2AFNA

Structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
331
Chain Sequence
b'IAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 88
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA02
4W1TA 2OJ1A 3OMIB 3ABLB 3SQRA 3FSZA 2VN3A 1J9RA 4BWTA 1SHWA 3FYIB 3QPKA 4AZUA 3WKQA 1A4CA 2IDFA 4KOCA 2GC4C 1NIAA 1IKOP 5D4JA 4PCYA 2YQBA 4DPBX 3ABKB 3PXLA 3S3BB 1E5YA 1HAUA 1AZNA 3AG2B 4JHVA 1M56B 2HRGA 1MZZA 2GC7C 1JZJA 3FSAA 4FA7B 6PCYA 2I7SA 2BWDA 4E9QA 3TBCA 1KGYE 2UX7A 3NP3A 2QPDB 1ZV2A 4P5RA 2R7EB 2AVFA 1WS8A 3NT0A 2XV0A 4NERA 1PZBA 1N68A 1PCSA 3AG1B 1NIEA 3AW5A 2P80D 7PAZA 1AANA 3NSYA 3X1EA 2GB2A 5I5JA 4BWUA 1ZIAA 2HRHA 2IDQA 2E86A 1W6LA 4DP8X 2WO3B 3SBQA 3H4FA 3EH5B 4L0PB 4YVUA 3FU7B 4WTQA 4E9VA 5B3SB 2X87A 3NJGA 2EILB 4MFHA 2PPEA 1TU2A 2W8CA 1BXUA 4BWWA 1OE1A 2W88A 1R1CA 1AS8A 1A4BA 2X88A 1WS7A 2GBAA 4A2FA 3DTUB 5I6PA 2ZOOA 1NIBA 2PPDA 4G7SB 1XB6A 4YSRA 5EHFA 2HZHA 4HAKA 4QLWA 4KO6A 2N0MA 2DYRB 3IBOA 1AZBA 1SF3A 4BXSV 2PP9A 3QJVB 4NB7A 1RZPA 3IE9A 3CVBA 4DP7X 5TK2A 1OCOB 2WSDA 1AIZA 1JZGA 2GSMB 4YL4A 2H3XC 4YSOA 1J5DA 2IWFA 2J55A 4HCFA 2YAHA 1L9RA 4E9YA 1BQKA 1ZIBA 3PCYA 4GP8B 1IBYA 1J9QA 3TBBA 2FWLB 5I6OA 4E9XA 1KBWA 2XU9A 5TK4A 3UGEA 1RZQA 2GHZA 3H4HA 1NDTA 3PAVA 4AKQA 1NZRA 2I85A 4KO9A 4BDVB 1AQ8A 3PPSA 5F7BA 1OF0A 4DP6X 1TEFA 2RACA 4G70B 1SJMA 2WO2B 2DV6A 1CURA 1HAWA 4N8UA 1JZHA 1IUZA 3OMAB 3T71A 4X4KA 1EHKB 1CC3A 1OCRB 4A66A 2DWSA 1AZRA 2OCCB 2CCWA 2UXTA 1MDAA 1ZDSA 5B7EA 2I7OA 3ASNB 2Q5BA 3L45A 1J9SA 1ETJA 2IWKA 4NAJA 2VW4A 3EF4A 1SF5A 2CJ3A 1AS7A 1SNRA 4G72B 3CDZA 2VSMB 8PAZA 1ZPUA 1QLEB 2FQDA 2J56A 1JXGA 2H47C 2HX9A 1GYCA 2UX6A 2IH8A 1ZDQA 2YAEA 4YSEA 5I6NA 1BEXA 3EH3B 3QJTB 2PP7A 1L9SA 1AAJA 2QT6A 4YSTA 1A3ZA 5AKRA 1JVOA 2FTAA 4GP4B 3GYRA 3OM3B 1PNDA 4YSDA 4K9JA 3WG7B 4TXVB 2BWIA 5I6KA 2VW7A 1GS7A 1XMEB 1MZYA 1OOWA 5B1JC 3DKHA 2CAKA 5AZUA 4YSQA 1NWPA 2PPCA 1DYZA 1PF3A 1QHQA 4F2FA 3JT2A 2EINB 1SFHA 1NIDA 1WA0X 4Q89A 1E65A 2H5UA 4KNTA 3AG4B 4DP2X 3NYKA 3TA4D 1HFUA 3ASOB 2P80A 5D4HA 3UAEA 3KW8A 1SDDA 1RCYA 2BP0A 3N2JA 2VW6A 1WAEA 4A67A 2FNWA 4PAZA 1V10A 1WA2X 2YAQA 4YSSA 2DWTA 1JOIA 3H56A 5B7MA 2AZUA 2BP8A 4N4YB 3X1FA 2AFNA 1N70A 9PCYA 2FT6A 4YSCA 1AZUA 1ET5A 3ABGA 3AZUA 1RKRA 4A2EA 1J9TA 1L9QA 2YAMA 1T5KA 2CUAA 2TSBA 1M9WA 1KDJA 3FQ1A 3IN2A 3S8FB 4YVNA 4GYBA 2FT8A 4YSAA 2DY2A 2IDTA 3NSDA 1ADWA 1WA1X 2PCFA 1ET8A 2EIKB 4DP4X 5B1JA 4HALA 3KW7A 1ILSA 3UABA 2PPFA 1NTDA 1JZEA 5FC9A 1IC0A 4JKNA 2IAAC 2ZXWB 4DPAX 3QJSB 3FPXA 1AACA 2IWEA 3X1NA 1GW0A 4F2EA 4KOBA 3PAZA 2BW4A 5D4IA 4KO5A 3GXUB 1GY2A 4G7QB 2GI0A 3BVDB 3UACA 3BQVA 1AG0A 1A4AA 1AOZA 1FA4A 1GS6X 1JXDA 2LLNA 1JERA 4WKXA 1V55B 1NINA 3GDCA 4DP0X 2Y69B 1ILUA 3ZBMA 2B08A 2QDVA 4A68A 1ASQA 2UXGA 4E9SA 3ZIYA 4A2DA 4UANA 3WNJA 1V54B 3QJQB 3V9CA 2CBPA 2HX8A 1PMYA 2TSAA 2BW5A 1SHXA 3NSCA 1CYWA 3AY2A 1BAWA 4E9WA 1ET7A 1W8EA 3FSWA 3FT0A 3MBWB 4AKOA 3NSFA 1AG6A 5AFAA 2J57A 2UXFA 5IY5B 3NJNA 2JKWA 1BQ5A 1X9UA 4AKPA 3T9WA 3X2QB 3NJKA 2YAPA 4P5SA 1JZIA 1L9OA 4M4RB 2JXMA 3FQYA 1DZ0A 1OCZB 4AX3A 1KDIA 1PLCA 3IEAA 1YLBB 3S3DB 3SBRA 3V9EA 4ZK8A 1UATA 1M57B 4JHUA 3NJFA 2HX7A 1URIA 1PNCA 2IDSA 5PAZA 1L9PA 2XXFA 3QQXA 3CG8A 1EZLA 2PPAA 1CUOA 4DPCX 4E9RA 2BP8B 2PCYA 5I6LA 1ID2A 2BZCA 1MG2C 4BDVA 4GP5B 2OV0A 3TU6A 1PZCA 3FYEB 4KNSA 2EIJB 1OE3A 2XWZA 3ABMB 5PCYA 2A3TA 3SBPA 3U25A 1B3IA 1TKWA 4M3HA 2IH9A 5I5IA 1KV7A 3FPYA 5F7AA 1PLBA 2BZ7A 1BXVA 1VLXA 1GSKA 3T6ZA 3WNIA 1OE2A 1OCCB 1AZCA 4HIPA 2XVBA 3OD3A 3ZX1A 4DP5X 4HHGA 6PAZA 2BHFA 2BO0A 3WKPA 3NJLA 4CSZA 2XV2A 2FQGA 2QDWA 4F7KA 2VM4A 4AI7A 5B1AB 5LDUA 7PCYA 1X9RA 3NJHA 1KBVA 2XX1A 3CVCA 3D12B 5B7FA 1BYPA 3T6VA 2FJSA 3JTBA 1I53A 5I6MA 4BXVA 2DYSB 1PY0A 4FAAB 3PLYA 5B1BB 4HCIA 2YXVA 1QNIA 4Q8BA 2XLLA 3WI9A 4QKTA 3CZUB 2HLEB 1BQRA 1E5ZA 3WIAA 3MX0B 2MRYA 2CALA 2B3IA 4CSPA 2XV3A 2ZWNA 3CVDA 1NPNA 5B1KA 1J5CA 1CYXA 1GY1A 5I28A 2XYBA 3G5WA 2YARA 4E9TA 1JXFA 2XUWA 3EHBB 4YSPA 2R7EA 1KYAA 1BYOA 3IN0A 3PAUA 2HXAA 3X1BA 1E67A 1TEGA 1ASOA 1XB8A 1PZAA 1MG3C 1NPJA 2AANA 4G71B 1KCWA 2J5WA 3RYMA 1NWOA 3CDZB 1BXAA 3QJRB 2YAFA 1IBZA 2MTAA 3N55A 4YSUA 1FWXA 3X1GA 5I5MA 1NICA 2YXWA 3FQ2A 1PAZA 4G7RB 1KCBA 4GY4A 3FU7A 2VM3A 2XXGA 5E9NA 3T6XA 1E30A 3NP4A 1F56A 3TASA 1XB3A 4W9ZA 4HHWA 3UAAA 3FU8A 4GXFA 3OQRA 4BK5C 2ZONA 3HB3B 3C75A 5A7EA 1L9TA 3S3CB 5ANHA 4DP1X 2VSKB 1GR7A 3NJMA 2IDUA 1OV8A 2Q9OA 3HEIB 2Y1AA 1FFTB 2QPEB 1W6WA 2FQEA 4A2GA 2XX0A 4HZ1A 1GS8A 1SFDA 2PP8A 3NJIA 2UXVA 3FU9A 3AG3B 3NJJA 1JVLA 2PLTA 1AS6A 2VMJA 3OMNB 4DP9X 3ERXA 4RH4A 2GIMA 3FSVA 3S8GB 5I26A 2NRDA 1SDDB 2BP0B 2FT7A 2FQFA 4UF7C 3T6WA 3EH4B 1NIFA 2AZAA 3DIVA 4A2HA 2JFCA 2EIMB 3FS9A 1A8ZA 4KNUA 4HCGA 3ZDWA 1PLAA 1A65A 2YAOA 1AR1B 3QJUB 1JZFA 4ENZA 4UAHA 1ASPA 3UADA 4EF3A 4KO7A
chains in the Genus database with same CATH superfamily
1G7QB 3IK2A 4E41B 2E5EA 4TUKL 3OMIB 5D7IF 1ZLUK 1R0AH 2EH8H 5HYJE 4Y4KB 4NIKB 4CVZA 2W95A 1NAMB 4MYPA 4PJDE 3MACL 2WMPB 5D1QB 4G9FA 5GSVB 3HS9A 2AJSL 4RSVA 1FNAA 4U1MB 5I66A 2FWSA 1A4CA 2VT0A 1WZLA 4PW3A 2GSGA 3KPRE 3QCUH 4F24A 4BSVB 2H6OA 3HOGA 5K5YA 3T65B 5INDB 1MRCL 1CN4A 1VACA 2OTPA 4XX1E 2E7LA 4OAWB 4FEMA 1ZT4B 1T83C 5E08L 2NY2D 5TE7L 4NNPH 3NP3A 5EEWA 4N6QA 1DVTA 4IRZH 4RMQA 3NT0A 1NA8A 4U1LB 1CG9B 4LSRH 2CLVA 5IVZB 1JJUA 1V3LA 4EDXB 1LMKA 2KL6A 3ZRFC 1BAGA 1BPLB 1RV6X 3X1EA 4LP5A 1TFPA 4LL1A 5IR1B 5C92A 4HG4J 4WO4D 3WY2A 4NZRH 4BUHA 5CJOL 3E38A 5KZCD 4O2CA 5J1AB 4XNYL 3V52L 5B3SB 4JFDE 3IYLW 3NJGA 2D7PA 1QW8A 4YN3A 4JRXA 3T4YA 2D3VA 1SMAA 2WTPA 2VIRA 4JZOB 1BIIB 1BBDH 1IGJA 4BSWB 4HGKC 2AK4D 4D0DB 3GJFH 4GQ9H 5CM1A 2OMVB 2VRKA 4NQDA 3EJQA 2C5DC 2P45B 2HJKB 5TF0A 2H7WA 2J1XA 4EEEA 1NIBA 1L9MA 3ME0A 4XGZA 2Z34A 3G6JB 2OJEB 1WBYA 4QT5A 5ACMA 2D3NA 3B7UX 4FXKA 3EFFA 4EQ3A 3VXMB 3KPOB 4LCVA 3WS6C 4JDEB 4XNQB 1OAXH 2X2IA 1NMAL 3L9EA 2QSQA 3MV7A 3HNTL 2VLLA 5B8CA 3MLYL 5DC4B 1AGDB 3TESA 1VENA 3RUGB 2B0SH 1AP2A 2HFGH 5EORH 3WMQA 1UA7A 3HC3L 1HE8A 2R9HD 3WFHA 3FO2A 1PQZA 1A64A 2KKQA 4EN2A 1CI3M 5DCCA 5DRXA 5FUCC 2KDGA 4W68A 1K2DB 1L7IL 3EFOB 3MRMB 2MPAH 3SDYL 4KK6C 3C87A 2OR9H 1OT4A 2OBGA 5B3JF 3IF1B 4DUXA 1NGYB 4LQ1A 4WKZB 5IHZB 4P2RB 4PGDB 2YD6A 4D9LL 1WDAA 3CU7A 1A8JH 1L0PA 4F9PA 1TQTA 1EEYB 4NQXA 1G7HA 1JK9A 1TNNA 3NIDE 1HDMA 3LMJH 4NX0A 4PJIE 3BUIA 4XO4A 1IKNA 1D9KA 4L4VA 4KWUA 1X4ZA 4NKMA 2B1HL 1DBKH 4P4KC 4X6DE 5INCA 4NAJA 3MLZL 4XP9H 5AZEL 4AJVA 3I9AA 3I3EA 2BSEA 1FZMA 5DFWH 4QHMA 4RDQG 5CLTA 2X6AA 2PYFA 5CNHA 4P5TA 4Z7NB 2P8PA 4F7PA 3QZMA 1QO3B 3FO1B 3UPRB 1ZY9A 1PLGH 2JQZA 4HCRL 1CDHA 5I5RA 1SJHB 4YSTA 3BP4A 3SE6A 4AH2B 4AGNA 2QPSA 4ETQB 4B41A 5IQMA 1I9IH 3FQTA 3U4BL 1HOCB 4B27A 1B90A 4JFPA 3GJFB 2FAUA 1QFWH 5FDWB 3JZYA 4YSDA 5KYXB 5T1LD 3KNBB 2FL5B 2VGLM 2X4NB 4X8XA 4U7SA 4EKXA 3KWWB 2E8ZA 1OTTD 1YEGL 4X5LA 5HHMD 3RAJL 1I9JH 3MBWA 2JVUA 1NFIB 4WY7L 5E4AA 4YDKH 1AGFB 3IMRA 1EZSA 4UYQA 3GSNB 4ZMWA 3RPIB 3GT6A 4KZ0A 5AAPA 1DJWA 4N0CC 3BAKA 4JPIA 1I7ZA 3EDKA 1FV1B 5I1AB 2LE9A 1UWEH 2FSEA 2MTPA 2H1LM 4Q89A 1VFUA 3N9GL 5CS7A 4YXLH 5ESQB 3L4VA 1JI1A 1M7UA 4HKBA 1BQHB 5F9DC 1IAIM 2WN2A 5D4HA 4JDVB 4P06A 2X4PA 4LP8A 2EEXA 2HLFC 1T0MB 2GTZA 1FG9C 4WO4A 5D2NC 1V10A 2C7FA 3P4MB 5M7QA 4UU9A 1FRGL 4F8NA 1G94A 2BP8A 2MCPH 3OV6A 4HJUA 3CH8A 1OGAB 1V3MA 4E41D 2AK4A 2BCKB 1ET5A 2P3YA 3AITA 4PJCE 4Y4KD 3ZT5A 1FGNH 4FQ2L 5D1QD 5I8EA 5D1XB 1T2XA 1RZJH 2GPZA 1AY1H 2VDQH 1WFJA 1NAKL 1P0SE 4KAQL 2C1PB 4OF6A 2WV3A 2PR4L 1DVXA 4GKLA 4UT6H 5EBMB 4P5KB 2N1KA 4X83A 1WICA 5DRWB 5E8PA 3VDAA 2VZUA 3US0A 4PBXA 2ARWA 3UTPE 2AQSA 3RB5A 4FX5A 2PPFA 2GSIB 2PYEE 4OBRA 1LWRA 3DIFA 1FVDB 2WLJA 4ZNEA 2BRRL 3SE9H 1N18A 1TTRA 3QO1B 3X1NA 1GW0A 3HRPA 5FUCE 1TLMA 2NUTB 1A7QH 4JRWA 3CN2A 1G5AA 2GI0A 3BVDB 3GI8L 4M3JA 2VSCA 3EO9H 4JY5H 1B4JL 2H2PD 2UY6A 1A47A 3GRBA 4MZ3A 1N67A 5ITFA 3AAZB 3UZVA 4KTYA 5DO8A 1E50A 4DF9A 1N3NB 4DP0X 3VW3H 4NLHA 2E3VA 3K2UL 2XZZA 3CN1A 1OWWA 2VCOA 1E4JA 3LIZA 2WXRA 4FABL 5FYLE 2NSMA 4ESKA 2BC4B 2FX8H 4HEMA 1IGMH 4Q0XL 3PNWB 3BKYL 5EZIH 2IF7A 3C8HA 3DIDA 4E9WA 5LQBH 3RWCA 4P23B 3IDUA 5I30H 2AQ2A 3KLAA 5FHAH 2AS5M 3ESVF 4GT0A 4ODXA 3DX9A 2JKRM 3VXMD 3ZL4H 5BVJB 5TJWK 3RJDA 4POZC 1RUQH 2JKWA 4Z7AA 3EYQC 1KN4H 1U3NA 3LN5B 3ZZLA 2ORBL 2KZKA 2WAHA 4ZX6A 5KVEE 1JZ4A 1HJBC 1UB5A 2V9TA 3G5ZB 2R2EA 4ZK8A 1CFVL 1G9EA 3LB6C 4F9LA 5F9JA 3ELQA 2KT6A 3X3FL 1PNCA 3WKYA 1BF8A 2IDSA 1P5UA 3D8MA 4BH7B 2FX9H 4JQVA 5T1LA 1YDPB 4JFWA 4YDIL 5MERB 3TO4C 4L1HA 4J3TA 5E6UB 5ESVB 3QYNA 2VDQB 3PV6A 1CU4H 5TQ0H 1T5XB 4P2RD 3K5SA 2MCG1 3NIDF 3UXFA 5CP7A 3B34A 4F92B 1IO4C 5DUBA 1WBXA 4PJIF 2W5PA 5KVGE 2E7BA 5HGBB 4ZFOA 2AV1B 4HK0B 1I8MA 3FPYA 2BZ7A 4X6DF 2ALWA 1IBBA 2EDRA 2CIIA 2EECA 1UWGL 2A9NH 3M07A 1TNMA 1S5IL 3FRPB 5FGBA 5D2NE 2AAAA 4X5XA 2BO0A 5FKPA 3RDTC 1CR9L 4UUJA 5EUOA 2WKOA 4HQQH 2WYTA 3K5RA 4HKJA 2VM4A 1F86A 3AM8A 3UJIH 1LL1A 1TJHH 5E99H 1G7QA 1T7ZA 1I8KB 5I6MA 4ZUTB 1E5UI 1UACH 2EACA 4H26A 2BVPB 2V9RA 2IGTA 4C58B 4IKLA 1NAMA 4XCCL 2WMPA 5D1QA 2XN2A 1PDKB 5DWPA 2B7DT 4YZFF 4IBYA 5GSVA 1SGKA 3EYOB 3QG7H 5EFIA 4ZS7L 4U1MA 1DFXA 5FPIA 4H7VA 2JTYA 3GBDA 3T3PE 4X80H 5I0ZA 4BSVA 3QUMH 4Y2OB 1U8IB 4XWGH 3T65A 4JM0A 7FABH 3DUSA 5CGMA 5INDA 1FORH 3PGDB 4XVUD 1EGJH 5TGBB 3DX3A 5SWQB 3V0IA 1ZT4A 3UZQB 3B9VA 1JXFA 1KCVL 4ATWA 2CR0A 1BZ8A 5KW9L 2VR5A 5T3ZD 1IB5A 2YGNA 3GS7A 1TFHA 3BP5B 4IBQA 3BAEL 4UMGA 1CG9A 5DJXB 4E5XB 4DT2A 4EDXA 2PNDA 2J5WA 4H5SB 2VDPL 3IJSB 4IK7A 3HKFA 5IR1A 4KZEH 3N55A 4MAYC 1ZD6A 2Z35B 1FNGB 4NJ9L 3S96B 3K6FA 5JXEC 2FCBA 2VDMH 1YY9D 3MFGB 4GSDH 5J1AA 3SPCA 3BXNB 4FQLL 4DESA 5J57B 5A2CA 4M6OL 2WO4A 2XVLA 3DBXB 4JZOA 1WT5C 4W9ZA 1BIIA 1OGAD 4BSWA 3ATEA 4D0DA 3OQRA 4HIIB 3BUTA 2OMVA 2J6EA 1NCCH 3IMTA 2AERT 3C75A 3N3EA 5E2JA 5ANHA 4G83A 5GXBB 3FN9A 4CRPA 5D1XD 1NUDA 1S3KL 4Z76B 1RUML 3G6JA 2B2XH 2OJEA 4YGVB 3FQNB 4ODWB 3OR7B 1SFDA 3KPOA 3MU3A 4KH9A 4JDEA 5F7YC 4XNQA 5C2BH 1D7FA 1NOAA 2G2PA 1B0IA 4V11A 2J43A 4X9GA 3TV8A 4AVKA 1AGDA 1JPFB 2X4QB 3RUGA 2KYIA 2YSSB 4JX0A 4RH4A 5C7XH 5FFLA 5LJYH 3FOLA 1SM3H 2JE8A 4LT7A 4PUBH 3TZVC 5I6XC 1SDDB 3ECBB 1X5AA 3N0AA 4YHPB 2BVYA 4XPGH 3WUWG 2WD0A 3GSWB 1DQVA 2MFNA 4WTWA 4BKLB 4MJIE 1K2DA 3MHZA 3EFOA 3MRMA 4U0RC 1A65A 1RULL 3FO9B 4PJ7B 3ZRSA 1ASPA 1NGYA 4WKZA 4JO3L 5IHZA 1J8HE 4HAGA 4P2RA 4JANB 5E8EB 4PGDA 2P4AB 3EYSL 2C9RA 3D07A 4TQPA 4DGIL 5MENE 3IJEB 5KN5B 3WTTA 2WLYA 1BIHA 3ESMA 3ZYIA 1N6QH 1CT8B 4N20A 3WKQA 1WYJA 4OGXL 2K0RA 3IS0X 4GIPD 1CVSC 1RXLA 1IKOP 5D4JA 3WELA 1JZ2A 3ABKB 1J8RA 3MBXH 4RGMC 2VABB 4IRZA 3ZTDC 1OSYA 1UTDA 4P23D 4Y4FA 1QP1A 2WN3A 5ALCL 3GHBH 5FIEA 2VDLB 4PLJC 5GGVH 3ZO0A 3B2UD 3OAUH 5I1CH 2AVFA 2HFFA 2ZUXA 3V0FA 1BVLB 1QO3A 4WFEE 2E7MA 2VDMB 3UPRA 1PCSA 4OGZA 4BD4A 1SJHA 5GS0L 3RWHB 2PXYB 4AH2A 3D4ZA 2TAAA 5JIDA 4ETQA 4R7LA 3VFRB 3SD2A 2GB2A 3VMOA 1NBVH 1J7VR 1HOCA 4OGQC 2AMGA 2J5LC 2XCMC 1NH6A 4TVPH 3MODL 5FDWA 2O93L 3QQ9D 3D09A 3KNBA 3MJWA 3OWRA 4PJHB 2ZJSL 4L1LA 4I9XA 1Z3GH 2X4NA 4YVUA 3HR5B 2R29H 3KWWA 1KWKA 2ESVE 4N1EA 1NFIA 1AGFA 2J88H 2W88A 2W9DH 3ECWA 4L9DA 3WSQL 2P26A 3GSNA 1A7RL 4PJ8C 4U6VH 5HDOA 3RPIA 5CSZB 4J28A 3QB7C 3QWOB 1INDH 2GEQA 4UT9H 1FV1A 3CVHH 5I1AA 2P5WB 1Z9LA 2GJ6A 5ESQA 2Z91B 4XBGB 1BQHA 1FNHA 3QEGL 5JA9A 1FVEB 4UTBL 1N8ZB 5HDBE 1T0MA 5GHWH 3B5HA 4ZPTB 2ED6A 3P4MA 5A3IC 1KPRB 5AW0B 4XAKD 4AIEA 1Y6NR 1F3RB 1OGAA 2J55A 2XKUA 3TEZA 1BDYA 2BCKA 4GJTB 4N9OB 4Q2ZA 1K6QH 4E9YA 3WIHL 4RMBA 2X10A 4W9GC 4KROC 1ZIBA 3O2VL 2XWDA 4Q6IA 5DC0A 3TWCH 4F58L 5KBDA 1A21A 4O58L 5D1XA 3T3PF 1XGYL 4AV4A 2I24N 3B7RL 2ZWLT 4WW2C 2HMIC 3GS0A 2FWLB 4WNSA 3POHA 1YRKA 3W9DB 3UGEA 3PDOB 3PAVA 5IESH 2DQGL 5HI5C 3QIUC 1D6VH 5C6TH 3FFOA 4TRPH 3HZMB 3CZKA 4P5KA 1JZHA 5DRWA 5TF1H 1L7TL 2WBKA 1X44A 2GSIA 3FN0L 2I69A 3A22A 1KB5L 2GQHA 2CR3A 2Y5TB 2XQYK 1ZDSA 1FVDA 3P30L 3QAZC 2F53B 1I7TB 1GGUA 3WE1A 2RA1A 2BZDA 1NLDL 3QRGH 2NUTA 1AR1C 4BQCA 1EEZB 1XVSA 5DTFB 1QFHA 4BRJA 1EMTL 4XBPB 3TYGH 4NCC2 5J13C 4TQIA 4ICWA 4QRFA 3AAZA 1N3NA 4BCYA 1CBVH 1AAJA 1D5BB 1JHKH 4DAGL 3SJVE 4FFWD 2XV6B 4BFIB 3A0OA 5HHVL 3CFCH 4FKKA 1HK6A 3DOIA 1IILE 4F93B 2PWGA 3LZFL 4PLOB 1MIEL 1ADQH 2BC4A 2EKSB 3WY1A 4E68A 3M7FB 4PS7A 3CVHB 3IGKA 3LPPA 3KL3A 3WEAA 1ORQA 1BBJB 4ODHL 3DKHA 2XN9B 5BVJA 3H55A 3I84A 2HWZH 4W9CC 1MY5A 2NY6C 3N1GC 1DYZA 1QHQA 4FTVE 4R8WL 3IXAB 3IMSA 2EINB 3LN5A 2VM9A 1MCNA 1II4E 2QEJA 3O2WH 1BEYL 5C08E 1SXAA 4DP2X 4OFDA 1CD9B 2HT3D 2PTVA 3KJ4B 3T08A 3SPJA 2ERJC 3H6AA 4N25A 1WZ1H 2VLJE 1EZUA 3QPQD 1YEFH 4Q4IA 3H85A 5IF0B 1Z3RA 1GPOH 1Q0EA 1TTCA 1YDPA 1JTTA 3SE8H 1T4WA 4MXWL 4WVRA 4AENA 5MERA 3GXIA 5ESVA 1OHZA 1XZ0B 1T5XA 2BLFA 3GMOB 4QTIH 1AZUA 3DHMA 2K4WA 1CTOA 2EE2A 1QBLL 1XXFC 4U3HA 1DBMH 1OGSA 3VU1A 3QXWA 1S7SB 5HGBA 2TSBA 2AV1A 2HUEA 2OMXB 3B2PA 1FL3B 4KUZH 4GMSH 4UT6A 4HK0A 4K8RL 4M6MH 3FQ1A 4G42B 1C5DA 4LEOA 1OB0A 1RUKL 2KI6A 3I85A 4LVHC 3V5DB 1IVTA 3SYOA 3FRPA 4ZX5A 5LG1A 2ZUSA 3DBSA 4OLYL 1GC1H 2EIKB 4QHLB 2F1BA 5GS1C 3S36H 3NCYS 4NPYB 2W1NA 1N0LB 5FF6A 4J7RA 3HC2A 2ZKHL 3IJHB 2ZXWB 4EIBA 1BZ9B 1I8KA 1AACA 2YXMA 4ZUTA 5E56A 2V9UA 2BVPA 4MXQD 5J06A 3I6GB 4ABUA 2PXYD 3EJYD 4PWKA 5HI4C 1PDKA 3PABB 4Q14A 3EYOA 3KGTA 1JNNH 3HIZA 3D2UB 1GS6X 5I1IH 2LLNA 1JERA 1Y0LB 1LO0L 2AJVL 1U8IA 2OXGB 4Y2OA 5EEXA 2LU7A 2UZIL 2D3LA 5L0QC 2X05A 4GAGL 1MDTA 1IL1B 2ZOUA 3PGDA 4BCZA 2UXGA 5SWQA 2YR3A 3O45B 3UZQA 1CLZH 2C3VB 3GEWB 4X5QA 3LKRB 1SDYA 3ZTJG 1PMYA 4ZO9A 1SHXA 3PUCA 3ISYA 3IPEA 3MRQB 4LKCB 1F4WL 3Q01A 3FH8A 3ZMEA 2P5WD 3BP5A 5DJXA 3SE3A 4E5XA 4Z7OE 5HDBF 5JIIA 4PW9A 3B2MA 3FB7B 5J9PB 4H5SA 3TBYB 3IJSA 2JKXA 3BWUF 1KTJA 5EH1A 3F7VB 3LPGA 4BZ2A 4DTGL 2Z35A 3NJNA 4LCIH 1FNGA 2A2QT 4A6YL 3S96A 5L9DL 3CHPA 4P5SA 4TNGA 3W11D 5F0PB 2PO6B 3BXNA 1JNJA 4RX4A 1Y1DA 1DZ0A 1OCZB 4KUCD 1KPVA 1RH8A 3B7TA 3VFVB 5GZOC 3FTUA 1INQB 2NY5C 3DBXA 4ADIA 2BSCA 2HX7A 4H44C 1HN1A 4P9HC 4HIIA 4HIEB 5I1KH 1PX8A 1W72H 4YBLB 5IB3B 2XXFA 2JKNA 5LCVL 1M05B 4MZ2A 3H53A 4CL7A 3ARBC 2DIJA 2NXYB 4K3JH 3VI4E 1UD5A 4Z76A 4DVBB 1TJXA 2DLHA 4YGVA 1KC5L 4AOFA 5T5FA 4KK8C 1B6DA 1ID2A 4ODWA 3OR7A 4OJAA 1AGCB 3PF2A 4K71B 1F00I 3WEMA 2MJWA 3GBNH 3GSVA 3L16A 1CK0H 1QZ1A 3TGXA 3ULSB 2AXWA 1Q0YL 3PGFL 5I8KL 1JPFA 3EKCA 4YHLH 1PG7H 3S34L 1XZWA 2YSSA 3ESPA 1BXVA 3ATFA 1TZGL 2YPLB 3I9PA 3ECBA 2F53D 2ZWKA 4UOW1 4YHPA 3K71A 2NLJB 1RU9L 2XVBA 4IDLA 2DMGA 4AQ1B 1H6EA 3GSWA 1NCAL 3HUJE 3D30A 4BKLA 4KKAC 4CSZA 3JYBA 3O4LB 2EEAA 4M6NL 4PHXA 5E9DE 4FNPA 3RY4A 3FO9A 2W65B 2DIAA 4N2NA 4PJ7A 8CGTA 5GJSH 3Q2LA 3ZL2A 1M9SA 4ONGL 1RFDH 4JANA 4TVPD 5E8EA 4N3UA 1OD7A 3IJEA 4R0LC 5KN5A 3LKQB 1A9EB 1I8UA 1CT8A 3F00A 4APQC 1HL8A 4Z3TA 4LESA 3UERA 1UB6A 5L7XL 4Y2DB 3RVXC 5T1JA 3L5HA 2VABA 2FLRT 5C0RL 2H45A 1NDMB 2BJMH 1A7NH 3NAAH 2CKBL 4A39A 1RZ8B 2XN9D 4RFOL 2QKIA 5AW2B 4CC1A 5IKCB 4L8SB 3S35H 4AMWA 4YSPA 5CWSB 3B9KC 4MA8H 2F54E 2A5UA 1BVLA 1WTLA 4PV1C 4KNQA 1IGCH 2DQCH 5A2FA 1A1OB 1U33A 1ZVHA 4OZGB 2IMMA 4ABVA 3HBGA 5D93B 3RWHA 2PXYA 5EWIL 5KYUB 2UUDK 5D2LA 3VFRA 1FLRL 2OMZB 1OP3H 3L81A 5AQ0A 5LG6A 2OSXA 2R1WA 5DHEA 1TJIL 3EOBA 2ZKXA 1TTBA 3IDYB 4YEEA 1ECZA 4PJHA 4YHYB 5FECB 1ZEAL 3WFEH 1G6RA 1UT2A 1N7ML 1JN6B 4NQEB 1T04B 3ASWA 1I3RB 3WFCL 3L3DB 1IFHL 2WGNB 2AHIA 4ZUWB 3APNA 3VA6A 4CW1B 5KSBB 2CMRL 5CSZA 4UT7L 1T21B 3QWOA 1X5FA 4JRLA 3ZLQC 2P5WA 1S46A 2Q9OA 2B1OA 2FD6L 3IS1X 4PJFF 2E7LC 4W9DC 2NSQA 4XBGA 1T20B 3FKUS 1FVEA 5DT1H 2AI0H 1N8ZA 1SY6A 3P9LA 3R18A 3QYMA 3IMWA 5IJCC 2GIYA 4ZPTA 1B4RA 4JO2H 2IGFL 1FBIL 3T8MA 1KPRA 4RFEB 1Z5YD 4MA7L 4OZIE 4NHCH 3CFJB 2BVQB 5J11C 2Q10A 1MFAH 2FQFA 3Q5TA 4M8QB 2AZAA 2DN7A 4WW2F 5C8JB 2XN1A 3Q1SH 2WSKA 2BVOA 5SX5K 4HCGA 3KGSA 3EOAB 3CFEB 2AGJH 3EDJA 3D2UD 3GUFA 2DI9A 1YNKL 2QV2A 4K5MA 3T09A 4H1LG 3W9DA 3PDOA 2J6WA 2Q86B 2HG5B 5HPOA 5DRNB 1UA6L 4DKFL 1KXQA 4JY6A 1QLRB 3B37A 2LTQB 1EBAA 5IFHH 2ZSWB 3HZMA 1SHWA 1S7UB 1CQYA 2Z31B 3P3YA 1GZHA 4XP1H 1MW2A 2XT1B 3O6MH 4FXKC 3VFMB 3VXRE 4J3OF 4M61B 1JGVL 2Y5TA 5AVWB 1TZHA 3E3QC 2VC2H 2F53A 3QFJE 1I7TA 3MCYA 4Q9CA 5B8CC 5I1DB 3FSAA 3GGWA 1G1OA 4F8QA 1HYSD 1XTMA 5ETUB 1AKJB 4WU5B 4OM1L 5JOPD 1EEZA 5DTFA 3TT3H 4JFFB 4A7VA 4XBPA 4GG8B 4C55A 4K94C 5K59F 4PYGA 3CFQA 2OA9A 3O9WB 5JZ7C 5IHWA 3L48A 3BWZA 2VO5A 1HHJB 4RETB 2PO6D 2HTLD 1N68A 1D5BA 1MHPL 1JNHB 4BFIA 2W07B 2PETA 3C09B 1FN4B 4DGVH 3VI4F 1U3JA 2ZIDA 2XWJB 4GXUN 3DMMA 3SY0B 2EYRB 2CHXA 2EKSA 3F05A 3LPWA 3KYOB 3ZZQA 2BVEA 3MOBL 4TL4A 2NXYD 4F9PC 5CEZH 1HH9B 3CVHA 1H3XA 2WLNA 4W4NA 3CLFH 5JQ6H 1BBJA 3L4ZA 2XN9A 3IDMB 5LUMA 1V7NH 3NGBB 5DURB 5CD3B 1MCKA 1MCEA 1D9KC 1U3ZA 1OP9A 3BH4A 3QUXB 4JMXA 4XPHH 4Z3FA 1WFTA 1QI3A 3OJMB 1E28B 2ZOOA 1ZSHA 2I5YL 5T3XL 2J1ZA 3OAYH 3PJSB 4S1DC 1Q9KB 1ESOA 5HHOB 3KPSE 1BMWA 1QTSA 3DRTB 1TLKA 1PZSA 5J5EA 5K9OB 3HUJF 2B1AL 4FNLH 3T77A 2YPLD 6TAAA 1A3LH 1ZV9A 4A7QA 2PMZA 1OWRM 4DQAA 4P5TC 1CF1A 2HKFH 1NEZB 1HEJC 5IF0A 4I5BB 3G9VA 3O4LD 4IDJL 4Y1TA 3KWXA 4F27A 1C8PA 4N2IA 3I75B 4G9FE 4YLQT 4I1PA 2QQLL 1XCTB 2H3XC 1XZ0A 3PXJA 1R5IA 4MJHA 2HLAB 4FTDA 4NWUH 1JHTB 3A4FA 3GMOA 2MKLC 2WWKT 3D51A 2YEZB 43C9B 2O6PA 1I9RL 1S7SA 4LCCB 4JQIL 2OMXA 1FL3A 3V6OA 1UOVA 4Z8FH 4CDGC 2BDNH 2EDYA 4EOWH 3ZYZA 2PN5A 1JRHI 2XU9A 2G2RB 4G42A 4H0HB 2XHNA 4A1RA 2VR7A 4Y2DD 2I85A 3QULB 2NY2C 3V5DA 2F8VA 5JORB 1TIUA 3DOSB 3H42H 2VC2B 3QZPA 4D7BA 3REWB 5EBGA 1M7XA 3PIQB 4RGOL 2F5BH 3DO4A 2X4OB 4QHLA 1KN2L 4XNDA 1MN4A 4NPYA 5DJ0B 1N0LA 3FH7A 4A66A 4FN0A 2EYSA 5HDQL 1BZ9A 2IO5A 1CGSH 2X4UB 1KELL 2XZQH 4PH8A 4WO4C 1IM9B 3I6GA 4TQEH 4CADA 1JVKA 4WHTA 4ATTA 5A43C 2EUWA 4JRXE 2FO1A 3D2UA 4GSQA 2D73A 3MREB 4JQXA 1T6WA 2FQDA 4M7LH 4J3VA 4WGKA 3RVWD 2R2CA 1O6VA 2HX9A 1GYCA 2OXGA 1Y0LA 2HKHL 3NRPA 3ATBA 1OAYL 1MF2L 5ESAA 5I6NA 3OKNB 2VWEC 3OKDB 1TQSA 4NQED 1FSKC 3IFNH 2PP7A 5CJXA 3SGKA 4S1RH 1IL1A 3SHSA 4CU8A 2GJJA 3O45A 1JVOA 1OXYA 2FTAA 2X0WA 3K1KC 2YK1L 1NCDH 3RA7H 2RGSA 3CFKB 5EULV 3JTSB 3LKRA 3QCVH 1LEGA 3MRBB 3MRQA 3E3QE 4LKCA 1ZHKB 3BD3A 2R8SL 1F42A 2C4XA 3ARFB 4BZ1H 1ZPLA 3MV7E 1LHZA 1A7OH 4KI5D 3FB7A 3N50A 1JDAA 5J9PA 3B9AA 3TBYA 4LMQI 3OTTA 1CXKA 4LZKA 4AYMC 4YSQA 2VZ1A 3GXTA 3F7VA 3N42F 3U0WL 3KLKA 5EOQL 4OZIF 4LQFH 3EYUH 2PO6A 3NFNB 2XZAH 4Y7MA 4M43L 4X8GA 2WXQA 3VFVA 4Z3HA 4IYKA 3NYKA 5DK2B 5I1EL 1CL7L 2ZF9A 5D6CB 1INQA 5F9WB 4NZFA 1MJUH 2TRYA 4KC3B 1BA9A 4HIEA 4JFHE 3MJ9H 1IC7H 1MELA 1Z9MA 5C9KA 1A6TB 4XCEB 1M05A 5B7MA 3CX5K 1N4XH 4DVBA 3ALPA 1MCOL 2WQUA 1FGVL 4LCUB 2WZ0A 1N70A 1AGCA 2FT6A 4G7VL 1TQUA 1KPUB 4L4VE 3KPMB 3ZJAA 4K3DL 1UM5H 3ULSA 1ETB1 2YAMA 2DJ4A 4BE6A 5F3BB 4U3XA 2YGOA 3MXVH 5GGTH 2J8HA 6FABL 3V4PA 1XFPA 4M7JL 2Z31D 4EZLA 4HPYH 4LASL 1QEXA 4KRNA 3GJEB 2YPLA 2FT8A 2ZCLH 4DKAA 4U1NB 2YD1A 3QNZB 2NLJA 4KQ4H 4AQ1A 2V6HA 1U8QB 2CPUA 3MLTB 3RY5A 1AKJD 3KW7A 5F3HA 2H32H 3O4LA 5TH2B 3BVUA 4JFFD 4Z0XB 3ZHNA 2G4GA 2W65A 4ALAH 2Y23A 1A6AB 1UCBL 4XOBA 4UOZA 3WOVA 4F9LC 3O9WD 3GDBA 2A73B 1P5UC 5AW9B 4F2EA 4DKEH 1TR7A 2VDNH 1MRDL 4JQVC 4NWTL 4HOZA 3VGGA 2R27A 5DJYB 1ZXKA 4QNPE 1A9EA 4I88A 1O5DT 1SXCA 1OTTC 3IFPB 3L3IA 2C3HA 4OJCA 4Y2DA 4PR5B 3RWEB 1MCLA 1VGEL 2DQEL 2EH7H 4PG9A 3R8BB 2WWOA 3WEOA 1NDMA 5E2TH 1D3CA 2DQUH 2OL3L 3IJYA 3QNYB 3L3HA 2P8MB 4X7SH 1M1XB 3SQOL 4DH2A 4UANA 1J0IA 4ENED 4HGWB 2O5XH 5DURD 3QZLA 3QUXD 5F89A 1F3DJ 2HX8A 5CWSA 4XO5A 1NFKA 1HC1A 3V95A 5FGBC 4JFOA 4ODSH 5KBKA 1A1OA 4R4FH 4AG4H 4XO8A 5TE4L 5HHOD 2OXHB 5KOMC 3MC0A 3T0EC 5KYUA 3UX9B 5EMYA 4G9DB 3ZUNC 2FX7L 1EDQA 5F72S 3AM8C 3MJGX 4FQJL 5DZPA 5F96L 1KB9J 3MUGB 3NSXA 3LNDA 1E5AA 1BM3L 1DN2A 2AK4E 1USZA 3FCUB 5AB1A 3SKJL 1Z9SB 1L9OA 1KTCA 3JV4B 1FO0B 2VWEE 5FECA 3OZ9H 4NQEA 1JN6A 3O6KH 1HINL 1T04A 3WO3B 4M7LT 5D1QC 5FEBA 3PXHA 1EBPA 1I3RA 3VD7A 3L3DA 2E47A 3CMGA 4TF4A 3FMGH 1AHMA 4S1QH 4OLXL 1GMIA 1JRHH 1MCWW 1NEPA 2GJZA 3NJVA 1RUAH 4ZUWA 4OZHB 4CW1A 5KSBA 1BAFH 3QVAA 5PAZA 2VSDA 3D34A 1T21A 4NFDA 4GKZB 4N8CL 3SQBB 4U05A 1WFUA 5K33A 5I0DA 1OQXA 1XCXA 3H0TB 4X7DC 1A4KB 2YRBA 3FQ4A 4W9IC 5EUKB 1T20A 2BZCA 2Y9RT 3IGAB 5SWSD 1P53A 5I1GL 3GXNA 4HFWB 3F64A 2IEPA 1ZGLM 4KHXH 3JSSA 1QFUH 1VRSA 2XWZA 1TF4A 3LQAC 2XJKA 3ARDA 4G8EB 5GRZA 4RFEA 1IEHA 3CFJA 3I9GH 5I5IA 2BVQA 1GSKA 4I9WD 2ADGB 2VL5B 2GTQA 3ARRA 2H2PC 2F7PA 3QISA 4DP5X 3T2LA 1IM9D 4XC3H 5C8JA 2ITDB 3ZTNL 4C56A 1F90H 4HIXL 3RGVB 1FNEB 1YEHH 2NY3B 3CFEA 3DARA 3EGSB 2NY5L 3EOAA 5H37H 1HXKA 1JGEB 4QI3A 2WNKA 4JL2A 3VE0B 4P9HL 4WGWB 1J0ZA 1HQ4B 4OVUA 2FJSA 2Q86A 2HG5A 1WZAA 3JTBA 3NIFF 1ZLVH 5DRNA 5CZVL 1QLRA 3DK0A 5IJBC 2DYSB 3TLRA 2ZSWA 1YNLL 1RPKA 1S7UA 3RWDB 1QNIA 4PCKA 4F15B 4I3RL 3CZUB 4I1NB 3LZLA 2YRLA 3VFMA 1HSAB 4M61A 1JPGB 3ARFD 1H3GA 4FXTA 1QWUA 2Y7SA 3CVDA 4PSRA 5I1DA 3QPXL 1J1OL 4RAVB 4UTAL 3EG9A 5ETUA 1ED3B 3UZEA 4WU5A 2ZAIA 5JIKA 4E42A 5CKGA 2F68X 4JFFA 1IQDB 4GG8A 2AK1H 4OLWH 2A77H 5ALBL 1B88A 3O9WA 4LK4A 3PQYB 1HHJA 1KTBA 3LNHA 3UDWA 5DD5H 2EEBA 3WNOA 1E67A 4MVBD 3R7QA 3BUYB 1X5MA 2AANA 3BMWA 1JNHA 3RYMA 2W07A 1JXKA 4WK2B 1F18A 1FN4A 2YAFA 1M7IB 5KANI 2ZXGA 1IVLA 5HHME 2XWJA 3H54A 1FWXA 3SY0A 2EYRA 2FK9A 3HRZA 3T2NL 4PEEA 4BHUA 3KYOA 4GY4A 1LQBC 3VTAA 1F11B 1MFDL 1HH9A 4HW6A 1JGUH 2K78A 5EC1B 4GO6B 4FFZL 3BVXA 4OCRH 4WO0A 1BQHG 3QG6B 1P6AB 1FLTX 2OFQA 3B5GA 3DO3A 4FLOA 4WHYG 2WLLB 2IXQB 5CD3A 3QE5A 3QUXA 5CR8A 4IQHA 4OU3A 2AEPH 1N5YH 1E28A 3M45A 1OV8A 4IJTA 4NO0B 4Y4FC 2QPEB 3PJSA 5HHOA 1Q9KA 1W8NA 3QSKB 5EUOE 4ZMZA 3DRTA 1GS8A 2PP8A 3ATAA 4XNBA 1KEML 3ORJA 3E6HB 2CGZA 3LEYL 3GRGA 2LR4A 4AEIL 4E41E 1NEZA 2O5YH 4KJPD 4XNXH 1JPTL 3IJ8A 3OMNB 4YC2B 4L8BB 3AWFA 4I5BA 3AACA 1AMYA 3FXIC 4JS7A 4XN8A 1F58H 1C5BL 4FXLA 3I75A 4M8VA 1C1EH 2WXHA 1IBHA 5D1QE 1XCTA 3U9UB 3GQFA 1G1CA 2HLAA 1BFVL 4QNPF 2IOIA 1JHTA 2FT7A 1DJGA 4ONFH 3U82B 1HZHH 2YEZA 4MLSA 3TVMB 1T5WB 43C9A 2JB5H 3BKJH 2EIMB 1YPZB 4NYLB 5GGUB 1RIVL 3DX8B 4LCCA 5TDNB 3ES6B 3LY6A 4MCMA 1YQVL 5DMGD 1DR9A 2UWEF 2ZUYA 4XVUC 2APXA 4KO7A 5C07B 2G2RA 3UJJH 1LE9B 1H6TA 4O4YL 4JPKH 3QULA 3GJFK 3VGFA 1NGQH 3TEWA 3SQRA 3DOSA 4ZUVB 2DQJL 1CJYA 1SQ2N 3REWA 2QADB 4PREB 2X4OA 2AXFA 3MUHL 1ULVA 3S2AA 1JYWA 5DJ0A 2GC4C 5JYLA 1RZKC 2MQ3A 1SUJA 4OCNC 4OQ1A 3VXQB 2WZPD 4BFBD 3ULVE 1IM9A 2AP2A 2AJ3B 4U6HB 1YY9C 4XBEH 2I7SA 2IBGA 5EBWB 1CGVA 4KPHL 1OSEA 2XA8L 2XWBB 3IFOB 1EXGA 3ARTA 3MREA 4K3HA 3E6FA 3PV7A 3P40A 4URTB 1KSRA 1YY8B 4ORGB 3MKKA 3DSNA 2CIKB 3EOTH 4LRNH 4NERA 1BECA 3C6LB 3OKNA 4DN4L 5IM7A 3OKDA 4Y8AA 3GTTA 1DN0B 1CLOH 2X6MA 4Q6IC 5AW7B 2BFVH 3UCRA 3TV3L 1FAIH 3QH3B 4OR1A 2BNQB 3G6JE 1ZA6A 3WGVB 1W0YT 2F8OA 2XBTA 4Z7UB 4O02L 3CFKA 3HFMH 3JTSA 4KRPB 3VXME 3MRBA 3A6BL 4OH2A 3QARA 5I0WA 1ZHKA 4WEBH 3ARFA 3WXVH 1X5JA 2EILB 2NYYD 5AVUB 2Z0BA 3HE7B 3KJ6H 4ZX4A 3DJRA 3GLZA 5E4IA 3RUGE 4D0CB 2N0KA 1E3FA 3HHMA 5AW3B 1CMOA 2A9BA 2Z7WA 4QCIB 1PKQB 4A2FA 1HQRB 5F9OH 5LXGH 2H3NB 3N1QC 5EA0L 3NFNA 1T1WB 5EHFA 3VACA 4B9KC 5AW5B 2EDNA 5DK2A 5D6CA 5D70L 1E0OB 1WV7T 1E8WA 2OYMA 3NZHL 1T7XA 3N40F 4B9GA 4P2RE 2OMUB 5I1JL 1KLFB 1A6TA 4XCEA 3RGVD 2Y6TE 2NY3D 4AT6B 4FZ8L 3RTQB 3N5AA 4X50A 2YD7A 1AIZA 1GGIH 1GZPA 4FCAA 4LCUA 2ZX9A 4M9PA 2IWFA 5E24E 1JZ3A 3VU2A 1UUSA 3RIFK 4P05A 4P59L 1KPUA 1KEGH 3FRPG 3KPMA 4LRIA 5FYJD 3M1OA 4YE4H 5F3BA 4XMVA 5DS8B 1S7QB 5ID0B 5FAAA 4JREC 3MOQA 3WTYA 3PUUA 5K39B 1WEJH 2Z0UA 1CFMA 2EXSA 2GHZA 1NDGA 3GJEA 4JJHA 4JHAH 1NZRA 4ZS6C 4JN1L 4FA6A 4CJ1A 2MQCA 4U1NA 3B2UC 3QNZA 1FHNA 4HKXB 2H26B 4Z6AT 2JCCF 3KWVA 1CDJA 1U8QA 1ZJBA 4QDGA 3MLTA 3F6LA 4Q6KA 5DD0H 5J1TC 1J18A 5TH2A 2YJLA 2V33A 4Z0XA 1MY7A 1ZMYA 1A6AA 3VGBA 1E40A 4OT1L 2I60L 4R7DA 1XQ4A 3PQYD 2F7OA 5E70A 1DO5A 1ZWIB 4NKDB 3RURA 4ELMF 1AYOA 3QQ9C 1M3JA 1PD1A 1ZANL 4GRWF 4R5VA 1B6UA 5F6HJ 5DUPH 1YN7B 2N3JA 1K5WA 4JPVL 3FNKA 1WGOA 3IFPA 5FO8A 3ULUH 4TSBH 2XIDA 2NY1C 4UV7H 5D7IB 5HYFA 4B9JA 3GRWL 4PR5A 2G5RA 3RWEA 2YC1B 5T3ZE 2CWRA 1LTXA 1MCIA 1ZHLB 2VLKB 5AYUL 4URKA 4BZ1A 3ECUA 4JPWH 4E5XG 2V17H 4EZKA 3QNYA 2E6QA 1JPEA 2P8MA 3H9ZA 1M1XA 5E8NA 3BSHA 3EJZD 3LKOB 4HGWA 4U0QB 3TA3A 4G6JL 3GYRA 4LCWE 1MWOA 3U4EB 1VESA 1A0QL 4I13B 2VDRH 4QEGA 5E2WH 5EUOF 1N6UA 2WKOF 4PVNA 2WZPA 2O6DA 2NCMA 4NO0D 4ZOEA 3TJHD 3T8XB 4DEPC 2GBVA 3GZPA 2K7QA 4I2XB 3QO0B 1U8LB 1ML0A 4YHZL 1MFMA 2CAKA 1PJ9A 1OTUD 4ZFQA 4Q9RH 1QG3A 5F3FA 1EUTA 1LD9A 5D8JH 3WKNA 2Q0ZX 1AFVH 1OGAE 2BIIA 2X9WA 3JT2A 1DCLA 3K6IA 3MRKB 4OD3H 4BINA 1Z9SA 3JV4A 1NIDA 2HFEB 1FO0A 3JWNH 4XH2B 5FYKD 1LO4L 3ZKND 4LO9A 2Y6SD 5D1XE 4D3CH 5ID1B 1RCYA 3MCG1 4J2XA 3ARYA 2Y4SA 1WAEA 2CU9A 3I74A 3AMLA 2IPTH 4UCFA 4OZHA 3TVMD 1NCOA 4OJEH 2ITFA 1LEIB 2K4AA 4GKZA 3ZKSD 2HJLA 4GW5B 3SQBA 3LEVH 3H0TA 3VJ6B 1A4KA 2AFNA 5EUKA 2AW2A 3LX9A 5C07D 4Z7QB 1OAQH 1TCRB 2VZTA 9PCYA 4HFWA 2K6WA 3RILA 3CPUA 1NCNA 2G3MA 2YA2A 2WQRA 2HKAA 1FNFA 2QADD 4WCYH 3TCXA 3SOBL 3MLWL 2VUKA 4G8EA 2EABA 3X3GH 5DMIL 4ODUB 3SE3C 1KDJA 3O3BA 5FDYA 4BIKA 3ULVF 1YEKL 1T1XB 2ADGA 2VL5A 2F0CA 5TE6H 5JUEH 1Z5LB 2IDTA 1U42A 3ZKXC 3SKOB 4ZDHB 2ITDA 2VH5L 1R4XA 3RGVA 1FNEA 3EGSA 4F7MB 1KYDA 2WCGA 4KQ3H 4OLVL 1JGEA 3EW3B 4FFWC 3VE0A 2CHWA 1NTDA 1G7MB 4JKNA 4ZMPA 4QRTA 1HQ4A 1NM9A 1FFRA 3VYNA 4TL5A 3C6LD 3MVSA 5FHBL 3VFOB 4LFHG 5BV7H 3CLEL 1OAJA 1OGPA 4U1JB 4PBVC 5KVFL 3RWDA 1ZT1B 5EG6C 2BNQD 1TYJA 1AG0A 3MJ8B 1CGYA 3FTZA 4KK9D 3LIZL 2NT0A 1R5WB 4ZNCD 3PWUB 1PSKH 1T0OA 3KCWA 3LRSB 4KRPD 1HSAA 4CN1A 3NH7L 1JPGA 2VDRB 2K9UA 3RUGF 3BE1L 5TFSL 3HE7D 4RAVA 1N64L 1ED3A 1AVAA 4E9SA 1LXMA 3WNJA 4XN1A 2FH6A 2E9WA 1MVYA 2HT3C 1IQDA 1P7QB 4MD4B 4ZFZB 5DJ6B 5DHMC 4AIXA 3PQYA 3QPQC 4YH6A 1ET7A 1QR4A 4WENB 5IBUB 4MJ2A 3H1ZA 3BUYA 1BJ8A 4ZI8A 5HVHB 4OUOA 5IB1B 2J57A 1M7IA 3O4OC 4G6KL 4JFUA 2F19H 4ZTPL 3X2QB 3DYOA 3RTQD 4K7PY 4ZQTA 4QRPB 5EC1A 3VGAB 2BSDA 3QG6A 2Y22A 4YHOH 2DLIA 5ES4B 1Q72H 3E80A 1MAML 2WLLA 2IXQA 4G8AC 3DC0A 3M8OH 3NTCL 5CFAA 4AE0A 2PPAA 1GTFA 1LO2H 4PGJA 4WHDA 2R0WL 2EP6A 1IGIH 4ZFOL 3BUBA 2QKIC 25C8H 1CZ8L 4DJMA 4N0YH 5E2UH 4XAKE 4LPTA 4G5ZH 3NVQA 2Q8BH 2CA3A 3J27A 1IKFH 3E6HA 4JUSA 3FYEB 5CEYB 2WWMD 5DEZA 3LV3B 1QFWM 5DHVA 5EO0B 2AKRA 1FCCA 5L8KB 4L8BA 4MXQC 4MRBA 2Y5QA 2BPBA 5H37A 3AC0A 5IHUH 1QLEL 3OSKA 5KYWB 1WD8A 3TL5A 3U9UA 3Q5OA 3OD3A 3P2BA 2CQVA 1MJ7H 2WLKA 1RURH 4K3EL 4QPEA 3TVMA 2PCFB 1NAML 3NJLA 4FHKA 1YPZA 4H8WL 4NYLA 4R4BB 5GGUA 3S37L 5BV7B 3DX8A 3UPAA 5TDNA 4PU2A 3ES6A 3M7OA 4NGHL 4N2GA 3D05A 2L7QA 5C07A 4NN5B 2PW1A 1LE9A 2A1WH 3DO7B 3I50H 3P0YH 2VLKD 4WSKA 4ZUVA 1P7BA 4PREA 1OW0A 4FQHB 1SEQH 4OSUL 3FO0H 1RP8A 2DM7A 4MCYB 4HP5A 3P2TA 3Q8CA 1A6VH 3T0AA 1RZ7L 1AC0A 4MB1A 4HBCL 3D9AH 4UTCA 3VXQA 5DEJA 2BNRE 5SWZA 3LQAL 2Y1VA 4KV5E 4ZAKB 4CSPA 1YZZA 4NXSA 2AJ3A 4U6HA 1UM6L 3RL2B 1J5CA 3W11C 1GY1A 3BSZH 5EBWA 2XSKA 3IGLA 2XWTB 2DDQH 1SBSL 4OLEA 2XWBA 4E9TA 1DUYB 1U93B 3F58H 3BGMA 3WHE1 4MZIA 3S88H 4MQTB 1YEIH 1TTFA 1YY8A 2Y07H 3HG2A 4ORGA 3SKMB 5KJRL 2CIKA 3C6LA 1MFCL 1DN0A 1NGPL 3G6AB 1CWVA 3I6LD 4QRAA 2AEIT 2ITEA 2WBXA 3MR9B 2BNQA 3TNMA 4G82A 3TN0B 2MTAA 4M1CC 3M1BB 4Z7UA 1KBGH 3RVUD 1KBKA 4YSUA 5JMRA 3WNNA 5DJZB 1MJJB 1UA3A 2B4CC 4ZMOA 5C0EB 1UQSB 3ZRCC 5E9NA 4J23A 4ZG1A 5KBNC 2X1QA 2MQGA 4RRPA 3HE7A 2KQMA 1P4IH 4M1DL 4D0CA 2OMYB 1GZHC 1UXWA 2X2UA 1MVUB 1ZCRA 3S3CB 4QCIA 4YJZL 4X6EB 5CLZA 1HQRA 4O5LH 2C3GA 1MXGA 5DUMH 3ECVA 2H3NA 3OHXC 3UC0L 4YAQB 2ZX5A 2YMXH 3B3BA 3ARGB 5DFVD 3HEIB 1T1WA 2JJVA 5IQ7H 3WMSA 1PU0A 4JR9L 3FTXA 4JVUA 4F33A 2ID5A 4ZD3H 3RIFF 4KRMB 1KY6A 4AGQA 4PIBA 2DQTL 4PJ7E 5CJQH 3WS3B 4IBZA 1E4XI 3QJFB 5FW6A 2D8KA 2OMUA 1KLFA 2AF2A 3TH2T 3KAAA 4I89A 3MOAH 3K91A 4AT6A 5E5RB 3FSVA 3EJSA 3RTQA 3MV9B 2QQQA 2AQ1A 4UF7C 4R2GC 4ZPVA 5BVPH 3DMMC 2AJYH 4PV9B 1DBJL 2ZCHL 3TFBA 4DKDC 5DS8A 1S7QA 4JFZH 4EIZC 3MLRH 4FYTA 4PFEA 2VZ3A 5CCJA 2QQKL 1BP3B 4QJ4B 1PFOA 2ADFH 3UADA 4PPTA 2EE0A 1OP4A 5K39A 1CE6B 1PW3A 1I85C 1P6WA 3WO4B 3ABLB 1JF1B 3KLSA 1ETZB 4HKXA 3U9WA 2H26A 3LXAA 1NANI 2FUQA 5HHQA 3TH4T 4RLDA 3F7QA 4DGYH 4PJAA 3A23A 3KDMB 3LDBC 3A67L 4PJBB 1FDLH 4HGMA 4APXB 4BK5A 1P7QD 3KJ4C 4I0KA 2J8UB 4J1UB 3NA4A 2GI7A 2WP3T 4CSSA 1DFBL 2DRUA 1ZWIA 4NKDA 1U8OA 3SYCA 1TVHA 3DSFH 3TJPA 4PJHE 2LFGA 2HH0L 4LPCA 3FU5A 4QO1B 1YN7A 4HK3J 4FQ1H 4OI9A 4ZFGH 5C9JB 2OZ4H 3NJXA 3B7SA 1GAFL 1ACYH 5D7IA 2V3FA 3RNQB 1HHIB 4WI5A 2YC1A 3T0WA 3NFSL 4MQSB 2VLKA 1ZHLA 5EF3A 4QRPD 2WXGA 1U92B 3LKPB 1NIEA 5FW8A 7PAZA 3MQIA 1DJXA 2YEQA 5KEZA 2P5WE 3L5XL 1Q0XL 2GJRA 4LAQH 3GSNL 3KYAA 3U4EA 1DBBH 3FUMA 5T3ZL 3VG0L 1SOKA 2VLMD 4BELD 2JH2A 3T8XA 3HTLX 2PPEA 5BUAA 4WEUD 4I2XA 4NCC1 4CU6A 1U8LA 2EXYD 4CC4A 5AG8A 1OE1A 1RZKL 4OIAA 4RNRA 1L9NA 3CC1A 3D4CA 3VYOA 4DUWA 1VEMA 4K2UH 2ALAA 2V3EA 3MRKA 5I6PA 3L9RB 4PWGA 1NMBH 3V7MA 2HFEA 3KBHE 1J1XL 1XB6A 2D7TL 4XH2A 5DSCB 5C0ND 4AV0A 1N5AB 1DJHA 4G11A 2J8OA 4KO6A 5ID1A 2N0MA 2CM6A 2VXVH 3RLSA 1J88A 1QKZL 1U41A 1WUZA 3B2VL 4JQXC 5CLYA 2Z92B 4YQXL 5JHLH 4OZ4B 1LEIA 1KXQE 2DPKA 5TK2A 4N2MA 1HCVA 3KGUA 4GW5A 4NKOB 5GJTL 1TEYA 5CJXC 3SGKC 1T03L 3VJ6A 1DQMH 3LMJL 3LNFA 3E8UH 4IU3B 1TCRA 3GINA 4N24A 5EZOL 3A6CL 2C1OB 3HB3C 3WIFB 1D5IH 2F53E 4ZMQA 1N59B 1BVZA 1NOFA 3HPLB 4JFEB 2A0LC 4ODUA 4PWEA 2Y5EA 3TBBA 1CXLA 4QHUA 1HYSC 3B8SA 5GIRB 4KXZI 1RZQA 1KXVA 1T1XA 2AJZB 5F7BA 5IW6B 4ES9A 5EEZA 5F7MC 4ZAKD 3K2MC 2FJFB 4L8CB 3HMXA 4AYDC 1DE4B 4BCXA 4TVPE 4TTDD 4K07A 4LLAA 4NRXA 1HAWA 3TBWB 4DVRL 2HTLC 2PO6C 1CURA 2BIQA 1T0NB 1FFPB 3F6IA 2R0KH 4F7MA 4Q56A 3FZUD 2E8YA 4X6BB 5C1MB 2X4SB 1G7MA 2JJWA 3P77B 3NEXA 4XVTH 4Q9BA 4YBLC 1ZK5A 2VW4A 3VFOA 3SZKC 1XSKA 2CJ3A 3ESOA 1Y7VA 1EV2E 2NXYC 2APFA 2LT9A 5CSGA 4QJ5B 5E6YA 1T7VA 3GO1L 2KZWA 4PJGB 4HXBH 1IBGH 3TN0D 3MJ8A 5L88L 1NCIA 1Q9WB 1R5WA 2AEOA 1U36A 2XN9E 3PWUA 4NS0A 2Y72A 4TMPA 3S0PA 3V2AR 3L9YA 4MDIB 2CJUH 4U1GC 1S2EA 5ABZA 1YJDH 3QC5X 1YUKB 3MDJA 5FOBB 1RIUL 2KH2B 1GC1C 2WLIB 2X2JA 4JM4L 3CZLA 4LNRB 3B7YA 4LLUB 2V7HB 4MD4A 1EJOH 1H8OA 1P7QA 2YOCA 2DJUA 4XC1H 3IXTB 5DJ6A 5IQNA 4ZFZA 5AB2A 2E27L 3E9UA 1E4XH 2VJXA 2VTFA 4AQ1C 4XMPH 3ARGD 1CO1A 1FZOB 4HLEA 3JWDH 3H2PA 4PJ7F 4WAFA 2LLLA 1RIHL 3AQDA 1LLAA 4QXUL 5IB1A 1UH2A 3VFGL 3WJJA 2NUPB 3DJZA 3ZW3A 5FB8B 2WBWB 2SEBB 4OI8A 4JO4H 4U2ZA 1BJ1J 3LHPH 1TETH 2JNZA 4O9HH 5I1HH 1WA0X 4AXWB 5F1NA 4QRPA 3MV9D 1BF5A 5LBSA 2DMCA 2XACC 1KIPB 4B9PA 3KW8A 2RHEA 2VW6A 2NYZA 3V6OE 4NM4L 3DUHA 3CWGA 4NNXB 4RISL 4P3CL 4Y2DC 5IROD 3L9BA 1CS6A 3C60B 4QWWC 3RRQA 1NANH 1RZGB 3WJMB 3N43F 1O9ZA 2GJPA 2KQNA 4X4ZA 3R1GL 2GVYA 4LSSL 3L5WA 3FOMA 1NCWH 2XNAB 2I27N 3B83A 1O75A 4M5SA 4M93B 1J9TA 1JZDC 2BNUB 3GLAA 4UILL 5CEYA 5EO0A 3LV3A 2GITB 1UKTA 2MHAB 5AOMA 2VRAA 4RMSA 1WBZA 5D93C 3IN2A 5KYWA 4HWNA 1AI1L 1I9EA 4PJHF 3M46A 1T22B 2RQ8A 3QWRD 4DZ8B 3IDYC 3KPLB 5BRQA 2PCFA 3NOIA 1OM3H 4R4BA 5B1JA 4YHYC 5IEKB 1ILSA 2JI3A 1A02N 2JLPA 4Z9KB 4YXHH 5EN2B 2C9QA 3QFDA 5GGQH 2XBZA 3RU8H 3DO7A 2IWEA 4KY1H 4DO4A 4UNTA 4W4OC 3WE6A 2XRAL 4M5ZH 3KPRA 1NLBH 4FQHA 3T3PB 3VSUA 1FIGH 3BQVA 3MRPB 4Z0BH 3QXTA 3Q0HA 2ZOLA 3Q2WA 4NC0B 2B9AA 4U49A 5JOPE 3OAZH 4GKNB 4R97C 1NINA 4ZTOH 1KYUA 3GI9L 3C2AL 1UFUA 4ZAKA 1E3ZA 2VLRB 4KUCF 4PP1D 5HSFA 2VDOH 3RL2A 3ARDC 5I18H 2XWTA 4K23L 3ZIYA 4RWYL 1DUYA 1U93A 5F0LB 4BZ2L 1CLCA 3TBVB 3FB5B 3L3KB 2FEDD 1USQA 1PS3A 3SKMA 1C08B 4TNVK 4Y1AB 5KSUB 4N87A 3H3PL 4OM0L 4Y9GA 3G6AA 5DZJA 5IGXH 1G7LB 1CFSB 4PRIB 12E8L 2FEEL 2ICEA 1F6LL 3BVVA 3MR9A 4JKPH 2K3TA 4XP6L 3TN0A 5DDHA 3M1BA 1HYRC 1NFDB 2G4EA 3ZMRA 5DJZA 1MJJA 4HWBA 1LVEA 5C0EA 1FL5B 4AK1A 4K15A 2NNRA 3LXCA 4NP4L 3QCTH 3FTSA 5T5FL 4ELKB 5EF2A 3HBPA 3UJTL 2JKSA 2VXSH 4KXZH 1MVUA 4X6EA 2FO8A 4PTUB 2YPLE 3NIGB 4GH7B 1NEZG 2X4RB 1OY3B 2ICCA 4LSPL 4YAQA 4JFED 3ARGA 4AQ8A 2BOBB 5DU7A 2V37A 4X4XB 3UZEC 5JW3H 5DA4A 2NDFA 2GTWB 3MLXL 1X5LA 3II3A 4P0DA 4F7CB 3FU3A 2VUOA 4EJ1C 4XVJH 3WS3A 3H6JA 3O9WC 3QJFA 3GHPA 3TJEH 5J8OA 1QOKA 1Y6MR 2ZUTA 2VZOA 3UDWC 1I8IB 2P9RA 4PJ9B 4FOMA 1RMFL 2BH0A 3OKKB 3UBXB 4F57H 3C09C 1OP3K 1OE2A 1SXSA 3RY6A 4CMHC 1AZCA 4NQSA 3ZX1A 2VNCA 5A2JH 1QI5A 3HRZC 2K8MA 4PV9A 5IROA 3BT2H 4ANXA 3E9TA 3D33A 1XGQA 1J8HB 1FPTH 2HB0A 3B5TA 4XMLL 1J1PL 3FUKA 3OGCB 3OKEB 1ZTXH 3NJHA 1MEXH 4ENEC 1CE6A 5A2IH 3NGBC 2GY7B 3MV01 1I53A 4MWFB 1X5IA 3QUXC 1ETZA 1PY0A 1FE8H 2VDOB 4Q74A 2XC8A 4KVNH 4OZGE 1INEH 3WI9A 1TQCC 3VXTB 4APXA 2VDLL 2J8UA 4J5VA 3QK0A 4J1UA 1XGPB 1S6NA 4H8UA 1HOEA 3DGDA 3VSQA 2D7OA 3QHFL 3QWRA 2H9GB 2FGWH 4FXGC 1TG8A 2ZWNA 4IOIB 2ZUWA 2XWXA 2Z1KA 3FAWA 4OF0A 4S1SH 4XCNB 3QXAB 3X14A 1TO5A 3Q6GH 1HH6B 5C71A 2XYBA 4NQEE 1TYRA 5C9JA 1XIWB 2JWYA 3KLQA 5EZPA 3TPUB 5ADOH 4GSUA 1MRFL 1F13A 5AOKA 1HHIA 3RNQA 5J6GB 3PAUA 5KSBE 1QQDB 1YG9A 3DHPA 3U7YL 1G6RL 4MHHI 3QDMB 4MMYB 5C0GB 4HMDA 1U92A 3LKPA 1NPJA 2A4EA 4G71B 4WFFD 2B2XL 2F08A 2XBDA 3CDZB 5G5DB 4UNVA 4JDZB 2YBGA 4KI5E 5GGSB 1WF5A 3LD8B 4HPOL 3U9PH 4G43B 1VPOH 4PRBB 3C60D 2A4CA 4PBWD 1D5ZA 2DKUA 2ICWB 1RAMA 3IDJA 1V7MH 1N12A 4W9FC 2UV3A 1UZ6E 1XB3A 3P0VH 3QT2A 4P2AA 2WVVB 2YIHA 1WISA 1F3DH 1SY6L 3JT0A 4L48A 4TLKA 5FLUA 1E2ZA 3BLBA 3L9RA 1X4YA 2Z65C 3SD5A 3SPVB 3BRDA 2LOEA 5EZLB 1IC5L 2G5BB 5HDBB 5DSCA 1GYWA 3SB3A 1N5AA 3P11H 2J4WH 4HH8A 4Y1SA 1S9WA 5F7DB 2Z92A 3Q8FA 2V8LA 2VMJA 1E8ZA 1AO7B 2OCFD 2LABA 1CIUA 1O9VA 4NKOA 4AYFB 3V0WH 2OLDA 2K6YA 3O2DH 2WANA 2NRDA 3CXDH 4LSTH 4IU3A 5DR5H 9CGTA 3ISRA 2Z8WC 2B4CL 2C1OA 5DQDL 3WDHA 4AYEC 3VVVA 1RJLB 3WIFA 1HESA 5D72H 4Y5VA 3BN9D 5E8DL 3V8OA 4NKQB 4HS8L 3VRLE 1N59A 1COBA 4H20H 1RL1A 1ZVNA 4KTEH 3HPLA 4JFEA 1M71B 4XBMA 2MQ0A 2YPVH 4P04A 5ITBL 5K9QG 1QW9A 4PY8J 1G6VK 5GIRA 5KSAB 4JFFE 1YSOA 3CSPA 4PJXB 3A6OA 3C8DA 3WNMA 1EJ6A 5IW6A 2FJFA 4L8CA 2VLRD 1DE4A 4BWTA 1XBRA 1CICB 2XG5B 3CIQA 3GTNA 3FYIB 3IKKA 1R3HB 4HXAL 4WZ9A 3TBWA 1T0NA 3MCKB 1ZLSL 1DO6A 4MVBC 4X6BA 1DLFL 3OAYK 4EI5B 2BX5A 2X4SA 4GUPB 3UCQA 3O0RH 5D7SH 4OV6F 5F9WC 3T6QC 2H1PH 3P77A 2PWFA 2AEQH 5GRUH 2C9UA 3BUPA 3AG2B 4FF9A 1MHCB 2EO1A 3C5XA 3WFDH 4Y1AD 4PRID 4UNIA 3GIZL 2NTFB 4UOJA 3OLIA 4PJGA 3QRBA 4R9HA 4BK8A 1JTOA 2UX7A 4XN5A 1Q9WA 3IMUA 3P69A 3MV8B 3IU3B 4JFTA 5K1VA 1MHHB 1S4IA 4LRIC 5BZDB 4MDIA 1A2YB 4XXCA 1EXUB 4PG2A 5FOBA 1T1ZB 2WUCH 2WLIA 4Y16C 1JPSH 4LNRA 3BDBA 1U8CB 4HC1L 5HHOE 1S7XB 1YEWA 4LLUA 2V7HA 4BWUA 2MSPA 1L6ZA 3O6FB 1YYLH 1PZ5A 1OSPH 2Z3FA 3IXTA 4IBUA 4X8JB 1OZTG 2DMBA 4E9VA 4WTQA 1MWAB 2IQ9H 1FZOA 2QFRA 1MFVA 4TULL 2W8CA 5T1MB 4D8OA 2R0LH 1B0RB 3H9SB 3V4VH 2YZ1A 3AXHA 2IVFC 2NUPA 5F88A 5FB8A 1SN2A 1IC4H 1WS7A 5CUSH 2SEBA 3WHXB 1MNUH 1VFAB 1P84K 1J5OL 3HAEH 5HI3D 3QI9B 5AWNL 5JHLA 4AXWA 3LZRA 3BT0A 4N0FB 4JB9H 4PJ9D 3HFFA 3FTVA 5BQ7B 5DMGC 4J6RL 4OD2B 4OI7A 3ESNA 4R26L 2G5UA 4JW3A 2ED8A 4NNXA 5SWSE 1AE6H 3V55A 4NKIL 3ZZ1A 3C60A 5F6HI 1J8HD 4DP7X 1RZGA 3ETTA 2NCEA 2G3ZA 1GGCH 1FAKT 1ZS8A 4QXGL 4UZUA 3UGXA 4OCYH 3AREC 3TA3C 3NZUA 2XNAA 2BIOA 4OZGF 4I9WE 5JDJA 4LBAA 4WI4A 2YD4A 4FA8A 2FE0A 2GITA 4FADA 4NZUH 3Q3GA 4DW2H 3T04D 2MHAA 5IWLA 1J9QA 4PJFB 2DI8A 4MBRA 5H8DA 1KTKE 5I6OA 3GMRB 3LHAA 2LU5A 5T33L 3K81A 4BDVB 15C8H 3CFDB 4GO9A 4GG6B 2FATL 2ZG1A 3F7RA 3PPSA 2DM2A 4DP6X 1T22A 3KVDD 3IT8D 5D7HA 4DZ8A 2V9QA 2X09A 3KPLA 2WINA 4HSQA 5G4OA 1IUZA 5IEKA 1OOAA 4CMMB 1CBVL 1MAJA 4NC1C 1EHKB 4LSUH 1RHFA 1XIWD 5KSBF 1LWHA 2APBA 4PB0L 1MDAA 4FQCH 5EN2A 5EPMB 3X11B 4HG4K 3CN3A 2OMTB 4NZTH 4P2QB 3VUAA 3KL5A 3QDMD 4KI5F 3OF6D 3ZHDA 2FB4H 5CZKA 5CKAA 1UOLA 2NYYC 2Y36H 3MRPA 2VSMB 3DTXB 2QZQA 1DJYA 1FFOB 2G60L 4PRNB 4TNVF 3HLKA 4KZDL 4GKNA 4FG6D 3QJXA 4WK0B 2Y7OA 1BEXA 3H3KA 1A14L 3LKSB 5DYFA 2ZF8A 2VLRA 3RB7A 1XAKA 3RZCC 2C9AA 4X6CB 4Z5RB 2VXQH 4R4ND 4TSAL 1MPAH 1VJSA 1KUMA 1I3UA 3U2SB 1UFGA 1WC7B 3IWVA 3GM8A 2OSYA 3CMOL 3WTVA 2SODB 3TBVA 5MEQB 3FB5A 4IHOB 4K9JA 2MWCA 3L3KA 2DD8H 2WXNA 3L8QA 3UP1A 1C08A 1E6JH 4XO3A 5CCKH 4Y5XB 2XWCA 3Q6FB 3ROOB 5KSUA 3OLEA 4LPXA 1G7LA 1CFSA 3RGVC 1BZOA 2NY3C 4BH8B 4FP8H 3CZEA 1T7YA 2L7JA 4MJ4A 3UO1L 4ZYKB 4TUKH 1BYNA 4PRDB 5AOZA 1AO7D 4WFGD 3UTTB 3MACH 1FL5A 4HLZG 1JWMB 2CK2A 2AJSH 3U0PA 4ELKA 1M2VB 4LHUB 3U6RA 4F15C 4HJSA 3DETC 4M6ML 1I7UB 3VRLF 3N0PB 4EI6A 3UTZB 4HMEA 4PTUA 4GS7C 3VFUB 2IBZX 1MRCH 4XODA 2X4RA 1JPST 1A6UL 3ZE0F 3V4PL 1UM4L 4XO9A 2BOBA 4NSKB 4GUQA 5H37G 5E08H 5TE7H 5KSAD 2GTWA 3CH1B 4F7CA 4DWHA 1JP5A 4UDTB 3INOA 4ABQA 3AMKA 2WYHA 3IWUA 4LOEA 2QQNL 1CICD 3ISWA 3T5WA 2OTWB 1P7HL 4WUKL 4HJ0D 4Y9CA 4P9ML 4Y88A 4EI5D 4RA0C 3H7BB 4FD0A 5CINL 5ELIA 4PJ9A 3OKKA 3S8FB 3HUJB 3UBXA 4ORZC 3S4SG 2C8NA 5CJOH 2AQNA 2ZZUT 2FO4B 4FLSA 5I8OL 4XNYH 5IOKA 3CFBB 3V52H 3UYRL 2F1EA 1BQLL 2Y7MA 5I75C 1LO3L 4J8QA 2X0UA 1J8HA 2ZSVA 4MSWB 3OGCA 3OKEA 3QA3B 3T0BA 3GWJA 5MENA 1AGEB 5FC9A 1IC0A 3MV8D 3HJEA 3ZZSA 3EJZC 3LYRA 4AYSA 1B9KA 4MWFA 3HZKB 5DFAA 5ABDE 5I17B 5D4IA 5DJ8B 2OYPA 1GY2A 3TJHC 1EHLL 3INUL 1O6TA 4MNGB 3VXTA 3IB4A 4HAFA 2V5RA 3OB0H 3HBZA 3O6FD 1C12B 4JN2B 1NMAH 1XGPA 4JZJB 3HNTH 4H2AA 4N2AA 3ZDXB 3MLYH 2H9GA 3VQ2C 4YC2C 1A6ZB 4XCNA 3QXAA 1F2QA 3H9SD 1HH6A 4NC1E 3OKOA 5CCHE 3HC3H 3RHWK 5L8LB 4G8FB 2Y6SC 3PRZA 1XIWA 3EJUA 2DKMA 3TPUA 3UO8B 3NSCA 3QI9D 4OZHE 3U6XA 1L7IH 2ZXEB 4N2CA 1QQDA 2DQIL 3TVMC 5C0GA 3QDMA 4MMYA 3SDYH 2EVIA 5MEOB 1G9NC 4I1RA 4AWJC 4W93A 5G5DA 4JDZA 4KKCD 4O2FB 5GGSA 1WFNA 4D9LH 1JF5A 4G43A 2YQGA 4PRBA 4G6ML 1ZLVK 3U30C 2ICWA 4DO5A 4ES8A 4AX3A 4CVWA 1NOLA 1OW0C 1SLXA 2WBJC 3CGTA 1ERNA 3A4DA 4YDJB 1HCFX 3D4GA 4GIAA 2R23B 1HL9A 2WVVA 4MMZB 2B1HH 1BX2B 4J4PC 1EVUA 3MLZH 4QGTA 5F1IB 5AZEH 3SPVA 1B3JA 1QNZL 1T7WA 3FQUB 5EZLA 2G5BA 4WU7B 3WN5B 3L17A 1X6NA 1NBYB 1J0HA 1IQWL 3B3IB 5F7DA 1SDAB 1RVFL 2AMUA 4MAUL 2ZX7A 1GGBL 4K7PL 4HCRH 1AO7A 4Y0GA 3C6LC 3BAJA 2YUVA 1VZIA 4AYFA 1CGTA 4GXUM 5FYJE 3PJLA 5F71A 4FQXC 3U4BH 5F7LB 3MNMA 1A4JB 3B56A 1C5CL 2QHLA 4KK9C 4HIPA 4P2QD 1RJLA 4HHGA 5IB5B 2F18A 3FUFA 4FFYA 4G8IB 1E2WA 5CU5A 1X5YA 4NOBA 2EIZB 2QTVA 1YEGH 3SKNB 5HJGA 4F7KA 3RAJH 4AI7A 4WY7H 1M71A 3QHZL 3HE7C 1XTLA 2NR6D 4AJ0A 2CHZA 1A1MB 4O51B 2EDTA 4PJXA 4F8OA 4IRJB 4NO3B 2Y2TA 2OX5B 2NTSP 3N9GH 1CICA 2XG5A 1R3HA 4X9HA 3MCKA 4F7TB 2RJMA 1Z32X 4GUPA 3C08L 1IIKA 1MLBB 1SN5A 4JLRB 4OFQA 2CBTA 4QHKJ 4ZX3A 1MCHA 4NN6B 5J3HD 1FRGH 2X89D 3CU1A 5FO7B 1YHPA 3VH8B 4LLMB 5IMLB 3B9EA 4EUPH 5I28A 3D39B 5FW7A 2NTFA 3RTQC 2Q7AA 2YARA 1U2CA 4QYOB 2NNCA 3EHBB 1AMXA 3N40P 1TQVA 1KYAA 3MV8A 3IU3A 1YEJL 4W6WB 1JDDA 3UTTD 3ZIMA 1QVOB 4FQ2H 1AJ7L 2D7QA 3QQNA 4LPYA 5BZDA 1VCAA 1A2YA 3QUZC 4HFUL 5J4MA 3SN6N 2PTUA 1EXUA 1A6WL 1UGKA 1T1ZA 4LHUD 1O9WA 4BFRA 3QJRB 1U8CA 2JELL 1NAKH 1S7XA 4KAQH 2YD5A 2B15A 3G5YB 4HT1L 3O6FA 4WEEA 5E6SB 2PR4H 4EN3B 1KCUL 4JPSA 4QXWA 1MWAA 3QEUB 5DVKA 5T1MA 3SDCA 3C5ZB 1H19A 3BDXA 5F2FA 3H9SA 3QAQA 4M29A 3D0VB 2JJUA 1F02I 4BK5C 1EERB 3IRPX 2EVJA 1LP9E 2BRRH 3ABZA 3CBKB 3WHXA 1VFAA 2VSKB 3QI9A 3VFNB 1BOGB 1PZ3A 4CJ0A 5JDSB 1UD6A 1JZ8A 1CE1L 1YPZE 2FQEA 1T0PB 2AGJL 3AGWA 3DX2A 3GI8H 3QUYB 2E46A 4A7GA 3BCDA 1B4JH 3UIYA 5BQ7A 4OD2A 4J3UA 3O8XB 4IBTA 4J6IA 5C07E 3VXSB 1JVLA 3IDIB 4LMQE 2PLTA 4UI2A 4F5CA 3K2UH 3S5YA 1TKWB 4X7CC 1KENL 2ZX6A 1UWFA 3G04A 5I26A 4FABH 1KOAA 5KYYB 2BP0B 3ZHFA 4DQOL 4Q0XH 3BKYH 3MA9L 1U58B 2XDHA 4NRYB 3TM6A 3Q43A 2I26N 4KDWA 4IW4C 3CVIL 5I15L 1TMCB 2DEWX 4PJFA 1UEMA 4WWNA 2MNJB 5DLLA 3GMRA 3J7HA 2UVFA 4YPGB 1J5IA 3CFDA 4GG6A 2IFGA 1THAA 2ORBH 4LSVL 4YFEA 1Z2KA 2R0ZL 3BKCL 4BFKA 4AZUA 1KF9B 4KFMA 4CMMA 3ZSSA 1W91A 4KOCA 1CFVH 2VXUL 3WDIA 4YDLB 3AJ7A 3X3FH 3ZSTA 1F0LA 2BNQE 5EPMA 3Q8BA 4Z7UE 3QBTB 2OMTA 1HHGB 4JHVA 4P2QA 4P57B 3OG4B 3OB8A 6PCYA 4GUOA 4FFVC 4AW4A 4YDIH 2ENSA 3LN4B 5LGHL 3GSOA 5EV7A 2XQYA 5EZJB 1OQOA 1KGYE 2EO7A 2KS0A 2NR6A 3DTXA 4PYHA 1FFOA 3KXFB 1GTNA 4S0SD 3BZ4B 3NIFB 4ZW8A 4QTFA 1L3WA 2L04A 1SN0A 3AT0A 4U1IB 4UM8B 3LKSA 1KZYA 1PKQE 2R69A 5IBUG 4Z5RA 4X6CA 4OCWL 3S37X 4MD0A 5DFVC 3WTUA 3U2SA 1WC7A 1RD6A 5E7BA 2YKKA 4NUJB 3SBQA 4DP8X 1UWGH 5MEQA 4UB0L 1J0KA 1S5IH 3KEDA 4IHOA 1WZMA 1PGRB 5AVXB 4I77L 3CQQA 3VI3E 1CR9H 3P9MB 1HJCA 4GKOA 3MJ7B 4Y5XA 3Q6FA 2X89A 3MRDB 3ROOA 1K4CB 4Z3EA 5I71B 5CBAB 4Y2LA 4BH8A 1GYAA 2GBUA 3F3HA 3T2QA 4JFQA 1OAKL 4ZYKA 3FUHA 3CZNA 4PRDA 3GHEL 2D31A 4EXKA 2ZG3A 1IARB 3VAEA 4XCCH 4KKPA 3UTTA 2A38A 3MA7B 1JWMA 1MUJB 2HZHA 3QWQB 3JTTB 5E9AA 4ZS7H 1QSEB 2LVCA 1M2VA 4LHUA 1HZLA 4JRFA 1I7UA 5E6IB 4YK4C 4H0GA 4PCSA 3UTZA 3CZFB 1RZPA 1VCBC 3VFUA 4QJ3B 1KIUB 4AIOA 2YZ8A 3KLHD 1YVLA 1MFUA 2B39A 2WSDA 4IIQA 2WLHA 4NSKA 3F6JA 3HZVB 4NO2B 1KCVH 3DVFA 4OQTA 5E5MB 3D0LA 1J5DA 4WI8A 1BHGA 3L3OB 5KW9H 2AV7B 4UDTA 3W39B 2Q2LA 4IRJD 3BGFB 1FZKA 1BVKB 1PY9A 3BAEH 2IG2L 2OTWA 4DOHB 1GCYA 2VDPH 2HP4A 2RBLA 3H7BA 2FYYB 4WV1B 3W38A 3HUJA 2F5AL 4PJEB 3C5JA 4KO9A 1H3PL 3VX1A 4NJ9H 1S8DB 4L5FL 5FA3B 4OCMC 3WJJC 2FO4A 2DWYA 4NRZB 5E9DA 4G70B 5DVPA 3CFBA 4FQLH 1JV2B 4MQXC 5D7IE 1TZIB 1ZK9A 2BM3A 3TC9A 4N8UA 3D39D 1WIPA 4M6OH 2VLKE 4MSWA 5L2KB 4RRPM 3L2MA 1ZE3C 3QA3A 3VGAC 3EHBD 2UXTA 1AGEA 2QMKA 3AB0B 3F83A 2GT9B 1PKOA 4XX1G 5DZOA 5AZ2L 3GPEA 3OAWA 2Q5BA 4NHUB 3HZKA 3F04A 3GS4A 1U21A 3VD5A 1AS7A 1S3KH 5I17A 3RHWF 1RUMH 2FIKB 4A63A 5DJ8A 5L4FA 5CJBA 2VXQA 3NCXA