4CMHB

Crystal structure of cd38 with a novel cd38-targeting antibody sar650984
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
216
Chain Sequence
QVQLVQSGAEVAKPGTSVKLSCKASGYTFTDYWMQWVKQRPGQGLEWIGTIYPGDGDTGYAQKFQGKATLTADKSSKTVYMHLSSLASEDSAVYYCARGDYYGSNSLDYWGQGTSVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAR650984, a novel humanized CD38-targeting antibody, demonstrates potent antitumor activity in models of multiple myeloma and other CD38+ hematologic malignancies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords ADP-RIBOSYL CYCLASE 1
total genus 52
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2014-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cmhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cmhB02
4QHMA 1FNGA 2OXHA 1KJVB 3BP6B 1DLFL 3LMJL 3VA6A 4GRLC 5HVHC 1HXMB 3INUL 2R15A 1W2KT 1NCCH 5KSVB 5L2KB 4BKLA 3HZVA 1HWGB 3VXTB 3MYJB 5ALBH 3BP4B 2FX7H 2B4CL 2E9BA 2GUOA 5BS0E 5D7KE 3BISA 1PX3A 4WCYL 1UVQA 4M7LT 5FYKE 1CXHA 2HVJB 4ZO8A 1MCHA 3RWCA 4TTGA 4QXGL 3MSPA 4S1QH 4Y16C 5KANI 4XPAL 4M4PA 4LSRH 3FRPG 5C0CA 5B8CA 2YRPA 3TIDB 3O4OB 4CVZB 4M1DL 3CFKB 2A0LD 2DLIA 2J6EL 3DRQB 3HE7D 2YR3A 2NY2C 4FQXA 4JFFA 2PTVA 1GGYA 3GSQA 3CVHA 2Z31D 3X11B 3PV6A 4O4YL 3VXQB 3OKOB 4ODXA 2DMKA 1X5KA 1V5JA 1I1YA 4PJEA 4QKXB 2IFFL 4XZUA 2VSCA 5DUBB 5E99L 2CIKB 3DX9A 4JPWL 3FO2B 2VDLL 5ADOL 1KGCD 1WK0A 1IBGL 3BPOB 4WHYG 2R0ZH 1T1ZB 1MWAA 2BVOA 3QUML 5C0RH 2PNDA 2E7LC 5C07D 3QUMB 4X5WA 3C6LC 3FN3A 3MRFA 1XGYH 4X6DA 4M1CD 4PJ9A 4LEOB 4Q9RH 4ZD3L 3D2UA 4POUB 4RBPK 2CK2A 1E4JA 4JDTL 1INEL 4MAUL 4RGOH 5I1GH 2EDRA 3S34L 1N6QH 3QIBC 1A6WH 1SMAA 1FGNH 2CJUL 3O6FA 4WV1B 3SKOB 4M5ZH 4M6OL 4L4TE 3N85H 1DQJA 1RVFL 1IGTB 1J1OH 5JLZB 1H3PH 2ZPKH 2EIZB 4JQIH 3WHE1 1N0XL 1XF4A 2OK0H 3RU8L 2EYRB 3BKJH 2BY3A 1P7QD 5I74C 1OAYH 3RVWD 5GHWH 2FWOB 5I18L 3O2WL 4L8DB 4K8RC 5DK2A 5FOBA 1U6AH 4HWZB 4ZSOE 4BFEA 1TETL 3C5JA 1BFSA 3OQ3B 4GRLB 1OAQL 5HVHB 5LKNA 3L3IA 3MPCA 2ZOLB 5E9DB 1G6RH 2CK0H 4P5TC 3A6OA 2ICCA 4OLVH 4YBLC 4Z7QF 3CDGA 3V0AC 3QUYA 3DI2B 4K8RL 2Q8BL 3RBSA 1SYSA 4X9GA 5H94A 3C08L 3V79C 1LEIB 4N1HB 2KL6A 1I1CA 1EO8H 5CIPH 1YN6A 1RJZA 1N8ZA 3IRZA 4WI6A 5IFHH 3BPCA 4HBCH 3TCLA 4P59L 4TUJA 5FECA 2P4AB 4MMZC 5DURB 2G2RA 4JFXA 3GSRB 5CHNB 1X6NA 4IOSD 4NQEB 3X12B 2NY2B 5FYKH 5MENB 1HI6A 1PQZB 2ERJC 3PGFL 5LGHH 4MJIB 4CMMA 1ACZA 4S0SD 3CX5J 3MNVB 2BHUA 3LQZB 3HAEB 5F6IC 3STZB 2FEDC 1AO7E 2G9HB 5I8EB 3P2TA 1SY6L 4FXGB 5IJKA 1AD0A 3VFNA 4FTVD 5GRJH 5FXCH 3NGBC 1NCWL 4RGMB 3KPSD 5BCAA 4X98A 2GJ6A 2AV1A 3UDWC 3PP3H 1IC1A 2R8SH 2DWEB 2FSEA 3S8WA 3DTXA 4XX1G 3X3GH 4LVNB 2IFGA 1OCWH 4MJID 4F7CA 4YEFA 3UBXB 2ZCLL 3NAAH 3P4MA 5DS8A 1DL7L 1OGAE 1YZZA 2AK4D 2AJYH 1UADC 2EDYA 1UB6A 4M6MH 3VG0L 1NL0L 5EUOA 1ZANH 1E6OH 3GKWH 1EGJH 1PG7X 2PO6A 5J4MA 4HQQL 3MLRL 5GIRA 2NW3A 1EUTA 4LF3B 3L3GA 1ERNA 5ADPL 5DYOA 1T20A 2FX9L 4WFHD 1F3DJ 2JJUA 4MA1B 4XNUL 3QCUH 2YUVA 2X2YA 2I9LB 5D7SH 4EUPA 5DQJA 3GBML 2RIKA 1R3KA 4W68A 1OP3K 1J8KA 1RZGA 1GZQB 4JVPA 3WL9A 3JTTA 3PE9A 2R56L 4OTXH 3SE4A 1G9NL 4P3DA 1DR9A 1M71B 4XPGL 2M8XA 4LPVA 1FC2D 1CK0L 4MQ7A 3MLSH 2BOBA 4I3SH 1UM4H 2Y07L 2NXZB 3QT2A 5FO8B 1BJ1J 5AAWA 5HGHB 4KKBD 4JFYB 5FAAA 4TOYH 4LU5L 4L8BB 4WDIA 3S88L 3SGDH 5D96B 1N4XL 3B9VA 2X4NA 4WY7L 3BD5A 5DJ6A 3CLEH 2D3VA 4RDQF 3IGAB 5BW7A 5EUKA 1KIQA 4L5FL 2F5AL 1F4XH 1IAOB 1XIWD 2O5XH 3RWGB 5EORH 2VXSH 3G6DH 5HYSG 3MZGB 5EU6D 1IAIL 1JRHL 4H8WH 3BZEB 1R5VB 3TYGL 1FNAA 2D7TL 2DQFB 4CVXA 1WAAE 1ZT1A 4Z95H 3E6HA 1G0YR 3OR6B 5D1XC 2PCPB 4HK0B 4YGVB 3V7AE 2AEIT 2APVA 1W0VA 5F9OH 5GGRY 3NH7L 3VWKB 3PIQB 5C0JB 5DRNA 5FUOH 3X3FL 5HI5C 4UNTA 2C7UA 5DJXA 5TDOB 1EFXA 4G8GD 3MCG1 4KV5E 3BWUC 4LIQL 4XWOD 4ZFOB 2A1WL 5LGKA 1H3XA 4WO4B 3KWWA 4EI6A 3GJFA 1AQDB 4U1GC 1NAKH 4NO0B 5INDA 1MREH 4Z18A 3ZKSD 2BNRA 2IGFL 5FCUL 5E2VH 3HZMA 4O2CB 3IDNA 3C6SA 4N90D 2NYYD 1LVEA 5HPOA 4KRNA 2NY2D 1S8DA 4M5ZL 1D5ZB 1X7QB 4YDVB 2CRZA 4CNIA 4JO3L 4WEMB 2YRLA 1CGSH 4ZS6D 3C5ZD 3JXAA 2CKBA 2JK5A 5B38G 2R4SH 3LIZH 4RX4D 2EDKA 3RRQA 3QRGH 3TH3T 5I6XB 1KTDA 4IEFB 3OKDB 4PLJC 4G7VL 3TVMC 2VMFA 4LQFH 4OLYH 4OQTL 3VI3E 2GCYB 5IV2A 4DK6A 4NO0D 5I19H 5CEZH 3BEWB 4UDUB 4GSDH 1U92A 3PWNA 3VDCA 1LMKA 4J8RA 3F6IA 2NY1B 1IM3B 1TPXC 1G6RL 3EYVB 1QR4A 3FMGL 2NY6C 4JZNB 1EZVY 2C3WA 4XNZB 4XVJH 2V5YA 3C8KB 3C08H 2E27L 3OJ2C 5IIEA 3KYNA 3NZHH 4R4FL 2XQBL 4QXGH 1KC5H 4KHXL 3D0LA 4XP9L 5GS0C 3MLWH 3MRPB 2FZ3B 3HPLA 1XZ0A 3U36A 5CGMA 4HPOL 3VFSA 5DD6A 1VENA 5LG1A 3GJFK 4LNRA 5C09B 5C08D 3RKDC 1S7SB 1MPAL 3H9YA 1ZLSL 1KELL 1MFBL 1CDJA 4L9LB 4K2UL 3T8XB 3WBDA 3MLUH 4PB0L 3VXOA 4KJYB 2JJSA 1JGUL 4K8RD 5DDHB 2UVFA 5L6YH 4YFLF 2ICEA 3NFSL 3ZDZE 2BHYA 5CIPA 4LLMB 3KXFE 3Q48A 5E7FA 5IEHB 1GYAA 1BFVH 3MLVL 1HH6A 4NCDA 2QSTA 3DX8A 4NNPL 4JGUA 4TSBH 3QWRD 1OTTD 1IGJA 3L9RB 4JFZL 3C8DA 5ICYA 4AIZB 3IDJB 1NQBA 4WO4C 3HZKB 3UTSA 4ZNEE 4YHNB 3VA2C 2X4PA 1Q0XL 2XZAL 4N0UA 4MMXC 1MFCL 4HX1A 2W1NA 3W0WD 2OTWA 4S1QL 1JNJA 1PG7L 5GGRA 3RX5A 4HKBA 4DN3L 1KLUB 4PLNC 2W9DL 1ZHBA 1UJ3C 2YK1L 3FCTA 2AK1H 3B2UC 3LQAH 5HD8D 5DJDA 5BXFA 1ZANL 4PJ5A 1X5GA 4ZAKC 4TNWF 5DVMA 4LBEB 1BF8A 5BQ7A 5BZDB 3BGFC 1FIEA 1VSCA 4DW2L 2VITB 3RNQB 4DAGL 5ADPH 4G43B 4R96A 1SYVA 3B9KB 4X99B 3QULB 4LFHG 5EU7C 2NY5L 3QWOA 3QA3A 5D1ZB 4P2YA 5CBEA 4U1IB 1LP9F 2P5EE 5GS2H 5J56B 3GB7A 4LSSL 4ZQKB 3H3PH 5DWUL 2XWTB 1FO0A 3QNXB 3ARGA 4DZ8B 4M7ZC 3CZFB 2VLKD 5ALCL 1SJEB 2EDBA 1FDLH 2Y06H 3V0WL 3VWKD 1EXUA 4BJLA 4LHUA 4NC1C 4OFVA 3D0VA 1J88A 5J1TC 4P0DA 5I75B 1NGQL 1KLGB 2FJGA 2E7CA 4ELKB 1A7BA 4Z76B 3VFRA 1A4JB 4JFEE 2H32B 4KK8D 4DKDC 2R29H 3ME0A 3IU3B 2BOCA 3BUYA 5IWLC 2DQGL 1BZ7A 2SEBB 3MNWB 4Z0BH 4MJ4A 5C07E 1MI5B 4YFEA 2VLMD 3FB7B 1YECH 1P4BL 1TJHH 4MD4A 3S3PA 1FGNL 1AQKH 3BE1H 1YEJH 5IB5B 4XPTL 2V17L 3HC4H 3RUGF 1JMZA 2AI0L 4P5TB 2QQKL 4HIXL 5C0BB 4F3FA 4QRTB 1F4XL 2JB6B 3IFNH 4HUWA 3VFVB 1BWMA 5H35B 1RHFA 3BDBA 5L8LB 3O45A 2CUIA 2CGRL 5B8CC 2PYEA 4KK9C 3I02A 4JDZB 4GW4B 4LCWD 3BX7C 3LHPL 4MNGB 3DV4B 4KMTL 1B3JA 3JWNC 1CFSB 4XBPA 1FL5B 4IRZH 3IB4A 5IMMA 2F54E 5JHLH 4DN4H 4V2CB 4Z7UF 3T2NL 1A7PL 3NH7H 2HLFC 3ARZA 1OB1B 1KPVB 3C60B 1JIBA 1JWMB 3WJLA 5I8CB 4LIQE 3OKKB 3H7LA 2R1XA 2E6JA 2XXCB 2HA1A 3MRQB 1HHJA 4U49A 1UJ3B 4ZFGH 5J13C 5IQ9B 2XQYK 3PWPE 4OV6F 3SDAC 1L7IL 2VE6B 4PJ7F 4Z5RB 3PGFH 1ETZA 1OF2B 4H1LB 1OAUH 4WI8A 3ARWA 3UTTD 2VZOA 5E24E 4P3WA 2QBWA 1E4WL 1INDH 1GOHA 3FTGA 1MWAL 2HH0L 3VXMD 1TQBB 4G42B 1QSEA 3GBMH 1S7UB 3WDIA 4KPHH 4PV9B 3VXPA 3EZJB 3TBSB 4AT6B 3OKMB 4GXUN 2BSTB 4M7ZB 1WAAA 5FF6A 2ZG2A 1ULVA 1A6UH 4OCWH 3BRDA 2CO6B 3KXFD 3CFDA 4OUUA 1AHWB 1OGAB 3BO8A 4Y19D 4N5ED 4D0DB 4ZFOL 3KR3H 4YPGB 4XWOC 4UTBL 5C9JB 4PLOB 2O5ZH 1AD9B 4O58H 1YDPA 3VXMB 1U8JA 5CMAA 1T1XA 5JIIA 4NZTH 4AMKH 3L7FA 4HBQA 3ZSSA 3S34H 4JFOB 5EU6A 1YMHA 3A67L 4J23A 2ORBH 1DLHA 1E6OL 3GKWL 3OKLB 2ZNWA 1G0XA 1Z9OA 3GI9H 4HWBA 3MLRH 5E94B 1XF2B 5AAMA 4MNHB 4U3HA 1JGLL 1D5IL 3B2VH 3FB8A 4F7PA 1T4KA 3OR7B 5HDBE 1OGAD 4Y19B 4MA8L 1PEWA 1ZK9A 1BZQK 1T03L 1CFQA 2FYYA 1AO7B 4PJIB 1C5DA 4R7NA 3QCTH 1IQDA 5D1ZD 1UFUA 2EXYC 2IQ9H 3LKQA 3UPRB 1FFQA 3FB6B 2KBGA 1FFOA 4K7FA 1YNKH 4UNVA 3MLZL 4NNYB 4OLWL 4QHNA 3S5LA 1G7QA 3M1BB 3MCKB 1U8OB 3QYCA 2XNAA 3BKYL 1NDGA 1OL0A 5DVOA 1QYGL 5KSBB 1MJ8H 3WD5H 2X89A 4ZTOL 5IJKC 4JRXB 2EE3A 3L3OA 1CXKA 4BSJA 3QUXA 5A16A 1DQML 5J8OA 5JUEL 1NC4D 3CAFA 5I6XC 2KQNA 3AAZA 4NM8H 5C8JB 5JPNA 3SKNA 3TPUA 3UDWA 5IFHL 1RV6X 4CBPA 4PB9H 2YPLD 4Z0XB 5DJZA 4LHUD 4S2SB 4ODSH 1NGPH 5IJVA 3RVVD 1YEKH 1XAUA 1BMGA 5DJ2B 7CGTA 2CH8A 4RMQA 1MCFA 4TTDC 1W72A 4JZOA 5HSFA 15C8L 2H26B 4JN1L 5FYJH 4MS8D 5D1QC 3ULVH 4HIHA 5C0CE 1RZ7H 3TN0B 4PUBH 1I7RA 4I1NB 4BFIB 1N5AA 3BH8A 2D9CA 2FL5B 3LEVH 4LQFL 4OQTH 3T2PA 3VFUB 2YPLB 3NCYP 3BQUD 4X7TA 5F7WC 4FQLH 1MAJA 2GEEA 3TYFA 5MEQA 1CXEA 2V2XB 5CEZL 1FRGH 2R8SL 4PJ8A 5FDWA 1NBVL 2HJLA 3F7QA 3MCLH 1ADQH 2R23A 3UJTL 4RWYL 1AXIB 3CCHA 5T5NG 5I8KL 1WIPA 1W0WB 4EVNB 4U1NB 1VDGA 1J86A 3D85A 1XF5B 3TIEB 2JLLA 4LIQH 3OKNB 3BH9A 5ICZB 4OM1H 1CE6A 3ETBF 3S9DB 2P7TB 4P2RA 1DBAH 1QSZA 3O9WA 3SPVB 1IFHL 4KVCL 4Z7VF 1NAKL 4P2QE 4NKOA 3NPSB 1S7RB 1T22A 3W39A 4JFDA 4Z0BL 4RAUA 2QR0B 4JEGB 4ZUWB 1FAKT 3LKPA 1FYHB 2X4SA 5FO9B 5D6DC 1A4KB 4HUVB 5E1AB 3UYOD 3SKJL 3V5HB 1TVBB 2GITB 2IBBA 5BOZG 4PPTA 3I50L 2DYPA 3O0RL 3WKNA 3B8SA 3HI1B 3VCLB 3ZTNH 4G7VH 4NP4L 2W65B 4Q97A 3F12B 3OF6A 1JGUH 4Y16D 1R3JB 2FH6A 2X41A 4H20H 5ID0A 2DMCA 2CXKA 3CMGA 3FL7A 4XMPL 6FABL 2XZQH 1YEHH 5T1KD 4JZJB 3DLQR 1GHFL 1TJIL 2B2XL 1LD9B 4N0FA 5CLWA 2DIBA 1I4FA 1T2QH 5BVJB 5JW4N 4ORZC 4TQEL 1XH3B 4DGYL 1QRNA 4XVJL 3EYUH 3IKCA 3H2WA 5EU5A 2R39A 4TOYL 3SGEH 1JGVL 2WINA 4JFZH 5D1ZC 2HTKC 1K8IA 4ZFZB 3PDGA 3CD4A 3ZDXF 1XGRA 3PHQA 4Y16B 2Q8AH 1I1FA 3KPRA 1KJ2B 4O2FB 1TIUA 1FZMB 5FM4A 3GSNL 4FMKA 4HWUA 5J89A 1IGMH 2B1AH 1U8KB 1MHPH 3DVGA 1NMAH 4LLQA 4QEGA 1I8LA 4HW6A 3G6DL 5EG6C 2RR3A 3RWIA 3C6LD 2VDQH 1G7LA 4UIMA 1OAKL 5KSBF 4AK1A 1BD2E 2QTEA 2D7TH 5AZEL 1E4XI 3P40A 4L4VB 3HRZA 1HCFX 5EBMA 4XBGB 1NUGA 1B90A 5BZWB 2FO1A 4PRPD 2VXQH 4IS6B 5IB1A 1D7FA 3RJDA 2I9TB 4IDJL 1QLRB 5EU4A 4GMTL 1H5BA 5FUOL 1G0DA 3QO1B 5EO1A 5I0DA 3T77A 3VRJA 2Y7QA 1JPFB 4JGMA 4JFDD 5BRZA 3EFDL 2VUYA 3TZVA 3BT2H 2XOTA 3FQWA 1NDMB 3MBEB 2VIRB 4LLWA 1EEZB 1MFCH 3EO9L 2IALA 3RPIA 4LSQL 2P42B 1HILB 4Q58C 3FOLB 3RVXD 2W9DH 3QXDA 1OARL 3QQ3B 2HFGL 4JO4L 1MCOH 1FAIL 5F7FA 4YXKH 1I8IA 1WWCA 1BEYH 3V5DA 1FE8L 1I9EA 3QDGB 4X0KA 1UEMA 1RZKC 3CNKA 3LEXA 1RD6A 1OW0A 4JANA 4X5LA 5HDLA 3QRGL 3GMOA 5ABDE 3L7EA 4JJ5B 4AL8L 4ELMF 1IM9D 4L29A 5I1DB 1LEKA 3CFEA 1MRDH 1QBLL 3KYMB 3RL2B 2I27N 4KDWA 3LKRB 4NN7B 3B6SB 4ETQA 4Z7WB 4OF6A 2UYLA 4TUOB 3DIFB 5DTFB 3QPXL 3CFJB 4N90E 5T1DH 3MRCA 3IDUA 4R2GC 4XTRD 5I1IH 3MO1A 3WIFA 2A6KB 3Q3GA 4XP4L 5C0GB 4OAWA 1WC7B 4PJHE 4NBYB 4PD4J 5DMIH 4ERSL 1Q8MA 3IRPX 3O81A 1P4LA 3WO4B 2YPKB 1HSAB 5C6PB 3QXAA 5IBUB 1BBDL 1XEDA 3GSQB 4TSAL 3BIBX 3SOBL 1YEEH 1MI5D 4G8FB 3VXQA 1EH9A 3OKOA 3K3QA 4R7DB 1K6QL 2C4XA 2XKSA 3AY4C 1AFVL 3WDHA 3FQNB 4I5BA 4U33A 1OWWA 1MJUL 4G6FD 4NRZB 5E6ID 3BZFB 4NOFA 3UC0L 4PREB 4ZNCD 4QYOB 1BFOA 1X5YA 3GMLB 4WWKA 5KSAC 4LLAA 2EXYD 3QCVH 2ZOKA 1T21A 4NO5B 3C5SA 3RX8A 3AC0A 1MWAB 4MDJA 3MXVL 2V2TB 1HHIB 1ONQA 4WEUD 3TA3D 4EXKA 4WIQA 3SDAB 2I5YH 2CDEB 4OGAC 2DQIH 3BQUA 5DHVH 3SJVB 4GKNA 1AY1H 5A2LH 3LCYA 3DXAA 1ZLWK 3GUTA 3IJHB 2R4RH 3KHOA 4RMRA 2D4DA 3VW3L 1Y6NR 3MRJB 2LU7A 4FQQA 3PQYE 1IC4L 4YH6A 4HCRA 2YK1H 5D72H 1J12A 2R9HC 5TGBA 1AGCB 4YR6A 4BZ1H 3MRKA 2AEPH 4ONFH 3X14A 2H9GA 4QHLB 5C0AD 2FCBA 1WZMA 1JGLH 3B2VL 1OAUL 5IFAL 3PNWB 4KGJA 4N8VG 2DI8A 3ZYIA 5D70H 3O6FD 4WNQA 2BZDA 3D3VD 3QEQB 1I3GH 1QD0A 4PP2A 1YJDL 5F93C 5DJYB 3V6FA 5JOEA 4MAYB 4NQSB 2P24A 5FKPB 3CMOL 3DOSA 1IARB 1GHFH 1TJIH 4BFBD 5EOTA 3WE6B 1LEIA 1XIWC 5D7IA 1LP9A 5SWZD 3OJMB 3MRNB 1KB5L 2H1PH 4OGYL 5IBTL 5TDNB 2WMPA 3B9KC 2P46B 5D2NC 2XN9A 3H0TA 2V2WB 1BVLB 2WQ8A 4NQEA 5FA3A 3GBNL 1KFAL 4IRSB 5FUCE 1HWHB 1U93A 4PLKC 4YPJA 3QXWA 4APQB 3ROOB 2BSED 3NFPA 3SDYL 5GRXG 2CRYA 4Y4FD 1WVZA 1M05B 1NSNH 3LQZA 3STZA 1WEJH 1A6VH 2RHEA 2UWEA 4ODWB 4P99A 4NKIH 5HI5D 4LKXB 1NMAL 2QEJA 3V52H 1FZJB 1BGXL 1NLDL 2BVTA 5DQ9A 4YEEA 4DGIH 3DUUB 2EKSB 4HZLB 1G9MH 3L6FA 1OD7A 2VR9A 2DAVA 4NFDA 4E42A 5EH1A 1IM9B 2GJ6B 1YEDB 3CX5K 3CX2A 5T5FH 2V9RA 4GKSA 5KW9L 3WNOA 1JF5A 2ZSWA 5I30L 4M00A 1TTUA 5D7JA 2HP4A 5KN5B 3MUZ1 1V8HA 1I1RA 4YLQT 4F7CB 3G5VB 2CDFB 3MR9A 2EDDA 5HVWA 4BQ9A 3FJTA 4NYLA 3VJ6A 3VWKC 1XGQB 4ZPVB 3SBWA 4ZUUA 4PRIA 3WN5B 2VYRE 1DZBA 2EDOA 1VFAA 2VAAA 3FN9A 5T1KA 3IFLH 4XRCA 4PLJD 3REVB 2BNQE 2V9TA 4KROC 5D5MF 5GIRB 1RI8A 4BSVA 4RFNB 1HSBA 3V4UL 1NGPL 2A74B 2N4IA 2DQTH 8FABB 2BVUA 4HWEH 3QHFL 5D1XD 3P77A 3HFML 3EJYD 2ITDA 3LSOB 4GRMA 1W8NA 3MRBB 1HHHB 5F3HB 5D7LD 1GZQA 1U3HB 3MUJA 1BEYL 2P1YA 5F1IB 4OCSL 2D2OA 4JY5H 5D8JH 4D0BB 4G9FE 3UX9B 4XBEL 3HRPA 4OM0H 1HOCB 5SWQB 4F33B 4K7PY 1S7TB 4H20L 4RAVB 5IG7B 2R2HA 4WFGE 1FVDB 4LPUA 1NUFA 2APXA 1DBJH 5ACZA 1BREA 3S37L 3S4SA 1ADQL 2E7HA 4RWYH 3DUHA 3WDJA 3CK0L 1BZ9B 1F3JA 1IGYB 3PUCA 2NY6B 3O11B 4HWBL 2FX7L 3CSPA 5DEFA 1NAMB 4FG6C 3BYYA 1F3RB 3D48R 3MRLA 4GAGL 3V0VA 1Z3GL 2WBJD 4EUPG 2ARJA 2CD0A 3MLYH 3ALPA 4J6RH 3S36H 5E0QA 5T1LA 5EFIB 5E8OA 1S5HA 4TNWK 2OR9H 2APWA 2UWEF 3OR6A 1MCWM 3HC3L 5DR5H 4HK0A 3TVMB 5DFTA 3MBEC 1QEWA 3TWCH 1IQWH 3UZEA 1F2QA 5L2JB 4PJFA 1QRND 2FDBP 3MBXL 1X5AA 4LGRB 3RDTD 4MCYB 3I6KA 3VH8A 2LV4A 2F74B 2FJHB 2W59A 4ZFOA 4GMTH 4RMSA 5D1QA 2XTLA 3I3EA 4XTRC 4ZAKD 3WD5L 4U0QB 2VLRA 4N5EC 1KJ3L 1ZWIA 4NO0A 4U4BA 5DUPH 3QIUD 3O2VH 5DLML 2QSQA 2ADFH 4M7KH 4WCYH 2HVKA 5IROC 4O2CA 2D4FA 2VDKH 3QEQE 3ROLA 5L9DH 4PB9L 4YDIH 3VXUA 4KV5F 1RIHL 1X7QA 4YDVA 4CNIB 1WSST 3FONB 4OFDA 3TP4A 2DBJA 3P4LA 1DL7H 4S1DD 4IHOB 3WNPA 2CKBB 2JK5B 4NFBA 2NY0D 4EZMA 3TNMB 4JFHE 2J6EH 3O3AB 1T0NB 1KULA 5BVPH 5E6IC 3V8OA 1E0OB 4ZAKB 1D3CA 1QSED 2BC4A 4NQDE 1FVEB 1DTUA 3AS0A 3DURA 3JSSA 3QEUA 4L4VE 4JQIL 1WITA 4UBDD 4KK8C 2J7LA 4HGWB 3RU8H 2X1WL 4DOHB 1AXTL 3LVEA 1MRFL 4ZSOA 2WANA 2FIRT 3O2DL 3LN9A 4U1KA 1K5NB 4JZNA 1EHLL 3L3HB 5GGQH 1CT8A 4PGCA 5K9QG 3MV8E 4YFDB 4OI8A 3KPMB 4HC1H 4X4XA 1RZIB 4MJ5A 4AJ0A 4DTGL 5KSUB 2E7MA 1UXSB 2DLFH 4J1UB 2F53B 4XXCC 4U2ZA 4KK9D 2R1WA 4ZFFB 5E56A 4XC1L 3RZWA 3VXSB 1F8TH 2F54A 2Z93B 3BEVA 1P5UA 3QFJA 3O3DB 3VFSB 4BELD 1D5XB 1N4XH 2EE9A 5LCVH 4EJ1C 3NIGE 2HT2C 3NCBB 1CD8A 5FYJE 4M1GH 3LOWA 4EN3A 2W0LA 4D9LH 4QT5B 4KRPD 5LXGL 1AP2B 1TCMA 5EBLA 3Q0HA 1L6XA 3V6OE 2RFXB 1EAJA 1RUKH 1WZ1H 1F58L 5D7LB 3VXRB 1AFVH 1KG0B 2HLFD 4CW1A 3BGFB 1UH4A 2DOCA 1H3PL 1H8SA 4AH2A 1U95A 2X44D 3DX6A 3N0PB 4GG6E 2UY7A 3KPRD 1MCSA 4LLMA 3MOBL 4JQVC 4FXKB 4NHCH 1BAFL 1FG2B 1MRDL 1UACH 2HWZH 3HUJA 1DBKL 3TNNA 1QTYT 5JW4R 1Y0LB 5TE6H 3QFJE 4JG1H 4JFEA 32C2A 2ARWA 4WUKL 5ICYB 3MJ9L 4KRPB 5CBAA 1B6DA 3HZKA 4FA8A 3LKNB 4E0RB 1B2WH 1P4IL 1R3LA 3RWJA 2YN5A 5GGRB 3DGCR 2NY4C 5EC1B 4HKBB 4QXTB 1FNGB 1T3FB 4Z7VB 1TVHA 2GSGB 2F19H 5DJDB 5BXFB 4YWGH 2ZCHL 1AIFA 5F70A 2PKDA 3EDDA 4BKLB 3HZVB 5FM5M 1ZGLP 1KCSL 3THML 2PW1B 5IESH 4PRID 4G9DB 4Y5YB 1VERA 3QA3B 1J1XH 5T3ZL 3MOQA 3L5WA 2HVJA 3H9HB 5HJ3B 2WBJA 2QQNL 5CAYB 3B3IB 4G6FB 2OR8A 5IF0A 1RK0B 2YD4A 2PXYA 2QKIB 3DRTA 3PP4L 5B8CB 4RDQG 1BVKA 4MA3B 4OCXH 1LO4H 5D2NB 1G7PA 4XBEH 1CZ8L 1I3GL 3MXVH 4PRDA 4O9HH 3I2CH 3JWDC 4MNQE 5EULV 4JGJA 4KJPC 4LOUD 1IAKB 4HSQA 4KMLB 4L3ED 4K7PL 3X11A 4HUUA 4KY1L 2VR4A 4ELKA 1KPUA 3SE8H 2R2BA 2I5YL 1QSVA 5TPWL 1I1YB 1I3UA 3GO1H 4N0CD 2DQIL 3HPJB 3S37H 3SDAD 4CADB 3IU3A 4DVBA 2EE6A 2MHAA 3BUYB 4EIZC 5TFSL 3Q6GL 3BVNA 3SDXB 5EPMB 5D2LE 3RVUD 4MD4B 3BN9D 4GW5B 1RZJC 2P49B 4OF3A 1F4WH 1ZSDB 5C0BA 4OB5L 4F3FB 3AREA 3GMRA 2IH1A 3FFDB 5L8KB 1G1YA 4X7FC 1RFDH 1T2XA 1CVRA 4L3EB 3O45B 3IDMA 2VZTA 4GW1A 4KQ4L 4RX4A 3RGVB 1KXTB 2FJFA 4G6ML 4W6XB 4TRPH 2AEPL 3WKMH 1XIWB 5CGYC 5ENWA 4WHYH 1MNUH 5FK9B 4GBXA 3AS3A 3GSVB 2Q86B 3PQYD 2EIEA 3WN5C 3DROA 1H3TA 5F7LB 1BP3B 4YK4C 3O6FB 1WBXA 3SKOA 1EAPA 4YHIA 5F3BB 1QBLH 1L7TH 5HGAA 4APQC 2PW2A 2XACC 4PG2A 3Q1SH 3OKEA 3PL6C 5I30H 3HE6A 5I8CA 1E4XH 3HI5L 1Q1JL 4FFVD 2AQ2A 4MCZB 4WWKC 4KRPC 4XB7A 3G6JF 4OZHF 1MHCB 3ARBA 3VDAA 1Q94B 4POZD 2A83B 4RISH 1MLCA 1HXYA 4TTDD 3P73A 2NY3D 1U3HC 1UZ6F 4PJEF 4XNMB 4CN1A 4FQHA 4HWZA 2VDPL 1T04A 3P9MB 3WNNA 2P48B 1F90H 4GRLA 2R0KH 3MYZA 3FO1A 5JOFA 5C3TA 4DJMA 5E9DA 4HGMA 1O7VA 3BQUC 4H1LA 4PBVC 1GAFL 2IG2L 1Q9LA 4PS4L 4FZEH 4RMUA 4NQXB 4G42A 1S7UA 3VXRD 3DV6A 1NFIA 3WIIH 2HYMA 1QR1B 2IJ0C 3PWUB 5T33L 2P5WA 4XVTH 4PRNA 5INCB 4WWID 1CGSL 3QJHA 5JNYA 4GMSL 1CG9A 4JFXB 3HAEH 4X83A 5F7DA 3X12A 1A9BA 3DJ9A 4X9BA 1HI6B 1PQZA 2VB5A 5M95B 3KLSA 5SWSD 5I0ZA 4AENA 4CMMB 5FHBH 1IILE 4PTTB 1EHLH 3CSYB 2QSCH 1A5FH 4I8DA 3FB5A 5LBSL 4MQXC 1GGCH 2J6EA 4MA1C 3QISA 1J9CT 4NPYA 4PJDE 3B5HA 2VLJE 1J8HD 4H88H 3G5ZB 5DJAA 3ES6B 2CMRH 1I3RB 1R24A 4LCWB 4ZPTA 2FSEB 4DGVH 1WCQA 4RCAA 4MNHA 4F7PB 2P8MA 5H2BA 1CGTA 1LO3H 4K3EL 3RGVC 5DVKA 4JFQB 1P69B 1EV2E 1RJLA 3QQ4A 2RB8A 1IQDB 1DQDH 2VJXA 1AQKL 3I3BA 3BE1L 1WBZA 5D6CA 3VMNA 4J6RL 3S36L 5I1KL 4FTVA 4UQ2A 4GLRI 2YD1A 4Q7DA 2HLAB 3QCUL 2DM2A 5FFLA 4QHNB 1IEAB 4O51B 3O3EB 3S5LB 4MQTB 3MCKA 1FV1A 2J12B 3FO0H 3JTSB 4PB0H 3HMXA 5HVGB 1YYLL 5C0EB 5JPMA 1JI1A 4IOIA 1PZUB 1T20B 4HIEB 3V5KA 2E5EA 3UROR 5A16B 5LGJB 1V7ML 4JZJC 4LNVA 2VRAA 4EUPB 2X7LB 5IEKA 2GIYA 5I8OH 1JHLH 2B0SH 5CGYD 4I3SL 4Z77A 5DJZB 3V4VH 4KVNL 4C55A 2DQJH 4Q74A 3A0OA 3HI6H 4QRSA 1M71A 4NZDA 1TLKA 2EC9T 4K3DH 5ITFA 4P5KB 4GKOA 4PJ7E 5F88A 4BH8A 1RHHB 3CXDH 3QWRA 4GRWB 4Y19E 4BSWB 3QUYC 3L5HA 4XNQA 2NPLX 5DF0A 4ODUA 1DVFA 4P23A 4S10A 1A6VL 2W0KA 3KLHC 5A2IH 2OX5A 5K9OA 2K3TA 5D2LF 5L2KD 3O4LE 4U0RC 5IVXB 1VA9A 4OZFB 4CUCA 3PP3K 3VXME 3NN8A 4K23L 3MLUL 4EIGB 2D31B 4GBXD 3TVMD 1FFNB 1JNLL 2RBLA 3STLB 4X4ZA 3I2CL 4UOW0 1KCRL 1NCDL 4NGHH 1W0WA 1EBPA 4BK4A 1VFBA 3H3PL 5DWUH 3AS1A 3MRIB 3QNZA 4G8EA 1R5VA 4P3CL 3MLXH 4I77H 3TBYA 1ZT4B 2F8VA 3UYRL 2ZCKH 4G8IA 3QEHA 1ZT1B 4J3XA 4EDWL 3E6HB 4B53A 2ADGB 3GRWA 2NY4D 2VQ1B 4NKOB 4CU6A 1ZHNA 1PLGL 1MCCA 1LK3L 4JFFE 3U9PH 4Y2DC 5DQDL 4ZTPL 3QIUB 4C83B 4XVUD 3KAAA 4U1MA 5IB2B 3P0YL 1K85A 3GMPB 5CJOL 3A6BH 3MREA 1U8HA 1NBZB 3EW3B 3LZFH 2GITA 5TDOA 3D18B 2AK1L 2XA8H 3O6LL 2WUBH 2MSPA 3UTZA 1G7IB 4EI6B 2R69H 5GRZA 1CFBA 3L5XL 4MQXD 1R3JA 1N6UA 4O2EA 5D8JL 3EO0B 3FT2B 1R6VA 3GSUA 1FLRH 2ICES 3CPLA 4KUZH 3RI5F 1N7MH 4Y8DC 3PABB 4MXWL 4GG6B 3QCTL 1S8DB 3ILQC 1IKFH 3O6MH 1JK8A 5IHUL 4YJZL 4JR9L 3H9ZA 4K9EH 3MXWL 1X3DA 1DBJL 1VCAA 5GJSH 3P11H 3EGSB 1RJYB 3P9LB 4HS8L 4AIOA 2R2CA 3C60D 1KBGL 1ZGLA 1G7HB 1DUZB 1C7TA 2E3VA 4OIIH 1JV5B 4GQPH 4M9OA 3LS5H 1KJ2A 4OCNC 2ZZUT 4J8RB 1A1OA 3MRRB 4WO4D 1LDSA 1S9KC 4NN6C 1ORSB 4LLQB 4YZFE 4L1HA 1YEFH 4AM0B 2X40A 2F5BL 1FN4B 2ZUXA 4RBPH 1A47A 3MLYL 1V05A 4JHAH 1OTUD 3UO1L 1KN4H 3HCVB 3IXTA 3MV7A 5IROA 3B2UD 3ABZA 4OGAD 4HKZA 5JHDE 5GS0L 3MGAA 2YD6A 3C09B 4KQ3H 4JKLA 2J2ZA 1AJ7L 5E9DD 2Q7YA 3WFDL 4DKAA 5IB1B 1GCFA 2ESVA 5BW7C 3LRSB 3KPQB 2FZ3A 4JN1H 5KSAB 4PGDB 1F6LL 3D39A 1EJOL 2C3XA 4WHCA 2BY2A 1X5JA 5E6IA 2EZ0C 1G7MA 4NN7C 5TE6L 4LNRB 4WI9A 1S7SA 3QUYD 5JR1H 3DXAD 4KKLD 1BFVL 3MLVH 5DUML 3T2NH 2PTTB 4KKCC 3KPPA 5MP6H 5EIQA 1X5IA 3QZWA 4NQED 2AJVH 1INQB 2ICEB 3KYAA 2NY7H 1W0YT 5C7XL 3FOLA 1LEGB 3VD4A 4U6XA 3QQ3A 4OBRA 2QQLH 3UJJL 1BOGB 4XPBH 2Y5TA 1YY8B 4X9IA 1Z5LA 2G75B 3FFCA 2ZCHH 1CDGA 3IJYA 3S36X 3LEXB 4H26A 4KAQL 5E00A 3K2UL 2KZ1B 2ARJQ 3A67H 1ES0A 3GI9L 2BVEA 4LDOB 2X4RB 3E2HB 2Y36H 3OAUL 3B6SA 3RY6C 2VXTL 3AM8C 2AQ1A 4GXVL 3ARVA 1HQRB 3DIFA 4G7YL 5DTFA 3KPRE 2IEPA 3SKUD 3CSBA 4QRRE 4XCEA 5C08E 3EHBD 2P47B 1RU9L 3MYJA 3VDBA 1WC7A 2ED9A 2EKJA 1FNHA 4RIRA 3RNQA 2OL3A 4G43A 3SE8L 2AK4B 4LSVL 3QULA 5F89B 5E8DL 3RVTC 5F9JB 4FFZL 1CLYL 5SWSE 2AJZB 5FUCC 5JIKA 1N0LA 2XWTA 4XAWL 4UTBH 3GJEA 1JE6A 4G8FA 4CVZA 3CFKA 3U82B 4R7DA 5JORB 5EZLB 2OBGA 4X9FA 5C86A 4LHUB 2G60L 5CJBA 1ZA3B 5I1CL 3ILQD 3KYOB 5TH2A 3VXUE 1D9KB 2D7MA 3SY0B 4D9LL 5K59F 1GAFH 4HG4K 1RURL 4MB4A 4XMLH 4R0LB 2K7QA 4ODXB 3ZE0E 2ZOKB 1UB5A 1CDIA 2QQKH 4PJDF 4YDJB 5FA4B 3T0EE 1IGML 4XZUB 2IANA 1CLZH 5DUBA 1JNNL 1HYSD 5DZOA 3C60C 1A3LH 3K8MA 3HB3D 3BZDA 3FO2A 5I74B 4BUGA 5IB5A 1I85A 1OGTB 4PGJA 4E9LA 1T1ZA 3KG5A 2BVOB 3BQUB 5DEGB 1NGWB 2J4WH 3LKOA 2JIXB 2G5RA 3FAXA 4JKPL 4WHTA 1JUFB 1PG7W 3GUTB 5J13B 3MRFB 4IIQB 1NCTA 1OTUC 3MV8B 1A6TA 4UOJA 2JJSC 5KAQG 1QYGH 2YKLL 3D2UB 3WXVH 5FCSH 4AY0A 3GM0A 5LBSH 2VN4A 1M7XA 4MD0B 2DRUA 5GXBB 3TM6A 1CFSA 2NY3B 5IK3B 5C6TL 5DJ8A 1TQBC 2BXZA 2X4UA 2DLTA 5IGXH 3TEUA 5GZND 2VLJD 3T1WA 1T83A 3MRKB 3NPZB 4R90H 4ZD3H 1JZ2A 3UBXI 2R0WL 1DQJB 4H5SA 5EOQL 2FBJH 4FMFA 5SV4A 1N6QL 2CKBL 4JJHA 1FAIH 1GGIH 2FWOA 3BKML 3NTCL 4P5MA 4ONOA 3D69B 1KXVC 5CP7A 4OQTA 4NQTA 1RIVL 3RY5A 4K3JH 3SE4C 2X4OB 3GHEH 4N8CL 5TDPA 2R2EA 3EYSL 3OX8A 2YA1A 5D9SA 1RJCA 4I0PD 3OZ9H 4NZUL 1E4KC 4L3CA 5DD0H 3QUYB 4EDXA 3O3BB 5H94B 4A2LA 3R1GL 1UCBL 3O4LA 2DTMH 4PV9A 2DJSA 3BP7A 1IL1A 4MVBC 3TCLB 4Y4KA 5FECB 3ARGC 2IPKB 1Q9OA 3GSRA 1FC1A 3QDMA 4X6EA 1DN0B 1A3QA 1NGYA 4QTHA 4F7TB 4RFNC 3SGKC 4JN2A 2JKXA 3BO8B 4PR5A 3AXLA 2XZCH 3CXDL 5DQ9B 2F5BH 2IADA 4TSAH 3SOBH 1Q9WA 4YPGA 4I3RH 3FT3B 4UIKH 2G9HA 1A7QH 1QG3A 4PRIE 3T65B 1YN7B 2O61A 5GS0H 1AD0B 5DA0B 3VFNB 3ULUC 4MA8H 2NY1D 1CYGA 4D9RE 4JFOA 1HHKA 4LCWE 4S1RH 3RIFK 3FO0L 4PGZA 4FG6D 1YQVH 2X1XR 4ZPVA 3D9AL 4HV8A 3W9EB 4LOUC 2BNQA 1IC5L 4OCYL 2H2PD 2WUCH 1YEGL 3REVA 3INUH 4MGXA 2J8UA 5D2LA 3WUWB 3FB6A 5F7NC 2X70A 3WO3B 2R0ZL 4LPCA 1HSBB 2AJVL 3E1F1 5DHVB 4PJGB 3KNBB 2AKRB 3RVUC 8FABA 3CH8A 1QFWH 5GGUB 4Y7MA 2XNAB 5A2JH 4BA8A 5HYSB 4M7JH 1KB5A 5KZCB 4LF3A 3AU1B 4I4WA 4MAYD 3TJHD 2LU4A 3WJLC 1SJHB 5GGVL 4NFCA 1JGDB 2NNAA 4MQSB 1MQ8A 2JE8A 4X6BA 3AAZB 1RZGB 5CSZB 5SWQA 4F33A 2V7NA 5DFWH 3TBVA 1LP9E 2AERT 1A21A 3QFDA 3WHXA 4O4YH 3QIUC 1CU4L 1HCVA 2GTWA 1OM3L 4HCRL 2WP3O 5GZNC 3PDDA 1QBMH 4KUCD 1N5YH 2MNUA 3NPSC 1AKJD 5CZVL 3QNYA 3CFBB 3I6LE 3W0WB 4HKJB 3VE0A 3ZE0F 3MV8D 2UUDK 4XPFL 2NY0C 5GGSY 3CLFL 4P2OA 3QFJD 4EDWH 5E8DH 4QY8A 2VSDA 4JRXD 2L7JA 5E4IA 3VFUA 2FR4B 2AGJH 1X5XA 5DJ6B 4ZS6C 2IH3A 2ADJA 3NA4A 1XF3A 4F7MA 1S7XA 1KFAH 1EO8L 2R23B 3GSOA 2ZSVA 5LQBL 5F6HJ 4LCIH 1N3NA 1JPST 4HXAL 3IAPA 3V6OC 4F2MB 4P59H 3RTQB 3D85B 1XF5A 4HEPG 3TIEA 3BH9B 4MHHG 4YXKL 5ESQA 1CL7L 1RSFA 1MJUH 5EC2A 3LN4B 4PJCA 3I50H 2AVGA 4YHOH 1H3UA 4ZUWA 4K7PX 4P9MH 3DYOA 1I8MA 2H41A 5I18H 5J9PB 4RQQB 1NFDB 3JWOL 3MX0A 1QSFB 2HG5B 2C7UB 3NIDF 3FFCE 4ZOCA 5I1EH 4W70A 4C56E 1DLFH 2CDGB 3ROLB 3IETB 3F12A 1FORL 2QJDA 3C09C 5HHQB 5DHXB 3ARED 3IDXH 5K9KB 3HNVL 3E2HC 4HS6A 5C0BD 1J05A 3HNSL 4QXUL 4WEBH 3QUKB 1IT9L 1TZIA 3TNMA 3KS0J 1Q72H 2R4RL 2R1YA 3R8QA 4FQ2H 4HMEA 3S96B 1QA9B 4ZAKA 2BC4B 4YHPA 1R5WA 1FVEA 1V3JA 2EDJA 3U4BH 4NSKB 2BHZA 2FO4A 3IKCB 3N06B 4U1HB 4XH2B 5EU5B 3RVXC 2NTFA 3GIZL 1XGTA 3AMKA 5FCUH 3MGOA 2FHBA 2ADIB 4HG4J 4MD5B 4P49A 1CFNA 1CFVH 3QDHA 4Y8AA 5KJRH 4OLEA 1ZLVH 4X7DC 1XGRB 2ICWI 3BN9C 1K5NA 4UDTB 3P30L 4JM4H 3D3VB 3QEQD 3L3HA 4K3JL 2JCCB 3IDYB 2DI9A 1F4HA 1IM3A 2EXWD 4D9QE 1TVDA 5AZ2L 4XNYH 4DCQB 5JR1L 4WI3A 5IMLB 4XCCH 1MCLA 3ARXA 3IDIB 2BSRA 5HDOA 4YX2L 2ZCKL 4UT9H 5DFVC 4U6YB 1UKSA 3BEVB 3C2AL 4F7EA 3O3DA 4PJBF 3EFFB 4HH9A 4RFEA 1U58B 3JUZA 2VLRE 1VKXB 5DC9B 2Z9TA 1RZFL 3FMGH 2FECL 4QT5A 4APQD 1QACA 5D7LA 3L3DA 2NXYD 4AQOA 3VRJB 1U95B 2ESVD 1MCRA 2H45A 3KHQA 4XP9H 2XIDA 2GJZA 4R2GB 3BJ91 3VXOB 1FG2A 1RVFH 4N0CC 3T3ME 1IAMA 4OJFL 1RMFH 4TYUA 4OLUL 3MJGX 2EC8A 4FP8L 2WAHA 4MXVF 3FQTB 4Y1AE 4DZBA 1FJ1A 3VD9A 4QRPD 1D5BB 3WO4C 4YK4B 2C5DC 3BGMA 4PJHB 1DQTA 1OAXH 4E5XA 1RU9H 3QDGA 1S7QB 2XFXB 3LS4H 4QXTA 4JANB 1F3DH 1QKZH 4PFEA 4RRPG 4P46A 4UI2A 3L7EB 2Y72A 4JJ5A 4CJ1A 2VNCA 4YHNA 1S5IL 2OZ4H 2YA2A 3PWLB 4I2XE 5DD1H 1CGWA 1QBBA 5I75C 2ATPA 1URLA 3BD3A 4G6KH 4NQCB 5DMKA 4TUOA 4Y5YA 3S88H 2MPAH 4XX1E 4XVUC 1AO7D 2MWCA 3F7PC 5L9DL 3NA9L 3MO1B 4HMCA 3AS2A 4PRHA 3H9HA 3KPLA 4PJ7A 3TF7C 2VITA 2GUOB 5GZOC 3QWOB 4LARL 2HJFA 5D1ZA 1G7PB 3MJ6A 3G04B 3K74B 3V52L 4WTWA 3UC0H 3GB7B 1WFUA 4YAQA 1I75A 5C0CB 3GBLA 5D71L 2OMNA 2UUDH 1NGZA 4OGXL 3CZFA 3DRQA 3HUJF 4U6VL 1TQCB 5C2BL 5T5FL 1REIA 1X9QA 2MHAB 3EYOB 3PL6B 1KOAA 4EOWL 4N1CA 1I9IL 4QYOA 3RY6A 2WWKO 1BLNB 1BECA 3C9NB 4HC1L 4LKCA 5GGTH 1ZSDA 3AREB 2SEBA 3MNWA 4D9QD 4GLRH 3R4DA 2CIKA 1XCQB 1ONQB 1AKJA 3DX9B 2AGJL 4HT1L 1FIGH 4L3EA 1IMHC 2P43B 4GW1B 4YXHH 4U05A 1VEMA 1TZGH 3VRLE 3WNKA 2E27H 2Z8RA 4MAYC 3GSVA 4QRTA 2IPTL 3OSKA 3QUMA 4X5WB 3SKMA 2VLRD 4RSVA 5IOPA 3DROB 5HXMA 4LEOA 5EOCH 4GKZA 4YXLL 3I6LD 4YHIB 5DFVD 4HDIA 4MNGA 3DV4A 3UPAA 1FG9C 1FL5A 3HE6B 3PG2A 5D7SL 4B5EA 4YHOL 5IMMB 1RZ8B 1AGCA 3GK8L 1OQOA 4WI5A 3ARUA 3EYSH 2A83A 4ALAL 2K1MA 1HXYB 5JW3L 2AJ3A 5SWZE 4P2RE 4WFFD 3C60A 2DD8L 1IGFL 1JZ3A 3P9MA 3VRIA 3R1GH 1IEHA 3FO1B 1AHWC 3BIKA 1BBJA 2R1XB 2BCKB 4IM8A 4L8DA 4P48A 5F1OB 4NJAL 4XAWH 1MUJB 1FL6A 5DJCA 3O2VL 4Q0XL 1S9WB 1WZLA 1MY7A 3HE6D 1CCZA 2YBRB 3WLWC 2WM0A 1CTOA 3DV6B 4R3SB 4YWGL 5D7IB 3X13A 1ED3A 1ETZB 1OF2A 2P5WB 2F8XC 5INCA 2B1HH 5DXWA 3T0WA 4WJ5B 1LILA 5JXED 4PY8J 2XN9B 3H0TB 1E6JH 1SYSB 2AABH 2V2WA 4L5FH 1PFCA 2D7NA 1QSEB 4YNYB 5E4EC 1J1XL 1N8ZB 3DYMA 3BPCB 4JRYE 1G9ML 4NUJB 1KB9J 4DW2H 1ZAGA 2BNRD 3N1QC 3CFIC 4KDTC 2BVQB 2F15A 3AY4A 4HJJL 3DECA 3UJIL 2W60B 1FH5H 4KHTH 4OCLC 4C56A 1CZ8H 4WGVB 2OQJB 3VFPB 2GAZA 4LKXA 5MENA 4O9HL 4D0DA 3CUPB 3DNKA 5C0DB 1EO7A 3O2DH 2Z31A 4HZLA 2VDOH 3L6FB 1OSPL 3QAZB 2QLVB 2VDRH 1YDPB 1YEDA 2XN9D 2WIIA 1A1NB 4FXGA 4BYHA 3QR2A 3GMNA 2YPLE 1H8OA 3L7FB 2EEAA 3TA3A 4ODHH 3DUSB 3U0WL 1NAML 3QQ4B 2A9NH 2AV1B 5EU6E 4J3VA 2DWEA 1XF2A 4UQ2B 3FB8B 1I8KB 1RY7B 1QNZH 3GDBA 5FYLE 1BVZA 2AJSL 4Y4KC 4Y4FB 2YWYA 1NCBL 3O3EA 4AG4L 1A22B 1CIDA 4R7NB 3GSNB 1FV1B 4X6FB 1YEJL 4TN9A 2LE9A 4GRWF 5AD0B 2QHLA 2FLRT 1VGEL 2VDNL 3TBTA 3IAGC 1HYSC 1B0RB 5EB9A 1UB6B 1SJXA 1A7OH 1G7QB 3TN0C 2ITDB 2GFBB 3LSOA 1GGTA 3L1OL 1MRFH 1I9RH 3MBED 5FYJU 4Z77B 4JDVB 2MTPA 4LSSH 2YD5A 5KVDH 5DYOB 5DD0L 1UH2A 3NIDE 4GSDL 3HI5H 4ODVL 3F5WB 1T6WA 5ITFB 5LWYH 1MVFA 1WWBX 1S7TA 4XMKL 3R06A 5ISZA 5IG7A 4Y2DB 2OCFD 5IJVB 4FOMA 2A73A 4B41A 2F19L 2JB5L 3WNLA 5K9OB 5LQBH 1Z3GH 3MROB 5HI4D 5J06A 4I2XB 3BFOA 5IVXA 4N68A 1IGCL 5CD3B 2IG2H 1A6PA 4KKCD 4L8BA 5LVEA 1SJVA 5I71C 1AR2A 3SGJA 1EK3A 1QFOA 2YD3A 2X4NB 4XC3H 4KJQD 2EIBA 4X7TB 1KELH 1DEEB 2O5YL 4OLZL 4Y1AB 2J8UE 3TT1L 1BAFH 3LEYH 1UWGH 2WLZA 1ZT4A 3FAWA 3TWCL 4G8IB 2HWZL 4KI5C 3V7AG 5A3IC 1IAOA 3GFUA 5KVEL 4YHKH 1IC5H 3PV7A 5I1EL 1U3ZA 2OJEB 1NC2A 5C92A 3BZ4A 4GAJL 4X9HA 4S11A 2Z92B 2PYEE 5E08L 2YEZB 3MA9L 1CE6B 4U1MB 3M8OH 1T89A 3FFCD 4JAMA 5L2JA 1NBZA 1SEBA 3W39B 4QXUH 5H37H 4P57B 2F58H 4NKMA 3VGAC 3I6KB 3VH8B 3ARGD 3JWDH 1GXEA 1RZJH 2PCPA 3DARA 3EOTL 1YEIL 3TV3H 1OVZA 4OZFG 3VWKA 4NN6B 1JWSB 4CGTA 4XI5C 3SDCA 2X89D 5E1AA 1RUAL 2P5WD 5KVGH 5GZOD 3THMH 4PRHE 3EO0A 3FT2A 3GSUB 4RFOL 2YMXL 4GG6A 1G9EA 4A6YH 3J8F7 1WWAX 5AEAA 1AQDA 1F45A 3ZE1E 5DRWA 3ZLQC 4L8CB 2BNRB 4OLUH 4HXBL 2ZJSH 1LD9A 2D0FA 1WUNT 4FQIH 4MJ6A 3RGHA 5C09E 4C54A 5JMOC 2VH5H 1OAXL 4M61B 1QRNB 5CJXA 5TE7L 3ZKQD 1B9ZA 3QEUB 3RDTB 1CFTB 5GGTA 3TH4T 4Y4KD 2WINB 3CXHK 5TPWH 4EUPH 5EZJA 1L0QA 3MRRA 4ZXBB 1ORSA 1T2QL 2OLDA 5IV2B 5C0AB 4YHML 3SDDC 2GW5A 5TF0A 3D87B 3OB8A 2X6MA 5I9QC 4UNUA 1NBQA 4O58L 5JA9A 2XT1B 4FABL 3A6CL 2OM5A 3WFEL 2CUMA 5CP3A 1H15B 2X4QA 3RUGB 4N0UE 3W9DA 1UWXK 1P4BH 4J1UA 3FHQA 1CF8L 2ESVB 4WUUD 4R4ND 1WZ1L 2AP2A 4P2CG 2LTQB 4XBGA 4AQ1B 4R2GD 4OI7A 3MJ8A 4HS3B 4RA0C 5K59E 2NY4B 5HYIA 2AQ3A 2WZPD 5C07B 5A2FA 3FZUD 1YNTB 4HPYH 3OAYK 3ZL4H 2ENYA 4JPVH 1C16A 5AZEH 3QZWB 4LLDB 4P2QA 4F58H 5HI4C 1NANH 5IUSA 1JPFA 4C4KT 3DX7B 4JB9L 4U6XB 4DN4L 4FXKA 3SE3A 5DO2D 2E9IA 2JJTC 3S35L 4WUUB 3MBEA 3IJYB 1ZEAL 1YC8A 3HUJB 2BRQA 4HJGB 2C1OB 4WEBL 5ACMA 4HKXB 4ZG1A 3HC0B 3QXDB 4PJCF 1MCNA 3ZTJH 4NO2B 1BQLH 5IEHA 1P7QB 3NA9H 2CLVA 4I0PC 3VI3F 4UV7L 1D9KC 4C59B 4X7SH 4GT7A 3MODH 1T3FA 4NRYB 4M43L 3U2SB 1HQRA 4L29B 4B0MM 2CJUH 1LEKB 4WI7A 2R0LH 3WIIL 3RWDA 5EBWA 4HLZG 1FP5A 1CICA 3LKRA 4ETQB 1TITA 1VADA 1ZHBB 3FCTB 1V3MA 5EO0A 1VB9A 3CFJA 4MA7L 43C9B 4LBEA 1I9RL 2OI9C 2A6KA 3QUZA 4XI5D 2DWDA 5HYJE 4OAWB 5KVDL 4TVPD 5IHUH 1JHTA 4YUEH 3K7UA 2P45B 1SYVB 4IRJA 2PXYB 4QRRA 3B9KA 3QPQC 1GPOH 1J0JA 1S9VB 4G9FA 4FFVC 5DI8A 2DQHL 1TENA 5JORA 43CAB 5CBEB 4KZEL 4U1IA 1RULL 2Q3AA 5GGTL 4NQUA 12E8H 4PRDB 1TXKA 4POZC 4S0TD 1ZA3A 3KYOA 4ZS7H 5TH2B 1U3HD 2PUQT 5DRXA 4ZQKA 1A7RL 4HUUB 3ARGB 2DQJL 3EJZD 1S3KH 2UZIL 4ZOBA 3IDYC 3O6FC 3TCXA 3W81A 1PSKH 1UGNA 2B4CC 4OB5H 2JB5H 4PJGE 4NZTL 4WU5A 1GJIA 3ZMRA 3UTTE 5IM7A 1YEFL 2HFEB 3NIFF 1BBDH 1YMMB 4HBCL 4ONHA 2H2PC 3BMVA 1AGBB 1BFOB 4WWKB 3KPSB 4ESKA 4F37K 3GSXB 4FQ1H 2PXYD 2ZG3A 2H32A 3QI9A 4C56D 1F6AB 4MDJB 1FFPB 1NGWA 2IBZX 4WW2F 4U6HA 4DVRL 1FBIL 3TPKA 2BNRE 35C8H 1L9MA 2CDEA 1KB9K 1LO0H 2J8OA 4LAQL 3BKCH 2DBLH 3BAEH 4PLKD 1SQ2N 2H3NB 3MLZH 3MOAL 2JB6A 5IMOA 5H35A 4WW2A 3MJ9A 1VEPA 4XCFL 3RNKB 5CCKL 2D7QA 5I15L 3S3SA 4JDZA 5ADOH 4GW4A 2WW8A 5B21A 4B50A 3IT8D 4MDIB 3UTPE 3ISWA 1DQMH 2UWEE 5HHNB 1GSMA 3X3GL 4QO1A 3U9PL 2QQLL 1MF2L 4JFED 3KGRA 5K9JH 1MHCA 2IC2A 2JJWA 1YPZE 1WICA 4P5MB 4G6AC 2VOTA 5J0BA 1OB1A 4X7CC 4F8TA 4D0CB 2AJYL 5HYQA 3FN0L 2EO9A 1JYNA 4M1DH 4K71B 5GRWA 3K4DA 5TDPB 3QEQA 2R2EB 4BZ1L 4PP2B 1JF1A 4A6YL 4DKFH 1P1ZB 5DMGD 1VGEH 4HQQH 4ZMAT 1ND0B 1J1OL 1XGPB 7FABH 4I18A 4FFYL 1Q9LB 5GGVY 3Q5OA 4Z7WF 1WLHA 4OBSA 4E41D 3G5XB 5A3ID 1IGIH 1NFIB 1YJDH 2Q6WA 1KPRA 3PWUA 4NGHL 4OZIA 4K9EC 1I9IH 4XCNB 4PJFE 4NQEE 4OF8A 5TDNA 5TE7H 3TJHC 3ZHLA 2DN7A 4LEXH 2BJML 5FOJA 1CG9B 2CR3A 3GKZA 4A2MA 1GVIA 2JTDA 1DN0A 5FKAB 4ODVH 1NBVH 2ATKB 3EJYC 4G5ZH 4RMVA 1QO3A 4URTB 4HS8H 1KCVH 4WTXA 1U8MA 1YPZB 3AXLB 4AENB 1KYOK 5FF6B 4PTTA 1MFDL 3FT3A 3MRMB 2UWEB 3S98A 3G6JA 1AHWA 3VFWA 5SX4I 1FZJA 4RGOL 4HUNB 4PJAA 3FO9A 4FZ8H 5HDQH 1OARH 3EYQC 4NPYB 3EDEA 1G9NC 3QPQD 1IM9A 1HDMA 3VXMA 1JWUB 2P8LB 1BIIA 1MIML 3AREC 3KLHD 1DQQA 4GKSB 4PJCE 4HV8B 3W9EA 1A7NL 1N0XH 4NJ9H 4G8GB 1P2CB 3PHSA 4H8WL 1IAIH 1JRHH 3G5VA 3K1DA 1MCIA 1I9JH 3MR9B 4MS8C 4ODBD 4CN4A 2VLJB 1IC7L 4GBXC 4K07A 3O6ML 2GI7A 1SY6H 4QF1A 4ZUUB 3TO4B 5DHVA 4JO1H 5TQ2H 3JZ7A 1BQSA 3C2SA 3GGWB 4OFYA 4HC1A 1CFQB 4GAJH 4LGSB 3Q2CA 3SHSA 3LB6C 5E2TL 3MA9H 1UM6L 1WQVT 4U6TA 4BSVB 4GUPA 1KENL 3AU1A 1P84K 4I4WB 4AEEA 4UMGA 3V5KB 5JOPD 5CWSB 5JO5A 4Y2DD 1KCUH 4XPBL 2NNAB 4BZ2H 3P77B 4IRJD 3EIFA 5I17B 2EE2A 1UCTA 5CSZA 2Y1VA 1EVTC 1U3HA 2J88L 2WQRA 5FM8A 4JO2L 1P6AB 3TFKC 4Z78A 3L3OB 2X42A 1IGCH 2P5EA 5HI3C 1MREL 4TNVK 3MODL 3I9GH 3FHAA 3RIAK 1EHAA 1K6QH 3U7YL 2M2DA 5JIPA 4RFOH 5JMRA 1MHPL 4YHLH 1OSZA 1EGJL 1GGIL 3BKMH 4CRPA 5HGDB 3U48A 3IJSB 2EO1A 3ARFC 4XNQB 1KF9B 3VFGH 3ARRA 4OCSH 1FVDA 1DSFL 3ZKMD 5D70L 2MOVA 4LL9A 4QOKB 4P2OB 1JNLH 4QY8B 4JRYB 1H3WM 1BM3L 4OZGE 1NMBL 1IGYA 5K93A 5I1AB 4WI2A 3O11A 4S1DC 1UM5H 5DEFB 4I77L 3NN8B 5HHOA 1GPOL 3REWB 1XF3B 1JNHB 4M8QB 1FFNA 5C0RL 3STLA 3MLPA 4FRWA 4F2MA 3PWPA 2OMBA 1XGYL 4O5LL 4G8EB 1SM3H 1XF1A 5CJQH 1CR9H 1D5MA 5ESQB 1CDUA 1PSKL 2HTKD 3GM8A 1D9KD 1RUAH 5L2KE 2VQ1A 5GS1C 2Q76A 3LN5A 4R4FH 3NACH 2V9QA 4AG4H 3W5NA 4X6DE 3HKFA 4J7RA 4NBZB 3TVMA 1LE9A 2YC1A 3RI5K 2XPGB 4ZDHB 4L3EE 4P2RB 3O9WB 4ZXBC 3SPVA 2A6DB 5L0QB 1QSFA 1TMCB 3NCJL 3WXWH 2GSIA 2HN7B 1X5HA 2QR0A 3D18A 1A7OL 3H3BC 3F7RA 1F00I 1YPZF 1IVLA 5BO1L 35C8L 5KTEH 1G7IA 2BNUB 2VH5L 4HUVA 1A8JH 5K9KA 4F58L 5F1NA 1ZWIB 5L6YL 1BF2A 1UZ6E 4PJEE 2HT4C 1CI5A 3AMLA 4ENEC 4OCYH 3UTOA 1TZIB 1O0VA 5IVXF 3J7HA 4TULL 2VL5B 4W4NA 1YUHB 3GJFH 1ZKAA 2Y07H 4YHPB 3FONA 4OIIL 1R5WB 5CP3H 3KJ6H 3U79A 4BUHA 3LS5L 1ROWA 4JZJA 2XRAH 1MCDA 5DGRA 2NTFB 5DD3L 4OKVB 3RJQB 4L8SA 5DC4B 3O3AA 3WS3B 2VDKL 1T89C 1HN1A 2J5LB 4H25A 2ICWJ 3GRWL 4CN6A 3U4EB 3HMXL 1RUMH 4JHAL 5FB8B 5LJYH 2PXYC 5MERA 3OHXA 2VLKB 5EO9A 4HGWA 1AE6L 1JF6A 1R3HA 3DVIA 1A1OB 4LRNL 2O5XL 1AXSB 3OGCA 2E9JA 3BJLA 1OQXA 3ELAT 1ZHLA 3VD5A 1H8NA 3IDIA 1PYWA 5DD5L 2BSRB 5BJTA 4I0PB 4HCRH 1NUNB 4ORGA 1RZIA 1CGYA 3KYKH 3RWIB 2M1KA 2Q7YB 1LDPH 5HI3D 2V5MA 2CRMA 2ICWB 1FSKB 1J0ZA 2R1WB 4ZFFA 2NR6C 2Q20A 4Y4HA 2AS5M 4L4VA 4PGDA 2Z4QA 2DLEA 3HRZB 4AEHH 2EDNA 1D5XA 2LVCA 2X1OA 1I7ZB 4HIIB 3WYRA 4EN3B 1NGQH 4QHUB 2HFFB 1V3KA 3ZKMC 3ULVD 3WCYA 2UZIH 3VW3H 1CD9B 4UAOB 1UKTA 2C3GA 3G5YB 4NT6A 1ZT7A 3T77B 4J12A 2Y7QB 3RAJH 4UT6H 2DL2A 1MQKH 3E6FB 3UPCA 3U30C 4ZUSA 4F15C 5DMGC 3BGMB 3EAKA 4JO3H 4HIXH 2DJUA 2HKHL 3IS1X 2XFXA 3KPNA 1Y0LA 4JHWH 4XNUH 2GK0B 3T3MF 4ODTH 2K9UA 2P5ED 3HE6C 1C1EH 2DQEH 5KSAD 2QADD 3H6JA 3SE9L 1L4IA 1Y18B 4PJXE 4I9WD 5L88H 1JCKA 2F53E 1G6RA 4X0KB 1E28A 1PEZA 3BN3B 4HWNA 2ATPB 1JTTA 4YUEL 5FIEA 2HT3D 1HQ4A 3OXSA 4R0LC 1OP3H 4Q6YA 4YHZL 3QJFB 5F9DC 5B3JE 3I84A 4XCEB 3V9FA 3KYMA 2VISB 2BRRL 4P9HC 3RL2A 2VXVL 3KPLB 4PJ7B 1A7RH 4HWBH 4P46D 5DUPL 4Z7WA 1S3KL 3IYLW 3VXSE 1T7WA 4M7KL 3P4OA 1MFEH 1HH9B 2X1PA 4LLUA 5HHOD 3UTQB 3WIFB 5HJ3A 5GGSA 1CF8H 4DN3H 4IIQC 3GJEB 5DHYA 1KEGL 1JMXA 4DEPC 4WWKD 1KN2H 5BV7H 1A9EA 4PRHD 1A0QH 1HSAA 5E4EB 4LCUA 4ZO7A 2NY3C 2YPVH 3NFNA 1D9KA 3ZL4L 4D2NA 1JPSL 3EKCA 3VFGL 1XGUA 3H9SB 1KPUB 2R2BB 2CIIB 3V95A 3MGTA 3QH3B 1N64H 4G6JH 1LO0L 4LAQH 4LKCB 2Y6SD 4DVBB 1QHOA 4X6CF 5T5NF 4LRIC 3IU4H 5E8NB 1CICC 5FM5O 1FSKC 2IQAA 2MJWA 4KY1H 4WUUE 4GW5A 1J8HA 2DDQL 4LPXA 1T21B 1OGTA 4NO5A 4LSTH 5L8JB 4JPIB 1NLBL 4GH7B 3C5SB 4M62L 4D3CH 4NKDA 5TJWK 3GMRB 2IH1B 3LKOB 4QRQA 4G80B 2JIXA 1HHIA 4OZGB 4MVBD 2DLFL 4JM2F 1BQLL 3IDMB 3SDDD 4IRJC 4QCIB 5KS9F 3RGVA 2NX5E 3MV8A 1LNUB 3SDAA 2GTZB 4HDIB 3H42H 4GBXB 2Q86A 2EDXA 4YDLC 1Z2KA 3SJVA 4MD0A 5E8EA 3G08B 5SX4H 2DQGH 3RTQD 4PGBA 4NDMB 3FRUA 4Y4FC 3FQXB 2DJ4A 2X4UB 4NKQB 4OLXH 4KQ4H 3SDXF 2ORBL 3MRGA 5HGAB 3GIVA 1QSFE 2PW2B 1B6UA 5ESVA 1JZ5A 4UINH 4YGAB 3MOBH 4YR6B 3OJDB 1NC4B 3PWVB 5KOVC 3BIKB 4I0CC 2AEWA 2IQ9L 1JN6B 1S9XB 2BCKA 1MLCB 2OL3L 5E1HB 3N1PC 3D69A 1C08B 1S7VA 2JIXD 4W6WB 3U0TA 4LEXL 4K55A 4LASH 4JREC 3JWOC 2X4OA 2DQHH 4HLZH 2A77H 1JI2A 1H9VA 4OD1H 5JOFB 3D2UD 5IMKB 1NGXA 1U8PA 3V6FB 3WS6C 1A6AB 1CD1B 4NQSA 3IDXL 3U46A 1YA5A 1P7HL 1AGEA 1F4YL 2HKFL 1MFDH 1S9YA 1YNLL 5D7IF 5EOTB 4NQXA 4YNYA 5FV2A 3N1FC 3TN0D 3TO4C 1T5WA 3MRNA 3D6GA 1KC5L 4KK5C 5DEZA 4NUJA 1W8OA 4OZIF 4ODSL 2BVQA 1L0XA 5CEZD 3TC9A 1CL7H 5F7DB 2W60A 1L7IH 4QTHB 2OP4H 4F7TA 3WIHL 1FGVH 2AXFB 2IPUG 3CUPA 2FATH 2IADB 1PKQB 4P9ML 1H3VA 3PP4H 4N9GB 2NZ9D 4BQ6A 4WGWB 3TO2B 3FB5B 1PZ5A 5C2UB 2KPNA 3QB7C 5FDYA 5D7KD 4U3XA 1YN7A 2O61B 5C2BH 1T5XB 3MFFA 1IZJA 4J3SA 5ECJE 1FYTB 5LAXA 2A9ML 1FNFA 3DUUA 5EDXA 5CCKH 1HHKB 4E42B 1EUUA 3IVKA 4I18C 2A6IB 1WBYB 3QDME 4ZUTB 4M93B 1ZLUK 4WTZG 4TSBL 1I8KA 5IW3A 1DUYA 5E2WH 5TFSH 1T6VN 3FQUB 2EC9U 3VGBA 5DMJB 1NEUA 3KR3L 1RJLB 1DFBL 3GSNA 4X6FA 2H32H 5HYFA 5D2LB 3WUWA 4X80H 4IOFC 1RIHH 3G6AB 4CL7A 4JG0L 1IFHH 4KVCH 3TBTB 1BJ1H 4DQOL 2VKWA 1OTSC 4ZFGL 5MENE 5T1KB 4U7KA 1R3IH 2AKRA 1RFDL 5E7BA 1CICD 4K3GA 1IEAA 4O51A 2CPCA 3K2MC 3KJ4C 1MQKL 2X1QA 5F7EH 5HDBF 3T04D 3DO7B 5I71B 5EOCL 5KS9A 1G7JB 2MQCA 5C0EA 2ITCA 2KDGA 3ILPB 4QRRD 3VFOA 5CSGA 2HTLD 4JHWL 4D8PA 1EX0A 5EU7E 1MWAH 4QRPB 5FO7B 3KDMB 4GRMB 3CU7A 4Z7UE 1JZ6A 3T08A 1ZHKB 1T2JA 4QOKD 1V7NL 4MHHI 5EA0L 1PD6A 4JRYD 5ESAB 2RJMA 4OLWH 5C0FB 1VHPA 3E8UL 3RDTC 3OJVC 2VDML 4P9HL 2LAGB 3RWHB 3CLFH 5BS0A 1X5LA 3O9WC 1WF5A 4YFLI 4P5KA 4G3YH 1CIUA 3Q6GH 4BH7A 1LGVA 4NQCD 5EWIH 4RAVA 5ETUA 3CFBA 3W0WA 4NQVA 3VGAB 2FB4H 4M03A 2OZ4A 4PJIF 4KJWD 4XP5L 3BDYL 2FHCA 4OIBA 1CQYA 4H1LG 4YE4L 5ACZB 5D6DA 1KXQE 2G5BB 4XWGL 5KZCD 3GRWH 2KH2B 4OZFA 5DO2C 1ZXQA 5FGBA 4M6NH 4WU7A 3KPOB 4R4BA 1E6JL 1FZOA 2AABL 4Z7OF 1T7XA 2J1KA 2VC2H 3SDCD 5EU3B 1OP9A 5B4MC 5E6YA 3GSOB 2VQTA 5T33H 1T03H 2OJEA 1VFBB 2IANE 2ARJB 2MQ0A 1T1YB 3E0GA 3MV01 3TH2T 3TBYB 3ULVL 4LCCA 5EFIA 1G6VK 1YNKL 5TQ2L 4ZYKA 2IFFH 5EC2B 1ZHNB 3LEVL 5E95B 5KAQF 2EEBA 3F62A 4KDVA 4PTUA 5MI0B 4P4RB 5IB2A 4R4NC 1QEWB 5J9PA 4ZTOH 4HZAA 1NFDA 3SDCB 1U8HB 1EDQA 1J0HA 3BGAA 3WLBB 3EO1A 4MCYA 5D7JD 1LK3H 3RQ3A 1CL7I 3EFDH 5I9QB 2F74A 1J11A 2MPAL 4ODHL 1ZS8A 3T3PF 1U8IA 2E9WA 3BT2L 4FQ2L 4M5YH 2A9NL 3IETA 4EQ3A 1I8LC 2VLRB 3DMMA 4MX7A 3UTTA 4DGVL 1T1WA 2EZ0D 5DRWB 1INEH 1CGVA 5CKGA 1T7YA 3QUKA 4GOSA 4LARH 3STBA 4AEIL 4K3EH 3CPLB 2ED7A 3PABA 4KKLC 1SBSH 2R1YB 4JQXC 4LRNH 5I1KH 2R69L 4J3WA 1CXFA 3OV6A 4NSKA 4OGXH 2ZPKL 5GPRA 4FQCH 4UB0H 3P0VL 1AC0A 1MLBB 1SVZA 3BMWA 3GK8H 3T0BA 1KYOJ 4KPHL 1T0NA 3ZTNL 4X7EC 4NP4H 3PXJA 2Y6SC 4MD5A 3VGFA 1CFNB 3HR6A 1BM3H 4ZXBA 1ZGLB 2DF3A 4B7LA 1DUZA 5KG9A 1C5BH 4OZHB 3SCMA 4U1JA 3U30B 4YX2H 2DM7A 2JCCA 2VLLA 1M4KA 4PYGA 3FT4B 1DN2A 4Z6AT 5I1IL 5ERWA 2DQDH 5C0ND 4M7LL 5I1LB 1KBGH 1MFNA 1FIGL 1Q9KA 2HTLC 5GJTL 4Q0XH 3HCVA 1Z9LA 2UZYB 1NBYB 1JGVH 2EYSA 1F4AA 3NCCB 1F4WL 4X4XB 4QGYA 4HKZB 5AG9A 3RWFA 3O6KL 3QXUA 2BY1A 4EI5D 5ICXB 3NACL 3EHBC 1UXSA 1CQKA 1GIGH 1YJDC 1YNTA 4XNXH 3D39E 3O8XA 2OJZH 3VXSA 2J8UF 1I85C 3D39B 3UYPA 1EZVX 3AB0B 3L3DB 3O0RH 3ARFD 3S6CA 3V4PH 3WHE0 1BPVA 2PTTA 3LEYL 5T3ZE 4G6JL 3MV9A 4CW1B 3RZCD 1EJOH 3DWTA 1U9KA 1LEGA 3HC0A 4JPWH 3UTPD 3L3KA 2I25N 4DEPB 3P4NA 5E08H 3CH1B 2VZSA 5EZIL 3Q6FB 4PJHA 4E5XB 5EIVA 1UXWB 2D9QB 4KTDL 3K80A 3EYUL 3CC5B 5CEXA 3IDGB 2F58L 1P53A 4P46B 3U0WH 3U2SA 2DM3A 3LKSA 3MV7E 3BW9B 1ES0B 3RWDB 3BRGC 3P0YH 5MHSE 1R3LB 5BS0D 3H42L 3RWJB 3PWLA 1U8LA 4F9LA 1RUML 2Q8AL 4WVRA 1TVHB 5DMKB 1YC7A 2GSGA 1OOAA 2AV7B 4NZRH 3PGCB 1C5CL 5K33A 4KZDH 3D1MC 3W82A 1AIFB 4PRHB 3QUZB 2XI9A 3L5XH 5IHBA 2DWDB 3T4YA 5TF1L 2APBA 2PW1A 1B4JH 4G9DA 4KGLA 1KIRB 3OG4B 1S9VA 4G9FB 1NUDA 2L7UA 4U6VH 4X8JB 43CAA 3QO0A 2IAND 3G04A 1VESA 2J5LC 2C26A 4NQCE 5GHWL 1L0YA 3L5WB 1DBBL 1KCRH 1NCDH 1KT2A 2AJZA 4FQLL 5IF0B 1RK0A 5DSCB 3MV9E 3DRTB 1NGZB 2C3HA 5I66A 4LSTL 5GS3A 2A6JA 1HK6A 5T1DL 2L4OA 4D3CL 1GGCL 4PV8B 5IB4B 1P7KB 4EI5A 1UA6H 5IM7B 2W0FA 4KKAD 1KB5H 2H1PL 4OGYH 5EN2A 4YHMH 2YUXA 4R0LA 1MY5A 3KPSA 2HKFH 3GSXA 3ULSB 4P4KC 3EO9H 3HPJA 1F6AA 1ZTXL 2IANB 1KACB 5C71A 3BVNB 3MV11 4Z7UA 3MMEA 4A6YA 1AKJB 4WY7H 3HLAA 1KJ2H 1E27B 3LB6D 5B3NA 1KN4L 2VZ3A 5E5MB 2W38A 5GSRA 5DEGA 1S7WB 2H3NA 4JM2B 4KQ3L 4M4RA 4LMQI 3SKMB 5C0CD 4WHTB 3RNKA 1JUFA 5EUOE 1JYWA 3TGXA 5J1SC 2I26N 5DA4A 4IIQA 4UAOC 4ALAH 1XIWA 3QSKB 1IKFL 4MDIA 1NPUA 4QRUB 5IK3A 5HHNA 4L1DA 5DJ8B 4JVWA 1I1AB 1N2RB 1TNNA 4X5XB 1WV7T 3N50A 1JHLL 1WBXB 1N26A 4L3AA 2CK0L 8CGTA 5DC0A 3OKEB 5ALBL 2AJ3B 1ITBB 3S7GA 5EIIB 4D0CA 3WUZA 2V7HB 3QXVA 3UJJH 1Q94A 1MIEL 3HMWH 1JF1B 1EO5A 2H8PA 3F6LA 1J0YA 3P73B 1WAAF 3NZ8A 4HLJA 4XNMA 3RFZC 4FQHB 5DRZA 3EOAB 3Q5YA 1XGPA 3UO1H 3K2UH 3QAZC 1KEGH 3C6LA 1S9WA 4OFIA 4OD3H 4JY6B 4AEIH 1KUMA 1Z9SA 1I1AD 4PJ9C 3G5XA 5F7EL 5B4MD 2OP4L 1SBSL 2YHGA 3D39D 3OX8B 4UU9A 5D9SB 5HVFB 2EIDA 4XC3L 5FYLL 4WFFE 3X13B 4NQDA 4JCMA 5IFAH 1DDHB 3ARFB 2O5YH 4Q2ZA 5C0IB 1WWWX 1ORQA 3O3BA 3DYPA 1BQHG 2QADC 5FKAA 3O4LB 2ATKA 4PJFF 5E99H 1QR1A 4MSWB 1XMWA 2ZG1A 5JTWA 3WIHA 5TE4L 3OZ9L 4NZUH 1YPZA 4Y4KB 4MLIA 4IDJH 2HT3C 4UV4H 1FYTD 5DUMH 3CXHJ 1NLBH 3MRMA 3QDMB 4X6EB 3QDJD 4ZXBD 5J6GA 1BIHA 4C56B 3HE7B 1J87A 4GRWE 2OQJA 1EMTL 4OGZA 2I24N 2NY7L 4PR5B 5C7XH 4PJAB 3CK0H 4OSUH 3KPTA 2ZWLT 3GMQB 1DBML 2Z31B 5IBTH 3ULVF 2GY5A 3OPZH 5I73C 1CLOL 4Q9RL 5E5RB 3UMTA 3FRPA 2YRZA 1A1NA 4JRXE 5ILTL 4JLRA 2VKXA 2HT4D 4JFPB 2HFGH 5ANMB 1NCBH 1B0GB 5IVOA 1GIGL 4PY8I 1P2CA 3K46A 1U2CA 5MI0C 3ES6A 3KVQA 4LCWA 4ZPTB 1A7QL 2MFNA 1FZKA 3QDJB 4QF1B 3TO4A 5L0QC 3NCEB 3DGGA 2P8MB 5HGBA 1RK1A 1FBIH 4FNLL 1MFBH 4LSPH 2WWKT 3ALWA 5AD0A 4YDLB 1LK2A 4GUPB 4KI5D 4V1DB 3VWJA 1YQ2A 5J1AB 1SVCP 1B0RA 4LSVH 3AGVA 4PP1C 5GGUA 2NY0B 1F11B 1JP5A 4OFPA 3JTSA 2GFBA 1WIUA 2JCCF 2VZVA 1CLYH 4GQ9L 5AWNL 2QV2A 2HJKB 2AJUL 3MA7B 1RUPH 4JDVA 2X09A 4IOIB 4RAHA 3RP1A 25C8H 1A6ZA 4YQXL 4K8RH 3QXTA 1JGDA 1NEZA 4XAKD 3U0PB 1U8NB 2DIJA 1JL8A 2X7LA 1OSZB 4K94C 1MSPA 2V7NB 5GS1B 3TBVB 2XKUA 5ISZB 3RTQC 4M6NL 2GTWB 2FBJL 2A73B 3ZDXE 5MEPB 3LQAL 2YSSB 1FGVL 1QVOA 5GRUH 4DKFL 4JRWA 4BH8B 2XKNB 4ISVB 1RHHA 3EUUA 4BSWA 1Z9MA 3AUVA 4HKJA 3VE0B 4HAGA 5I1AA 1NJ9B 4DAGH 3P0VH 1IEBB 3VXSD 4XGZA 4IMLB 3BP5A 4I48B 4JE4B 5F9WB 4LSUH 4LPYA 3PDOA 5KW9H 5HHVH 3DSFH 3JV4B 4U1LA 1DEEA 4KDTA 1NCNA 1HNFA 5I19L 5IKCB 1FL3B 4F7MB 4BQ8A 1D5MB 1S7XB 1ZEAH 2OXGA 1MRCH 5J6HA 5I76B 3SQOL 1J5OH 3OWEA 5K9QI 3WEXB 2Z92A 1VGKB 1MCKA 1MOEA 1CTNA 2YC1B 4GG8A 4ZDHA 2RCSH 3QEHB 2VERN 1YMMD 2ADGA 2FRGP 4Y88A 4HUXA 3TO4D 3CU1A 4PJCB 2GSIB 2HN7A 3C5ZA 4MNQA 4NKMB 4M6ML 3IF1A 4C83A 1YECL 1HINL 1NCAH 4BZYA 2NR6D 1I8MB 1GGUA 4ONGL 4QLRA 1JWSA 1KIPB 1F58H 3MREB 1FO0L 4MNGE 4Y5XB 1UT9A 2HG5A 4NO3A 4MYWB 5H37G 3FZUC 4G7YH 4OFKA 4OM0L 4GAYA 3UTZB 1YQVL 4XPHH 4YO0B 1K3IA 4W81A 4HS6B 2NXYC 1HHGA 4FQJH 4O2EB 4L8CA 2FLBT 3KS0H 4OKVA 4L8SB 1AC6A 3QDMD 2LTQC 5DT1H 4MJ6B 4AEFA 1R5IA 3AB0C 5TQ0L 2Z35B 4LLYA 1B2WL 1P4IH 4R6UA 4AZ8A 4F9PA 3GNML 4EN3C 1U41A 3EZ8A 4OD2A 5GJTH 5AYQA 3WV0A 1CFTA 1XGTB 5MERB 3MGOB 2VLKA 1KCUL 5H8DA 1Q72L 3O6KH 4C4KO 2JF1A 4IOFD 4TVPH 4OV5B 1PAMA 4JY4B 3QQNA 5C08A 3FKUS 5IHZA 3QHZL 1GOFA 1OP5K 4OF7A 4YHYC 1RURH 4XMLL 1ZHLB 1NSNL 3ZHDA 2FX8H 4UDTA 3D3VA 5BJTB 3I9GL 4PP1D 3QWQB 3LQAC 4NZRL 2NX5A 1WCBA 4ORGB 3VFTA 3VH8G 1HIMH 1H15A 2X4QB 4QTIL 4TUKL 1MJ7H 3UBXG 3VXNB 3V4PL 1KJMB 1INDL 1K2DB 3DVFA 2W91A 1PVHA 3T2QA 2EDEA 4FHBD 3EDFA 3EFFA 4HH9B 4RFEB 5C07A 2AXGB 5TE4H 3RZCB 1NMBH 4J4PD 2CKNA 2FGZA 4QHUA 3KPQA 4XVSL 1C16B 2I07A 3VWJD 4MLSA 4I0KA 1UG9A 1OWRM 3NABL 3RVTD 1KJ3H 1G84A 2LABA 5T3XH 5M94B 5IB3A 4I9WE 4KJWC 2HRPH 4CAGA 3EJZC 4GRWH 4YDIL 1L6ZA 2MMXA 4HJ0D 1BJMA 1INQA 3HAEG 4X7SL 5ILTH 4HJGA 1GGBH 2FH8A 2KQMA 2IGFH 4M48H 1BOGA 1YY8A 4ZO9A 3B9EA 1I1AC 1FJ1B 4IJ3B 1D5BA 3KPSE 4N0YH 2VLKE 2VN7A 1JZ7A 4NM4L 3SDCC 2XV6B 3BI9X 4H1LH 4OJFH 3G9VA 1MHHA 5T1MB 4NRYA 3BP6A 4EBQH 1JYXA 3O8XC 1TQCC 5IVXE 4YZFF 1N5YL 2CO7B 4YC2C 4LQ1A 1UACL 5KSVA 5L2KA 4CVUA 4Z7NE 5D7LE 4NWTH 4C58B 1UZ8B 1ZA6B 3HZYA 1VADB 2WP3T 2DL9A 1HEZA 4JPKL 1GZPA 3BOVA 1FDLL 2Y06L 4EXPX 3WSQH 4TULH 4KRLB 3ZHKA 43C9A 3QRFM 5CJXC 3F7VB 3GEWB 1MCPH 2BNQD 1JHTB 4RIRB 5HHOE 4IRJB 3V8CA 3RBGA 4N8PA 2HJFB 5DHYB 3RL1A 1A14H 1EPFA 5F9JA 3ZZ1A 2BDNL 1DP0A 4R9HA 1VFUA 4YAQB 4YHYB 1OAZL 4U7SA 3PV6B 3NCFB 2COQA 5SV3A 5IESL 3PHOB 2CIIA 2V17H 3HC4L 1K4DA 5IW6B 2WWMD 3VD7A 2VLME 4PRAB 2OR9L 4PG2C 3ZT7A 3EYOA 3PL6A 5E8NA 1U0QA 3SY0A 1YMMA 3KLAB 3LAFA 3RWEB 3SQBA 1MCQA 4LVOC 3EOYG 5D5ME 2F9BT 4NHCL