2AFNA

Structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
331
Chain Sequence
IAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
total genus 88
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA02
2FJSA 3U25A 2FQGA 3QJQB 1ASOA 1X9RA 1BXVA 1J9SA 3NSDA 4KO7A 4M4RB 1AOZA 1N70A 2LLNA 3QQXA 2N0MA 2VN3A 6PAZA 4YSPA 4YSRA 2HXAA 1GY2A 1NPJA 3FSAA 4CSPA 1OCCB 1KBVA 3QJVB 3BVDB 9PCYA 3CVDA 2ZWNA 3NYKA 3DTUB 3TBBA 1JXFA 4QLWA 3UABA 1L9QA 3IE9A 4E9YA 1JXGA 2FT7A 3JT2A 4PCYA 1NPNA 1DZ0A 4RH4A 1OOWA 5AZUA 3TBCA 5B3SB 3PLYA 4GP5B 1PY0A 3NSYA 2P80D 2VM3A 3H4HA 4AKQA 2BW4A 3FSWA 1A3ZA 2OV0A 2J56A 3NJMA 1L9SA 1NIBA 3PAZA 4YSOA 4KNUA 1SDDA 4AX3A 3QJUB 4KO9A 4JHVA 3G5WA 1JVLA 2XYBA 2QPEB 3HEIB 1SNRA 1OE1A 3TASA 4EF3A 1JZGA 4BDVA 2GC4C 2XWZA 1BAWA 2VW6A 2XX0A 4HZ1A 1OCRB 2B3IA 4YL4A 1M9WA 4GP8B 1KBWA 1WA0X 2HRGA 3AG3B 1ZIAA 1ZPUA 3FU8A 4A2FA 4YSUA 3EH4B 4BK5C 2BWIA 1SDDB 1QHQA 2GI0A 1PF3A 2HX7A 3AG4B 1PMYA 4JHUA 3OMIB 2IDTA 1JOIA 2FQFA 3X1EA 2X88A 3AG1B 5A7EA 5TK2A 3UADA 4A68A 2R7EA 1XB6A 3JTBA 1W6LA 5F7BA 3NJLA 2DV6A 1M56B 5LDUA 3PAUA 3X2QB 1HAUA 3ERXA 1JZHA 1BYPA 2YAOA 2GHZA 1ETJA 1AS8A 5I6PA 1IUZA 2CBPA 2FQEA 1GS7A 1TKWA 2EIJB 1BQKA 2CUAA 3ABKB 2PPAA 2J55A 1NIAA 3NJNA 1AZNA 2A3TA 1BXUA 2J5WA 1OCOB 1DYZA 1J5DA 2CAKA 1RCYA 1T5KA 2J57A 3SQRA 2WO2B 5B7MA 4KO6A 1GS8A 4A2EA 1SFDA 4E9WA 5B1AB 1IBYA 1NICA 5D4HA 2PPDA 1JZJA 2AFNA 1BEXA 2JXMA 3FS9A 2IWFA 1RZQA 3FQ1A 1PZAA 5I5MA 1M57B 4WTQA 3EH5B 1W8EA 1GW0A 1ILSA 5B1BB 4E9TA 3NJKA 1FFTB 2DY2A 5AKRA 3WKPA 3OMAB 1UATA 4HALA 3C75A 4YVUA 2MRYA 4DP7X 4AZUA 1ET7A 2BP0A 1JVOA 6PCYA 5AFAA 4KOCA 2MTAA 4DP1X 2EINB 1MZYA 1J9QA 1MZZA 4BXVA 1E30A 2YAEA 2IDUA 2GB2A 2FTAA 3QPKA 2IWKA 1AANA 4DPAX 2YQBA 2VM4A 3NT0A 1BYOA 3SBPA 1NTDA 4A2DA 2IWEA 1AZUA 3T6ZA 4DPBX 5I6MA 2IDQA 1SF5A 2EILB 3FYIB 1A4BA 3TU6A 2IAAC 5B1JC 4DP4X 2QPDB 3UACA 3N55A 3IEAA 2RACA 7PCYA 4HCGA 1IBZA 2H47C 1A4AA 2AANA 4KNSA 4YSTA 2YAMA 1MG3C 1E5YA 4GP4B 1L9PA 1W6WA 3T6XA 2PLTA 1JERA 5B1KA 1EHKB 3S8GB 1HAWA 1WAEA 4HHGA 1NIEA 4F2EA 1XMEB 1KDIA 3ABLB 5I6OA 1GR7A 1JXDA 3WNJA 5I5IA 2UXGA 4G7RB 1SFHA 4UANA 1A8ZA 1L9RA 3H56A 3KW8A 3T71A 3ZIYA 8PAZA 1I53A 1A4CA 2DWTA 1ET8A 2JFCA 4A2GA 2EIKB 2H3XC 2HX8A 1B3IA 4YSCA 5B7FA 2DYSB 3NJIA 4GXFA 3WG7B 1AACA 4BWTA 2XV2A 1PNCA 1V54B 3NJHA 3CZUB 3ZX1A 3OM3B 1YLBB 2YAQA 1NWPA 1NDTA 1PNDA 3DIVA 4NAJA 4WKXA 1CURA 4FAAB 1PZCA 2P80A 1OCZB 2WO3B 1VLXA 2Q5BA 3CVCA 2EIMB 1SHWA 4YVNA 1R1CA 1MDAA 2PCYA 2BWDA 4ENZA 3MX0B 1OE2A 4NERA 1ET5A 7PAZA 4Q8BA 2HX9A 3X1NA 1OF0A 2XX1A 4YSQA 3V9CA 2GSMB 1IC0A 2W8CA 1NWOA 1AS6A 2OCCB 2AZUA 1WS7A 1ZDQA 1AG0A 3FT0A 2IDSA 5E9NA 3CVBA 2CJ3A 3CG8A 1GS6X 1IKOP 3EHBB 5B7EA 3GXUB 2XU9A 4DP9X 2BP8A 3FU7B 4YSEA 3FSZA 4AI7A 1OE3A 3HB3B 3OQRA 5B1JA 3CDZB 5I6NA 4HHWA 4A67A 2HLEB 4E9XA 4YSSA 1CUOA 2HRHA 4HAKA 1PAZA 4YSDA 4DP5X 2XV0A 3PPSA 1TEFA 2PCFA 3AY2A 3EF4A 3NJGA 2PP8A 1CC3A 2ZOOA 2NRDA 2PPFA 1JZIA 1XB3A 2R7EB 1GSKA 1PLAA 4BXSV 4E9QA 4BWUA 3KW7A 3S3BB 1CYXA 1SF3A 4GY4A 2UX6A 3ZDWA 3PCYA 1MG2C 3DKHA 4DP2X 1AG6A 5IY5B 4KOBA 2VW4A 4A66A 1WS8A 1E67A 1V10A 1HFUA 2BW5A 4BDVB 2JKWA 1ZDSA 2YAFA 4W9ZA 2UXTA 3ASNB 3D12B 2FT8A 2ZXWB 1OV8A 2E86A 3S3CB 2GC7C 3SBQA 4UAHA 1E5ZA 3BQVA 3OD3A 4G72B 4FA7B 4F7KA 3S3DB 2Y1AA 1CYWA 3WKQA 1SJMA 2X87A 4DP6X 3FU9A 3FU7A 4L0PB 1F56A 1V55B 2VW7A 2WSDA 2XLLA 3UAAA 2Q9OA 3NP3A 2VMJA 3CDZA 5F7AA 2TSAA 1BQ5A 4P5RA 5I5JA 1N68A 2UXFA 2CALA 1PCSA 2BHFA 3FPXA 1KGYE 2IH9A 2XUWA 3X1BA 1AQ8A 3T9WA 3WI9A 2FT6A 5D4JA 2YXWA 3T6WA 3UAEA 3PXLA 3FQ2A 1FWXA 1ID2A 2AZAA 2IDFA 2VSMB 1ASPA 2YARA 2YAHA 3WIAA 3ABGA 4F2FA 4G7SB 4Q89A 2PP7A 1KYAA 4DPCX 1GY1A 4CSZA 2I85A 4G7QB 3QJSB 1XB8A 2GBAA 1RZPA 2PP9A 3NSCA 2UX7A 1AZRA 2VSKB 1TEGA 2BZCA 4N8UA 1URIA 4DP0X 1GYCA 2BZ7A 2TSBA 3SBRA 3T6VA 2IH8A 3L45A 3ZBMA 4E9VA 4JKNA 3MBWB 1ADWA 4QKTA 1BXAA 5I26A 4M3HA 5PAZA 1AAJA 2W88A 3UGEA 3AW5A 1PLCA 4BWWA 2DWSA 4NB7A 1BQRA 1KDJA 1KCWA 3N2JA 3S8FB 3GYRA 2OJ1A 3FPYA 1ILUA 2HZHA 3FSVA 3TA4D 1SHXA 5I28A 1ASQA 3AG2B 1EZLA 2FWLB 3RYMA 3X1FA 4HIPA 3AZUA 2GIMA 5ANHA 3PAVA 5EHFA 1NIDA 2ZONA 4HCIA 3OMNB 4AKOA 4E9SA 2XXGA 1AZBA 3IN2A 1TU2A 1KCBA 3NJFA 1KV7A 1NIFA 2CCWA 4TXVB 2FNWA 2QDVA 3NJJA 4A2HA 1NZRA 2BO0A 2FQDA 1L9TA 1FA4A 3WNIA 1J9TA 4E9RA 4G71B 3H4FA 4G70B 1AZCA 4PAZA 4N4YB 3X1GA 2XV3A 1WA1X 4GYBA 2BP0B 5D4IA 2I7OA 3QJRB 2BP8B 2QDWA 3NP4A 5I6LA 4KNTA 5PCYA 4AKPA 3NSFA 1JZEA 1A65A 4UF7C 1AS7A 1AIZA 2B08A 3FQYA 2Y69B 1J9RA 4X4KA 1WA2X 5TK4A 4YSAA 1RKRA 2QT6A 1PLBA 2XVBA 4DP8X 2UXVA 2PPCA 2YAPA 1X9UA 2YXVA 1ZV2A 3ASOB 2PPEA 1NINA 3IBOA 1ZIBA 1JZFA 2H5UA 1L9OA 1QLEB 2DYRB 5I6KA 5FC9A 2XXFA 1E65A 1QNIA 3GDCA 1J5CA 4K9JA 4W1TA 4HCFA 1PZBA 3ABMB 3IN0A 3QJTB 1AR1B 2AVFA 3FYEB 4P5SA 3EH3B 4MFHA 4KO5A 4ZK8A 2I7SA 3V9EA
chains in the Genus database with same CATH superfamily
1BD2A 1WFNA 2MNUA 3L2LA 4XMXA 5E5MA 5FAAA 5IEKB 2IH1A 1RPQA 1LO5B 3MRCB 3TIEB 4LSDA 5T1DH 1N70A 3V0WL 4BINA 1QLEL 1MLBA 1X9QA 2N0MA 3H3BC 3R4RA 4P46B 4Y19A 5BJTA 2NY0C 2IOOA 4ZX6A 4D9RE 2NXZB 4PW4A 3C5SA 3ZKND 4K3GA 4AE0A 2PW1B 4OI7A 5FLVA 3SDYH 5KVEH 3SDXA 2WMPB 4KVPA 4P2QD 1NCBH 2F54D 2M26A 3QJVB 3BVDB 4XBMA 3B9KD 4I4WB 5KBDA 4NM4L 2F53D 2ZYSA 1S9VA 4DGYL 5EF1A 4JJOA 2CGYA 2RBLA 1JRHL 5DRXA 4FKEA 1O5DT 3LAFA 2VDML 3T4AC 4RGOH 4G8GD 4P8QA 5A7BA 5C1MB 1RFDH 3GQFA 1FE8H 2YPKA 4RMTA 3RDJA 4NIKB 4MB3A 3MROB 4J3SA 1JL8A 2WCSA 1I1FA 4XNAA 2EIZA 4F7CB 2OSLA 1BHGA 3SE9H 3KYNA 3OLGA 4L37B 5DS1A 5CEYA 4XBEL 4NKDA 3TOPA 3WV0A 2XRAL 2GIXA 2FGWL 4MAZA 1F4YL 4K5PA 5DZPA 1E3XA 4UTBH 1NSNH 4YFDB 4LRIC 3RVXC 4Z7QB 4LVOC 3OKYA 1L6PA 5KTEH 2VERN 5I1KH 4K94L 3VD9A 1A14L 5DVOA 4XO4A 1I8UA 1AGBA 3TA3C 5EN2B 1QVOB 2AJUL 4LBEA 2GEQA 2XYBA 4FC3E 3DETC 3IU3B 3CBRA 1QOKA 3CN2A 3IGKA 1JPFA 1NSNL 2FO8A 5KSAD 4KFZC 2W94A 3TN0B 3GRWL 5E6SB 4FXKC 3TA3B 4DQAA 5C6TL 4N0FA 1F4WH 5F7KC 1FVCB 4D0DA 1B6DA 5D7HA 4FFZA 4U1MA 3O8XA 5AOJA 2WINB 4HUUA 4HC1H 3DX4A 3QC6X 2D9QB 2JJSA 3DX9B 4BCYA 3OMIB 1P5VA 2OR8A 3QWRD 5DJ6B 3ESUF 3LN4A 3PHOB 4IIQB 3TBWA 1ORSB 1F58H 4LLQA 4U6VH 2Y06L 3ZTEA 2UWEA 3EHBD 4PJ9A 2FEEI 2AEOA 4PCSA 4IU3B 5D7LA 2BFGA 5A1AA 2DV6A 2NY5C 4M93C 3BIBX 4U1JB 1R5WB 1F2QA 3X2QB 2P5PA 3FHAA 3MRKB 4PJDA 5CSZB 2MTPA 2YGNA 1CFBA 3V0EA 3O3DB 3WL9B 5C0FB 3PJNA 3F6IA 3GSQA 2XZQH 1D9KA 2PTTB 1SN2A 3A23A 3FTZA 3J8F7 4K5OA 2BSSA 5EUOA 1IVTA 2WMPA 2VSDA 5AAMA 3I3DA 3JUZA 4F7EA 3ABKB 3MLWH 3RUGE 4DEPC 2YJQA 3RWCA 1IC4H 3VJ6A 5FYLD 2V5RA 2Q8AL 3RWEB 5J56B 3KPMB 2NYYD 3GJEB 3Q01A 3SE6A 3GHEL 1SQ2N 4B9KC 1XF1A 2ED9A 2H45A 5IMMA 3HE6D 1RMFL 4GAGH 4E9WA 3IJ9A 3FB7B 1VIWA 4HEPG 4Z7UA 4BUQA 5C3IA 1KT2A 3M07A 4KRPC 1SEBA 5E8EA 2BDNL 3MOBH 4IRZA 3GK8L 3MA7A 2JXMA 1TPXC 1U0QA 5FWQA 4DETA 3BAXA 3AT0A 1DVXA 4CRPA 2J88L 3NZHL 1CD0A 3RWJA 4L0YA 5DMYA 3F05A 1G87A 3WKPA 2P52A 1CXKA 4WI9A 3CWGA 3C75A 2LFEA 5D1XB 1FL6B 4M5TA 3T8XA 4YFLF 4A37A 1NCHA 3B2VH 4YHZH 1HK6A 1ET7A 2ORBH 1QKZH 3HRPA 2BP0A 2P1YA 3QNXB 3V5DB 2VGLM 4LSRL 3NTCL 2MTAA 3EBHA 3MV11 1QUPA 3OWEA 1X4ZA 3VXME 1DLHA 2FTAA 1P1VA 4DPAX 1U8QB 3BXNA 2WIIB 3L3KA 3VG9C 5CKGA 2Y36H 2CZNA 3EH1A 3WKNA 3VXRD 1D7CA 4OAWA 5B4MC 4LCCA 4TNFA 4WWPA 1XSOA 2VISA 3T1FB 4GXUM 1SF5A 2BOBB 4JFHD 1PYWA 4L8SB 4RFOL 1N0XL 2ENPA 5AVTB 3STZA 4Z7VA 1KEGL 1U92A 3VI3B 4EDWL 1KJ2H 4PJIA 2L7UA 2W60B 3PV7A 2XBZA 3RVWC 5EBLB 3D0LA 4K15A 4YSTA 1ORQA 1T03H 3NBNA 1YMHA 1KEMH 1PS3A 4HKZB 1BOGA 4BKSC 4OSUH 5IROC 1XIWD 1MI5E 5EORL 3AXIA 4CGUB 1X6LA 4OVVA 4A6YL 3B2UD 1YJDL 2A7BA 4HJ1A 4Y4KA 1OSZB 3WN6A 5HSFA 4WHYH 4DCQB 3L4TA 3L9EA 4HETA 1EHLH 3AUVA 2UXGA 2VZSA 2IXQB 1XF2A 3ZKXB 3FO0L 1LVEA 2Z31D 4LCUA 3WS6A 3ZSSA 2OXHA 2OR7A 1IM3A 5JMRA 3K6SB 2C7UA 3WG7B 2R2HA 2XN9A 5C9KA 3F65A 2AI0H 1B0IA 2A0LD 2GUOB 4HZAA 3TJEH 2MQ3A 3GHPA 1H3VA 5GRWA 1U8CA 4Y4FA 2A38A 1JFQL 1WUNT 5KSVA 2VERA 4GW4B 4CW1B 1O9ZA 4YWGH 3KYAA 3V0HA 3H9SE 4NP4H 5TD4A 2W9DH 4R96B 3MOAH 3NOIA 4FKHA 4X6DA 2MKLC 2P7TA 2R4SL 1HL5A 2AJXL 4XB3A 1JV2A 2BOBA 2XG4A 4M1CD 1M53A 3HC2A 4GJTB 5EF0A 4IM8A 3A6CL 3HNSL 5DFTA 2HVJB 1RU9L 2GY5A 4FLOA 2E9WA 4OF5A 2AXFB 4ICXA 4PB0L 5IESH 4FGMA 4UDTA 1CICA 3CCHB 2NTFA 1WAAA 4PMFA 5LBSH 4GRMA 4UM8B 2JIXB 4H40A 5EA0H 5DJDB 4IK6A 3GMPB 2XACC 3HNVH 1DQJB 4KY2A 2XX1A 1Y0LB 1CQKA 4YSQA 3V9CA 2FX7L 3FB7A 2AQSA 1EZVY 1FBIH 2B7DT 1NAMB 5ADOH 1NWOA 3RJOA 5IV2B 3KXFA 4EEEA 1EJ8A 3GBLA 1ZDQA 5IJBC 1H8LA 1A66A 3K72B 4ODXA 2YIHA 4R5TA 1CPUA 3N85L 4XP4L 1RIVH 1K3IA 3CZFB 3NRQA 3HVNA 4RRPM 4IJ3B 1KB9K 4UDUA 4K4KA 4NDMB 4QTIL 2I24N 3OXRB 3QZWA 4Y16B 4FLQA 3KPNA 4HJ0C 5EEXA 2QHLA 2YXFA 1T5WB 4NKMA 3GLZA 2K3HA 1OF2B 5I0XA 2AEQH 1ONQB 2E9BA 1CUOA 4IGBB 2IDCA 1RSFA 4F7MA 5GS0C 1A6PA 3VM5A 5LLIC 2PCFA 1J8KA 1AHMA 2CGRH 3BWAB 3VG0H 5TQ2H 4OBRA 3TYGL 4E9QA 4ZAKC 1QNZH 3LRHA 2FBOJ 5AOIA 1A0QH 1MCBA 4ZPTA 4N26A 4E9LA 2BW5A 3EOTH 4CC1A 5JPMA 1KB5A 3QORD 3L5JA 4RNRB 2JKWA 1RZ8B 3NRFA 3D8MA 2ODIA 4JDTH 1G6RA 4YHPA 1F02I 1G7LB 2B1HH 4PRIB 5D7LE 4KI1A 3RE0A 3QEUA 3GT6A 4ZD3L 2X4SB 1A3RL 1TQUA 4D0CB 3OJDB 1JBJA 4Q2ZA 2BSDA 1K3ZA 4RZKA 4XPBH 1V7NL 2AEWA 3S3DB 1AH1A 2X70A 4JRYA 1AKJD 4DOHE 1GC1H 1WT5C 2DQTL 3MGOA 3QQ3B 5E1HB 4XCYA 4HCRA 4R4NC 2A9MH 4FQQA 4KK6C 3LVEA 4DWHA 5L0QC 3TBTA 3VRIB 4OGQC 4JZOA 4P99A 4UM8A 1NEUA 1O7DE 5D1XC 5JXAL 4DVRL 4PJ7A 2CH8A 2AJYL 4PJEB 1F3RB 1IL1B 2YD9A 4CNIB 3O8XC 2R27A 1GMIA 5KVFH 2NYZA 3O2DH 2QKIC 4AIEA 3FSOA 2I07B 2XFXB 3DPBB 1QI5A 3D25B 2AK4E 4QY8A 5LGYA 5JNYB 3DO4A 2BCMA 3O3UN 4TUOB 3K2IA 4X83A 2E76C 1QWUA 5CCJA 3QIWA 4TOYL 3ZDZF 1UENA 2V2TB 1HZHL 5DMIL 3DECA 5BS0A 1OD7A 3LD8C 3HI1B 1YDPB 3QNFA 4Z3FA 2Z8RA 1TT6A 3M88A 4AY0A 2A1WH 4UT6A 3VGFA 1A9VA 1FZMB 4N3UA 4PRIE 2YMTA 5FF6A 1D9KC 1KGJA 1L4IA 1X5MA 1S6NA 4NNXB 2BZCA 3GTNA 3SQBA 1BD2B 4ZTPL 3L3JA 3QUZB 1AFVH 4F37F 4H8WH 5PAZA 3LV3A 2YO3A 4LEXL 1TTFA 3KS0H 4NZTH 4P4RB 5HI4D 2B5IB 3HRZC 1JD7A 4P2CG 4WKZA 1ML0A 4JM2F 4UDUB 1ASQA 1MN4A 1MLBB 4JDVB 3MR9B 3VD7A 4FQXC 1S3KH 2X4TB 3HS0B 3QIUA 5SV4A 5C97A 3TJHD 4P5TA 3CFCL 5B22A 4A55A 3ZDYE 2XVKA 4ODTH 5D93C 1IGIH 5HHNA 1KCBA 4NN5B 3ZHNA 2ZSWB 1NIFA 1PD6A 3FQNA 2X70B 3EJJX 4JRYB 1NCIA 4A2HA 4MZ3A 3LKNB 1XSJA 4H1LH 3BAKA 4ODWB 3RVTD 3N6YA 4EQ2A 1J9CT 1UD3A 5H94A 4ZNEE 3KM1A 1E4XH 1OM3L 1J8HB 1LYQA 3ZMRA 1NFDF 2FUQA 4MAYC 1CGVA 1V8HA 1JZDC 2Z8VC 2F74A 5F7YC 1ZVHA 3KM2A 3KEDA 5FYJU 3OG4B 1F1DA 2BP8B 2IQ9L 3NP4A 5JPMB 3LDBB 1THAA 4XPAH 3TT3H 4LNVA 4ERSH 3DGDA 2Y69B 3NCCB 3S35H 3B34A 1CZ8H 2BK8A 1XV8A 4LHUA 4TVSa 4WFFE 2CLVB 1N0LA 4MLIA 5LG1A 5L88H 5AW3B 3ARYA 4LCWA 3MBEB 2JB6B 4GAYA 5EB9A 3RVXD 3WFDL 4Z1PA 3SPIA 1YO4A 4LEEA 3RX5A 4ETQB 4G7YL 2R0LH 2MPVA 2PN5A 2XG5B 5FC9A 3MNDA 1QNIA 4D7PA 5BCAA 2P48B 1J5CA 1BSIA 2I60L 1X4YA 2OL3A 3P77B 2ZOKB 1URZA 3PL6C 5FF6B 3APDA 3DIFA 1ZJBA 3RNKB 2CLRA 3UH8A 2CDGA 4LSUL 4PJ7B 5C71A 3CHRA 4IOIB 3F58L 2PMZA 5IQ9B 3FQ4A 4HJGA 4RISL 2Z35A 2NQ3A 1VA9A 3B3IB 3V9EA 3BQUD 1AYOA 4AQAB 3SO3C 3QO0A 1KTLB 4GEIA 3ZKMD 1ZV9A 3AMKA 4YBHA 4Z5RA 1I4FB 3O3DA 3Q6FB 4KUCD 1IEHA 4K73A 4UQ2B 4XOEA 4ZTEA 5F6IC 5E24E 1T7YA 3KLQA 4J3BA 3DBXA 1KGIA 1RUQH 1AHWC 1JNNL 1OGSA 3CQFA 1YEEL 2WLLB 3FSAA 4FERA 5I74B 3MC0A 5BZXA 2FH8A 1JUFB 2ARJQ 3LH8A 1OOAA 2DI7A 2FGZA 3V6OC 2E75C 3C2AH 5ID1A 1BD2D 1CD1A 1M3JA 1GYAA 2Q76B 3ARFD 3WNPA 1MHHA 4YPJA 4UQIM 4H20L 5EU5B 3U6XS 4HDIA 5HHVL 4OLYL 3KGUA 4PRDA 2JCCF 2YN5A 4MXWL 4C56D 1D5ZB 3PGDB 4AQ8A 1OAXH 1UACL 4A7UA 2R69H 4GPVA 1A1MA 3VW3H 1T4WA 3CE1A 2P80D 2O5ZL 5GS1A 4UNIA 4PG2C 5I0VA 1XGPB 5T1KB 4PGBA 3RDTB 1BX2A 4AK1A 2H3KA 2COQA 3MLVL 3NJMA 1NL0L 4K2UL 4UYQA 2CR6A 3DHPA 3SGEI 2OMTA 4YSOA 1P7KA 3VFNA 3RUGB 1MCWM 3D33A 5HJBA 3MRMA 1FFOA 3MMEB 2R0ZH 4L8DB 4W6YB 1KTLA 3BVXA 2CSPA 3PWPB 1YG9A 2YEZA 4Z95H 3GJEA 2DYPD 2ZKYA 1E7UA 3HJ0A 5JIKA 3LRKA 1JZGA 4DFHA 3QYNA 2HVKB 1CK0H 4KGLA 1U41A 1IX2A 1Q9LA 1DEEB 5KJ7E 1E42A 1HHJA 3TVMA 4OFVA 4A2FA 5CZRA 4JO1L 3HLAB 5G4NA 5DC0A 1QHQA 3DJSA 1PF3A 2A77H 1NEPA 1U92B 4JHUA 5CSZA 2DQJH 2IDTA 5IVZA 4ZO6A 4YBQC 3VI3A 3ZR6A 4X7FC 3WS3A 3V4PL 1KYUA 2VXQL 3OLEA 2FEEL 3HE6A 2JF1A 4QXUH 4OZIA 1BW8A 1JI2A 4Y9GA 1IZJA 2OXGA 3EJSA 5L9DL 3VFPA 3MLSL 1GJUA 1GGUA 1MFEH 1JAEA 1QABA 5BO0D 4YPGB 4Y4KC 5IF0A 2RTTA 2IQAA 1OP5K 2R2BA 3D4CA 3GSUA 1F90L 4OZFA 5DRWB 3QZWG 4OY9A 4F9PA 1XGTA 4GXVL 3K6FA 5J12B 4JAMA 3P9LB 1RUML 2RHEA 4U1IA 3LQAL 1BYNA 4ECNA 1AGFB 3PU7A 5JHLH 1KWKA 1FORL 3EJCA 5AB9A 4HWBH 5I0ZA 1XD0A 5B8CC 1FGNH 2IADA 4PJGB 4PJCE 4MJID 2HRLA 3OKKA 5T5FA 3Q2NA 4TSCH 4LLUB 2D4FA 3R8BB 3QIBD 4BSWB 3WJMA 4UTCA 3O4OB 3KPPA 4LPCA 3PGCA 4Z5RB 5I8CA 1MCWW 3W0WD 3V6OA 1QASA 1KG0A 2WYHA 2CHZA 1JZ7A 5IREA 1IFRA 3KPMA 4GUPB 1MCEA 4P2RE 3LEVL 1LQBC 3F5WB 4PLKC 4XO8A 4ZXBD 5LGHH 4AIOA 3CCHA 4H8VA 5KVGL 1YECL 1CF8H 3UBXB 4AZUA 2WVSA 2JELL 5I1HL 4GO9A 3L5XH 3CFMA 5T3XE 3FH5A 4PJXE 4O2CA 4YGVB 3NFNB 4DP1X 4JHWL 5IT2L 3JXAA 4IU2B 1JN6A 1TKWB 3FQTB 1IBBA 4LP4A 5TQ0H 2HKHH 1GGTA 4CVWA 1LO2L 2BHZA 1OM9A 5IJCC 5J0BA 1FLTX 4FQ1L 1DN0A 5ETUA 2A9DA 1F11A 2GJ6D 2NT0A 1MPAL 4MNQB 4Q0XH 3VGEA 2JKJA 2QV4A 3OMZA 2EKSA 3N1MC 4PRAA 3HZVB 3JTSB 2J72A 3QNXA 1K4DB 4YDVA 3DA0A 4ISVA 4NPYB 1N26A 3QHZH 1EDQA 1RUAH 5DUML 1QWHA 4EZMA 1YNTA 3QUYD 1UXWA 4LL9A 4X6EB 2W5PA 4ATWA 1J8HA 1FH5H 3G6DH 3ZU8A 2R2BB 1XCQB 4POYA 1M71A 2QMKA 4QHMA 2UYLA 4B50A 1GZHC 3MRDB 3MUGA 4GW1B 1JWMB 1ID5I 4KTDL 4QTFA 3SYPA 2MFNA 2VM9A 1SFHA 1ZSHA 1ZEAL 4LKCB 5EC2A 3RZWA 1XH1A 4ALAC 1OL0A 2HLFD 3H9HA 3GPEA 1ORQB 4Q97A 1X7TA 1T20B 4S0TD 4KHXL 4QXVA 3U79A 1B3IA 4NGHH 1BIIA 1Z5LB 2X6MA 3H54A 4ZFQA 5KJ4A 3GZOA 4W9GC 4TUJA 4HWBL 1T83C 5FHAH 2D31B 5JO5B 3X12B 1I8AA 4OLXH 2G2PA 2DQGH 3ATEA 3ZE2B 5IJVB 5EEUA 3CHXA 5F8RC 5JQ6H 2J2ZA 3QZLA 4TN9A 4E5XB 2YAQA 3FT2A 4CU7A 3GXTA 1ND0B 4PJ5A 3N06B 3TESA 5EH1A 1DJXA 1XGYL 3WIFB 4WUKH 3ZR5A 3MLZL 3AQDA 2BNRA 3ISRA 4X0KB 4DZBB 5KBLA 5LXVA 3OLDA 1MWAA 1O6SA 1J1PH 5C0CA 3P9LA 4DF9A 2WOBA 4G6AD 4OB5H 2J7LA 3IDMB 3U1PA 4CW1A 3B7UX 4FQXD 5FEBA 1SMAA 4NBXB 4U3CA 5TDNB 4MB1A 4NO0B 3NABL 5L6YL 5EOCJ 2VIRA 4JKLA 3SJVB 4NERA 5IW6A 1VJSA 2QFPA 3BSZL 4QXGL 5FFGA 3U0WL 4ZAKD 4I85A 4UT7L 2A6DB 2ZSVA 1U91A 2W8CA 3OAUH 4KK8C 1AS6A 5DHXB 5F1NB 1G9NH 4JO3L 2WC7A 5SWZE 2WZ6A 2ADGA 4GQ9H 4L23A 3ZE0B 3CMGA 3JWNG 3KWVA 5IQMA 1ZGLM 5ISZA 1YNKH 2VAAA 3VGGA 2H6PA 4NUQA 3RNQA 4BA0A 2AXJA 3V7AE 1EEZB 2ZCZA 3CX2A 2R0ZL 2KUTA 5KYXA 1FF5A 1OE3A 3PYCA 3RL2B 4EN2A 7FABH 5ISZD 1DDHA 2FBJL 4EI5B 5JPNC 1UM5H 2J8UF 3NAAL 3S0PA 4ZG1A 2ESVA 5E4IA 5HHOD 1DQDH 2WNXA 5E51A 1SPDA 1CC3A 4MNGA 3PWUB 3TYFB 4X8JB 4XHQA 2P5EE 1IBHA 3VFNB 2XA8H 4I13B 2R69L 3B56A 4LARL 1ZD6A 2UX6A 1P4LB 3U2JA 2FBRA 3MCLL 2VW4A 5CJOH 4QO1A 2PCXA 3KVDD 5KAQG 2EXYC 3SPHA 2HG5A 3ASNB 4FTDA 4OU3A 2ZXWB 5ICUA 2WGXA 4UNTA 4I2XE 4ODBD 4EQ3A 1FNGB 1LWHA 3PWNA 2AQ3A 3PDGA 4NZFA 3N9GH 1Z7JA 3QORA 1ZKAA 4HISA 3RVUD 4UNVA 1ODUA 4DESA 1W72L 3V6OE 4NZDA 4AMWA 2WSDA 4APXB 2BVPB 1GCYA 2FLBT 4I18A 4YXKL 1XBDA 4UAOC 4IRJB 1WFJA 4OQTA 4LO9A 5DRZB 5BW7A 1E5UI 3F7VB 5CM1A 1DQML 2AJZB 4HLJA 4NM8L 4X6CF 5D4JA 3UBHA 1G7IB 1KACB 5LKNA 3BVWA 2B0SH 2PCPB 3BCDA 4YDNA 4CBZA 2NY0B 1GGCL 2YARA 2Y5TA 4L29A 2R56H 3VRIA 4KQ4H 4M7JH 4XAWL 5GJTH 1WWBX 3THMH 2V8LA 3NN8A 4JY5H 3GSXB 5C0BD 1G7MA 4CSZA 3S35L 3B9KC 4ERSL 4AQOA 1DDHB 5DS2A 2NY1B 1H3GA 4IRSC 4XVSH 1QFUH 1XO8A 4EVNA 3H9SD 5DEZA 1MJJB 1AZRA 2HFTA 1LO4H 4OLZL 3B9KB 3ZHFA 2ZG2A 4FI8A 4A7TA 3CMOL 3PNWA 3Q9QA 4MA1B 3ZT7A 3QPQC 4A7GF 3Q2WA 1RJZB 2W88A 5I6XC 1UH4A 2OTUB 4GSUA 2VWEE 1GAFH 3GSOB 4DEPB 3AG2B 3G04B 1PAMA 3CFJA 3MRNB 3U2SA 4XC1H 4JDZA 1IEBA 1YMMB 3L3GB 2BX5A 3QI9B 1UWXH 3UBXG 4XVTH 3WTSA 1KXVA 4FQIL 4WO4C 3BDXA 2Y3NA 5L4FA 3IDMA 4C54A 1YUHA 3ILPA 4U1GB 4WI3A 3BPCA 4P0DA 4XCEB 4PLOB 1KV7A 2CCWA 2GTQA 1KPRB 3K0YA 2IV9A 2GAZA 2P4AB 1OZUA 2WKOA 4X7SH 5DK3A 3VXRA 1NCGA 4I9WD 4HLEA 4KZDL 3GTVA 1SXSA 1AD9A 1S7SA 1IAOA 4JDVA 3S4SG 4OZ4B 2X2UA 5J6HA 4WWID 1G1YA 3L3IB 4YHOH 4UU9B 1IKNC 1S9WB 1U3ZA 3CK0H 4HGWA 4HKBA 2N7AA 1JPSH 2VN7A 2O5NA 3FCGA 3OZ9H 5F7WC 1FFOB 2YUZA 1YYCA 2VDOH 1QMUA 3AU0A 1KLUA 4QXWA 4XGZA 4Z7WE 2D7TL 5SX5H 2WZPD 5CEXB 4HIQA 3TNMA 3MRLA 1GIGH 3EZJB 1DFXA 5CMAB 2R15A 1ZT4B 2JB5H 3RTQD 3ZL4L 4DT2A 1N3NB 2D7TH 2IEPA 2YAPA 5IVOA 2PPEA 1ZV5A 1ZIBA 4N0RA 1JZFA 12E8H 4ZMTA 4NBYB 3NZ8A 4WFHE 3LIZH 1R5VA 2PYED 2VQTA 3O0LA 3US1A 3CK0L 4MRCA 2OQJB 1P53A 1TSRA 2YSSA 3V6ZB 4HCFA 1J87A 1KBGL 2IF7A 2R23B 1NCNA 5F7NC 1N5YH 5DA4A 4F15B 4GW4A 2MPAH 4PTTB 3OX8A 4KKLD 5C0JB 4X7SL 1HOEA 3BPOC 3C5JB 4R7NA 5DO8A 1P4BH 1YQVH 2I5YH 2MOGA 1EHNA 3LS4H 4NQXB 4YLQT 3ZHDA 5DQ9A 3JVGC 3GSVB 3LXAA 1QBBA 4KC3B 4P2AA 1Y6KR 5F9OL 5IUCA 4RFNB 1ACZA 1AOZA 3IJSA 2AGJH 3AT9A 5GRVK 1T0NB 1V7NH 3DRQA 5HGAB 1ZMYA 5D7EA 1Z2KA 1NPJA 5C0EB 3I9PA 35C8L 1ZT7A 3AU1B 4LDCA 4ZRGA 2NX5D 2WB7A 3E9TA 3SCMA 2OTWA 4TQHA 5EZPA 3B3IA 3Q3GB 4QLWA 1RHHB 2BZDA 1I1FB 3KYMA 3IVKA 1LJMA 4MCMA 3X13B 3IGFA 2WW8A 3CU1A 3AJ7A 5BV7C 2WXRA 3PREA 2FHFA 4YHPB 3PLYA 3PQYE 2V5TA 2BP5M 4OIAA 3DJ9A 2J8UB 4I4WA 1DE4B 4XVSL 1SOKA 4XMPL 4JK0D 5CJQH 5HHPB 3TVMD 1M6OA 3IXTB 3BUDA 3Q5TA 3BZ5A 3NEOA 4FTVE 2WBKA 1IEBB 1YMMA 1T7XA 4PRPD 3H2WA 1M3IA 5EG6C 2EVHA 3DHUA 3ATDA 1QFHA 2Q7YA 3VD4A 2CO7B 4HUUB 1OP4A 3K2MC 4JKWA 4H0GA 1QW9A 1DQMH 4X9FA 4FNQA 4TS6A 4YZFE 2H26B 1XF4A 1QATA 1RIVL 3N85H 1HCVA 4XP4H 4BFEA 3MJ8B 2PWDA 3T3MF 5CLTA 2B3IA 4PJAF 2LHAA 1JGUH 1X5IA 1CCZA 2FAUA 1ZPUA 2FWOA 3EHBC 3FU8A 4JFQB 1J88A 1V7MH 4EUPH 2GI0A 3DXAA 1DJHA 5BRZD 1NMBH 3V6FB 5MEOB 3C6LC 4U31A 1TETL 3RPKA 2Y7NA 1PVHA 4XX5A 2X4NB 5H8DA 4DN3H 1SYVB 4PGEB 4XGZB 1U3JA 2Z0UA 3C6SB 2YFOA 4KH9A 1RU9H 2NR6D 4N24A 2B8OT 4KX9A 4NKDB 3IETB 1XCTA 4JGUA 3E6HA 4M03A 2IJ0C 3ZIMA 4K23L 3ZQ9A 3LZNA 1UCBL 2MJWA 1DFBH 2CBPA 4JDEB 3WTWA 5FGSA 1TKWA 3AU1A 5HYFA 3BQUA 3CFKA 4LMQI 3VXRB 4KJYA 1MCOH 1CVSC 2KLSA 2O5XL 2A3TA 3DJZA 3L3OC 2APVA 2KH2B 3LRSA 3TJEL 1NAML 3MCYA 3C8KB 1KIRA 4PJDB 1GJIA 5DQDL 4HG4J 2XA8L 3KWXA 5I73B 2ZWZA 5TDOA 2PKDA 1RLBA 1NICA 2OMVA 4Y9EA 2ILLA 2VMFA 5D4HA 5DD5L 5DD0H 3WMPA 1ZXQA 1N0LB 4EXKA 3NAAH 3DHJA 3NACH 2FBJH 4M7LT 4AGLA 3WXWH 2QKIB 3T4YA 5ERWA 4XXWA 1BG9A 1NCWL 1PZAA 1ZHNB 3BMWA 4OGAD 3KLHC 4QI3A 3TTSA 1GW0A 3HE7A 4GBXB 2VITA 2DY2A 3KGRA 4RMRA 5TE7H 3HR6A 3EJZD 5GZNA 1YNKL 4O2EA 3VQ1C 3NZ8B 3IFNL 3MV7E 4KMQA 4YDJB 5DC2A 3WNOA 2K7PA 2MSPA 3L6FA 3B2PA 2B3RA 4DP7X 2DQEL 2YZ8A 43CAA 3OPZL 4EDWH 4XCNB 4ELMB 3QEGH 1OTSD 2EDXA 4NYLB 4KJQC 2LW3A 1XCTB 5IR1B 1XF4B 3N50A 1MZYA 2PYEB 2YPVA 2EADA 2OZNA 5FUCC 1JYWA 1KG0B 1Z0MA 3NT0A 1BQHG 5IMLA 5L6YH 3HS0A 4HXAL 4EI5D 1PD0A 1E2VA 4QHKI 3K6OA 1ZT1B 1DVFD 3B2VL 2NSXA 4P5TD 2RACA 1JWUB 3WIHL 4RGNE 5A3IC 3F83A 4ODHL 2H47C 4JFFD 3UBGA 2EUVA 1EEZA 1VADA 1Z5HA 1MFAL 4MXQC 5MP6L 3NZHH 3BN9D 4DUXA 4PB9L 4POZC 5HY9B 1R5WA 5I6XB 4OZIE 1R9FA 2WWOA 1JFHA 5D4QA 5AB0A 1JXDA 2VXVL 1Z9PA 3KYKL 3G7TA 3O41B 4R4ND 3W81A 2CLZB 4ANUA 2QMJA 4M3JA 4ADIA 5GS1B 2ICWJ 5C07E 2YPVL 4H2CA 1M7DA 3JWDH 2YGVA 1ERNA 3TIDA 1GA2A 1BQLL 4JR9L 4BWTA 5AENA 2EXWC 4KZEH 4BZYA 4L5FH 2BC4B 2I25N 1O6SB 2RB8A 1TENA 4HT1L 2VL5B 3RI5F 4IJ3C 3MV9A 3VE0B 5JUEL 1GGBH 4PRNA 1ZANL 1QQDB 4NQED 2YK1H 1LO3L 3B5GA 1HKLH 4R2GB 1A4JA 1COBA 4RLDA 3SPJA 5EIIA 1BIHA 1NANI 4U49A 5A43C 2FIRT 4RA0C 1Z9SB 4O9HL 3PGDA 2NNXA 4ODXB 4OF7A 4Q0XL 5HJDA 3Q6FA 2WQAA 5EIIG 2NNAA 4FQ1H 3H9SB 3VNYA 3GRBA 5DDHB 4F24A 5DJ8A 4X4YA 4BBWA 2A6KB 1GPOH 1D2OA 3RVUC 3LMJL 3BXNB 2W59A 1I7ZB 3LB6C 3MBEC 3NIDB 4G8FB 4HMDA 2HYMA 3FRPA 1JTTA 1DBJH 2NZ9D 5C6TH 3H9YA 4OCWH 3TBSA 1IGCL 1S9VB 1UA6L 3CLWA 3HAEB 2EXYD 2WBJA 3CDGA 3L95A 3RY4A 1BZEA 2YRBA 3EHBB 3UFIA 2Y7QB 4UI2A 5HI5D 3E0GA 1IC5H 1RJYA 2BSBA 4FEIA 2XTSA 4XZUA 1L6XA 3L4XA 1A14H 3OQRA 4K94H 3O4LD 2B1AL 2O61B 1XIWA 2GJ6B 2FO1A 2K6YA 2N59A 2DW5A 2N7SA 4UUJA 1FG9C 2ZWSA 4XMLL 5E0QA 5A3ID 1FHGA 2PPFA 3SE9L 2IXQA 4U2ZA 1FGNL 3BP7A 3QZMA 3S3BB 4OV6F 2ZIDA 1R33A 5CCGE 1G6RH 4LVNC 5C0IA 4FI7A 4HIHB 4MWFB 3QDMB 5EWIH 2VSCA 2FJHA 5KSBA 4OUOA 1TZIB 3K3QA 2H2PD 1ZK5A 3NH7L 3EDFA 4P23C 1OARL 2UXTA 5C0AE 6TAAA 1DANU 1Z3GH 1HINH 5EZLB 1CDBA 2E86A 1FV1A 1KFAH 4MJIA 2ZP9A 3IJYA 2KPWA 5HD8C 5E6ID 4WI6A 4KAQH 3WD5H 3ILPB 4XCEA 1U6AH 4TSBL 1L5GB 5IHBA 4FABH 3WS6C 2VXQH 2EYTB 5JHDA 3KWWB 4WWKC 5D7LB 3DX1A 1WZ1H 4W9HC 5I1DB 3HR5B 3HG5A 2BS71 2PW1A 4L0PB 1OSPH 3ZQWA 1AO7E 2O4EA 4F91B 1NUNB 4ZX5A 3U9PH 4QUOA 3KBEA 5JW4N 4KROD 4UTBA 5I5JA 1U8IA 5KANG 4AMXA 2CALA 4FTVD 1CDJA 5BNXD 5C92A 2XVLA 2WO4A 4M02A 2XUWA 5BRQA 2E74C 3T9WA 2D7OA 4K7FA 4JPIB 4Z95L 3UAEA 4EN3A 5IQOA 2NY6D 4MS8C 4CVZB 3ZE2E 5JW3H 1YA5A 2C9PA 1E9OA 5D2NA 3VFMA 1MJJA 1VEOA 2VLKD 3AREA 3ABGA 1BPLB 1U95B 2OW6A 4KKQA 3ME0B 1LE5B 1RVFH 5GZND 3W11D 3SDDA 4E5XG 1A3LL 5EOCL 2ICEB 2QTVA 3VH8G 4AV4A 3V4VA 2V17L 2XTJB 4M4PA 4FQ2H 2ZP0T 1ETZB 4BFIB 4B5EA 4N8UA 2AKRB 4G6FB 1TZHA 5KG9A 4YHYB 1A6VL 3BD3A 1FYTE 2YKLL 4JKNA 4XWGL 4ATTA 2ZXEB 5C0JA 4F7EB 5C0NC 4EJ1C 1AD0B 3S88H 4J39A 1NCUA 5GGSA 5I73C 1V05A 1G7QB 5BVPL 1DJZA 2WXIA 3D85A 5GSVA 3D39E 1NKOA 4HOZA 1NA8A 2X0UA 3BWSA 4IBUA 3P3RA 4N68A 3ZE0E 1YEEH 3RGHA 5JHMA 3M86A 5DSCB 3SDXB 3MLUL 2ZOUA 3N44B 1FO0H 1KXHA 2ENYA 3OPUA 1WBZB 5DO2D 4AYGA 4AC4A 1I1YA 4JFWA 4ZUVB 4I7ZC 4WVRA 1B4JH 4URTB 1L0XA 2Y2YA 3U82B 3QXAB 3F58H 4XCYB 1YNTB 1A1OB 3V4VL 4X42A 2Z7WA 4U05A 1GTFA 4ISVB 1PBYA 3E3QE 3WU1A 3CN3A 3NPSB 3SOBH 3BWZA 2YUWA 3IJ8A 4Y4FC 1AMYA 2ZUSA 4WW2B 4F2ME 4QHPA 5D1QC 5C09E 1E4WH 3QZNA 4OBSA 4R2GD 2YQGA 3B1UA 2JV6A 4PJCA 4TLSA 3INUL 3NSFA 1M71B 4QHMB 3KWUA 4WW2C 2GAZB 2PUQT 3MA7B 4GS7C 2EYRB 4P48A 5CS7A 1ADQA 1QAWA 1URLA 1SEBB 2X40A 5L88L 1TJGH 4UIMB 1CGXA 4ONGH 2BERA 3D85B 1KCLA 2EACA 3Q6GL 1KBKA 4AENA 4K5NA 4R97C 1L9OA 4V2CB 2XN2A 4HGWB 4AUYA 5I76A 4XVUC 1VPOH 4Z7WA 2PYEE 1TOXA 5GGUA 4P2RA 4G8EA 4MRBA 1CE1H 3QCVL 5D5MB 4HKZA 5I1JL 4G8IB 3A4FA 2EEAA 4XI5C 4WK0B 5HHPA 3IFPB 2Q8BL 3ZGHA 3IPFA 5ISZB 2Y72A 2K1MA 4AQEB 1D6VL 3G08A 4RMBA 3VWJD 4HPHA 1EAPA 4D9LL 3H2QA 5K1NA 1NBYA 1HIMH 4AL8L 1HNGA 2GABA 2WQVA 2IBZX 2FJSA 4WJKB 4S1DC 3O2VH 4M3KB 5ENWB 1ASOA 5FKAB 2YFNA 1W8NA 2C9UA 3X13A 1E9OB 5D2NB 3VFMB 5I30L 1J8SA 4XTRD 2C9VA 2VN3A 4TVPL 2A6KA 2B1OA 4EZKA 4WGWB 2XZAH 2DQFA 4TUKL 1YQ2A 3A4DA 2GTZA 4LOFA 4NO5A 2Z92B 3EJYC 3FRPG 1RQ5A 2H3NA 3LNDA 3E1F1 5ABDE 5I66A 4ANKA 2IAMD 4UTAH 5MENB 3VFVA 4H8WL 3BN9C 3MBXL 5C0AA 1HXMA 2XKSA 1FUNA 1USZA 2ITDB 3MRDA 3MUGB 3MNZA 2DKMA 3DV6A 4LKXA 4C4BA 5D7SL 3TBCA 1A25A 4RZCA 2Q86B 1G7JB 2FLRT 2A1WL 3KPSA 4JPIA 4XCCL 2E7HA 3FHEA 2OV0A 4PRBA 5M95B 1RH8A 1L9SA 1JXKA 5F7EL 3D87B 1KFGA 2W07A 4TOYH 1EV2E 2F8IA 2D3VA 3PP3K 3LCYA 4FQLL 4Y16D 1Z1WA 2X1WL 2OX5B 2D4DA 2QBWA 4QRRB 3LN5B 3VSQA 3H3PL 3TWCH 1J11A 2EH7L 4OCYL 4L8CB 2GCYB 3HEIB 1PZUB 1OE1A 4MA3B 4EI5C 5C7ZA 2DMBA 2PO6D 3LZRA 1F3DJ 2D2OA 3LNIA 4DW2H 1EPFA 2D3NA 2Y25A 3IXAB 5EZIH 4PYHA 2WZPA 5JORB 2EUWA 2C8NA 2ZKHH 3S5LA 5AVWB 3UIYA 1XR8B 3VI4A 3TEYA 2Y7MA 4Q9BA 5E2UH 2HX7A 1HL8A 2OMBA 3GM8A 2RCSH 3UDWA 1A9BB 3RIAF 1QYGL 5BUGA 1IBGH 5DUBA 5EV7A 4YEFA 1GC1L 5T3ZE 3LH2H 1KTRL 3C6LB 1E4KC 1L7TH 5GGTL 2AJ3B 2IH1B 5DVKA 4M5ZL 1UCTA 5CHNB 5AD0A 2HWZL 1FCCA 3BPCB 4FQLH 2B1HL 2V5YA 1D7DA 1K2DB 1QBLH 5IMKA 4CBPA 5FV1L 1U8OA 1KELL 4UTAA 1DTUA 5I6PA 4B97A 1ZCRA 2F58H 5AQ0A 4TTDC 1YEKL 2OMYB 1XBRA 3M8OL 4MDJA 4N0YL 4ZFOA 3BZ4B 3I2CL 4TNWK 3I3EA 4H44C 4AQZA 1YEFH 1WRFA 4GKZA 1RCYA 5KN5B 5AAMC 4PLNC 3NN8B 5FM5O 1IAIH 3CC5A 4MNGB 1QR1B 5EU5A 1R17A 2G0LA 3MGOB 2JMRA 1DBMH 4AUUA 2Q6WB 4U0RB 2ATKB 1SXNA 5HVFB 3LKSA 2OSLB 1SEQL 2NLJA 4G9FB 3ECVA 4KK5D 5C3LD 3GBDA 3QDAA 1T21B 3GO1L 5TDOB 1QQDA 5GRZA 3PWJB 4WTQA 4LLMB 3BLPX 5B38A 3HC0A 1JDAA 1G9HA 5FYKL 2DM3A 1NC4A 4PJEF 5I30H 5ID0B 1YRKA 2P5ED 2CJSA 2I27N 3BUYA 2EDLA 3FCSA 2EE6A 3MODL 3PXJA 4MSWB 3FHQA 1AO7D 1EFQA 1NGZB 1PX8A 4W9CC 4R7DA 5DMKB 4R7XA 1F4HA 2XTJE 4WEEA 3KLDA 1QTYT 1M9SA 4JZNB 3H7BB 4QXTA 1RK0A 5IIEB 3QNYB 3HNVL 3NSJA 2D7PA 1JNLH 4PRHB 2A9AA 2OYMA 3QUKA 1ZXKA 3SDAB 1IO4C 5LAXA 1BYOA 3AROA 5J5EA 2HRPH 5IEKA 2TRHA 5F3HB 3WS3B 3ZL1A 1PY9A 1VPOL 1DEDA 3IDIA 3BZ4A 4RSVA 1CL7I 2PYEA 3MRQA 3BP6A 2F7IA 3GMRA 3JZYA 5DD1L 5I1GH 5IMMB 4ZMWA 2ZOLB 2ERJC 2UVFA 1MG3C 3VXTB 1BLNB 5C8JB 3CFDA 1MAMH 1LLAA 4DPRA 3VFVB 5B1KA 1CIDA 4HOWA 4CAGA 1MF2L 1W72B 2NY6C 3KPRE 4MS8D 5GQBA 1TJIL 5BRZA 1JFQH 1QX1A 1NAKL 5AW7B 4XPHL 3GBML 1Z5LA 3NFPA 3KL5A 4BZ2H 1FO0A 1H0DA 1YY8B 2EE9A 4LHUG 4XO3A 2PNDA 1L9RA 5E1IA 1BG1A 3MNWA 4K71C 3ARDC 5CD5C 3VD1A 4LPXA 1ZGLB 3RIKA 3S36L 1SMOA 3NJIA 1ZT4A 5GS2D 4Y8DC 2VKWA 3PHOA 3W5NA 3QWQB 2X1QA 4URKA 3BHBA 2X4UA 4IU2A 5D6DC 3ULUD 2RMNA 3BVTA 4A6YH 1Q1JL 3QUZA 4HJUA 1F6AB 2NNAB 1HH9B 1WFMA 3U1SL 1PZ5B 1WZKA 4CC4C 1H9VA 1EXUB 1JWSA 4QGTA 3HG1E 4ACTA 4Y2LA 4NHCH 1CURA 2ZX6A 4PRAB 1MNUL 4L2LA 1KJ2L 3RWJB 4KKBC 5JLZA 2A6IA 1MW2A 2HT2D 2QQKH 1AIFB 5CGBA 3U2IA 1HL9A 1SHWA 2CHXA 3L1EA 3PJSA 4XBPA 3N41F 2XJKA 1ITBB 5ADPL 2VAAB 4OZHB 4NQSA 1BGXH 2VDPL 3SQOL 4XWGH 2FJFB 5H4ZA 2GK0B 2VZ1A 3QUGA 1MNUH 3IJSB 1RXLA 2ITEA 2YC1B 4GFXA 5IQLA 1NBZB 2V17H 3R4DA 1WG3A 1QPXA 2AZUA 2B16A 3C60C 3WNLA 4U1SA 2FD6L 1IFGA 3SE4A 3P1VA 2EEBA 2VIRB 1SXCA 4MCNA 4ENEC 5IB3B 4YAQB 1T1YA 4WSKA 2J88H 2BP8A 5F9JA 4A38A 3WFHB 3FU7B 4AGMA 4AQ1B 1JK8B 1FAIH 3QFJE 3RJDA 4FZ8L 2Z91B 3TBSB 4AMKL 1N18A 3ZE1E 5AOMA 4L9LC 4XN8A 1ND0A 4HJSA 3S36X 5D7IA 5JZ7C 3GS0A 1QLFB 3GBMH 3G5ZB 5H37A 4GAGL 4QRQA 4XPHH 3BP5A 1XB3A 3RAJH 1TJIH 3U9PL 5IK3A 1MF2H 2P43B 5FOJA 4OM0H 5FCSH 2Q0ZX 3NCJL 1TJHH 3ZDWA 4H0LC 4C83A 2VLJA 3KBFA 2B15A 4JKPL 2XWBA 3GEWB 4GRWF 4R0LC 3LQMA 2HVKA 5KVEE 3CDCA 3EYUL 4I9XA 2DL2A 4AZ8A 1M42A 2BJMH 2VRKA 4X6DF 4H0HB 5D7JC 3ZMEA 3NPZB 3QXWA 3VG9B 3KLAB 5TF1H 4ZDHB 4U6VL 2CR0A 1ZA3A 5J13C 1CFTB 5HVWA 3BIKB 4DP6X 2DQCL 4OCSH 1F56A 2FH6A 5KAQF 3EUUA 3U48A 1V55B 2AJVH 3UAAA 3BRFA 3QUKB 4QMEA 1TZAA 1MVFA 2VMJA 3EJUA 3VI3E 4CJ1A 2X3BA 4RBPK 4WW2A 4OF3A 2J8UE 4NO0A 1LNUA 1BQ5A 1SDYA 2TSAA 4M5YH 4OJAA 2KERA 4PU2A 1IAMA 5J6SA 3MNMA 1KIPB 3D09A 5FA4A 2BSSB 4N90E 4KK9C 1AQ8A 3FRUA 1A4KB 2MCPH 4FMVA 3PV6A 5EZJA 1F6AA 1ZHLB 2B1AH 3BD4A 1SEQH 2VR7A 1XZ0A 2BFVH 3DWTA 1TVHA 4ABVA 1M7IA 5DJYA 5IFHH 5I75B 2J3SA 5HHME 5HJ3A 4C56E 1MJ7H 3D18A 2Z0BA 1W0WA 3OKKB 1AKPA 1IAIL 1DHKA 4Q89A 3K8KA 4G8EB 4NC0B 3TPUB 4Z7NF 2CD0A 4BSJA 4J4PD 1K8IB 1GY1A 4MB5A 4D2NA 5I76B 3TO4C 3RKPA 2IPKA 4PJFF 2UY7A 2WLJA 5IB4B 3QPQD 4E42A 1YEKH 2X2JA 5AYQA 5EU3A 4LL1A 3B2XA 3GMPA 1GYCA 1XGTB 5B38G 1KTDA 5GRYA 2WIMA 3ZBMA 3H8NA 1ADWA 1V5JA 4PRPE 5E8PA 5EMYA 4FEMA 3SDDD 5F89B 4ELMA 2YQ2A 1SN5A 4J2QA 1ETZA 1XXFC 5CN3A 3NQIA 5MHSD 1L7TL 1SHXA 2FSEA 2Q3ZA 3IK2A 1UM4H 4I18B 1OGAB 2XYCA 4J2XA 3ZK0A 1O75A 1JGEB 4HH8A 3PWLB 2A4ZA 3PAVA 4OZHA 4R0LA 3X3FH 5EHFA 1UGKA 1U30A 5LAXB 3OWRA 3REVB 3QUML 3F3HA 2OW7A 4OZFB 1I9JL 3OMNB 5AOKA 5JYLA 3QQ9C 4LCYB 4QCIA 2Y7LA 1EFXB 4UQDA 1TU2A 4PP1D 1YUKB 4YPGA 2EDEA 1BM3L 3DV4B 4S11A 3GLAA 3QG6A 4NRXA 5IVXE 2FQDA 2YMXH 2QTEA 4CMHC 1L9TA 2DWDB 2NX5E 4BYHA 3ILEA 3JWDL 1EHAA 4OCYH 3BUPA 1HSBB 5E6ZA 3TZVB 5CZKA 5E94B 3HAEA 4GYBA 5EF2A 1KCUH 2WN2A 3CNKA 3QJRB 4J3OD 5BZDA 3H9ZA 4ANXA 1J0IA 5F7EH 1XSKA 2X10A 4NDMA 2EVIA 1OAZH 2Q87A 1MHPL 1XAKA 3VXUB 1MJ8L 4LCCC 3UAFA 3QHFL 5J6HB 3O6LH 3L4WA 3O9WA 1FP5A 5BRPA 3TURA 3TV8A 3PWPA 2QPSA 5A40E 3AQXA 4BZ1A 3RWFB 3ZSTA 3RX8A 1F4XH 3QK0A 5I6KA 25C8L 2UWEF 2XXFA 4X6CE 3ZDXB 3A24A 1TLMA 2JQMA 1G7JA 4UTAL 3GSVA 4WWKD 5I1LA 4GAFB 4K9JA 4Z3JA 1R3KB 3IMRA 3TGXA 3ULVH 1N9PA 1XEDA 1ZGLP 5JQHC 3REWA 1EERB 4OCNC 5F96L 5TE4H 4L3EA 3SHSA 5DZVA 3EH3B 5EUOF 1UJ3C 3DARA 2C3XA 5F93C 2HKAA 1HH6B 4HOMA 4ZK8A 3U25A 3FH8A 5LUMA 2QVFB 2WCGA 4N2OA 3WSQH 4OT1L 1Y07A 3V6ZA 3KZ8A 2G2RB 2DMCA 3KPRD 5B3NA 2JKLA 1WBYA 4CGTA 3MV8D 4R4FL 1WSST 1E6JL 4D9LH 4WI0A 2Z7UA 2WM0A 2YPKB 3EDEA 4HJIA 1TJXA 2PXYB 4KXCA 1JPEA 1NBYB 5FO8B 3TT1L 3GJFA 3GKWH 4FHKA 3L4CA 1KCVL 2JNZA 2JLLA 5DD0L 2JQZA 4WV1C 1ES0A 5TDPB 1HL4A 3RWGA 3IGAA 2FT7A 2NSMA 4NJAH 3SSGA 4X6BA 4PH8A 2IGFH 3JWOC 1EK3A 4GRLC 4FX5A 2WNWA 4CVUA 1LXMA 4G6JH 1BVZA 1MQ8A 2NYKA 4ONGL 5EBGA 2EDYA 1HVXA 4HFWB 4R26H 4LL4A 1HXKA 2GPZA 3KGSA 1MCOL 5I1CH 4DKEL 1S7SB 5T33H 1JPTH 1SY6A 3VAEA 4AVJA 1HHIB 2V2TA 4BGDA 3BUQA 2EC9U 2XJLA 3INUH 1MCLA 4WTZG 3QRBA 4H8HA 3QUYB 4A39A 1O6VA 3BP4B 1HT6A 2BP3A 2K8QA 5E8OA 1F3DH 3EBAA 3KPQB 3EGSB 4IRSD 4QNPF 3SOBL 2Q86A 3SDXE 1T6VN 4YDKH 1BQHB 4X7TB 5J13B 4XNQA 4RMWA 5C2UB 3SKMB 4LCWD 3LNFA 3ARFA 1L0PA 5E1QA 4J7RA 4WJ5A 3PRZA 3BSHA 2CBOA 2L7QA 3CZGA 3Q1SL 5AVQB 1I9IH 3EH4B 4GRWH 2UVEA 3X3GL 3T3PB 3IKKA 5ESQA 3MCKA 2J4WL 3AG4B 1PMYA 9CGTA 3NK3A 5DR5H 3MR9A 3F84A 4LSSL 3WHXB 2PTVA 4LOEA 5MI0B 2JCWA 2OI9B 1VFAA 2Y07H 3U36B 1CICD 2NCEA 1OLZA 4H8UA 1VACA 1DE4A 5TPWL 5KS9B 3PAUA 2H6PB 3O9WD 2VXSL 2WK2A 2Y23A 4GRLB 1LMKA 5AAPA 4ORGA 5KYUB 4OLWL 1AYRA 4HS6B 2ADGB 2YAOA 1U3HC 4DK3A 3AS3A 4G8GA 3BEWB 3N43B 1KIPA 4FQ2L 5CJQL 4AL8C 3ARVA 1BAFL 3WTVA 2CCVA 2G60L 2J55A 1NIAA 4FYTA 2QSQA 3RL2A 1N67A 2DLHA 2BNQD 4O51A 4KVCH 2APBA 4QKXB 1QFPA 3MV9E 5F0LB 3FJTA 5E2VL 3KE0A 1RZKC 5FIEA 1O9VA 5DD3H 2EVJA 1KC5L 2AMUA 4XNMB 5ID0A 1XMWA 3FTYA 1JTOA 5DZJA 5HPMB 1CL7L 1FSKC 3OHXC 2JI1A 1BF8A 4QNPE 4AH2B 2K45A 4TVUA 1CTNA 2X3AA 4PJ5B 4JRLA 43CAB 3R06B 3KHQA 1E28B 4MQTB 2ATKA 2A9NH 2A2QT 3WE6B 5ESVB 1JV2B 1Q0EA 1UATA 5E5LA 1UVQB 5EBMB 1NOFA 1CJYA 4YVUA 5I75C 4HF5H 2H7WA 4J3VA 5FYLH 1WZ1L 1DJYA 3QO1B 4I1RA 5F7DA 1MFMA 2Z9TA 3C5XA 2EINB 4FABL 1MZZA 4TSBH 2ZWLT 1MIMH 3PWJA 3GSNB 1EDYA 3SE4C 5IHUL 2ZX7A 5I1DA 2GSGA 1AP2B 3HZYB 2LAGB 1KFAL 3GGWA 3MNVB 3O2WH 1NTDA 5IEHB 4HZLA 3W9EA 1IAIM 1LM8V 2IWEA 1Z3GL 2IO5A 3MRHB 5GSRB 2NY2D 4GEJA 1OARH 5ACMA 3SE8H 5I6MA 2IOIA 1OB1B 4KPHH 5FKPA 4DP4X 2KHAA 2P5EB 4K3EH 3RU8H 5CCKH 4XMVA 3KCPA 4KH2A 1IBZA 5AW5B 1LD9B 4IDLA 2YAMA 4AE1A 2F2HA 3ARFC 4FL4B 4LVEA 5E9DD 5GGRY 2ZTBA 3MV8E 4UU9A 1G7IA 1EHKB 4IBTA 1DQIA 3F6LA 1WAEA 2ZYHA 1U93B 2G4EA 3ML8A 2WQUA 5I16A 5I6OA 5DMJB 4X6BB 4PS4L 1VEPA 2HPTA 5AOLA 2DF3A 4HCRH 3KR3L 4G7RB 4Q4IA 3ATAA 1FYTB 5DJAB 3QXDA 1C8PA 4XN7A 1H3TA 1FYHB 2EYRA 4ZPTB 4L18A 1WIOA 4LDLB 1UWFA 4KZDH 5FS5A 5CZVL 4XNUL 3VU2A 1BJMA 4HYTB 1KPVB 4C4UA 1CYGA 4F8TA 1VESA 2V0AA 3ECBA 2FR4A 3GHBL 3O11A 3DUHA 4L4TA 4IHOB 1YLBB 2D0FA 3AM8A 5I66B 3TEXA 3RIFK 2R0KL 4AV0A 1Y6NR 5CGYC 3U4EA 1P7HL 4NAJA 2BVTA 5FYLE 4F37K 3LMJH 3FF7A 1GPOL 1OB1A 2V9QA 2AQQA 1ED3A 2OMNA 3FRPB 1AGCA 5L4JA 5C70A 3KDPB 3CVCA 5F6IB 1I7ZA 4PR5B 2QZ5A 2K78A 2PCYA 1S7WB 2NUPA 2MCAA 4HX1A 3MI6A 5HHOE 1NLDL 4Y19B 1G1OA 3T77B 5H35A 1DL7H 5F7MC 4U6YB 3IM1A 4HD5A 4Y5YB 3WNNA 2NR6C 3PV6B 4HFUL 1LWRA 2QSVA 4EZLA 1HKLL 3IDJB 1LO3H 4HK3N 2YUVA 4NZUL 2V8MA 1LTXA 3HHSA 1AG0A 1E27B 3J2PA 3VA2C 4HT1H 1MLCA 2FYYB 2VJXA 3TPUA 3LZFH 1XH3B 4Q9CA 5GJTL 3THML 4JO4L 5HJ3B 1HXMB 4LSQL 4B5ZA 1JPGA 4PM1A 1BVNP 3RL1B 4MB4A 4YMPA 1SXBA 2B0SL 4NO3B 3RY5A 5I24A 1FH2A 3BP7B 4F57L 3P4LA 1EAJA 4FQXA 2RH0A 1FC1A 3ZRSA 1IM3D 4YXKH 2NRDA 4IBYA 4YNYA 5IB1A 2FK9A 2H8PA 3A47A 4F5CA 1PLAA 4LIQE 4N0UE 4PB9H 1L6ZA 5HDWA 4Y4FD 1CYXA 2DQMA 3HFMH 1MFAH 4QDGA 1MG2C 1PFCA 3BH8B 4KOBA 2OTUA 2YEZB 3ZDZE 2EE2A 5D71H 3IXAA 5JORA 4KDTA 1UKTA 3KNBB 4AEFA 2YD0A 2ATAA 1TLKA 1CBVL 3RHWF 3HB3D 4WJ5B 1JK9B 4H13C 4MAYA 1FVEA 3V95A 3F64A 3ARSA 3L1OH 2GC7C 1Q9LB 5L8LB 1E5ZA 2ADJA 4FA7B 3EGXB 3HS8A 4MAYD 1ORSA 4KI5E 4XXCC 3V5KA 4Y4HB 4TNVF 3W56A 2X87A 3PHAA 3SCMB 4WUUD 2Z1PA 1BA9A 3H9SA 5C08A 5I8OL 4PBDA 5DK0B 4AYDC 1XDTT 4UILH 3MXVH 5C0CD 3DI3B 3JBG7 3BYTA 1CWVA 1OQXA 1PIGA 3OXSB 1AQKH 1TXKA 3KH3A 5EOQL 2EYSA 5IHHA 1W0WB 3APFA 3S4SB 4QRBA 4XN5A 4MJ5B 5K33A 1BFVH 2A6JB 2WLZA 3IJHA 4F33B 3WDHA 5ICYB 1PTZA 2F54B 4FXLA 4D3CH 2GJZB 1AGFA 7FABL 4HIEB 4XRCA 4MNQD 3SGDI 2YAHA 3MLPA 5LGKA 1AQKL 1A6AB 2KT6A 1F13A 2CRIA 5L2JA 4AJWA 4DOHB 5J3HC 4UYPA 3FTVA 1R5VB 5DQDH 3W57A 1P4UA 5JIPA 2WXLA 1MWAH 5D70L 1Q4NX 1D5XB 2GBAA 3OAUL 1OK0A 1XTMA 3QUMB 2JXMB 4L05A 4F3FA 1P1ZA 5D1XE 3H42L 2X9ZA 3E1ZA 4MSWA 2DQHH 3WXVL 3NZSA 1I4FA 3L1OL 3MO1B 2DYPA 1AHWA 4PJ5E 4GG6E 1XF3B 3C09B 1JHLH 1ILUA 4YFEA 2FYYA 3MTXA 4LCIL 4PSPA 3WDJA 5FGCE 2C3VB 4LGRB 4WUKL 1XGYH 3OXSA 3LN4B 3QIBA 3QNZB 5GISL 2TRYA 4NI3A 4MMXC 1ZT7B 2ZF9A 1K4CB 3HFML 1SYVA 2CA3A 2VZVA 3IMTA 5M7QA 4OLXL 4FNRA 2ZPKL 2NY5L 2FIKB 2HT4D 2JIXD 3VXSA 4XC3H 5DEFB 3NJJA 4L3EB 3WNMA 1X9LA 1ZVSB 1GZQB 2CKBB 4LRNH 3HR5A 3NRPA 5GS3A 3S97C 5CKAA 4YFLI 1WAPA 5CGMA 1TITA 1J9TA 2EYTA 1XGPA 3ARPA 3CU7A 4XNXH 5T1KA 3ARUA 5JHDB 3IKCB 5AVZB 2CLVA 1JCKA 2X6VA 2MQCA 3GUTA 4LPYA 5LNEA 1NJ9A 3MGTB 5T1LB 3BPNC 1TTBA 1RSYA 3LZFL 3OTTA 4XHJD 2R8SL 2JK5A 1G9EA 1NC2A 3OSVA 3D51A 4BHUI 3OG6B 3T5WA 4X4KA 4LQ1A 3NIGF 4FFYA 3ZYJA 1U8PA 2G3MA 4XMUA 3FUFA 3TPKA 5T3XD 1RUAL 4DP8X 3ZDYB 2XICA 1XF3A 2OJZL 2X6CA 1OAYH 1ZWIA 4IMKA 4KUZH 4U6TA 1NLDH 5E6YA 5KYYA 3LPGA 2HMIC 3A3YB 3GDCA 5I0YA 2C9QA 3BRDA 5E5RB 3JTTA 1LO0L 1TSHA 4F9PC 4XNYH 4JFXA 3VQMA 5A2KH 5A2LH 1A64A 2L4OA 4JHWH 5IT2H 3SYCA 2DIJA 4K7PY 4JZNA 2J21A 4XN9A 4MDIB 3FMGL 4KO5A 4L4JA 1WGOA 4O00A 2NY7L 3M1CA 4JVWA 3CV5A 4ZW3A 5KVGH 5T5NF 4Y1TA 2XY2A 2BXYA 1J9SA 5TH2B 3BPLC 3GHBH 4D9QD 1CXIA 3VSVA 2VISB 3T1FA 2OK0H 1CT8B 4MJJA 1EEUA 1JGVH 2XIIA 4MQXC 5CLYA 2KZKA 1JHTA 3HG1D 1T2QH 3REWB 1K85A 1MRDL 3KLLA 4GT0A 2HFGH 3QORB 4W93A 1WE5A 5E8DL 2QVKA 4PS4H 5SX4I 5CF3A 3MCKB 3B9EA 5LXGH 3LIZL 3WY4A 2X0VA 1VF5C 5FW8A 1AE6L 3MRPB 4W9DC 3ZL4H 4BQ9A 5A2IH 3QXAA 4OJDH 1FORH 4EI0A 4Z77A 5JHLL 1WO2A 3DHMA 1GIGL 2ZUUA 3PE9A 5CCKL 4LBEB 4BM7A 4NQEE 2C7UB 1HI6A 5DI8A 2VQ1B 2VL5A 3AQZA 2DPKA 3CSBA 3H1ZA 1EZVX 1PKQA 3TNMB 1SDDA 1UJ3B 4FQQB 4PJIF 4LP5A 3D3VD 1HHIA 1KYOK 4QXUL 1TTRA 3FN9A 1AGDB 2B9AA 1SNRA 2WAQA 2NY2C 1FFNA 2JWYA 4GRWE 2QSCL 4GIPD 1Q8MA 4AYID 4J1UA 2ZJSL 4P3WA 4P2OB 4WNJA 2YOCA 1IC1A 2OJEA 2ROXA 2XTJD 3JTTB 4LVOB 5JHBA 5C0FA 2BWIA 3HE6C 4FFTA 4OCRH 1MJUH 1PDKA 5AB1A 2BNQA 3MRKA 4Z7OF 3ARDB 4EIUA 2HUHA 1BZ8A 1FZOA 5A7EA 2VLRD 1XGUB 5BRZE 4PJ8C 5BQDA 4RZCB 4HK0B 4JUTA 1KJ2B 3QZBA 4JDZB 2RJMA 4NUGL 3ZTNH 1EAQA 1EFXA 3VXSE 2AP2A 1JZ6A 5E2VH 3LRMA 3SO3B 5CUSH 2EKJA 1AXTL 3D69B 4C4KT 3BYYA 3A4AA 2GFBB 2BHUA 4ALAL 2P5WA 5CWSB 3IDGA 1REIA 2G60H 2OMZA 3S5YA 2I07A 4BFFA 4J28A 2O5ZH 4NO0D 3G3LA 3J7HA 3TFBA 2I32A 3FB6A 4KRPD 5B38B 4PJXB 1DYZA 1E2WA 2NDFA 3SQRA 1X5HA 3DV6B 3MLRL 1QPPA 5HHVH 3S3JA 3QDJB 4HBQA 4M7JL 4XAWH 5E8NA 2WLMA 5FK9A 5B1AB 1NCOA 3DURB 3F2LA 3QA3A 3RQ3A 15C8H 3QQNA 1G7MB 3OSKA 4FQCL 2K4WA 1AQMA 3BE1L 5DD6A 4P5TB 4MBOA 2Y07L 3INOA 4NM8H 2NR6A 1SLUA 3HZMB 2VZUA 3MYJB 4ZFFA 2UY7B 1CD8A 1IIIA 4KTEL 2P44B 4W4OA 1RUQL 1FIGH 3ENEA 3GI8H 5HDQH 1DBBL 3RBSA 5GZOC 3V2AR 4JGNA 4ZUTB 3UTZA 4XE0A 4KQ3L 1A2YA 3MJ7A 1GHFH 1Z9OA 2ZOKA 3LV3B 1P6WA 2AXGA 2Q7AA 2VH5L 3IMSA 4TRPL 4KOCA 1O7SA 1CGTA 3II1A 3QXUA 4M1CC 5I17A 5DJXA 4ZDHA 2EDQA 3TONA 4AGNA 4Z7QE 4MA3A 1I75A 5J89A 4YLBA 1G6VK 1QEXA 4KTEH 3S96A 3SBPA 1LMIA 3D3VE 3TV3H 1LDPH 1NFKA 4TULH 4DJMA 1QSZA 2O72A 3FN3A 2EIEA 4H1LG 3FB6B 4K3JH 4LDOB 2EILB 3FYIB 1A4BA 1YPZA 15C8L 5F3FA 3ZYZA 1KXTA 2WQ8A 5T33L 4DKEH 4XZUB 4JHBA 4XBGA 2HG0A 3V4PA 4F8PA 5E00B 4LCUB 4PJEE 3HCVA 2Z4QB 1FYTA 4MD0B 2F74B 2WP3T 3ESPA 2D73A 3BHBB 1L0YA 4YXHL 4RX4A 2Y6SC 2OS7A 4TL4A 1KDIA 2IQ9H 2G5RA 4PG9B 1KCVH 2ZOLA 1AXTH 4L9DA 4X8XA 2WPGA 4YH6A 4EZJA 3ZPDA 3ZYIA 5CD3A 2CPUA 1RY7B 3MRLB 3PUCA 2ZQKA 3BT0A 3AABA 5I9QB 3AACA 3MRBA 5HGDB 3JWNC 3AB0C 1XF5B 5HYEA 4PVNA 5IW3A 5ICXB 4OCMC 3E2HB 1P9MC 2DJUA 3WSQL 3UERA 3VTMA 2SEBB 5CILH 4D8PB 4L8BB 1CXLA 3WEXA 4E0RB 3OB0K 3H6JA 1E8WA 4JFXB 1FZJB 2OMUA 3P77A 3PGFL 5F96H 5TE4L 2YD7A 3SZ6A 4Q9QL 1JIBA 4JX0A 2DMKA 1CGYA 2OULB 4GBXA 3SDCC 3V7MA 1NGPL 3WJJC 1TVBA 1NBQA 3I75B 1A6ZA 3B7TA 1W0VA 2YBRA 4YVNA 4LEXH 5F1NA 2YEQA 1C8QA 4U6HB 3F7RA 4ENZA 4Z0BH 1BX2B 2CJUH 4PGBB 4LHUD 4M4RA 1JGDA 5BJTB 1U3NA 2JJVA 3T09A 3MLZH 1FNAA 5AVYB 1OF0A 2IH3B 4ZUUB 3JWNH 1ZLUH 1UC6A 3TFKC 1MJ8H 4PP2A 4HKXB 3PL6A 1RIHH 1GW6A 4FE9A 5CN2A 2HJLA 3FT0A 4B96A 3S8WA 2Y7OA 5E2WH 5E9NA 3S6CA 5KYUA 5GS2H 5JQ6L 4HIEA 2DQGL 1P84J 4BUHA 3HMWH 1HHKB 2WLKA 3DSNB 5F88B 5FO7B 3GXUB 4FFVD 3ZRCC 2C4XA 5GGQL 2I9TB 1EGJL 1TG8A 4IBSA 4NGHL 4IKNA 3EG9A 3FSZA 2NY2B 3CDZB 4GQPH 2E7LA 4AEEA 1BWMA 4JY4A 1EXUA 2FB4L 2VN4A 4QRPA 5FGRA 1DVFC 3V5HA 2HFGL 2AERT 3EF4A 4OKDA 2PP8A 3T65B 3B2DC 1B4TA 1M1XB 5DC4B 5JYMA 2R7EB 3FO2B 3R7RA 3WJMB 4BJLA 5CBAB 1JGVL 3P73B 4EIZC 4HPOH 4TSAH 5FK9B 1VACB 5AVSB 5T3ZH 1HJCA 3BGAA 2B59A 4I5BB 5KBNC 1JI1A 1AG6A 3QEUB 5DUMH 1QFOA 3QHZL 1NCCL 1EUUA 1UM4L 2FHCA 3JZ7A 3AFLA 4IS6A 4QAMB 3QDHA 1Y1UA 5D9SA 2FL5A 3WGVB 1C12A 4JHZA 3FMGH 3FTSA 4O58L 1MPAH 4PWJA 2V2XB 4U1IB 4ELME 1I8LA 3HE7B 5E00A 1FFRA 1A3RH 1MVYA 4ZD3H 1LO2H 4AYBA 1X4XA 4B9PA 4XNYL 1LO0H 1P9MA 1NBVH 1X7QB 4YZWA 1RHFA 5I1AB 2DBLL 5ALBH 1AD9B 3GFUA 2KQMA 3PDOB 3NIFE 1CB4A 5D1ZD 1RJYB 5IB2A 2KS0A 2XSKA 3WUWA 4KRMB 1OF2A 1TZGH 3MGTA 3NFSH 3ZO0A 3OKLA 4IGBA 4L4VB 4PCTA 3EW3B 1ES0B 2CGRL 1MJ7L 4QGYA 1HC1A 4LZKA 4CKVX 4ZQTA 4OFDA 5E9AA 2OP4H 3EXLA 4WTXA 4DO5A 3PWVB 2IPTH 3ULUH 2Y22A 2MMXA 4C58B 5CEYB 2OYLA 4PJGE 2SODB 3RWCB 3VJ6B 2UZYA 3FQ2A 1IQDA 1WPCA 4F8NA 1GVIA 3WIAA 1QWNA 4XNXL 2BY3A 4CA4A 4QTIH 5ITFB 3VMNA 4U6XA 4WHCA 2X9XA 2ADIA 4DPCX 3ATBA 3RUGA 2B14A 2CK0H 2ZPKH 5DD6B 4JB9L 3KPTA 2PETA 3GGWB 3MNVA 4BSWA 5IOPA 1QLFA 5HHMB 3HG4A 4TNEA 2FX7H 2BHYA 3D34A 5IQ7H 2OZ4L 2A4EA 5HI4C 1URIA 2LV4A 4DP0X 1OT4A 4DZ8A 2IH8A 3DX7B 3L45A 3CQQA 1F90H 3L08A 1QBAA 4WFHD 2BJML 5IESL 2VLJD 1UXWB 1MFEL 5HDBE 4U1MB 4ZMOA 1UVQA 1IC7H 2FCBA 2VC2H 4PJFA 5EBMA 5B21A 5K93A 5MENE 4FQHB 2VN5A 1PL3A 2E0PA 4Q56A 2AJXH 4WHYG 3V4PH 5D2LF 5C9JA 3BKCH 4F15C 2DQHL 5H94B 1FLRH 4O02L 5TGBB 4R83A 3ZO9A 2COVD 1I8IA 3C9NB 1NIDA 1IZKA 2UY6A 5DC9B 3KS0J 4N8VG 3EYQD 3RAJL 2EDNA 1KYFA 1AZBA 1IILE 4ZSOB 2QLVB 1BECA 3ALPA 3NJFA 3SJVD 4MCYB 2JKTM 3BFWA 1OPGH 2UZXB 1WFIA 4OJFH 1SHMA 4PS8A 1K4CA 1C16B 3T3ME 1FA4A 3JWOH 1JNHB 4AMKH 1SBBA 1N59B 1X5KA 4FZ8H 4OF8A 2PR9A 4F7CA 1JZ4A 2EXSA 2F53A 3T2QA 1MLCB 1PLGL 3T0EC 1EHLL 5D4IA 1TU2B 2CPCA 2I7OA 2HH0H 3T0BA 4F20A 2R1WA 5BPPA 3DVNB 4K2UH 2E3VA 4CDGC 5EFIB 3BDBA 3Q2LA 4FFWD 4KXZH 1BFVL 4PJ9D 2EE3A 2VO8A 1MFVA 4H2AA 3UMNA 4NKQB 1E7VA 3QDGD 1SZNA 4MCZB 1WA2X 4EI5A 3AXHA 3L16A 5IM7B 2UXVA 2F7PA 1K8DB 2K7QA 3AVEA 3FB5A 4CN6A 3HI6H 4XX1G 5I8OH 2NXYB 5FXCH 2VRQA 3V8CA 5AB2A 1A3QA 4X8GA 3P73A 2PYFA 2XIBA 4ZOBA 1D3CA 1Z9LA 4H20H 4AW7A 5J9PA 4BFJA 1HNYA 4W1TA 4MMXB 1PG7W 3OF6A 4PGCA 1CFQA 3UAJA 4NHCL 4B0MB 4DK6A 1NGQL 1TYJA 3ARBC 4ZUVA 4ES8A 1J10A 1CBVH 4IRZL 2YWYA 4JPQA 3LX9A 3OBAA 4XPGH 5GIRA 4B95C 1TO5A 3UTPD 1ZHBB 4PJ7E 5D71L 4NAQA 1X9RA 4TLKA 5FV2A 2NMSA 3T3MB 3IMVA 4KXBA 2O93L 3BP6B 4LAJH 1ESOA 3QWRA 4GRWB 4XH2B 2F8XC 2ZCHL 5F3HA 3QDGB 4AVKA 2OYKA 3PWUA 3TYFA 2KLTA 4Y2DC 4F7TA 4CSPA 3SDDB 4ZUSA 2X53A 1Q94B 5FO9B 3CVDA 3BEVA 4Y19D 2F6AA 4HD9A 4TVPD 3UABA 4PV9B 3ULSA 5GZOA 2QGBA 5HHQA 4FNSA 1H8NA 5G4OA 4G7YH 4M9PA 1CFSA 3F7YA 2CBMA 5EZOL 1JK9A 1M7XA 4GUCA 4MAYB 2KL6A 3UP6A 5SWZA 5CJ5A 3H4HA 3MLWL 2ZD0A 4FQPA 1N5AA 3A0OA 2OL3H 4BEIA 5J1SC 3GIVA 2ZAGA 5HYSB 3AWEA 1TFHA 3EAKA 1R46A 3F04A 3RWHA 3ZMNA 4RMQA 3TO2A 1GTNA 3FFCD 4ZYKA 4JHVA 1P0SE 4PVMA 2G2RA 3UYPB 3VVWA 1SJHB 2Y06H 3VSUA 5IB3A 2HG5B 4OLUH 3LTVA 1CN4A 4JRXA 2DLFL 4Z7VF 3QDGE 1IGIL 5IF0B 5BZZA 1PG7L 5C0DA 4HC1L 3CFCH 5ID1B 4O58H 2APTA 4HH9B 3B7RL 3OLIA 4IKJA 1XXDC 4GLRH 2R0KH 4BK5C 5I1LB 2BSEA 1J0YA 1AZZC 3BKML 4KKCC 4HWZB 1E8YA 3HZKA 3T0DA 3X1EA 2PWHA 1CDHA 2GK0A 4JCMA 3KXFB 5HYJA 5FA3A 1TPXB 1LILA 4K9EL 2NXZC 4XNUH 1HHHB 5CZVH 4MQ7A 5LDUA 5AWNH 1JYXA 4XP6H 3UG3A 5EU4A 4TM9A 1LEIA 4P23A 4RAVA 5HYQB 4G9DB 5DT1H 4Q58C 2DS4A 2W1NA 2GQHA 1X5XA 1PY4A 2XRAH 1ZLSH 1BBDH 5JDSB 2HMID 5EDSA 1P7QB 5CLWA 3D6GA 4Y2DA 3F85A 2VDQL 5ITBL 5CJXA 2YUXA 3NEXA 2F58L 3B37A 5FO8A 1UURA 2CAKA 2HJKA 3UJIL 1DQKA 2WO2B 4RRPG 5IFAH 4RGOL 1B88A 1TF4A 1FVDB 2VDMH 3CFTA 1JRHH 1ZE3C 2ZT9C 4NWUH 1LP9B 5C0AD 4BELD 3HI1A 1MFCL 4R97B 4X5XA 4KPHL 4NFCA 4FQJH 4PJBF 3AT8A 4H0IA 1A6UL 1JD9A 5D2LB 5KVFL 1F4AA 2VR4A 5DXWA 3T0VA 3CC1A 1GGIH 4P5TC 3PG2A 5IHUH 1X5YA 5J7CC 3UTTB 3LY6A 1MIML 3QWOA 1A1NA 4P5KB 4Z78B 4NEHB 2AF2A 3U30C 2XT1B 4Z3IA 4X7EC 3IKCA 4AXWA 5TE6L 5AG9A 1KIUA 2FYVA 4NP9A 4MD4B 1A6TB 4F5CE 4JFVA 3O2DA 4ONFL 2CO1A 2ALWA 1XF5A 2EH7H 2A9NL 1D2PA 1BFTA 4KBPA 5C07A 5CEXA 3KCPB 5DK0A 1E50A 3BMVA 1E3ZA 2QVMA 4X80H 4JDTL 3T2LA 4X6CA 2OZ4A 3CX5J 1EVUA 4PWHA 4QRRD 2KDGA 1J48A 3R0MA 3IEAA 5DA0B 3VXMA 2WJ7A 1IAOB 2C4FU 4XCCH 5DD3L 5I23A 4M7ZB 4KNSA 4MLSA 4RGMB 4ZSOE 4PJCF 2OCJA 5A2FA 2H0JA 3VCLA 1CGSL 3S8GB 4U0QB 4NQVA 4HHGA 2WBXA 2VR3A 2YLKA 4P07A 5F9AC 2XCMC 5L2KE 1K5NB 1YPZB 3L17A 4DSYA 1SBSL 1KB5H 2EJ1A 4X9GA 4IIZA 1IGML 4UANA 1A8ZA 5JIMA 3H56A 4QTHA 4MZRA 5EEWA 1JZ2A 2VXSH 1A4CA 1FGVH 1M6UA 4PJBA 4QCIB 4R9HA 5HYSA 1UH3A 2IG2L 3RZCB 4HIHA 4MWFA 3RKDC 5E6IC 3C5ZD 5HGAA 2HFEA 3L5WA 2E7BA 3NJHA 2Z31A 1A7NH 4DGIL 1TVBB 3I75A 3P54A 1GOFA 5I19L 2JE8A 2NY6B 5DR5L 3S3PA 1ZE3H 4WJG3 2FSEB