2AFNA

Structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
331
Chain Sequence
IAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
total genus 88
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA02
5EHFA 3T6XA 2XV2A 1GS6X 5PAZA 5D4JA 4CSPA 4FAAB 1JXFA 2BP8B 2FT6A 2UXVA 1AQ8A 1B3IA 1L9QA 1XB6A 2WO2B 3NJHA 4YSPA 3AG2B 1PLBA 1DZ0A 4KOCA 2YQBA 1SF3A 1NIEA 1AG6A 1OOWA 1I53A 4GP8B 1M56B 3RYMA 1ASQA 1KV7A 1PMYA 3SBRA 1PNCA 2FT8A 3UADA 3QJUB 1W6LA 1ZIBA 4BXVA 3V9CA 4E9XA 2TSBA 2BZ7A 2UXTA 1JZGA 2VW4A 3NJLA 5F7BA 3UAAA 4YSAA 3NT0A 4BWUA 4F7KA 4YL4A 3GDCA 3CZUB 4NB7A 3NSCA 2CUAA 3WI9A 5AKRA 1JZJA 3ASNB 2BW5A 3EH3B 2VN3A 1J5DA 2HZHA 1PY0A 1ET7A 3HB3B 2YAFA 2IDSA 5B3SB 4N4YB 1SF5A 4DP9X 4DP8X 3PAZA 4YSDA 2AZAA 1NTDA 2XWZA 3IN0A 3S3CB 2IWKA 4YSUA 2H47C 2MTAA 4DP0X 1E30A 4AX3A 1M57B 2GI0A 1XB3A 1X9RA 4G70B 2PP7A 1ZPUA 2YAHA 3EH4B 3ZDWA 1JVLA 2MRYA 2TSAA 4DP6X 2DWTA 1L9RA 1PZAA 2QDVA 3TBBA 3FSWA 4DP1X 1OE1A 4HCGA 5I6OA 1JZIA 2XLLA 1PAZA 4BWWA 2PPCA 2FQDA 2IDUA 2UX6A 3FT0A 3FU9A 2BP8A 3GYRA 3QJRB 4DP5X 1AZNA 2FTAA 1J5CA 1YLBB 2GB2A 4JKNA 4E9WA 1CC3A 1JXGA 1NIDA 3SQRA 4A2HA 1FA4A 1WS7A 4KO5A 3DIVA 2XYBA 1ZDQA 5LDUA 1AZCA 1RCYA 2BWIA 2CJ3A 2ZWNA 3ZBMA 2PPAA 2B08A 1IUZA 1BXAA 2PPEA 2UXGA 3OQRA 2X88A 4HAKA 1JZFA 5I6MA 2IDFA 2DYRB 5B7MA 1SFDA 4WKXA 5A7EA 2IDQA 1PNDA 2YAQA 1TKWA 1GS7A 1GYCA 1AZUA 5FC9A 1V10A 2GBAA 4AKOA 5I5IA 1CYWA 1ZV2A 4WTQA 5I6LA 1OV8A 5I5MA 2GHZA 2QPDB 2J55A 2VM4A 3S3BB 4E9QA 2Q9OA 1A4BA 1OCZB 2VSKB 4L0PB 5B1BB 1BEXA 2NRDA 1CYXA 1UATA 3T6VA 3S3DB 3EF4A 2FWLB 1KGYE 1N68A 3FPYA 1W6WA 1EHKB 8PAZA 3NJFA 2YXWA 3ERXA 3NSFA 3TU6A 3OM3B 4A2EA 3FYIB 1HFUA 5I6PA 3NJMA 1BXUA 3X1NA 4F2EA 1MG2C 1QNIA 1IC0A 1M9WA 1AIZA 3N2JA 5I6KA 3X1FA 1ILSA 4E9TA 1SDDA 1EZLA 2FT7A 1JXDA 4NAJA 3BVDB 2P80D 1ID2A 1JZHA 1ET8A 2I7OA 2EIMB 2HXAA 3ASOB 4A67A 3AW5A 3NJKA 3WNIA 3FSZA 3TA4D 4FA7B 1MDAA 6PCYA 3FU7A 2HRHA 1SFHA 2I85A 2VW7A 3NSYA 3IN2A 1J9TA 2YAPA 2OJ1A 2GSMB 1BQKA 3JT2A 4N8UA 3KW8A 4AKQA 1KCBA 3IBOA 3PCYA 1ZIAA 2PP8A 2UX7A 4Q8BA 2DY2A 3UGEA 9PCYA 3QJSB 4KNTA 1SHWA 2AVFA 4RH4A 2GC7C 2RACA 4A2DA 3FPXA 4A2GA 3NJGA 2H3XC 4MFHA 2XUWA 1BQ5A 3DTUB 1E5YA 3X2QB 2BWDA 1SJMA 3AG1B 1SNRA 2VM3A 3NP3A 3S8GB 5TK4A 4YSTA 2H5UA 2E86A 1PCSA 4GXFA 3NJIA 1NWPA 2PPFA 1OE3A 3AG3B 3IEAA 1ILUA 4BXSV 3PAUA 3ABGA 1IKOP 1URIA 5B1JC 3NSDA 1WA2X 3FSVA 1J9SA 2HX9A 1NWOA 2IH9A 1X9UA 3WIAA 5IY5B 1RKRA 4HIPA 1NZRA 2PPDA 2JXMA 5D4HA 2IWFA 5AZUA 2HX7A 3OMAB 1ASOA 2FNWA 4GP4B 4E9VA 2HX8A 1AZRA 3EHBB 4JHUA 2GC4C 4W1TA 1AS8A 1L9PA 1PLAA 4P5RA 2R7EB 4BWTA 4GYBA 4HCIA 4KO6A 4A66A 1GSKA 4AI7A 2DWSA 4HALA 1WAEA 5AFAA 4YSQA 1T5KA 2J56A 3H56A 3QJQB 2XV0A 1NPJA 1A65A 1SHXA 1BYPA 2YAMA 3IE9A 2JFCA 5PCYA 1ASPA 1TEFA 1R1CA 1W8EA 1SDDB 3PPSA 3ZX1A 4HHWA 2XXFA 2EIKB 2N0MA 3PAVA 1TEGA 4YVNA 1NICA 5B7FA 4A68A 7PAZA 4UAHA 1IBYA 1IBZA 4HZ1A 1ADWA 1RZPA 1WA1X 4BDVB 2BHFA 4QLWA 3OMNB 2AANA 3HEIB 1L9TA 3FU7B 1A4CA 1AZBA 5B1KA 1NDTA 1V55B 2FJSA 2FQGA 2DV6A 3KW7A 1AANA 1AAJA 3ABMB 1AS7A 1PLCA 1TU2A 3CVBA 4EF3A 2BP0A 3U25A 1BAWA 2XU9A 4KNSA 2PP9A 3JTBA 3D12B 2IWEA 1OF0A 4DP4X 2EILB 4X4KA 2WO3B 1NINA 2UXFA 3CVDA 2FQFA 5B1JA 2XV3A 5E9NA 3ABLB 1GY1A 3G5WA 2HLEB 3UAEA 1OCOB 3H4FA 4G7QB 4UF7C 3C75A 3N55A 4AKPA 1RZQA 4KO7A 2IH8A 2ZXWB 2X87A 2XX1A 4F2FA 1HAWA 1AG0A 4CSZA 2Y1AA 2YXVA 3BQVA 4DPAX 2Q5BA 3AZUA 1XB8A 5F7AA 4K9JA 2PLTA 1JVOA 3AY2A 2XVBA 4HCFA 1WA0X 1J9RA 3TBCA 3UACA 3NJJA 4UANA 2BO0A 3SBQA 3CDZA 4DPBX 2XXGA 5D4IA 2AFNA 4YSRA 1NIFA 2PCFA 4KOBA 2I7SA 4KNUA 3WG7B 4TXVB 3UABA 4QKTA 1HAUA 1A8ZA 2OV0A 2IAAC 1QHQA 2DYSB 3L45A 1N70A 3QJVB 3NP4A 3X1BA 4DP2X 1BYOA 3T6ZA 2B3IA 2IDTA 3GXUB 3FQ2A 3ZIYA 1PF3A 3DKHA 3PXLA 5I5JA 3CG8A 2EIJB 6PAZA 4BK5C 4ENZA 3WKQA 2CBPA 1ETJA 2BP0B 4YSEA 2R7EA 2J5WA 3QPKA 1MG3C 3WNJA 4M4RB 4YSCA 1JOIA 4DPCX 1CURA 4G72B 4PCYA 3T71A 4Q89A 2VMJA 3ABKB 1KBVA 7PCYA 1A3ZA 2GIMA 1ZDSA 4G71B 1GR7A 2CAKA 5B7EA 1E5ZA 2BZCA 4W9ZA 1E65A 3EH5B 4KO9A 3TASA 1AOZA 3NYKA 1AR1B 2LLNA 4P5SA 2A3TA 4AZUA 3FSAA 4YSOA 2CALA 3AG4B 3T6WA 2CCWA 4YVUA 2QT6A 1KDJA 2PCYA 1VLXA 1J9QA 4BDVA 2XX0A 4GP5B 4E9YA 4PAZA 3FYEB 2QDWA 3OD3A 4ZK8A 5B1AB 3WKPA 2YAEA 3CDZB 2ZOOA 1E67A 2HRGA 4NERA 5I6NA 4DP7X 1MZYA 1AACA 1OE2A 3V9EA 2P80A 4JHVA 1V54B 3MBWB 1L9SA 1BXVA 2W8CA 1DYZA 3OMIB 3PLYA 1KYAA 1JZEA 4E9RA 4YSSA 1PZCA 3FS9A 2ZONA 2W88A 1NIAA 3X1EA 1BQRA 2YAOA 5I26A 3S8FB 1FWXA 1MZZA 4G7RB 1GY2A 1A4AA 1GW0A 1ET5A 1NPNA 3FQYA 3QJTB 1CUOA 2J57A 1PZBA 3X1GA 3H4HA 2AZUA 3QQXA 1F56A 1KCWA 1KBWA 2JKWA 2YARA 1OCRB 2EINB 3CVCA 1JERA 3T9WA 4A2FA 4HHGA 1WS8A 2VSMB 3FQ1A 3FU8A 4GY4A 5TK2A 1QLEB 2QPEB 5ANHA 5I28A 2WSDA 2BW4A 4G7SB 1GS8A 1OCCB 3MX0B 1FFTB 1KDIA 2OCCB 3SBPA 1XMEB 2FQEA 1L9OA 2Y69B 4M3HA 1NIBA 1AS6A 2VW6A 4E9SA 3NJNA
chains in the Genus database with same CATH superfamily
2GAZB 4HJJL 3ZKSD 3GSRB 5EBMB 5D1XC 5IHZA 1TENA 2F9BT 2RALA 3HCVA 1S3RA 4Y2DB 5EU3B 5E4EC 4PYGA 1SLUA 1U30A 4NP4L 3PHQB 3NJHA 1CN4A 4LU5L 5D2NB 3WDIA 1K5NB 5E6ZA 3WHXA 5AVSB 4ODVL 4WSJA 4PRHD 4QXVA 5I1CH 1GYWA 4ZAKA 2BOBB 1AXIB 2B16A 3CSGA 4A63A 4KKZA 2X7LA 3DSNA 3LKSA 3OLEA 5I71B 1CICA 5DJ2B 3MRLB 1VJSA 1KN2L 2IPUG 2M26A 4DVBA 3O6KL 2OSLB 4O4YH 3BLPX 3KLLA 1KCRL 2VW4A 3K91A 3OAUH 4X4YB 3ZTEA 4G2AA 1LNUA 3V6ZB 5GS1B 2EE2A 2O6CA 4JPVH 4P23A 3CU7A 4I2XB 3OKOB 5LCVL 2XVGA 1KPRA 1JTOA 1X7SA 3QDGA 3FN3A 2V8MA 4ZXBD 3VD7A 4AQZA 5EIQA 2C8NA 4R26L 3MTRA 2XVKA 1FC2D 2WIIA 3OHXC 2XBTA 4Y5YB 5EDXA 1JHTB 4XVTH 4H88L 2D0HA 1MH5A 1W2KT 4HYTB 4JN1L 4N2FA 2ZAIA 4NDMA 1CU4H 1OAYH 3CHSA 3S3CB 5IQ9B 2MTAA 2R2EB 3BEWA 3QCVH 3DXAA 3AITA 3G9AB 4MNQD 1R0AL 1JRHL 4AM0Q 1CGUA 1FFRA 1NDMA 2NQDA 2CHNA 2K3TA 1RVFL 2JI3A 5E8DL 2TSAA 3L3OC 1IAOB 1NAMA 4LPWA 4J2XA 2BDNL 4IIQA 4K4KA 3D30A 1B0IA 5IB3B 3Q8CA 3BVVA 1INEH 1R5WB 2J4WH 1P9MA 4NM8H 5F7MC 4BQBA 2EUVA 2OTUB 3F6JA 1RVFH 2ZP9A 3NZ8A 3GM8A 4L4VA 1CC3A 1RJYB 3IFLH 3O3BB 4O58L 5T5FA 3QIWB 3EDKA 2FO4B 4MAYC 1FHNA 1KB5A 3FB7B 3Q1SL 3VVVA 1OWWA 2MCPL 4MSWB 1I9IH 1S5HB 2FSEA 3ZY7A 3EBGA 1KB9K 4QRRA 4AL8C 4G1MA 1KGJA 4UTAA 4IU3A 2DQJH 1I7UA 1ES0B 1VFMA 4XWOD 5IMOA 4P2YA 4OZ4B 3WFHB 2CDGA 4R2GD 2QSVA 4FXKC 5L4IA 4X6BA 1MJJB 5DS8B 5CSZB 5CEXA 1IQWH 4EO5A 4M5TA 2B1HH 3RPKA 3Q9QA 3C60A 3PWJA 1SY6A 2FLMA 2GTWB 5E5UB 1IGCH 1CI3M 3TBYB 3K5RA 1JWUB 1A0QL 1A1MA 1V3MA 2WYZA 2OTPA 5HI4C 5FUZL 4ESKA 4GBXA 4R4BB 4RMBA 4DO4A 4TNEA 3WFCH 4S0SD 5IROD 4P4KB 3TL5A 4R3SA 1U8CA 1V7NH 2ZZUT 1XT5A 2NCEA 4RMRA 1OM3L 2EH7H 4YE4L 1BEXA 4IBLT 1TYRA 2XWTB 1DL7H 4RIRB 4RNRA 4LDLB 1GHFL 2C7FA 4Y4FB 1AKPA 1AE6L 3DYOA 1WFUA 1JN6B 2K9FB 2P9RA 3IJYB 3NJFA 4N0FB 1P5UC 4J28A 3RAJL 2O1AA 2D0FA 2IQAA 5AAWC 2EZ0C 2N56A 3S7GA 2JSFA 3UEZA 5JQ6H 1RLWA 2Y6SD 4P9HC 2IADA 4OIIL 3QQ9D 4X99B 2Z9TA 3N2JA 4OTXH 1RJCA 4TQ8A 1BM3H 3CN1A 3X1FA 3HA0A 4ES8A 1EZLA 4HAFA 5F1NA 3H3PH 5AW9B 4JFZL 3F7YB 3Q06A 3THML 2X4NB 2ZOKB 2IPKB 4GH7B 1VZIA 4FYTA 1KB9J 2AJ3A 5C0CA 3U46A 1NL0H 2YEQA 3COOA 1MDAA 2EC9U 3LS5H 2ROYA 2PUQT 1WPCA 4JEGB 3BGMA 1CIUA 2ZF8A 4EZMA 1O6SA 1H8OA 2HSIA 4LLQB 2KQMA 4NQXA 4MTMA 5D7SL 5AOKA 3D34A 1CICC 3VWKB 3Q3GB 4I4WA 1NGZA 1DE4A 3AS1A 4PJCB 4O2FA 4RX4A 2ZKMX 5SV4A 1OD7A 2W0FB 1Z2KA 1NC2B 4JVPA 4MHHG 1WWAX 1BQ5A 4L4TA 1SXBA 3FT4B 4ZS6C 1SJMA 1H3PH 4ZOEA 3V95A 2F1BA 4LO9A 4U33A 2E7LA 3ZZLA 4M00A 3UZEA 5TK4A 1RZGA 4GKZB 5F6IC 3IRPX 3DVGB 1R3IL 1WWWX 3GMNA 3DARA 4PJ8C 4AYFB 1A4KA 3QCTH 1A1OB 5GRYA 1EH9A 1M7DA 3UC0L 3AG3B 3L3HA 5D1ZB 4X8XA 3K0WA 5LLIC 4WTZG 2NUPA 1UB6A 4WI8A 1HXMB 5I8EA 5I1AA 3O6FC 1RULL 2IH9A 3LVEA 3TN0D 1JV5B 3H3PL 2DMBA 4IRJD 4ZMPA 5HP5A 3B1TA 4QYOA 3LXCA 3IDGB 5FYJE 5GRXG 4OH2A 2EVFA 1HS6A 3TH3T 4ODSH 3N04A 3KH4A 4YAQB 3IETB 1SBSH 1YYCA 3JTTA 4LP5A 3OMAB 4RA0C 4X6EB 1P84J 2EEFA 4U1LA 5AZUA 4I3GA 1ASOA 4LDEB 3VG9B 4FQLH 4OD1H 4PSPA 3T8XA 3L5JA 3CDCA 1SEBB 3EHBB 3GIVA 1U3HB 5D2NC 3H85A 5D71H 1UD6A 3IJSA 4P5RA 4FXLA 4GYBA 4OB5H 4XBMA 1KN4L 4FQCH 2EADA 1XVSA 5FYLE 2Z34A 2ZOWA 5I8CA 1HEZA 1MRCH 4OQTL 5AFAA 1E5UI 1IFRA 2RIKA 3UJJH 5CP7A 1CDBA 1HCVA 3BUQA 3IE9A 1NMBH 3QUKA 5FYKD 1DVZA 3VSQA 5A2KH 4IOSA 1YEHL 3SPGA 1DLFL 1BBDH 1KB3A 3GXIA 2F19H 2Z7ZA 4H8WL 4PGBB 4YEFA 1KGIA 1HOCA 3AREB 2QPFA 4A68A 1NKRA 4NBXB 4U6HB 5L0QB 4IDJH 4PS4H 4L8SB 1H9DA 3HEIB 3MLYL 4LLMA 4MJID 5DD3H 5T5FH 3WL9A 4DGVL 4QF1B 4X83A 1MCOH 2ZG3A 1CZ8H 1MF2H 1QLFB 5EN2A 3PPEA 3SDDD 5BCAA 5C0DB 2ZNXA 2A5UA 3EJJX 5BZXA 4HETA 5E2JA 3ZTDC 1U2CA 3EDDA 3RWDB 4IDLA 1WFTA 4I9WE 4F7EB 5MEOA 3W0WA 2XFXB 3MJ7B 1AFVL 3KWWB 3S88H 3U7AA 1CG9A 4XMLH 4GINA 3MUJA 5GGRB 3UAEA 5ANMB 3GM0A 35C8L 4PUBL 1OZUA 4X6DB 1FVCB 1ZVHA 1A3LL 3SCMC 2QVFB 3C60D 5DHXB 5EU4A 4Q52A 4MA3B 5GSRB 4QXUH 1IT9H 4AUUA 3LIZH 4RISL 2PW1B 3O2VH 4NRXA 3QEUA 4WTWA 2WNXA 4XMTA 5I1GL 4U05A 1O75A 2JCCF 3KM1A 3ZYJA 1Q0YH 1ROCA 4YHPA 5I0VA 2NTSP 5AB9A 2AJZB 2TRHA 1NCAH 4D8OA 3BZ4A 4WENB 1KLGB 2HT3D 4GW5A 4PJ9A 4H5SB 4CAGA 5D4IA 3A6BL 2X4PA 2QZ5A 5FKAA 5ENWA 3F7QA 2WNKA 3LKRA 3PL6C 3GMLB 4DSYA 2FH8A 4XP4H 4LSVL 3L45A 5GGVH 5ADPH 1N70A 1QWUA 2RBLA 4EI5D 4XGZB 1SJEB 2OCJA 2B3IA 5SWQA 2AAAA 3T4AA 1EEZB 4Y2DA 4Y5YC 2AJVH 2AF2A 3QZWB 3Q2LA 1TG8A 1P1ZB 4ENZA 4MJ6A 5FECA 3PHQA 1ICTA 3NZSA 3S34L 1JHLH 1OB1B 4JG5A 1MHCB 1DJHA 4N2MA 1I8LA 2CGRL 2EEBA 2Y2YA 5EOCJ 5C0RL 3N1MC 2BSCA 1DQJA 1TUPA 4RFOH 4YDLC 4PJHE 1OP5H 1CICB 3MNWB 2VRQA 3VWKC 5CINL 3ARFB 1PKQA 1KXQE 3EO9H 1P5UB 1E43A 1H6EA 1NCJA 2JKJA 2B59A 4RRPA 2XETA 1UT1A 3OZ9H 2FX8L 1KJ3H 4LOFA 3NRFA 3TASA 1AR1B 1ZSHA 1BVKA 4JDVA 3HC2A 5F0JB 4BFFA 3Q6GL 4I2XA 1O0VA 4WHDA 4DVRH 5CINH 5IV2A 4NQUA 1KCSL 3LZLA 3JWNE 1ZTMA 2Y23A 4S1RL 4MAYB 1MCWM 3K2KA 4E9YA 1ED3B 2HTKC 2K70A 5CCGE 5CR8A 1RSYA 4ZK8A 5B1AB 2H3NA 2WIIB 3QDJA 1AGBB 1I3GL 2NMSA 3BPNC 4Y5YA 3VFUB 2J21A 2XZAH 5AW8B 2Z91B 3BSHA 3GS4A 3VI3E 2E59A 3BUDA 1LP9A 4HUWA 2R29L 5JHBA 3MBXL 4WEMB 1LO5A 1U8IB 4NJ9L 3P3YA 5HDQH 3MRMA 1L9SA 3GF8A 2NW3A 3TZVC 5IW3A 3VXSE 1QI3A 5FGCE 4ZYKB 4A6YL 2B2XH 3C5XA 5A2CA 4HJTA 3ATFA 1PZCA 4PY7A 4NWTL 3EBIA 3KLAB 5F7NC 5FYLD 4GUPB 5DRZB 4UTAH 1R5WA 1RPUA 4WHTB 1RIVH 2VJXA 1ZT7B 3NRQA 1JFQL 4OJEH 1RJYA 3O3BA 4R4FL 1KCWA 4PJFB 4Y9FA 1EFXD 2WK2A 4LEBA 4P06A 4Z95H 2H2SD 4Z7IA 1A6WL 4LB8A 1JDCA 3VFVB 4HHGA 4JBSA 5C09B 1RUML 4HJUA 1AXTL 1I7UB 4ZMAT 3C9NA 1TQCB 2HT2C 3MX0B 1KN2H 3L4WA 4GW4A 2OCCB 4U1GC 3ARDA 2VH5L 3IJEB 3ZUCA 2MOVA 3ZE0B 3NSXA 3SBPA 5DS8A 1JGVL 4ZOAA 5DD0H 2N4IA 3IGFA 1QBBA 3BPOC 1JPFA 3VMPA 4X6DF 4WFED 3NJNA 4BQCA 1HXYB 3JWDH 4IHOA 1JWUA 1YEDA 1JXFA 1WV7T 2FT6A 1USQA 4GAFB 3CQFA 2YQBA 1B4LA 4Y4KD 2VWEE 3LRLA 4QHNB 3UYPB 1XGTB 2D3JA 4CC4A 4EEEA 3L13A 4S1DC 2EC9T 1RZ7L 1J5IA 2BSRA 4DKFH 3OR6A 2YHGA 2ILLA 4Z7UB 1MLBB 2ZWZA 3R8BB 4NKIH 1XF5B 3BWUC 1E7UA 2TSBA 3GBDA 1JZGA 1TJIL 1P53A 3FFOA 5KVDL 4A37A 2VERN 3KJ4B 1U58A 2AK4D 2DQUL 4N90D 5JHDA 4NQED 5C0FA 4K15A 1J05B 2BK8A 4NWUH 1JZJA 3ASNB 5FEBA 4WI7A 2AMUA 3HE7C 4GW1B 3DXAD 5F7EL 4Z1PA 3IPFA 4ZX3A 3KLQA 1NOLA 2WC7A 2R1YA 4N2KA 2M1KA 3F7YA 4CRPA 1EERB 3J27A 1N10A 2DB8A 1M1XA 2X4NA 3SGJA 3I3DA 5F6IB 5KJ7E 1NTDA 4XE0A 4JR9L 2XRAL 4G8GE 4JFZH 3U46B 4DKTA 1F4XH 3GB7A 4IJ3C 4ZFZB 3ARGD 5BV7H 5FO8A 2JV6A 4YDZA 1L9NA 2QTVA 3BGMB 2HFEB 4MXWH 4EDXB 2YAHA 2XPGA 3EH4B 4JY4A 4ODSL 4U4IA 4WI2A 1GCYA 2MRYA 3VFGH 5CZKA 1OSYA 2DWTA 2OJEB 3L1OL 5HVWA 2WINA 2FUTA 4UQAA 1T21A 4HMCA 2HN7A 4OF0A 3QJRB 2OMUA 4N2EA 5F7KC 1G7PB 4XBPB 2DMHA 4XP1H 1DE4B 4PJCA 3NAAH 3QJOA 5GGUA 2EVJA 1KXHA 3KGTA 2LLLA 2VR4A 5DK0B 5I8OH 1NC2A 4JE0A 4OLVH 4AYID 4PJCE 4UU9B 4YE4H 5K1NA 4KITB 2JIXB 4KJWD 3AS2A 3QNZA 3T8VA 1V5JA 3G5VA 1FZKB 3V7AE 1C5CL 1A3RL 2A7BA 4F58L 5IF0A 4TS6A 5EU7C 4X80H 5I6MA 1H3PL 3SZKC 4ZFGH 4WWPA 2G60L 3ARFC 5A7EA 3VD2A 1PG7W 1MVFA 4GAYB 1A1OA 4LCWA 2VE6B 1A64A 4L4JA 1HIMH 5GSVB 1I8KB 5SWSA 1XZ0A 3WTWA 2KERA 1S7TA 1FSKB 5KVMC 1PYWA 4H13C 4BFGA 3EJRA 2EH8H 2A9NH 3JV4B 4PJ5B 1MF2L 2GSGB 1E2ZA 4ANKA 5J1AB 3PHAA 2FYYA 2AJYH 1D5MB 4JO8A 5I5MA 2HPOA 1KTLA 2I32A 2QPDB 3QUZD 4AK1A 2VXSL 4EKJA 5CZXD 5DYFA 3AY4A 2D7QA 1K3ZA 3OG6B 4JO1H 4MD0B 5B1BB 3ZMRA 1GVIA 3O6MH 5D5MB 3GD1C 1RZJC 3WFEL 1KTKE 2EJ1A 4LHUG 4U7SA 3T8XB 4NJAL 5JHLH 2XZQH 1EXHA 4Q6IC 1UFGA 2MNWA 3CFTA 3FPYA 5I75C 1EHKB 2OYMA 4LCIL 3IRCA 4JK0D 8PAZA 4M6ML 3ERXA 5CU9A 3QC5X 3OM3B 1YPZB 1LP9F 1H5BA 5LG1A 5I6PA 2OI9B 1ZLSH 4A2EA 2OMTB 1KENH 3L4YA 3MRNB 3ASWA 1HHIA 2BIPA 5AENA 4JRYD 3EJTA 5DRNA 1WHOA 4WV1A 2WMPB 4X0KB 5FGBA 4FNRA 1O9VA 3G6JA 5E8OB 4EI6B 1DHKA 3VD1A 4PGBA 1YN6A 3UL4A 3ROLA 1U8PA 1LQSR 4OVVA 3L3KA 1E8ZA 2VZ1A 3QUGA 5FYJD 3OJDA 2XQBL 2DQ6A 3KYOA 4L8SA 3Q5YA 1TVBA 2P48B 3W11C 5JORB 1KC5H 1AI1H 4PTTA 1F0LA 3MSPA 4QXGH 4NQEA 1A14L 1Q38A 2OS7A 3ZN6A 1BQKA 4F1SA 4WFGE 3MNZB 1QPXA 1K6QH 4FTDA 5J89A 3ULVC 2WSPA 1CL7H 2DI7A 4F2ME 1RJLB 4XODA 4O4YL 1SDAB 4ZW3A 5IB1A 2K7QA 3RUGE 3RVXC 2VT0A 4PJAF 4N8VG 1F8TH 4QO1B 5AW7B 3FUMA 3QWRD 5SWZD 4AITA 1M7XA 4D0CB 2XFGB 3G04A 4LLUB 2PXYD 2QEJA 1F4HA 3T0AA 1IGML 3CQQA 1FP5A 2AQSA 4JDTL 1S7WA 3RDTB 3RKPA 4LGSB 3EJZC 5CU5A 3RZWA 1MREH 3HFML 5EOQH 3CX5K 5JXAH 2AJZA 3EYVA 3K72A 4GQ9L 3F58L 3UO1L 1XAKA 5C2BL 5DTFB 1ZS2A 3FSVA 3VSTA 1BAFH 4JG9A 1KBKA 1YNLH 4YDJA 5IJVB 1EK3A 1R24B 1KC5L 3SDXF 2I9LA 1BD2D 5JYMA 3DX7B 4M1GH 5IY5B 4L1SA 3RKDD 5J6HA 1ORSA 4OJFL 1CL7I 3O2DA 3BZ5A 4K71B 2E7LC 1SJEA 4HXBH 3F64A 1ZY9A 3VB9A 5SWQB 2HX7A 4NC1E 1QSEB 2ENPA 4XN8A 1KGCE 2HUEA 2NY2B 5BS0E 3TF4A 5HHXL 2X5PA 3O11B 4M93C 3X12B 3ARSA 4FLHA 5C0CE 3DIFB 3T3ME 3B9VA 2QGDA 3ESUF 1MHCA 4JFYB 4JO4H 3CSTA 5EWIL 2XYCA 4ODXA 4C4KO 2R8SH 4AI7A 2ZG2A 1J1PH 2CXKA 1ZD6A 2Y6TE 3OKLB 2D31B 5J8OA 1QZNA 4G3YH 4JR9H 2QFRA 5E94B 3L1FA 2YAMA 5IJCC 3I74A 3L48A 4XP6H 3BUBA 5TH2A 1NCCL 2GW5A 1GZPA 1D5XA 4U1SB 3ZHNA 1LK3L 1QP1A 1QLEL 2EIKB 4YIQB 3WFEH 3OAUL 2DQEL 1BVKB 2XV6B 5MP6L 1YEWA 3QEHB 4UILH 4XI5D 5E8PB 3IXTB 2UVEA 2EEXA 2BVOA 3QRFM 5TPWH 5C07E 3OKEB 3D85D 1AZBA 1GGCH 3GSWA 2A6JB 4OF6A 2R4RL 1MN4A 4UM8A 5DGQA 2FB4H 3K74B 3PP3K 3S3PA 1MFAH 1LP9B 4I9XA 1EGJA 3HR6A 3LKOA 4UUJB 5IROA 2KHAA 5MENB 4NN7B 4PWIA 1G5AA 2FJFA 2G5RA 1U3NA 4PGJA 5J13C 1AGDA 2YWZA 1FZMB 1CE6B 4HFUL 1LE9A 1W8NA 5CJQL 3VI4F 5EC2A 2ZXWB 1QUNB 3BP5A 4MWFA 2W60A 1HAWA 2CJUH 1DSFL 3F7PC 3GRGA 4CC1A 3P4MA 4ZX5A 3V4UL 5AW4B 3BT0A 3BQVA 4N9GB 2R2BB 2OMXB 5LGHL 1YEKH 4UB0H 5C0ND 2Q5BA 1QBML 2AJXL 4XAWH 4LVOB 3LN5B 2L7JA 3UTZA 3CQPA 1DQMH 1FNAA 4ZUVA 4UANA 3NTCH 2IV8A 5IJDC 3ALXA 2BS9A 2OI9C 2MCAA 3CVIL 2HTKD 5KN5B 5F7DB 1RU9H 2B9BA 3FBQA 1NC4D 1LO4L 3D69B 3I9IA 4O51A 3UTQA 1W72B 2VLRD 1E50A 2YKLL 3S35H 1QFHA 4GW4B 5JHLL 1WBZB 3AXLA 4NT6A 1AGFA 4M48H 4XN1A 3AGVA 3DJZA 4UCFA 5SWSE 5FW8A 2OV0A 4L9LA 1GC1H 4AJ0A 4P2OB 4FFZA 1JPFB 1BYOA 1EXUA 1UXSA 2GBUA 1SYSA 4PY8J 4EXKA 5C3LD 2HFGH 3FQ2A 3INUL 4XMUA 2Y2TA 3S35L 3ZIYA 4BFIA 4ANUA 4YQXL 4K5LA 1EUTA 2OMYB 4NO0D 4TQEH 4NKOA 4YHLH 4GRLC 1QSVA 2ATPB 2D3VA 5K9KA 1UD2A 4MJ5B 1MIEL 1UOWA 3DMMB 1PIFA 1X6NA 4FXGA 3GI9H 5LQBH 1J8HE 1EJOH 5KVFH 3RLSA 3IXAA 5DURB 3I9GH 4PTUA 4Q89A 3UAJC 3H7LA 3MV7E 3SGDI 5DK3A 3SO5A 3ZRSA 4ORZC 4FXTA 2H2SC 3U0WL 1HJBC 2ZXAA 2B15A 4HD5A 1FBIL 2NY4B 4MA8H 1U58B 2A3TA 4CMHB 1FFOB 5EO1A 1E8WA 3QQ3B 4JFDD 4NLHA 1VF5C 1YEGL 2WLMA 1L0QA 1MCNA 4TSAH 2QJDA 4WW2B 4R5TA 1VLXA 1AFVH 3SGKC 5ESQA 3AQZA 5KS9A 1WICA 2V2TB 4GW1A 3WUWG 2BY0A 5EULV 5LUMA 2XIDA 1HILB 3IMVA 1T66C 4ORGA 4BCXA 2DLEA 2GJ6A 4HS6B 4KV5F 4XBGA 3EO0A 3HG3A 1RFDL 1S78D 4KTEL 3FQUB 4W81A 3WS3A 1VCBC 1OK0A 3GB7B 4YQXH 4BEIA 4JCWA 3SYQA 4F2MA 3DBXA 2YMOA 2HCZX 3ISWA 1JZ5A 2E47A 3E6HB 3QHZH 2E6PA 2OMWA 3C5ZD 4E9RA 1D5IH 1QACA 5CKGA 2XQYK 4HV8B 5ACZB 4WI9A 5B39B 3I02A 4NXSA 3FCGA 1NIAA 3C09B 1NGPH 2HN7B 2MOGA 2NX5B 2YAOA 5I26A 3DJSA 1IGYB 3S8FB 3ZHDA 4Y8DC 1GY2A 2O4EA 3GKWH 2XBDA 4ODUA 1XIWD 4KROD 2ZOLA 4N1HB 4FI7A 3X1GA 4MA7H 5KJ4A 1EO8H 1U8QB 4MD5A 2XY2A 3D39D 4ATWA 4UBDC 2R59A 1BQHG 1A66A 1JERA 2JIXA 1RZJH 3GRWH 2W9LA 1IGJA 5HHQA 1UKSA 2KS0A 5EUOE 1T0OA 2WUBL 2VSMB 1IGTB 3B9KA 3SY0A 4AQ1B 2HPTA 3NCBB 1WTGT 4HZLA 4IIZA 2VLKD 5T3XL 1PVHA 3AMLA 3QGVA 3TIDA 4EN3A 4PRBB 4LBAA 3BISA 4BE6A 2R2CA 2ZUQB 2BSDA 3Q44A 4PJBA 2NY5C 4UOQA 2JB6B 1M71B 4BD4A 5E00A 1P2CB 2JKIS 3TN0A 4IRSB 3H9SA 5EA0L 1U91A 1FNFA 5T1DL 1I1CA 4FCHA 2N0KA 1SJXA 4HVBA 3MRIA 3OKYA 5TQ2H 1SJVA 3QIBD 4OCRL 2A4ZA 1NMAL 5I1DA 4NQCE 3AY4C 5J1AA 4M3JA 3QR1A 3OC5A 3CFDB 2B0SH 5MHSD 2OR9H 4I85A 2VZTA 5HTSA 4MYPA 5DQDL 4DCQA 3AT9A 5ISZB 4UQCA 4FLRA 3WY3A 4E5XB 1CDUA 2QR0B 4HGMA 1DUYA 2AXJA 1E5CA 2CJTA 3NA4A 4FFYA 5E1HB 3NQKA 3BE1L 3J2PA 1I7TB 3H0TB 5DD5L 2DEWX 1YMME 1OO2A 3O6FD 3PWNB 2ADFH 3JVGA 1RUQL 1U8LB 2RQEA 2EDFA 1NOFA 3U7WH 2RD0A 3HC3H 1UWXH 5GS0D 5D7JB 3BRDA 1X7QB 4HJIA 3G5XA 1N18A 4P5TA 1AYOA 4WV1B 4OBRA 3FTYA 3IVKB 2GKIA 5JW4N 4MJ2A 5BZWA 3ARYA 1G9NL 5DZNA 4ZUSB 5KSUA 5IEHB 3C5ZB 3QUZA 5JW5B 3WY1A 5J9PA 3DMMC 3G5YA 3TYFA 1CBVL 4CILA 4K3HA 1OAUL 2DEXX 4TVPD 1TNMA 3B8YA 1L7TL 2XN9D 3LCYA 4R7NB 2ZYIA 4H1LG 4ONHB 3MRGB 3RVXD 3ZDWA 1IFHL 3K8LA 1A7OL 2KKQA 4PTTB 1PW3A 3B3IA 4G9FA 4NLAA 1PZAA 4QR7A 5A2AA 1T2QH 1Y18A 2BP8A 3GYRA 4DEUA 1IAKA 1GKEA 5I24A 2A9AA 2CO7A 4HX1B 4X5WB 3PY9A 1JXGA 1MDTA 3MV7D 4LAQL 4A2HA 3BYTA 4NQCB 3CN0A 1OP4A 2F5AH 3V0VB 1PZ5A 3RJQB 4HHAA 5T5NF 4RSYA 1KYUA 2HMIC 1AZCA 2BWIA 3GBEA 4A7SA 2PNDA 4H2CA 4OZIF 2Z7YA 1EAPA 4P2RD 4KV5E 1YUHB 5HVFB 3LRSB 3FB6A 3MJ9A 4QRBA 4PJAA 1Q9WB 4JG0H 5B38B 3ZSSA 2X6UA 1E40A 4U6XA 4MAYD 5I5RA 2LU5A 2DYRB 3PWPA 4UNIA 3AB0C 4YK4C 2X0WA 1MHHA 4L5FE 4HK3N 4L1LA 3MCLL 4OF3A 4LPXA 5CIPB 4WUKH 3RKDC 4LOVA 2AGJH 2LTQC 2R15A 3EYVB 5AKTA 3N41B 3US1A 3RWEB 5DTFA 1AY1L 4JPKH 4N0RA 1X5MA 5C9JB 1EEQA 2XA3A 1GTFA 1PAMA 2DAVA 5AG8A 1ZV2A 4NO3A 3SQBB 1HX0A 3BKJH 4R5VA 4OJAA 4KUZL 1QRNE 2G3MA 4Y2DD 5EO0B 1BVOA 1JD7A 4BV1A 5AWNL 2ORBL 1VEOA 2APSA 1KFAL 2NRDA 1GGBH 1QSEA 2AAVA 3KPNB 4JREB 4YJZL 2D7OA 3KHQA 5FPIA 3N85H 4PCTA 4DPRA 2J44A 3RZCC 4N25A 4EPSA 5JPMC 3VFWA 4IMKC 4I18A 5KTEH 3ZDZB 1LLAA 2OSXA 3POHA 4C54A 4JKWA 4KMTL 4AUYA 2R69A 2E6QA 2IBZX 1J11A 3RA7H 4CKVX 4XCYB 3QJZA 5C09D 1TTFA 2OSYA 3PL6D 3MBEA 4WWKA 4I3RH 2H32H 3CZSA 5BZZA 3VXUE 1F86A 3O3EA 4QRPE 4WEUD 5AVQB 4KMTH 3EBAA 1AXTH 4R7LA 4NAJA 2WWMC 4YBLC 1NDGA 1GZQA 1JZHA 2ZF9A 3FTUA 1I9JL 1UB5B 3A23A 4GRWE 4KROC 4GQRA 3QUMB 3HFFA 3S36L 3IXTA 3AW5A 4DETA 1OARH 2PCXA 4P48A 4FA7B 2CO1A 2X12A 3ETBJ 4HWNA 1SFHA 3D0LB 4Z7WA 3VM7A 3U7WL 3QZOA 4ZW7A 3MV7B 3BVNA 4ZO6A 4F7CB 1KGCD 4LLAA 1YQVH 4Y16C 1KCBA 2HRPH 3CLEL 3MACH 3UGEA 3GMPA 3LKOB 4XC3L 9PCYA 4LPTA 1ORQA 1MRFL 4J3VA 3BCDA 5MENA 4L1DA 3HJ0A 3JT0A 2BNUA 4MFHA 4FQHB 1XTLA 4U3CA 3DPBB 1H3UA 3KYMA 1UYWL 2YBRB 3S96A 4H8HA 2R29A 5DMKA 3CFCL 1QR1A 1QUNA 3PWPD 4AT6B 8FABA 1MCQA 5CMAA 5GGVY 5HGDB 2JNZA 3ULAB 4PB0H 2HJKB 4EKXA 4ONOA 1N6QH 1QFWI 1DQDL 4JCLA 2OMXA 4PJ5D 5E7FA 2IBBA 3V5DB 1S7SA 4NSKB 4QXGL 3CFEA 1BJ8A 4G6FD 2PPFA 5DDHB 3LZOA 5JR1L 4XXWA 3NRPA 2BVUA 1PJ9A 2NY0D 5DLLA 4BXSV 4AMWA 3N0AA 3NFSH 4O2EB 3G6DH 3WN5B 5H35A 4I87A 4CNIA 4GB9A 1I1AC 5F7DA 5CM1A 4ZSOA 3BSZL 5LNDA 1NCDL 4MZ2A 2IFFH 2WKOA 1W72A 4JS7A 2WQVA 5HJDA 5F7UA 3TO2B 4D7PA 2VXVH 2EDBA 5L6YL 1N8ZA 1AGFB 2E74C 1MUJA 4MCZA 4A39A 3RZCA 1VFBB 1XGUB 2J8UE 1CD0A 4FNPA 5A6LA 5EU7E 3VJ6B 5MEQA 4P57B 4KI5D 2Y5TB 1FAIH 5K39B 4OCNC 4PRAA 4HWBH 2FNWA 1RHHB 3UP1A 1LDSA 3TBVB 1U92A 4LFHD 2OMYA 2ARJA 4OLXH 1HINH 2GC4C 4YHZH 1BZEA 3MRDA 2IWGA 1I1YA 1W9XA 3MMEA 4RVBA 4OY9A 4XCNA 1DLHA 3MRBA 1AGCB 2DIBA 3CHXA 4FXGB 1SRDA 4EIBA 5T33L 4PRDA 2JJUA 5IFHL 2DYPA 1I9RL 5AZ2H 5D7JC 1K2DA 2GTQA 4U1MB 4WDIA 4GAAA 2EXYD 1NPJA 4WJ5A 3FT1A 4L1TA 4AIOA 4LCVA 1SHXA 3DSFL 4J4PA 2VISA 4L3CB 4LHQB 1BM7A 4XMPL 5E5RB 4LLDA 5I23A 3TFKC 3VG9C 1U3YA 4S1SL 5DD6A 5L0QC 3H2WA 3JWNC 3UBXB 4X8JA 3SYOA 4UT6H 5IESH 3ZKMC 4BFEA 3TTSA 1N0LB 3NIFE 1G7QA 1QHOA 1ADWA 3EYUL 2BHFA 5SWSD 1X5FA 1L9TA 3MJWA 3NFPA 1MFDL 3KPRA 1NDTA 2CBMA 2FQGA 2J6EA 4UIKH 2ADJA 4LASL 3HG1E 4HS6A 4WO4A 1K6QL 1NEZB 2AK1L 4XBGB 3FO1A 3G9VA 1ANUA 2NLJA 3PYCA 3VGBA 2LTQB 2FO1A 3EF7A 3SPJA 1BFOA 5F1SA 5K9JL 4F2MB 4L3AA 3DBXB 3W37A 4EE2A 3PQYB 1HHKB 3MI6A 4P9HH 2PKDA 4DVRL 1UURA 5B39A 1DQLL 2XQYG 3H9YA 4K7FA 4TN9A 3C75A 4NUPA 1ONQB 1BHGA 4PHZA 1QSFE 1KF9B 5J4MA 4WW1B 3OQ3B 4MCYB 1TTGA 1BECA 2RMNA 3ARVA 4R7DB 1A6ZB 5AYUL 5LG6A 3T0EA 2Z64C 4YHLL 3A21A 3SQOL 3F6LA 1AKJD 1AXSA 2CXGA 2P5WD 4A7GA 4KXAA 2MHAA 3P77B 1J9RA 1KIRB 5G5DA 3QZPA 5LHDA 1EO8L 3NIFF 5HHOA 4APQC 5GISH 2G75B 3ARGA 5JDSB 2NQCA 2CNZA 4IBVA 4AW4A 2FWOB 2DQCH 2N1TE 5LGJB 2C3XA 2DS4A 4JFOB 4PVNA 4KNUA 3RVTC 4KH2A 4GO9A 3IDJA 1A8ZA 2BXZA 3QCVL 2E56A 3ESVF 4Q56A 5C71A 1M71A 5ITBH 1FO0H 2IDTA 3DKHA 3C5ZC 3DECA 3TESA 2OFQA 4WUUA 2EH8L 1OW0A 4TRPH 3UG4A 3K2UL 3R4RA 3W0WE 4M4RB 3TYGH 4GSDL 3U36A 3VD4A 5C0EB 5CCKL 4UINL 1J8RA 1UVQB 2QR0A 1B6DA 1LO3L 1UJ3C 4KJYA 3A24A 5IQLA 1CR9H 3Q48A 1WAPA 7PCYA 4AQ8C 2LAGB 4X4ZA 3HNVL 2OQJB 4B97A 1I7TA 3H0TA 3MLRH 2E7BA 3CLWA 3B3BA 4OZHF 2VDPB 1JNHB 2BHYA 5DJXB 2ZCKL 4XC1L 1PBYA 1E4XH 1MQKH 1TITA 2V9RA 1OT1A 2NY5L 5AW5B 3VI4B 5D7JA 4YDLB 1ZHBB 2VM9A 3GZOA 4ELMB 2GJZA 5DLMH 3ZK0A 4J4PC 4IBSA 4PP1D 1A6AA 1V3JA 1K8IB 1ZTXH 1YMHB 3OWEA 3R7RA 5C6TL 3C5ZA 3TIEB 4ZMQA 1TU2B 3CXDH 5I6NA 5I0ZA 5JW5A 5J9PB 1PD0A 1ZGLB 2LU3A 2FJHB 3JQOB 3N0PB 4GXVH 5ICYA 3FFCE 4G83A 4BK5A 1GXEA 5AAMC 3O3UN 4R7NA 2IBGA 4ONHA 3OKDA 5TGBB 5J3HC 5GGVL 1KELH 1X3DA 1N4XL 4JO3L 1XGZA 4I1RA 1E3FA 1FIGL 2QGCA 2WOBA 3A6BH 3QSKB 2OULB 2X89D 4JHZA 1MJUL 5HHXH 4PJ9C 2RGSA 4R4ND 2CHZA 4JUTA 3QQNA 3LPGA 4WO4D 1BZOA 2D7MA 2WZ5A 3VGDA 4P2QE 3W5MA 1QNZL 3VXTB 3OMZA 5I9QC 2AJXH 3MA9L 3P4NA 2HLFC 4U1GB 4U2YA 4JZJC 4DEWA 2OXGA 4C47A 5B38A 2BMKB 1IBFA 3HS0A 5GRVK 3M17A 3OZLA 1VHPA 4HWBL 1JNNH 5C0AD 3NG5A 1KDIA 4KBPA 3UDWA 3IT8D 5IHLB 1SBSL 2I60H 2VYRE 1MHHB 2FVNA 4F5CA 2UZXB 3QYNA 4PRNB 5AYUH 3GSNB 5AYQA 1ZCRA 4JHAH 4XN2A 2DBLL 1D6EA 4W6XB 1AIFB 2FUQA 4XNQA 5AVTB 1AQ8A 1MFAL 1DJZA 3F5WA 5JIHA 3SQBA 1DZ0A 4KOCA 1NBZB 4EZKA 3AQDA 4NHCH 5MEPA 3QCTL 2VLJE 1LEGB 1BX2A 2F53D 4JPIB 5DMJB 7TAAA 2YIHA 3KPNA 1XL4A 4ZPVB 2Q3ZA 5IUSA 1JMZA 1DEEA 4AQAA 3WY2A 5HDBF 3VFWB 3CD4A 4WHCA 2HVKA 4Z7OF 1TZAA 1UH4A 5I18L 1DLFH 3H53A 2YEZA 1LO3H 4N0YH 4OF5A 1DSWA 3PWPE 3CN4A 4NB7A 4HUNB 2C9XA 2YMTA 1TXKA 2JF1A 3QRBA 1BCIA 1L5GA 4GLRH 5DCCA 5DS1A 1OCWL 1UWGL 4WGKA 5ADPL 4TL4A 4R4FH 3ARBB 1PZ3A 4F7TA 4UDUB 1TJMA 3LRMA 5TDOA 2HKFH 2A77H 3HI1A 3EOAB 3VCLA 4B3VA 1AD9B 1FZOA 5EZJB 4UMGA 4N20A 4HUXA 1CD1A 3WIIL 1GZQB 2JCWA 2D2CC 2WB7A 3IDMA 1WAAE 1E30A 1M57B 1FZJB 2H0JA 3T0WA 4FNUA 1QBLL 3NA9L 1TZGH 4OUOA 3VRLE 1Q72H 1QYGH 2BVYA 4QHLA 3FU9A 2IDUA 1BIHA 3FT0A 2CJSA 4UWQB 1Q1JL 4K94L 4M6MH 2P52A 4OF8A 5I1JL 1UOLA 5M95B 1ESOA 1TZGL 1J8SA 1CTMA 1NIDA 3GSVA 3GJEB 1PU0A 2P24B 4ONFL 5FM4A 1F1AA 2XYBA 1E9OB 2YPKB 5AOLA 1Z6JT 1EBAA 5FF6A 1QTPA 2CJ3A 2LOEA 3V0WL 3DX6B 15C8L 3LOWA 4M5YH 1AE6H 2PPAA 2PPEA 2WGNB 3MGOB 2HH0H 1MCPH 1S9XA 2AK4E 4HAKA 3QJFB 1JZFA 4NQDA 4M7JL 4Y5VA 4YDVA 3RGVC 4K9EH 3ZE0E 1HDMA 1S7SB 3LXUX 4NSKA 1BEYH 1PCXA 4KZ0A 4PJEB 4YPGB 2FK9A 2NYZA 2VZVA 4P4RB 3S4SG 5B7MA 2YC1A 3BUYA 5DD3L 2H0EA 1HIML 2BP3A 2EYSA 1B6UA 4FQPA 3SBWC 3WN5A 4N0YL 2PO6D 1B9KA 5I1IL 4ZSOB 1C5DB 2L3BA 4DAGL 5IWLA 3LZPA 1CFQB 5D9SB 1CYWA 3TO2A 5L8JB 1BFTA 2GABA 2F53A 1ZSDB 2OA9A 1UZ6F 3JSSA 3LMJL 3PS6A 1VFBA 3VRIA 5A3ID 1G84A 1F3RB 1AGEA 2RR3A 5DRXA 2VM4A 1JZ3A 4PGDA 4FJYA 1ID5I 3D4YA 4Z5RB 1NCWH 1YEJL 2XWJA 4LLYA 5CBAB 4TYUA 2O6FA 5JHDE 1WGOA 4JM2F 1RHHA 2EDHA 3MLVH 1TMCB 4OM0L 3BW9B 1W6WA 1XSOA 5FKPA 3MMEB 4XCNB 5FGCB 3GEWB 5HY9A 1MCFA 1OGAB 5ADOH 5KSBF 5KBNC 2IANA 2OXHA 2LVEA 1EDQA 1HFUA 5KZCD 2IH1A 4Q9RH 5E1AB 3FFDB 1HESA 3TO4D 3BH9B 3MO1A 3N44F 5KS9F 1OARL 5TE6L 1QNIA 5EBWB 2WVUA 5I6KA 4HPHA 1C8QA 4D3CL 1ILSA 1NGYA 4H8UA 4KI5F 4ZMVA 3VGAB 2QVTA 3F3HA 4F8OA 1BF5A 4HOZA 3UBXA 3QULB 1MJ7L 4BZ2A 4R90H 3FU3A 3BIAX 1I8IA 1MELA 2PYEE 2R2HB 4Z78A 4JKKA 4NUMA 1QO3A 4G42A 2M8XA 3T1WA 3FMGH 4Y4HA 4RETB 3DJ9A 3RA7L 2QKIA 5FFGA 3VXMD 2Y0SA 3IN2A 1J9TA 5ANME 1DZBA 4KK6C 4MBRA 3TA3D 4E41D 1SN5A 3D4ZA 4K8RH 2PP8A 2FL5B 2WQ8A 4OCSH 5ETUB 4YHIB 4FNSA 2GC7C 2KLTA 3U2JA 4M62L 5CP3A 3O4LB 1EMTL 4L5FL 4ZUWB 2ZAGA 2BNRA 4HQQH 1BOYA 1A6VL 1EHLL 3NOIA 4QOKD 5C08A 3UBGA 4X6CA 2W5PA 2DWEB 5D70H 4MCYA 3KYAA 3CC5A 3IDXH 2NY7L 2ICEC 4LXFA 1FNSL 3SCMB 3RBGA 1GYVA 2C9VA 3JWOC 2BC4B 1F3DH 1XF4A 4NQVB 4DZBA 1DANT 2VCOA 2VDNB 3OSVA 2F7OA 1MQKL 1KMGA 1JS4A 1QRNA 1PFOA 3ML9A 5HHOB 2NY1B 2G75A 3ARGB 5JDSA 3PAUA 1KN4H 4FQCL 4A7GF 5B1JC 3X17A 2WXRA 4NGHH 1TETL 1J9SA 4G6KL 2GG1A 1ZLEA 3FT2A 5KVEL 1LO0L 2HTLD 6CGTA 4X6FA 4U3SA 3VGGA 1IC5H 4FYQA 2Y7QA 5JW4Q 3AACA 1IE4A 1VGKB 3CSBA 3IDJB 4Y5XC 1H0DA 2J7LA 1B4JH 1OW0C 4ODTL 1N2RA 1M53A 5KZCB 5I2IA 2HX8A 3VXRB 1MHPL 2BOLA 2XWBA 3K6SB 5T3ZD 1AS8A 1Y0LB 4OGZA 5DVNA 4BH7B 4BWTA 4DQOL 2Z3FA 2CUMA 4WNJA 3ES6B 2HKFL 4JKPH 2H6UA 4NC0B 5D7LE 4E9LA 2DQFA 3O6LH 5J13B 4HS8L 3L5WA 2C3WA 5DRWB 1T5KA 3SGKA 1SHMA 3H56A 4JRFA 1OB0A 4L18A 5I8KL 4M02A 1UADC 2JFCA 4QPEA 5T1LD 1YEIH 5ICUA 4LCUB 1KXVA 3DURB 4JRYA 5BOJA 3BZFB 2GIXA 5FGBC 1JUFB 1NCHA 2N0MA 4GQQA 1U93B 5BW7A 1EANA 1I8LC 5DJ8B 1A6VH 3BXNA 5DVOA 5DUBB 4MS8D 4P05A 1ZKAA 1ECYA 1B0RB 3QJHB 5C0AE 4G6AD 3MLWH 1A4CA 2QTEA 4LBEB 2FHBA 3GHPA 4KHXH 1NFAA 4X5QA 3RP1A 3IWVA 3KW7A 1ETA1 4MRBA 1AS7A 1AY1H 3E1ZA 4EF3A 4PCKA 1WZ1L 5GJSL 1CK0H 4CJ0A 2PP9A 2FJHA 2J6WA 3D50A 5C0GA 4NN6C 3V0WH 4CU6A 5DGRA 1NJ9A 2WO3B 5GGTA 4NAMA 4HSCX 1E6JH 4NHCL 3LPOA 3RFZB 4JX0A 1CDJA 4HH9B 1JPGB 4KQ3L 4XWGL 3RE0A 1RZFH 2WLLB 2I9TB 4Y4HD 3MODL 5C0CD 4FRWA 4B95C 4E42A 2PO6A 1JHLL 3T77B 2QHRH 1D6VL 3DX8A 5D55A 4DPAX 2WJ5A 1TVHB 1O9WA 3AZUA 4OFKA 4FG6C 5F97E 1RI8A 4AENB 3CH1A 4TNVF 4Z95L 1JVOA 5HYSA 4HCFA 4PP2B 3UTOA 5FV2A 3P4NB 1DVFA 4F9PC 5FW6A 1RZ8B 3IE4A 1BZ7B 5EDSA 1BJMA 2XTSA 1F3JA 5F93C 5E2UL 4TLUA 2NY4C 4K0OA 1MHEA 1WE5A 4W9LC 2I5YL 3WD5L 3S35X 3VH8A 2P46B 5I17B 1T66D 1VESA 5GRUL 2V8LA 4PJDE 4D2NA 2CMRL 3EADA 4CVZB 4PBWD 5HI3D 4PVLA 3QR0A 3IGUA 1D6EB 2NUTA 3ZYOA 2YEVB 1ZLUK 1T83A 4XNQB 5LAXB 4YHZL 3RHWK 2YPVA 2VDQL 4N68A 3IDUA 4PB9H 1WVZA 1G1YA 1XTMA 2BP0B 4TLTA 4Y2LA 3UG3A 5F0PB 2R7EA 5CGMA 3LXBA 2VUYA 1G0YR 1EVUA 2O61A 4N0UA 4J3BA 5JIDA 2B8OT 1LEGA 4ZX6A 5F89B 4W9HC 4MNHA 4ERSL 3IGLA 4OCYL 5E4IA 1QKZH 1BEYL 1OAQL 4AXWA 4Q2ZA 5D1QB 4LNRB 3ORJA 2EYRB 2NZ9D 2CE6A 3EYFA 3FSAA 1FPTL 2L8AA 4EUPB 2Z6FA 4MQXD 4ADIA 2CCWA 1Y6MR 2G9HA 2Z8WC 4PW9A 2V33A 2X4QA 2IGFL 4GIPD 4UINH 5F3BB 1PJWA 4OJYA 5GGRY 3TVMB 4F20A 5IJKC 2LV4A 3OF6A 4JFWA 4POZC 4FFVD 3VFTB 2ATKA 2ZOOA 3HAEA 4KGJA 4DKAA 2ZXGA 3RZCD 1UCTA 2AABL 3IDMB 4CMHC 3C5JA 1JGUL 3FONA 1T7YA 5A16B 3D2UB 3OX8B 4X42A 4YPJA 1FZJA 4L29A 4YDIL 4JRXE 4J3TA 2ESVA 3ZKQD 2Y07L 4QRTA 1W91A 2OCFD 2GPZA 4DVBB 4UQDA 2Q7NA 5FO9A 4ZJ9A 3WNNA 1J18A 4Y19D 5DA4A 1Z3GH 4DIXA 3E6FA 3FOLA 4ETQB 1SXAA 1ZANL 3BSZA 3NCJH 2R23B 3FO0H 4NQSB 4G7RB 3DV6B 2ICEB 1B4TA 1ET5A 4JFFB 1I85C 2WZ6A 4KXDA 1J8HD 5FLVA 3HLAA 2WQSA 3L7EB 4L37B 1Q0YL 1A7BA 4X50A 1F4WH 4FMFA 1XIWC 4PI0A 4Y9EA 2V3DA 3DPDA 3LIZL 4OLWH 4W4OC 5CJ5A 3MGOA 4IOIB 4L9DA 3FQRA 3QHFH 2ZX8A 2A6IA 1QFWM 3WJMB 2APWA 3NJVA 4P0DA 3PGDB 4MJIE 4U1IA 4XAWL 1JF1A 4MYWB 1A22B 4XOEA 2Q76B 2VDOH 3EOBB 4PS8A 3GSUB 5K9QI 3KHOA 2Z4QA 3AM8A 2EYSB 4E9SA 1YAIA 4N9OB 5F7WC 1GS6X 2CGYA 2XA8H 5IVOA 4KZEL 1FPTH 2HLAB 2ESVE 2NW2B 4CSPA 2WXIA 1XH0A 3QP3A 1R3IH 4O02B 1CFQA 3CFUA 4FE9A 5D9SA 2F54B 1Q9KA 5IREA 2BLFA 2B4CH 2NSQA 4XPFL 1NM4A 4N5ED 1NKOA 3SDDA 1AG6A 1IC7L 2VMEA 4PD4J 4EBQL 4HKZB 3OC8A 2ZCLL 3QXVA 2NYYC 4LDCA 3LKPA 1QI5A 1IEAB 2KMWA 2P7TA 4GMTL 2PTUA 3UZQA 3FB7A 5CBAA 1KV7A 4GSDH 1EMTH 2BY1A 4L5FH 4L2LA 5IMMB 5J56B 5T1KD 2EKSA 4FXKA 4MKTA 4NZRL 4K2UH 1P7BA 1RPQA 1BWWA 3NJLA 4LCWE 4OZ4A 3BD4A 4XRCB 1FYTB 5E9DA 2HMID 1BZ8A 4ZQTA 2IANB 3MC0A 4HEMA 2EDEA 3VTMA 5KVFL 4X6BB 2Y7OA 3QUXB 2V37A 3BH9A 5CSZA 4DGYH 5CEXB 4KK5C 4XZUA 2KLRA 2Y7MA 5DR5L 1PKOA 1P84K 1G9NC 5IK3B 1NCBL 4FABH 2GTWA 4PWHA 3KVQA 4JG1L 4M1DH 4JLRB 3VYNA 1GMEA 1TLMA 2HRPL 2EUXA 4DP8X 4IGBB 3PAZA 3IJ9A 2FR4B 2PO6C 1URLA 3NSJA 4LRNL 1T7XA 4PRPB 4N6RB 3KPSB 1U8CB 3EKCA 3ARZA 4Y4FD 2W94A 5E08H 1N26A 1FL3A 4Z7VA 3SDCC 1I85A 2PWEA 4AGMA 3L95A 3QIBA 3DMMD 4RIRA 1JVLA 3OKKA 3IMTA 1BXXA 2WCSA 1GH7A 3GSRA 4FULA 2PPCA 5EU3A 5GZNA 3CSFA 5K9OB 3BWSA 3ULUE 4E2OA 5T1JA 2A73B 4JFEB 1X5LA 3ILQC 1OKEA 3WBDA 5D2NE 2Q10A 2FGWH 3O4LA 3SQRA 1EVTC 2A9DA 4CN1A 3DIVA 3QNYA 4JVUA 3LQAC 1G87A 1RCYA 2X7LB 3DSNB 5D7LA 5C08B 2ZWNA 4CJ1A 3QYCA 1NCDH 5F7YC 1LO2H 1Q9OB 3RGHA 1W80A 2WM0A 3G08A 4KUCD 5CN2A 3V55A 1YJDH 2DQIH 5F44A 3NK4A 4NQEE 4JMNA 1IM3A 4KXZI 1L4IA 1S3KL 2H1XA 2VLKA 1XF4B 1VCAA 4JO1L 4K3DH 4NQVA 4P23B 3MJ6A 4I0KA 4HWEL 1MCEA 7CGTA 3QDGB 1KGUA 5E6UB 3DXAE 1NCNA 3HLKA 1QRNB 3QVAA 2IH3A 1NANH 4F8NA 3E8UH 5LBSL 5T3ZL 2EDRA 4MDIA 3BJLA 4LEXL 4R96B 1AZUA 3G6JE 2GBTA 3TNNA 1GGTA 2ADIB 2H45A 3LPPA 1MQ8A 5I5IA 4G8GD 3VWKA 4R97C 2WCPA 1UEYA 3MUZ1 4PRIA 4I4WB 3ZYIA 4EIGB 4O2FB 15C8H 1VGKA 2R2EA 2W81C 3BEWB 5G4MA 5GZOC 4HIEA 4HWUA 2EO1A 5HYJB 4J3OC 3A47A 2X9YA 3F83A 3QIWC 3V5HA 4OLZL 1KZYA 1J9CT 1A47A 4AYEC 3FMGL 3ARBD 4JPWH 3VXRA 1IAOA 4XCFH 5T3XE 4Y2DC 4NKQB 4IIQB 4XVJL 1J86A 1JGIA 5D1ZI 1YNTF 2J1YA 1RZGB 2X0VA 2KBGA 2YXWA 3DVGA 5CSBA 2NTFA 4MMZA 3ES6A 3IU4L 4HUMB 4W9CC 3VXOA 5HPMA 1I82A 1J1PL 2OTUA 4AYFA 1A4KB 3BIBX 3NZ8B 1DQKA 1ZEAL 3VG0H 1ZOXA 5EBGA 2A9CA 1SLWA 3MUGA 3SJVE 1DVYA 4IRJB 4AEHH 2PR9A 3FQTB 1ADQA 4P3CL 1UB6B 3F7LA 1T2QL 5I8EB 4ZX4A 1U0QA 1IAIM 2CM6A 2Y72A 3KZ8A 2NY0C 2ICWI 3IDGA 2QQKL 2DI8A 4L8BA 4PQXA 5DS2A 5E5MA 1I1AD 4GMSL 4YHYB 1ZA6B 3WNKA 6PCYA 3AUVA 2F08A 2GT9A 3O0RL 4FKKA 1GL4B 3TXAA 2G2RA 3P9MB 5GZND 3CK0H 4N8VA 1JNLH 1XEDA 5ICZA 3RI5F 3D85B 3TBYA 5B3JF 4ZZFA 3FTVA 4U2ZA 3BAEH 2V7NA 1I7ZB 1BVNP 4GSQA 4OSUL 1XR8A 2IFGA 2FLBT 4ONGH 3QJSB 4MX7B 1NJ9B 1M7IA 1IGCL 1HEZB 3FPXA 1OHQA 1HSBB 3K6OA 4A2GA 4P4KA 3FN0L 5JDJA 3VD3A 4AG4L 2ALWA 4MA1B 1HKLH 3GT6A 5IMLB 5IQOA 3CWGA 3OV6A 4GJTB 3WLBB 4Z7QB 5F9OL 1YHPA 1EEYA 3CMGA 4JPKL 3LX9A 4ZS7L 2K4WA 4PJ7A 3ZE2B 4Y4FA 2PO6B 3T77A 1QX1A 4YDKH 4HLEA 1JP5A 1CFBA 4MB5A 1TVHA 2H5UA 4LARL 2Y3AA 1U42A 3JYBA 3PP4H 4HCRH 3WNPA 4AL8H 3KL0A 2ZSVA 4TSAL 1N5YL 3ZKMD 5JLZA 3TT3L 3VXUD 3QDMA 1QLFA 3DO3A 3I6KB 3TV8A 1EAOA 3A4EA 3W1ZA 1NEPA 3EOTL 4JFPA 2VRAA 3TM6A 3EFDH 1QRKA 3VFOA 2ZOKA 4H25A 3NPZB 4ZAKD 4R8WL 3MV11 2LFGA 5E95B 4FEMA 2ROXA 1MAKA 3KL3A 4LAQH 5TE4L 4ZNEE 1CLOH 2H1LM 5D4HA 1QBLH 4NOFA 3S3SA 5FOBB 4QRQA 3OLGA 4WK2B 1URZA 1XR9A 4AGNA 1YYML 4OD2B 1AZRA 2LLGA 3RQ3A 1JHKL 5J0BA 2R7EB 1W16A 4B9PA 2BVEA 4AIZA 3DUUB 1INQA 1HZHH 2W1NA 4KC3B 3KLHD 2W0FA 1UD8A 3KS0H 1TSHA 3M1OA 3MRCB 4FG6D 4LRNH 3VH8G 1N64H 4J1UB 1TEFA 1PX8A 3R0MA 1KLGA 1SDDB 1XGYL 1ZAGA 5ICXB 3TV3L 2ZXBA 4JG1H 4RLDA 2WXHA 2DMKA 4Y5VC 1T7WA 2GTZB 3IKKA 2EXYC 3LHAA 1Q8MA 5KUKA 5HDLA 1FN4B 5EU5A 5CLXA 3ARRA 2D4DA 3H8NA 1I7RA 2V2WA 4G6MH 3MNVA 2AANA 3NZUA 1M7DB 2CBTA 1FO0B 3R8QA 1V55B 4W6YB 2V17L 3S97C 2YK1L 3QZWA 2BSTB 2ATKB 3VFRA 4MJ6B 2ZQKA 2E8ZA 2YRPA 3U0PB 5BV7C 2JI1A 2YWYA 3VFNA 1OB1A 4OZFH 5AOIA 1V7ML 4BA8A 5I0WA 3FT3B 4XH2A 1PL3A 4KVNL 4L29B 4M7LT 4PLKC 3SJVA 4DTGL 5T3XD 4MB1A 3SPCA 4LVHC 4YAQA 3U30C 5DJAB 5FA4A 5IQNA 1WTLA 1WFJA 3ARFA 1OGAD 2AEOA 4U1LB 3BFQG 4HKBA 3DVNB 3FOLB 4U4BA 3T5WA 4ETQA 3BKYL 4NQSA 2MFNA 3ATAA 3U79A 1A9EA 4LEOB 1Y7VA 2Z8RA 3IJSB 4JDVB 2CO6B 4YHYC 1JPSL 1T0MB 1F4YH 4YE0A 4NQDE 3GSXB 3E9UA 3WLWC 1JK9B 4OZHA 4P9MH 5KBDA 2MPVA 3GRWL 4AWJC 5E56A 1U6AL 1NUNB 1JL8A 4Z7QE 1E6OL 2DLFH 3D39B 4KK8C 2AQRA 2BO0A 1ZHLA 4F7MB 3CFBA 5F8RC 4J3SA 1QEWA 4JQXA 3FQRB 2Z91A 1M3JA 3WIHL 2Y36H 2RCSH 2VSDA 4HS3A 1FNGB 2I7SA 1LEIA 1KFAH 4Z7NE 3UABA 2ICES 3TT1L 1G0XA 1NFDB 2PXYA 1SDYA 4HJ0C 3NP4A 4Q0XL 3MJ8A 4F1ZA 1F4AA 3KLAA 1LXMA 4BA0A 2Y36L 3BPCA 4KX7A 3EJYD 4XXCC 4FG2A 5I5JA 3WIFA 1AHWB 5KYXA 3GMQA 5I19H 1JPTL 2EIBA 2F54A 3W9EB 1A1NA 4AMKH 3KXFB 1OP9A 3RB7A 3WFZA 4ZW5A 1NGXA 4HT1H 3D18A 1AYRA 1OVZA 2DM4A 5KSAD 2KYIA 3UBHA 1IEAA 4HK3J 2P7TB 2Y3NA 2OPCA 4UTBL 5GGRA 3NCMA 3VFVA 3IBEA 1A7PH 5GRWA 1HWHB 4P2QD 1OT2A 3ZOAA 1FJ1B 2B0SL 1T5WB 4WVRA 2ZCKH 4NNPH 3UROR 3C9NB 4TUOA 2UYLB 2XTJC 3MLRL 4ZNCD 4H2AA 3VTTA 2P43B 1OTSC 5KUMA 3IJEA 1UOKA 4TUJB 4NYLA 1OQXA 2H2PC 4FQJH 5CGBA 4TLSA 1MW1A 1WDAA 2X28A 1OSPH 2UWEF 5IK3A 5CCJA 2NZIA 3BESR 3F85A 5HHPA 4OI7A 1O9ZA 2ERJC 4KKAD 1LP9E 5INDB 2ZSWB 4W4NA 2F68X 2P4AB 2Y5EA 1KT2A 3NCEB 4H5SA 3L2MA 3WHE0 1CXEA 2FIKB 2IAMB 4QHNA 1T1ZA 4W70A 5FHAL 1I4FA 2VABB 4M5ZH 1FL3B 2VDML 1ZVNA 3T0EE 1SJHA 2D03L 1MLBA 4LL1A 4IKIA 1V3KA 1YNKL 2B7DT 4FA6A 3A67L 4FQQA 4LZKA 3DDFA 4EQ2A 1P1ZA 2J5LB 3RL2A 1VZHA 4YBQC 4AYSA 3QJTB 5C0FB 2J57A 4Q0XH 2E9JA 1J05A 1CLYH 3S37L 3VXNB 3QQXA 5FR3A 3VGHA 4CU7A 2Q20A 5JPNC 2EINB 1SM3L 1G1KA 1OP3K 2ZUQC 1WS8A 4WU7A 1FFQA 1KXVC 1YEKL 4LQ1A 4UB0L 4F92B 3QEGL 3G08B 1P5UA 4M7LL 1IM3B 4JFDE 3QG6A 3SDXB 3DDGA 4M8QA 5FO8B 4LL9A 3VWJD 3B2MA 3STZA 3N43B 2HFEA 4R8WH 5TE4H 4M3HA 4JY4B 4NS0A 2VL4A 3KLSA 2P1YA 4Z0BL 3KCPA 3QIWD 4MQSB 1T21B 2EVHA 4XPHL 3DNKA 4NZ8A 4XWGH 4J3XA 2IOMA 6TAAA 4PUBH 2Q2LA 3B2PA 3AG2B 4HUWB 4KKBD 1NIEA 4K3GA 3F65A 4Z0BH 2J8OA 2QQNH 3KPQB 1GGCL 2J1ZA 1SOQA 1B90A 2Y06L 5LBGA 3V5HB 2H32B 3ROOB 1KTBA 4PWFA 5A1AA 3QXAB 4XO5A 1IMHC 4JVWA 4E0RA 2YQ3A 1DBKL 5EUKA 5CD3B 5BO1H 4TRPL 3TZVA 3BX7C 5GGSB 4KPHH 5F9OH 4ZBJA 5DRZA 5C0BE 2J3SA 4BWUA 4ZXBB 2VLLB 1CBJA 1G9MC 3MLYH 4Z7NF 5HPMB 1TQWA 3DX0A 3KPOB 4FTVD 1JBJA 5D72L 3QWNA 4PJ8A 2HJFB 3O3DA 4NCC2 4X7EC 3D2UD 1YEEH 3MAWA 1DDHA 4PJFA 4PJIF 1MI5E 2BIMA 2G60H 3B7RL 2YD4A 3FQTA 3Q0HA 4LFHG 4XVUC 4AH2B 1ET7A 1L0PA 4Z7QF 5GS3A 1I9JH 4LCYB 1THAA 2FYYB 3ESOA 4F37F 4XXCA 2O72A 1VZGA 2H47C 2R56L 4M7ZB 5KVFE 5B8CB 5IR1B 2NNAA 4ENED 4WK0B 3ARDB 2G2PA 5GRUH 3FU5A 5EZPA 3WTSA 2GT9B 2DWXA 2OL3B 1NFIB 1AHKA 4LP8A 3HNSL 4PJ7E 1QW8A 3ZJAA 3W2DH 4LPVA 2AV7A 1H9VA 4DWHA 3S5ZA 4M43H 2LT9A 2ZYRA 3U6XS 4PD4K 3FSWA 3MV01 2EO9A 2XLLA 3QZMA 1QAWA 2V7NB 3KM2A 4DP5X 1XR8B 4YS4A 5K59F 1H5BB 2JTYA 1YLBB 5IVNA 3W2DL 2H9GA 3TCXA 4ZTEA 1H6TA 1HI6B 1MRDL 2J88L 4N2CA 3EAKA 2EDOA 3CZNA 3ZTJG 4F57L 4TTGA 1VFAA 3TBWB 3V10A 1IT9L 1ZLSL 1ZDQA 4TVPH 2DLGA 3QI9D 3EJYC 1EEYB 1OAKL 1BAFL 2X41A 1TETH 4P2CG 2ARWA 1K8DA 4Z7VF 3VWJA 1OM9A 3FTXA 3C8KB 3LQZB 2IF7A 3LEYL 5EIIB 4ZRGA 2H0FA 4N26A 3O2WH 2F54D 3BEVA 2V17H 3PP3H 4BM7A 5KANI 3T0BA 1MFDH 1FYTE 1ODUA 5AZEL 4NHUB 4TQPA 3GLDA 5HHNA 4Y7OC 1MIMH 5CEZH 2J1XA 4LARH 4H8PA 5D72H 4HKJB 1MWAL 4MMZC 4UM9D 1GC1C 4CW1B 2WVSA 4JFPB 4UILL 4S0HA 3M45A 2Q8AH 3GFUA 3HMWH 3J7HA 3AQYA 1CGTA 4Z7OE 4AKOA 3RVUC 1H3TA 1F8TL 5HI5D 3VE0A 4JM2B 1F1DA 1DBBL 3PGFL 2WKGA 2J55A 4FQXA 2R9HD 4Y19B 4JZOB 1WYJA 2W9EH 4AYDC 32C2B 2DTML 2XACC 3KPRE 4D0CA 4EDXA 1XR9B 1SHSA 1DVTA 3G04B 2EEAA 2X4SB 4FZ8L 1KGYE 2OJEA 4L3ED 4GRMA 1O5DT 1XGPB 4Y5XB 2HVBA 4NO0A 2OMUB 4UT6A 1G7PA 4XBPA 5IB4A 3WFBL 3IDYB 1YO4A 1OF2B 3N43F 1QUPA 1PD6A 4M43L 4G5AA 5E8NA 1KJ2H 1EQWA 3LEVH 3VACA 2BCKA 4OB5L 4J1UA 3K72B 4NQDD 4UU9A 1SN0A 4PBVC 1TQTA 3QNZB 1MW3A 1S7VA 2UVFA 1FZKA 1T1YB 2BSSB 2X70B 4QRAA 3BVDB 4HZAA 2GTZA 5AUMB 5J57B 4MDJB 3TEZA 2I7OA 1FN4A 3K3QA 5J6HB 4RAUB 2P45B 3S98A 1QG3A 1GW6A 1F58L 1YECH 1DFBL 2V2WB 4QDGA 3KWUA 3PJSA 2N7AA 3PP4L 4HCRL 1QSFA 4L3FA 1N5YH 3JV6B 2HRHA 4ZAKC 2VUOA 4GFXA 2VW7A 4C59B 5GSVA 2ARJQ 4FKHA 1I8KA 1DR9A 1S7TB 2BSTA 4FX5A 3N42B 3BKJL 3JT2A 2SODB 2WLZA 1PYWB 1X6LA 1G6RB 2JJWA 3KW8A 4PY8I 1XV8A 4X4XB 5IMKA 5DO2D 4OFYD 1ZIAA 4JPWL 1YNKH 3L3JB 3FDWA 4ZS7H 3GGWA 4FQ2L 2YK1H 2KZWA 4LMQE 4ODXB 4XO3A 3W38A 3N42F 3L3IA 3OJVC 5F9WB 5CEYA 4Z7WF 3U4EA 4NAQA 4DN3L 3H6AA 5SX4I 1GGIH 4P23D 2XUWA 3JWOH 2EECA 4DK3A 1BD2B 4ZO8A 1B4RA 5F9JB 5D5MA 4HKBB 3SE9L 3L4ZA 1P4IL 4AEIH 4EVNB 3TJEH 3DETC 4K2UL 2V7HA 2E5EA 3FQ4A 1WC7B 2WZAA 3OLDA 4Z7UE 3BFWA 4DGIL 4N22A 1BJ1J 1MI5D 2WLNA 4S1DD 2BVOB 1X9QA 4O9HH 4HWEH 4DESA 1RUAH 5I1CL 1BQUA 1TF4A 2W9DL 1MLCB 1XCQA 3V52L 1NBVL 1W0VA 1CXKA 1ZHLB 3U6XA 4Z8FL 1ZE3C 3VW3H 1BPVA 4XP1L 4U1NB 1JGLL 4TVPE 1G43A 2V9QA 1VFUA 3UTSD 4FQXD 3I6GA 3WCYA 2YRBA 4OVUA 3RWIB 2ZE0A 3EJUA 3TJHD 3U9UB 3WIAA 5J1TC 1ZGLM 4N1EA 1J0JA 3SKMB 1KIPB 5G4OA 1F11B 2PPDA 5KBLA 2K1MA 1X5GA 2IALB 4KVCH 3BI9X 3MLTA 4NNXB 3VRLF 4DUWA 1E4WL 2Z0UA 1U3HD 4NZUH 1YPZE 1OOAA 5IVXB 2V9UA 4WFFE 1EXGA 1CBVH 5DYOA 2XKNA 4BSVB 5HHMB 2VDPH 2E9GA 3EFOA 1R3KB 2CR0A 5CEZD 4Z77A 3RTQB 1JF6A 1XD1A 3K6DA 2OW7A 5T1MA 3CVHB 1MFBH 3WJLA 1YEFH 3EGDB 3B9EA 3N1PC 2XV0A 4NNYB 1UUNA 2JTDA 2X9WA 3PGFH 3FCTA 5CS7A 4Q4IA 2X4TB 4GKLA 5TDNB 3F6IA 4MLIA 3QA3A 2HB0A 3HHSB 5EPMA 2GJPA 5E2UH 4PJ5E 1Z3GL 2XJLA 2QZQA 3ARED 4K8RC 4KKAC 3AXLB 4NT6B 5JW4R 1NGQL 4TUJA 3GK8L 4P2RA 4FI6A 3DO4A 3RDTA 4P2OA 2FDBP 5CZXC 3OMNB 1B0GA 1FE8H 2WWKO 1E9PA 1FNEB 3RDJA 4UAOC 5TF0A 4RBPK 4K3DL 5HHPB 4GG6B 3GPEA 4NKOB 3QUHA 1AAJA 1G0DA 3BAIA 3EYSH 5AAMA 4CADB 4MJ5A 1YG9A 4YDJB 1A3RH 4G6AC 1OF0A 3REWA 3UMTA 4XPHH 2I9LB 2EILB 4FYSA 4X4KA 4YBQD 1PZDA 4DUVA 1DBMH 2W65A 5I74C 1Q9LA 2XQBH 5IB5A 1LVEA 1SJHB 3GXDA 4FMKA 2XN9A 2HH0L 1UT9A 1FFNA 4RSVA 4FQQB 4KO7A 1CK0L 3DA0A 5FFLA 4XPTL 5D1XB 1RUMH 3U9PL 4O58H 4BUGA 1ZEAH 3VG0L 2CKNA 3AY2A 1SOSA 4KTGA 3UTPD 5L8KB 1ADQH 2I69A 4WU7B 3BCFA 5J12C 1R34A 2GJ6B 3O4LE 1F90L 1GZPB 4U7KA 1D5XB 4OGAC 4U1SA 4YXHL 3V0AC 4X8CA 2OK0H 3WS3B 2AEWA 3NIGB 5ACMA 2GCYA 1NAKH 5KS9E 3ULVL 2DYSB 1FYHB 2UZPA 1ZVYA 1XDTT 4HV8A 3WEBA 4G9FE 3E1F1 3P4OA 2VB5A 3F05A 4UYPA 1ACYL 5HDQL 5D4QA 2V3EA 2G0KA 2LFEA 3CC1A 2XN9E 2BZDA 4XWOC 2XDHA 5C0IA 1NCAL 5DJDB 2J8HA 4OIBA 1Z7JA 5AKSA 4AVIA 5EUOA 3WNJA 2PYEB 3KPQA 1JOIA 1T83C 3VQLA 4C4UA 2NNFA 4HPYH 1U8NA 3NPSC 4RZCB 3DRTB 4PBDA 2VITB 4H26A 4QGTA 4PBXA 1A3ZA 3SPHA 4RAHA 3ZDYB 1TVDA 5CD3A 1IKFL 5EC2B 4G6KH 3TIDB 4EN3B 1E65A 5KYYB 2W60B 4MZRA 3EOTH 4ABWA 1VACB 5IP4A 3MRRB 1F41A 2HG5A 3HC4L 4P2RE 1J5OL 3VMNA 2R2BA 5T1DH 3JZ7A 2V2XB 4EOWL 3C6SB 4YNYB 2PCYA 4ZD3H 4OQTA 1DDHB 4GP5B 4F91B 1P2CA 3UOAB 3R06A 4OCLC 1XIWB 4J3OF 5HGAB 3LEXB 5LAPA 2NDFA 3X14A 4WFEE 4MS6A 4WFHD 1SY6H 3QPQD 4QHMB 4ZMLA 4K71C 4GAGL 3CV5A 3ARBC 4L48A 1MFCH 4LCYA 4DP7X 4RAVA 3ET9F 4M7KH 3KWTA 5DHYB 4LK4A 1MZYA 1AACA 4G11A 5DEFB 5FLUA 5TQ0L 3WMQA 2P80A 4UNVA 1C12B 2EZ0D 5GRVL 5ISZA 4DCQB 3MROA 2KDYA 3OWRA 5C0RH 1KYAA 3NZHH 4YHOH 3L9RA 4LCCC 3SDAB 4IKNA 2AQPA 4I0PA 4EZJA 2AV7B 5GQBA 2AQQA 3FS9A 3UG5A 2XRAH 4PB9L 2JKNA 3X1EA 1HWWA 2AQNA 2CA3A 1A7RH 2DWDB 2E4FA 4G8IB 2NYYD 4CSSA 3ATEA 2ATPA 1ZANH 3NCJL 3RVTD 2FJGA 4BJLA 4URTB 3GBMH 1C9SA 4FA8A 1QBAA 2GJ6D 3MXWL 2F2HA 5IG7A 4U1HB 3TWCL 2CMRH 2AZUA 3VA6A 1LWHA 3SPVA 1KBWA 1VFAB 2JKWA 3WKMH 3MPCA 1X7QA 2CHXA 3GTVA 2CK2A 5I1GH 3DHMA 4PTUB 3ILDA 1MW0A 1JIBA 5EG6C 4MDRA 4EAEA 4OJDH 2B77A 4MBOA 4ZUSA 5IEHA 3FU8A 3P4LA 3VI3B 4MCMA 1Q94B 3ZE0F 3H1ZA 3TYFB 5IZ7A 4HIIA 3L1EA 5FYLH 3BEVB 3MCYA 3LD8B 2FRGP 2X4OB 5E9DE 5KOMC 4NHUA 4RMWA 3IDNA 3HZ3A 3DLQR 2QQQA 4J12A 5ESQB 4AL8L 5KS9B 3B3IB 1PIGA 4CW1A 1U33A 1F02I 4ZO7A 4YXKL 4HEPG 4ODHL 2B4CL 4GBXD 1DUZA 4HDIB 5IGXH 4ORGB 2BP8B 2JIXD 3BLKA 4MZ3A 1G7JA 3REVB 2CO2A 1L9QA 2AERT 1QW9A 3ZDXB 4K7PY 3H2QA 2UY7B 5LO7A 1HJCA 1OOWA 3V0VA 4JZOA 4RDQG 2EDWA 1CXFA 32C2A 3UTTE 4B9IA 4M5SA 2OMWB 4CVXB 2YA0A 5I1HH 2P8PB 3H9SE 3RPIA 2FT8A 4OW6A 5JOFA 5D70L 3LRSA 2Q1EA 4GRMB 3V9CA 5K9QG 3MTXA 5IM7A 2NX5A 3UAAA 4W9DC 2R4SL 4XNYH 3SZ6A 1KLUA 3LIZA 4PU2A 5DJZB 4XP6L 3GDCA 3CZUB 2ZOLB 2VAJA 2NXYB 3NSCA 5J3HD 4KX8A 2QMKA 5CIPA 5DT1L 4EXPX 1U8QA 4MD5B 2WKLA 2DPKA 4NZTL 2EIZB 1OPGH 3TO4B 1MRCL 2CDEA 2VLRE 2F74A 5TF1H 5IESL 3TEWA 4CMMA 5BMFL 1OHZA 5IW1A 2YJLA 1YEHH 3B9KB 2FD6L 5CO1A 5C9JA 1C5BH 3HB3B 1OD9A 1T1YA 2YAFA 3FO0L 3SDAD 4MCNA 1EGJH 1SF5A 3SY0B 4M6OH 5FFOA 1NMBL 5AUMA 3CGTA 4QHKJ 3ARTA 3NCYP 2RJMA 1L6ZA 4ALAC 4GG6E 3MV9B 4RFNB 3MLZL 5DD1H 1JYWA 5EO0A 1HN1A 2DMCA 3PV7A 4P4KC 1K72A 4UV4L 4PJBB 4UIMA 1FAKT 4PV8A 2LR4A 3E3QC 2ESVD 4IRSA 4I0PC 2QDVA 4GIAA 1WHPA 2VDKH 2WN3A 2FWSA 1G6RA 1OE1A 4FEIA 1INEL 4HCGA 4I7ZC 4JZNA 4LOUC 2FQDA 2OMBA 4LSQH 1XSIA 4NO5A 3GGWB 1DJIA 5JQHC 3WS6A 3DGGB 2ZUSA 4DFHA 4L0YA 1A5FH 3NBNA 2F7RA 3CFDA 2H8PB 1Z66A 4PW3A 4FFWC 4XCYA 3LRKA 5K1JA 3UZVA 5J5EA 2FEDC 3VFMB 1BD2A 1WZKA 2I07A 3NK3A 3HZKA 1WIOA 3EUUA 1XXFC 1DUYB 4UMSA 4EVNA 4N2LA 4IBUA 4FL4B 3LTVA 3CJJA 1KJ3L 5GJTL 1BGXL 2E9IA 3TVMD 2XQYA 1IGMH 3RURA 1RQ5A 1FL5B 1Z9PA 2IDFA 5TF1L 1KB5L 1KYDA 1XGQA 1CFNB 1N3NA 3BJ91 1SFDA 3D1MC 1GPOH 1J0YA 1UHVA 3UAFA 2VKWA 3NN8A 2H41A 1W0VB 1A4JA 2JMRA 3G5XB 4P5TB 1FL6B 3BN9C 1HEHC 5DMIL 1U3HC 3T3PF 4N85A 1E7VA 5CJOH 2WXGA 3BAEL 3IK2A 3IJHB 4PREA 4WTQA 3FFCB 3U9UA 2Y1ZA 2D8KA 3G5YB 4B27A 1CLCA 3JV0A 3SKMA 4N87A 2OMZA 12E8L 1RIUH 3BKML 4EIZC 2JKXA 2Q9OA 2WZPA 2XHNA 4GSXA 4ZTOH 3DPBA 3II1A 4Q14A 4GKOA 4XE5B 1GOGA 1UATA 4BK8A 2YD5A 4ZMWA 1ZE3H 3DJRA 5DQJA 3BDYH 5C0AA 3ZHFA 4ELME 5I16B 1MCPL 5CMAB 2BM3A 2A74B 5DYOB 5E6ID 5HGDA 2HJKA 5EF3A 5HYFA 3X13A 1Y18B 4UT9L