2AFNA

Structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
331
Chain Sequence
IAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 88
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA02
4GP5B 4W1TA 3G5WA 1PLCA 4WKXA 3SBPA 3WI9A 4ENZA 3FYEB 1JOIA 2JKWA 4X4KA 1A4AA 2Q5BA 2PPEA 4PAZA 4G70B 1KBWA 1L9TA 3TU6A 2VW7A 2IH9A 3ABMB 2DWSA 2IAAC 2RACA 1E30A 1IC0A 4KOBA 3UGEA 3NJNA 2HX9A 4MFHA 3S3DB 1WS7A 3UAEA 1A8ZA 5I6MA 4E9WA 1NIFA 1PZAA 1OCCB 3ABKB 4YSOA 2ZWNA 1J9QA 4AZUA 4KNTA 4Q8BA 2GBAA 1AZRA 3QJSB 4GXFA 4G7RB 1L9PA 1JXGA 2YARA 3OQRA 1WA2X 5D4IA 1GY1A 3AG1B 3D12B 1IBYA 2JXMA 1ILSA 3IBOA 2LLNA 5B1JA 3S3BB 1HFUA 1X9UA 3PCYA 1BQKA 3L45A 5B7EA 3PXLA 2DWTA 4BK5C 3WNJA 1TEGA 3X1NA 4AKQA 4A68A 1RCYA 5ANHA 5I5IA 5LDUA 4WTQA 2BZ7A 1GSKA 1AZNA 1DYZA 1CYWA 1URIA 1UATA 3FU8A 3GXUB 3IN2A 3PAZA 2GB2A 4DP1X 1TEFA 3AW5A 3T6VA 4BDVA 1SFHA 1CURA 4UF7C 4A66A 1W6WA 1AR1B 1W8EA 2P80D 2IDTA 1JXDA 1NIDA 1NPJA 1XB8A 3FPYA 3UADA 1ILUA 4HCIA 3FS9A 1T5KA 6PCYA 3X1FA 1BEXA 2BWDA 1GYCA 3SBRA 4DP5X 4BWUA 3FSVA 5EHFA 2FQEA 3CVCA 1AAJA 3MBWB 2R7EA 3NSCA 1AACA 1AOZA 5E9NA 2UXGA 4HHWA 2OCCB 4NB7A 3NJLA 1AS8A 2X88A 2IWFA 1AG6A 4F2FA 4P5SA 2QPEB 2J55A 2PPAA 3GDCA 2PPDA 1GS7A 1HAUA 1AG0A 1WAEA 4UANA 3H4FA 3ZBMA 1ASOA 1PCSA 2DYRB 2HRGA 2YAMA 2FT8A 2W8CA 3QQXA 2OV0A 2E86A 3T6WA 1J5CA 3UABA 4F2EA 3EH3B 4YVNA 1KV7A 1SDDA 4GY4A 4FA7B 1KDJA 1EHKB 3NSYA 3X1GA 1E5ZA 2WO3B 2X87A 2Y69B 2GHZA 4JHVA 4TXVB 1OF0A 2FT7A 5TK2A 1MZZA 1NINA 3NJMA 4HCFA 2PPCA 1N68A 2YXVA 1SHWA 1BXVA 2PCYA 1M56B 2YXWA 3ASNB 4YSSA 2J56A 3FSZA 1A65A 2MRYA 2NRDA 2BW5A 1KCBA 1E65A 1R1CA 5IY5B 2FJSA 4BWTA 1A4CA 2PLTA 2EIJB 3V9EA 1OE1A 1KYAA 1NTDA 1WA1X 1KCWA 2FT6A 3OMAB 2PP7A 4YSPA 2HX8A 5AFAA 1ZIBA 2BWIA 3CDZB 1CC3A 1J9SA 1DZ0A 2FTAA 2PP8A 4M4RB 2AFNA 1L9SA 3IN0A 2BP0A 4QKTA 1PMYA 3EH5B 4HHGA 3TBCA 3NJFA 3TBBA 2XV2A 4YSEA 4AI7A 3NT0A 2ZOOA 1TKWA 5I28A 3S8GB 1B3IA 1BXUA 1NPNA 4QLWA 2CUAA 3FSAA 4KO5A 3FQYA 4A2FA 1BYPA 2BZCA 2FQFA 2GC4C 2A3TA 3CG8A 4AKOA 2AZUA 3S3CB 1EZLA 3ABGA 3IE9A 4KNUA 1L9RA 1BQ5A 4BDVB 2QPDB 2B08A 2EIKB 1NWPA 2HLEB 3C75A 1V10A 3JTBA 2CCWA 4L0PB 3NSFA 3NP4A 1WA0X 4G7SB 2EIMB 4DPBX 3EH4B 4DP7X 4G71B 1PLBA 3KW8A 2XWZA 4AX3A 3ZIYA 2H5UA 1NIBA 1SJMA 4E9YA 2VMJA 3EF4A 3ZX1A 4DP9X 2IDFA 2PPFA 4DP8X 2UX6A 3CVDA 3CVBA 1ASQA 2BO0A 1ZPUA 2VN3A 3FU7A 2FQGA 4DP6X 4DP4X 2AVFA 2XVBA 2R7EB 3FU9A 3QJUB 5D4JA 2FQDA 1OE2A 3NSDA 1PNCA 3GYRA 3TASA 4AKPA 4GP4B 5AZUA 7PCYA 2GSMB 3T71A 4Q89A 2Q9OA 1JVOA 2XLLA 1JZEA 3RYMA 3U25A 2P80A 3UACA 1E67A 2YAEA 4YL4A 5I5MA 5I6NA 3EHBB 4A2DA 2FWLB 3ASOB 3WKPA 1NZRA 4BWWA 4E9SA 4E9QA 2QDWA 3HEIB 3BQVA 3QJRB 2CBPA 4ZK8A 1QNIA 2GC7C 3JT2A 1SFDA 1AZBA 1SDDB 5B7MA 1V54B 4UAHA 3FSWA 3IEAA 3OMIB 1JERA 3X1BA 1JZIA 3PPSA 2Y1AA 1BYOA 4RH4A 3PLYA 1JVLA 1OOWA 2XYBA 3X1EA 1ET5A 2VSMB 2XUWA 1KBVA 1IKOP 1TU2A 4KO7A 3NJIA 3SBQA 4E9RA 4DPCX 4YSUA 3FPXA 4GP8B 2XU9A 4A2EA 1PY0A 2GI0A 4KO6A 1L9OA 1PNDA 1V55B 4JKNA 4A2HA 1CYXA 4BXSV 3HB3B 1AQ8A 2I7OA 2IH8A 1FWXA 3ZDWA 4NERA 1X9RA 4KNSA 2XXFA 3FQ2A 1QHQA 5B1BB 1ZIAA 5TK4A 1JZJA 1SNRA 2UXTA 3WG7B 2JFCA 1ZDSA 5I6KA 4N4YB 1GY2A 2UXVA 3AY2A 3DTUB 1M9WA 5B7FA 2VSKB 1AS6A 1AZCA 3UAAA 2YAQA 3KW7A 4M3HA 3WKQA 1OCRB 3AG4B 1XB3A 3NJJA 2XV0A 2YAOA 4A67A 5AKRA 2PP9A 4G72B 2CALA 3QJVB 3QPKA 1FFTB 2XV3A 2HZHA 2UXFA 4E9VA 4NAJA 1W6LA 1SF3A 1L9QA 2UX7A 3N55A 3DKHA 1GS8A 3AG3B 3DIVA 4BXVA 3ABLB 3OD3A 2AZAA 2VM3A 2YQBA 2OJ1A 3OMNB 4F7KA 4HCGA 3BVDB 5A7EA 3PAUA 2B3IA 3N2JA 3FU7B 5FC9A 1A3ZA 4FAAB 1BXAA 9PCYA 2HXAA 2W88A 3QJQB 1OV8A 2BP8A 2VW6A 1PZCA 4KO9A 5F7BA 3FT0A 1F56A 5B3SB 1E5YA 1NDTA 2XX1A 5B1AB 3WIAA 4G7QB 4JHUA 1ZV2A 4YSCA 2TSAA 2EILB 1MZYA 1IUZA 2I85A 2YAHA 3OM3B 1WS8A 1MG3C 1A4BA 3CDZA 5I6LA 3ERXA 5I6OA 2BHFA 1FA4A 2I7SA 4GYBA 4E9TA 1NICA 2DV6A 2VW4A 3FQ1A 2IWEA 1GS6X 2XXGA 2J5WA 1AIZA 2ZONA 4P5RA 2HRHA 2YAPA 4EF3A 3SQRA 2H3XC 4YSAA 1GW0A 4HALA 4PCYA 2FNWA 2XX0A 1BAWA 2J57A 1ETJA 2PCFA 4YSRA 5PAZA 1PF3A 2CJ3A 1I53A 1XB6A 1AZUA 4W9ZA 1HAWA 2EINB 3NJGA 3H56A 1JZGA 2H47C 2YAFA 3X2QB 4YSDA 3NJHA 3CZUB 3NJKA 1PAZA 4DPAX 6PAZA 2HX7A 1J9RA 4HZ1A 2MTAA 3QJTB 1OCZB 2GIMA 2BW4A 3TA4D 5D4HA 3H4HA 2IDSA 2N0MA 2ZXWB 3AG2B 3MX0B 3FYIB 2IDUA 4HIPA 2DYSB 1ID2A 1MG2C 1NIEA 4DP2X 2DY2A 1XMEB 2VM4A 4KOCA 1KDIA 1JZHA 1SF5A 1ASPA 1CUOA 4CSZA 5F7AA 5I5JA 1RKRA 1MDAA 1GR7A 3NYKA 4YVUA 2QDVA 3T6ZA 3T6XA 1KGYE 8PAZA 1OCOB 2WO2B 1IBZA 1YLBB 2QT6A 3PAVA 2WSDA 1ET8A 4YSTA 1N70A 5B1KA 2BP0B 4CSPA 3T9WA 1VLXA 1J9TA 1PZBA 1SHXA 1JXFA 7PAZA 4A2GA 3NP3A 4N8UA 1PLAA 1RZQA 3AZUA 1ET7A 5PCYA 1BQRA 3V9CA 3S8FB 1AANA 1NIAA 5B1JC 1RZPA 3WNIA 1QLEB 1M57B 2IWKA 4YSQA 2TSBA 1AS7A 1NWOA 2CAKA 2IDQA 4HAKA 4DP0X 1OE3A 5I26A 4E9XA 1J5DA 2AANA 1ZDQA 4K9JA 2BP8B 1ADWA 5I6PA 1JZFA
chains in the Genus database with same CATH superfamily
1E7VA 1U8CB 3FHQA 4KXZH 5E1GA 4BEIA 4WKXA 2X4NA 2XQYA 1KEGH 4LU5L 5C6TL 1QSFD 5F9WB 2C1OB 3MRDA 4DEPC 3QXVA 4FJYA 1A4AA 3BAYA 4TVPL 1M9SA 1ZTXL 4AJVA 2JH2A 5ALBL 1LE5A 4JGNA 5F1SA 1L9TA 5I8KH 2DWSA 5HPMA 4HLZH 5EBMA 4LCWE 1D7DA 4LCUB 4O2EA 5CIPH 5J9PA 4F15B 4YE4L 4CC4A 1NDMA 3S3DB 3WTYA 4D3CH 2VSCA 4X7CC 4D8OA 1OCCB 2B59A 2H6PB 2NUPA 2PWGA 1BLIA 1MJ8L 3C60A 3JWDC 2FGZA 4P49A 4Q8BA 4UI2A 1AY1H 3BQUA 4QRAA 3VI3E 5ADPL 4HIEB 4MD4B 5TDNA 4HBQA 2ZG1A 4FABH 2JWYA 1XO8A 4IMKA 1JPFB 5A2CA 3KBEA 3KPTA 4PJDF 3EYOA 4DGYH 3A4FA 5C0IA 2OR9L 2PYEA 1HFUA 4L3ED 5FYJD 5IK3A 4YNYB 2CDEB 1TEGA 3AS0A 3RVUD 3EHBC 4PP1D 3L54A 4TVPE 2R56L 1BQHB 1ZTXE 2MCAA 4B96A 4B3VA 4KJYA 3D0VA 5ANHA 3P9WB 2P8MB 1T0NA 4JRYB 3P9LB 4M1CD 2GJZA 4P3WA 4PTTA 4TQ8A 5DJ0A 1GSKA 4X9YA 1CF8H 4OLWH 1TEFA 3ARGD 5CEXB 3HS9A 5FUOH 1D5BB 2X1XR 2I25N 2J88L 1T4KA 1W6WA 4GG8B 4YDKH 1VFBB 3HZYB 2DMGA 1QLFB 4P4KD 3LPPA 2BVEA 3FT4B 5E0QA 3QZLA 5BRZB 1R33A 4WFFD 4JPVL 4K8RH 3MV7B 3NA4A 4PQXA 2E47A 4Y2DD 3UROR 5ISZB 4LL1A 4M62H 3ZO0A 2DMCA 2JIXB 5IB3A 5IP4A 5EA0L 4O5LH 3IFNH 1BREA 3C5ZB 3NDYE 3ZHNA 4AVJA 3FSVA 4FA8A 5I17A 1XGTA 1C08A 3VFOA 1AGFA 1ML0A 3ZMEA 1RZJL 5CJOH 3INUL 4PJXA 4YXKL 4YUEH 1D6VL 1UM5L 4JFDD 2QVTA 5CJQH 3QCTL 5JIKA 3U9PH 1IGFH 2XWTA 4WWPA 4NB7A 4EVNA 3TF4A 4Y5VA 5EWIL 4YGVA 5BUAA 4MJ6A 1AIFA 3LTVA 1R34A 1TPXB 3PGDA 3RY6A 3UX9B 3GDCA 3PDOB 5EU6B 5LNEA 4N8VG 1PY9A 2FLBT 2PW1A 1UWGH 2BNRE 5ACZA 5J6GB 5FYJU 3OLIA 2XKUA 4WHDA 1MNUL 5KVEH 1XH0A 3O6FB 1J05A 2R2CA 2YJLA 4N2EA 5D1XD 4CRPA 2P8PA 3MGOA 4EZLA 1ZLWH 4PRHE 2Y2TA 1OGAE 3Q2CA 4LSTL 5GRVL 3VI4E 4M3KB 4UILL 4A6YA 4N0UE 3BFQG 1I1CA 2X09A 2Z65C 3LRKA 4JO4H 4MZRA 3C2AL 5MENA 1JWUB 1RULH 2EH8H 4Z77A 1OOAA 3OLEA 1JYVA 3OKKA 2HFGH 1DBAH 5C08A 5IMMB 5J6HB 5AKSA 2DMKA 1ETZA 4GNKB 1M42A 3U36B 1EPFA 3K6OA 5HGHB 4RESB 3MJWA 1P7QD 5K9KA 5FYJL 3KPQA 4NOFA 5F44A 2VDNH 4BGLA 3ZY7A 1PEZA 2J25A 1QSFE 5FYLD 3NCFB 1RSFA 2CIKA 1WCQA 4I0CC 5CJXC 1QEWA 4PVLA 3V9EA 3L16A 1FH2A 4ODUA 1YUHB 3MLSL 4JL2A 4YSPA 4PJ5A 3SDAC 4AQAB 2QKIB 4PUBL 3UG5A 3DX3A 3UBHA 2EXSA 4W70A 4AG4H 4JVPA 1FVEA 3IDIA 4F8NA 1Q1JH 1C5CL 2FTAA 3LQZB 3QQ9D 5ABZA 1L9SA 1NKGA 4AITA 2N7AA 2JKSA 4ZJ9A 1WITA 4NIKB 4Y16B 2W0PA 1ECZA 2FJFA 4XNUH 3SSGA 5T3ZD 5T1DH 2OXHB 1WTGT 2WLHA 4EIGB 3O8XA 2YEZB 5G4MA 2FQFA 2IG2H 5L88H 5HHOA 3F12B 5J06A 5K9QI 1H3UA 1DUYA 1JHTA 2GVYA 4FKKA 4KBPA 2IPUG 3QO0B 5DDHA 4ZS7H 3S5LB 1RZ7L 3LB6C 1BQ5A 3HR6A 5DURB 1AD9B 1RZ8B 5D55A 3PWUB 4PJBE 1KELL 4ZAKA 4L8BB 4ADIA 1KPUB 3GJFK 3T3PE 3QCUH 1QPKA 4ICXA 4WFEE 2VZTA 4U7MA 3GIZH 2Z8WC 1LEGA 2A4ZA 3L4ZA 3LKSA 2DI9A 2AJ3A 4KKAD 4J3OC 1AO7B 4OCRH 1SMOA 2IAMA 4I0PD 3HPJB 1AFVH 5FO8B 1A1OB 3FO2A 5DQJB 3HS0C 3KS0J 4J3XA 4ZPVA 4CN4A 1CGWA 4JM2F 3T4AA 3CVDA 2WLKA 3IDMB 4N6RB 5TGBB 1INEH 2C8NA 2R4RH 4XX1G 1G9NL 1MH5B 4FXGB 4LLAA 1K6QL 3AQYA 5EPMA 4Z7QB 3RQ3A 4PJEA 4PIBA 3RVVD 4BFJA 1OSZA 4P2OA 4WFFE 4AYDC 3O2WL 4OGQC 1JZ5A 3ARRA 1Z3GH 4DKDC 1E5UI 3B6SB 4X6CA 3MMEA 3KPSA 2P80A 5HYQA 1CMOA 1WFJA 4JFOB 1HHGB 2FBJL 4P46D 3HC3L 2IPKA 2J21A 4JDVA 2ID5A 2YC1B 2IWGA 4JFDE 2JLLA 4BWWA 4I3SL 3QWRD 3TIDA 1A8JH 4DZBA 2A73A 3MA9L 4Z3GA 1LO2H 4JFFB 1WFNA 4UAOB 1QFUL 4HD5A 1MNNA 2J5LB 3CZFB 3GJEB 4FYTA 1IGCL 4W9EC 5HDQH 3IEAA 5FYLL 3ARED 4QGYA 4Z7VF 4IS6A 2J8UB 4BFRA 3QRGL 5KG9A 1IAMA 1IKOP 5ECJE 2YHGA 1AHWC 1I3RA 4PJHA 1I7ZB 2GTZA 3RZCD 5J57B 5LBSL 5DFVC 2A2QT 3PJSA 4LPYA 4JFPA 4OGZA 3CZGA 4HSQA 3KPRD 2MOGA 2V5SA 3FT1A 3SE4A 5D5MA 2GUOA 1AD0A 4WJG3 4ZDHA 5T3ZL 1E9QA 1MN4A 2CGRH 2ICWJ 2OSYA 4PJ7B 4OLXL 4UZGA 1KJVA 4QOKB 2XXFA 3DJ9A 4XMPL 5FFLA 4J3WA 1JZJA 3SKMB 3L95B 2JQAA 2DJSA 3PL6A 1DQKA 4M93B 5KN5B 1G6RA 3KDPB 3MXVL 3KHOA 4GXVH 4N4YB 5ESAB 4AM0A 4MD5A 5HYSG 1M9WA 4NCDA 3VCLB 4NNPL 4MCYB 3ULUF 3ASWA 5HD8D 4PYHA 3WCYA 2SEBA 2GK0B 2YAQA 3SPJA 1L3WA 1U30A 3D50A 4GJTB 3AG4B 3LNIA 2EIBA 5ENWB 4KRPD 3NQKA 5HGDA 5B39G 2D0HA 3BEWA 1KWKA 4K3JH 2WN3A 2X2JA 3CPUA 4KAQH 1VEMA 1RMFH 1U6AL 3MLXL 1IC1A 3QUZB 5F89A 3UAJC 2WBJB 1I75A 4J8RB 1VJSA 1W6LA 5DJDA 2UX7A 3RHWF 3CU1A 3DXAA 3FUFA 3WL9B 4EI5B 5TPWH 3DIVA 3QDHA 4MBRA 2QSVA 3ULSA 4K9EL 4U33A 1MPAH 3ZYIA 5IM7A 4MDIA 1CK0L 3TWCL 1I8LC 4FQ2L 5DEGA 5F0MB 1TQTA 4PJ8B 3V4VH 4HUWA 1WFTA 1JV2B 2HLAA 1VKXA 4U3XA 2WVUA 1VENA 3I9PA 4QTIH 4IRJB 2VJXA 1FNEB 4KKNA 5G5DA 1XL4A 4PWHA 2WZAA 3FU7B 1XF2A 3PABA 4JY6B 4NO0B 4YDMA 4DNLA 2ED6A 3TBYB 1E4KA 5T3XH 1NCAL 1CE6B 5JO5B 5B1AB 1X9LA 4MMYA 5I1HH 1RVFH 3F58L 2UY7B 3GSQA 4AQ1C 3WY4A 2BCMA 2JQMA 4PBWD 5DS2A 3V6FA 2J8UF 1E4JA 2A6KA 2Y7QA 4J1UA 1KXTB 3BWSA 3HMWH 4KRNA 1VGKB 1XR9B 4FTDA 4KMTH 4XCCL 3QORC 1GS6X 5BV7L 5LQBH 2X6VA 1HKLL 4BRJA 5SWQB 4AOFA 3SGEH 4HKZB 3DI3B 3L3OC 2R23A 4YFEA 3MCKA 4LVEA 4WI3A 4YSAA 3L2MA 4F7EA 4C47A 2ZXBA 1G6VK 1RLWA 1EO8H 4TTDD 1PF3A 1MRFL 1WO2A 2O6CA 5C0RH 3EFFB 3DURA 5F9DC 3GRWH 1QPXA 1CVRA 1P9MA 3SOBL 3HBQA 3L4TA 4OB5L 4YX2H 1FBIL 4XBEL 1A3LL 2E9WA 4IGBC 1GPOL 4G8EA 5FW8A 1LNUB 2D8KA 3TVMB 2B2XL 1JRHI 5CD5C 5KAQF 4NQVA 2D2OA 1L0QA 1W72A 4DKAA 4K7PL 1MAJA 2X53A 1ID2A 2ARJQ 4KFZC 5ICZA 3J27A 4JFTA 4RGNB 5KANG 1JGIA 3BH8A 2J6EH 4YHNA 5CZVL 1U8QA 4PJGA 3WJJA 3ZE0E 3BGMB 3L6FA 4YHOL 3I2CH 1GAFL 1ZLVK 1KBBA 5TH2B 2CK0H 3C6LB 3DJTA 3SGJC 3I75B 4K5LA 4EN2A 5FO7A 3P4MA 2L7JA 1ZEAL 4OZFG 4QXUL 4UTAA 2ZXGA 1KGYE 1NGZB 2RA1A 1YLBB 2B16A 3BVTA 3MLTA 4YDVB 1NBVH 4XC3H 3HR5A 5IG7B 1FE8H 2YPKA 5DUBB 4S10A 4AT6B 4PV9B 1OY3B 5EZLB 2V8MA 4QWWC 2HLFD 1K8IB 3AZUA 1A9BA 1BQRA 3MRJB 1F8TH 2H0EA 2W0KA 4MNGA 5J5EA 5T5NG 3GXPA 1MCJA 3BVXA 1J9CT 2ZWZA 3CFJB 3L3DB 4XPBL 3K80A 1XF1A 4MX7A 2VXQH 4R84A 4UDUB 1XX9C 4EXKA 2VE6A 3U30C 4OD2B 2TSBA 4QOKE 3VSQA 3SD5A 2YD7A 5F6IC 5IVXF 2IFGA 4XGZB 1QW9A 2I69A 2NY7H 2AF2A 2P5EB 2VNCA 4GRWB 1DLHB 2ESVD 4GP5B 4N2HA 1U3HC 4PWFA 5IBTH 3BPCA 3NVQA 3FZUD 2JKWA 3F6LA 3OZKA 4PAZA 5T1LA 2IQ9H 5HHQA 3BAJA 1IARB 2NLJB 1HOEA 1FQ9C 2XWXA 1GCYA 5TE7L 4RRPG 3BP4A 4I18C 5E00A 1N3NA 3SPCA 1QSEE 5AD0B 4M03A 1MFBH 3ARPA 3K0WA 3UGEA 5MEQA 3L7EB 3OZLA 2ZSVB 4JO2L 3MREA 4TUUA 5DI8A 2D03L 2XZCH 1T83C 4KUZH 1IGIH 4JM4L 4KZCA 4NQED 4WV1B 5ACMA 5TE4H 1D5MA 3MJ8A 5C0BA 1G0XA 4NXSA 2VXUH 4HGWA 5DUPL 3FULA 2ZYHA 3KWWA 4AY0A 3P4LA 5LG6A 4FYQA 3OQRA 4XNYL 2WXJA 2R1WB 3VRJA 2JKNA 3LS4L 1YJDL 5EO1A 3VD9A 5B39B 1SHSA 4QRPE 1T5XA 3GMPB 4EQ3A 2JXMA 1ILSA 3HHSA 4Z0BL 5EU4B 3T1WA 4L8SB 1J8KA 3EKCA 3S3BB 5J1TC 2VDOL 2O5NA 4B9IA 1BQKA 2DIBA 2LOEA 1O7SA 4L3CA 3GMNA 1KENH 4JQVA 1CLYL 1K8DB 4LOUD 3PP4L 3TWYA 4XC1L 1BG1A 4A68A 4QRBA 2ALWA 1RCYA 2N3JA 2R2BB 3FOMB 5DRNA 4PJ6A 5D6CA 4RSYA 1CI3M 2IV9A 4YDIL 4F2MA 5IEHA 4ZW6A 4K0OA 2CZNA 4RMVA 4MXWL 4DCQA 2Y07L 2Z35A 3NZ8B 2BJML 4LVHB 4F9LC 4KDVA 5I71B 1HCZA 2W91A 1F18A 2A9NL 4JVUA 5DEJA 3UXFA 1H3XA 5IMOA 4HJTA 1FFNB 2XT1B 3F3HA 1E40A 1AR1B 1KG0A 1W8EA 1XBRA 1KIRA 2H3KA 5E56A 1VFUA 3ZZ1A 1KCLA 3LNDA 1J18A 2ZYSA 4HCRL 4MGXA 1U42A 3AS1A 4I9WD 3CXHK 3PNRB 2VXTL 5EG6C 2VXSH 4YIQA 1RJLB 5ID0A 4I5BB 3HE7B 3MRKA 4X80L 3NEXA 1UA6L 4A7QA 1NC4B 5EFIB 1RZJC 5FA3B 4DN4L 2BSBA 2OTWB 1RLBA 2YOCA 3D3VD 4WUUB 3RURA 1E2WA 4C83B 1GCFA 4JKWA 4BSVA 4X98A 3BFOA 3UFIA 4BFEA 5DEZA 4GRWF 3ZIMA 1IAIL 3BRDA 1YPZB 2JJUA 1GS7A 3ARBA 5E4OA 2HKFL 1ACCA 3RVWC 3V4LA 3VFNB 4WDIA 4PJAB 4ELMB 2BOCB 2DYRB 2IGFL 3A5VA 2G60L 3Q6FB 2G5UA 3QE5A 3QQNA 4LKXA 4J3BA 1UFGA 3SGKC 3ZE2F 4ONGL 4KKBD 3RLSA 2AEOA 5CKGA 2Z7ZA 2BFGA 3F6JA 2WJ7A 1FH5L 4L29A 4H7VA 3MOBH 2K6WA 2L7UA 3FFDA 4KVCL 2FT7A 4Q6IA 5JOEA 4R90H 3QZMA 4KHXL 3GLAA 5LN4A 1QBLL 1S7WB 2V37A 2FH8A 1FAKT 2IC2A 4ZUTB 3UJTL 3ZDYB 2ESVE 3FQXB 4DKFH 4PI0A 1JWMB 4BQBA 1F86A 3RVUC 1QTPA 3H3PL 2IQAA 5D1QB 3FO0L 2Q76B 4PP1C 1A4CA 2CKBB 3IJ9A 4Q52A 5HVHC 3MGTA 3V55A 3JWNE 4IK6A 4M1CC 1TOXA 1WCBA 4LPCA 4CMMB 2AGJH 1RJZB 4U4BA 2IPTL 1FZKA 3V52H 2YBRA 2GJRA 4LF3A 4KJQD 5I0DA 3MLVH 1YO4A 3REVB 3TBCA 4WU7B 3IDYB 1WAAF 3EYUH 4XN8A 2AP2A 4NHUA 4Y7MA 3GMOB 4I4WA 4P4KC 5IUCA 3S8GB 2Q8AL 3UYOD 4WW2A 2XZAH 3PQYD 5FHAL 5FF6B 2P8LA 1TR7A 4Y2DC 1MCFA 1UWXH 2ZTBA 4JG1L 5H94A 1DL7L 3B9VA 3BMVA 4GUOA 5F7MC 4MMZA 3WY3A 4KNUA 3MRNB 1F1DA 2C9PA 1EUTA 1L9RA 2NNAB 3U0WL 1INDL 1M7UA 3SBWA 3MUZ1 1O6VA 1QZNA 5DR5L 3UMNA 4A7GF 1HXKA 3MRLA 3BIKA 4XOEA 2EIMB 5FGSA 3A6CL 4P3CL 4BZYA 1BX2B 3KW8A 4JQIA 3MV8D 3ZIYA 2OJEA 1F4WH 3HJEA 2XN1A 1XBDA 4C56A 4FP8H 4NKOB 1PZSA 2CDGB 3C08L 1NMCB 3ILQD 2XTSA 5CMAB 2YD0A 3WXWH 1SN2A 1HINL 1COBA 1G9NC 3QXUA 4PJAF 5LGHH 4ELMF 5C2UB 5IHZA 1MFAH 1KCSL 3QIBB 2HVKB 3O6ML 1EEYA 4NEHB 3U2JA 3OKDA 1MHEA 2DLTA 4A38A 2ZUSA 1LO4H 3L3GB 4OJFL 3QFJD 1RZIA 4AYBA 1R3KB 1CDCA 3EDFA 1M3IA 2Y5TB 4XXDA 3ASOB 3WKPA 4AQZA 1NZRA 1S6NA 3HAEB 5GISL 5GRJH 3TYGL 5E8NB 4GINA 3V0DA 3BT2L 4Y2OA 4OIIL 5IMLA 4HGKC 2C3WA 2W0LA 3PS6A 1QNIA 2CK2A 2YZ8A 4HH9A 2XNAB 3TN0D 3GXTA 2BIQA 3G7TA 4DERA 4LLDA 3F85A 4B9PA 1A3RH 1JZIA 3AS3A 2C9AA 2Y1AA 1E9OA 4L8DA 3DX7B 1F4YH 1OOWA 3TTYA 4L2LA 3VXOB 4RETB 4Y4KC 3BH9A 2ED7A 1WT5A 5MI0C 5AL0A 3QQ9C 3OF6A 1E28A 1B0GB 1A21A 2XN9A 3CLWA 3GHPA 4UM9D 3BGAA 3POCA 4A7TA 5EUOA 4XPTH 4APXA 4FHKA 4E5XB 5K9OB 3VE0B 3T0DA 1H5BB 4NCC2 2VKWA 1KIQB 3ZYJA 2D7TH 2DICA 1TVHB 4OI7A 3B4NA 4ZFOL 3FQ2A 1EJFA 4FFZA 4L1DA 1U8OB 4WI6A 4HJUA 2XN2A 3MX0A 4I88A 1YPZE 5DVOA 4KZDL 2VC2B 3DSNA 2B0SL 2Z1PA 3VFWA 1NLBH 1UXWB 3WNPA 4AGLA 4UINH 1Q38A 3T0XA 1JAEA 1QSZA 2FHCA 2UXVA 3B37A 2FB4H 1RHFA 5F7EL 2JJTA 3AT0A 1KN4H 4F33B 1W2KT 3FH8A 5DD1H 2BNQE 5FO2A 1YEEL 3KW7A 1AGEB 3HZ3A 3M6DA 5D1ZA 4KKAC 3B2DC 4I0PC 2WVSA 1XH3B 1NCBH 4HAGA 5D9SB 1S7SA 2WVVB 3BP6B 2HFTA 3BZ4B 3ETSA 3QT2A 4Q4EA 3O3AB 1TJIH 4MYPA 3B5GA 4U05A 2Z7WA 3BZ5A 1KB3A 1NFIA 1T0OA 3ES6B 3Q8EA 4NPKA 1TDQA 3MXWL 3PQYE 2YPVL 3IF1A 3IU4L 1GGCH 4F58L 1ZWIB 3QZWA 2VDKB 4NZFA 4OVUA 4OZHE 2WLMA 3QEGL 4K9EC 1G1OA 2YD9A 4OM1H 4FFYL 1F11A 4P46C 2HKHL 4YFDB 5A7EA 4GSDH 1MJUL 4URKA 3FDWA 1DVZA 1PQZB 2HVJB 3MNZB 2PUQT 4JHWL 3MV8E 2W88A 1HNGA 3QO1A 1U92A 4OKVB 5FA4A 2BP8A 1YHPA 3P1VA 1CLOH 3PXJA 1TYJA 1X5FA 1S78D 5B3SB 3LEYL 5CFHA 5I1CH 2VIRB 2XPZA 4Q2ZB 1XFPA 1JCKA 1BQUA 3DROA 4ODTL 3AREC 2EXWD 1KYDA 1SYSA 4G6FB 4H25A 4LCIH 5JPNC 3IMSA 4IOIB 4Z3HA 3CDZA 3SYOA 1S3KL 1HQ4A 3QWOA 5FKPB 1FA4A 1P5UC 3O6LH 2R0WL 3TO4A 4ODHL 2K7QA 2VW4A 4ZMLA 4D8PA 1OAZH 3A3YB 3D06A 2XWJB 1F3JB 3GNMH 5BV7C 1QNZH 1MFDL 3O9WA 4N20A 4Z7UE 2DLGA 2NY3B 3W9DB 1IAOA 2Q8BL 4G6JH 3D69A 4GRMB 2EEDA 2VUYA 1S8DA 4ILDA 4NT6A 4XVUD 4AT6A 5DD5H 1CTOA 3SKOB 2G0LA 2CJ3A 2I9LB 4ZUSB 4KQ4L 3I74A 4NN7B 3QDMD 6FABH 3MBEA 2YBGA 2H47C 3EGDB 4RWYL 1R5WA 3X2QB 2JB6A 2AQSA 2XQYG 4P5TC 4R96B 4WFHD 1YYCA 2F9BT 3QUYC 5B21A 1HEZA 3I9GL 3RKDC 1TJXA 1BM7A 1GKOA 4DK6A 5HD8C 5HHVL 4HZ1A 1J9RA 3G5ZA 3RGVA 3VGHA 4KY2A 4MAYB 1T6BX 4ZUWB 5I74C 4I87A 5D4HA 3GMLA 3CBKB 5KBDA 1A6VH 2ZSWB 3QUML 4GW5B 3IDJA 2JKIS 2XA8L 2BOBA 5C0CA 4JRXA 2DRUA 4NZUH 5AOMA 3P0YL 2BSDA 4KOCA 5EEVA 5KYUB 1KFGA 2E9BA 1OPGL 2WWMD 1T1WB 4FS0A 4WU5A 2KKQA 3A4EA 4PN6A 2O6PA 3RWCA 3LDBC 3MCLH 3WKYA 3T6XA 5HTSA 1A7PH 3VMNA 4BFIA 1P69B 8PAZA 4AE1A 5GRWA 1OCOB 1ETA1 4DK3A 4Q6YA 3UTSB 3MNVB 4ZXBD 1FFQA 1C5BH 1ET8A 3QYMA 3FB7A 4AYSA 2EH7L 1MI5D 1VA9A 2FK9A 4XPAL 2YQGA 2VZSA 5CIPA 4A2GA 4EIBA 4NC1E 1BBJB 4JDEA 3RFZA 1MEXH 2MNWA 4LHUB 1MFEL 2GSGA 5CF3A 4I77H 1UH3A 3NGBB 4S2SA 1AANA 1NIAA 43CAA 4OM0H 3MACH 1RZPA 3WNIA 2O5ZH 2COVD 3WS6A 2Y0SA 2F53A 2VLLB 3GSVB 3FU5A 3QNXA 4Z78A 3K72A 1J1OH 3RWEB 3M86A 1SGKA 1DBML 3D25B 2B5IC 5H37H 2RBLA 4Y4HA 1VHPA 1BAGA 4C4KO 4K71C 3QI9B 1LWRA 5DZ9A 2VT0A 3S3JA 3QUGA 3FYEB 3PWPA 1HJCA 1DJHA 1AHMA 2YGQA 1Z3RA 4NM4L 1S7VB 1PG7H 1AE6L 1R19A 3KPMA 4TTDC 5JLZA 4G1EA 4N1HB 3B5HA 4MCMA 3W0WA 1A4JA 5A16B 2NUTB 4KOBA 5DZLA 5KW9H 2CLRA 1O5DT 1BWWA 2CHXA 2X6AA 5D7LA 3VFGH 2H32B 2X9XA 3GMRA 3S37H 1I8KA 4YQXH 2DWXA 5FX3A 3DMMD 3K6DA 2C9SA 1KGCD 5F97E 3LKNB 3DPBA 5IJCC 1YJDC 2PO6D 3VQMA 3CIQA 3D12B 3FHAA 4JGMA 4AGMA 5I0VA 2YGOA 5FOJA 1L0PA 4RAVA 1WIOA 2E46A 3MJ6A 3O3EB 2BRRL 4N0FB 5CGYD 1C5DA 3SE9H 5MP6H 4KKZA 2HFFA 5IV2A 1B0RA 2VR7A 4GRLD 4OLZL 4ZNCD 1CXLA 2Y3NA 5GS2H 2ITDB 4IBTA 1ZVSB 1G5AA 3I9IA 5DWPA 1WUZA 1ZS2A 4WSJA 3JVGA 1FP5A 5I16B 2KZWA 4ADJA 1CYWA 1URIA 4JDTH 1E5CA 3CBJB 1JFQL 2GB2A 3QDME 4DP1X 2DQCH 4CU6A 4W93A 3SGDH 3ZPDA 1FN4B 2WNKA 3L4VA 5EOTA 4WFHE 3WO3B 1RUKH 2IVFC 2P42B 1J88A 4H4NA 4XWOD 4MJIE 4QXVA 2FSEA 1XIWC 5C0EB 1NPJA 4UYPA 1KJ2B 4CVZB 4U3HA 5CR1A 3GSXB 4YZFE 2HLFC 3VXMD 1BJMA 2JF1A 3MOAH 3N1PC 3ZL1A 4BK8A 1MXGA 4QHMA 2RMNA 3MAWA 1B2WL 2DIEA 4FLHA 4MD0A 4RZKA 5H35A 4XBGA 3U79A 3QA3A 3CHPA 1CL7H 1GYCA 3CXHJ 4FXKA 2R1YB 4U1SB 3FN3A 4WTZG 2VDPB 1EAJA 2WTOA 1DQDL 1UH4A 3GI8H 2UXGA 3T0BA 4EPSA 1ZRUA 4XNQA 1AS8A 3CIAA 3RWHA 4PRIA 2BVPB 1BGXL 4PV8A 4C4BA 3EAKA 1QQDA 2G75A 2PPAA 3N06B 4QHLA 3AFLA 5JQIB 1UJTA 4LU5H 5C6TH 4YHYC 1AG0A 3FZUC 3T2OA 2E27L 1EEZB 3GXNA 2OQJB 1ZTXH 2R0LH 1OVZA 2VDRL 4Q7DA 5ALBH 5IQ7H 1OHZA 3IKCA 3MRFB 1BD2A 5CBEB 1EJ6A 1FSKC 3HHMA 2DLFL 3M88A 4XH2B 4YE4H 4YVNA 1KNOA 3NOIA 1EHKB 3BN3B 1IC7L 3NSYA 2Y22A 3IGAB 3IRCA 2X4NB 2GHZA 1MJ8H 5B22A 4OF6A 3HS8A 3MRDB 3NK3A 5TK2A 5E9DB 1KLGA 4ZFZA 1B9ZA 2XWRA 3HG1A 3ZOAA 1LE5B 5AUMA 3EJJX 3RIFK 4JBSA 3VQ2C 5HSFA 3LZRA 5HPMB 4JLRB 4KZEL 4W9IC 3F84A 4O2EB 5J9PB 1UYWL 1FZJA 2IALA 3X3GL 2WZ6A 5F9OL 2RGSA 2K6YA 3C60B 2B59B 1EXUA 3BQUB 4U1JA 5AW1B 3HG2A 5TDNB 4PWIA 1B4LA 4P2RE 1K5NB 1ZIBA 2QMJA 5GJTL 3V8OA 2GAZA 3AXLA 3SKUD 5TTRA 2AABL 4WSGA 4LIQL 2I24N 4X8GA 3IN0A 3ETTA 2D7OA 3EYOB 1MCWW 1N26A 2GQHA 4LCVA 5C0IB 3T0ED 1D9KA 1DSYA 1FJ1A 2J88H 2PYEB 5AW8B 3TBBA 5IK3B 5D8JL 2Q20A 3BP7A 3DO4A 1F02I 1M6OA 1ZT1A 2C3VA 4X5LA 2RQ8A 2WP3O 5HDOA 4KJYB 3D0VB 4JPVH 1T0NB 5DJ0B 4KTEL 2GJZB 4PTTB 5LWYL 5M94B 4C58B 3MUGA 2PCFB 5EA0H 2NY6B 2VRQA 3V0FA 1YNTA 3HUJA 1AQHA 4E9LA 4MLIA 1YNLL 2QPDB 3D34A 2EIZA 5HI3C 1SYVB 1T4KB 1RZJH 3GXIA 2QVIA 2V6HA 3INUH 4YXKH 2BX5A 2X3AA 1UM5H 4GBXD 3QCTH 2YZ1A 3VGFA 1D2OA 3UCRA 1JG9A 4K07A 4Z7QF 6CGTA 2BLFA 3LEVL 5FYKU 3WIHH 1F3DJ 1N8ZB 3ULVF 3Q05A 1SJMA 5IB3B 3AY4C 3UJJL 3EJZD 4MNHA 3OGCA 4O02A 2DQFA 3ARFD 1B90A 5I17B 1XGTB 1SJVA 5IOKA 1C08B 2QQNL 1MNUH 1QSVA 1AGFB 3VFOB 3MCYA 1ZPUA 2BXYA 3NN8A 4PJXB 4FI7A 3FU9A 4JB9H 4YXHL 3QJUB 1CN4A 4KKBC 3RPIA 3VXME 4YC2B 4EVNB 3DHMA 3QS2A 4Y5VB 3LNFA 2K70A 3N44B 4XP1L 4LSTH 4YBLB 1KWGA 4MJ6B 4UILH 4U31A 1AIFB 3TFBA 3PGDB 3U25A 1E8ZA 1L9NA 3B9DA 2PW1B 2IXQA 5ACZB 3C12A 3C2AH 2IGLA 1JF1A 4KUCF 1BOGA 3GBML 1E6OL 1YECL 4L9DA 1J05B 4LEXL 1J1XL 2P8PB 3QNYA 1RD6A 3MGOB 4ZK8A 1DVFD 2XRAH 3LRGA 3BH4A 1YN7A 5FYJH 5CKAA 2W5PA 3OHXC 4FQXD 2BVOA 5FAAA 4A6YB 2EIEA 1WFOA 5ID1A 3HW7A 3MZTA 5F7NC 1JDDA 4XPHL 3PPSA 1QI3A 3RNKA 5FECA 3UPCA 1BYOA 4M1GL 1CE1L 4NNYA 3T0WA 5GGSA 5J12B 5I6XC 5D2LE 3MLSH 4Z77B 2ETWA 4PUBH 1G1YA 2EDDA 3OKKB 2G5RA 5C08B 1XF5A 3FUNA 1ZANL 1JHKL 1OM9A 2QZQA 1T7VA 4KJQC 2CR6A 1C5CH 1ETZB 4E41D 3TZVD 1Q9OB 4IKNA 4P9HL 3TT3L 4B3EA 5K9KB 5JHAA 1P7HL 3KPQB 3D0LB 2Y1VA 4JKNA 3M46A 4KXBA 5EZJA 4BXSV 2VDLB 2CIKB 5EIIA 1CGXA 1YC8A 1QEWB 2EICA 4ODUB 4LRIC 4NERA 3FB5A 4PJ5B 5FGCB 5LGJB 1O6TA 2EDOA 4ABVA 3BUDA 1M2VA 4Y9EA 5F7UA 3HZVA 1FVEB 3IDIB 4MMXC 4Y9FA 3V4VA 3VUAA 4P59L 4OF5A 1JGVL 4QHPA 1RIVL 3TV3L 2BY0A 1BHGA 1KELH 1CB4A 2FJFB 1DQML 1RJYA 1HJBC 3L4WA 3O81A 3KLLA 4M3HA 1OCRB 4F27A 1EVUA 3O8XB 4XCYA 4J39A 3OQ3B 5KJ4A 3BAKA 2X1PA 1DUYB 1JHTB 1RXLA 3ILQC 4MCZB 1IM3D 4MDRA 4NN6B 3T0EE 2OZ4L 5AAWA 4E68A 3QPKA 5DDHB 2ZNWA 5E9DE 2CGZA 1UD6A 4OU3A 3GS0A 1G9NH 1K6QH 3MLZH 3MRIB 1WWWX 3CZEA 2IFFL 3STBA 3O2WH 3P69A 1LEGB 1PD6A 3ARZA 5E8EA 3LKSB 3I6GA 2AJ3B 3N44F 4C57C 1FGNL 2IAMB 1IQWH 4FF9A 5DXWA 1J0ZA 5C0AD 2B39A 3FO2B 3WAJA 3NIGE 4ZPVB 4APQA 3T4AB 2VTFA 5E70A 4LEEA 5IOPA 3IJHA 3KPPA 3CFKA 4JGUA 2YA1A 4PJEB 3MA9H 1OSZB 1OT2A 4P2OB 3TYFB 1QFUH 4RGMB 4AEEA 1I1YA 3TN0C 1R47A 4KO9A 5F7BA 1UT2A 2RCSL 1BECA 1IGCH 3MMEB 3KPSB 1FC2D 1BFSA 3OB0H 1PSKL 1NGPL 4TNGA 5FYLH 4AYGA 5HYQB 1MREL 4XT1C 5IT2H 3P02A 1DN0A 2J1ZA 4A63A 2IPKB 1IQDA 4JDVB 4LLYA 3QRGH 5DTFA 1HHJA 3TIDB 5E24E 4RMBA 4MB4A 4GYBA 1NUGA 4DZBB 4PG2C 2A73B 4YPJA 3D9AH 2H1LM 4N2IA 1I1RA 3ARXA 5LBSH 1IJNA 1AIZA 2ZD0A 4YHIA 5FFOA 2J6EA 2YAPA 3U0TB 3Q7JA 2A6DA 2F18A 2RALA 2AJYH 3AM8C 2DQIH 4HW6A 3HG5A 4IS6B 5HJ3A 4FMKA 5T3ZH 4OLXH 4PJCA 4XMPH 2NTFA 4GAYA 5DJCB 5KG9B 2X89A 1ORQA 1I3RB 4PJHB 2GTZB 3FKUS 4YSDA 5F7LB 2NNRA 4ZOBA 1SY6A 1FNLA 4H20L 5ICUA 3PJSB 3VXTA 4JFPB 3RHWK 5CEZD 2XOTA 1KYOK 5TF1L 1L9MA 5D5MB 2GUOB 1AD0B 2X41A 4LT7A 1TQVA 4ZDHB 1U93A 1E9QB 2OJZH 1BFTA 4NC1C 1KJVB 1UEYA 3CLFL 1OTSD 1XMWA 3AG2B 1KB5A 3S4SG 1U6AH 3ME0B 3PL6B 4DKEL 2DPKA 2VXQA 3KVDD 3MLXH 1G6RB 3MV7D 4AM0B 1A6ZA 2DYPD 4MD5B 5EC2A 2ERJC 3DOSA 3RIAF 1B88A 1QPPA 3QEHA 4GQ9L 2SEBB 2GG1A 4AUJA 3B7SA 3NYKA 1HESA 4J4PA 2Z3FA 4K9EH 5HGDB 2AEIT 3BEWB 4X6DE 1CK0H 5GJSL 3TWCH 5BUGA 3Q1SL 1CDBA 3DHUA 3TEUA 4IBSA 4NO5A 4CU8A 4ONHA 5F89B 3VQLA 2BP0B 1I9RL 1U33A 4HC1L 4JM2D 5DJDB 1Y1DA 1WH0A 1O7DE 3DXAB 4PJEF 3ARDD 2AQNA 1S78C 4PH8A 1NCAH 1QW8A 1KPRA 5IM7B 4FNPA 4MDIB 3F58H 4X6CF 2EXWC 2AJVL 5DEGB 1FZMB 2B77A 2WLZA 3BESR 1XDTT 2HLAB 1VKXB 3N50A 1QLEB 3C6SA 4KTGA 3ZTDC 2IWKA 1XTLA 2KERA 4J3OG 4HIXL 2LVCA 4P3DA 5G5DB 4KGJA 1XF2B 3OL2A 4DP0X 3PABB 2YR3A 1E5BA 2EE6A 5BV7H 4ABWA 3LRSA 1HKLH 1FVDA 2E9JA 2WXKA 4FOMA 4LHJB 2QR0A 1JPSL 3FO1A 3CSTA 3BJLA 3SD2A 5SWZA 4N6QA 5EORL 3FQUA 1SJHA 4B9CA 3V6FB 4XVUC 4IIQC 1FI8C 3ABMB 2A6KB 3ZT5A 2Y7QB 4J1UB 1XSOA 5KSVA 1GZHC 3PV7A 2J6WA 4JX0A 5L6YH 1HDMA 1A22B 2HG5A 3I6KA 3O4OC 5IFJA 2YO3A 3SPHA 1I8UA 3SOBH 4G3YH 5CEZL 2C4XA 4GFXA 4OB5H 2R23B 2ZF8A 3MCKB 1FBIH 2JJSC 4XBEH 3D09A 4FNRA 5D5MF 4F7EB 1A3LH 3H7BA 4Y16D 3GBLA 2C9VA 4K7PH 1IBYA 4LLWA 3DURB 3TCXA 1JNHA 1YSOA 5CZVH 1DCLA 2EDTA 3X1NA 3F7LA 4RX4A 1F13A 2WWMC 4YHOH 4ZPTA 5KS9A 4YEFA 1FUNA 1QFWM 1ZEAH 1ZS8A 2BZ7A 4G8EB 2D9CA 1IVLA 1FIGL 2VQUA 4OIAA 4QXUH 2ZKXA 3Q5TA 3ULUD 2BSEA 1W72B 4Y19E 1XVSA 2YLHA 4ZXBC 5CFAA 5ICZB 1J8HA 5B1CA 5CEZE 2QV4A 1AO7D 1X5JA 3BH8B 3BIBX 4YHNB 1U8QB 5EZPA 3L6FB 3RBSA 1NIDA 1NDGB 3LVTA 2A4CA 4CN1A 5FO7B 3KWTA 4PRNA 4NBYB 3ZJAA 4Y1AA 4ANUA 1KCRH 3A6OA 4JO3H 3GJFH 4YDJB 3SBRA 4XPBH 5DHVA 3VXUA 1AAJA 3T8XA 4RMQA 5GRYA 3MLTB 5J7CC 5JXAL 1TMCB 2QGCA 1TVBA 5EH1A 3HR5B 4D0CA 3FXIC 2IOOA 3A4AA 2VISB 3WFZA 3NTCH 3F62A 2IWFA 2C1PA 5FM5M 3CFBA 3HBGA 3Q3GA 1A9BB 3GRBA 2VR6A 4MNGB 2Z31A 5LKNA 4YAQA 3PF2A 1V27A 4TLKA 4RWHA 4MX7B 3VXSE 3VD4A 2GJPA 3WENA 1ADQA 2VE6B 2CUMA 3NJVA 4UV7L 2WOBA 5TE7H 1P4IL 3FMGL 4G8IA 5L7XL 4XCFL 3G5VB 1F4HA 4LP5A 4JO2H 1ZPLA 2C3HA 4ZSOE 4OCXH 2D03H 4XMZA 4OJCA 1HE8A 5KVFL 3OAUL 4JM4H 1LO5A 2FR4A 3BPCB 3T09A 2FJGA 1TQCB 2FIKA 2WBKA 5CO1A 5DUPH 1NCNA 5T1LB 3SYPA 3KLQA 4DQOL 5HHQB 4NZ8A 2PO6C 2SODB 4MHHG 1YJDH 1D7FA 1ZT4A 3D48R 4X6EA 5E00B 1BXVA 1N3NB 4PYGA 2Q7AA 2YXWA 2AK4E 4Z0BH 3VXNA 5CGYC 2VDOH 3MREB 1H6EA 4GRLC 3AMLA 5DI8B 2VDQB 3HN5A 3MYJA 4TNWF 1CLYH 3PP4H 4PSPA 2VN5A 3VMOA 1D5MB 2PLTA 4XC1H 4B7IA 3MJ8B 4BWTA 5C0BB 1EDQA 1G0DA 2H0FA 4HGWB 4R4NC 3RAJH 1HCVA 3KWWB 3QK0A 3VWKD 2E9GA 4YDIH 5E1QA 4JFHD 4MA1B 3ULUL 4MXWH 1UM6L 4WK0B 2EDMA 5GGTA 2Y07H 5EO1B 2BJMH 3WFEL 3ORJA 1LP9A 3X17A 4ZMPA 1QR1B 1T5XB 2JXMB 2A9NH 3HHSB 1I31A 5KVFE 5I1IL 3PFUA 4YSEA 3LXBA 3D7PA 4L3CB 4NZDA 3R1GH 4XWOC 4JR9L 1Y07A 4MZ2A 3OKEA 1WISA 4LOEA 3QISA 4PJGF 1F5WA 1TKWA 3QXAA 3ZKND 4ALAL 1B3IA 5I1GL 3PWNA 4QLWA 2YUWA 3QUZD 1P5VA 4HCRH 5DRNB 4GMSL 5D6CB 4F2MB 1QRNA 3CG8A 3SDCC 5I75B 4DCQB 4GKLA 2Z35B 4L4TA 2DQEL 1RURL 1T2XA 3NAAL 4NFCA 3UEQA 4EI5D 5C1MB 4X80H 3LRLA 1UA6H 4HWBL 5IMOB 2LHAA 3JUYA 4M56A 3N9GL 4DN4H 3O4LD 1KG0B 2X10A 1KIRB 3IDXL 4N2AA 3NRFA 4PJ8D 3EGXB 3EZ8A 1QD0A 3Q9PA 2D3JA 3SDXA 4GB9A 4DP7X 5I8CA 2FDBP 4IRJD 1E4HA 3LZQA 4A7UA 4PHXA 2PCXA 1IAIH 3BUBA 4WAFA 2VMJA 3DETD 4YIQB 4NO0D 5ID0B 3KYNA 3MRKB 4NKMB 5CJXA 3AB0B 4A2MA 2JKRM 2IGFH 1KTBA 4G2AA 2J3SA 3SDAA 3AT8A 1NMBL 4H8WH 5D7IA 1A2YB 1IE4A 2QADB 2WXNA 4PG9A 3RA7L 4RFNB 4BSVB 4C55A 1PLGL 3FQRA 2Z8VC 1FH5H 1P84K 4XHJD 4HJGA 3QEQE 3ARBB 1CU4H 5I6NA 2O6EA 2OYLA 2UZYA 3JTSA 4KVCH 4WDIB 3WHE0 2QSCH 3ROLA 1C12A 4LKXB 4KHXH 3OZ9L 1QBLH 4ODWA 3WNMA 1BZ9A 1NAML 3UJTH 2PWDA 1UG9A 4LDCA 1KT2A 4PGCA 5IJKC 2FEJA 5DJXA 1JZDC 1FG9C 1PKQE 2EYSA 2IADA 4L29B 4PFEA 4MQTB 4Z3TA 4RH4A 3FFDB 4I3GA 1KULA 4Q6IB 3WN5A 4UT6L 2VSMB 4FLOA 4XNDA 2IPTH 4NJAL 1FNSL 2HH0L 1WBZA 4JREC 3S35L 4YSUA 3L9RA 1WFUA 1NGXA 2FZ3B 3HS0A 3QJFA 4P9HC 4TOYL 3T0EC 3ZTJH 3FT3A 4A2EA 1A64A 1TYRA 3Q6GH 1UGNA 2C34A 2IQAB 4KVPA 5SX4I 1IEHA 5FCSH 2I7OA 1AKPA 2IH8A 3ZDWA 2Q8AH 5FHAH 2A9DA 3MGTB 1WCBB 4JG1H 1DP0A 1IKNC 1L6XA 1TZHA 2Y7NA 1DL7H 5FGBA 3X11A 1Q0YH 1FZKB 2YBRB 5L2JA 3C6LD 3F8UB 4LF3B 4XX5A 5D7JC 3VJ6A 5F7FA 2ZQKA 3D85A 5GIRA 1OAYL 3U0WH 3DTUB 1INDH 4KMLB 5B7FA 1QABA 2F54D 2XQ0A 5DR5H 4KX7A 4NHUB 2X1WL 4I4WB 1TZAA 5HDWA 3A6CH 4WW2B 2QGBA 1TZGL 4DTGL 2P8LB 4L3AA 3QJOA 5H94B 3NJJA 5L8KB 1QFPA 1ZOXA 1ZLVH 1VADA 3RWFB 3C08H 4EOWL 3VD1A 2BIIA 3EJZC 3MLWL 1MLBA 5DVNA 2CALA 3Q44A 5F3HA 2ZKMX 3SYQA 1JVKA 1N5AA 4N22A 2HT4C 2XV3A 4E9VA 2W59A 1HINH 1YEIH 1DSFL 5EIVA 1IEBA 3Q0HA 3N55A 4XPFL 1KCSH 3MRCA 1AHWA 3UYPA 1QI5A 3BIKB 3O6MH 3TNNA 2OJEB 5L2KE 1XGYL 3D8MA 4OJFH 2QTVA 3KR3L 1DBBL 4FLSA 4DPRA 1NFKA 3O3DA 2MNUA 2W81C 1MVYA 3G6JA 3ZXAC 3LS5L 4POZC 3O4LE 4FN0A 5GGRA 3REWA 5DJ8A 4Z7NF 4NHCL 5GISH 1I3UA 3TYGH 3KHQA 1EANA 5IHZB 1NMAL 3BT2H 4JJ5A 4G1MA 3IMWA 2NXYB 4OIIH 5EO0A 2HXAA 1BBDL 1EEYB 2IIJA 3V4PA 4Y4FD 1OXYA 1F41A 4ELKA 5GHWL 1DO6A 1JPST 2PWEA 3ZZSA 1RZIB 5SX5K 3EJSA 3CVHB 1QYGL 5IHBA 3O3UN 5M95B 4XXDB 2VLJA 3GKWL 1VEOA 2QTEA 3V4UL 4GAAA 3N3EA 3CPLA 4Z7OB 1F42A 4Y2OB 3SEPA 3TZVC 1VACB 3EUUA 4HH9B 4OLUL 2WXMA 3H55A 3CZKA 3QB7C 2K45A 4LLDB 3OAYH 3DX2A 2MQGA 4OY9A 1DO5A 2W80C 5H4YA 1ZLUH 4TNEA 1DANU 4L8DB 4G8GB 1LYQA 1ROCA 4AJ0A 1G7IA 1U8KB 3BH9B 3LKOA 4KZDH 4XODA 2B0SH 2H6OA 1E28B 1XEUA 3AQDA 2XN9B 2F7QA 2F08A 2OW6A 4X4MA 1BIHA 1HU8A 1WP6A 3NJKA 3SPGA 4APXB 5F7EH 4AQ8C 2B1AL 2B9BA 4O2CA 5FHBL 4XB8A 3R7RA 2ZICA 3AGWA 1KYOJ 1OCZB 1O7DC 4WW2F 4G42B 3APCA 4D0BA 1QI4A 4J8QA 5JR1H 1CDIA 2UWEA 4N68A 1PTZA 3MX0B 4OSUL 4UOQA 5HDBF 3DSNB 1T03L 3VFWB 3BJ91 2YMTA 1FIEA 2X4TA 4AQ1A 4PR5A 1AC6A 5E8DL 2DL9A 3GGWA 4UT9L 4NWTL 3RJQB 1XCTA 1PL3A 3LN4A 3GXMA 3DJSA 3HE7D 2YPVH 3IU4H 2VCOA 4F58H 1DFBL 1NC4D 2XFXB 2OL3L 3EJTA 1UASA 3VG9B 4XX1E 3QEGH 5E6ZA 3B83A 2EO7A 2FL5A 4N0CD 4WUUD 5IBUB 2R8SH 4LSSH 1S7SB 5JXAH 1Z0NA 2Q87A 2WSDA 2HKHH 5IVNA 4U6YA 4HKJA 3NZUA 3GD1C 1Z9LA 1MJUH 2F54E 2L7EA 3MBWA 4I2XB 4JCLA 5EV7A 2BDNL 4WEMB 4LSVL 4AENB 1HOCA 1NFIB 2NY1B 4UQ2B 4JHWH 3QZWB 3QDGE 2OYKA 2WB1A 3MV11 2NNXA 1CQKA 1KGUA 1M1XA 1Q8MA 3LEYH 5AZEL 3V7AE 4DEUA 1F6FB 4ODTH 1SQ2N 1F11B 4WGVB 5EEXA 1S3KH 2UYLA 2OTPA 5DHMC 1DJIA 5F0PB 5CP3H 1CBVL 4NP4L 2R0WH 4UIKL 4WRLA 3UBGA 4JFXA 4ODHH 1IU1A 1EHLL 2HWZL 4Z7OF 3A67H 5CR8A 2KDYA 2H4EA 3QO1B 1U92B 1TMQA 2BP8B 4JAMA 4M5ZL 4TUJA 1MFDH 4XVOA 4QXTA 3UYRH 1T2QL 2ZCLL 3G5WA 4NRYA 2WV3A 4M6OL 4LSPH 1C9SA 4CKQA 2P48B 2Q8BH 2ZG2A 4PJFF 4KMQA 2DM7A 2Y36L 1SYSB 4H25B 2X9YA 3SGJA 5E99L 3C5SA 1UZ6E 1HQ4B 3QWOB 2E75C 5MEPA 5F7DA 4Z3EA 3TO4B 4KQ4H 5AVZB 4D8PB 4RWYH 3EXLA 1EZUA 4U7KA 3N42B 1PZAA 3O9WB 5MHSE 3I9GH 1JZ8A 4B9ZA 1IAOB 5EUOF 5E95B 4D2NA 1N59A 3D69B 1YZZA 1EJOH 4DFHA 1S8DB 4LCCA 5IEKA 4NT6B 4EO5A 1OTSC 1MOEA 3MPCA 3IDUA 3MRMA 3QUMH 1NCUA 2W9EL 2XA8H 4Y2LA 4NP9A 2H45A 4GQZA 3MBEB 4MHHI 4JG5A 3UC0L 4GAJL 1U0QA 2H1PL 2AEQL 3IE4A 3P0YH 3VI3A 1R5WB 2WN2A 2R69L 2JB6B 3FCTA 4AYFA 1OPGH 5AVUB 3VTAA 5E5RB 3RGVB 2YWZA 5ANME 2ZUQB 3FTUA 3Q5OA 2B1HH 4TLSA 2Y2YA 4C59B 1VPOL 1U3HA 3HKFA 5AYUL 1HCYA 4LEOA 3IDJB 5KZCD 3TM6A 1HL5A 4NAMA 4PRAB 2BOBB 5C0CB 4WHYG 3W11D 5E03A 2OULB 3GZPA 4HEPA 1O0VA 5HYJE 2YPLD 3S7GA 2E7LC 1OEZW 1KPVA 1UHVA 4JM2C 4TPRH 3TBSA 4I18A 2ENQA 4XPAH 3CDGA 3FPYA 4WU5B 5D2NE 4EZJA 3ARDC 4HCIA 4BHUA 4WTWA 3RWCB 3CHRA 2W1NA 5DEFA 4UTCA 2NW2A 4X4XA 2BWDA 1A47A 4TSCL 4FQQA 1I1AC 4X9GA 3U46A 3CVCA 4GOSA 2VWEE 3BE1L 2J1WA 4G8GE 1BAFL 1NBYA 3FB7B 3JV6B 1BF5A 5CCJA 3L3HA 1DBMH 3POHA 4FHJA 2OCCB 3LRMA 1MHPH 4IIZA 2VDML 3OKMA 4HQQL 5CIPB 5T1JA 4JDEB 4EDWL 3RFZB 4M61A 3KEDA 4FQIH 3BPOB 3P2BA 1HAUA 1S46A 4S2SB 3BVUA 43CAB 2ZXEB 4R5TA 4NM4H 4M4PA 2F53B 2C7FA 4Z78B 3QNXB 2ZPKL 4AQEB 4L8CB 2VN6A 2YKKA 4LPWA 3G9VA 3UABA 3RI5F 3SZKC 5FUCC 2CU9A 4M8UA 4Y4HB 4BFKA 1LXMA 2BNRA 2ITCA 5DRWA 4XMWA 5IQMA 1A7RL 3EJPA 3X1GA 1BV8A 2PR9A 5D1ZI 5JXED 2H9GA 3DX9A 4JHVA 2P3YA 4GKOA 2J7LA 3PWPB 3GMQA 5E2JA 2KH2B 3NJMA 3HI6L 4NPJA 4PRHA 1OGAA 3KPMB 4EEEA 3D2TA 5J6SA 4G1EB 3VI4A 3W0WB 1I85C 3HTLX 1A4JB 4N0UA 3CHXA 4U4IA 2JE8A 2EE3A 2BRRH 2FJUB 3QUXC 1W9XA 2WGNB 3NCBB 4OLZH 4I2XE 4OCNC 5D7LB 4HIHA 4UOJA 3VSTA 3GMRB 1I8KB 1N64L 5AB0A 1JPGA 2QLVB 3WMPA 4DFIA 5AFAA 3MDJA 3DPBB 3ULUC 3VYNA 5J1AA 2V4LA 4NO3B 2R29A 5DQ9A 4P05A 4HDIA 5HPOA 1NFAA 1QSFA 4RAVB 4MWFA 1UXLA 1S7TA 3B8SA 2EACA 1C5DB 4EUPA 3CLEL 1IJ9A 4DZ8A 1B0RB 2NX5E 4AI7A 5IV2B 3RVTD 1S7RA 5D93C 2DZEA 3SGKA 2ZOOA 35C8L 5LHDA 1B3JA 4QXGH 1I8MA 3N1QC 4ALAC 3S3SA 4FNQA 2WUCH 1BYPA 4BRVA 1B2WH 3F2LA 1SLVA 3IE9A 5KOVC 2FWSA 3RB5A 1JYWA 5EOTB 3DHJA 3FT2A 1NWPA 2EYRA 4F5CE 3N6YA 2YXMA 2XJKA 1G9EA 1DQDH 3SO5A 2FSEB 5ERWA 4Z3IA 2NSMA 1U8CA 1Y6NR 3K5RA 4WFGE 3WIFA 4Z7AA 3FUKA 1BGXH 2VR9A 1TSRA 3FUMA 4JFYA 3ZU8A 4QHMB 4MD0B 4XBGB 3S36L 3QA3B 5DD0H 1XWVA 4PJBA 2UX6A 2E27H 4FXKB 2J5LC 2GSIA 3GS7A 4OCWL 4JJHA 4NUPA 3ZDXB 2YK1L 3E3QE 2ZAGA 5EC1B 5IBLD 1PNCA 2DLFH 4XNQB 1RZKL 2H6PA 3RWHB 2WYZA 2H3NA 4PRIB 1KEGL 2OA9A 2Q9OA 4PV8B 2VDNB 4G83A 1IC7H 1QQDB 2OW7A 2XKNA 3S96A 1EFXA 2YAEA 3AITA 1EV2E 3Q8CA 1JGLL 5DFWH 3SPVA 1FCCA 5I5MA 4HFWA 3S9DB 2ENPA 3VD0A 5JW3L 4LLUA 1A4KA 3ZT7A 1U58A 4Y2DA 4AJWA 4AW7A 3BQVA 3IKCB 1BXXA 2G5BA 3QJRB 4HJ0D 4I48A 4KZEH 1BD2B 5D72L 2O5YL 3EOYG 2GC7C 3T08A 3IGLA 4M8VA 1UYWH 1YVLA 5E7FA 2JQZA 1KNOB 2VM9A 3X3GH 1BQHA 5F9OH 1VEPA 2VC2L 2Z6FA 3H9SE 2ZNXA 4JFDA 2P8MA 3QXWA 2ZWSA 4JRYA 4JZJB 4KXZI 1BOYA 2XHNA 3CQQA 1KLGB 2GTQA 1IGJA 3CFQA 4ZFZB 3VWKC 4BH8A 5CEXA 3HG1B 5ABAA 2I07B 4UOW0 3BPLC 2ZKYA 3NJIA 5AUMB 5GJTH 3WGUB 4DGYL 4XPGL 2AABH 4JEGB 4LIQH 2HG0A 4MAYD 3QAZB 1PY0A 4X7EC 1QFOA 3AABA 2VZVA 2IDCA 1FZJB 2R2HA 4ORZC 2F0CA 2IALB 3FT4A 4ADGA 1PNDA 1YEFL 2RAMA 4M48L 3N0PB 5CD3A 3ZKNC 4TTGA 1EXUB 4U1JB 3FN9A 5AVYB 4OLWL 5GS1C 3BD4A 4NQDD 2MCPL 3ZRSA 5I0WA 2V7NA 1NC2D 5CAYB 2GAZB 2E74C 3AXLB 4R7VA 2N59A 3GTVA 2W9DL 4EI5C 2VDKL 4N2LA 1YNLH 1O9WA 1D9KB 1FJ1B 2HPOA 1FAIL 4ODSL 5BO1L 1NGQL 1M6OB 2A9ML 1JD9A 3UTSD 1ZT1B 2C3VB 4QTFA 5IQLA 4M62L 2L7QA 1P7QA 3LEVH 4LKCB 3BEVA 3IFNL 3LX9A 4H1LG 4A67A 1N8OE 3UJJH 4JUSA 5KWYC 2CHNA 1YNTB 5CJOL 3HUJB 1EA9C 2AJXL 4HZLB 4YUEL 1FFTB 2AC0A 4XP9L 2QFRA 2G9HA 2EIZB 4Y4KA 1XF4A 3DKHA 5AYTA 4CA4A 5IUSA 2ADIB 3MJ9A 1TQBB 4XP1H 4XVJL 1WIPA 2BFVL 5GZOD 1UWGL 1N67A 2JK5A 3BSGA 3QPXL 5LBSA 2CNYA 5E4EB 4XHJC 4F80A 4PB9H 5AKVA 1N0LA 1GTFA 2W0FA 4BZ1A 5JQHC 5KBMA 4OIFA 5KVEL 5B38A 1NOLA 4MNHB 3OGCB 1HYSC 2DQFB 1A0QL 5IMMA 1TEYA 5DF0A 2X4RA 2F8OA 3GBMH 1E6OH 1YECH 3NN8B 4LEXH 1PKOA 1J1XH 4E36A 3PWJA 4JFWA 3RPIB 5IMKA 3GFUA 4N2MA 2GJ6E 1QA9A 4XP6L 3VFMA 1MSPA 1ITCA 4JO5A 2A83A 4M29A 4XPHH 2EH8L 3VWJB 2IXQB 4AQAA 2P9RA 5FPIA 4M1GH 1CE1H 3P0GB 1JF1B 2X1QA 3SKJH 2H2SD 5JPMC 3DUHA 1BOGB 5T5FH 2CA4A 5DJYA 1EX0A 4I0PA 1JHKH 5CSGA 5DUJA 4GG6E 3QNYB 1XGQA 4RBPH 4P9HH 1YN7B 3TT3H 2BNUA 3MZGB 1A6UL 2BVOB 2HRHA 4J6IA 4CBPA 5KVEE 4PIRF 5AOLA 5ID1B 2BY2A 3RNKB 3IPBA 5GPRA 3HG4A 5FECB 1I1FA 1LILA 1BAWA 2WZ0A 2Q86B 3FUJA 3F12A 4NNYB 5GGSB 4AG4L 1UWYA 4R2GD 5GGRY 1QKZL 4MB1A 4WWNA 5I2IB 1P0SE 3FH7A 4QGTA 1XF5B 2PF6A 3HOGA 3KLSA 1BVLA 3PWUA 4P46A 3TV3H 1JGVH 2CLZA 1RIVH 5J1SC 3K1DA 3NJHA 4B27A 4BINA 3BWAB 3KYOA 3DGDA 1Q0EA 5EZJB 4GFTB 5EIIB 5D7HA 1DQMH 3V5DA 2CA3A 2IG2L 3PHOA 3LHAA 2GIMA 2BW4A 1NUFA 3B43A 3FB5B 4M5SA 4ZS7L 4FTVE 3FYIB 2CBMA 1M2VB 4HIPA 4FQ1H 3HZVB 3AREA 3V4VB 4K2UL 2Y06H 5JPNA 3F83A 3HUJF 3HCVA 2B4CL 4JKLA 5F7AA 2VQTA 1H8NA 3OB8A 1P5UA 3W5MA 2M83A 4X0NA 5GRZA 3TESA 2P52A 2X2UA 1RJYB 4NQDE 4P2CG 4Y9CA 2IFFH 2JKJA 2CO6A 2P5PA 3HLAA 1P53A 1XZ0A 4PWEA 3GKZA 5CHNA 1FGNH 4XCYB 2FO8A 1IBZA 2QMKA 2WGXA 1SEQL 2DQGL 5HYIA 3FTYA 4HMEA 3BWUC 4HD9A 3STLA 3U2SB 1GGBL 5HI5D 2EDLA 4XBPA 4W81A 3VM7A 3GJEA 5TDOA 2Q1EA 5J89A 4Y4FC 1RK1B 2Y3AA 3QXDA 5BPPA 2ZOLA 5E8EB 3I6GB 2RCSH 4PCSA 1CXHA 3TPUA 4B7LA 4P5TA 2CXKA 3QUYA 1PSKH 1NGPH 3VX1A 5I8OL 1MREH 2V9RA 4FG2A 1OANA 3HN8A 1MCWM 4APQB 1WZ1L 3IJHB 4PLJD 5IOPB 5CSZA 1LQBC 3KPPB 2FX9L 3CFKB 1NWOA 2IDQA 1OE3A 3ILPA 4KUCD 5A3IC 2BPBA 3EO9H 1ZDQA 4LRNL 1I1YB 2X7LA 5EOCL 1ADWA 4R9HA 5FGRA 4AYMC 3ECWA 2F5BL 2TRHA 1CDJA 4GSUA 1FVCA 1HHHA 5JDJA 2Q5BA 4QOKA 1AGCB 1CFTA 3H2PA 2ZP9A 2VITA 1IQDB 5L4FA 4LLYB 3C60D 5DTFB 1HHJB 1GZQB 4Y1TA 3BQUD 4NLAA 3JZ7A 2WQVA 4FFWD 2EZ0D 3UAEA 1ZJBA 3HLKA 4H20H 4YHIB 3RIAK 1FORL 3F6IA 3K1KC 2A6DB 5TF1H 1P4BH 5F96L 2GBAA 3QIUA 3QJSB 2PYED 1ZSHA 5D2NC 5HJ3B 4XAKD 1L9PA 1QSEA 2ZAHA 4FLRA 3OLGA 4PJCB 4HUUA 3WLWC 2NTFB 1J87A 3CLFH 3FU3A 4GAYB 4MJ2A 4OJDH 1ORQB 1Q0XL 4WKZA 1RK0A 2XBTA 3H9ZA 3FTWA 5GZNA 1DTUA 2VWEC 5AB9A 3VXTB 2VZ3A 3KCWA 1SVCP 2DBLL 4GQ9H 4BFBD 4QRPA 3ESVF 1U93B 2VDPL 2O72A 1FLRL 1JGDA 3IN2A 4N0CC 1QASA 1JV2A 1G9ML 2Z34A 5LBGA 4Y1AD 1CFSA 3Q1SH 4Q9QL 2O93L 3PIQA 1KB5B 2Z91B 3V6ZA 3NFSL 4A66A 4N8CL 4HEME 4IKKA 1Q1PA 1A6ZB 4PLOB 1I9RH 1YA5A 4JPKL 5EC2B 3TBYA 2ZJSL 3DOSB 3WY1A 3LIUA 4AMXA 2JTDA 3QEHB 1ILUA 1VFAB 4N90D 3GM0A 5A6LA 2GJJA 3E80A 4O9HL 1TETH 3CDFA 1OZTG 4N9GB 3F65A 1JMZA 3BVNA 4HBCH 3MLYH 2QQLL 4QTIL 4BWUA 1CDGA 1U2CA 2AJVH 4EDXA 1M53A 1M6UA 5H8DA 3ZHDA 4B9GA 1OAKL 2DH2A 5BNXD 3HB3C 4NO5B 4ONHB 1S9YA 3H3BC 3FRPA 3K81A 3NSCA 4HIXH 2OMBA 1DDHA 3L3JB 4GI6A 1BIIB 4U3SA 4L1SA 2ROYA 1WUNT 2NY5H 5KVDL 3VGBA 4HMDA 4Z7QE 1KPRB 3H4FA 1JPSH 3MRRA 4QHKI 3KPNA 1G1CA 2OMUA 1XSJA 3RDTD 4YK4C 2FYVA 1S7UA 2ADGA 3C6SB 4P3DB 1NEZB 3X14A 4N2KA 5LQBL 3NPSC 2WIIA 5MEND 5CXPA 3HRZC 1R3HA 3T5WA 4DOHE 1XZWA 2EDFA 2Z0BA 4UQIM 1KCVL 1KTKE 3LRSB 1FVDB 2X6UA 3KL0A 5CEZH 2Y7MA 2QR0B 1XIWA 3FO1B 3Q2WA 5AOJA 3VGAB 2NYYD 5SWZB 2WKLA 2YXVA 3FQUB 1SJHB 2XWBA 5T8IA 5T3XE 3RWGA 3GRWL 4MNQD 4Q74A 3K46A 1EMTL 5KSVB 1LDPL 5T1KA 1HDMB 3MKGA 2DWEA 1NEPA 3I6KB 4FQHB 5IFJB 3LVEA 3GLDA 2X1OA 2ZE0A 1CFVL 1XD1A 4MZIA 3I3DA 3WU1A 3VH8A 1EGJA 3SGEI 3FTVA 3WBDA 4NI6A 2ADJA 1NTDA 1KYAA 4WQOA 2FT6A 1KYFA 2HCZX 3TS8A 3BSHA 2BWIA 1FIGH 2ESVA 4K3EL 1E27A 2NDGA 1CXKA 4X4YA 1T80A 1Q90A 3W11C 5DUBA 4M6AA 4UOZA 4YBQD 1TQSA 3G08A 1OAUL 1SBBA 5HHOD 2HJKA 1K8IA 1DE4A 4ZPTB 1T1ZA 5KS9B 2Q7YA 3E3QC 4EBQL 1NPNA 4A2FA 2ADYA 2P46B 1WGOA 4ZAKD 5F3FA 1EZLA 3B2XA 3VD2A 2K0RA 3DX0A 4DEPB 1TNMA 4ANKA 2HLEB 1J8HB 4LAJH 2C4FU 5FIEA 1Y6KR 2IAMD 3N41B 2YRZA 1CFNA 1IEAB 3HJ0A 3W39A 4HT1L 1VIWA 4RSVA 2QPSA 3VFUA 1F4XL 2X9WA 1UEMA 5DVPA 4PRNB 1TFPA 5TE6L 4KK8D 4Y1AB 3ZX1A 1TLKA 4FJ6A 2UZIL 3VM5A 4DP8X 4H88H 4ACTA 3SQBB 3B3IA 2PETA 1ASQA 5DHVB 5EULV 4TKWA 3VXUB 2Z64C 3T8XB 4A6YL 1RIHL 2EDBA 2VN3A 5EB9A 1CIUA 4UV7H 4DGUA 2GT9B 2X9ZA 1TVBB 3KPSD 3L7EA 2NY7L 5D4JA 5AKTA 4D0CB 3ZR6A 4QRSA 4DUVA 4TQEL 3STZA 5L7XH 2AV1A 2C9RA 3IDGA 4XCFH 4LMQI 1A1MA 1RZKC 3LSOA 2C1PB 4U1MA 2OR8A 3BFWA 1DJXA 1X5HA 3Q3GB 2VAJA 4FQPA 5JXEC 5KVFH 3OAUH 4A7VA 4Y8DC 3EHBB 3WEOA 4FKHA 2R1WA 4YAQB 5JHDE 1L3NA 2WINA 3CJJA 4V1DD 4E9SA 3RILA 1MJJA 5IB4A 1XH1A 3DUUA 4G8IB 4DUXA 3LPGA 1KGXA 4NM8H 5TE4L 1B2YA 1DQQA 1HXMA 4KHTL 4OFDA 1XH2A 5LCVL 3UPRA 1B4JL 3X1BA 2FR4B 1LO5B 2FJGB 4JFUA 2FIKB 3VXQA 2XI9A 5JHBA 3TT1L 3E0GA 5I9QB 2XUWA 5AAMA 3W56A 3BUYA 1KBVA 4FMFA 3DGCR 3ULUH 1UM6H 1CFBA 2XG4A 3V9FA 5MENE 1ZT4B 4X6EB 1FFNA 3WFEH 2WC7A 4TM9A 4KGLA 3AY4A 4QRUA 4FYSA 3PHSA 1J48A 3VXNB 2OSXA 5I1IH 4KO6A 4QRTA 3RVTC 2MMXA 3MTXA 4TLUA 2VZOA 1FWXA 2AQQA 2CO7A 4YJZL 4QCIA 5KS9F 4WNJA 4JK0D 4KVNL 1MLCA 2H0PA 1X9RA 1CICD 1CXIA 4GMSH 4MNQE 1WJ3A 1CD9B 3EYVA 1SXCA 3RU8L 1LP9B 1QVOA 4BBWA 3NAAH 4PCKA 2OTWA 3RJOA 4N85A 5IESL 5I1DA 4HWBH 5JW4Q 3LAFA 3N9GH 4C83A 3UTTD 3WFBL 1A66A 2ODIA 3IDXH 2PXYA 3N41F 3DSFL 2RFXA 1TKWB 5EU7E 3QXAB 3WKQA 1YPZA 3PWNB 1P5VB 2M26A 3OHXA 2YAOA 2FLRT 5K1VA 3DXAD 4G72B 3D52A 4L4TB 5E51A 2GIYA 5C07E 4DO6A 2HZHA 1I8AA 4XXCC 1TNNA 2BNQA 3KL3A 4YN3A 2XXMB 5IBLC 1MW0A 5ETUA 4BXVA 4EN3D 3SDXB 2FECI 5I8CB 3O0RL 3AVEA 2A7BA 2OYPA 1MCBA 4ZUVA 5LGKA 2J4WL 1NJ9B 2RJMA 1NLDH 3OMNB 4X9BA 3OAWA 2EXTA 3KYNB 3U4KA 3PQYA 4LASL 2B3IA 2Z9TA 1KJ3L 4LRIA 4ZFOA 2WXRA 3SDAB 5DT1L 4WI0A 3FQXA 4OZHA 1A9EA 3OZ9H 3MUY1 5CCHE 3J8F7 5K1JA 1NAMH 2DKUA 3L1GA 4RMUA 1RSYA 4UDTA 4PG9B 1T5WA 2Y5QA 3DRTA 2AMGA 2Q76A 2W94A 3FQRB 1DVQA 1EDHA 2IMMA 2D31A 2LTQC 4PCTA 1XCXA 4HJGB 4OGXL 2V5YA 1BM3L 5LNGA 5GGUA 5LAPA 1OAQL 2UZYB 2BSSA 3FU0A 5HGGS 3SDYL 4UT6H 3SJVD 4ANXA 4JJOA 2C3XA 3MV8A 3AC0A 3ROLB 4MS8D 4HAFA 1C12B 2PCPA 2DQJL 2WLYA 1FNSH 2HH0H 4DKFL 3S35H 3ZE1B 1BZ9B 4MAYC 2XXGA 4OFQA 3QHZL 4OGYL 5B3JF 2MQCA 4Z9KB 1VCAA 2FATL 1PZDA 1KT2B 3E9UA 1TZOA 2EYSB 5DJXB 4W6WB 2IADB 5J3HC 3BRFA 1KZYA 2MQ3A 3TXAA 3V7MA 2YPVA 4GT0A 4V1DE 4WI7A 2AGJL 2P5WD 1G6RL 1ETJA 3WN5B 1N6VA 1ZVHA 1DJYA 4M7ZC 4FFYA 3BUQA 1WBZB 4JVWA 1FYHB 1LP9F 1NGXB 3HS0B 3QJFB 3FT3B 1OAYH 3L9BA 4ANVA 4D0DA 4R4FL 2VLRE 4MTMA 3QZBA 4R3SA 3RX8A 2XZAL 4MJJA 1U95A 1USZA 3QJTB 5CLXA 1FHGA 4B9JA 3CVIL 2XPYA 1TZGH 5BOJA 3TN0A 4DTGH 3H85A 1M05A 1TTBA 1TZHB 4EOWH 4OFVA 5K39B 2DEWX 2X70B 3U2IA 3X11B 4E2OA 3MLWH 2EABA 5L2JB 5K59F 2MFNA 1MJ7H 3VJ6B 3KCPB 2DY2A 3D85B 1X7SA 2B4CC 2HVKA 3GK8L 1DSFH 5CP3A 4GQPH 2MCG1 4AC2A 5GZOC 3KBFA 3HIZA 1UOVA 3SDXF 1DZBA 2HP4A 3T6ZA 3KDMA 1DBBH 4V2BA 1VADB 2NNCA 1MLBB 5F3HB 2Y4SA 4KI5F 5IW3A 1QBBA 3IJSA 3LS5H 2GUYA 3UTTE 4H26B 1LQSR 4F93B 2EJ1A 4NHCH 3W1ZA 5DK0A 2XNAA 4R83A 1NMAH 1IEBB 2WTRA 5D7KD 4R0LC 5D7IF 3MRCB 1AHWB 3UYPB 5CGTA 2YWYA 1BBDH 1PLAA 3TNNB 1UA7A 3EDJA 4AUUA 2ZG3A 5GHWH 3APNA 4H44C 1LWJA 4KKCD 1ZLSH 3EFDL 3O3DB 3C5XA 1H0DA 3G6JB 3OJDA 5DRXA 1ESOA 2XQBH 1QYGH 4HEPG 5F88A 5C3IA 5ADOH 3CC5A 2H2SC 4HJEA 4WVRA 3BYYA 5GGRB 1CZ8L 3OG4B 2E0PA 3ZL2A 3G5XA 3ALWA 1R4XA 3V4UH 4WCYL 3QUMA 3WTWA 3K74B 4JJ5B 4G1MB 1TCRA 5EO0B 4OLUH 3V4PB 1ORSA 4E5XA 4W1TA 1GIGL 4QXWA 3Q43A 3WEAA 4ELKB 4UTBA 2V2TA 2ARJA 4OAWA 5DLLA 1F4YL 1E4WH 1NA8A 3H42L 4LK4A 3QZPA 5A2AA 3VA6A 5BOPA 3I6LD 4R2GC 4PRPE 2VLJB 3NQIA 1GGUA 4IHBA 1BMZA 1V8HA 3CPLB 2BVTA 3ISRA 1MXDA 4TN9A 4XPTL 3S6CA 4AUYA 1NIFA 5F70A 5KJRH 2WHVA 4X5PA 3AACA 1AGEA 2WPGA 2B1AH 4QRFA 3SJVE 1AZRA 5KTEL 3ALXA 1CGYA 2EE2A 3BP6A 3QDJD 1G7IB 1KY6A 3AG1B 2MNJB 4MJ5A 3NRQA 4M4RA 3P73A 4ZW5A 3ZN6A 1NANH 1G43A 4K7PY 3ES6A 4F8QA 3MJGX 5E8DH 4BSJA 1JV5A 2D7PA 1KN4L 1MW3A 4UTAL 2CBTA 1NOFA 4NWTH 1KTRL 2CRYA 4OJAA 5CZXD 2P5WE 3S5ZA 4O2CB 3WUZA 1H3PL 2OL3H 3F04A 3PP3K 1NCBL 1JWSA 1DYZA 3V0JA 4D0BB 1G9MC 5BRQA 2UY6A 2UWEB 3MA7A 4XCNA 5DHYB 4BDVA 2CE6A 2WJ5A 5IHWA 2X4TB 2JSFA 2HVJA 2D9QB 3F64A 4GRWH 4PR5B 4ZX5A 4AQ1B 1O9VA 3GGWB 2BDNH 4LSVH 4IIQA 1XCTB 3LN4B 4BKSC 4PWKA 2WXGA 2EO1A 3QDMA 1W8OA 1TIUA 1X5ZA 3QORB 4TV3A 3T2NL 2FL5B 5AZEH 3IFOA 4LCYA 4GSDL 1UURA 3TJPA 2OK0H 4EUPG 4NENA 4MJIA 2ZCHL 2JJSA 4N8PA 4HKJB 1GGIL 3MBWB 3C8HA 4PLJC 1CBVH 3ARBD 4NP4H 1HOCB 2XWJA 4UIKH 1EHLH 5C6WH 1CTNA 2HWZH 3RKPA 4HKXA 2ADFL 3HMXA 1GRWA 4M5ZH 2QPEB 4F1SA 1T2QH 2E9IA 1M1XB 2ZCLH 1KFAL 4M6OH 5E1AA 2ISDA 5JW5A 3T8MA 1N5YL 4JHBA 4P0DA 2V5RA 3CX5K 2Y36H 4HK3N 4U0RC 5E99H 1AI1L 1UB6A 1AOHA 3ML9A 2GABA 2FT8A 4OQTA 5I1JL 5I24A 4IGBB 1TZ8A 2UYLB 3C60C 4L1BA 3U1PA 5AAPA 4JFXB 2QQKL 4DESA 4ZX4A 1BPLB 3AAZA 3EH3B 4R96A 1R24B 2EZ0C 4ZXBA 2HB0A 4JAMB 2AJUH 4PHZA 1BVOA 4QXTB 1RZGA 2Y69B 4NRYB 5K9QG 4ZUWA 4GKNA 1HNYA 2GYSA 1OF0A 2VKXA 4ICWA 3IPFA 3UH8A 1HNFA 5DD5L 5I1AA 5SWSB 4XN4A 1BF8A 3C5SB 4KXCA 5MEPB 5INDB 3NFNA 4MVBD 4L0YA 5F7DB 1FGVL 1PD0A 1M56B 2W9EH 1IC4L 3VXRD 4HXAH 2D7NA 3UC0H 3KL5A 1A65A 4GAJH 4RZCA 4HOXA 2H1PH 2I5YL 3AS2A 4F92B 2N7SA 2AV7A 2R69H 4IRSD 3ZMRA 1KUMA 3MVSA 5ECGA 1N59B 2B9AA 2R9HD 2ZP0T 4LCWB 5DJAA 5KYNA 4LCCB 5IEKB 3FFCE 1VPOH 1H8SA 2AERT 4WNQA 5AYUH 5HGAA 3HC2A 3MRMB