMVA 5B38G 2W1NA 3WUWA 3HZMB 1X5FA 4TNVK 4KKCC 3WLBA 3BPLC 1XF1A 4Z5RA 2FO1A 5SWSA 3RWEB 2DTML 3CSGA 5EZIL 4B41A 5C0ND 4MZ2A 4X6EB 1YECH 5ISZA 3B3IB 5MP6L 3CFBB 4ZFOL 1KULA 1NCWL 1RZIB 1DBML 3EZ8A 1LK2B 1IC7H 2P5WA 3BP5A 5EOQL 3T8XB 4ZYKB 1KCVH 1N7ML 3NPSC 4NQTA 1EJOL 1HXYB 3HS0B 4L3EA 4Y7MA 4KQ3H 5IB1A 2EICA 1BQUA 3VRIA 4O2FA 3VFTA 4DGVL 4HK3J 2JK5B 1BOGA 1P5VA 1YMMD 2VUOA 1S9KC 1NGWB 4NHCH 3WL9A 4Z7QF 4DEPB 1CZ8L 1MEXH 3VFMA 3ZT7A 3HPJA 4IRJA 3X3GL 4JM2A 1SEBB 4JPIB 4WCYH 1A7PL 2XN9D 3IDJB 4Z8FH 2QTEA 1D5IH 4XVJH 5BQ7B 4MD4A 3VFPA 5L0QC 5J6HA 5IR1A 1CIUA 1UVQA 4V1DA 2BY3A 5HHMD 5CBAA 3F58L 3W81A 2QKIA 1HHJB 4HIXL 2BC4B 4RGMC 2XQBL 2I9TB 3LRSA 5B39B 5CJ5A 3C9NB 5DLMH 2C3WA 5CWSB 1VFAB 1A4KA 5CEXB 3HFML 4TRPL 2CXKA 2W60B 1MCWM 2ICWA 5LQBL 4I48A 1IC5H 2FL5A 2R2HA 3O0RH 1HHKA 1TPXC 3FT4B 2CIIB 3ZE2F 1NCAL 5GJSL 1YNTB 5E8NA 5FOBA 4XC3L 4I9WE 4YO0A 3ZTJH 4HDIA 5B3JE 4MA7H 3AM8A 3BD5A 1PG7W 1R5IA 3EBAA 4FXKB 4YZFE 1EVTC 1BFTA 2OTWA 2YPVL 4TSCL 5F6HJ 3GBNL 1KF9B 4WI3A 2HFEB 2IAMB 4KDTC 1YMHB 1WAAE 3QDGB 5JHDE 5DD3L 3MRPA 5J06A 1E4WH 1MFEL 2HYMA 1JNNH 3TJEL 2ICES 2EE6A 1OTUD 3MLTA 4RMQA 1MCRA 3GKWL 4PJIA 3VXQB 4Q9RL 1ES0B 3C5JA 2DLFH 1A2YB 4FMFA 1BQLL 4HS3B 1NEZG 5I0ZA 3QCVL 1BM3H 5DQDH 1MAML 3U0WL 2VLKA 5BVJA 3MNWA 3OKDB 4F8TA 5KVFL 3MACL 2WIIB 4TQEH 3I84A 2J8UE 1N5AA 4XPAL 3JUYA 1JRHH 5F3HA 5IMOB 5IM7A 3V8CA 3SDCC 4ETYA 1A7BA 5HD8C 3KPPA 4K8RL 2YD3A 3FT3A 1Q94B 3WHE0 4ZO9A 2J8HA 5DQ9A 4KTEH 4KI5C 5FO7A 3O3EA 1P84K 3VG0H 5EBWB 4ERSH 4GRLC 2DJ4A 4KJQC 3LRGA 1G9NL 5F6HI 3MBED 4U3HA 2EDYA 3ARUA 2NY3B 2A38A 3BKML 3ILPA 1UKSA 2J6EA 1VESA 5BW7A 4FFZH 4Y1AB 4F9PA 3VW3H 4PGEB 5DJXA 4D9RE 4LDOB 3T2QA 3SCMC 1IGFL 4IS6B 3VH8B 3OAUH 3CH8A 4FQIL 3DX8B 1I8IB 2C5DC 4EXPX 2IG2L 1ORSA 5D2LB 3DYMA 2GI7A 5E6IB 4Y4KA 3K4DA 3I2CH 2OMNA 4P5KA 5JLZB 1DN0A 4PY7A 4GXVL 2AXFB 4P2QD 4LHQB 3RNKB 5CHNB 3VGFA 2DYPD 4TUKH 5ITBL 2DKSA 3GMLA 3H3BC 1ZSDB 3QZWA 1GPOL 2UY6A 1NAMB 1T7VA 4IBLT 4ZTOL 3DX7B 5TGBB 2EXWC 5D1ZB 4K8RD 4WI5A 5HYQB 4X80H 1CLYH 2EDOA 3QUYA 4LQFH 4LL9A 4MNQA 1K4CB 4WFFD 4OLUH 2O5YL 3ARDB 3B83A 4LSDA 3PL6C 4PPTA 4R26L 5CBEA 5CD5D 4EI5A 3BYTA 2OQJB 1FFPA 3U30B 3TT1H 1A4JA 1F45A 5GPRA 3QEUA 4NZTL 1ZGLA 3LN4A 3NACH 3RVXD 4LSQH 1JVKA 2XI9A 4KUZH 1ZVHA 3BFOA 3MGTB 4AQ1B 2CRIA 5GSRB 2DAVA 1P7KB 3L3IA 3GUTB 5ESAB 1HXMA 5FYKL 5KJRL 2AJZA 3JWDH 3SDDB 3IAPA 4PLNC 4I5BB 7FABH 4ELKB 3EO9L 4EN3A 3BH8B 4I0CC 3QI9A 4U1MB 4M03A 1QFUH 4HIHB 5EBMA 3D3VB 3LPFA 4HKXB 2X2YA 3O6FB 3VGAC 4JN2B 4OCRL 1WK0A 5KBNC 1OPGH 4PJBF 4U0RC 1RZGB 4IOFD 1CBVL 4EJ1C 3VA2C 4JKMA 3IJYB 3GRWA 1U8JB 3LIZL 4N9OB 5DVNA 3V7MA 2NTFB 1XCTA 4FFYL 3OXSB 1GZQA 2PCPB 1HWGB 2BSTB 2ZJSH 4L4VE 1O0VA 1JPST 5JHLH 3AREB 2NZ9C 1LO0L 4XB7A 4J3TA 2GJZB 2Z9TA 4ZOBA 4A2LA 3SDAA 1AQDA 3QHZH 5SV3A 1VACB 1D7FA 2A1WL 4X0KB 1A47A 2HFGH 4X4XA 2BNQA 3HC4L 3MGOA 5IT2H 2D31B 1OOAA 5E2TH 1GIGH 1FVCB 3DROB 3VGEA 5F88B 1ODAA 4BQBA 4JANB 1X9QA 5FYKD 4JVPA 5EIVA 3CC5A 5IOPB 3V6ZB 4OFYA 3OR6A 5MEPB 1HOCA 3C6SA 5C0AA 1UACL 4LLUA 4LSSL 5LGKA 1WBZB 4F7PB 3CK0H 4S1SL 3VWJB 3ULSA 1W8NA 4WUKH 4UMGA 1SYVB 3C6LD 3IU3B 1MHEB 2KBGA 2QQKH 1ZLWK 4Y1AD 1JPFB 1BWMA 4WTZA 3I6KB 5K93A 4R2GD 1XGTA 1CICA 1LDSA 1A3RL 4RGOH 3THML 3AGVA 3FN9A 3EJYC 4QKXB 1SY6L 3HG1B 1R5VB 3T0DA 4HC1L 2EDDA 2OK0H 4U3CA 1QFWI 3LN9A 4F7EB 2XQYG 3I50H 4PRIB 4OCLC 3U4AA 2H3NB 2FX7H 2QSCL 1MLCB 3CLFH 3N1PC 5DZOA 3E1F1 5DJCB 3AU1A 3MX0A 2A0LD 4OGXL 1JHKL 5HGAB 5I1CH 4JFDE 1CT8A 3IF1A 4HMEA 3S36X 1YPZF 3QG7H 2H6PB 1FVDA 1CLOH 2XTJB 1KEML 5D1ZD 1ZT4A 1DVFB 3DMMA 3RDTA 1VFBA 2DI8A 1BBDL 2NY0B 1NBVL 3LH2L 4IRZL 5I1LA 2D2OA 3EGSB 3PJSA 4OCSH 4Z0BH 3SO3C 4M5ZH 5FYLL 3UYRL 4YDJB 1L7IL 1M7DB 2CLZA 3HE7D 4APQB 2B7DT 4HJJL 3SE8L 1PYWB 1DSFH 2NPLX 2ZOLA 1A6VH 2ESVA 2H2PC 2EDHA 3NZ8A 1HSAA 1DEEA 4HBQA 4G5ZL 4HIIB 5JXAL 5GGRY 3PWJA 4PJFF 3B9KC 4DKFL 1P7QB 3BKYL 5HPOA 1KNOB 1S78D 1BZ9A 5EU3A 2YPLD 3CFDB 4ZPTA 5IJKA 3O8XB 3QZWG 15C8L 2B1HL 5D7LB 3S3JA 2DLEA 1XGPA 2WQ8A 4QNPF 3BZ4A 4UTBH 3W0WB 1L9NA 1VGEH 2ZUVA 3O6FD 4QXTB 1N2RB 2AEQL 4MDJB 1X4ZA 1QVOA 2KQMA 4EBQL 2COQA 2NW3A 4J3SA 3FO1A 3GI8H 5AUMB 1G6RL 2LQRA 1NCDL 4JG0L 1GAFL 4X6DB 1AD0B 1MSPA 1Q9OB 5F7DB 3L6FB 5SWQB 2A73A 2IBGA 3JVGA 5BRZA 3WUWB 3WLBB 1WICA 4Z5RB 5SWSB 5FYLD 4QHLA 1I3VA 1H8SA 2DQHH 3KJ6L 3MNVA 4FOMA 3W11D 5FO8A 5ISZB 4P9HH 4XCCL 1XGYH 3KS0J 4NN6B 5L2KE 5JQ6H 1IAIL 1S7WA 2P5WB 3BP5B 3FQNA 3OG4B 4P2RE 4XCFL 3GNML 4YHYC 3QQ9D 5DRNB 5IHLB 1G7JB 4B5EA 1DN2A 4L3EB 4WU5B 2W59A 4P0DA 5IB1B 3VRIB 1Y6NR 1AXSA 1JHTA 4O2FB 3BEVA 2FIRT 3O2WL 4YE4L 3O81A 3LQMA 3D0VA 3VWJD 2NY7L 2ORBH 2MSPA 5ADPL 2VLLB 3WL9B 5TPWL 1KB9J 5HDLA 1FGNH 1JTTA 4UNVA 2AQ1A 1NUGA 3D39D 3VFMB 1EPFA 2E9BA 3S5LG 4KRMB 4IRJB 1JNLL 4JM2B 4OZHE 3BYYA 3QAZC 3S98A 5D2NE 3ZKNC 3MTRA 4HT1L 4MD4B 1G9MC 4YBQC 3VFPB 3ZDXF 3S37X 1FYTE 3Q1SL 1UVQB 1LEIA 2ILLA 3RP1A 1U8OA 2X4QA 5KN5A 4V1DB 1CGWA 3T0AA 3BKCL 3IDIA 5JTWA 2QKIB 1XF2A 2YPKA 3LRSB 4KKAD 4PTUA 1F8TL 4QRPE 3VRLF 4CDGC 4KFZC 4PRID 3BPNC 4U1SB 1MUJA 5IFAH 4GBXA 1JFQH 2XNAA 4QOKA 4WHYH 1MFCH 1UXWA 1A4KB 5DC0A 1T7YA 5T3XD 6CGTA 5GRVK 2ICWB 4LRIC 4OCWH 4I48B 2R2HB 4GKZB 1H3PH 2YD4A 1CR9H 4KQ3L 2V7HA 2XTJD 3Q0HA 3QEGH 2VC2H 1DVFD 2XY2A 1MCSA 5D6DC 3BIBX 5E8NB 3DETC 5FOBB 3CU7A 4YO0B 4HDIB 4CJ1A 4XCEA 1RU9H 2AK1L 5FK9B 4Y16A 2FD6L 5DD1H 1MQ8A 4WTZG 1R5IB 5JW4M 2PYFA 2V17H 3FO2A 3PP4H 3VDCA 4NN7B 3TBYA 5J1TC 2FECI 4P4KD 2J2ZA 4KAQH 1JNJA 3MRPB 4D2NA 2QADB 1P4BL 2B4CH 2C4FU 4LFHD 4YDKL 4WEMB 3MLTB 4L8DA 4MZ3A 4PJIB 4QXUL 5FCUL 4ZDHA 1YEEL 1HKFA 4U31A 4I1NB 2DQIH 3LDBB 3O8XD 4XB8A 2FATL 5D7LD 3O9WA 2VLKB 3MNWB 3FN3A 5GS0H 3RVWD 3VXSA 1IC5L 1CIDA 4JHWL 4QXWA 2MPAL 1N5AB 3HR6A 1B3JA 1JPTH 2HFTA 1I75A 4MNGA 2OJZH 1KJMA 4U7KA 4F80A 3CX5J 5IM7B 1MJ7L 5T1MA 2Y36L 4KWUA 2ZWLT 4NZUL 1ZT7A 2KPNA 3KPPB 3HKFA 1AO7A 1P69B 2WP3O 5C2UB 2R0WH 5FO7B 4PJBA 3O3EB 4JFZH 4W68A 2AEWA 4OF0A 1C12A 5I19H 1T2QH 3MXVL 4ZFZB 2FLRT 3OGOE 1BZ7A 3ILPB 1F3DJ 5ACLA 1E4WL 5ISZD 1I1AC 1NGYA 2CGRH 1S7QA 2VLRD 2CRYA 3FQRA 2DLFL 2H45A 3KNBA 4S1DD 3L5HA 3V4UL 4IOIB 3V4PH 5JIPA 1INQA 3RWJA 1N26A 1ORSB 2AV7A 4OGYH 1ULVA 4U0QB 3GHBL 4MCZA 4ELME 3WYRA 4Y4KB 5JXEC 1RUQH 3UBXA 4GJTB 5IIEA 4K3EL 5HHPA 4PJ9C 4NWUL 3V2AR 2FHFA 1DN0B 1OTSD 4PY7B 3OHXA 4WFED 2ADFL 3CGTA 3P77A 3GMLB 2GCYA 4EDXA 3QZWB 4H1LA 3ZDZE 4IRJD 2VDPH 1JGLL 4M7LT 5DD5H 2IH1B 1DL7H 4BH8A 5F3BB 3BSZH 4D3CL 1IQWL 5CCKH 3EYFA 3TT3H 3L3OB 3GJFA 5FF6A 2Y06H 4JFEE 4N8VA 3QUYB 12E8L 5AG8A 4V1DD 4M5YH 3AROA 3OKYA 4MNQB 2Z4QA 3K8LA 4NT6B 4OT1L 2HT3D 1WLHA 2SEBA 1EAJA 2ZP0T 4FFZL 5EU7E 5CBEB 4EI5B 1RD6A 3DTXB 3H42H 1FFPB 3QPXH 35C8H 1A4JB 3K3QA 5FUOH 3S35X 3QEUB 2M1KA 1WZMA 1E4XL 4JVUA 1ZGLB 2XG5A 5DR5L 4AIXA 2J1KA 2Z31C 4XP1L 4LDLB 2YKLL 4K23H 1NFDE 4WW2C 5IGXH 1HXMB 1QFHA 5B22A 1S9WA 3NIFE 4G6KH 3MRHA 4W81A 2NY4C 4EN3B 4JDTH 3QI9B 4LSTL 2WANA 5EBMB 1YPZA 3P30H 1F90L 3GSWA 3ZKXB 3BAEL 3DX6A 1D5MB 2ARWA 2NY6B 2J6EL 2PO6D 2W92A 4X80L 1EIBA 4RWHA 3ORJA 1J0IA 4N8CL 1UZ8A 3C5ZA 2CO7B 2QADD 3TFKC 1XCTB 3FHQA 1VCAA 1GZQB 2YXMA 4QRQA 3QXUA 4XH2A 4YHOH 3SDAB 1AQDB 3GM8A 1EFXA 1AGEA 4PJ7F 2VL4A 1FNAA 4HWBH 1OGAE 3T3MF 2E8ZA 1KJVA 5GS2H 3G6DH 4I0PC 4X4XB 2CLRA 3LEVH 1I9IH 4PJFA 4ZQKA 3MGOB 4OBRA 4ZOCA 4NN5C 4L9DA 2YA0A 2AK4A 2Q8BL 4L5FL 4BUGA 4ZMAT 1LE5A 2VZ1A 5IVXE 3QIUB 3CC5B 2EDLA 4LGSB 3OR6B 4EKXA 1HOCB 3C6SB 5C0AB 1JPSH 2DTSA 4L4TA 1OSPH 4LLUB 3HZVA 4U7MA 4OJFL 4XNZC 5TQ2H 3ULSB 5C0RL 4ZD3H 2JJVA 3QIWC 3IU4H 4HJ0C 4LLVA 4TOYL 1QBAA 5LGHH 5A1AA 3IVKA 1YNLL 4NNPH 2NR6C 4JQIL 3MRNA 3OJMB 4PB9H 4YJZL 5ERWB 2AGJH 1XGTB 1CICB 1J1XH 1T1ZA 4V2CB 3KDMA 1J8HA 1MFAH 1WWWX 2X4OA 4FQXA 1AFVL 1ZVSA 2EEBA 5F9DC 5K59E 1V7NH 2HRPH 1OVZA 4L8SC 4OV6F 1LEGA 2E3VA 4JRWA 2Z91A 1GGIH 3G5ZA 5B4MD 2XV6B 2HT2C 1GIGL 3TH3T 4AT6A 1R3HA 4KVCH 3AU1B 5D1QA 3AY4C 1CT8B 3IF1B 3ZTNH 1UH2A 4I9WD 4XVSH 4K9EH 3GRWL 4WI4A 1FVDB 5L7XL 4YHIA 3LN5A 3QQ4A 2EEDA 3ZKQD 3B6SA 3DMMB 5KVDH 3GSVA 4WGWB 3LKRA 1FL6A 3RDTB 1K5NB 1VFBB 3D85A 1RZKC 5LGJA 5I1LB 4ZUTB 5IFHL 4OGZA 5EZOL 3L7FB 5JHDD 3PJSB 2E9WA 1DBKL 5FHAH 1OAYH 3SPVB 1XFPA 4WW1A 1NH6A 5C6TL 5CD3A 5MERA 4GOSA 3QDMA 4EUPG 2CLZB 2W0FA 2VZ3A 1OSZA 2IQ9H 1W2KT 1FH5H 1H3VA 4X8JB 2DQGH 2ZOLB 1U3HA 2ESVB 4O5LH 1MCLA 3TM6A 1JPGA 4MQXD 3NZ8B 1HSAB 3ZE1F 4OD2A 5F89A 3PGFL 1JNHA 3VXMB 3EHBC 3PWJB 2NXZC 3HE6A 2D4DA 4GRWE 3U7AA 2FX7L 4J4PA 1X5GA 5I9QB 5EU3B 2OZ4H 1GGUA 5KANG 4KV5E 4ZPTB 3QI9D 3IRZA 3O41A 3T0BA 1UCBH 2RR3A 3BZ4B 3DGGA 3ARBD 1JJUA 4XPBL 1CTNA 1OQXA 1CLOL 4UAOC 2NY6D 2IADA 1QVOB 3EIFA 1MHHA 2NW3B 5IWLC 4P5MA 1EO8L 5EO1A 3FO1B 3FJTA 4Y0GA 5ECJE 2XWTA 2ED7A 1KIRA 2HTLD 2RIKA 4ENED 3MRCB 4HMDA 2YD7A 4PJ8A 1G0XA 1MWAH 2EDKA 3SEPA 3V6OA 2X44D 1HIML 5EBLA 5BV7C 3RA7H 2A73B 4Z7NF 4D9LL 3IGAA 2Y6SC 1EEUA 3ZDYE 4D9RD 5BRZB 1IGCH 4FG6D 3S36H 2GYSA 4MJ6A 1CFNA 3SDAD 3VXTA 5DD0H 1OP9A 4XP6H 5E99H 1JTOA 3MNVB 1EUTA 1A6VL 5D93C 5FO8B 1KC5L 2QL1A 1F6LL 1YQ2A 2BNQD 4PJHB 1UWGL 1D5XA 2P8LA 4J8RA 1QSZA 3KHQA 1KCUL 4UBDD 3FQNB 2P5EE 3FN0L 4MLSA 1JK8A 1L0QA 1WEJH 1MFBL 1QLEL 3CVIH 1UJTA 2NX5A 2LU4A 5DURB 5C07A 1R3KA 5C0AD 1AXSB 1JHTB 4HXAL 3BEVB 1ZS8A 4Z78A 3D0VB 2JJSA 1AQKH 2OTUA 4Y5XC 2OL3H 1YN6B 4N5ED 4ETQA 4LRNH 2I60H 2UUDH 3UJTL 1G7PA 1EHXA 1RY7B 1NDMA 3JWOH 1HYSD 3BP4A 3WSQL 2X1QA 5EOCH 4GKSA 4NO0A 1UB5A 4S2SA 1Q9WA 1F6AA 2J12B 1L7TL 4HPOH 3ZKSD 3OTTA 4CMHC 3LQZA 1U8OB 4ZTPH 4XXCA 2X4QB 5KN5B 4I18A 1OAKL 4DK3A 3G08A 4ZS6C 3IDIB 1XF2B 2YPKB 4PTUB 3TN0A 3TZVC 1A1NA 4JO4H 1MUJB 4YHNB 4GBXB 2XNAB 4QOKB 4NBYB 3RKDC 4GXUM 1A6UH 1UXWB 4XHJD 3QCTH 1ZV5A 3H6JA 3BHBA 4FZ8L 2YUZA 3OX8A 2VQTA 1T03H 4P5TC 4RFEA 2V7HB 1UYWH 3SE3A 2F54A 2D7TL 2MOVA 1EO7A 3NA4A 1EJ6A 3U46A 4G42A 4PG2A 5D7SH 4HPYL 4XCEB 4Y16B 3O4OB 1HI6A 5INDA 1UA6H 2PYFB 3U2SA 5IESH 3FO2B 5L6YH 1K85A 1MFDH 3TBYB 1NEUA 1YY9C 3P4LA 3QUMH 3SHSA 3KYKL 1W72H 5DS8A 4Q0XH 1KLGA 2JE8A 4GRWH 4FP8H 2XICA 1FPTL 1FNHA 4L8DB 1HQ4A 2HN7A 4ZDHB 1PY9A 3BWUC 1T0NA 4PREA 1MFCL 4P23C 2OR8A 4FNLH 1NGPL 4PLKC 5I8EA 3O9WB 5C71A 1H0DA 3MV01 4MVBC 4OCWL 2AEPH 1DLFL 1MIMH 1KCKA 3O6MH 3BPOB 4OI8A 3S37H 4HGWA 2EDXA 4U1HB 4MNGB 1UZ6E 1KJMB 4LPYA 4LU5L 3BOVA 3GSRA 4LARL 1ZT7B 1TVBA 1YNKL 4CDHA 3WNLA 1AO7B 1U8LA 1JV5A 4MXQC 4BSJA 3MOQA 4PJBB 1NCUA 1UM5H 3VE0A 4DN3H 1C12B 2XZAH 4K2UH 3RZCD 1FIEA 2PXYA 4LVOC 2A9ML 3MLYH 1B6UA 4CVXA 1BZ7B 2ADIA 5DFVC 3M17A 1UJ3A 1I7TA 3X11A 1E6JL 5F7HA 1NGYB 1S7QB 4WO4C 5I1HH 3MFGB 1B90A 3MLSH 1F00I 3J8F7 3KNBB 4RQQA 4PJ7A 1U3ZA 1INQB 4GMTL 3RWJB 1GHFH 2AV7B 3B9VA 1GL4B 2IH3A 3WKMH 5E2WL 2DL9A 1U42A 4MCZB 1Z6JT 4AG4L 1NC2A 4M1DL 5HHPB 4TN9A 2GSGA 3BO8A 3U6RB 5IVOA 3T0EE 1HNGA 2EZ0D 3JV6B 1WVZA 4S11A 3OV6A 2GCYB 4EDXB 2VNCA 3RVTC 3AS3A 5DK3A 1TCMA 3RHWF 3D5OF 4FQLH 2BFVH 1OCWH 4UT6L 4ODWA 3EYFB 1I7UB 5FF6B 3GJFB 1M6OA 4N8VB 2BVPA 3OQ3B 4MWFA 2Z4QB 2F53A 3GMOA 4G3YH 3BUTA 2X1OA 4JRXE 4U6VL 3HNVL 4JZJC 2SEBB 4XPHL 3RWFB 1MREH 5GSVA 1NQBA 4GBXD 4P46A 4DKAA 1FN4A 3LKPA 1T83C 4GAYA 2R56L 1AH1A 2W0PA 4RMVA 2VZOA 3O6KL 1I9JH 2NY2B 5LBSH 4M7LH 4GMSH 1BQSA 4H0GA 5F7EH 4LVNC 1RUQL 3EYUL 1MVUA 3MRHB 5HDBE 5GS0D 5FB8A 1NFKA 3FQWA 1WT5C 2YA1A 3QHTC 4QRRA 2PNDA 1YPZB 1MCJA 1EGJH 3GSWB 2EO1A 5DT1L 2R2CA 1FSKC 3DX6B 5HJ3A 1OAQL 2VQ1A 5CCKL 2YC1A 1BMGA 4XPFH 3LSOB 4JCLA 5CILH 1UZ8B 2ID5A 1O7VA 3NFSH 3PV6A 1P4IH 4P57A 5F1IB 1F13A 3VI3F 3VFVA 5GXBB 2B0SL 4MAUH 2VUYA 4QRQB 5FUCC 3K4ZA 2ZCLL 4MAYA 5L2KD 2OI9B 3K2UH 4IRSC 4XH2B 2XZZA 4PJGE 1BFVH 3O9WD 4LLMA 5DWUH 1B2WH 2GJ6E 1AGEB 3T4YA 4YFEA 4R0LA 3DWTA 3VXSD 4P2RD 3DECA 1KJVB 3DI3B 3H9ZA 4P3CH 3DXAA 4U3XA 5FFLA 1NMCC 4XNXL 3TJHC 4LHUA 2FEEI 4PJFB 1M71A 4ZQKB 4UILH 4IDJL 2AK4B 4LOUD 1FE8H 3UP1A 4JFOA 4LKXB 4I3GA 1WCBA 5ESQA 3VFSA 1LE5B 2NY1C 1AO7D 5HTSA 5IBTH 1FNSH 1J9CT 1NBQA 2VERN 1JGUL 4L4TB 4OF3A 4KUCF 3HZVB 4NQCA 5ACMA 4YGVB 1S8DA 3W9DB 4K3JH 3TESA 1X5YA 5DVMA 4LLVB 3IVKB 1TQBB 3BDBA 5ELIA 1JMZA 1FYTD 1EO5A 3MXWL 4JPVH 1I1YA 2O5ZH 4JQXA 5HYEA 1T1ZB 4QRPD 1MAJA 2DQFA 3KDMB 1J8HB 2ATPB 2X4OB 1E6OL 2HMIC 3T77B 3NH7H 4JN1L 3RY6C 1DQLH 1JZ8A 5KSUA 5GISH 4AL8L 2NMSA 4FQHA 4I2XA 4DW2H 1I9IL 2Z91B 2X4TB 2V2WB 3G5ZB 3WDHA 2YD2A 2CDGA 5IEKA 2UUDK 1BHGA 1DBJL 1KUMA 1R3HB 2XACC 2ZKHL 4PBXA 3EOYG 1BBJA 3L3KA 5DRXA 5GZOD 1IC1A 2BHYA 3KXFA 4YHIB 3LN5B 4DFIA 3QQ4B 3B6SB 1A7NH 3WCYA 2RCSH 4BFGA 5D96C 1QSFE 1NUDA 3LKRB 1FL6B 4U1GB 3D85B 1ZGLP 1AKJA 3U7WL 4ZD3L 1BOYA 3AB0C 1LE9A 2D7PA 1RUPH 1ZVYA 4U1LA 4RGNE 5DEZA 3N1MC 4NNPL 2JIXA 2O26U 5J1AA 3MLRL 3FQXB 2UY7A 5F97E 2EDFA 1B4JL 1NLBH 2B5IC 4WW1B 4ZUWA 3QEQE 5MERB 5CD3B 3CVHA 3GSUA 2CK0L 3QDMB 2W0FB 1OSZB 1N5YL 1MFAL 5DD6A 3Q6FB 5D6CA 2NY2D 1JPGB 1GC1L 1PAMA 1T89C 4PJCE 5F89B 4WFHE 4C4KT 1JNHB 3IS0X 3HE6B 2C3VA 1ETZA 1VGKA 4BZ1H 3GBML 4GKNA 5FA4A 5GS2D 4GW4A 3N50A 3QDJB 2GK2A 3O41B 4KHXH 4J3VA 1O7SA 4IOSD 3DGGB 4P2OC 4HAGA 2IADB 1TTUA 4Y19A 1MHHB 4P5MB 5EO1B 3OKNA 5DMGD 2XWTB 3VXME 3ARSA 1KIRB 3C5ZD 5IROC 2XXCB 3MRBA 4JPKH 3SDCB 5HPMA 4PJ8B 1I3RA 5FIEA 5HI4D 1NC4A 4Y4FD 5EBLB 1A0QH 5IB4B 2P1YA 4NC0B 1R3JA 3IGAB 5A16A 4MJIA 1HDMA 3OKLA 2JB5L 3RWDA 4KPHL 4MJ6B 1CFNB 3VXTB 2BHUA 1EFXD 3DHMA 3BQUD 1FH5L 3MLZH 1QRNA 2DQGL 1JWUA 3EOTH 4O5LL 2F5BH 5MENE 5JUEH 4XGZA 1D5XB 2XFXA 2DQCL 4M3KB 2P8LB 2FBJL 5I8CA 1ZA3A 1JK8B 3SCMB 1LDPL 4UT9H 1KJ2A 1SEQH 1INEL 2NX5B 4YDLC 2HT4D 1J5OH 4AH2A 5C07B 1R3KB 2NW2A 4TUOA 2YZ8A 1HH9A 5HDQH 4Z78B 2OTUB 4MNHA 4YWGL 4ETQB 5DHXB 4PJHE 1T0MB 1G7PB 1UWEL 5J4MA 1Z9MA 1M1SA 3TEUA 3BP4B 4N0FA 5I2IB 4JY5H 4NUGL 5D5MF 2AW2A 1WBXA 4GKSB 4NO0B 1UB5B 4S2SB 3RA7L 1Q9WB 5LWYL 3CXHK 4JEGB 1PZUB 4NZRL 2ARJB 1KENL 1J8HD 3HAEA 4FQXD 3LQZB 1IZKA 5E2VH 3LKNA 2WNGA 4YHPA 4OZIF 5DD0L 1IKFH 1OTUC 2C7UB 3TBTA 4HBCL 4HHAA 3G08B 1KCRH 4MXVE 4LHUG 1A64A 1G7QB 3TN0B 1H9VA 3PNWA 5I1IH 1A1NB 1YJDH 1R5WA 2XT1B 3Q5OA 1WEJL 3RL1A 1F6FB 1YY8A 2L0DA 2CKBH 5D1QD 1R0AH 1MRFL 3BHBB 5HGBA 4YNYA 3OX8B 3P2TA 1NMBL 1GCFA 1ZT1A 4PJDB 1V7ML 1F4YH 2K7QA 4LCIH 4RFEB 1U58B 2P8MA 1PQZA 4AEFA 5DUBA 3DYOA 1GGTA 4ZAKD 2HAZA 3U46B 3QFJA 4G42B 4PRBA 4XTRC 3IDNA 5FDYA 1S9VA 5EOCL 2D03H 4C56A 1IMHC 3U2SB 4MX7A 4U05A 1JMXA 1Q1JL 4M02A 4XBEL 4N1HB 4U0RB 3BEWA 5I15L 4XXDA 5DS8B 2RGSA 1U3HD 1KLGB 4UTAH 3P11L 4OCMC 1CQYA 1QKZH 3M45A 2A77L 1HQ4B 1CDCA 4JO4L 4OZFA 1P4LA 1T0NB 3NZHH 3VGDA 1A6UL 2EC8A 4PREB 5CINH 3SE9H 4C55A 3LQAH 3QXWA 3WLWD 1H0DB 2GEEA 2IALA 1F58H 5LCVL 4XNQA 1IGML 3KLHD 1KG0A 3ZSTA 4DKEH 1BP3B 4DEPC 3HTLX 4HGWB 4U6YA 4RFNB 2Y25A 2BK8A 4N0YL 3GSRB 1KIUA 2FR4B 1SBSL 1TVBB 1U8NA 3SOBH 4PJ8D 5GZND 1U8LB 4K8RC 2AV1A 2P24A 1I3GL 3MV7A 2P43B 1QFPA 1S7UA 1AY1H 2KKQA 2XRAL 3VE0B 1MFDL 4XMLL 1MCPL 2PXYB 5BOZG 1G9NC 1EV2E 3D6GA 4CVXB 4S1QL 2IPUG 2ADIB 4F57L 4KQ4L 1Q0YH 1URLA 1UJ3B 3M17B 1I7TB 3X11B 4M6ML 4R4ND 4YC2B 5C9JA 1D6VH 3WS6A 3RVXC 5C1MB 1X5XA 4NO3A 1J0ZA 5DHVH 3CFJA 3BE1L 4TSBL 5FYJL 3ULUF 4RQQB 5HY9A 4PJ7B 4K7PY 1N3NA 4XNYL 2IH3B 5C07D 3ULVE 1Q9KA 3O45A 4FMKA 3RJQB 1NC2B 2FX9L 2ZCHH 4X7SL 4OLXL 2GSGB 3BO8B 2XQYK 2L7UA 3M8OH 5DJ8A 3S34H 4F7TA 5I1JL 3MODH 2IAMC 4KROD 1CGSL 1UADC 2CJUH 2R15A 3LY6A 4FRWA 4GAGL 4L3CA 3F6IA 5CGYC 5HBBA 3ZHKA 2DQEH 5D7JA 4KMTL 4PP1C 1MCWW 2BVPB 4MWFB 5AD0A 3GMOB 2F53B 3FQUA 1BECA 1F11A 4YXHH 1A1OA 1HYRC 4XNUL 2FBOJ 3LKSA 4IJ3B 4WFGE 2Z8SA 4Z77A 4N0CD 2MCG1 1P9MA 5GSVB 5I75B 4MA3A 5INCA 1A6AA 1LVEA 4P46B 3CXDH 1FN4B 4JM4H 4F58H 5ID1A 3B2VL 2YD5A 1MI5A 4O4YH 1ZHKA 3MBXL 5TF1H 3WKML 4YXKL 1HKLH 2Z0BA 2F54D 3DVFA 2AJVH 5FB8B 4CVZB 3FQWB 5E2JA 3RIFF 3KPSE 1QSEA 4QRRB 5BZWA 4RDQF 2EKJA 3MLPA 3MUHL 2DQJH 3TO4D 2NY3C 5HJ3B 2YC1B 5BJTA 4MQSB 2BZDA 4KGLA 1TJHL 4DOHE 3PV6B 1UWXH 5CSBA 4R2GC 3VFVB 3HUJB 2PTUA 4HGKC 3NOIA 1PDKA 1MREL 3QG6B 1FAKT 5H2BA 3WD5L 5L8LB 4MAYB 1JYWA 1MPAH 3T65B 4HS8H 5E6IC 2P5ED 4LLMB 1QEWA 3T4YB 4OFDA 5LBSL 4OQTA 3QJHA 1WFNA 3B9DA 4LHUB 4XP5H 5AWNL 1M71B 2A0LC 4F15C 4S1RL 1TNNA 4N0RA 4ONFH 2HH0H 2XZQL 3C8DA 4JFOB 1VEPA 1HE7A 1R24A 3VFSB 1WCBB 5ESQB 2B1AH 3B2UC 5D1ZC 3S3SA 3CZJA 4LIQE 4X83A 3X13A 3NN8A 2V9RA 4HAFA 1RVFL 4NQCB 1NJ9A 1S8DB 5I1DA 1RIHH 4XPFL 2IBZY 3NCYS 1U8PA 3RIAK 2GHWB 3CSYA 5IP4A 3VWKA 1QHPA 4NNYA 4HQQL 2ZNXA 3FFDB 3I9GH 3C60A 4NKIL 1SJEA 5BS0E 3I6LE 2X4RA 2DQFB 4OCXL 4BFIA 4A6YH 3ULVH 3LEYL 1ZLUH 4YIQA 5IB5A 1E4JA 3SDDC 2IPKA 3AMKA 5T5NF 4LNVA 5KSUB 4F7CB 4FQHB 4I2XB 5GHWL 1RZFH 3MA9L 3A0OA 2EH7H 4YX2H 2CDGB 2FJHA 3TLRA 1FRGH 5IEKB 2H32H 5CLTA 2N7AA 3HI1A 5F7KC 4NNXA 3O6FC 4M61A 4H20L 4IEFB 4EUPH 1BBJB 3L3KB 1QG3A 5DRXB 3U9UA 1RUML 2WP3T 5IBTL 4Z7WB 3KXFB 3S35L 3ZKMC 4NHUA 4PG9A 1LEKA 2VIRA 4E42A 1AKJB 1CI5A 2BSRA 4XMPH 1LE9B 3R06A 2F53D 2IANA 4U1LB 5D1XA 3MROA 4JDVA 2W38A 3AREC 4TNWF 3JXAA 5J1AB 5D5MA 1X4XA 4NSKA 4M6OH 5BO1H 4ZUWB 4P46D 5J8OA 3CVHB 4CW1B 3GSUB 3S88H 4BZ2H 3MC0A 1F3JA 4OZIA 5T1LD 1JGVH 1TQCB 3TWCL 5D6CB 2JJTA 4LCWA 3GSNA 1DQLL 5F9OH 1IGYB 3MCKA 2VQUA 1RUKL 4Z95L 4DW2L 2C3VB 1ETZB 3QQ9C 1VGKB 3MV9E 3H3KA 2AJ3A 4N1CA 4GKNB 5CGMA 1YEHL 4X7TB 5DO2D 4YR6A 2EYTA 3VWJC 3QRGL 1QTYT 4D9QE 2DM4A 4LPUA 4QTHA 4LLWA 1OWRM 1J8KA 4M7ZB 4LMQE 4Y19B 1WC7A 2I07A 2NY5L 2RCSL 2VYRE 3SGDI 4YPJA 3OKNB 4MD5A 4DK6A 1HNFA 1MCFA 1GZPA 5HPMB 1V8HA 5JO5A 1I3RB 5D70H 1NC4B 1XAUA 2FHCA 2E27H 3QDJE 1DZBA 1QNZH 3P0YL 5A16B 4MJIB 4Z7OE 1VFOA 1HDMB 3OKLB 2CPCA 3RWDB 2Y5EA 1VA9A 1ZLVH 1CFTB 1J10A 3DBXB 2UZIL 2Z8VC 4KKAC 2R0ZH 2Q87A 3PWPE 4L9LC 1QRNB 1WZLA 5DRWA 3DXAD 1J0HA 3DNKA 3D2UD 2R4RH 4M1GH 1LO4H 4XGZB 1I1AB 3N1GC 2XFXB 2ZCKH 5I8CB 1PGRB 4ODSH 2DIBA 4TUJA 5LAXA 3GB7A 1ZA3B 2GQHA 2XTJC 1KJ2B 4LIQH 3NGBB 1DVFC 5E7BA 3CPLA 2R1XA 2LVEA 4UV7L 4RIRA 1NPUA 4KI5E 2NY0C 2NW2B 4TUOB 4OAWB 1NAKL 1X7QA 4FQ2H 3BRFA 3H9HA 4XBPA 3MJ9A 4MNHB 4WTXA 4PJ9B 3CVHL 2G2RA 4JE4B 3WIHH 3C2AH 4N0FB 1BAFH 3D18A 4APQC 5AYUH 2AKRA 1WBXB 4P4KC 4KJYA 4XMKL 1RZ7H 5HDOA 2CK2A 3HAEB 3LKNB 4YUEH 5GGTH 4KZEH 5IW6A 3FMGL 5C09A 4FABH 3G04A 4JB9L 3TBTB 1C1EL 4GUPA 4HHAB 4X98A 3HCVA 1NKOA 2AERT 3UJJL 3UTOA 1IAOA 3PNWB 1KV3A 3O8XC 1MAKA 1D9KA 5GGVY 1R5WB 1S7VA 5TE7L 4B7LA 5T1KA 3HNSH 4Q2ZA 3RL1B 2E9IA 1YY8B 5HGHA 3CNKA 1KPUA 5DMKA 5HGBB 4YNYB 4GSDH 2WBJA 1ZT1B 4Z7UF 3CSPA 5GRUH 2P8MB 4BFBD 1J0KA 3HMXA 4QWWD 5HDQL 2VAAA 5I30H 1F4XH 3SGJA 1KCSL 5DUBB 3QFJB 1CGUA 1YQVH 3PIQA 4PRBB 3IDNB 2JCCF 3AS1A 1X6LA 5JW5A 2JIXD 3TNMA 4C56B 5CJOH 1T20A 2ZUTA 4CU7A 1OT1A 3R8QA 1MRDH 4MX7B 1FQ9C 1J1PH 2OBGA 5JIIA 3EKCA 4PJDE 5IBUG 1WZ1H 3BEWB 4P59L 4XXDB 3B9EA 3VJ6A 5FECA 3HRZA 2YHGA 1KJ2L 5D8JH 1H3UA 4AQOA 3UROR 4S1DC 1GRWA 4FS0A 2F19H 3FO9A 4OZFB 4FZEL 3OZ9H 3U0PA 1P4LB 2X42A 5EU5A 3FAWA 4IM8A 1RZJL 4EVNB 3P9MA 3OAZH 1PJ9A 2IALB 5EA0H 4YFLF 4XNQB 4WI7A 1KG0B 5D71L 2X9YA 3QNYA 5KSAD 3KPQA 4TNVF 4XVTL 1J1OH 3QIBA 1BJ1J 4Y19D 4U6YB 4EI6B 4JRYD 5IHBA 4O02H 4IRJC 4JM2C 4NN5B 3UXFA 4UT7L 2L7JA 1UWXK 3NABH 1U8NB 1FBIL 1H5BA 1NC4D 4RCAA 2AV1B 2P24B 1CWVA 3MV7B 1FNGA 1S7UB 4JJ5A 5DZLA 3HNTH 2HT3C 1IM9A 1Q0XH 1KN4H 3H3PL 5FOJA 5IHUH 5C0DA 4ACPA 3QIWB 2WWKO 4HH8A 1CGVA 2PYEB 5C9JB 3GSQB 1UM4H 4NCC1 2ICWJ 3TYFA 3MR9A 4BSWB 4NO3B 3MSPA 2XWJA 3CFJB 4YQXL 5CINL 3CDYA 4K7PX 5HY9B 2PETA 3LQAL 2WWMD 1N3NB 1Q9KB 3BKJL 3VXNA 3AM8C 2WLYA 4A2MA 4F33A 5JMOC 2DDQL 5DJ8B 1I4FA 4F7TB 3L3GA 2AJUH 4NN7C 3C5SB 4JFPA 4LASH 4RGND 3IKKA 3ILQC 4K3DL 5D72L 3I3EA 2ICCA 1YYLL 1RURH 2QADC 3EFDH 2QHRH 5D7JB 2HLFD 1Z3GH 3PHQB 5AD0B 3FQUB 1F11B 4D94A 5CJQH 2UV3A 3LKSB 1K8IA 1U2HA 4YAQA 4Z77B 2AEIT 3KWWB 4H25B 1A5FH 4WFHD 4HFUL 4MA3B 4HIJA 1A6AB 5INCB 1A3LH 2FGZA 4IMKA 3FOMA 3ARZA 5GS3A 5ID1B 3MUJA 5HHOA 4WHCA 1U6AL 1MI5B 4PTTA 1NMAH 5DSCA 1AXTL 1ZHKB 5T33H 4M48L 2FX8H 2VDRH 4I77L 4NQVA 5JIKA 1PKQE 1GGBH 4F3FA 2ZCHL 4K3HA 4KZDL 3FT2A 3S34L 3X3FH 3MGAA 1EVUA 5BZWB 5AZ2L 1I85A 2EDBA 1DQJA 1A7QL 1YMMA 2CJUL 3ARWA 1DLHA 5E08H 4UAOB 5BW7C 5BJTB 4F9PC 4OF7A 2KH2B 4MXWL 3W2DL 2E7LA 4ODTL 4Z7VB 2OCFD 1CE1L 4WV1A 2XN9A 3UPAA 1CG9A 3GIZH 4NFBA 4P99A 4X9HA 1IC4L 4ODVH 4UI2A 3O4LE 5B21A 5H2BB 5MEND 4KC3B 1JGDA 5EORL 3VFUA 1JP5A 1GGCH 1INDH 3LD8B 1OAZH 3HZKA 2B2XH 1QEWB 4Y4KC 2VDML 1A7RL 4IDLA 5TFSL 3FO0H 1IAKA 1U8MA 4LSPL 5I1EH 1C5BL 5B4MC 3MLVH 5HSFA 4J23A 2Q3AA 3QJHB 2VDKH 3SKJL 2OR9H 4TVPE 1CLCA 5EFIA 3HUJE 5DJDB 3VFGL 1JYXA 2BRQA 4HGMA 4PLJD 4PJAB 4KRNA 2HVKA 5K9QG 1UFUA 4QRTA 1MIEL 3R0MA 3QUYC 4KKLC 3X13B 2DQJL 5DUPH 3NN8B 1IRAY 5KZCD 1NJ9B 2GK0A 1QFWH 2AJYL 1ZLVK 3LVEA 1HZHL 2IBZX 3ZE1E 1A7OH 4GRMA 1OP3K 1NL0L 4EI5C 5CJXA 4Y5XB 3CSYB 2A6KA 3VWKB 3BP6A 2K9UA 5DVKA 2CDFA 4RMTA 4NNYB 1C5CL 4PRPA 4U6HA 1QBML 1CU4H 3RUGF 3RWCA 3C60B 5TE4L 1T4KA 4EQ2A 2X4RB 2C9AA 5EUOF 4BFIB 1QYGH 4CMHB 1K3ZA 4YIQB 5IB5B 2AVGA 4NQCE 2IPKB 4ZPVA 1KPVA 4YXLL 2D7OA 2ADGA 4EN3C 4CMMA 5C7XH 3WNKA 3U7YH 4ODUA 3QI9C 5DRZB 4ONFL 2FJHB 4Z9KB 2HA1A 3HI1B 4MS8D 1KGCE 3ZKXC 4NNXB 3T3PE 1BZQK 4RDQG 4M61B 3PP3K 2HTKD 2NY6C 3LB6C 3TA3A 1KPRA 3U9UB 3HI5H 4ISVA 3PHSA 1KT2A 1MCIA 5FUZL 2Q7NA 4JFHE 4NHUB 2HTLC 5D7IF 4ENEC 1CXLA 4E42B 4OF5A 2BSRB 5IG7A 2Y07H 3E8UL 3R06B 3PDOA 2IANB 4HWNA 5D1XB 3MROB 4JDVB 4G6AC 5D5MB 4NSKB 1QBLH 2WUBH 2ZUSA 4FG6C 4XPGH 3SDAC 3VD4A 3MBEA 1OM3L 5E1AA 4OQTL 2VDQH 2KUTA 4Z7WE 1F3JB 4OZIB 4FQ1H 1FYHB 4LCWB 3GSNB 4D8PA 4UBDC 3SO5A 1YEGH 4H0IA 3MCKB 2GITA 4U2ZA 3UTSA 4OZGE 4L1HA 4M7JL 1RHFA 3GMNA 2R8SH 1FRGL 3ZE0E 2APBA 4B53A 3H7LA 5EOTA 1QSED 4YR6B 2FYYB 5C08A 2EYTB 4Z7UA 4G7VH 4GG8A 5I73B 4OCYL 4XP9H 1SM3H 5ENWA 4QTHB 3HMWL 3LV3A 4P2YA 4W6YB 1IGTA 5IUSA 3BN9C 3LZFL 1WC7B 3MJ8A 4P2QA 2I07B 4YHKH 2ZUXA 5DMIH 2DYPA 2XZCL 5IFJB 2JCCA 4XMPL 3BDYH 2BY1A 4MD5B 2VXTH 1GZPB 2PF6A 1CICC 1PVHA 3O2DH 2YK1H 5EO9A 4ZSOA 4NWTL 5HI3C 5SWZE 3VXUE 2FJFA 3ZYIA 1NLDL 2DD8L 3O3UN 3JV0A 2FEDD 5C0GA 3MCLH 5DRWB 2HVJA 5TQ0H 4TVPH 2OP4H 4MB5A 5J9PA 4LEXH 3ULVD 1FZKB 1B88A 4JG1L 4TULH 5ESVB 3NCJH 4AJ0A 4TUJB 5LAXB 5JW4Q 4XWGH 3WJLA 4JZNA 4QY8A 3DMMC 3CPLB 4W6WB 2R1XB 4RIRB 3RDTC 3T4AA 5K9JH 3DV4A 2DICA 1KJ3H 3KPLB 3V6FA 1Y6KR 3VXOA 1X7QB 5CSZA 3H9HB 4XBPB 2W9DH 1IM3A 5JQHC 4LSVH 5J56B 4M62L 3MRKA 3TBWA 3KS0H 3GGWA 4IMLB 3TVMA 3D18B 4G9DA 1LP9F 1IGIH 4KJYB 1BEYL 3GSNL 1GH7A 3C60D 3H9SE 4F9LA 3UEZA 2EDRA 5L2JB 5L88H 3TV3H 1IT9H 3S6CA 1OLLA 4P2CG 3LS5L 5C09B 2R0ZL 3G04B 3RJDA 4GUPB 5HHQA 4X98B 3HCVB 2C3HA 5I9QC 2BNUB 5ALCH 4HX1A 1IAOB 1LO4L 5IJKC 4JZJB 1D9KB 1TETL 2ZCKL 2BVQA 3ARGD 1I3UA 2XXMB 5T1KB 4Q2ZB 4X9FA 5HGHB 1KPUB 5DMKB 1KEGL 1G9MH 2CIKA 5I8OH 2WBJB 2ENYA 2RFXA 1I9RH 4HSQA 5CZXC 1CL7I 4ONHA 1TIUA 1CXIA 3PIQB 3RPIA 4OM0L 5F44A 2IAND 2Z93A 1YEJL 1MELA 3JVGC 2D7QA 5JW5B 3PQYB 3WIHL 3WN5A 3VCLA 1PX3A 3STZA 5GS1A 3JZ7A 3TNMB 1X6NA 2DQTH 1T20B 1XT5A 5JDJA 5CKGA 1IL1A 5FDWB 5IK3A 1ADQH 3BPCA 5HYSA 3EDJA 1CF8H 1PLGH 3C6LA 3VJ6B 3FRPA 5FECB 2Z8WC 3HRZB 1M7IA 2HWZL 3GMMB 4H0HB 3RU8H 5ADOL 2XA8L 1Y6MR 2DQDH 2LVCA 2MCPH 3P9LA 3WDIA 3FO9B 2VXVH 4HZLA 3VMOA 3U0PB 5JR1L 5EU5B 4OGAD 2VLJA 4ZO6A 4PGJA 3P9MB 4IRSB 3MJ9L 1HINH 3IFPB 5KTEL 5IQ7H 3QNYB 3KPQB 1N0LA 3QIBB 1BF2A 2APWA 2EZ0C 3FCTA 4QTIL 4XAKE 1ZMYA 1UG9A 3DUSA 4KRPB 2F5AH 2VXUL 1H3TA 2VXSL 1A6WL 3SY0A 4CAGA 2HJLA 3KR3H 4DUXA 1DR9A 3O2VH 5KW9H 3DOSA 1FNGB 3RX7A 4RZCB 4JJ5B 1T04A 1YEFH 1MRCH 5JPMB 1JUFB 3QHFH 1IM9B 1J0JA 5C0DB 1C08A 3S8WA 1C5DA 4HWEL 5IMLA 4GBXC 3MRMB 3ULUL 2O5XL 3KPOA 4NKMA 1JWSB 2DN7A 1D5BA 3TYFB 3HRPA 4KJWC 3HE7A 5GRYA 3EUUA 1G6VK 2XWJB 5DK2A 5HHXL 4PJ5E 5H37H 3GI9H 5JW4R 3HMXL 2CUHA 3C87A 4JFFE 5KVGL 1FO0H 4PJXE 1BREA 1MCOH 4R7NA 1YYMH 3QUZA 1LO5A 4LGRB 3WFEH 1SY6A 4FQCH 3SDYH 5E8DL 3OPZL 3VXNB 4Y16C 1F3DH 3O4OC 4JR9L 4O02L 2PYEE 4F33B 1I4FB 3L3GB 4JJHA 3NABL 1QP1A 1T5WB 4PYGA 3WFBH 4JFPB 4G8GA 1N6QH 5C70A 1Q0XL 2CD0A 4Z6AT 2YMXL 4OTXL 4WI6A 1K8IB 4RA0C 4YAQB 1UM4L 3RUGA 3O9WC 2ITCB 1E4KA 4M6AA 4HIJB 1Y0LB 4NGHH 4CU6A 1LK3L 5T1KD 2EYSA 3UTTA 1AJ7H 1N0XH 4O00A 3ULUD 5EUOA 2F58L 3FOMB 3BPOC 3QA3A 2GY7B 3FZUC 4X99A 3P0VL 5DSCB 3KYMA 1XF3A 4NQVB 5AG9A 4PRHA 2ZUWA 5FYJU 2J88L 3X12A 4NQDA 2FGWH 5B3JF 1DFBH 1JZ4A 1DQJB 1CD1A 4GQ9H 1YMMB 4YZFF 2CR3A 2AQ3A 3WNPA 1UEYA 1DLHB 5D7IA 1OAUL 3Q48A 1UQSA 4YFDB 1TZIA 4HKZA 1RURL 3V52L 3EFDL 5I1KH 2VSCA 2OLDA 4M6NL 5I16A 3D39A 4NRZA 2YD8A 3T1FA 1WAAF 3NTCH 4WV1B 4BQ6A 4MGXA 2XN9B 4PUBH 1CG9B 2YZ1A 5CJQL 4PB0H 4LLQA 1YC7A 1GYAA 4EDWH 4HCRH 4WEBH 2ZSWA 3FTGA 1JGDB 3O3BA 5CEZE 5KAQF 4KK9C 1U8IA 3HZKB 5EG6C 5HD8D 1IAKB 1U8MB 4XVUD 4BKLA 4YHML 2FX8L 5A3IC 1DCLA 4KI5D 2X9XA 4NQEE 4S0SD 4Z7VE 3GHEH 2J8UF 4GRLD 4KJQD 1GGBL 1EBAA 2DI7A 5EFIB 3K8MA 4KRPD 5GZOC 5M94B 2EKSA 1BJMA 4PD4J 1YA5A 3DURA 4OLWH 2HVKB 4G9FA 3ZL4L 4OSUH 4GS7B 2BVYA 4WRLA 1SMAA 2GK0B 1Z0NA 3FRPG 3PXJA 4GRMB 1JF5A 4X6BA 3DUUA 3MREA 4N0UE 2A6KB 3BP6B 1ACYH 1EFQA 2CDFB 4ORZC 5DQJA 3WFCL 2P49B 1EXUA 2FB4H 4DTGH 4JQVA 4PRPB 4YHZH 4U6HB 3VA6A 3RWCB 4PJEE 2A83A 2ZZUT 2FWOA 1BD2A 1CFBA 4PJAE 1CK0H 2NY2C 2AABH 1PG7L 3MV8D 4JFXA 4NC1C 4G7YH 1INDL 1OAZL 2IMMA 3TPUA 4ZPVB 1KPVB 4QXGH 4H8WL 3WIIL 4CMMB 3V7AG 4ODUB 3MLUL 4O2CA 1KYOK 3RRQA 4H26A 4I3SH 5KANI 4CVUA 3N85H 2D3VA 3MMEA 4JO2H 3IJSA 3BZFB 3EO1B 5HVHB 4M7KH 1AGBA 4OLYL 1KPRB 3L7EA 3TA3B 3PL6D 4ISVB 3PDGA 1J05A 2CQVA 2PR4L 4FFVD 1KT2B 4R97B 3S4SA 4DN4L 3KLAA 1GGYA 3C5ZC 3E0GA 2IFFH 3FFCE 3SBWA 4MA8H 3FHAA 5IG7B 4CN4A 3EYSL 8FABA 3PDOB 1ONQA 1TZGH 4EOWH 1KB9K 1WZKA 5T3ZE 1LP9A 1NANI 4AMKL 3I3BA 3CFIC 4KHTL 5ILTL 4X6CE 5TDOB 3TH2T 3MBEB 2MFNA 4Y8AA 5E1AB 5BVPH 4AEIL 1FIGH 4WUUE 3SKOA 2LAGB 3T2OA 4E41E 3ARPA 5HHOD 1ZLWH 1RZKH 4NFCA 3C8HA 1GC1C 2VLRA 3IFLL 1I1CA 2QBWA 5CUSL 3UTSB 3SGKA 2DLGA 2R69H 3GMNB 5EWIL 2ZOKA 4D0DB 2MKLC 4Z7UB 4GG8B 1L6ZA 2J5LB 5ENWB 1RPQA 3LV3B 1TQBC 3TF7C 1IGTB 4P2QB 3MJ8B 2NZ9D 5DK0A 4FQPA 1N4XH 1OHQA 2DYPB 4HXBH 2JCCB 1U93A 5F9AC 5SX5H 2Y07L 3VXRE 1DQML 1AD9A 5C0JA 5EO9B 2CR6A 3PGDA 4FQXC 5ANME 5F7LB 5CEZH 4XPGL 1KBGH 4YHLH 2YEZA 1RK0A 4LCUA 2FJFB 3MRGA 2NYYC 1MFNA 3ARFA 1ED3B 1OGTB 1EH9A 5C0GB 5JW3L 5I1GH 4NM8H 3MUY1 2IPUK 4XC1L 2AXHA 2HVJB 4FTVE 5JZ7D 4NM4H 3P73A 4HUVA 2R0LH 5HI5D 5D1QC 2BY0A 3R1GH 3QJFB 3QXTA 4JKLA 3RGVA 5BV7H 4AYFA 1QR1B 3EOAB 4Q7DA 3RX5A 1FGVL 3MRIA 4JZNB 4PRAA 4QY8B 4MQTB 1PD6A 4U1GC 5C0CE 1FL5A 1S3KH 3I85A 3T4AB 4ALAH 1I7RA 3DV4B 4ZFGH 1DEDA 5CGTA 3V6FB 5CJ8A 3VXOB 1DDHA 2R0KH 5CSZB 3UX9B 4YHKL 5E9DA 1LNUA 5DMIL 3LS4H 2H9GA 1MQKH 3EJYD 3L3HA 3BDYL 3MRKB 3TBWB 3KLSA 2F74A 3GGWB 3PDDA 3CX5K 3TVMB 2BNRE 4PRPD 4G9DB 2PO6A 3K2MC 4NZDA 5TE6H 1RMFL 1U3HC 1FCCA 2F8XC 1V3LA 5C0BE 2EIDA 1NCCL 5J13B 3HE6C 5HHQB 4JHAL 1ITBB 4J4PC 2R9HD 1H3XA 2BCKA 1DBAH 2K3TA 1X3DA 3CLEH 1FORL 4LEXL 2HKHH 2BVQB 1MJUL 2R29H 5F1SA 3NCJL 5FGBC 5B8CA 4OLVH 2W9EL 1IILE 3SKNB 5DTFB 4F8QA 1LO3L 3TA3D 2CIKB 3K8KA 3NA9H 2RFXB 3LMJH 4XP4H 1RJLA 5K9JL 4ZS7L 1KJ3L 3U4BL 3MCG1 4LVHB 4ONHB 2G60L 2I5YH 4PJ8C 1QRKA 5GZNC 3V6OC 4KMQA 4GKOA 5T3ZH 4X6FA 3RPIB 1FDLL 3CMOH 2Z93B 2AS5M 5LXGL 5T1DL 2X6MA 3WN5B 3VCLB 3STZB 5GS1B 5EOCJ 1K6QL 3T2NH 3QBTB 2YBRA 1IL1B 5DJZA 1IGIL 2GIYA 1IAIM 5IK3B 4PGDA 1S7SA 4LMQI 3MRRA 3BPCB 3O4LD 5HYSB 4UINL 5FM8A 4R4NC 3C6LB 1GOHA 3D0LA 2HRLA 1H8NA 3NIDE 4LFHG 1BQHA 1UENA 1OWWA 1ZTXL 1M7IB 1WBYA 3TO2B 1UH3A 1CXEA 5ICXB 4C58B 4R2GB 4JGMA 4OIIL 3UTSD 3P9LB 4HZLB 3PQYE 3L5XH 5EU6E 2VLJB 3MYJA 1P2CA 4TVPD 1CFVL 3L95A 3UTPE 5C08D 2DRUA 2JJSC 5GJTL 4C4KO 3S4SG 2CMRL 3IFNL 2VDOL 3A67L 4HD9A 4YBLB 1IFHL 4H88L 5I8KL 3FCTB 1TNMA 1CDBA 1FFRA 4PS4H 2UVEA 3CCHB 4KROC 4F15B 4GH7B 5EC1A 3SJVE 6FABH 2Q76A 1KLFA 2J4WH 3SY0B 5HXMA 5GGVH 2PTTA 2HJLB 1F4WH 3RHWK 3DHJA 5FUCE 4I3RH 4FQJH 3WUWG 4NP4H 3OF6D 1PBYA 3MV11 1UM6L 1RULH 4XXCC 5E5MA 4I18C 1T04B 3DJ9A 1CF8L 3LHPH 1A02N 1A22B 3TN0C 1WAAA 3H8NA 4NJ9L 4N0CC 5JHDA 1C08B 4J6RL 1C5DB 3DV6A 1SYSB 3N9GL