2AFNA

Structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
331
Chain Sequence
IAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
total genus 88
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA02
2FWLB 3NJIA 1QNIA 2EIJB 4E9WA 2B3IA 2QDVA 1BYOA 1SDDB 1XMEB 3FPYA 4HCFA 2CJ3A 1WS8A 2IAAC 2AFNA 3T6VA 5B7MA 1A3ZA 8PAZA 5B1JC 4N4YB 2NRDA 2QT6A 2E86A 1PLBA 3FSWA 2OJ1A 1NZRA 1KDJA 3QJVB 1MG2C 4M4RB 2H3XC 1AS6A 2EILB 1V10A 4CSPA 2R7EB 2ZOOA 1FWXA 3NJLA 1AR1B 2W88A 3WKPA 1PAZA 1CUOA 2BWDA 5I6PA 2DYSB 1NIDA 2VM3A 3NJMA 2DY2A 3NJKA 1PLCA 3QQXA 1MDAA 4DP0X 2P80D 3FYIB 4KO5A 4AKQA 2EIKB 1PNCA 1JVLA 1L9TA 6PAZA 2PP7A 3TU6A 3WKQA 3DTUB 3GDCA 1JVOA 3CVCA 3H4FA 5B3SB 3SBQA 4E9QA 1MG3C 1IUZA 5TK4A 4WTQA 1AS7A 1ASPA 4KOCA 2YAFA 3S3CB 4X4KA 1GSKA 4F7KA 4UANA 3CDZA 2GHZA 1PCSA 1JXGA 1OE3A 1NPNA 2CUAA 4A67A 2BZ7A 2DWTA 5D4HA 2BZCA 4A66A 5B1KA 1GYCA 1J5CA 1HAUA 1AZCA 1OE1A 4KO9A 4KO7A 1I53A 1AZNA 3QPKA 4GXFA 5B1BB 3NSFA 3UABA 2ZXWB 4A2FA 2BWIA 5I6KA 2J5WA 1J9RA 4F2EA 2CAKA 2JFCA 4QLWA 2TSAA 4UAHA 3AG1B 4YSTA 2FQDA 1HAWA 3FSAA 4HCIA 1AZUA 3T6WA 4G70B 4AX3A 1NIEA 6PCYA 1J9SA 1V54B 2HLEB 2X88A 1J5DA 2XV3A 4BDVA 1PF3A 2GC7C 2XXGA 2XX1A 4PCYA 3NSYA 2PCYA 4YSRA 2FT8A 1UATA 4ENZA 3OMIB 1ET7A 2VMJA 1AS8A 3PPSA 5D4IA 2IWKA 3AG2B 1SFHA 1E30A 3JTBA 2ZWNA 2CALA 2YXWA 4BWWA 4HALA 3X1GA 1AG6A 4DP8X 2QPDB 1KCWA 1A4AA 2UX6A 5I6LA 2YAEA 3QJRB 2JXMA 2VN3A 2HX8A 2I85A 3EH5B 1BXAA 3CVDA 1AAJA 4A68A 2DV6A 4KNUA 3CDZB 2BP8A 3PAUA 1KYAA 5PAZA 4W9ZA 1SHXA 2XWZA 4HIPA 4W1TA 3ABLB 1GY2A 2J56A 4P5SA 3DIVA 2P80A 3QJSB 1EZLA 2VM4A 3WIAA 5I6NA 2YAPA 1JZEA 2X87A 3FS9A 2IWEA 3H4HA 3EF4A 3GYRA 4GP4B 4DP5X 4NB7A 1MZYA 1OCOB 5I5JA 1KCBA 2YAMA 3ERXA 5F7BA 2XYBA 1M9WA 1ZV2A 2CCWA 2Y1AA 4YSEA 2IWFA 2VW4A 3TA4D 1V55B 3NJNA 3NJGA 4BK5C 5LDUA 1E5ZA 4JKNA 5B1JA 3T6XA 3IBOA 2PPEA 3S8FB 4BXVA 4HHGA 3KW7A 2Y69B 2OCCB 5FC9A 3QJUB 2PPCA 4DP2X 1PNDA 4DPBX 4DP6X 2YAOA 4AZUA 1JZJA 2BW4A 4A2HA 2FJSA 3DKHA 1WS7A 4AKOA 1IC0A 2YAQA 3X1BA 1M56B 1ZPUA 2QDWA 1NIFA 1JZHA 3ZDWA 3WNJA 4JHVA 1A65A 1RZQA 1W6WA 3QJQB 1M57B 4FAAB 1L9RA 2H47C 3PAVA 1OV8A 4G71B 3NJJA 5I5IA 1YLBB 2IDQA 4WKXA 1L9OA 3AZUA 2XXFA 3ABGA 1NTDA 1MZZA 1B3IA 1ILUA 4HHWA 4A2DA 1WAEA 1ID2A 2PPAA 3OD3A 3PXLA 2IDTA 1NIAA 3TBBA 3EH3B 1SHWA 3ZBMA 2H5UA 4RH4A 4DP4X 2MTAA 2BP8B 2I7SA 3X1NA 3QJTB 1KBWA 2YAHA 4KOBA 1E5YA 5I5MA 2PPDA 3AY2A 4JHUA 4DP9X 5I26A 1BQKA 1L9QA 3FSVA 2VW7A 1WA2X 1NIBA 1URIA 3FQYA 1T5KA 2YQBA 3OMAB 4NAJA 3NJHA 1WA0X 5I6MA 4E9TA 2HXAA 4HZ1A 3ASNB 1L9SA 4L0PB 4DPAX 1PLAA 5AFAA 3OM3B 4G72B 3WNIA 2A3TA 1HFUA 3FU7A 4YSDA 3FQ2A 2BO0A 5B1AB 3S3BB 1SJMA 1ETJA 1IBYA 3PAZA 2FNWA 2FQGA 2GB2A 4BWUA 4TXVB 1N68A 3SBPA 2GBAA 1ADWA 3ABKB 3X1EA 1SDDA 2IDSA 2IH9A 2VSKB 3MX0B 3C75A 1A8ZA 1ET5A 1JZFA 2HRGA 5B7EA 1AG0A 3NP3A 2BHFA 2AZAA 3FYEB 2PLTA 4GP5B 1J9QA 4AI7A 2AZUA 3FQ1A 3G5WA 4NERA 2WSDA 5PCYA 2XVBA 3FU8A 3NYKA 4DPCX 3PLYA 4M3HA 1FA4A 1KDIA 1NWPA 3NSCA 5F7AA 4YSAA 4ZK8A 1PZBA 3ABMB 1BQRA 1BEXA 2GI0A 3V9EA 1ASQA 1QHQA 2BP0A 4E9SA 4EF3A 7PAZA 1RKRA 3L45A 1GS7A 1JXDA 1ZIAA 4YSCA 1WA1X 4N8UA 3X2QB 1FFTB 5AZUA 2FT6A 2JKWA 5B7FA 1PZAA 1RCYA 4P5RA 2UXVA 1CYXA 1X9UA 1TEGA 4HAKA 3N55A 1AANA 1CYWA 1SF3A 4E9YA 2FQFA 2WO2B 3EH4B 1BYPA 1AQ8A 2VW6A 4YSPA 5E9NA 1TKWA 1GR7A 3FU9A 5EHFA 3IE9A 2TSBA 2Q5BA 3NSDA 4MFHA 3UAAA 2IDFA 1W8EA 1GY1A 2GIMA 2UXTA 2MRYA 4Q89A 2PP9A 3X1FA 3AW5A 3NP4A 9PCYA 2LLNA 4F2FA 2XLLA 1BQ5A 1NWOA 1OF0A 2XV2A 2XUWA 3NT0A 2QPEB 4YSQA 1IKOP 4BDVB 1N70A 2DWSA 2UXGA 4GY4A 1AIZA 4YL4A 1AZRA 3OMNB 1BXUA 1XB3A 5D4JA 3HB3B 1BAWA 3IN0A 3BQVA 3FSZA 3CZUB 3UACA 2GC4C 2UXFA 4A2GA 5I6OA 2FQEA 2W8CA 1AOZA 1GS8A 5I28A 1PZCA 1ZIBA 3NJFA 3OQRA 2BP0B 4Q8BA 4E9XA 1IBZA 2EINB 1E67A 3T9WA 1PY0A 3AG3B 5AKRA 1KBVA 1OCZB 5A7EA 1AACA 1L9PA 1W6LA 4UF7C 3H56A 4K9JA 2IH8A 2PP8A 1SFDA 4YSSA 3JT2A 1JZGA 2XV0A 1J9TA 4A2EA 1NDTA 3V9CA 3S8GB 2OV0A 2FTAA 1DYZA 1GS6X 2Q9OA 3PCYA 2PCFA 4G7RB 3UGEA 3GXUB 1JOIA 4FA7B 3TASA 3CG8A 4KNTA 1GW0A 1SNRA 3D12B 1OE2A 2GSMB 2UX7A 4G7SB 3CVBA 2J55A 3UAEA 3WI9A 1CC3A 1RZPA 4AKPA 1QLEB 2N0MA 3T71A 4CSZA 1SF5A 1ILSA 4YVUA 1ZDQA 1F56A 1DZ0A 3N2JA 4GP8B 1JZIA 3KW8A 4QKTA 4PAZA 3TBCA 4BWTA 2EIMB 2ZONA 2HX9A 3T6ZA 3ZX1A 1NINA 1JXFA 2PPFA 3IN2A 3RYMA 1TU2A 2AVFA 3ASOB 1NICA 2HRHA 2R7EA 4G7QB 2VSMB 2YARA 1KGYE 4BXSV 1XB8A 1CURA 1AZBA 3AG4B 1NPJA 3FT0A 4YSUA 3WG7B 1ASOA 3FPXA 2J57A 3EHBB 3HEIB 1KV7A 2I7OA 1OOWA 3MBWB 5IY5B 3BVDB 4HCGA 3SQRA 1EHKB 7PCYA 1ET8A 3U25A 4KO6A 3S3DB 1BXVA 4YVNA 1XB6A 1OCRB 2YXVA 3IEAA 1VLXA 2IDUA 3SBRA 4GYBA 3UADA 1ZDSA 2B08A 2RACA 2HZHA 2XU9A 2XX0A 4DP7X 2AANA 1JERA 1A4BA 4E9VA 4E9RA 1R1CA 3ZIYA 1OCCB 1X9RA 1E65A 2HX7A 3FU7B 5TK2A 2BW5A 4DP1X 2CBPA 2FT7A 4KNSA 4YSOA 1TEFA 5ANHA 2DYRB 1A4CA 2WO3B 1PMYA
chains in the Genus database with same CATH superfamily
5HHNA 5IUSA 4NCC2 4XO3A 4KRLB 4PJGA 1CLZH 3SSGA 3AQXA 2MTPA 3BWAB 4Y2OA 3VXPB 4GG6F 2VB5A 3D51A 5KZCD 2A1WL 5L88L 2BHUA 2EIZB 5D96C 4A7GA 1MW3A 1I7TB 3C5XA 3IRCA 2NRDA 3GEFA 5AW1B 3CHPA 1I82A 2AQ2A 4UAOB 4JZOA 2OJZH 3FQTB 3TZVB 1S5HA 2ITFA 2Y7MA 1F41A 1PLGH 2XN9A 2Y0SA 4K3JH 4HLJA 4LAQL 4IW4C 1VFUA 1AE6H 1JNLL 4D8PB 1WFOA 3U6XA 3K0YA 4JCWA 1I1CA 3VD0A 1S9YA 4NN6B 4MCYA 1UD2A 1UXSA 4MAYB 1RHFA 2XHNA 4W6WB 5I6PA 3LNGA 5MENB 1IIIA 4NQXA 1IAIM 3RL1B 2EVIA 5T1MB 3O41B 1F6AA 4XPHH 1G9EA 5JLZA 1G7IB 1IC1A 3IDGB 1Z0NA 3NN8B 1UGKA 3QWRD 1TTBA 5L9DL 4CMHC 1E6OH 3U4KA 2HVKB 3LEXB 5ALCL 4AKQA 3F3HA 1YY8A 2E9GA 3JV5A 4FL4C 3B9KD 4OCMC 4GBXD 4KRPD 1ES0A 2R1YA 1WFIA 2PW2B 2CKBL 3DUHA 3DUSA 4CC4C 3FTGA 1I8LA 2Y5EA 3CSGA 3MRNA 5C0ND 1YAZA 2DI7A 1B0IA 2VJ0A 4RFOH 2QVIA 4XGZB 5D4HA 2F18A 4ZG1A 1B4JH 4L8BB 3UC0L 4C4KT 3INOA 3HNVH 2FCBA 5EUOE 1RJCA 5TPWH 2YUXA 4Y2OB 5T3XL 5IVXB 4X4MA 3ROLA 1DSFH 4HEPG 1U3HB 1KJ2L 3S35H 3CX5K 3UABA 4FFZH 3EADA 1MCIA 1MLBB 2XV6B 2PYED 4JRXB 4OTXH 3BKJL 4JZOB 3UTTB 1HWGB 3IVKB 1A1NA 1S5HB 3AG1B 4KK9D 1GW6A 2NTFA 5HJDA 4P5TB 4AYBA 3MRIA 1EAOA 4EPSA 3SPHA 4A38A 1MFEH 2J8OA 3AROA 1RSFA 2FB4H 2M83A 5D7IF 4B6ZA 1CE6A 4OKVA 5K39A 1DJSA 5B38B 1JL8A 2FT8A 5J1TC 3B3BA 2WINB 4XPTL 3SDYL 3BQUA 1OF2A 4GAJL 5DVOA 1BG9A 4G6AD 4HHAB 3OKOB 5T1KD 4ATTA 5JLZB 4JB9H 2IWKA 3CC5A 1N5AA 3PUUA 3NH7L 4WGVB 3T3MF 1FORL 4L9LC 3SOBH 3ET9F 1JV2A 4YDKL 5I30L 2MPAH 4PGJA 3E3QC 1YY8B 1QRNA 4H8PA 1EJFA 2FATL 4G80A 1NEPA 1KCWA 1WHPA 1HXYA 1U33A 5I8CA 1NC2D 3OQ3B 3I74A 3VQLA 1FL3A 3ZSSA 1U0QA 3L1GA 2JV6A 2OYMA 5DYOA 2K6WA 5IMLA 4OZHF 1BVNP 3QCTL 4ZFGL 3GJEA 2XWZA 1IQDB 1NEUA 3JT0A 5KS9A 3LN5A 2NSXA 2R2HA 1ZLWK 1BQLH 1F3DJ 1KB5H 4HC1H 3ROLB 1A7NL 3KLAB 4PJ8C 3CVHA 3DJTA 4EZMA 3MJWA 5HYSG 4Y88A 1CU4H 1ZV2A 1N64L 5A2BA 3MC0A 3HB3D 5BQ7B 4X6CB 1OP5K 3WN5C 3OR7B 2VC2L 1E5ZA 3FSOA 1ZVSA 1N6VA 2P44B 3EGDA 2PPEA 1MNUL 5IF0B 4CKVX 2XT1B 5D6DA 5C0JA 3WUWB 2L7EA 1AR1D 1CGYA 5CBEB 3DSNB 4WCYL 5F8QC 4ES9A 4CN4A 5FYKL 1UQSA 3JWNE 2V7HA 3X1BA 3BQUB 4IRZA 1YEEL 4R2GC 4JEGB 1E9PB 4UQEA 2YHGA 5C08A 3QSKB 1GL4B 5FGSA 3QJQB 1B4LA 3NABH 4ZMVA 1S7UB 3OPZH 4A7SA 4GPVA 4QEGA 3W38A 3T1FA 4TSBH 4AUYA 5F3BB 4MJ6B 4G80B 2R2CA 2D7MA 3DOHA 4HHWA 1BPVA 3TPKA 3PDOA 2BP5M 4LHUB 4ZW6A 5IG7A 1TTRA 2A73A 3FMGH 4EEEA 3BUYA 1L7IL 3DRTB 3PREA 4MNQA 4UT9H 5IMLB 3H3BC 1X5HA 5L2KA 1MJUL 3X1NA 1K8DA 3O2WL 3GJEB 4LLQA 5KJRL 3EJQA 2AXHA 2SEBB 1H8NA 5AAWC 2JQZA 1VGEL 3HPJB 2BINA 5BW7C 1XGRA 3OKYA 4QCIB 3LN5B 5KS9B 4GFXA 3KE0A 3MV7E 1KZQA 2A2QT 4QHMA 1B0RA 2JI3A 3U6RA 3CVHB 1BZQK 4HUXA 3I75A 4ZFZA 3QFGA 4UZUA 4EN3B 3SQOH 1F3JB 3MSPA 5FW6A 4LOUD 4IDJL 43C9B 4X6BB 3VG9C 1LMKA 1MHCB 5E1GA 1ZVSB 1EUUA 4JO3H 3EGDB 3WDJA 4ZMAT 4YHPA 2GBAA 2VSCA 4MQXD 4AXWB 3A6OA 2IDSA 1ZANL 2UUDK 4NWUH 1IM9D 1BVKA 1NGYB 1T0OA 4OJFH 4LU5L 3CZKA 2KPWA 4JMXA 1HEZB 5D72H 4MDJB 4W9FC 5CLTA 4NQSB 1TNNA 1WWAX 2EDYA 4OIFA 5F9WB 3GXNA 4K3JL 1C1EL 1I3UA 2FNBA 1XZWA 1CFNA 2HFFA 1LD9B 3KXFA 2Q0ZX 4JRYB 5GRVK 3L1EA 5HP5A 4XC1H 3FU8A 1FNEB 2H4EA 1ACXA 3KGUA 3PLYA 3PS6A 1NWPA 4KHTH 4NZ8A 4POZD 1SBSH 1Y18A 2A6JB 3KPSB 4R5VA 3TYFB 5JO5A 3QUZC 1LEIA 2CG9X 1WTLA 3FW6A 3L45A 4AJ0A 3ULVL 3PDOB 4GSDL 2ED9A 3L7EA 3WS3B 2A73B 2X4OB 2ADGA 3VTAA 4FQLH 2A0LD 3O6KH 3SE3A 5DRXB 4F80A 3NAAL 5ACMA 4KTYA 3ARGD 5L2KB 1G9NC 4HZLA 1UOWA 1K8DB 1CYXA 3O4LA 3AJ7A 4ORZC 5ILTL 5EEWA 4MZ2A 3DV6A 3ISWA 3SDCC 3JYBA 2ZWZA 3LKOA 5E7FA 5BUAA 1LP9F 4TSCH 3D06A 3AT0A 1FDLL 1PX8A 3UBXI 1JI1A 1TKWA 5JHDA 1RK0A 3QFJE 4MRCA 4MMZA 5D6CA 3I75B 4MFHA 3FB7A 2Z8SA 2GSIB 2UXTA 4RFNC 5ETUA 3OAYK 2ZX5A 2PP9A 3VG0L 4OLUH 1I9IH 1DQML 4BCZA 5HPMB 1IGFH 5DUJA 4NZJA 3UROR 2XLLA 5TPWL 3ZSTA 2HJKB 2BLFA 2YGOA 1ZA6B 2NLJB 3BHBA 4DETA 3CK0L 2CM6A 2ZXCA 5CWSA 2ZCHH 4ZMXA 4XCNA 5TQ0L 4FFZL 2GBVA 1AD9B 1BVKB 2J6EH 4XNQB 4OCNC 3BYTA 4CN1A 1SBBA 1L6PA 4JFXA 1BLIA 1AKPA 4J5VA 4LKCA 2G3XA 1UA6L 4FQ1L 4Z5RA 3SOTA 5C71A 4BZ2L 4JFTA 2YPLA 3LNEA 1FNHA 2MQCA 4N2MA 3WLWC 1BAWA 2VIRA 4NN7B 3DX1A 2ERJC 3KXFB 1CFNB 3N1GC 2VO8A 3MGAA 4MLSA 4PJ7E 5AALA 3AM8C 1PJ9A 2DMHA 5J5EA 5T1DL 1KIPA 1PVHA 1Y18B 2BSRA 2I69A 2A5UA 2BFVH 3TVMD 2MCG1 4HIJB 1LEIB 1F0LA 1T80A 3JV4A 2JLPA 1JJUA 1IM3B 3U7AA 1E67A 4OFPA 3L7EB 2ADGB 3QDMD 1AACA 3O9WB 4YHZH 3I6LE 4UF7C 1EWHA 3H9SE 4YEEA 4HZLB 2HVJA 3PQYA 4NJAH 2MPAL 3DOIA 1AXIB 4I77H 1AJ7L 1AOHA 5TDOA 1I3GH 5H35A 2EDHA 5KYUB 4OI9A 5KUKA 4A7QA 3QULA 2FTAA 5EEUA 4YPGA 5CJXA 4P9HH 5I23A 5A2IH 1RK0B 4ISVB 4LLMB 1I7UA 5D6CB 2R1WB 3HZVB 1A4KB 4F37K 2JIXB 3EYSH 5DO8A 5F1IB 2A4CA 3A4AA 1OT2A 3CVBA 2J1XA 3WFBL 5EO0A 3N1FC 1CC3A 4ZUSB 2GAZA 2N0MA 4JG9A 2NY6D 3I50H 1DEEA 5IWLA 3C6SA 5ACZA 1K9TA 2R27A 3SEPA 2OULB 1DBAL 4UINH 3IKCA 2JB6A 3ARBC 1K2DA 4XN8A 3W0WD 5IW1A 4BWTA 2WZ5A 1WH0A 5E6IC 2VZ3A 3HZ3A 5FO9B 3NCWA 3U1PA 4JFYA 3VVVA 2VLRD 2YD4A 2BXYA 4U6XA 2OZ4H 2YPLB 4MCNA 3BDYL 3RYMA 3HMWL 3ASOB 2HRHA 2X44D 3RIFK 5SX5H 2WCGA 4UB0H 5EU6E 4QDGA 1SOXA 4G7QB 2NY0D 5CJ8A 5EUOB 3GD1C 3QEQD 3GRGA 1KIPB 2BSRB 4X80L 3W9DB 3U9UA 2B59A 2RAMA 4P49A 1KJMB 2X4PA 5GS0H 2NCEA 3M07A 1QYGL 3JV4B 4NXKA 2JVUA 2PWGA 3JZYA 3LEYH 1I85C 4Z7OB 4WJ5A 4U7SA 5JPNC 5LBSH 4H20H 3NABL 3OPZL 4FZ8H 4OCXH 4Z3IA 4RAVA 1RZFL 4KJPD 4TSBL 1J12A 1F6FB 1FNAA 5DMKB 5TDOB 1I1AB 1T2XA 1MRFH 1VRSA 1C9SA 1Q94A 2BH0A 5C6TH 1Q38A 1ETB1 1FYHB 1X5JA 1ZHNA 1IAOA 4U3HA 1NCNA 3DYMA 1I7UB 1PG7L 4I3RH 4K3HA 4O2FB 5ANMA 3O2DH 3UXFA 3V4LA 3SKNA 3FO0H 2L4OA 1FHNA 4FQIH 4NO3A 2QV2A 3QHFH 1ACYH 1DUZA 2Y23A 5EO0B 2ESVE 5D71L 3UAJA 3BZEB 1JPTH 1Y6MR 1ZXQA 5EU5A 1ECZA 1PD0A 1FH5H 3C6SB 5ACZB 1MAJA 3GMQA 2ZAIA 3OGCA 3IKCB 1VZIA 5JW4N 2WHVA 4MMXA 3VI3E 1XIWC 4PBVC 3S34H 4UM9A 5SWZA 3U0TA 4PRHD 4JO3L 1IL1A 4M4RB 3GK8L 1MFVA 4LBEA 3FN3A 1ADQA 4OF6A 3OKDA 3EDEA 1D5RA 4AL8L 2XBTA 5I1HH 3QZMA 2B59B 4NM4L 4M02A 4PTTA 3C5ZC 2DYSB 1OARL 5CSZB 1ZS2A 3NJMA 5EU3A 4JDTH 4AH2A 2YUVA 3AWGA 4KHTL 2J88L 1SBSL 4RAVB 3C60C 3BWUC 3V6OA 3O3AB 4AVIA 3KBEA 4XNMB 4GUQA 1U2CA 4AGMA 3N41B 2WIIA 2FSEA 1RZJH 3MBED 1YC8A 3QDJA 4G1EA 1E50A 1WG3A 2KKQA 3SBWA 1IAOB 3P77A 1IUZA 2HKFL 2HMID 2BJML 2F53D 2MEJB 2XQYA 5BZZA 4AQ1B 3BAIA 4UANA 4NO3B 3G6AA 5AWNH 1DCLA 2FX8L 2WCSA 1BQUA 1DUZB 2JKIS 2NX5A 4QF1B 2ZP9A 4HKZA 3NZ8B 2I24N 3EF7A 5C09D 2Y7QA 1UZ6E 3FRPA 5EWIL 1IE5A 4FEMA 3KPRE 2VLJE 2G5RA 3ALWA 1P4UA 4J1UB 3WFEH 5GGUA 4TVPE 2FLRT 3ARDA 2F74B 5C86A 1Z2KA 1G1OA 1T0PB 1JGLH 4FQXA 4FA8A 2P8PB 5KN5B 1L9MA 2CAKA 1GOFA 3U0TB 4PIRF 3BGFB 2IQ9L 4XO5A 3F84A 3LRKA 3R19A 5JDSB 1G7HA 1NAMA 4IKLA 3P69A 6PCYA 2ZKMX 3V0DA 1RZKC 3T08A 3L5HA 4JVUA 3G6DH 4NQTA 4K15A 4RZKA 4M7KH 2FJHB 1QACA 4Z7VE 3S4SG 1U91A 3LZNA 3X17A 2XPYA 3HVDA 2Q3AA 3JVGA 4Y1AD 1FO0H 2D4FA 4ZOBA 2AQNA 3KL3A 4R90L 4NUGL 1AD0B 2YRLA 5FLVA 2ZWNA 3QUGA 3IU3B 2WNKA 4AY0A 2CALA 4UUJB 4LF3B 3L7FA 1D5IH 5EC1B 4J2QA 4WI0A 3UBHA 4PRID 2FYVA 2FSEB 2MOVA 4EUPG 2EDJA 3EOTH 3SDAB 2I85A 4S1QH 3BKYL 2VH5L 3EH5B 3SCMC 2VISA 3UMTA 3DOSA 1BXAA 1R3IH 2J20A 4NJAL 1UWFA 3G5XA 4WWID 3G6AB 4I77L 2J1ZA 3HZKB 1I3GL 1CLYL 3FONA 3NZUA 4G6JH 4TM9A 3DJ9A 2J56A 3LQAL 4HKZB 4PP1D 3L4XA 1OAKL 1PIFA 4TLKA 4F2ME 2BOBA 2E47A 4X98B 4JKPH 5GGUB 4RQQA 3ELQA 4MQ7A 3U9PH 2A83A 4UQ3A 4FQXB 5F6HI 4YIQA 3E3QE 1S78C 5ISZE 1HTYA 4ODXA 4QAWA 3QEHB 4IRSB 4F1SA 1UVQA 4ZXBD 2ENQA 4XWOC 4QUOA 3QEUB 4NP9A 5I75C 2GW5A 3UJIH 1OAZL 2VXVH 2CK2A 3CDYA 1PNDA 1I9JH 2R8SH 2EH8L 3LRSB 4AZUA 2HT3D 3RGVD 4DAGL 3LB6D 4M1DH 2BCMA 3T0BA 4XTRD 5KSUB 5H94A 4DCQA 1J0KA 5BMFH 2WN2A 1U91B 2E75C 4NUPA 4OUUA 1D6VH 1WE5A 3L3JA 1U93A 2QHRL 1LO3L 4UB0L 5LAXA 1KCVH 5JMOC 3V4PH 3V4VA 4FAAB 3GHBL 4XVSH 4JQXA 4S1RL 4M48L 4YDIL 3PAVA 3RBSA 3RRQA 3EHBC 1F4AA 5ITBL 2AQSA 1KPVA 1DLHB 3D0VA 1S3KH 2JH2A 3GSWB 4KRNA 4HMDA 3F7QA 2DZEA 3FQNA 4PJEA 3VW3L 3T6QC 1VA9A 1ZD6A 5HHXH 3T77A 2AV1A 2PYFA 2VISB 1NCWH 3DOSB 4HD5A 2XKSA 3V0AC 4FQJL 2Q2EB 4R26H 4YXHL 1CTNA 4RZCA 3HE6A 4K5PA 4JHUA 5HDOA 3OX8B 5J1SC 1URIA 3MRBA 5MHSE 2VZ1A 3O2DL 4OFYA 1KLUA 3BWZA 4FQIL 1L9SA 4MQ7B 1N6UA 2CHZA 4UQ3B 3F7KA 3QAZB 1ZTXE 2XA3A 3FQ2A 3MV9E 5B1AB 4P07A 2R1XA 3REWA 1QR4A 4OQTH 5F1SA 3H9SB 1FL6A 3FCSA 4BWUA 4LOVA 3HUJF 5HHMD 5JHLA 2OMNA 3M6DA 4KFZC 1X7SA 1OZUA 1G9MC 3C09B 2CUIA 3MX0B 3CQPA 4MAZA 2WC7A 1X7QB 1NMBH 4OGYH 3M86A 4YHYC 2OMYA 4QRSA 2E8ZA 4HUWA 5FYJU 3S34L 4J2XA 4RETB 2WM0A 2WXIA 1R17A 2J43A 3MRPB 3V8CA 5KOMC 3WTWA 2YQGA 3B7YA 3VD2A 3L1OH 5AW3B 4P59H 3WO4C 4DCQB 4XHQA 4NQDE 3K91A 1EHAA 4OUUB 1A3LH 4PU2A 5DJYA 5KANG 2MIZA 5F71A 5J89A 1K4DB 1O6SB 1T1XA 5DJCB 4JFDD 1F4WL 4PJCB 1Q72H 3S88H 3AREC 4HQQH 1FGVL 3Q43A 1KPVB 1P84J 1UWYA 1PYWA 2P47B 3D0VB 1RKRA 1URLA 3FB6A 4YHLL 1ZIAA 5JORB 1SMDA 4FTDA 5KSAB 1KYOJ 2BNQD 3T77B 1VFMA 1AHWC 2PYFB 4ZPVA 4ZUWB 1GKEA 1UWXK 3VXSE 1JXJA 3X14A 1ETA1 4TQEH 3NTCL 4ODVH 3SGKA 5KSBE 4N2HA 1HJCA 1X9UA 2P8LA 2QQLL 3RUGE 3PIQB 5EU6B 1KN4H 1IIKA 1U3JA 2G9HA 1HNGA 5E9NA 5G5DA 4N0UB 2O61A 2BSCA 2WQSA 3DPDA 3KYMA 5DUMH 2C7UB 4GSUA 2WOBA 4MVBD 1SLWA 5AWNL 3DIFA 4YE4H 2ZUUA 3VQ2C 4GQ9H 3BAYA 5I1EL 2H3KA 1UUSA 1KIQB 25C8H 1Q8MA 2H32H 3TBSB 2ADJA 4Z0BH 2XUWA 1HDMA 3IE4A 4FFYH 4GMTH 1EAQA 4V1DA 4WUKL 2XVLA 5FYLE 4RGND 3IS0X 4QRSB 4XCCH 2AEPL 3OMNB 1ITBB 2ED7A 5EOTA 1RIVH 1FF5A 2W9EL 1J1PL 4WNSA 3KL5A 1IAIH 2BC4A 3HAEB 5DJYB 2DQTL 1ML0A 2ESVB 1KCRL 1TSHA 3F5WA 4JY6B 4MD0A 5AZ2L 1FSKB 4WDIA 3FTSA 4MLIA 4KVNL 4FGMA 4K8RD 2AERT 3HZYB 2QR0B 2VUKA 3VXQA 4N9OB 2VL5B 1KLGB 3WHE1 3TCLA 3WIIL 2E6QA 3O6FC 5I1CH 4A7VA 2ZSVA 4KROD 5DD0L 3AG3B 1WCBA 3MXVL 4CW1A 3GJFA 1W6LA 1FV1B 4K9JA 3ZHKA 1HCFX 5DURB 1QTPA 4JPQA 1OAJA 3OKMA 1YVLA 2P8LB 1S7WB 3P9WB 2ISDA 5IKCA 3Q13A 1J9TA 3F7LA 2BIOA 1WO2A 2FLBT 3CSPA 4WUUA 3VSTA 5I17A 1FZOA 2G9HB 1YMMA 3RNKB 3CHXA 2HWZH 2WNXA 5EPMA 2R69H 1IGMH 4WTWA 2VN4A 5IGXH 4G6JL 5IWLC 4PBXA 4Y5YC 4J3TA 4KXAA 2GSMB 4GIPD 1KCLA 4PJAA 1OALA 1F13A 3K6OA 2EC8A 4FX5A 2E4FA 4X9YA 4CSZA 4QRBA 3MODH 1SF5A 3FFCA 5TDNB 3PDDA 3Q8FA 3DRQB 1HDMB 2QQQA 4MS8D 4AMWA 2ZCKH 2P1YA 4V1DB 3V0GA 4AVHA 2WKLA 5I9QB 4QRRD 4PAZA 3RFRA 3S5LB 4BKTC 2N56A 2BS71 2C9PA 3TTSA 1NLDL 1UD8A 1WP6A 2X4TB 3Q6FB 3GHEH 5EOTB 3VFMB 1NCDL 2ZXGA 5JZ7C 3ZX1A 1AFVH 1P5VB 3BIKA 4RMVA 5KVFH 2F61A 2AVFA 2BC4B 4I0PC 4JUSA 1OSPH 3FU0A 3LY6A 2R8SL 4PJDE 4F57L 1JF1A 1YEDA 3VNZA 2P45B 3SKOA 4OLZL 3QHZL 3RI5F 4M1DL 2NXYC 5I1IL 1AZBA 3VXQB 1NPJA 4EVNA 4KHXL 3BH9B 3VJ6B 2GCYB 4CMHB 3RX7A 5G2NA 5F6IC 4FXLA 5A1AA 2EAEA 4H8UA 2DJMA 1F4YH 1N59A 3B5GA 1WCBB 4FL4B 4MS6A 5IR1A 4JFZL 4EOWL 2JQAA 1X5FA 3GJFB 4XVSL 2W0PA 4KTGA 1IAMA 2CNYA 3TIEB 2OXHB 4HKXA 3WY1A 2X41A 3OKMB 1F90H 1CD8A 2K4AA 3UADA 2XU9A 8FABA 4PB9L 3I85A 1YMMB 2BCKB 1NCWL 2AANA 3TCTA 4XXDA 1C5CH 1CTOA 5EPMB 3QB7C 1OCCB 4HFUL 4XAWH 4Z7VB 5E00A 3NG5A 3UZQA 4JFED 2HX7A 2VXQH 2BW5A 3FQUB 1D5MA 1GRWA 2Z8WC 3VQ1C 1QHOA 4P57B 2YO3A 4GJTB 3IT8D 4LSQL 3MO1B 3SY6A 5IHHA 4DVBA 3B2UD 3FFCB 4WFEE 1YNTF 3WIFA 1LMIA 4HOWA 2R56H 2A6IB 1MW1A 1QFUL 3W9EB 5JIQA 1MRDL 5DC2A 4UTAH 1KUMA 5ADOH 3RG1C 3L4VA 3B56A 3IFLH 1CD0A 2EDQA 4P9MH 3TF7C 3QNYA 1JZ4A 2HTKC 2LVCA 3BIKB 3X13B 3R0MA 5C6WH 5A2FA 5DJ2B 5CEZD 1CFMA 5L4FA 5T3ZD 2I60H 5K69A 1YEIH 4XMKH 5KUMA 2D2OA 3FQWB 4OGYL 4UYPA 4PJGE 1I9RL 1J1OL 2OP4H 2WUCH 1GGBH 1RK1A 1EEYB 2JTYA 3Q1SL 2A9DA 5C0FA 5KVGH 2PMZA 3AU1A 1I1FA 2XFXB 3FUNA 5DJZB 1CFQA 3EO1B 4N3UA 3GLEA 3HNSH 1ND0A 5IEKA 4L5FE 4U0QB 5ISZB 4NC1C 2UZYA 5DS8B 3DHJA 3ECWA 4HKXB 4CDGC 4DP0X 2P80D 2JNZA 2DRUA 5FK9B 1V27A 5INDB 5F21B 1RLBA 1FE8L 2CZNA 1FBIH 2VKXA 1EUTA 4HEMA 5D7KE 3PP3H 1PG7X 3DTUB 5DD3L 1BZ7B 8FABB 2OQJA 3QPQC 4HOMA 3P0YH 3DA0A 5JIPA 4DK5A 1RUQL 3UYRH 4JKLA 3NOIA 4ODVL 5J1AB 1E2VA 4XN1A 2ZSWA 5D1QA 2CUAA 4PJ8B 3O8XD 5KTEH 1GYCA 4PRBB 5I71C 1KN4L 4GI6A 1UXWB 2OCJA 1KG0B 4DVBB 1JHLH 3SZ6A 1ID5I 2C9AA 3WIFB 4DGIH 1JAEA 5DUML 3ETSA 1FC2D 5C0EB 2ZXWB 4LFHG 4NZDA 4YE4L 2H2SD 4GQ9L 3FT1A 3Q6GL 4NNPH 4LVEA 3TNNB 3P02A 3BH8A 3ZKND 2NR6A 3QNYB 2R4RH 3OHXC 3KCWA 1OAUL 1CDUA 4H8WL 4G11A 2MPVA 4FFYL 4GMTL 1KCUH 3MRCA 1MLCA 2IANE 4PW3A 4R2GB 5DRWA 1HHGB 4J4PA 1Y0LA 2XX1A 4XVTH 1JD7A 3D4CA 2DWDA 1IARB 4HUUA 1SY6L 1VCBC 1LTXA 2R59A 5DDHA 1LEKA 1XH2A 3DO7A 2ATPA 3H9HA 4FNSA 2QLVB 1PKQB 1KWKA 1T04B 3U4AA 4ZX6A 4PP2B 2Y5TB 4PVMA 3MCLL 3C12A 1S2EA 4S1SH 3NA4A 2FBJH 5ID0B 2YXWA 1U4FA 3IJEA 4UQ9A 1TJIH 3SGEI 3CPLA 3VO0A 4U6YA 5D2NA 2OQJB 1SJXA 2F58L 2G5BA 1I1YA 1A25A 4MA1C 3QUMB 4YE0A 1E28A 2V3DA 4X8JA 3L81A 4NQDB 2Y6SD 4RAUA 2B15A 3BXNB 1SHXA 1A5FL 2YC1B 3MLPA 5KYYA 1T2QH 1AYRA 3QJSB 2DF3A 4Y9FA 3CIQA 4ELKA 1ZEAH 2CDFA 5JHAA 4HJJH 1H5BB 2HWZL 1F6LL 3G6JE 1AC6A 1F45A 1MZYA 2AXFB 3L4UA 5EC2A 2LW3A 3ERXA 5F9DC 1BXXA 4ZDHB 2CCWA 1I8IA 1TVHB 4HPYL 1BFTA 2J4WL 3ZW3A 5BS0B 1BJ1H 4Y19A 5DFAA 1VGKB 1XR9B 3KH3A 5T33L 1O7SA 4X6EA 1TPXB 2ZPKH 4B9JA 1JGDA 5KSBB 3QXAA 2ZCKL 3JWDC 5DFTA 5F1KC 1MHPL 1PY9A 1G0DA 3EOAB 3HC4L 2OMZA 4JM4L 3RUGB 5FC9A 3QIUD 5DRWB 4K5LA 1Y0LB 4ZAKA 1SXSA 4EJ1C 2F1AA 2DWDB 1E40A 3IFNH 4XVUC 3DKHA 4HUUB 1LEKB 4PS3A 4JQXC 2VKWA 1A47A 2YAQA 1WQVT 1IGJB 1M56B 4OJYA 3QUZB 5F9JA 4TNVK 1NGPL 2VN5A 1OSPL 4OAWB 4TPRL 4Y9BA 4QRPA 4FNRA 1HILA 2X3AA 3NSJA 4L3EE 4FQHA 4NIKB 3G08B 5K9KB 3IJEB 1E8XA 2P5WD 4BFNA 3OKLA 4XI5C 1NGZA 2O4EA 3NFNB 3OD3A 1G4RA 3CH1A 1TEYA 1I1YB 4YGVA 2K8MA 4L1DA 4PLKD 4M29A 4X8JB 1UJ3C 4PJHF 5HYQB 4U33A 4ZO8A 4Z7QB 3VWKA 2XRAL 3LKNA 1ZCRA 2YGVA 3LYRA 3QORA 4Z3JA 3OAUL 5GRUL 4P2RB 4JE0A 5LNGA 3P3RA 3F8UB 1WC7A 2BSTB 4UNVA 2Z91A 2CDFB 3BO8A 4DN4L 3PPEA 1BECA 3BVUA 2PKDA 3VU1A 1A6TA 3HIZA 1UOKA 3DJSA 5I6MA 4LARH 5DMYA 2VUOA 5FLUA 3QC5X 1OGTA 5EBMA 2HXAA 2AJYH 2AK4D 5F0PB 1PLAA 3CZFA 3QI9A 5GXBB 4F8NA 3DLQR 2BO0A 4PRPA 4DESA 1M2VA 2I5YH 4ICWA 4X6EB 5IMKB 4WNQB 3F58H 1MW0A 3AAZA 4NZTL 5L2JA 3DYOA 1XH1A 4AQAA 5E0QA 3A47A 2YD3A 2VERA 4DOHB 1M7DA 4PRNA 4TKWA 1MFAL 2UZPA 5JW3L 5DTFB 1U3ZA 1AG0A 5IVXF 3IFLL 1L6ZA 1KTDA 2IOIA 3LIZH 3MRKB 3P73B 5LB1A 1BAGA 3RX9A 3QVAA 1QTYT 2CBOA 3MA7A 1KB9J 2V33A 1E90A 5FECA 3HS8A 2KLSA 4XMKL 4B7LA 4CMMB 5AB9A 4FLHA 3PWNA 3RWDB 3EUUA 2OP4L 2WUCL 1GGBL 2CLRA 2WAQA 3DBXA 1KDIA 4PY7A 1ZJBA 4N5UA 4NHUA 1RU9H 4BSVA 1AMXA 1MSPA 4NO0B 1XL6A 1JXDA 1O0VA 4N8UA 4JFFA 5I2IA 3TO4D 4KY2A 3UZVB 4KU1A 3ESNA 3AT8A 3CDCA 1CGUA 5HYEA 4PWFA 4DKTA 3PWPD 1J0HA 3VWKB 5AVRB 3C08L 3QORB 4TVPH 2PR4H 2CA4A 1BJ8A 3QIBD 4MXQD 1PKOA 5LWYL 2APVA 3WSQH 1MFCH 2DI8A 3EYQC 4PB0H 5JHMA 2VW6A 2ARJA 4YSPA 1N4XL 5I73B 3E1F1 3VRLE 2H1XA 5EBMB 2QL1A 4RBPH 1YEFL 3PL6A 1P9MA 5DJ6B 2YEVB 2AV7B 3CZFB 2D03L 5JIHA 4AW7A 3D9AH 4PRPB 5E6UB 3B8YA 1M2VB 3O4LE 3MCKB 1NFDA 4DGIL 1TQBC 1NMAH 4XZUB 1T3FB 2QPEB 1ZLVK 5E2TL 5CIPH 4H8VA 5ESAB 5JHDE 1KTDB 4NKOB 2WP3T 5F0LB 1AZRA 1ZV9A 2MNWA 2R4RL 3KJ4B 3FOMA 4CVZA 4Z3GA 3MA7B 1L0XA 5DI8A 1HYRC 3Q2WA 3IN0A 2XOTA 4JHWH 3W39A 1YEGL 3PWNB 3CZUB 3UC2A 2YLHA 4G9FD 5JPNB 1H3XA 2UXFA 4XVTL 1KELH 4PY7B 5EOCJ 1AOZA 5DHDA 1RJYA 2K9FB 3PGCA 5C70A 3CUPB 3NK3A 5C7ZA 4V33A 5E9DE 3L9EA 4XX1E 3SGJC 3NGBB 4PHXA 2OTUB 4JFFB 4WIQA 3K7UA 2R0ZH 1JPST 2R29H 3D7PA 4S1SL 4FQQB 4BUHA 3ZL4H 2IH8A 1VFAA 2NY3B 4HDIB 1CLOH 3X3GH 4ZTPH 3HBGA 1TJIL 2YD8A 4YSSA 4QTHB 2LABA 4Z1PA 1CLCA 4NLAA 3FUIA 4DGYH 3WMQA 1MCOH 5T5FL 3MA9H 4MXWL 1GS6X 2H41A 3N43B 1BZDA 4M5SA 4ADIA 2CWRA 2KQNA 4JDEA 4P2QD 2C1PA 4IEFA 3HR6A 4FA7B 5CM1A 4P23C 2AEQL 2E4TA 2EEBA 2YOAA 1UJTA 4N8CH 4FYRA 4APQD 3K71A 4N2OA 1ETZA 4NQED 1OP5H 1XIWB 2CIIA 2OR7A 3GO1L 2GJJA 2Z7WA 4FNTA 4HJJL 4U6VL 4WI8A 3KJ6H 3SODB 3RU8H 4HWBH 1DZ0A 4FERA 2J6WA 4Z0XB 4GP8B 1JZIA 3GSNA 4KTEL 3MREA 5ICYA 4G2AA 1D6EA 3CVIL 1P5UA 4GI8A 3CFMA 4EDXA 1AQMA 4LDEB 5IMOA 4BFIA 4CVZB 1WICA 1Z7JA 3ZTNL 2ZPKL 4BFKA 4JPWL 1V3JA 3KYOB 4LDOB 1WUZA 3PP4L 2W80C 2PPFA 1CF1A 2MOQA 2DKUA 5IM7B 4O9HH 3BCDA 2DM4A 1MXGA 5DK2A 1CI5A 1EFXA 4HXAH 1FYTA 1X3DA 3HBZA 4N0CD 1XB8A 3IFNL 2XG5A 3MFFB 1A9BB 3F01A 4ONHA 1EQWA 2CKNA 3BH4A 4JHAH 1SPDA 1BM7A 1UFGA 5CGTA 3SGEH 3TOPA 3VVWA 4B5ZA 1X7TA 5I18H 3DV4A 5DS1A 2BVYA 3LZFH 1L7TH 3C2AH 3T65B 4LLYA 3H3PH 5C07E 5DLML 2EXYC 5DD5H 2I9LB 4H40A 5EZOH 1ZTXH 2RQEA 3HMXL 4KX7A 1UWEH 2R4SH 3S48A 3MR9B 4Q9CA 4N0FB 2HZHA 3QJZA 2KZKA 5LUMA 2QADC 4MCZA 1JERA 2C1PB 2XZQL 1QFWM 4IEFB 2UVEA 3ZDZE 3QDGE 1CICA 1KC5H 3QWOA 4L4VD 4DVRL 3EGXA 4N2FA 3K71B 2FIRT 3QUYC 4KI1A 1ETZB 3TESA 3HCVA 3KHQA 5AD0B 3IAGC 5HJ3A 3ULVD 2MCPL 1P6WA 3VXMD 3ZE0F 3EGSB 1N0XH 3B9KA 5CNHA 2AJYL 2YUWA 5ICZA 4GBXA 4WU7B 1FFPA 3GMMA 3MREB 4LPYA 5ICYB 2E7MA 1D6EB 2UUDH 1HI6A 3MGTB 3RWEB 2ETWA 2NSMA 5B1JC 4X6DA 3VFGH 4OW6A 4EDXB 2DS4A 3U2JA 5A2KH 3WTVA 2I5YL 2OJ1A 3EBGA 4OZIF 2WXKA 2CGYA 1V5JA 2R9HC 1MG2C 2DEWX 3UO1L 3GXDA 3O11B 3D34A 4NHCL 5I82A 3VXUD 4DZBA 5J12B 1AS6A 2EILB 1V10A 3VI4A 4PVBA 3JVFC 2X1QA 1J0YA 1OTUC 2K78A 5E8DL 5HDBE 1FYTB 3NJLA 2PO6A 3MLZH 1V05A 5LDSA 2QGEA 3C6LD 5T1LD 2VM3A 1NFIA 3NESA 3BPCA 3MLYL 3DECA 3NJKA 1W15A 2ZCLL 3FAWA 4JM2C 3LXAA 2ALAA 1A14L 2BWQA 3SJVD 3WS6A 3I9GH 5ICUA 3SCMB 1ZTMA 1Z5LA 3N85L 3UPCA 2Q10A 4MA8H 3OZ9H 3QXUA 4HWNA 4YWGL 3BZ5A 1D2OA 4QT5A 1DQKA 4EBQH 4Y7OC 4DERA 5FHBL 3RGBA 4M6MH 3VWJD 2QKIC 4KI5D 1ZLEA 1HH6B 1HXMA 3R0NA 2PR4L 1CICB 5FYLH 4JQIA 1GAFL 3EGXB 3OAYH 2DWTA 4XNAA 1MCKA 1MFCL 3T0EC 3L3GA 4FN0A 1IEAB 2GFBB 1UTDA 4AGPA 2VXSH 3QZWA 4OLYH 3TFKD 5EDSA 2Z8VC 4NC1E 2ZAHA 2X9ZA 4L3EB 3M8OL 4Y2DA 1KGJA 4AT6B 3GLZA 1H8LA 4DW2L 1R3HA 3ETBF 5I6XB 5ICZB 3MLXL 5D1ZC 1ZSDB 2D7TH 1A6WH 1NC2A 2HKHH 1HCYA 1HI6B 4X6DB 1A3QA 3U7YH 3HS9A 1JDAA 3HI1B 1G7MA 4H7VA 2TSAA 1QP1A 1OGAE 2QTEA 1XGZA 3N91A 4W81A 5JPMC 4Q9QL 2BSED 3TWCH 3L5WA 5KJ4A 3D2UA 3M1BA 5HI4C 2XWRA 5IP4A 1KIRB 1CF8H 2CK0L 1W16A 3BE1L 4NUQA 2Q87A 4N8VA 5CEXA 1UOVA 5HHVL 4QXGH 5DK0A 5DMJB 1MWAA 2GC7C 2JLLA 4MHHI 4KXZH 4JFHE 4AIZA 1D9KD 1RHHA 3MLSH 1NFIB 4J3OH 4AG4L 3BPCB 3ECBA 3EKCA 4JHWL 1IAKA 1CXKA 4XT1C 1ET7A 2D2CC 4FULA 1AS8A 1DN2A 3D18B 3IS1X 1SXZA 1PFCA 3BGMB 2BSDA 3HRZC 3D4ZA 1WT5C 1TQVA 2DB8A 5I1AA 3NIGE 1G1CA 2EKSB 5LXVA 2BOCB 3MLTA 4Q4IA 4Y16C 2YMTA 3JTTB 5GGRA 4DP8X 4DTGL 5EUOF 4I3SH 5ELIA 1C8PA 3LRGA 2PCFB 3JXAA 5HI5C 3QR2A 1TNMA 2VN3A 2DDQH 5EU7C 1WFUA 3IDIB 3ZL4L 4IOFD 3D85D 1UCBL 1H6TA 1FQ9C 2WKGA 2QGCA 3X3GL 2Z35A 3VFPB 1WGVA 2WMPA 2YPKA 4TSAL 3L3GB 3RTQB 1SJEA 1P84K 5D70L 5I16B 2X87A 3FS9A 3K8LA 4LPXA 2AJUL 2NY4C 4MQTB 4KUZH 1KYOK 4O02B 1MFBH 2F1EA 5TE6H 3VMPA 4CRPA 3MJ7A 4JFOB 2ZNWA 4YHYB 2OMVA 1U8JA 3MBXH 3RIAK 4IYKA 3T6XA 2AABL 4JN2A 3D2UB 4UQAA 4AEIL 4I1RA 3K46A 2Y69B 3D09A 3E2HB 5JXAL 1W72B 1YEHH 3G9AB 1I3RA 5CP3A 4DP6X 1I7ZB 1MVUA 4WO4D 3ZQ9A 4P46A 4PV9A 3LH9A 1LXMA 4GRWB 3TO2A 4DO6A 1WD9A 3T2QA 3AREB 4C58B 4XPFH 1THAA 1SLUA 4PJFA 1AY1H 1W0YT 5I1AB 5JXED 1AHWB 3MLTB 5LBGA 2KLRA 5FM4A 4G6MH 3U48A 4F24A 3KEHA 1IU1A 3BAKA 1IC5L 1NTDA 2XDHA 5L8JB 1INQB 3KPNB 5JIKA 1FP5A 5DUPL 2BMKB 3ILPA 4Z77A 1JZ6A 3RILA 5I18L 2ZOLB 1P2CB 2WW8A 2RCSH 1SHWA 1EHNA 3S36L 3ZBMA 5BRZE 1L7TL 4LT7A 4LHJB 1OANA 2PTUA 4YO0B 1EDQA 1G4MA 2Z35B 1C5DA 2YMOA 4X6FB 4PY8I 2ZXDA 1ZTXL 3QARA 4L4TB 2EDEA 1UWEL 2YPKB 1XVSA 3QI9C 3FSVA 3IFPB 1D2PA 2PWDA 1UYWH 1BVOA 2YQBA 4JG0H 1EAJA 3JBG7 2WKOF 1OAXH 2OL3H 5E9DB 4YX2L 1KC5L 2HFGH 3BP6A 5E5MB 5D7JD 1NCJA 3MRDB 3S5YA 4M8RA 2WXPA 1A7QL 1A6VH 3H2QA 3EO9L 1GMEA 1HOCB 1U8JB 3CN1A 3ZE2E 4D0CA 3QUML 2BIIA 4TXVB 1KPUA 3TN0A 1ZT7A 3ABKB 3AQYA 5FKPA 3X1EA 4L5FH 4P5KA 4XMWA 4ZD3L 5IHUH 2JJSA 1FRGH 2GEQA 3ALPA 2F5BH 5IJVA 1MVUB 1UM6H 1RPQA 4ZMNA 5KVDH 1X5KA 3TO2B 3MYJA 2PW1A 3EJYC 1J9QA 2DQUH 4DKFH 2C3VB 2XTLA 3G5WA 3P4OA 4QYOA 4M7JH 2XVBA 3O6FB 3NCMA 5DEJA 3HTLX 4NBYB 3MRLB 4LVOC 3ZGIA 3V6FB 4NUMA 2EDRA 2KZWA 3FTYA 4ZOCA 5DMIH 4AENB 5IVZB 4X5QA 5HY9A 1I3VA 2FJGB 2A4ZA 5GGSB 5BV7C 4K4KA 3TBYA 2ZUWA 3ILPB 5FA3B 3FZUC 2X42A 4MSWB 2EYTB 1RCYA 4G82A 4AMKL 4C59B 4G8EB 3CHSA 2AXJA 4IRJC 2DL2A 1C5DB 3L1FA 4LO9A 1MY7A 1UA3A 1NBZB 1MIEH 4HAKA 4R4BB 1CYWA 1A22B 2W5PA 1XXDC 3QQNA 1IBFA 4Y5YB 4EBQL 4I87A 3AFLA 3MGOA 4YAQB 4U1LB 2WIMA 1JZ3A 5GGTH 3FU9A 1JYVA 4Y4HA 1G9NL 3BP6B 4LRIC 3RVWC 1MFDH 4WWKA 5CN3A 2GIMA 3U7WH 3QDMA 3TZVD 2RFXA 3KNBA 4WTXA 4HV8B 3HC3H 2P46B 1R24A 1P7KB 2YKKA 2DTMH 1UACH 4RMSA 2KT6A 1W0WA 1BQ5A 1KPUB 1TJGH 3TN0B 2AQRA 4PGCA 4XO8A 5FKPB 1G6RA 2HTLD 2V3EA 3IK2A 2FJUB 1A6WL 2D7TL 4HW6A 4P5KB 3UTSA 1DVFA 1Q0XH 4MAYD 4I0PB 4UOQA 5E99H 5FXCH 1NDMB 4LCYA 2AJXH 1CN4A 3GBNL 4XPBH 1HN1A 1M1XA 4FCHA 2D3NA 1J1XL 3QDGB 4PVNA 4LLWA 2NUTA 4KJQC 1T7VA 3FT9A 4KJYA 1OOAA 3HZMB 5HXMA 1ROCA 4JY4A 3HI5H 4WEUD 1GJIA 4EI5C 1RZKH 3FT2A 5LVEA 1GOHA 4CVXB 5EBWB 2F15A 4XBPA 3R1GH 2WBJC 3GXMA 3H7BA 3MLSL 4GW1B 4LPCA 4CBZA 1MEXH 2MFNA 4GMSL 1G7JB 3FB8B 3TBYB 2JK5A 3FH5A 2Y3NA 4WFGD 2GJ6A 4R8WL 2BIQA 3SO5A 4HWEL 4GRMA 4U0RC 3UJJL 1PX3A 1OD7A 1T83C 4I3SL 5AUMA 1U8LB 3EZJB 3NZHL 4A2EA 5ES4B 3IWVA 5ERWB 2FR4B 2J21A 5HDBB 1GYWA 2AKRA 2DDQL 3MGOB 1Q9LA 2FWOA 4NRXA 3ZU8A 4HSAC 4QRFA 4BHUI 5CZVH 4Y4HB 2C9UA 4X5XA 4IMLA 1A2YB 3GMLA 3MV8A 4RX4A 5GJSL 2ICCA 1T66D 4I7ZC 1RP8A 5EEYA 1G94A 3KNBB 3ARPA 4HH9A 4P5TD 4F7CA 3WI9A 2NY5C 1U58A 4PI0A 2XN9D 4AKPA 1R24B 4BA0A 4NFCA 3SPVB 1PQZB 1W0WB 3T2OA 3WIHL 3U46B 4FFWC 3IF1A 3E1ZA 3MACH 3X11B 1EXGA 4PJ7F 4M43H 3PJLA 5DFWH 1K3IA 3UTSB 2VMDA 2E7BA 1VZHA 1DVFB 1MFBL 3FFOA 1DL7L 4NRYA 5IOPA 1NAKH 3CLFL 3Q05A 3VX0A 2IPTH 1O75A 3CAFA 2EADA 4H0GA 1PCXA 4ONFL 4PRAA 2H0JA 2XWDA 2X70B 4S2SB 2HLFD 1EEZB 3VTMA 2GY5A 1BZOA 1JXFA 4JREC 3CFCH 3PE9A 5CJQL 2I07B 3QH3B 1YEHL 2YD5A 2VDLB 4P2OA 4JY4B 2ORBH 4N86A 2FHFA 1THCA 3FT2B 4BXSV 3P4LA 1RZIB 3LZOA 2Z4QB 3H7BB 3REVB 2CUMA 4U1IB 2OR9H 4XPFL 4XPGH 5KBPA 3WLBB 3FPXA 4N20A 1AIFA 1BEYH 2JK5B 1AY1L 2DBLL 1XF2A 5K5YA 1OGAB 3U25A 5BO1H 1HL9A 2J25A 5EUKA 2IPUG 3HE7A 4XCEB 4KZDH 4YVNA 1J11A 5J06A 2AK1H 1TTAA 3IPEA 2GUYA 3IEAA 3Q2NA 3F7VB 2CXKA 4OJDH 3EDDA 4ZW7A 4N6QA 2RCSL 3G04A 5CILL 4AVKA 2CNZA 1PD1A 4X5XB 4IMLB 1H8SA 1BBDL 1SJHB 3MV8B 5I1KL 2LTQB 4LLUA 2YD7A 2K7PA 4ZQKB 2WY3B 2K3TA 3LKSA 5IJKC 3B9KC 4JJOA 4KRPC 2OYLA 5F3HB 3DVFA 4Y1SA 3WKMH 1K4CA 5JIDA 4Y9EA 3APDA 4HCRA 3IF1B 2Z4TA 3O2VH 1P7HL 4Y8DC 3OHXB 4UDTA 2EKJA 4NCDA 4D0BB 2OL3L 5IOPB 4FNLL 5DJ0A 4D9RE 5B7MA 5IROA 4OGAD 4KC3B 1CFVL 3AACA 3FCTB 2CO4A 3IGLA 4OCYL 4ZJ9A 3BQUD 4A63A 3FSWA 1KDJA 4HIHA 4XX5A 1FN4B 3D07A 3M1CA 5EZLA 1DFBH 1YEKL 2VZUA 4K07A 5E1AB 2VDKH 4L5FL 4JFSA 5GGVL 3WFCH 2G3NA 2J8UA 3BVWA 4PV8A 3QIWA 2F5BL 5ADPH 5LXGH 1P7QA 5GHWH 2CIKA 4AUUA 15C8L 2W9LA 5EO9B 3VM5A 1QRND 2YQ3A 1FWXA 2AITA 3MJGX 1MUJB 4KK9C 3JV6A 4QRUB 4KKCD 1T21B 1GVIA 3F83A 4DKFL 1MJJA 3N6YA 2UYLA 1DQTA 2VR8A 3PDGA 4TRPL 4PFEA 5JUEH 1AIFB 4FQCL 4RISL 4HJUA 1CXIA 4M7JL 5JIIA 3NSXA 4BQCA 5I24A 4TLTA 1H3TA 3ZTDC 4LSVL 5IHZA 3QXWA 1UWXH 3BJ91 4YMPA 2EE9A 5EUKB 5IQMA 4NQCA 1SN5A 3HE7B 5DMIL 5CU9A 5FYJE 1QBMH 3K6NA 3ARUA 1UM5H 4XMPL 4JR9H 3S97C 2EIKB 5FCUH 3BP5A 4G6AC 2PP7A 3H4FA 4KPHH 3HHMA 4E9QA 4HS3A 3G04B 2I9TA 1PJWA 1UB6A 2X89A 1OGPA 1BM3H 3GRBA 2WWMD 3NIDE 1TLKA 3T09A 1U6AH 3VI3F 1F2XK 2GHZA 3ESPA 1PCSA 3LQZA 4MJIA 4ZOAA 1KTKE 4R7DB 4ZO9A 3QEGL 5DC0A 5F97E 1KULA 1RJLA 1ONQB 3MNWB 1J5CA 2GJZA 1LE5A 3GRWA 1K4CB 4AMXA 4GG6A 4PCTA 3PXJA 3Q44A 4A7TA 1MIMH 5IHLB 3N0AA 1TZIA 5HYSB 5L6YH 3BIAX 5EMYA 4FLRA 5GGTL 4ZTEA 1Z9PA 2CDGB 4H2CA 3QPKA 2H2PD 1W0VB 3GSRA 3N1MC 1T0MB 5DJ0B 1MFDL 3NSFA 3U7WL 4IU3B 1J9RA 2OMXB 5EBGA 1MVYA 2WJ7A 4U1SA 3IGFA 1HHKA 1NFAA 2Y6TE 1S7SA 4PS4H 5E4EC 5EIIG 1UACL 2ZF9A 5AB0A 4JPIB 1EANA 3FSAA 5D1QE 2ZX8A 5C08D 4ZMTA 2VZTA 1DUYA 1FGNL 1JNNH 2C3XA 2FX7L 4EI0A 2GTZA 1FI8C 1YNKH 2DEXX 5IESH 4PV8B 3QIWB 1Q0XL 3GZOA 3SQBB 2ZYSA 1HNFA 3B3IB 2A38A 4OBSA 3HB3C 5E99L 1LJMA 1RIUL 2ZG1A 1D5BA 3T0EE 2DYPB 2ZWLT 3HG4A 5JNYA 3OLDA 5AOLA 1UATA 4ENZA 3A4DA 3GI9L 4MNQD 5LLIC 2BIHA 4U7KA 1AQKH 3LDBC 5L2KD 3IAQA 3PPSA 5K1NA 1AR1C 1FCCA 3MKGA 1NBYB 1RZKL 2EICA 1JD9A 4N2NA 1TQSA 3R1GL 4OM0H 1YUHA 3P2BA 1B90A 1E4WH 4IOIB 2V8LA 4AM0B 1MEXL 3GSOB 1BD2E 2VDQH 2ROXA 4Z7NE 1AG6A 4X8GA 2BNRE 4K3DH 1UZ6F 1EGJA 1HE7A 5E94A 5HDQL 3S8WA 2F5AH 4JG5A 4Z3HA 3O81A 4HS3B 2I9TB 1FFRA 5I76B 2ZP8A 4UWQB 1KB9K 1JRHI 1UB6B 4WFFE 5FO2A 4U05A 5MEQA 4JCMA 3HRPA 4JO2H 5EU4B 4MJIB 3BX7C 5A2CA 4NENB 2VNCA 3DIVA 3IDXL 4TL5A 5TDPA 4GEIA 1JK9A 1JDCA 2G9KA 2GJZB 2VM4A 1P1ZA 2WTRA 1E3FA 1XCWA 3CSTA 4TNFA 1JZEA 4GG6B 2MNJB 5ESQA 4WI6A 5MP6H 4PWHA 4F8LA 1V3MA 3GSRB 2P7TA 1QSEB 4Q4EA 2EYRB 5FOJA 4OJCA 4PW4A 1U8OA 5F44A 5IQ7L 4HJTA 4PLNC 4QWWD 2CMRH 1B6UA 3C2SA 4KXCA 3TA4D 4PJXE 4Z7VF 5EN2A 4M7ZC 3VD5A 3WD5L 3KXFD 1OSYA 3OWRA 1QEWB 4HBQA 5D1XA 3JQOB 4BK5C 3MACL 3JSSA 3IJSA 3EYFA 5EU7E 4YR6A 1DUYB 3KCPB 4M43L 5D55A 2AJSH 5D7IA 3W3BA 4DN3L 1U8KA 3VFWA 1B9KA 2YK1H 1HZHH 4L3CA 4DP2X 1K5WA 2IPTL 4OCRL 2KDYA 1IT9H 3ZKXC 4DF9A 4LOUC 3QQDB 3F6JA 5JNYB 1IM3D 3C8KB 3VYPA 4D3CL 4HWZA 4R83A 4MQXC 1GA2A 3DETD 4MNGA 3WY4A 2X2YA 3CFCL 5K1VA 1U92B 4TUJB 4JHVA 2Q76B 4XN5A 3FC8A 4MAUH 2OAAA 2F08A 4PTUB 2FJFB 2XIDA 3BFWA 4GSQA 4XP5H 3RA7H 2DKSA 3OBAA 3A0OA 4PREB 3ESOA 4FFVD 4Q6YA 1VHPA 3GKWH 4Y4FA 3VFTA 2MHAB 2YPVL 2P5EA 3FQXA 3PXLA 2IDTA 4OZHA 3TT3H 2VCOA 4LGRB 4GI9A 2CO7B 4Z7WE 4POZC 1TYEB 2C1OA 1KSRA 1DP0A 3P0VH 4DO4A 5E5LA 5E4AA 5F6HJ 2FAUA 4OZFA 5IQ9A 1XF5A 2WTRB 4OM1L 4YDVB 5IB3B 2HFEB 2L3BA 2EVGA 2A0LC 5BXFA 1T7XA 3KM1A 2XG4B 5CUSL 5KYXA 3DJZA 4AE1A 5IT2H 3ARGC 1WA0X 2EEXA 4N85A 4XC3L 4MWFA 5F96H 1J8HB 5C3TA 4L23A 3W81A 4HJ0D 3GBDA 5DHVH 2KUTA 3MRRA 2YPLD 1B2WL 3IDMB 5E7BA 3IJYB 3WKML 2Y1ZA 5BZDA 5D1XB 1K8IA 3IM1A 3BZ4A 1R47A 1BMWA 4YR6B 5EEZA 1MFMA 2YBGA 3WEXB 1BFVH 2IADB 1QKZH 3VFWB 4BRJA 3L3KA 4L3CB 1F3DH 4KQ0A 1E4KA 2JI2A 4JW3A 4MYPA 1VFBA 2GPZA 3QA3A 1AO7E 2H0PA 5AB1A 1ADQH 2PLTA 3FYEB 3MNZB 4MNGB 3CCHA 5CLWA 2OMUA 4PG2A 4O02L 2VDKL 3ES6B 3T3MB 4HIXH 1M71A 1Y6NR 4JZJA 1G9ML 5ADPL 5LXGL 4MX7B 3PQYD 2ZUXA 3IMTA 3NPSC 5IFJA 1VB9A 3EFOA 4ONOA 1N2RA 1E2ZA 3II3A 1KENL 1XZ0B 2Q1EA 2AAVA 4E9SA 4ZUVA 1CD1A 3TX4A 2W0KA 4XRCA 4RESB 1W72L 1VZGA 4DGVL 3S36X 4F8PA 3X2QB 4JKKA 1N0LB 3B2VL 3WFDH 4OZHB 5AVQB 1J87A 2WK2A 1LK3H 3IXAB 3FQRB 2JKWA 1MCNA 3BP4B 1CFSB 4MBRA 4R96A 3WFHA 3DO3A 1JK8B 1OB1A 1QBML 3TVMC 1YEWA 4GH7B 4YK4C 4NOBA 4N6RA 3U4BL 3WHXA 5IQ9B 1TEGA 4HUVB 3X3FL 1XF5B 1J05A 1DBBH 1SF3A 2DQ6A 2J5LC 2PTTA 3VD7A 2F19H 2F8XC 2CJUL 2A9MH 5BXFB 1J5HA 2APFA 3ILDA 2BVQA 1H0DB 3P3TA 5DGQA 4MWFB 3VFSB 2EDOA 1NKGA 1SMOA 4X5PA 2BY0A 4UMSA 2BS9A 4ILDA 3T2LA 3WU1A 1IZKA 4WFHD 1QZNA 1K8IB 4K55A 5HHOB 4H5SB 1OF0A 1A6UL 2BERA 4Z76A 1EO5A 4ZNEA 1DVZA 4ERSL 1YY9D 5A16A 1FLRH 4HF5L 1M7IB 2ICES 5GZOD 3DXAA 1NAMH 4YL4A 1VFBB 3CIAA 4P05A 4L2LA 3QA3B 1RURH 2ZYIA 4JL2A 1BG1A 2NY6C 1VESA 2QBWA 5CR8A 1K3ZA 1XCQB 2GQHA 4XXCA 1DBJL 2XACC 5ABAA 2ZWYA 3V0HA 3P0GB 1M71B 2E6JA 5E8EA 4ACTA 4G8GB 2UWEE 3APMA 3M17B 3VD3A 2JB5L 1XH3A 3D2TA 4Y7MA 4A6YB 5KSBF 1RMFH 5EORH 1QSFE 3RUGF 1IGCH 2Y72A 5DJAA 4O00A 1TQTA 4OFDA 4KKAD 2QSCL 4ZUVB 1MWOA 4GW5B 1GGIL 2JXMB 3HNTH 1JF6A 1V7NH 4GS7C 1IX2A 2NY0C 1FL5A 4AQOA 3WFHB 2PP8A 3OC8A 2CGZA 2QADB 3UAJD 3MMEA 3T4AB 3IJ7A 1LP9A 3WHXB 3DX3A 1RUAH 4K3DL 5HVHC 1YG9A 1T6WA 4G6KH 5A6LA 1JZDC 2OV0A 4FEIA 5J9PB 3QUYB 1S3RA 2VABA 3QUKA 1IB5A 2XA8H 2BVQB 2WLMA 1BGXH 1JOIA 2YN3A 2CXGA 3BSZL 4BELD 3TASA 4KJPC 3CG8A 1GW0A 3AXIA 1BJ1J 4UM9D 5SWZD 1G1KA 1TJHH 5KAQG 1P6AB 3TJPA 4G7SB 5J13C 3QXTA 4A2LA 1U8PA 3DHPA 3T71A 2I32A 2VDMH 2V0AA 1KJVB 3HS0C 4LOFA 1S7VB 4ODTH 5DEGB 3TF4A 4QOKA 1LVEA 3L4CA 1O6TA 4X42A 3RVTD 3TBCA 2LV4A 4NP4H 4NRZA 4Q0XH 5ABZA 1M1SA 3DXAB 3QWNA 4JFEA 2MQGA 4I88A 5EEVA 1Z32X 4F9PC 4KV5E 1C7SA 5HYJA 2C9VA 1EHLH 5E8EB 2W07A 1NICA 3JWDH 2DMCA 3BAWA 3QDHA 1NJ9B 1WEJL 1U8MA 1D5XA 1XH3B 2H6OA 3HHSA 3LKRA 4JM2B 4J3OF 3MNMA 1OPOA 1R3LA 4N0RA 1OK8A 3QDJD 4MB3A 3U2IA 3NJXA 5AG8A 3QS3A 3FB5B 3FT0A 3SDAD 1HHHA 3V4VH 1ASOA 1UM4L 1JGVL 4G8IA 1QLRA 2CPUA 2E27L 5HVGB 1RV6X 5C6PB 1T1YA 3H53A 5B22A 3ECUA 5FO8B 3EXLA 5C0CE 1WBXA 3BVDB 2ADFL 1MOEA 1AZZC 4HJGA 3TBVA 3L13A 1MCPH 2NX5D 4XP5L 1JRHH 3MMEB 4M6OH 5C0RL 2QKIB 3B7UX 3F65A 4U3XA 1JZ8A 3MUUA 4UI2A 1NEZG 3E6HA 1XQ4A 5B39G 4JY5L 4J28A 3EUDA 2WNWA 4N87A 2XX0A 3QYCA 4PJBA 5DWUH 3T0EB 2W81C 4P9HC 2C4XA 1XBDA 4HXBH 2N3JA 4F37F 1A4BA 5IW6B 1F4XL 4FQXD 1O9VA 1UD6A 3KGSA 5ALBL 4IRSD 3LVEA 5MI0C 4WI9A 5D1ZB 2VAAB 2I25N 3MBEC 1WIOA 1PMYA 1U8PB 5KW9H 4YBLB 3FL7A 3Q3GA 2ZJSH 1F2QA 2B3IA 3QNZA 3LV3A 2HMIC 5IT2L 2MQ0A 5F7EH 1BD2B 1SHSA 2D7QA 4PJDF 5IBLC 5JPMB 2YMXH 4BE5A 4JAMB 3SY0A 4F7MA 4F92B 2ZX6A 3DMMA 1MJ8L 4O4YH 4OZGE 2O6EA 1TF4A 1QPKA 4UMGA 5IIEA 1YEJL 5JHLH 1KEMH 1WWCA 1U3NA 4UQDA 3V6ZA 3RIFF 1R5VA 4HGMA 3DIDA 4YC2C 1C12B 3CFIC 1NBCA 1XR8A 4MD5A 3LKRB 5I8KH 4S0HA 4AV0A 3GIZH 3S4SB 1R3LB 3BPOB 3HRZB 4UOW1 4M8QA 3MUJA 2LHAA 4NN5C 3WKPA 5GS0C 1U8NA 2FGWL 3L5IA 4Y16B 4G8IB 4C83A 2DY2A 3NFPB 5DVLA 1VJSA 3DX9B 2E0PA 3VD4A 3WFZA 5SX5K 1S9VA 1N67A 1R19A 3KBHE 3H9YA 1XL4A 4EUPB 2QGDA 2KH2B 1XD0A 2QVFB 4QRAA 4GKZA 4P3CL 4RSVA 3S3PA 4CGTA 1TFPA 5CLZA 1PNCA 4OFQA 4XBGA 3E6HB 3AU0A 3GDCA 5B3SB 2QVMA 3U4EB 1E9OA 5FB8A 2BNUB 2JKNA 3KLDA 1ASPA 1JMXA 2PYEE 4KOCA 1SYVB 2LU3A 2O5YH 3SKMA 3CDZA 1QFWL 4ZO6A 4Y5XC 1KBGL 2NY4B 4HIEB 3GM8A 3NEEA 2PABA 4A67A 1DBBL 1GHFL 3MOAL 4JANA 1FVEA 1TLMA 3MRJA 2BIPA 2R0WH 4KTDL 3RPKA 4APXA 4YDJA 4PJGF 1XF3A 2G2NA 1PX4A 4Q6IC 3L5XH 5B1BB 2W0LA 1FHGA 4NZUH 4F7MB 1CE1H 1NCBL 3KPMA 4A7GF 3UAFA 4PP1C 4K71C 5IIEB 1AGCA 1IGYA 4ODSL 4Z7WB 4WEMB 1H6FA 1HJBC 5L0QB 2FQDA 3FKUS 4OV6F 1ZHBB 2DM3A 1B0GA 3NCXA 4F5CA 1SQMA 1WSST 3MCG1 4OBRA 1MHEB 5EA0L 5C3IA 4FHKA 4NKQB 2O72A 2UZXB 4MD5B 4HU8A 1KLFB 1JGUH 2WVSA 4NKDA 4BDVA 1YYMH 4PCYA 2B4CH 4XWGH 1RURL 3P9LA 4J6RH 4ZXBC 4AEHH 2EXWD 5EOQL 4JJHA 2OKMA 4QHNB 5KSAD 3ZTJH 3OG4B 2Q7YA 1BZ9A 3K4ZA 4Z23A 3VXRA 2Y06L 3CFDA 2XNAA 3NPZB 5BJTA 1RMFL 3N0PB 1A6AB 1FFNA 2HT3C 1FVDA 3HE6D 3RGVC 4OUOA 4GKZB 3ABZA 3RPIB 1KT2A 3CQFA 4XTRC 3DI2B 4NOFA 5KVEH 3GJFH 3HNTL 2PXYC 3QIUA 3QUXA 4OD2B 3DYPA 4XBGB 3I02B 3V5HB 1RZJC 1FZKA 3QJRB 1GTNA 1CS6A 2VM9A 5LHDA 2C9RA 1ZA3B 4L48A 1E9OB 1IGTA 2JKLA 4OFYD 5FB8B 1AO7B 2GG1A 5JR1H 4K2UH 4HFWA 3BWUF 1AAJA 3SKMB 3D52A 5D2LA 3CDZB 4JRWA 1B9ZA 1TZ8A 3APFA 3PJSA 2X4QB 1RUAL 4Z6AT 1D5ZA 3U2SB 2CJSA 3MUZ1 3CBRA 4G6KL 4G5ZL 2P8MB 3KWVA 2DQMA 5FUOH 4CN6A 1R4XA 1YQ2A 5AZEH 1BGXL 2B2XL 4APXB 4UZSA 4O2EB 4UU9B 4P06A 4B9IA 1BAFL 1NSNH 3RP1A 1JCKA 5IB1B 1F5WA 3BEWB 4AQEA 4LMQE 4WWOA 1KTLA 5DQDH 1IGYB 3UDWC 1WISA 3WTTA 3G5ZA 4BFRA 4K94C 1B0GB 43CAA 4CAGA 4YLCA 1F4HA 3FO1B 3KW7A 1SVZA 2DL9A 2GSGA 4LCIH 2GJRA 3CBJB 4HS8L 2VXTH 5AYUH 4JK0D 2XKNA 4M1GL 4OD1H 1KFAH 2ZKYA 3UGUA 2JJWA 2NDFA 4ZNCD 4J3OG 3P9LB 1QBLL 2D31B 4AZ8A 2V5MA 2FH8A 5D5ME 5GIRA 3MDJA 1I75A 5ENWA 3R06B 1ZPUA 2BK8A 2QDWA 4HGKC 1BZ9B 1FJ1B 1KGWA 4OLXL 3JWDL 2Q7YB 1NGXB 3VXRB 1CPUA 3CZGA 2XNAB 4M8VA 5DURD 1XGQA 3F7RA 5BJTB 2WWKO 5EZIH 3A6BL 2L8AA 4KK6D 2EE3A 4NAMA 2CKBA 4U1GC 1KT2B 4TS6A 3ABGA 4IRJB 3QUXB 4ZMOA 5IB4B 1HZKA 2CCVA 4JO1H 1AQDA 5L8KB 3LNDA 2PPAA 4PW9A 3G6JF 3PJNA 4XMLH 4BCXA 5CJOL 4HFWB 5E2WH 4PJFE 5I1JH 1WIPA 4M6OL 1KBWA 3NA9H 3PUCA 2G2RB 2ICEC 1D5ZB 4LEOA 2UWEB 3P3UA 2CRIA 2F8IA 4UIKL 1T5XA 3EDFA 3ILEA 3K80A 2R0LH 5DWUL 1CIUA 1QSFB 3CFEA 4V1DD 1JYWA 2NYYD 3IDYC 3FULA 5FGRA 4UILL 3TTYA 4E9TA 2YWYA 4F15C 2VR3A 1S7TB 5M7QA 3FTZA 4YSDA 3ZDXE 3NQIA 3PRZA 5F89B 4LLVA 3A4EA 5F7EL 2NXZC 43CAB 3E80A 3KPTA 4LKXB 1XD1A 4MVBC 1IFGA 1U2YA 1TDQA 1TJXA 4U1MA 7FABH 4MJ5A 2YA0A 5CEYB 3ZIMA 4PR5A 2EVHA 2AZAA 1VPOH 4EI5B 5D7HA 5GIRB 5GS2D 1EIBA 4N5ED 2GYSA 2BY3A 2IAMA 2OA9A 2WBJB 5JOFA 3NQKA 1Q9WA 3O6LH 1NBVH 1RY7B 3D25A 3ZR6A 4RGNC 2WSDA 2YKLH 3V10A 1JE6A 1XMWA 5L7XH 4B9PA 1UB5A 3SDXA 4HPOL 5CBAB 1YPZE 3ULUH 3VTTA 4EF3A 4U0RB 4WUUD 2BHZA 1UT2A 4OD3L 5TF1L 1GS7A 1YMMD 2YOCA 1WA1X 4HLEA 2BVEA 3QNXB 2J1YA 2K7QA 4YEFA 5SWSB 1ORQA 4QHLA 3TP4A 3ZY7A 3P40A 3MLWH 3QO0A 1HSBA 4OSUH 4B9YA 5IREA 5HVWA 4K8RC 3SKJL 2X0UA 1YNLH 3H54A 4LEOB 4M5YH 4YBHA 5BUPA 1QFHA 1KJ2B 1RP9A 2WXLA 3FFCD 4KROC 5FF6B 2BRRL 4I0KA 4LQFL 1IILE 2VMFA 3CFEB 3NFSL 1TQWA 3KBPA 3Q06A 4TUOB 3MLUH 3DUUA 1GR7A 2V5SA 5DJDA 4PVLA 4HMCA 2O5YL 1QUPA 4XNYH 2Z7ZA 2Q5BA 2FVNA 2XYCA 2X2UA 3TYGL 4YJZL 4PGEB 4NGHH 1CDCA 3CZEA 3FN0L 4R7NB 2LLNA 4LLVB 4GSRA 1RD6A 1O9ZA 2XZAH 4IK7A 2N7BA 4NJ9H 4FYQA 3DX8B 4JREB 4MJ5B 1VEOA 2AEOA 3KWTA 2UY7B 3MRGB 4PR5B 5CS7A 2OJEA 3WV0A 4L0ZA 4E41E 3UTZA 3QDME 3R18A 5BCAA 4MS8C 4M6NL 3H0TB 3VFNA 4HK3J 4NQEA 3JTSA 3MKKA 2G75B 1OTTD 3AS1A 3V9FA 2RH0A 4UV7L 1YYML 1CGSL 1E6JH 1UH4A 4JFWA 1UB5B 4YHKL 3X12B 4AEHL 4J6RL 4LSRH 3R4RA 1CI3M 4DT2A 1PZCA 5CCKL 5IFAH 2WGXA 3ARTA 4JPKH 4CGUB 1KCSH 2W91A 2Z7YA 1IBZA 2W65B 1XTMA 3VRLF 3FT4A 3KM2A 1IJ9A 1INEH 1Z9LA 1ORQB 1SXBA 3T0XA 3QO0B 1BLNA 4EQ3A 3K6IA 3WNLA 1E7VA 1SFDA 2B0SL 3B9EA 3AUWB 2Q8AL 3ZRSA 4J3SA 5I74C 2DLGA 1CDHA 3VE0A 3BKML 4NDMB 3V5KB 1D7CA 4UT7H 1MCCA 4XCFH 2RR3A 3V9CA 5F1NB 4ZOEA 4JGMA 1NANI 2OK0L 3W0WE 4GXVL 3MJ8B 1EO8H 3S5ZA 2DQGH 3DUUB 4BH7A 2VWEC 3RAJL 9CGTA 1W91A 2VLRE 3D12B 4HPHA 2XWBA 1VADB 2Q2LA 3OXSA 3HUJB 2C7FA 2GVYA 5FUOL 5FS5A 5D93C 3WJJA 5AZEL 3RY5A 2AJVH 3QEQE 4KVPA 4WJG3 2DIJA 3MJ9L 5D9SA 1J7VR 2Y36L 2HT4D 3MYZA 1QLEH 5E08H 4RGOH 5DQDL 4XXWC 4X5LA 3CN2A 4QTIH 3FT3A 5BZXA 2WQWA 4X8CA 1I8KA 1SUHA 3B2UC 5J6HB 1BWMA 4D9LL 3ULUD 4NUJA 2MNUA 1F8TL 3VFNB 1TU2A 2GUOA 3JTSB 4F7EA 3TH3T 4MA7H 3NBNA 3E38A 1KFAL 2ADIB 3DTDA 3DX4A 4KDTA 3IDJB 4O51B 4U1NB 2ARJQ 1WDAA 4I13B 4PSPA 3WMPA 2DEYX 4YSUA 1I4FB 5DHYA 3W11D 1BVLB 1XAKA 1JGIA 3U83A 3M45A 4JS7A 4HCGA 4UNTA 5E51A 3TCXA 2JKSA 2VDRB 3RDTA 5C0AB 1BREA 4WW2C 5IVOA 3S3DB 5I1DA 5TJWK 1YECH 1GTFA 1Q1PA 3NK4A 1VLXA 5IBUG 1AGFB 1TCMA 1CK0H 2B8OT 2IDUA 2G0LA 4I2XA 2VDPB 4XMLL 5JIMA 5BVJA 4A6YL 4KVCL 2OSXA 3S0PA 1Z9MA 2NYZA 5FFOA 4GUPB 2AMGA 2OSLA 2UY6B 4DKEL 5BS0D 4PRHE 1EH9A 1I7RA 1FZJA 2NR6D 2XIBA 3ZYJA 1TEFA 2IPUK 3SJVA 4FFZA 4GRLA 5GZNC 3RIKA 1LNUA 1JPEA 3JWOC 3V0WH 3VGBA 4MA3A 3TT1L 1UXMA 2Q86A 1SDDB 2O6CA 3FPYA 2ITDB 3NACH 5E4EB 4Z9KB 1NUGA 2AJZB 4J4PD 4BZ2A 3LH2L 5EZJA 5HGAA 4AYDC 4JVWA 3O8XC 4YFDB 1JPGA 1JHKL 3FT3B 2YJLA 4MHHG 1NLBL 4YDLC 3QUZD 4M7LL 1MHHA 4ZBJA 1GIGH 2GHWB 5I1LA 1ZE3C 3UIZA 3ME0A 1HH9A 4BKSC 1K5NA 4BFOA 3EOBA 4BGLA 1A7BA 2Q3XA 1U8HA 3HG1E 3QUHA 3ZKNC 1AR1B 1VPOL 5EN3A 5FYJL 4D9QD 3AXHA 2D3VA 4JJ5A 3WJLC 2F53E 3O6LL 3JV0A 3GINA 5BVPH 1SN2A 1KXTB 4OCWH 2X6CA 4HJEA 1LM8V 3UH8A 2WLLA 3ZDZF 1MDAA 4UNIA 4LNVA 3RDTB 1Z9SB 4K7PH 4P2RD 3ARFB 2AQPA 1P1VA 2EDNA 4G7YL 2JKXA 5I1DB 2EE6A 5C09E 4A04A 1C5BH 4Z7UE 1JVLA 4B0MM 4WV1C 3GB7A 1H3PL 1ZK9A 4GKSA 3SBQA 4I3GA 4GW4A 1EXUA 2XVGA 5ID1B 3T3PE 5D5MB 4TQ8A 1AS7A 3TBTA 5E8OA 5F9OH 2D0FA 2DAVA 4D0DB 1DANT 2C3WA 2YD9A 3EH2A 3WGVB 3CFBA 3DURA 1JWUA 1YNTA 1SXAA 4GRLB 5CLYA 5IV2A 1IGIL 1DFXA 3W2DL 3ASWA 4MA3B 4BK8A 4LCWB 1CQKA 3U1SL 3EYUH 4NIYE 1AZNA 1NCHA 1TCRB 4LK4A 1TMCB 4HK0A 4IBVA 5F7KC 2Y6SC 1JI2A 5DFVD 5FUZH 5HDBF 35C8H 4U7MA 4YNYB 4ZT1A 1YAIA 2X4RB 4NGHL 4ANWA 3PV6A 4QLWA 4HIIA 1M7UA 1R3KA 4H1LA 4Y1AE 3ZKXB 2ZUTA 3CXDH 1S7RB 1UHVA 5K9OB 3GSQB 3VRJA 4P5MA 1ZKAA 5I1LB 3O0LA 4QRPD 3KR3H 3BIBX 4YFLF 1QVOA 2V7NA 3ME0B 1ZRUA 1K5NB 1NCAL 1J5DA 4AEEA 1IM9B 3GLDA 4PRIE 3C87A 3QXDB 3RPBA 3NSYA 4LGSB 4H26A 1J9CT 2JJTA 3CJJA 5FWQA 3CZJA 4ANXA 2DLIA 3E6FB 2X0WA 3G5YA 1HIML 3P9MB 1N8ZA 5LCVL 5C0IA 2B9BA 3HFMH 3VWKD 3D39A 1EV2E 3QORD 4XH2A 1E30A 1HINL 3THML 1JMZA 3KG5A 3KPLB 3DSFH 4K3EH 4KUCF 2ATKB 3DDGA 3GB7B 3RURA 4G5AA 2VLKB 4PJ5A 4ZSOE 3N1QC 2Z93B 4X7DC 1EXUB 1UURA 5ESVB 3KS0H 3P4MB 1KXVA 2X09A 3E9TA 5DMGD 3BZFA 2K1MA 1KXHA 2V5RA 4PRPD 1KB5B 3ZR5A 1TZHB 4NWTL 1T5WB 5A2AA 1UZGA 2Y07L 4HIPA 1FZMA 1G7LA 3DURB 3FTUA 2ZXQA 4UT7L 4XCFL 3WIAA 1J86A 3PGFL 4X7TB 1IKFH 2B1HL 4FJ6A 4P3DB 4DFIA 4PLKC 2DN7A 2YEZB 3II1A 4GP4B 1JNHA 4OB5H 1NCCL 1E4JA 1OCOB 1VENA 1KCBA 1RUPL 4HKJB 1LL1A 1GSMA 2Y25A 3O3EA 1YMHA 4XVJH 1A6ZA 4ATWA 2Y1AA 4N2BA 3V4UH 4HIIB 2XVKA 1KGCD 1NM4A 3NJGA 5DGRA 3CLWA 2NY5H 2OZNA 3GSNH 3DBSA 4P5MB 2QSQA 4HBCL 3S8FB 3OR6B 2VO5A 4XB3A 5AOZA 2O5XL 4KMTL 3CMOH 4WFED 3NIGF 5E08L 2IH1B 4LCCA 4RGOL 2VR7A 3ZYIA 1QMUA 4XP9L 4H26B 1WS7A