2AFNA

Structure of alcaligenes faecalis nitrite reductase and a copper site mutant, m150e, that contains zinc
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
331
structure length
331
Chain Sequence
IAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 88
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2afnA02
1FA4A 4KO6A 1WS8A 2W88A 1AIZA 2QDVA 4HIPA 1J5DA 1PZCA 1JZFA 4A66A 1A8ZA 1BEXA 4HAKA 3ZDWA 4BXVA 6PCYA 2I7SA 4L0PB 3GXUB 3T71A 2WSDA 1XMEB 3S3CB 3NP3A 3TASA 1GY2A 1NPNA 2BHFA 2YAQA 4HCGA 2J5WA 4N8UA 3AY2A 3DKHA 5D4IA 4AKOA 4E9TA 3WIAA 3AG2B 3QPKA 2JXMA 3SBQA 5I26A 2HXAA 4GP8B 1WAEA 1BYOA 1V55B 4DPAX 4YSDA 4DP8X 4YSAA 3UACA 4DP1X 2N0MA 3T6WA 1J5CA 5B1AB 4W1TA 4E9RA 4DPBX 1PNDA 2XLLA 5I28A 3S8GB 4G7RB 4EF3A 2R7EA 3ASNB 4HHGA 3ZBMA 3OD3A 4DP0X 4FAAB 1RCYA 4YSRA 5B1JC 2FT7A 2JKWA 1J9SA 1L9PA 3FQYA 2ZXWB 3RYMA 2IH8A 3H4HA 1ASQA 1BQ5A 3X1NA 3T6XA 2WO2B 4BK5C 3WNIA 4DP9X 3FYEB 4A68A 2CBPA 1JVLA 2BP8B 1V54B 1WS7A 1OV8A 1DYZA 1QNIA 2XV3A 3FU9A 2Y69B 1V10A 2EIMB 3V9EA 3FU8A 3GDCA 3QQXA 2PLTA 3G5WA 1AS8A 3TBCA 3UAAA 4KOCA 3CDZA 1SHXA 1FWXA 1JERA 3NJFA 2GIMA 1OF0A 4UF7C 2XX0A 3S3BB 2YARA 5I6NA 4KO7A 2YAMA 5B7EA 1AZUA 2FQDA 1CURA 1KV7A 3X1EA 3N2JA 3PXLA 4JHUA 1ASPA 1ET8A 3AW5A 1AZCA 4K9JA 4E9SA 2BWIA 4G7SB 1ILUA 1ZDSA 3NJMA 2CALA 1MDAA 1MZZA 1OOWA 2ZONA 1PLCA 3NJJA 1ADWA 2DYSB 1L9QA 2UXVA 2YAFA 3TA4D 3FQ2A 1SFDA 1PLBA 3FQ1A 2OV0A 1QLEB 4KNTA 2X87A 1JXFA 2GC4C 2YAPA 3AG3B 7PCYA 1JZHA 1IKOP 3FSAA 1A4AA 2Y1AA 2DV6A 3FT0A 1WA2X 4KO5A 3T6ZA 4HALA 2HLEB 3S3DB 2MRYA 4CSZA 1PZAA 3UGEA 3FS9A 4RH4A 1KBVA 1PCSA 2VMJA 1AAJA 4HHWA 1X9RA 2H47C 3FSWA 3NJGA 1IC0A 2OJ1A 2UX6A 3ASOB 3SQRA 4YSOA 1BAWA 4UAHA 2VSMB 1SHWA 2FJSA 2ZOOA 3EH3B 3WI9A 1ZV2A 2FTAA 8PAZA 1IUZA 4BDVA 3X2QB 4UANA 1B3IA 2XWZA 4YSQA 1NINA 1SFHA 4CSPA 2IDFA 4YSTA 3KW8A 1AG0A 1CUOA 4YSCA 3DTUB 2QPDB 5FC9A 1MG3C 3AG1B 5E9NA 3WKPA 1PAZA 3PPSA 4AZUA 4E9QA 2QDWA 2UXFA 2FWLB 2CAKA 2GB2A 4MFHA 1NDTA 3NJHA 1AZNA 2XV0A 5EHFA 1WA0X 4YSPA 1OE2A 1SF3A 2XXGA 2GI0A 3BQVA 1XB6A 4YL4A 1A3ZA 1GS7A 2DWTA 3DIVA 5I6KA 2IWEA 4FA7B 1NPJA 3EF4A 1URIA 4WKXA 4JKNA 2YXWA 2IWKA 4F2FA 5IY5B 1JXGA 1L9OA 1N68A 1MZYA 5B1BB 5B1JA 1CYXA 1KCBA 1E65A 1NIAA 5D4JA 1ILSA 2NRDA 2EINB 2FNWA 5F7BA 3NYKA 5I6PA 4DP2X 4P5RA 1JZJA 2VW6A 4A2DA 5I6OA 2BP0B 4AI7A 1ZIBA 1GR7A 4BWTA 1SNRA 3MBWB 4KNSA 1ASOA 3CVCA 1XB8A 3UADA 2A3TA 2FQEA 1SF5A 2HX9A 9PCYA 3KW7A 3IE9A 1GS8A 5B3SB 1AANA 4DP6X 1A4CA 1AZRA 1X9UA 2LLNA 2TSAA 1ETJA 1AACA 1AZBA 1OE3A 2GSMB 2YAHA 3FSVA 1JXDA 4KO9A 1KBWA 4A2GA 2VW7A 1M56B 2EIKB 3WNJA 4G72B 6PAZA 1KDIA 2ZWNA 2VM3A 4NB7A 3HB3B 4TXVB 3ERXA 1AR1B 2BP0A 2P80A 1HFUA 4G71B 4QLWA 2GBAA 1PLAA 3L45A 1NWOA 1MG2C 1DZ0A 2BP8A 4W9ZA 2FQGA 4HZ1A 2X88A 1AOZA 2PPCA 2YXVA 1SDDB 1NICA 1EZLA 2PPDA 1AS7A 5D4HA 1VLXA 2XUWA 3S8FB 2WO3B 3ABGA 4HCFA 3PCYA 1GYCA 1JZIA 4AX3A 4E9YA 3U25A 2GC7C 1GY1A 1QHQA 1PY0A 3SBRA 2PP8A 1BYPA 1KDJA 3HEIB 2UX7A 5TK4A 1M9WA 3SBPA 3ZX1A 1BQRA 1ZDQA 1ET5A 3OQRA 3CVBA 2YAEA 3JT2A 3NSCA 1PNCA 3NJKA 1A65A 2VM4A 3PAUA 2VSKB 5I5JA 2XVBA 2HX8A 1NTDA 3QJTB 4E9WA 3IBOA 4G70B 2DYRB 5I6LA 1ZPUA 1IBZA 2BZ7A 1NIDA 3ABMB 1NIEA 4NERA 2PCYA 2VW4A 3PLYA 3NSYA 1HAWA 1UATA 3CZUB 4GXFA 2DWSA 1AG6A 2UXGA 3NT0A 2XYBA 1E30A 2CCWA 2BWDA 1T5KA 4YSSA 1RKRA 3X1FA 1I53A 2IWFA 3CG8A 1CC3A 1JZEA 2J55A 2IDQA 2PPAA 1W6LA 3CVDA 2E86A 4GY4A 2W8CA 5PAZA 4QKTA 3X1BA 2GHZA 3NJLA 2Q5BA 4GYBA 2AZAA 5LDUA 4Q8BA 4Q89A 2YAOA 2TSBA 2I85A 2IH9A 1NIFA 4AKPA 3X1GA 2IDTA 3QJSB 2JFCA 2FT8A 3QJQB 7PAZA 2XX1A 1BQKA 1NZRA 3FU7B 4G7QB 1XB3A 1FFTB 3H56A 1W6WA 1OCOB 4X4KA 3FYIB 5TK2A 4PAZA 2EIJB 1J9QA 1RZQA 3IN0A 5PCYA 4A67A 3OM3B 1EHKB 1BXVA 2R7EB 4P5SA 5I6MA 1BXAA 3QJUB 4PCYA 2XV2A 3ABLB 1JVOA 1OCCB 1ZIAA 3FU7A 3GYRA 3H4FA 2OCCB 3OMNB 4WTQA 1J9TA 1F56A 1GW0A 1A4BA 3NJIA 4GP4B 3WKQA 4KOBA 1J9RA 2EILB 5B7MA 4M3HA 1TEFA 3NJNA 1L9SA 4YSEA 3NP4A 3PAVA 2UXTA 5I5MA 2HRGA 3OMIB 3CDZB 4F7KA 1TU2A 1KCWA 1NIBA 3QJVB 3AZUA 1GS6X 4HCIA 2PPFA 2AVFA 4KNUA 2H5UA 3V9CA 3T6VA 3TU6A 2CUAA 3EH4B 3N55A 1IBYA 3WG7B 5I5IA 1PMYA 3UAEA 2QT6A 3EHBB 2HX7A 4ENZA 4ZK8A 2BW5A 1E5YA 2J56A 2Q9OA 5ANHA 4GP5B 4YSUA 2VN3A 1TKWA 2FQFA 2MTAA 3AG4B 1OCZB 1E5ZA 2J57A 1HAUA 3ABKB 1CYWA 2PP7A 4BWUA 2PPEA 1AS6A 2B08A 3UABA 1ID2A 2BW4A 2FT6A 1KYAA 2IDSA 3TBBA 2BO0A 1NWPA 5A7EA 2DY2A 3IEAA 1L9TA 2IDUA 3IN2A 4N4YB 5F7AA 1N70A 2HRHA 4A2EA 5B7FA 4A2HA 1R1CA 2P80D 2YQBA 2XU9A 1OE1A 3ZIYA 3C75A 1L9RA 3QJRB 3FSZA 1PF3A 4DP4X 3JTBA 1SDDA 4E9XA 1RZPA 1WA1X 2I7OA 1JZGA 5AKRA 4DP5X 1ET7A 2RACA 3D12B 3FPXA 1PZBA 1YLBB 2AFNA 2XXFA 1TEGA 4M4RB 1KGYE 4BDVB 2AANA 2BZCA 2PCFA 3NSDA 4YVUA 4YVNA 4NAJA 4AKQA 1E67A 2H3XC 5B1KA 1GSKA 4BXSV 5AFAA 1AQ8A 1M57B 5AZUA 3FPYA 1W8EA 1BXUA 1JOIA 3MX0B 3EH5B 3OMAB 1OCRB 4A2FA 3NSFA 4BWWA 2PP9A 4F2EA 3BVDB 4E9VA 3PAZA 4DPCX 2B3IA 2QPEB 3T9WA 1SJMA 2AZUA 4JHVA 2HZHA 2IAAC 4DP7X 2CJ3A
chains in the Genus database with same CATH superfamily
2V7HA 1HE7A 4HIPA 1E4XL 2CCVA 4M5TA 3L95A 3ILQC 3MA7B 3L4WA 3ILPB 4UQCA 4YHNA 1ZA6A 1UACL 1QFOA 2CGYA 4HWEL 2EDTA 1TFHA 4ZS7H 1WWCA 5F21B 3WJMA 1F4YL 4UOW1 2OW7A 1ZTXE 4UT6L 1G9NH 3INUL 1DBKH 4CC0A 3VFMB 1JXJA 3DKHA 3PDDA 4L29A 1A2YB 2YBRB 2J21A 4AV0A 3PJSB 1YUHB 3KPMB 2JXMA 5DC0A 4JO1L 3V0JA 4S0SD 2F5AL 2BMKA 4OM0H 4MNQE 4LHUA 3BWAB 5CO1A 4GAGL 5F93C 4YSAA 2AABH 1P7BA 4TVPL 3MRIB 1J5CA 1LXMA 1FL5A 4IBWA 2EDEA 2IF7A 5GJTL 4JPVL 1UGNA 1NFIB 4M8RA 2X09A 4O51B 1VKXA 3O8XD 3EOTL 3ASNB 4IBZA 3OD3A 4OZHB 3DPBB 4UBDC 1TVDA 2C3WA 3L48A 4FAAB 4X4YA 1BMWA 2WZ6A 2R9HC 1KWGA 2W91A 4EXPX 3IDYB 4PHZA 5AAMC 3U4KA 2ZXWB 4FQQB 2YD7A 4OLVH 4TLTA 1SYVA 4AQOA 3TBSA 1NOAA 4B5ZA 1P5VA 2ZG3A 4PJ8C 3RTQC 1MELA 4DP9X 2PCPA 4PJAF 4YHLH 1C5CH 5HGAB 4XBEL 4P5KB 3LQAH 3QG7H 1TTUA 2CUMA 3N1PC 4AC2A 4KRPC 4R26L 5LGYA 4K3HA 3V6ZB 3GDCA 5JDSA 2PMZA 4W9DC 1FWXA 1OD7A 4RZKA 1NC4A 5I71B 5LVEA 3VM5A 1ZLWH 2GIMA 1ETZA 1CR9H 1OF0A 3C5XA 3VWKB 3OHXB 4KKCD 3WNLA 4ZW8A 4D8PA 4QNPE 1MHHB 3CPLA 5AUMA 3ZO0A 4GI9A 5ESAA 4P2RA 3BAJA 5HHNA 1NGYB 4JQIH 4ZFOB 3QAZC 1L5GB 1MI5E 1O5PA 3LRGA 2CA3A 4P5TC 4TVUA 5H94A 3LYRA 2P5WA 5FYKH 1U8NB 4M7ZB 3PP4L 4N0CD 3U9PH 4GRWE 2WIMA 4F9LC 1WD8A 4MA7L 2YPLB 3ZE0F 5F89B 1TTAA 5I19L 4OCSH 3VM7A 4C56B 5AD0B 2R0ZL 2CR6A 1F4AA 3ETSA 1O0VA 3B9KC 4FI8A 4N20A 2BY3A 3BKJH 1A6WH 1EJOL 2P46B 3IFPB 3IJHA 1SEQL 4M6ML 4NYLB 3FT0A 1A4AA 4F91B 4R7NB 3KPTA 3I9AA 4LEOB 5I9QB 3VDAA 1CTMA 4QRBA 2J1ZA 3MOBH 5GRYA 1P4BL 3BLKA 3UBGA 4HK0B 2DQTH 1PZAA 2N0KA 2ICEB 4HPYH 3GKZA 4W4NA 1KBVA 1PD0A 3ZDYF 3KWXA 3WU1A 2EDQA 2WXMA 2XZQH 4FXKB 2OP4L 3HS0C 5GGSA 4JKWA 2Q6WA 3DJ9A 5J13C 1IC0A 2FBJL 4Q56A 1CICA 4ZSOE 1U91A 2Q20A 4XCCL 3KYOB 4J1UB 5CD5D 1G6RH 3MLWL 5MEQB 4G9DB 3DSFH 1A64A 4PIRF 1QW8A 4X6CE 4Y9GA 4X6FA 4UIKH 2VR5A 2XWZA 5I73C 3CX5J 3WIHL 3RA7L 4CSPA 4CAGA 2CJSA 3J2PA 2EDFA 5FOBB 3O8XB 2HG5A 3FQNA 3DV6B 1TJGH 2AJZA 2FH6A 3N43F 2LTQC 1WITA 2OXHB 3LKSA 3PPSA 4NN5B 1RPKA 3BIBX 1SDYA 2WAHA 35C8L 3ASWA 1GCYA 2QDWA 5DA0B 3SOBH 1DQDH 1NCOA 1FN4B 1U3HA 5LN8A 3TF7C 2IOIA 4U3CA 3AQYA 2JCCE 4OKVA 1HYSC 1EO5A 1MQKL 3DA0A 3MRFA 1H0DB 3RFZB 2CO3A 4XX5A 1DJXA 4WFFE 5F7NC 2AEPH 2VDLH 2ZUXA 3BQVA 1SGKA 3PDOB 4N0UB 1TYEB 3ECWA 5E94A 4HWZA 2D0HA 3O4OC 4U0QB 5JHDE 2ADIA 3KS0J 5B1JA 1PY9A 3VG0H 1F41A 3BGMA 1UA7A 3S3JA 2O5NA 4KH2A 3FHQA 4ALAL 2BNQB 3MV7A 5D8JL 3LZNA 1UCTA 4FQ2H 4GRLD 4S1QL 1TQUA 5T3ZL 2BP0B 3VWJA 3MODL 4AI7A 3ARGC 4PLOB 1NGXA 2M26A 4H13C 1VACA 3MYJB 2MFNA 1TITA 4MVBD 1SNRA 2HN7B 3LHPL 4MA1C 5BO0D 2J4WH 3GMRA 4WEBH 4Y7OC 2X28A 1GZHA 3H42L 1H19A 2Y5QA 2ATKB 2VDKL 1U2CA 1YECL 3GO1L 4JAMB 2PETA 4QRAA 3VI3A 4P46C 2JLPA 3A6BH 2L0DA 3DO4A 4HFUH 3PQYE 1NM9A 2IPKA 5ENWB 2VL5B 3SE9L 4GEIA 4N2OA 3HI1B 4LL4A 1OTSD 4PBVC 3LRLA 4OBSA 3LS5H 2P80A 1YEKH 1KEGH 2VR6A 5DJDA 4L8BA 5ICXB 1IQWH 5TFSH 4QRSA 1A1MA 4UQ3A 1HHGB 4FQXA 1JXKA 1R5IB 2OR9L 2V3EA 1Q9WB 1IM9D 3BPNB 5LGHH 2XUWA 1UEMA 5EBWA 1HHIA 4HCRA 3VSUA 4MJ6B 3NFSL 5JOPE 1ETA1 3BWUF 1J9CT 4IEFA 2H7WA 3B7YA 2LW3A 2Z0BA 4AWJC 1N18A 5T5FH 5J6HB 2CK0L 3O6LH 5JQHC 3K72A 4MBRA 1LDPH 3KWTA 3RJDA 2ZPKH 3UCQA 3QS3A 4X4MA 3QNYA 2BOCB 2VDMH 3WS6C 1A65A 1TF4A 3SDXE 5AW1B 4LOVA 5A3IC 3ZPDA 4JNXA 1X7SA 2XVBA 3NZ8A 1U8HB 4HH9B 1XD1A 1IZKA 4Q0XH 3TN0A 1TZHA 1UVQA 3NABH 5MHSD 4LVNB 5CIPA 3O6ML 1EHAA 2YO3A 4F2ME 1IV8A 1NEZB 5C6TL 4X5PA 1JPFA 2NY7L 4AJYV 3KWWB 4ZZFA 3ARFB 1DANT 1UZ6E 4PJAB 2B1HL 3ROOA 2IWFA 4OFYD 2F8OA 4I48B 2JQZA 3FT1A 2XPGB 3B3IA 1A1NB 4HFWB 4QKTA 5CILL 4K7PL 1SQ2N 2BSTA 5T1KA 2ZP9A 1JUFA 3IGUA 2OMXA 4KDTA 4F7TA 4QWWC 4LVOB 3L9EA 2FYYA 4K8RL 2P1YA 4ORZC 2FT8A 3EXLA 1OT2A 2XX1A 4N2BA 5A40E 4GRLB 4IHOB 1EVUA 1KBKA 4J3OF 1RY7B 2XWCA 3C9NA 2H0JA 4GAAA 4BRVA 1W6WA 2YPKB 4DUXA 5CEXB 4AENA 5E2TH 4GG6E 1YSOA 4PAZA 1AQDB 2NYZA 4K2UL 2FIKA 5H37H 2XQ0A 3O3DA 4MB5A 4WU7B 3WEAA 4CVXB 1T0OA 5FECB 2JELH 4YBQC 3QEQA 3O2DA 1ZV5A 4G1EA 3V4VA 1I3RA 2X10A 5GQBA 1IBGL 5SWQB 3MXVL 3C09B 1P69B 1Y6KR 3NZHH 4LIQE 5IQMA 3BLBA 5B3JE 4MZIA 2W07B 4NAQA 2F0CA 3G04B 4JO2L 1R0AH 1IAOA 4I1NB 4FQCL 5DEGA 4JK0D 43CAB 4OZGF 1ZVYA 3GSWB 4J3BA 5GZND 1OALA 3EBAA 4XOEA 3QZWA 5DCCA 5LCVL 4F24A 1JIBA 2G5RA 3K81A 3LNDA 5MEND 3JV6A 3QCVH 5IVZB 4OT1H 4Y1TA 1BZ8A 3NP4A 1I1AA 1UC6A 2X4TB 3FOLB 4XPAL 1FAKT 4EUPG 1TU2A 3GRWH 3QIWD 5C0FA 2ALAA 3AM8A 5MI0C 1YA5A 5IEHA 2PPFA 4F8QA 4XCNA 4JRYE 5F96L 3DJTA 4X6BB 1DQMH 1WG3A 3JV4A 2FSEA 2G5BA 2HX7A 4KKBD 3UERA 4UTAH 2NW2A 1R9FA 4G8GE 2V5TA 4ZNEE 1IGYB 4JZJA 1ZE3C 1S7UA 2ZJSL 1XCTB 4OD1H 3IJYA 4J8QA 1YYLL 4OVUA 2ITDB 4EDXA 4GO9A 3IJ8A 2JKLA 3FCGA 4G42B 4DZBA 3CIQA 3BQUC 1AYRA 2X53A 1OAJA 3N43B 5AVYB 3RGVA 5ICZB 4IDJH 1PKQB 2DEXX 3ABKB 1BBDH 4AIZA 5IMOA 3TV3H 2CPCA 2J1YA 4U3SA 2OL3H 3HC3L 1OAZL 1U95B 1I1YB 5BJTA 4FA6A 3QUKB 5DHVH 1QEXA 4H88H 2R0LL 4DF9A 4GNKB 3SQOH 5E7BA 3EHBC 2W92A 3K5RA 4XBMA 2CO1A 5IB3A 4WI0B 5CP3A 5EOQL 3QYNA 4YE4L 2H0PA 2A1WH 5F1OB 4PV8B 4HS8H 1B6UA 4XI5D 1CTOA 2NY3D 1CLZH 3QUGA 3H9SE 2AK1L 2DYPB 4ICWA 5G5DA 5KVDE 3MAWA 5E8PA 3ZL4H 4YC2B 1AFVH 1F1GA 1N4XL 2EO7A 5KVMC 1U8JA 5T1MB 4MAYA 3V0DA 1RD6A 1Q94B 2F74B 2M8XA 4KI5C 4R0LA 5HHMB 5EU5B 1ET7A 4F8NA 2BP3A 2IXQA 4WI9A 4LPTA 5MEPA 5D5MB 4FXGC 3M88A 3MO1A 4PYHA 1RZJH 1PG7L 4CMHC 4J3OD 5GS0D 3G08B 3W82A 1LWJA 2VB5A 1MFBL 4OJYA 4ETQA 1IGJA 3BVWA 2NZ1A 1TPXB 2EDNA 4NAJA 2WB7A 4ANVA 1FZMA 4AJVA 2X4UA 4IK7A 1SM3H 2AITA 2WP3O 4DO4A 3HS9A 4LLDB 1IFHH 4JFQB 3TEYA 2JKSA 5DJCA 5JA9A 4KAQL 4N2DA 2Q8AL 5CZXD 2A0LC 2J43A 4WUUE 2VMCA 4WTZA 5FEBA 3K2MC 3ARED 3PABA 3W9EB 5T5NG 1CICC 1BREA 3BKML 5C0GA 4A2FA 1A6UL 5E4IA 1OSZB 4DAGH 1AD9A 3FFCE 2FR4A 5MENB 3KYNB 3VMOA 4L4TA 1TSRA 3SKMA 1YEDA 1CDJA 2VDQB 4H40A 4U1SB 3A6OA 1UUSA 3H0TA 3NUKA 4CC1A 4NSKA 3AITA 1JZFA 4G1MB 1I75A 3F04A 5I76B 1QLRA 4L0PB 3BMVA 1IT9H 1MFDL 1MCQA 3I75A 3O2VH 1P9MA 4EOWH 4HCGA 1Y6NR 4NPJA 1F90L 5IB2A 3QUMH 4GKSA 2R2BA 1U3HC 2VLJA 2AGJL 4GBXB 4KJWC 4DOHB 2NR6A 5CCGE 5HYJD 4O5LH 1ZTXH 1MCPH 3EW3B 2I9TB 1SZNA 1RURH 3DHPA 1OB0A 3S9DB 3DLQR 4RRPA 1OT1A 1FZJA 2C4FU 5FYJD 5IW3A 1GYVA 3CX5K 5B8CB 1O7VA 4DPBX 4N2LA 2DQFB 4NQDB 4RAUB 5DD6A 5DHXB 5IMKA 4YHML 3QDHA 4OFKA 1IEHA 4HHGA 4A1RA 1CFNB 3T4YB 2NDFA 5ALBH 4GQPH 5C0EA 2WXLA 2EXTA 4G5ZH 5B1JC 1GJWA 2FT7A 5JW4M 5CJOH 3S5LG 4QRPB 2GUOA 2GJPA 2WNXA 3RYMA 4IKIA 3SBWA 1W91A 2H0FA 1D7BA 3A22A 2NY3B 3HNTH 4Y8AA 3FYEB 3VWJC 3MLVL 3UC0H 2Z4QB 4KVPA 1TNNA 4OCRH 3OLDA 2Q1EA 5D7IF 5ANMA 2J8UA 2Y69B 3MRBB 5BS0E 1W72L 2VZTA 2WXGA 5DGQA 1AS8A 1XF5A 3KWUA 1T1WA 2OR8A 3AWGA 4L8DA 3SPVB 3E1ZA 5FYJU 4TL4A 3W0WE 4KVCH 1EAPB 3MV9D 1XGUB 1EK3A 2AEWA 2IALA 2R56L 3QH3A 2YARA 4LVEA 4AXWA 2FEDC 4IIQB 1SEBB 1EJ6A 4HC1A 4OJEH 3RL2B 2JKRM 5KVGL 1XH1A 4Q6YA 2IAND 2UYLA 4G6KL 5ITFA 4JCLA 2CXGA 2WINA 2Z8WC 4K9JA 3ATBA 3ALWA 4NUGH 3RX9A 1JK8A 1YNTF 5JXEA 2FLMA 4J3XA 1G7JB 1YEIL 3GB7A 4URKA 1BX2A 3EJCA 3QRBA 1LWHA 4PWJA 3AREB 1A9BA 4UTBA 3NJJA 3UAFA 1KGUA 4C83A 1BW8A 1CPUA 3H9HA 1VPOH 4QJ3B 2Z34A 4ZMVA 1CE6B 3WAKA 5I1DA 2R1XA 4GRWH 3QWRA 4JHAH 2XTJD 1CDHA 1DBJL 1WHPA 3KNBB 4KNTA 1QFWH 1CK0L 4XWGH 1ZGLA 5H35A 1IKOP 4YDJA 3RB7A 4Z3JA 1BYNA 4I4WB 2YD8A 2BRQA 2OSLA 1IC1A 3V5HB 3RWIA 2R51A 2NXYC 5DJXB 4ANWA 4M6NL 3VRIB 4JGNA 1E3XA 4PRHB 4WHDA 3TN0C 4OGZA 4UT7L 2F15A 4PTTA 4BCYA 2YPVL 1TLKA 5ALCH 3FSWA 4DQAA 5HYJB 1ZVNA 3G5YB 3QEUA 3CVHH 3E8UH 2A9NL 3SDYL 1CLYL 5ECJE 1EZVY 2FJSA 1WBYB 1WWWX 3ZXAC 1DQJB 1ZV2A 3UO1L 2ZCHL 1X7TA 5EZOH 3TBWB 4B0MM 4D8OA 4HISA 4XMWA 1NINA 4NLHA 2GJZA 1U30A 2EICA 4JY5H 1W8NA 3S3SA 1R3HA 5F44A 3GXFA 1DZBA 1KBPA 5E56A 1UB6A 1B2YA 2Y2YA 2DWEB 3WE6A 3RUGA 3N85H 4KDTC 4HLEA 5INDB 4XNYH 2DQGH 3GSXB 3L7FA 1NKGA 3BSZH 3HMWH 4E9QA 4HJTA 3WN5B 2UXFA 1LEKB 2W9EH 1RSYA 2H26A 4FQLL 4PJEF 4PR5A 1R24B 4KXZH 4NJAH 1ZJBA 1ORSA 1AZNA 2BXYA 1I8IA 2ZXEB 3CLFH 4XOCA 4YXLL 4P4RB 1ANUA 2AW2A 2VO5A 4A2LA 5AL0A 1HINH 1PYWA 3ZY7A 4DGVL 1JYNA 3TJHC 2A2QT 3O11B 3VGGA 3O3BA 3ILQD 5HI4C 4JCMA 2BY0A 3EF4A 1AXTH 3RU8L 2BSEA 1RI8A 3UMNA 1KJ2L 2ARJA 2OTUA 2BFVH 5C2UB 1KIPB 2X05A 1FGVL 4L0ZA 4Z7NE 3FB6B 4RGNE 2VDRB 1JNLH 3O45A 1QUNA 1V27A 4M1CC 2IANB 4PJGE 4QXGL 4FTDA 3LMJL 2HLFD 1RFDH 4N3UA 4PSPA 5K1VA 3HC4H 3LNEA 3GSOA 3WYRA 3T0EA 1T0MB 5IVXF 4U49A 4NGHH 5GGTH 5D7KE 3E3QE 3P73B 1F4XL 2HJLA 4XVTH 4OSUL 4Z77A 1XB8A 2B4CL 1I1AC 4OD3L 1QPKA 1BOGB 1GS8A 1QI4A 2B3RA 3MRLA 2BC4B 3SKJL 4WEEA 1S7TB 3O2WL 4O4YL 3AM8C 1RZGA 2LE9A 2GSMB 2WXQA 5JIPA 4J6RL 4TSCH 3WNJA 1YMHB 4R4BA 2R9HD 5HVHB 3WIIL 4LPUA 3SDAA 3TYGL 2F53E 1NL0H 2K6ZA 1UD6A 3QIUA 3S35L 4LNRB 5E5RB 5B39B 1FC2D 2P5EA 3MRHB 1NWOA 2F54D 2NQDA 5BNXD 2J72A 2MHAA 4UZSA 5BZXA 2X88A 1AOZA 4BV1A 2AKRB 4DGWC 2A6DA 2YOCA 1JGEA 5JR1L 4D3CH 3ABGA 4WQOA 4C47A 2OJZH 2ZOKA 1IARB 2R2CA 4TUJA 2VLKE 3II1A 4QHKI 2ZTBA 4MNHA 2GK0B 1QZ1A 1HZKA 1R3LA 4ZFZA 1ZVSA 1X6LA 1Z3GH 2FAUA 3OLEA 4DGYL 1FVEB 3L5WA 2YMXL 1N2RA 4NWTH 2FBOJ 3CVBA 4GRMA 3NJKA 1WUNT 3A6CH 3LKOB 4OZFB 1HILB 3T2NL 5F88A 1PKOA 2HX8A 5TD4A 4P5TD 4E9WA 4Z8FL 4N8PA 4G70B 4GKZA 1A3RH 3MRRA 4HS3A 5HHQA 4L1HA 5I17A 3F64A 3OZKA 3QS2A 3ABMB 4MAYC 2ZKHH 3DUUA 3FHAA 4NZJA 1MCLA 4OM1L 4R0LC 2D31B 4NERA 3II2A 4ZBJA 2PCYA 1JV2B 2DLIA 3IJSA 5H8DA 2OQJA 3HHRB 2UVEA 5ID1A 2MQ0A 3VI4F 3B9KD 4WU5A 2CCWA 3VGHA 1NCTA 2VISB 4LASH 4H2CA 4OGQC 3DOIA 5D70L 2FIRT 2XXMB 1FFQA 2K6WA 2UVFA 3T1FB 5IR1B 4JY4A 5D7IB 2Q2EB 3CBJB 5IT2H 5IFJB 4NRZA 4ZW6A 3GBML 5AYTA 4ZS7L 2TSBA 3BSHA 4I18A 4JFEE 4EZKA 3QGVA 2MPVA 2BSRB 4N2GA 3UP6A 1G9NL 2H6UA 4L4JA 1DBKL 5T3XD 2AXWA 3PWUB 1LWRA 3B37A 5FUOH 5J3HD 1FO0A 2QGCA 4D0BA 3RPIA 1A7BA 4CKQA 3SJVA 4IMLB 3DK2A 1LP9E 4X5XA 3CMOH 4WI6A 1EEZB 1YEGL 1RULH 2VC2H 5HGBA 2XI9A 3VCLB 2DKMA 1FHGA 4A67A 4ZMYA 5KSBB 4G6ML 4FXTA 3AWEA 3CZFA 3HHSA 1NCBH 2A73B 4DERA 2R2HB 5DD5H 5DWUH 4AZ8A 1IKFL 3NCJL 3KR3H 2KLRA 2LOEA 2X38A 4Z7WE 5GISH 3C2AH 1ZV9A 3OJDA 5I1KL 1ADQA 3QIBD 4YZFF 1SYSB 4JM4L 5JHMA 1M05A 1OAUH 2NR6C 1O6VA 2D9CA 1RMFH 3DRQB 3ISRA 3OJMB 4OLVL 3RHWF 1F56A 2F54B 4LIQH 1HYSD 4Y4KA 1NC2D 4YHLL 4AQAB 2AK4A 3OKMB 1MHCB 4K3JH 3IFOA 4MCYB 3G6AA 4LSRL 2WYZA 4FFWC 4HKXA 4ZUSA 4JDEA 4YJZL 5E24E 4X80H 3ISWA 1N8ZB 3C60D 4PRID 2Q87A 3T4AB 1E4KA 2YMOA 4BUHA 3RJQB 3F7KA 4ERSH 1RJYB 5C0AD 1LQBC 1UA6H 5L0QC 2Q86A 3M8OH 4LCUB 3IMUA 3X13A 4AYGA 3R8QA 3DTXA 2K0RA 1NAKL 4XCFH 1C1EL 3MLRH 3SBWC 1VEPA 1Z5HA 2F8IA 2HFEA 2VLRD 3PRZA 4JQIL 2R69A 2QADD 5IBLC 4CVZA 2VRAA 2IWGA 4GP5B 4P5TB 2ZWSA 1S9KC 3SPHA 3ARGD 5TDOA 1CQKA 1N8OE 4GQZA 5I1EH 2XWTA 2J88H 1FZOA 1EDQA 2QV4A 1KJMB 2RFXB 1KGWA 5AVRB 4ODHL 2NUTA 1I7RB 1DVQA 2B16A 4WDIA 5TE6H 3U9PL 3MRGB 3OSVA 3VFOA 3L3OA 1T7ZA 2PPEA 4GS7C 3CVIL 1HSAB 3A3YB 4P46D 3V4UL 2IPUG 4OCSL 4Y1AE 3NOIA 3TZVD 5HY9B 2WLNA 4Z3GA 2XZAL 3NGBB 1ZGLM 3EIFA 1A14L 1GHFL 2IDUA 5GIRB 3K4AA 3CHOA 3FT9A 5FX3A 2ZD0A 4GO8A 3PL6B 4WO4A 4W9GC 3M17B 3D39A 2A6JA 2FO4B 5C97A 3QPXL 2ATPA 5KYXB 3MXWL 4BSJA 3KPLA 4HG4J 3BXNB 5KVDH 2XG5A 5J13B 2K7QA 3T8XA 2V5RA 2XZQL 1E8ZA 3FOMA 4L37B 4PG9B 3SEPA 1NLBH 2HFFB 5D7LB 3E6FA 4I88A 3S0PA 1D9KC 1IAMA 3GMNA 2OZ4H 4NC1C 2BNRE 1G6RL 4Y5YB 5BMFH 3QEHA 2AANA 3KPSD 4FMKA 2JJTA 3L4UA 4OCYL 3DV4A 5JHLH 4F33B 4RMBA 3V4PH 4P99A 5BVJA 1G1CA 4R3SB 3F05A 1YO4A 2VERN 1ZRUA 4KV5E 4PGEA 4WFGE 5A3ID 2LTQB 1TJGL 1AQ8A 4NJ9H 3TX4A 5DK0A 3QIBB 1BXUA 1VESA 4J2XA 3DETD 5HDRA 3SOBL 3SQBB 3OPUA 3E9UA 1RQ5A 5KYNA 2KC0A 1CDYA 1RUAL 2PP9A 1IAII 1NC2B 3KBPA 3CZKA 3OL2A 4M61A 3GMMB 1WYJA 1KPUB 4Y5XC 3SBPA 3T0AA 3J8F7 3C60B 2X6MA 1Z9LA 1WS8A 2ZZUT 2IH3B 5F7FA 2YEVB 2FJFA 1BEXA 2DWDA 3OR6A 1XF3A 5C0AB 2J8OA 2Y1YA 2YWYA 1AVAA 2DQJL 5F1IB 4LP5A 4QWWD 5EU3B 5EU4B 3UTSA 3FRPA 4LPWA 1ZWIB 3LQAC 2VLRB 4LMQI 4TNEA 5DK2A 1ROCA 3D2UA 3P0VH 3AG2B 2QADB 2H8PA 3QPKA 4FTVD 4NC0B 2O5YL 4OW6A 3SBQA 4PJCF 3ARGB 1V55B 1GGTA 3QZBA 2YIHA 4Z78A 1OTTC 1Q0EA 4NWUL 1ND0B 1QBMH 2EP6A 4QRQB 4MD4A 2PWGA 2C9VA 4WEBL 4GW1A 4LRIC 4JG1H 4P46B 4W93A 2HFTA 2ZYIA 1YCSA 1CBJA 2AQRA 1M71B 1NEZG 1R47A 4L3ED 4RZCA 4YBQD 3TZVB 1AC6A 3KH4A 5HYSB 4ELMF 5IHHA 5DHEA 2W60A 4FFYH 5E70A 3RWGB 4P59L 4XNUL 2R4SL 3AADB 3X1NA 4BK5A 3PWVB 4R2GB 2IADB 1H3GA 5CJ5A 3PWLB 3T0EC 1QEWA 1TQSA 3LS5L 1F4WL 2QSTA 3NTCL 4OQTH 1CLVA 3KD4A 3TA3C 1IQWL 5J9PA 2C9PA 1V7ML 3R0MA 1T04B 3OAYK 4L1DA 4JRWA 4R8WH 3KM1A 4QRRA 2F19L 3UEZA 5BV7C 2CDFA 4PJFB 3KVPA 4I3RH 1WWAX 3NJFA 1KIQB 4YIQA 1OPGH 5K69A 1HJBC 2AQ2A 5F9JA 1J1PH 2BSDA 1LEIA 1EHLH 3GPEA 5TGBA 2EYSB 5D9SB 5BQ7A 3KPSB 1RIVH 2OYPA 1X7QB 4N2FA 3QIUC 5DJ8A 2G5UA 3LKNA 3X14B 2Y6SC 3F8UB 3U9UB 1SHSA 2AEQH 1KB5A 2GVYA 3QISA 4LSSH 4UI2A 3TIEA 2AQSA 4PJ5E 5KW9L 2O61B 2C1PA 4FP8L 4IOIA 3P77B 3AJ7A 1G1KA 3BQUD 2Z92B 2Z93A 2R39A 3RWJB 1H5BC 4Z1PA 5GRVK 4NQXB 2WYHA 1VZGA 4Q97A 1SMDA 5TQ2H 4OZHE 2A4ZA 1G7IB 5DDHA 2A9BA 1PLBA 3FQ1A 2OV0A 5EO9A 4EN3C 1NMCC 4JN2B 4TTDC 5F3BA 3AG3B 4A63A 1XO8A 5EN2A 4BGDA 4AYSA 3FFDB 4KO5A 2JCWA 1WRFA 4FEMA 4JM2A 4K71B 5DZJA 2H32B 4FZ8H 2IV8A 3BPOC 4NKIL 2OYKA 4JFVA 1BG9A 4XNZB 3GM8A 3QEGH 1AAJA 4HHWA 2WZPA 4BA8A 4P9HL 2BVYA 1U6AH 4FTVB 3JYCA 4FN0A 2X4OA 5DRZA 3SKNB 3QDME 3P3UA 2YSSA 4RBPH 3Q7JA 2GBVA 4UAHA 5IOKA 1SHWA 2MPAH 2TRYA 2YQ2A 3MSPA 4O00A 4YHIB 3BUYA 4HPHA 3ZGHA 4N0RA 2E9WA 1P6FA 4GLRI 4ZMLA 3RY6A 5LXVA 5GRUH 3WL9A 2NX5E 5L6YH 4L3EB 3U0PB 1FFRA 2B5IC 1MG3C 2GY5A 1E27B 1UD2A 3P4MB 4I18C 3PWPA 4MAUL 2KZWA 4HPOL 3UAJC 5DR5L 3I02B 4P3CH 4M1GH 3U4AA 3GF8A 5D2NC 2Z4TA 4X7CC 2Y9RT 3FQTB 4B50A 2DQEL 4B97A 4ZQKB 4ZD3L 4JFYA 5A16B 5EEUA 4GI6A 3V7MA 3SIKA 3WDIA 4APQA 2Y72A 2ODIA 4OT1L 1S9YA 2V6HA 3KJ4B 4N86A 1OARL 2BK8A 3IWVA 4NIKB 4HIJA 2E4TA 2P8MA 4LSVH 1J86A 2XIBA 3OKNA 1N68A 2JV6A 5DUPL 5EDSA 1TCMA 1USQA 3Q2CA 2KQMA 1U58B 2Y1ZA 5F7BA 3NYKA 2M1KA 3LNGA 4H25A 4Y2OB 3KGRA 4JS7A 2JB5L 4Y4KC 5EF3A 2K3TA 4OD1L 4AEIH 4FMVA 1MLCB 4M5ZH 4JFXB 4KK6C 4WNJA 1X5GA 1DE4A 3FUDA 2B0SL 3BQUB 4PRPE 1OHZA 3LKPB 4MX7B 1NEPA 4K73A 3CVCA 1AKJB 1SXBA 4M02A 3VD7A 2X1OA 3LDBB 1BBDL 3CZSA 4MWFA 2EJ1A 3IXAB 1KZQA 4Z5RA 5L9DL 3T04D 5JQ6H 2EYTB 4HWBA 2KH2B 2OMYA 1N0XL 2ZWNA 3ARSA 3NIFE 4P9MH 3WY1A 1RIHL 2Y3AA 4R7VA 4ZPTB 2BCKA 4RAHA 3EF7A 4WI2A 2AMGA 3AACA 2X89A 2X6BA 4HS8L 3L45A 3VWJD 2AMUA 1MAMH 3VYNA 4Z18A 4KMTL 1GGYA 2PPDA 5GJSL 5CSZB 2H6OA 3L3OC 4B9JA 3DXAD 4AX3A 2WBXA 1E4WL 4JPKH 4JFFD 1DN0A 3HMXH 4U4BA 4XMUA 3RZCD 3ES6B 4N2IA 2FX8H 4M00A 1I3UA 1HEJC 2QMJA 3P11L 4XPBH 4PJCB 2FEDD 4ZW7A 3RWDB 1R3KB 2NT0A 1U3JA 5B38B 5KSAA 4OJCA 3LY6A 2DLEA 1UXSA 2X4SA 2E75C 4ZDHB 1J1OH 1UM5H 1EEUA 2BNQE 5FCUH 1XGQB 4WO4C 3BSZA 4GO6B 2BSCA 5I16A 2ADFH 1KTLA 1A8JH 3EGSB 3C8KA 4DVRL 2WZAA 1E50A 2GJ6D 2X2YA 4JM0A 1UTDA 3CX2A 4L9LA 3CZEA 3SO3B 3GRBA 1AJ7H 5JO5A 1XV8A 1J48A 2AJXL 4GQRA 4HF5H 1NUDA 2VZSA 5AVSB 2D2CC 4DAGL 5DHDA 3V0WL 1N3NA 1HDMB 3ILEA 3X1FA 2JJTC 3RKDC 1CC3A 5KS9F 1GSMA 3ZLQC 4I7ZC 2KZBA 1Q9LB 5FS5A 5AZ2L 1Z5LB 2NXYD 5C8JB 3MV8E 5F9WC 2NY5L 4HG4K 1U8KB 4HIIA 1U8QB 2WB1A 1S9XA 4TRPH 5D2LB 5IW1A 4GUOA 5DWPA 3KWVA 1CXFA 1T6VN 4J3OG 3DSNA 1RHHB 1FNLA 1G0DA 2CIKB 4ONFL 3VVVA 1G6VK 4GIOA 1MNUH 1MRDH 4MTMA 4NENA 3QZNA 3FW6A 4F7EB 4D9RD 5DLML 4HEME 3MTRA 3CZNA 1S6NA 1J1XH 2L7EA 4NT6A 2NY2C 1MCIA 3HI6H 3P0YH 3FFOA 4LEBA 3VXSA 4BBWA 1BECA 1CDCA 1LNUA 2CD0A 3EYSL 3FQ4A 1U8LB 3QC6X 5EFIA 1MCSA 2W65B 4G5ZL 2H2SC 1WCBA 5IBTH 4KPHL 5AEAA 1JRHI 4AMKL 4LPVA 3DUSA 5CJOL 4ZMPA 4ISVA 2CO6A 1HXMB 5EO1A 3R8BB 3RB5A 4ABWA 2WCPA 1YQ2A 3IGAA 2A77H 3PJLA 1U2YA 3T1WA 1CS6A 3VFTB 5F0MB 2BXZA 4CKVX 5LQBL 1W80A 4HU8A 1FL6A 1AQHA 3WHXA 2E74C 4PJAE 4NQEE 4NRXB 2YFNA 3DXAB 4IRJA 4MXWL 4X50A 1LO0L 3TJHD 4DZ8B 5B3NA 4JFFB 3OGOE 1KCWA 1JWUB 3HJ0A 4W6XB 5HI4D 3RZCB 1TUPA 5JHBA 1LHZA 3C2SA 4MMXA 4Y5VC 5E8OB 2V5SA 2MCG1 3WG7B 1IE4A 4YBLC 1H3TA 4N22A 1EJFA 3UAEA 1RUKL 1TVBA 4ENZA 1C12A 1O75A 4M1CD 1QO3B 1HH6A 3GSQB 4RAVB 4BZ1H 3WFCL 4BH8B 4XVUD 2Y1VA 5IESH 4QO1B 1DTUA 2KLSA 4PU2A 3VU1A 2Z7ZA 3CH1B 2BSSA 4NUGL 2BNUA 4W70A 1G1OA 1VIWA 4F93B 5DC9B 3QYCA 5F7KC 3HZMB 4R9HA 4I77L 3GRGA 2AQQA 1INDH 2OTWB 4NUPA 4HIEA 3JVGC 1FH5H 3S2CA 4FG6C 3ZZ1A 4Y2LA 4XO8A 2CHXA 3QK0A 4FNQA 1E3FA 2EIZB 4NHUB 4P2YA 4GSRA 5CD3A 4JKLA 2IDSA 5JORB 1E9QB 1YNKL 2BO0A 1P5UB 3ZE0E 5I1IL 4XWGL 4AQEB 3N1GC 5K9KA 4BQ8A 4AC4A 2J5LB 2BVEA 3SOTA 3TBYB 4MQ7B 3HB3C 4WW2F 3FT2B 1BD2D 4PWIA 1SVZA 3VFVA 2YEZB 1CD1A 1WPCA 2HTLC 2VR7A 1PF3A 2WBJA 5D1QC 3VRJB 4LLVB 4M62L 1HHHA 2I7OA 2R15A 4CMMB 4BGLA 3WFEL 3ZDYE 3P30L 4XXWA 5F6HI 5FV1L 5FUZH 3DROB 3W39B 1WQVT 1PD6A 1E28B 1LD9B 3ECBA 4LK4A 2GITB 1CU4L 3ATFA 3F6LA 4ODXA 2DAVA 3DVGA 4IKNA 5IV2A 1QPPA 3KLAB 3BE1H 4NC2B 4UB0H 2OXGA 5AVQB 4IJ3C 4NZTH 4QT5A 3K4DA 2WVUA 3BUIA 3GZOA 4JY5L 1AGCB 1AIFA 3ZTJG 4NNXA 3ESVF 3S2AA 3L3DA 3OAWA 4BFBD 3O9WA 4OI7A 1YJDH 4JZOB 3RAJL 3UTQB 1JL8A 2OMVB 3K8LA 4CN1A 1I7UB 3WDHA 1IL1A 3AAZA 3HMWL 1KG0B 5F7HA 3IKCB 1HQRA 2W9EL 3GI8L 4L8SB 1I8AA 1MJ7H 2HVKA 3L1EA 3PAZA 3UP1A 4NZRH 1DR9A 1PIFA 2B3IA 2IGLA 5HI3C 5B39G 4B9ZA 4NO0D 4JBSA 1TJHH 1BLNA 3CCHB 5HVWA 2CJ3A 2ZWYA 1QWNA 3RY6C 1CGUA 4MA3B 5E08H 1I82A 1J5DA 1NOLA 3ZDZB 5DFVC 6PCYA 2HG0A 2CHWA 3MLSL 5TE7H 3QRGL 1M3JA 4JE0A 4MNGE 3T71A 4AQ1C 3GUTA 3S3CB 1XQ4A 1K5NA 4PJDB 1MVFA 1GY2A 4YNYB 3TIDA 1QA9A 4B5EA 3TO4D 4KMLB 4ODBD 2XT1B 1NUFA 4AEFA 3AVEA 1I1FA 2GT9A 4X99B 4XN1A 4ZNEA 5HHME 1W72B 1G7HA 2O93L 3QFDA 1Y1UA 1HHKA 2GBUA 3GIVB 3HC4L 4FGMA 4EVNA 2BRRL 3RNKB 4OZFG 2GJRA 3KGTA 3RQ3A 4F37K 2X6CA 4NGHL 5GGTL 1I9RL 4XNMB 2OPCA 3BKCL 4KX8A 3U7YH 4P48A 4L0YA 8FABA 2XLLA 2Q10A 1X5JA 1TEYA 3B6SB 5D7JA 2Y7MA 3J07A 4AIXA 3B2XA 1IEAB 4PRAB 4OZIF 3QJHA 5DJ0B 3MNMA 3Q3GA 3QFJA 5C0BA 2I5YL 3CFDA 4ZMXA 4WV1C 3KL3A 5HJBA 1ASQA 2V5MA 1BD2B 3IPFA 4L3FA 2CMRH 4O2CA 1LK3H 1KJ3H 4Y4FA 1OAKH 5EIIB 1J8HA 4AGNA 1HI6B 2V2XB 5CN3A 5MENE 1WBZA 2J2ZB 3FT4B 1JVKA 5IVOA 3DDFA 2FHFA 4FFWD 1LK2A 1T2QL 3MCKA 2QVTA 3U4BL 1J05A 3NQKA 4W9IC 4RMQA 3OZLA 4HBCH 3RKPA 2Y0SA 4JGUA 5KBDA 1WCQA 1JPGA 3L08A 4M43L 5I8CA 2YAMA 2A6KB 3MGOA 5CJBA 5I2IA 3SE4C 3UZVA 2Y7SA 5BOPA 3WN6A 5I74B 5DJAA 4YDLB 1DHKA 3A6CL 2L7UA 4ZFQA 1JS4A 2E9BA 1Z9MA 4TNVK 3WMPA 1F13A 3VXPB 1WV7T 1A3RL 3M6DA 3NFNB 3EKCA 4WUKL 4ZO7A 5FFGA 1BJ8A 4F7CB 5I1HL 4HK3N 4WK0B 1JCKA 2CBOA 4NQDE 1ADWA 3ARDD 4LEEA 3RE0A 1L9QA 4YHPA 2J7LA 2JE8A 4GKNB 2D73A 4NO0B 3L54A 1A7PH 3Q48A 1W2KT 3FTGA 4JPWL 3MUHL 4WW1A 2NSXA 2GC4C 4QRPE 1MHEB 4ABVA 1BAGA 4XP1H 5FPIA 4N8CL 4ANKA 2WLIA 3COOA 1KEMH 5E0QA 3QUXA 5D72L 5IT2L 1H9DA 3C6LA 5ETUB 3TO4B 3MBXH 4NDMB 4X98B 2I60H 3UGEA 2EH8H 2XWRA 1ACYL 4N90D 2DLTA 2VMJA 3TFKC 1L0PA 3L3KB 4LAQL 4YR6A 2DL2A 5JOFA 4PP2B 5IKCA 2VH5L 1HCVA 3ZO9A 3ARYA 3NJGA 5C0JB 1MHPH 4LCWE 3GXDA 1FVCB 2Y07L 3VFNA 2VSMB 1D9KD 3F83A 2LFGA 1B4JH 4LHQB 1MAJA 5JIIA 1F6LL 2XNAB 5IJVB 3D4CA 1OP3H 5T1LA 5KYWB 4YSQA 5GGRB 1QABA 1YEHL 1GH7A 4C54A 1YN7B 2QHRH 1AGEB 1ZLEA 2D7TH 2CRMA 4GAJH 3B2UC 3V0GA 3G5ZB 4L8CA 2C7UB 1J5HA 3ETTA 5DWUL 1INEL 2G4EA 1PAZA 3GSNH 5L4FA 4WJKB 4AZUA 4E36A 4HOMA 5E6UB 3C2AL 5FDYA 1BZ9A 4OLUL 5IMMB 1OGAD 1KTCA 1D6VH 4NNPH 3D2TA 3PF2A 1RMFL 2EE9A 4MFHA 3ULVL 2WGXA 1IQDA 1WJ3A 1MH5A 2AXFA 4P4KD 2JK5B 4FE9A 4GXVL 4OZGE 3VYOA 4YUEL 5IEKB 5HPOA 5CJXA 5LGJB 2UWEB 4K4KA 3CU7A 3BT2H 4XC3L 5E9DD 4YPJA 3DIVA 3JWDC 3R4RA 4PRNB 1VEMA 2A9ML 3EH2A 1NPJA 4U1JA 1R3JB 4X4XB 3RWHB 2YUXA 2FGWL 1FPTH 4X6DF 3BAEL 3V6OA 2YRLA 5C07A 1XCQB 2EEFA 3I74A 5BQDA 4PRHE 2ADJA 3O6KH 1MZYA 1WC7A 1FH2A 2FK9A 1CYXA 3C5ZA 3CXHJ 4XGZA 1UA6L 4U2ZA 4KJYB 2MSPA 2X41A 2M83A 5DZVA 1IAIM 1CFMA 5DO2C 1KTDA 1F18A 3MKGA 5AOKA 2K45A 4A2DA 5MP6H 4O2EB 1QATA 2CR3A 5HHVH 3AQDA 3VXTA 3P3RA 4Y9BA 5FCSH 5I1EL 2DIBA 5CWSA 1Z3RA 5EU6A 4LB8A 2A3TA 2H6PB 1VGEH 4IRJC 3ARDB 3L3IA 1A4CA 3DO7B 6FABL 3FB5A 1E5AA 3BIAX 2DTMH 4NQSA 4ATWA 5I1JL 1WEJH 3RL1A 3VXMD 1NANI 1KENH 1X9LA 2HT3C 4Y19A 1IBDA 4OAWA 3GHEH 4ORGB 1FZKB 2Z31C 3VNYA 3JWNG 2WKLA 1U92B 2BERA 1AKPA 2VQUA 1YPZF 5IIEB 3GXMA 5FYKD 3CH8A 2MCPL 2BOBB 3P9LA 4G71B 3WY4A 4KHTL 4QLWA 1XHHA 4DUVA 5HHOA 3TA3D 3MNWB 4O2FB 3HFMH 3MBWA 2QLYA 1NKOA 3LQMA 5BRZB 3QCTL 1KUMA 3VFPB 1JNJA 2ZCZA 2FUQA 4HCFA 4MB3A 4Q6KA 5IROC 2PW1A 1OB1A 4JPSA 4AMXA 1JZ4A 1ZA3B 4M29A 3HUJF 4L9DA 3TBTB 3UJTH 1D9KB 3L4XA 1NLBL 4G7VH 2V9QA 1OPOA 4MD0A 4MSWB 5F1NB 5C0IA 3QFGA 3GJEB 1SPDA 1BVKB 5TK4A 5CGMA 3QO1B 5JW4R 5BMFL 3BMWA 2IANE 5CMAB 1LO3L 3OQRA 4KJPC 4R97B 2EUZA 4HCRL 2QBWA 4KUCF 1M6OB 2VDPH 2P24A 1A4JB 2NXZD 1MCKA 2WBJC 2FVNA 2P45B 5BUPA 2DQMA 4E0RA 1OGAB 3FQUA 1V05A 4KTGA 5HYSG 2AEIT 3WNMA 3MA9L 1WGOA 1GCFA 5IFHL 1CD8A 2B1OA 4XN8A 1RK7A 1WP6A 5H4ZA 1FNEB 1AG6A 4P4KB 5DJ6A 2UZYA 3DRTA 3DX7B 4Y5XB 3U0TB 4EN3D 4XMVA 2ESVE 2OTPA 2Q2LA 4ODSH 4MDRA 3HW7A 4TTDD 2WXOA 3U6XA 5CINL 1UT1A 3K8MA 3ZT7A 4DH2A 3H6JA 3LIZA 3WEXA 1TVHB 2DH2A 4X42A 3O9WC 5C0CE 5JYLA 4NNYA 5CR8A 2FWOB 2XN2A 1WHOA 2I85A 4FS0A 2IH9A 3AXHA 4EUPA 5C09E 4NO5B 1VFMA 1H3UA 4K3DL 5EZLA 2JFCA 4L3AA 5LAPA 1LILA 1DO5A 3ZE1F 1XX9C 2YLKA 2P26A 3SYCA 1XT5A 5AW3B 4I2XA 5IJKC 3HBGA 3BI9X 1UXWB 5L8JB 1LGVA 2VQ1B 1AD0A 2XN0A 3UBFA 4AMWA 2AF2A 1LE5A 3NACL 4PW3A 2VTFA 3P3YA 5BXFB 1ULVA 3U1PA 1JGUL 1RZQA 3ULAB 5HHXL 2X3AA 4MJID 1B4RA 3D08A 4JG1L 5C08A 3VXMB 4P2QE 3WFHA 5BO1L 5ELIA 5INCA 3S37X 3VXUE 3UAJD 3CSPA 2KMWA 1IC7L 5JIHA 4U1KA 4L5FH 4OLXH 3Q9PA 4O9HL 2A6IA 4KITB 4LQFL 4KKPA 1SXSA 2LHAA 2OCCB 4OFIA 3WDJA 5J11C 15C8H 1CL7I 5IQ7L 2JI2A 3HCVB 4JB9H 3TA3B 4ETYA 4DJMA 2BCMA 3WXWH 3O2DL 4OQTL 4AYID 3V4VL 5A43C 1DBAL 3TBVA 3TCLA 4PJBA 4UV4H 3UZEA 2BVTA 1U21A 5AOJA 2Y5TA 3IKKA 1JYVA 4R8WL 1DLHB 2DEWX 4N0YH 3QI9A 2Y2WA 5D7IE 4FFVC 3QO0A 3CDZB 4XOAA 4NZUH 4F7KA 5D7JC 3QJVB 3AZUA 5DQ9A 1S46A 5KSUA 2AVFA 2NOYA 1KB9J 3OKKB 3HG1B 2LVEA 3S88H 3EH4B 4ZT1A 1DL7H 1L7IL 2JI1A 3UXFA 1S7SA 4XB3A 5FF6B 1AHWA 2KLTA 2V2TB 5DFTA 4Y4FC 3D8MA 5DJYA 2Q9OA 3GXPA 2PABA 2O6DA 3BUQA 1IGIH 1P1VA 2NXZB 3QARA 4A37A 4X0KA 4KK6D 2P49B 4Y9EA 1SJEA 3H2WA 1UWGH 1CDGA 1G6RB 2K1MA 1J0JA 1H5BB 5F7LB 1MCRA 2QVKA 5G4OA 5IB5B 1G94A 4DK5A 2HLAB 2BW4A 3NG5A 3QB7C 2EXSA 2X1QA 2CDGA 4EN3B 1NMCB 3FC8A 3CFUA 5SX4I 5A7EA 5CZKA 2DDQH 5I15H 4ZFFA 4UQ2A 3W38A 1S5HB 2EDHA 3VMNA 5DK3A 1DVFB 2Z65C 1YYCA 4DEWA 1NCUA 1XGRA 1N5YH 1EZUA 4XVOA 3BPOB 2EQDA 3OJ2C 4OTXL 4XWOD 1XAKA 2ED9A 4D9LH 4N9GB 1TDQA 1DSWA 2DQCH 4RBPK 4X6DB 3R0NA 1A1OA 3TV8A 3TURA 1EGJH 3EFDL 3D25B 3ABZA 2CJUH 2XQYK 3FZUC 4UDTA 4XCYB 4DP5X 5HI5C 1Z9PA 2BSBA 3PJNA 5SWSB 2XPYA 5FXCH 5HJ3A 5BVPL 5I75C 4QTHA 4OZIB 4YMPA 1TEGA 4I13B 1BVLB 4QRFA 3F7QA 3NSDA 4OF8A 5GGVH 3C5JA 3EJZC 4ZUWA 1A6AA 1F02I 1YN6A 3C6LC 2H3XC 4XRCA 1K85A 2O6EA 2QQKH 3KZ8A 3BDYH 3HZ3A 3PWJB 1T1XB 2EH7L 3MX0B 2VITB 5E4OA 4X6EB 4AL8H 5D2NB 3GHBH 1F58L 5ICUA 3HR5A 4GFXA 2GSIA 4F8LA 3MNVA 2DMGA 4JDZA 4Z3IA 1YPZB 4CILA 2IIJA 4JO3H 5AVWB 4PJEE 5BZDB 5TDPA 4JHVA 4WGVB 1XGPB 2J12B 3DX9A 3RKDD 2EE0A 5BZWA 2VUOA 2WMPA 5ISZA 2D7MA 4PGDA 3FUEA 3MV11 3O4LB 3D3VD 2ZT9C 4P23A 4BZ1A 1T1ZB 3LSOB 3QR1A 3MREB 4YLCA 8CGTA 5KJRH 1FIEA 4JKPH 3HG0A 2OI9C 2VXUH 5E4AA 5FA3B 4HULB 5B38G 1MJ8L 3VG9C 5EF0A 3BT0A 5HXMA 5D7LE 4DCQB 2PNDA 2IPTH 3K1DA 4KQ3H 1NBYA 1QASA 4Y4HC 4YSDA 3L7EB 4E68A 1UM4H 4TN9A 2ZUQC 4W68A 4NM4L 3R1GH 4FG4A 4M5ZL 3STZB 3ZYJA 1ZT4B 3G5VB 2VXQH 5IVXE 3SB3A 1BDYA 1U9KA 2EEBA 1NGWA 3NN8A 1PNDA 1V5JA 4MCMA 4WWPA 4KZEL 1TTGA 4XC1L 2NY2D 2EABA 3IDMA 2DM7A 1MVUA 2VDMB 4MXQC 2P8LA 4EI5D 4G59C 2P48B 4EKJA 3K8KA 3EG9B 1IGFH 4JRFA 1P7KA 4TVPE 4OF6A 1L9PA 4P9ML 2IH8A 3B3BA 3VU2A 5E95B 2APTA 5EWIH 5LBSH 3SE8L 3ESPA 1DFBL 2WO2B 1CE1L 4K5MA 3V0AC 3HC0B 4YHZH 1MIEL 5FKPA 4WF7A 4UAOC 2HVJA 4WRLA 3GM0A 1KPVA 4PWEA 3ZHFA 2WLKA 3CWGA 4MBOA 1V10A 1QP1A 5CLTA 3I9GL 2WLLA 3QJOA 2GTZA 1H6FA 1LTXA 4CU7A 3ZOAA 5LGHL 5JPNB 2VDQH 4ENEC 3ZE1B 1ZS8A 3CXHK 3NIDF 4FA8A 5L2KA 3FB7A 2CBTA 2OJEB 2FQDA 4E41A 5K1NA 3DK0A 5BZZA 2AQPA 2Y06L 5DHYA 1E9PB 3UBXI 1U3NA 3L2NA 3RDTA 1UM5L 4I0PC 4O02A 3VQMA 3IXTA 1Z0NA 4A39A 4Y0GA 4DTGL 2CLRB 4XMTA 1FYTA 4HUNB 2ADFL 1DLFH 4HC1L 2CE6A 1MCWW 3IE4A 5E2VL 3VJ6A 3CNKA 4PJ7F 5AOZA 3IMSA 4TSAL 4Z7VB 4FG6D 3R06A 1AJ7L 3FQ2A 5DJ2A 1OTUC 3JBG7 1ES0B 1S7XB 2X87A 4UIMB 2I25N 1RSFA 4PGCA 3BPLC 3VI4E 4CW1B 4HKBB 3U6XS 4UTBL 2NLJA 1QR1A 2WQ8A 1NMBH 3HB3D 2YGQA 4AM0B 3D3VB 4KDWA 3KPRB 4CSZA 4MMZA 2BDNL 3P3TA 2HTLD 2XACC 3FS9A 3KXFE 2NTFA 5D1QD 5DS1A 2WVTA 3DYOA 1FBIH 1JFQH 1OAXH 5JA8B 3VFRA 5D4QA 1A3LL 3MLPA 1Z1WA 1XIWB 4HMEA 4V1DB 2ZOOA 2W0FA 4N6RB 2H41A 2XKNA 1Y18A 1VJSA 4RSVA 4ZPVB 2XCMC 3KPSE 1TT6A 4FXLA 4V11A 2G30A 1EO8H 2EUVA 4TUOA 3M1BB 2NY2B 3KW8A 5IP4A 1J1XL 1IC4H 5CKGA 3V5KA 4YSCA 2ZUSA 4EO5A 4EI5B 2QPDB 3FBKA 1BF5A 2MQGA 3B34A 3DIFA 1M3IA 2E6PA 2PW2A 3ARQA 3NSJA 5JIMA 1QW9A 4RGNC 1FV1B 3Q8CA 2FJHA 5IBTL 1ZLSH 4JL2A 3LH8A 5GS1C 3OZ9L 5DMKB 1YUKB 3DX3A 3NJXA 4W9HC 5IJDC 3UZQB 1PEWA 4YZFE 2D4FA 4MNQD 5GPRA 5TE4L 2Q8BH 5DVNA 3E3QC 1ZHNB 4KQ4H 2OL3B 4N0FA 1SF3A 2XXGA 1W16A 5DHVB 2X4PB 1EUUA 1J12A 1E8WA 1XZWA 4NP4H 4PLJC 5FLUA 3JQOB 4R5XA 4LSTH 3S34L 2DWTA 3MA7A 4FABL 1PLGL 4JG0H 5DFVD 3ILPA 1U0QA 3CSFA 1ZHLB 4W9CC 2WC7A 3MLXH 5IY5B 1AMYA 4U0RC 4Y5VB 3RWFB 1X4ZA 4JKMA 3JWOC 2VZOA 4PGZA 3SKUD 1A2YA 2GAZB 1PJWA 3FTVA 2ZOTA 1UWEH 2YBRA 4TQ8A 5F2FA 3EJYC 1YUHA 3KPMA 3LD8C 3PJSA 4P5RA 3R18A 4DP2X 5TF0A 1BMGA 5EBGA 4GUPB 5IESL 3BWAA 1S7RB 1GOFA 1ZIBA 3MRIA 1E90A 3EAKA 2QGEA 1YC7A 2W9DH 4H2AA 2QPUA 1QSEE 3MZTA 1NFAA 1AO7E 1B4LA 4UZUA 1NFIA 1P84J 2O6CA 3V4LA 4JHWL 4WGKA 1FH5L 1DUYB 3DPBA 5C6WH 4A7SA 1WFIA 3ORJA 2CSPA 4XPHH 5T3ZE 1H3VA 2EIKB 4D0CB 4NB7A 4XAWH 4U1HB 1AHWC 4F37F 3DURB 3HB3B 2IBZY 4Q14A 1E2WA 2B20A 4V33A 4KZ0A 5CN1A 5HTSA 4F5CE 1MI5D 3U1SH 5HGAA 4JO5A 4I3SH 4YK4C 2EVFA 1B0IA 2PPCA 2E8YA 4J3TA 4BCXA 4L18A 2OBGA 3V6ZA 2B9BA 1ZVHA 2WKGA 3V79C 1TENA 1NCWH 4KTYA 1QHQA 2MMXA 1KB9K 2N01B 2W0PA 1V3LA 3OHXA 4ZTPL 5FUZL 3VWKA 1JZ2A 3H3KA 2OMWB 1MHHA 4OCXL 3ZX1A 4XXDB 3L9BA 3PNWA 3AROA 1CFQB 2VZ3A 5JPMC 1NGYA 1GYUA 4ZFOA 3JT2A 3SCMC 1L5GA 3QUMB 5CGYC 5DEFB 3QWNA 4RVBA 3LEVH 3PAUA 2O72A 1WLHA 2HWZH 2VDRH 3FXIC 4FFZL 2NZIA 4D0DA 1DDTA 3GGWB 3QXVA 1E2ZA 5DMYA 4EI6B 5HYFA 2YOAA 4HWUA 3ZKMC 1RK0B 4K55A 3CSYB 1ZPUA 5T33L 1S7WB 4YX2H 4AEEA 5C7XH 3ELAT 5JW5A 2YPLA 5F89A 4C56A 5AD0A 1WFNA 5KVFE 5ITBH 2I07A 3KHOA 5L88H 1MJ7L 5AYQA 5SWZE 3ZTJH 2JKTM 3RVUC 1E30A 3IFPA 1R5WA 4NZRL 5L4MA 4NYLA 1P2CB 2VABB 1B9ZA 3QDGB 4TNVF 2XN9B 4R7NA 4FKKA 4LEOA 3DJSA 3WAJA 5A2IH 5IK3A 4AQ1B 5CCKH 3NJLA 2NNCA 4GYBA 1A22B 1KIRB 4HK0A 2YAOA 4BSVB 2ICEA 3W57A 5IW6B 4NPYB 1NIFA 4JO8A 3VB8A 4ACPA 4AKPA 5E99L 4FXKA 1GL4B 4RDQF 4HGWB 3QJQB 3SGEI 1U42A 2OW6A 2FX7L 4GMSL 4KTDL 2EC8A 3IU4L 1VCBC 4K9EL 5MEQA 5EZIL 3T65B 5SX5H 3UJIH 5IG7B 1LE9B 3FU6A 1XGYH 2FD6H 4PJCE 2HMIC 2VSDA 4N1CA 4WFFD 3ZGIA 2XFGB 1MCJA 2VRQA 3U7YL 3O8XA 1FO0L 4J3WA 3GNMH 3HFFA 3DV6A 4LESA 4AUUA 1D5BB 4JFOB 3S48A 2HUEA 3C5SB 5DQJB 4X7TB 1FG9C 5JHDD 4PCYA 3RVWC 4DO6A 2DJ4A 3AC0A 3CHRA 4K0OA 3BKYH 3IDIB 5T8IA 5C70A 4ELME 4XP6H 1MI5B 1I8MB 4UT9A 4QTFA 4FNRA 5IF0B 1XDTT 1H0DA 3RFZA 4GG8B 1B0WA 4HQQL 2MNJB 3T8MA 1CG9A 5IZ7A 4JFPB 1E7UA 4GRWB 3LRSB 1ADQL 2ITCB 4YSEA 1E40A 3PDOA 2VDNH 1IBFA 1ONQB 5I5MA 3ULVF 4N0UA 1UD8A 5L7XL 3GQFA 2R0KH 2V7NB 5I1LA 3BZFB 4HH8A 4TKWA 4HBCL 4JDTL 2IEPA 3PQYD 5I0WA 4RGOL 2FB4L 4GFTB 4DNLA 2OK0H 1MREH 3UYPB 4XZ4A 2BNQA 5DO2D 5FHBH 5ANHA 3Q06A 3OLGA 3IDUA 1RU9H 3MYJA 2QVIA 5F9OH 4UZGA 3CVHB 1OSEA 1PFOA 2H3NB 2HN7A 1HAUA 4NOBA 2ATKA 4ZSOB 4M8QB 2ZYRA 2R69L 4ZX6A 5LJYH 5JOPD 3BAWA 4NXSA 3LPGA 2Y3NA 4XMLH 5ENWA 1S4IA 4WFEE 2D0GA 2WLZA 1UJ3B 4DKFL 4Z76B 2Z31D 3HI1A 1YJDC 2YEQA 5CBAB 4CL7A 2L8AA 5F7AA 1N70A 2HRHA 5GRJH 3RDTC 3TC9A 1KEML 5ICXA 1OAYL 1QQDA 5A2FA 4HAGA 4PUBH 1OE1A 2XY1A 1HHGA 2Y7OA 2YWZA 1R5IA 2YLHA 1Q9WA 3DXAE 2LU3A 5EEXA 4JFFE 5IROD 3FN3A 3QA3B 1MHPL 2VDOL 4H4NA 4MJ6A 1N10A 1OP3K 5JW3H 1WIUA 5AB2A 2GJJA 3MUJA 5JLZB 1WIOA 4NBYB 1TETL 4MJ2A 2HT2D 4H20H 4JFUA 2BOCA 3TH4T 3OB8A 3QC5X 4KJPD 3FN0L 1BV8A 2D7TL 1U8HA 3OKOB 5JHDB 4HH9A 4YHNB 1FGNH 2V33A 3F6JA 3GSNL 4NAMA 1HOEA 4N1EA 3MOAL 4L29B 2AJUL 1NEZA 1OW0C 3MR9A 4KXBA 3Q6GL 1D6VL 2W1NA 3HAEH 2JXMB 3KWWA 1W0YT 4E9VA 5KG9B 1PL3A 5DVOA 3WE1A 3GJFH 1FRGH 5KTEH 4N68A 4GKOA 2QPEB 3P2BA 4PJAA 2GHZA 2IAAC 2ZOLB 1C8PA 4PBDA 1J5OL 2WQXA 1VFAB 4NRYB 2D8KA 4G6JH 1UM6H 3HJEA 4FZEL 1OM9A 3K7UA 4I48A 1HL4A 4KFMA 4BXVA 1A1NA 2Z8VC 1NFDF 2YKLL 4NKMB 1KACB 5EF2A 3PQYB 4OLYL 1FPTL 5ILTL 2EO9A 4DEPB 5DURD 3T3MF 1IM3D 1IC5H 3O3AB 3AY2A 1N64L 5DVLA 4U1LB 4Y1SA 4B95C 4GRLA 4MS8C 1BFTA 4R84A 1PG7W 5MP6L 2YPKA 4G43B 5DXWA 3MJ9A 2ZAGA 3G6DH 3P4LA 1E4XH 1AGDA 2DLGA 4BQBA 1AQDA 3SHSA 5CZRA 1UACH 3P9MB 5DLLA 5CLYA 4WU7A 4HWEH 5LXGH 2RMNA 3LS4H 1OF2B 1F4YH 1I7ZB 25C8H 4CVXA 2Z7YA 4UT6H 5FECA 1G9ML 1JF1B 3INUH 5SWQA 3LXAA 4JRYD 4P5MB 1OAQL 1WEJL 4GSDL 4W6YB 2EDRA 2C4FT 4GSUA 1KENL 4JHZA 2Z31B 5G4NA 4R5VA 3OXSB 4JO1H 2W07A 2YQ3A 2F5AH 2CHNA 3G04A 4G8GD 3E2HB 5EORL 4NX0A 3ECUA 4P2RB 4UQDA 4ZI8A 4NBXB 1RVFL 2WW8A 3J27A 4TVPH 4QXTB 2CBPA 5DMGD 4JW3A 2X3CA 2Y7QA 4OF0A 2J1WA 5GJTH 1ZJAA 4F7PB 1IM9A 4JPVH 2P5WB 2VERA 2HA1A 2X4TA 4KK8C 3FOLA 3L4CA 4A7UA 1N6QL 4F2MB 4KOCA 3W3BA 4FFVD 4JFSA 4OLEA 1I31A 2VIRB 3AXLB 4X6BA 1QPXA 4MCZB 2IVFC 2EXYC 5IUSA 1RL1A 1CFSB 1CURA 3MRCB 4J8RB 1IGYA 4FL4B 2E7LC 2CO4A 1SJHB 2QQNL 4XBEH 5MEOB 1XCTA 1R4XA 2ITDA 2JQAA 4AGOA 3H9SD 4HHAB 4R26H 4G42A 4OIBA 2VDPL 3EYUL 3NCCB 2AV1B 5ICZA 2W80C 4DGUA 1PKQA 4A04A 4UMSA 3SDDC 1P84K 3D4ZA 5KVGE 4FCAA 1MCEA 2X7LA 5HHPB 2VC2B 4F9PA 1U95A 1I1YA 1KB5L 2E5EA 3VWKC 2N4IA 3OHXC 3CN1A 4Y9FA 1GIGL 4GG6B 3EFFB 4OFYA 4UILL 2R0WL 2YAPA 3EYVB 3N41B 7PCYA 4AYFB 4WI0A 2DV6A 2HH0L 4PV8A 2ZF8A 1HIML 5KS9E 2KBGA 3TESA 3PP4H 1IM3B 2AJZB 3V95A 4OI8A 4XMKL 4EAEA 5I0ZA 4Z7QF 1PCSA 1YHPA 3LKSB 2ICES 2V8LA 4OF5A 4WUUD 5T1MA 4MA7H 2O5XL 3EUUA 2QSQA 3TYFB 5EU5A 2OJ1A 2UX6A 3CBKB 3FZUD 4YSOA 5FYLL 1NBZB 5D5MA 1SEQH 3FFCD 1QNZL 4OKVB 3LXCA 4M6MH 1DVTA 2WQUA 3E7JA 3LXBA 3MRFB 1UADC 3G08A 3BZDA 3Q8BA 4L1LA 4L4VE 3BP4B 1SN2A 5F71A 3ZTEA 3NIGF 1P4BH 5I9QC 2APFA 3D85B 2G3MA 5E94B 1GGBH 4JRYB 5FC9A 3UCRA 1F0LA 4JFQA 4KRLB 2VMFA 4HMDA 5I1CL 2ICEC 1QX1A 3ZMNA 2OP4H 1OP5H 4PI0A 3EADA 2ADIB 4G8FA 1Q9OA 2FBJH 2YUZA 1HH9B 1XEUA 1HCZA 2FWLB 4L5FL 1IE5A 5DSCB 1X5KA 3H7LA 3KLKA 4YEFA 4FLOA 3L1OL 1OSZA 1Z9NA 3MLYH 5GZNA 2XV0A 5ABDE 4JB9L 5MENA 3KYNA 2GFBB 2E27L 3WIHH 3PGFH 1DJHA 1XB6A 1PS3A 1WFTA 4U1SA 4RMVA 1THAA 3QIWA 3O8XC 4G1MA 4N0YL 4FA7B 5JZ7C 5I76A 1URIA 2DIEA 2V37A 2F5BH 2IWKA 3I6GB 5J4MA 3VAEA 1X3DA 35C8H 1KCBA 1ACCA 5D4JA 3S88L 1R17A 2H32H 2EINB 3EH1A 2ZE0A 3BHBB 2EYRB 1MQKH 3QDJE 3ZZQA 4FC3E 4A7VA 2I9TA 1OQOA 3WO4B 3BUBA 5A1AA 3RFZC 1JHTA 1ODAA 4Y4HD 4K94H 1GR7A 2V4LA 4QYOB 4UOZA 2EAEA 3LV3A 4U7SA 5B8CA 5BS0D 2DQFA 3L17A 1DUZB 1KCRH 3KW7A 3ZR5A 4RAUA 3S36X 1HL5A 1X9UA 5EBWB 4MDIB 1RZ8B 1WAAA 1AZBA 3KLLA 4KKCC 4Q9BA 1CFNA 3T4YA 2QZ5A 3W0WD 2NUPA 4LOEA 3AB0C 4MYWB 2QSCH 4NEHB 4UWQB 7FABL 4ALAH 2BIOA 2WKOA 5D8JH 3L1FA 3F58H 5I15L 1RZFL 4KKLD 5T3ZH 3MODH 1KGCE 1T4WA 3IF1B 4Z95L 2Z4QA 1LM8V 1C5BL 1MG2C 4YDZA 4HWBL 5E00B 3NZ8B 4N0CC 2Z7UA 3H42H 2GG1A 4IRZH 3PREA 1NFDB 2VDKH 3GO1H 4PJ6A 5CU9A 5FW7A 1AS7A 3CFCH 3VH8B 3JSSA 5DUBB 4B9YA 1KT2B 5TTRA 3QJZA 4UQ9A 3SPVA 5J0BA 3DOHA 3FFCB 1W0WB 1EAPA 3E0GA 2CGRL 3SE9H 4ENED 1QFPA 1SXNA 3S5YA 3ZR6A 4IIQA 1SEBA 4S1SL 1EPFA 2IFGA 4H8UA 3RL2A 1BJ1H 2IQAB 2OYLA 2YD5A 3FUIA 4CN6A 3H2PA 4H0LC 4I0PD 5AOIA 5AW5B 2C3VB 2D7PA 3HKFA 1BBJB 4UNTA 2OR9H 3L9RB 2J8UF 5FWQA 1YYML 2NW3A 1YMME 1ZT7B 3U6RB 5F8RC 2OMXB 1YEJL 1RUPH 4Y8DC 1P6AB 3AREA 3CFQA 3LRKA 2DJSA 3EDEA 3NFSH 4AL8L 4TQHA 5CD5C 2QQQA 1L6XA 5E8NB 3WKYA 1HQ4A 4YFLF 2XYBA 4HV8B 2QKIB 3EBHA 3KNBA 2BWDA 2VWEE 4OI9A 4AENB 3C8DA 5KVFH 4JL1A 2J55A 4I4WA 2QZQA 3V5HA 3MJ7B 5DJXA 2P8PB 5AW2B 3O3DB 3VRIA 4AOFA 2WUCL 2I9LB 3M7OA 4ESKA 4FEIA 1JI2A 4BFFA 2NYKA 1CXEA 2XWXA 2X2IA 4PRHA 5FKAB 5LDUA 2WWNA 2WN3A 3O6MH 4QR7A 1PZSA 4LVNC 5BRZE 2BVOB 3FONB 5KJRL 5DD3L 2NY7H 5HYJA 4LBEB 5DTFB 3VG9B 2VXUL 3G5YA 4PBXA 2EDYA 4HUWA 4YDVA 5CHNB 3TM6A 5KWYC 1WBYA 2IPTL 2WWMD 4KQ3L 2B1HH 3ARFC 2NDGA 1DQJA 4AK2A 1TFPA 1UM4L 1R5VB 3LKQB 1C08B 3TBWA 5BS0B 3FYIB 2JQMA 1GJUA 5IHZB 3JV6B 5CILH 1L0QA 1GKEA 3IN0A 2F58L 4K7PH 5I0YA 2ZIDA 3W0WB 1EH9A 4F1SA 1RXLA 4PJIE 3FJTA 5I6MA 2GEQA 2PWFA 3TTYA 2NY4D 4HEPG 4K8RH 3WJLA 4N6QA 5H37G 2DIJA 5INDA 4U33A 4XCNB 3HZYB 3GSXA 1JPTH 1PGRB 2XV2A 3C12A 4RGND 3GKWL 2FBRA 3WN5A 4CDGC 1LEKA 3JV4B 2G5BB 4GRLC 4XT1C 3RWEA 4G3YL 3OMNB 1R24A 2G3NA 1BXXA 3JWDL 4WTQA 5EWIL 5LBSL 3L13A 3L5JA 4JRXE 1CVSC 1MJJB 1SXAA 2HB0A 4P4RA 5D7KD 1MVYA 4HOWA 1L9SA 2I69A 2EDBA 2F9BT 4MRCA 3O11A 3RGVB 3WGUB 3HPJB 3VE0B 1GPOL 3GLEA 3OAZH 3P9WB 1NIBA 3DVNB 3RUGF 3MV9A 1IBGH 2N3JA 3D6GA 3MXVH 3VMPA 2F7RA 4U3SB 3BFOA 3C09C 5BJTB 3Q5TA 4JO2H 3FB6A 5E6SB 5DUML 3MLTA 2IANA 4FQCH 2F53D 4FQJL 1I1CA 2FLBT 3EJYD 5IB3B 4FLQA 3BEVB 1OOAA 1OZUA 4I89A 4J23A 4AV5A 2RHEA 4ES9A 3P73A 3RVVC 4Z0XB 3VXRE 4XPAH 4CU8A 2J57A 1BOGA 2BC4A 4BWUA 1CIUA 2FECL 2VR3A 3HIZA 3VXME 2VLKD 5DA4A 2FT6A 1KYAA 1K3IA 1TQWA 1YMHA 1MFAL 2W81C 4N2MA 4XPGL 5KVEL 1O6SB 2ZJSH 4RFEB 4Y7MA 4H26B 1YYLH 4H8WL 5CS7A 4ETQB 3GI9L 4M7JL 4MJHA 5B39A 1KJVA 3MRHA 1GYWA 3STBA 3M86A 2W95A 1JE6A 1H9VA 1FC1A 5C6PB 2X6AA 2AKRA 3NA9L 4NM8H 1DANU 2QKSA 3CJJA 3QPQC 3HC3H 1OAZH 3LTVA 3PGDB 4XN2A 1GZPB 4U31A 4F9PC 1GXEA 4Y9CA 1J8KA 1BJMA 2R0LH 3D12B 3HG1E 2GK0A 3ROLA 3C08L 3RVTC 4TSBL 4YE4H 4HOZA 4BDVB 1FVEA 1AQMA 2O5ZL 2BZCA 1JNHB 4BZ2A 1W9XA 2GQHA 2H4EA 2AK1H 4OZFA 3LKOA 4L2YA 1HILA 5CGYD 3SCMD 2EVIA 1JD7A 2CG9X 4NSKB 3MFGB 2NY4B 1N4XH 1T7VA 2UUDH 3AWFA 4ODWB 5DEZA 1IVLA 4YC2C 4JFED 3FPYA 1ORQB 4PJGB 4RGNB 2WTOA 3ZKSD 1DVXA 2ITFA 3B2PA 4ZX5A 4IBUA 3NQIA 1L0YA 1XZ0A 2QV2A 2ZX9A 4JVPA 2D31A 4CC4A 1JV2A 3BW9B 4BKLB 7CGTA 1PG7H 4Z7UF 4LLWB 1H6TA 4B96A 4IGBC 4IKKA 1JWMB 3ME0A 1SJMA 1WZAA 5HYIA 1TG8A 4HXAL 3D34A 1HSBB 4EZJA 1FZJB 1SHMA 2W88A 3T1FA 5IR1A 1TPXC 3ETBF 2NNAB 5D7IA 5DHMC 4LSTL 4A66A 1A8ZA 3OXRB 5DD6B 4U0RB 2Q8AH 1IVTA 3GXUB 2WSDA 3GS4A 3WLBB 3IT8D 4QD2E 3JTTB 4X6DE 1USZA 4XHQA 1A6UH 2BVQB 3PWUA 4CVWA 1BFVL 3Q1SL 5DVKA 4L1TA 1QFWI 1UWEL 1XCXA 2YZ1A 3IFLL 5I26A 3V6FB 1AC0A 4NZFA 4IMLA 4HSAC 5SWSE 3OWRA 1OK0A 1KXQA 4A7TA 2XA8L 1EEZA 4QOKD 1UH2A 1WE5A 2Z64C 3EDFA 2J8UB 5ANMB 3EO0A 3VCLA 3K3QA 3WJJC 5KSBA 2HTKC 5BRQA 2A73A 1T1WB 2VLKB 5AG9A 2R2HA 4JQXA 4WI5A 1ZT1B 1IBBA 2EE2A 4KKNA 4KKBC 4OCWL 1AXIB 3RVWD 2AGJH 4OZ4B 5ABAA 1EMTL 1G0XA 3BWUC 1SYSA 4GBXC 1RZIA 4JN1H 3UO8B 3DRQA 3D52A 1T0PB 2VMEA 3TF4A 3WNIA 2F54A 1YPZE 4AQAA 2JB6A 2BP8B 3OKMA 5HYEA 1MHCA 1V54B 1WS7A 4I3SL 4MCYA 2XV3A 3MACL 4H0HB 5FUCE 3V9EA 3VD9A 3QQXA 1N8ZA 1XH3A 2PLTA 2G60L 3T4AA 5FHAL 4GPVA 7TAAA 1JERA 1NCWL 1RJYA 2VJ0A 3O4LE 4Y1AD 3RI5F 3S3BB 1KGJA 3IWUA 1ESOA 2AQ3A 3HUJE 4KXZI 1D3CA 2WLYA 4FOMA 1AGFA 4LCUA 3QZLA 4X9FA 5DC4B 3SE3C 3SCMB 1F1AA 2NY3C 4LKXB 3KAAA 4P5TA 2OSLB 2NMSA 1N7ML 3LEVL 1IIIA 3PPEA 2HWZL 4PB9L 4E9SA 4JFEB 4MAZA 2XWBB 4NFCA 4B7IA 4G6AC 4MB4A 5B4MC 1JPEA 1KJMA 2RFXA 1I7RA 4F9LA 3SGDH 2KS0A 2WBKA 4OF7A 3FUFA 3UTTE 1JHKL 4R7DB 5C7XL 1D2PA 2R56H 1HSAA 4H1LH 3B9KA 2K70A 4JGMA 1KCVL 2VXVH 2W0LA 4J3OC 1LP9B 3QULA 5GS0C 2BNRD 5L88L 4WLCA 4DPRA 4G6KH 5HY9A 3V6BR 1QVOB 2G2RA 5I1GL 2PYEB 2Y1AA 2P28B 3KS0H 4RISL 1LLAA 5GIRA 5I1AB 5FR3A 5GS2H 2YD6A 5JW4N 4AGPA 3B5TA 4HALA 5AVTB 3M17A 4WFGD 3QHFL 2FO4A 1J8SA 3KYMB 5J57B 4Z7WB 5KYXA 1MFUA 2EZ0C 3HS0A 2RB8A 3AREC 3VQ2C 3D48R 3B7UX 5SX5K 2H47C 4P57B 4L37A 4NO3B 2HFFA 4ODTL 1DBJH 1BAWA 1DBBH 1CK0H 4WI3A 3ZE1E 3QXTA 2XJKA 4JHBA 1QACA 4QOKB 3ET9F 1BVNP 2IGTA 1B3IA 2DH3A 3GINA 5CN2A 3ZKND 2C9QA 2DBLL 1RHFA 4POUB 4R3SA 4TLKA 4XPTH 3GNML 4PW9A 3DTUB 3O3BB 4X5WB 4UT7H 2KZKA 3SY0B 1CTNA 2OMUB 3O41B 3QIBA 2YPVH 5ADOL 2E6JA 4NKOB 4HUUA 4ZMNA 4WI4A 1INQB 3SQBA 3O45B 2A9NH 1CLYH 1XF4B 2F61A 4GAYB 1YDPB 1LO5A 1NC2A 1E43A 2CRYA 3UO1H 2DMBA 2YRPA 2ZCHH 2ADGB 4ZO9A 2X4RB 4YSPA 3GMMA 1OP9A 1KPUA 4ZXBC 5KAQF 3C60A 1U33A 1VSCA 1SOQA 3EO9L 2P7TB 4DK6A 3MRLB 5C0AA 1TQCB 1TOXA 4JKNA 4Y1AB 2GUYA 1BJ1J 4YXKL 1RZGB 3GT6A