4AV4A

Fimh lectin domain co-crystal with a alpha-d-mannoside o-linked to a propynyl pyridine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVNLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 32
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av4A00
4X5QA 3BWUF 1UWFA 3ME0B 4XOEA 4XOBA 4AUJA 1TR7A 4J3OF 5FWRA 5JQIB 2UY6B 4BUQA 3ZL1A 3JWNE 4AV5A 1QUNB 4ATTA 3SQBB 1N0LB 4CA4A 1PDKB 4XOCA 4XOAA 4J3OH 5FLUA 3JWNH 5LNEA 5FS5A 2JMRA 4AVHA 5IQNA 4X5RA 4XO8A 2W07B 2XG5B 5CGBA 5IQMA 5AAPA 4AVJA 4J3OG 3JWNG 2WMPB 2JTYA 1N12A 1KIUB 4CSTA 2J2ZB 5AALA 3MCYA 3RFZA 2VCOA 4AV0A 4AUUA 4X50A 4CSSA 5IQOA 1ZE3H 4AVIA 5F3FA 5AB1A 5FX3A 3ZL2A 4LOVA 5ABZA 3BFQG 1KLFB 4X5PA 5LNGA 3ZPDA 2UY7B 4AV4A 4XO9A 4XODA 4AUYA 2XG4B 3BFWA 4AVKA 5F2FA
chains in the Genus database with same CATH superfamily
4O58L 4LSUL 4M7ZC 1JZGA 5LGJB 1AQKL 2VMDA 4UUJA 3D30A 1K85A 2C8NA 4ZD3H 4G6AD 1EAJA 3KJ6L 1JZ3A 1RZJH 1DJYA 4KKCD 3X1GA 1OAXL 5B3NA 3SOBH 4RGMB 2CKBH 3A6BL 4ZW3A 1U95A 5KSAC 2KBGA 4ZPVB 4OLXH 2K6WA 2X05A 5L8LB 4GIAA 1AYOA 4ZTEA 3SOBL 1IAII 1X9RA 2CHWA 3CC5A 1UENA 3KPRA 3SDDD 1GCYA 1AR2A 1VIWA 4N5UA 1R5VB 2OJEA 1YPZB 4OLXL 3IFLH 1ADQA 4FMVA 3EDKA 1AE6H 1LWJA 1OOWA 4HV8A 4XWGH 3WEOA 4Y2OB 4LQFH 3CXHK 4N0FB 5G4NA 5IVZA 3EH3B 5MEQB 3MRLB 4S0TD 2IQAB 3RWGB 1OPOA 2WTOA 1HH6A 2VSKB 1IGFH 3TBTA 1AE6L 2VLJB 3QDMA 5FS5A 3JUYA 3P4OB 4B95C 2R1XA 5LXGH 2WQSA 2G5BA 4Y2LA 3GI9L 3L1FA 5AG8A 2JB6A 4F58L 5IJKA 3DX7B 3OMAB 4HCIA 1SRDA 3CXHJ 2E9WA 4L1TA 1LDSA 4P46D 3K6SB 2VWEC 1IGFL 4RGNC 2ZX9A 4K55A 1TCRB 3UBGA 3B2UD 5LXGL 5GGVL 5HDQH 1RZJC 4M61A 5IMMB 1JYXA 4GAJH 1KJVB 2J2ZB 1GA2A 2JI1A 2Z31C 3ECBA 2XBDA 1L9OA 4DZ8B 4E2OA 2YPLA 3JV4A 3ULSA 4OLWL 3T9WA 5I1DA 4JO1H 5HDQL 2P1YA 5IMKA 2HLEB 4MDJB 1N4XH 3TASA 4ZUVB 3FT1A 3RTQD 5PAZA 4G7SB 3TCXA 4EI0A 1ZHBB 1XR8A 5GGRA 4M00A 5IB3B 4HWUA 3BYYA 1DANU 4JO1L 1CQYA 1V54B 4ERSL 4K23H 4KAQL 4MZRA 3IETB 1N4XL 2G60H 1M7DA 3JWOL 4YDJA 3RL1B 4X7DC 4YR6B 4ZAKD 3G6JE 1TMCB 4MDRA 4AJYV 1GGTA 2KL6A 1GGIH 1M05B 1QPKA 1KB5H 3KCPB 4Y9EA 3T8VA 2WW8A 4D9LH 3WKPA 1TZ8A 4QHLB 1HFUA 2PO6D 2XY1A 4K23L 4XE0A 2QADD 4HMDA 3ILDA 3LEXA 1P0SE 1JAEA 4PJDB 3H9YA 1UGNA 4MA7H 4OU3A 5ITFB 5IB2B 2DQTH 2ED7A 4GUQA 3L3IA 1KLFA 5CILH 1KB5L 3UPRB 4JHWH 1SQ2N 3P77A 5GHWH 1DJWA 3VG9C 1UC6A 3AUVA 9CGTA 2Y07L 5IF0A 3RTLA 2Y3AA 3D4GA 3GXMA 4MA7L 4YHMH 1MRFH 3OX8A 2DQTL 1T04B 2LQRA 5CILL 3JTTA 4PWHA 2PCFA 2PYEE 1LILA 4MDIB 4PWJA 4JHWL 2PMZA 5GHWL 2YAOA 1ND0B 3DX8B 5ELIA 4UU9A 4KVPA 1M9SA 3FTYA 4J2QA 1MRFL 3IGUA 3U2JA 5I71C 3D18A 3FTSA 2ZWNA 4NZJA 4S1QH 3VYNA 4NHUA 4RX4D 3AAZB 5C8JA 3D50A 5E24E 1PGRB 1P5VA 4L8SC 4A7QA 5I17A 4XH2A 2YPVA 4ZMYA 1F58H 4O02H 1PZUB 1ETZA 2XTJC 3VXUB 4HT1L 1U8MA 4S1QL 4U31A 3D0AA 2MNUA 4JDVA 2DWXA 3L1OH 2AKRA 4QJ3B 1QFWH 4ORZC 2EDFA 4N68A 4R7NA 3DVNA 3MODL 2XG5A 2YSSB 1F58L 4O02L 3PABA 1JUFB 2OMWA 1D5BB 3QFJE 4KO5A 1KG0B 3F2LA 3NQKA 4MCYA 3SJVA 5L2JA 3L1OL 2ZNWA 2EIKB 5GRJH 5C0CB 1MIMH 5SV3A 3VXPA 5EO0A 3US9A 3AG1B 4Y88A 5EZIH 2NR6D 2HG5A 3WYRA 4NKIH 1E0OB 1DVFD 5C09A 4JFYA 1E9PA 4FFTA 1G0DA 5GRJL 3G04A 1ZHKA 4ACTA 4JDZA 3DECA 1AS6A 1ZGLM 4NKIL 2MJWA 1MVUB 2KZBA 5CN2A 3BZDA 4D8PB 1HHHA 1BG9A 5C9KA 5DJ6B 1FV1B 4HK0B 5F6HJ 2F58H 2CLZB 4R8WH 3EYFA 3BIKB 1X5HA 2JJUA 3ZDXB 1NAMA 4UYQA 4Q0XL 5E70A 5J11B 3W5MA 1PAZA 5FYKU 2DWEA 1YUHB 4CN4A 3GS0A 1VFBA 4TTDD 3BGFC 5G5DB 3IJ8A 3GMLA 1UZ6F 3CSBA 4P3DA 1W0WA 4NI3A 4R8WL 5HYQA 1B4TA 5CS7A 4KFMA 3S88L 2YJQA 4OAWA 2WYHA 3QQDB 3FQXB 4ZFZA 1Y0LA 3FU5A 3PS6A 5I16B 3L4TA 4D9RD 1K3ZA 2XYBA 4XNMA 2X4NB 3CSPA 2P8MB 1ZT4B 3FB6B 4G6JL 4MJJA 4U1NB 3T2LA 2D8KA 4LF3B 4QRRE 3OV6A 1HIMH 4XB3A 5L6YH 1U92A 1ZVHA 4HS8H 4UQ9A 2G9KA 2HRHA 1TVDA 5CUSH 5CD3A 4I8DA 2IV8A 2NUPA 3WTSA 2YAFA 1KCWA 1S7WB 4ZXBA 3C60D 3QEHA 3FO9A 2DYRB 3ASOB 2A3TA 1HIML 3UFIA 4N3TA 4HS8L 5T33H 1GYUA 5CUSL 3RX5A 5CFHA 1NANH 1XCQA 2BY1A 2GQHA 1IBDA 1T66C 4K3HA 5EBGA 1UT9A 1AGBB 4HA1A 1B6DA 2FJHB 5T33L 3RWJB 2Y1AA 2YAEA 3KPPA 4OY9A 2X40A 1AVAA 3QR0A 2NW2A 2RIKA 3ZKMD 1HQ4A 1FO0B 3QNXB 3VRIB 4PVBA 1MEXL 1R4XA 3F7PC 3MRIA 4DK6A 1BFOB 1XH3A 2NX5A 1JPST 2PTUA 5E4EC 4RRPM 3H7LA 5DFVD 4JPWH 2OPCA 2P49B 3BEVA 4XNXH 4UQDA 5FWQA 3LS4L 3LVEA 4HSCX 4TUKH 5MEOA 3ARED 4LPWA 5C0FB 3VXSD 3DGGB 4NRYA 3HVNA 4PLOB 1O7DC 1Q1PA 1WHPA 4PJCA 3BDBA 3AGVA 1IM9D 1RK0A 3VXOB 4WW2B 4XNXL 1I1FB 1QLRB 4H13C 1T0PB 1PCXA 5HGBB 3ZVVA 1CLCA 5E7FA 2FBRA 1IGCH 2ITDB 2AQSA 3X3FL 1JGLH 5DRWA 1KBPA 3V0DA 3QDAA 5ESAB 4H26B 2CR0A 1CL7I 1OSZB 3BYTA 4P2RA 4RRPG 2H5UA 3T65A 1WA1X 4MMZC 2E5EA 4BKLB 2G3NA 1E27A 5CKAA 4NENB 2J6WA 2UZYA 1IGCL 4OLZH 4ABVA 1JGLL 3DBSA 2BOCB 4FA8A 4YSAA 2IMMA 5D2NA 3CPLA 4O2EA 4OQTA 3VG0H 4Z5RA 4PY7A 4N0CC 2WLJA 5IJCC 2FQDA 4YEFA 1PZCA 3C5ZA 4UQAA 2WNKA 4OKVB 4OLZL 5EC2A 1TZHA 2NOYA 3T6XA 1YVLA 3RWEA 1FC1A 1LK2A 4HKBB 5K1NA 5H94B 3WNMA 5I2IA 2CUAA 2EEDA 3VG0L 4FZEH 5J6HA 1JBJA 3PG2A 5D1XB 5E99H 4R7LA 3EO9H 3HB3C 5DEGA 3PWVB 5E95B 4KNSA 4KQ0A 4JN1L 1AGEB 5TQ0H 3ZR6A 3WKNA 2YD0A 5AYUH 2VAAA 1IBYA 2L7UA 3SKJH 3VD1A 2FBJL 3GMMA 5GJTL 5T1DL 3ZYOA 4KROC 4L9DA 2AAAA 1CXFA 1NAKH 4F7MB 5E99L 5KYNA 3MJWA 4CMHB 3EO9L 1MHCA 4NYLA 3H2PA 1UA3A 4Q6IB 3H7BA 4JRYD 1RQ5A 2BSSB 2FDBP 4PBVC 5D4JA 4YWGL 3OWRA 1TJXA 1BLNA 3RWFB 4WEEA 1I1YA 1NAKL 1UH4A 3EJZD 1QPXA 4NUJB 5BZWB 1ACXA 1P5UB 1B9KA 2GSGB 4HF5H 4UINH 1AIZA 2BWDA 5AOZA 1NIDA 1RZIB 4H1LB 3MTXA 4RETB 4P59L 4QAMB 3L5WB 2EYSA 3IDGA 4M4RB 1GS6X 3V7MA 4APXB 4G2AA 3UACA 2XZCL 2QVKA 2RA1A 4KJWD 3HFMH 5GZOC 2GBVA 4WZ9A 4UINL 3EAKA 1YYML 3SCMB 3ULVH 4X9FA 5AVWB 1GKEA 3CLWA 1T0MA 2DI9A 2OMXB 3DX1A 1W8OA 5BRZA 1A7QH 3FONB 1DDTA 1DE4A 1SXAA 4DGIH 4EIZC 4WF7A 1TYEB 4YBHA 4LPVA 1S7SA 3GSNB 3FYIB 4BK5A 1FLRH 4L8BB 2DM3A 3HFML 3RFRA 1J5IA 4NQDA 2ZNXA 4WUUA 1U58B 3ULVL 2R1YA 2E7LC 4S1DD 1SN0A 3ZYIA 3QRLA 5IW1A 1A7QL 4DGIL 4FQLH 1CYWA 4G9DB 5FUCC 5EU4A 2X89A 3LQZA 3UADA 3US1A 5AZEH 3BC9A 4GXUN 1NA8A 3V8OA 4W6YB 4TRPL 1OTTC 4H0IA 5TE6H 3R7RA 1ZVYA 1QABA 3T2PA 5C08B 2VDKB 2NW3B 4WJG3 5H8DA 5EBLB 1T7ZA 2BRQA 1PEWA 1GGUA 4X98B 4GSQA 5TE6L 5H37H 3FSVA 1PMYA 5BO1L 3UP1A 2K7QA 4R4BB 4JPSA 5ABZA 2KQNA 1BFVL 1Z3RA 4FQQA 4L9LC 2QVIA 2WB1A 3BGMB 3N44F 1YNKH 4PS7A 3QBTB 3OKNA 3RVUD 1SXCA 1UYWL 2IGFL 2BFGA 1FYTB 2QELA 3I6GB 5E2VH 2IVFC 1A1OA 2CO6A 5F2FA 3ARDA 4H8QA 2BSCA 3ULVC 1OWRM 2W60A 3CDCA 1XMEB 1CE6B 1JK9B 5LGHL 5IB1B 2YEVB 4PJ9B 3QDJA 1FZJB 5E2VL 4E42A 1ZV5A 4HMCA 3TURA 4A38A 1F42A 3KEDA 5CCGE 1ZD6A 4QTFA 4TVPE 4Y4HB 4WU7B 2E8ZA 4OZGF 4B50A 4GKZB 2OJZH 2IIJA 4QTHB 3TBYA 1F3JA 1QQDA 3VSUA 3WAKA 1GZPB 3PWPD 5EZJB 4L3ED 5E6RB 1Z9PA 3TEZA 1Q38A 5T3XH 4QNPE 3NZUA 3MFFB 4Y19B 3UJTH 3W11D 1X5XA 4OGZA 2OJZL 2Z7YA 3FRPB 3TXAA 4Z7OE 4XPBL 4S1SH 3PQYB 1R34A 3LNIA 3ARBD 3L3JB 4AGLA 3BVDB 4HYTB 3OR6B 1XGZA 2YXFA 4LE8A 1R5IA 3SGJA 2F7RA 4NO2A 1DANT 1T4WA 1XHHA 1UA6H 3QZBA 1KBVA 2NSQA 5CLTA 3S36H 4A39A 3F58L 4HEMA 4S1SL 1X9UA 4HLEA 1A3ZA 1AGCB 2JWYA 3TWCL 1QFWI 3MNWA 3FULA 2XPYA 2X2IA 3CWGA 4U1GC 4Y2DA 4WNSA 3OG4B 5JUEH 2IBGA 4XVUC 3SYCA 1UA6L 3MV8D 4OKDA 4PRAB 4W1TA 3HG1B 2ADFH 3GUTA 2ZOWA 3CBJB 5KVEE 1A1NB 3ETTA 1MCJA 4FXGA 5ETUA 3L4YA 1N12A 1BZOA 3VJ6A 4ONOA 5JUEL 1MZZA 4XN8A 1W2KT 3HHSB 5CWSA 2CO7A 4JFEB 4L0YA 1E8WA 2ADFL 3B34A 4J8QA 3GIVA 4WWID 3REVB 3KPLA 2IH1B 3I02B 5D7JB 3VXNA 4DKTA 3CU7A 5E5UB 3HG0A 1TLMA 2Q7YA 3NPSC 4ANVA 2R9HC 3EGDA 3ETBJ 2ZKWA 4PD4J 5D7LA 5KANG 2FWOB 5C7XH 3X2QB 5BZDB 5JXED 4TQHA 5CEYB 1FL3B 3BMWA 3H9SA 5KSAA 2G2RB 1XIWD 5INDA 3I75B 5CIPH 1QSFA 4X6BA 3VGBA 2FHBA 4JO2H 4U7KA 5FDWB 1VB9A 2NY0B 1U93B 4NPYA 1JGEB 4KKAC 3BT0A 1JZJA 1LE9A 2BMKA 3IGAA 3Q9QA 4WEUD 2WBWB 4OZ4B 4R5TA 3Q6GL 5AVXB 4DEUA 1RZFH 1GSKA 1S78D 2NY5L 4HS3B 3SDXA 3ZUNC 3DO7B 3C09C 4IOFC 1RK1A 2DWYA 3BZ4B 2A7BA 5DQ9A 2ED9A 3PAUA 5MENE 3VU2A 4JZNA 2CGRH 3L9YA 4XMUA 2WP3T 4PJEA 1OD9A 1RZFL 2JIXD 2YJLA 3G6JB 1U3JA 3HKFA 4HHGA 5FB8A 5HGHB 3V0WH 1LEGB 2XZAH 2VMCA 3VD5A 1HEZB 2HSIA 5DJCA 5EEVA 3ZRSA 5DQJB 3GMRB 4FAAB 4GY4A 5CKGA 2HZHA 1AANA 2DLGA 1UQSB 2KS0A 3UG3A 3IJHB 4M7LL 4NKDB 4PJHA 4B9GA 3BSZH 1BZ8A 1IO4C 1ZS2A 2XZAL 4YZFF 4E0RA 1TQUA 4JFQA 3A67L 3X12B 4BDVA 3BZEB 1CDGA 3IDYC 5DJ2B 4KKBD 1OGPA 1RJLA 3RUGB 2VR5A 4ETQB 4LSRH 1BJ1H 1XGPB 5L9DH 4LRIC 4J7RA 5E9DB 1NANI 5FYLE 3BSZL 2EH7H 2PYEB 2YA1A 3T0BA 1M7IB 2WKLA 5DZAA 4TKWA 3HIZA 4PWIA 2NY5C 4LSRL 1WYJA 5T5NG 3RVVC 4H8VA 4OF0A 1WWCA 1ZTXE 3PP4H 3QZOA 3VQ2C 3J07A 5L9DL 2OYMA 4PWGA 3TH2T 4AQAB 3TVMC 2EH7L 3FB5B 1QNIA 5FYJD 5ILTL 2D4DA 4U1LB 5I0XA 5DZPA 2FH8A 2ZSWA 3PP4L 4JLRB 1IVLA 3ETBF 5CN3A 1FL5A 4KO9A 2EIMB 5L2KA 1ZWIA 5EU5A 5DFAA 2V9UA 1QVOA 1T5WA 3KPQB 4PUBH 1JS4A 3SPHA 1EDQA 2UX7A 3H2WA 2EECA 4PJ7E 5HHNA 4DN3H 3WTYA 4PP1C 4GQQA 1MHPL 5I1CH 3IFNH 2CWRA 2G5RA 3LH2L 1U8OB 2BNRD 3ROOB 3SKNA 3D33A 5FDYA 1WUZA 4MZ2A 2AQ2A 2OXHB 4YJZL 3LN9A 5C0AA 4DN3L 1LNUA 2C34A 3UBFA 5I1CL 3IFNL 3OSVA 3KLHC 2K8MA 4B0MM 3I9PA 1IIIA 3KWXA 5D1ZC 4M7JH 1ORSA 5SX4I 1UD8A 4HQQH 1N26A 3H3PH 1TJMA 1U8JB 3BUDA 1FZKA 4N22A 3VX0A 3QEQD 4OV5A 4G9FE 4NRXA 3ULVF 4JHAH 3CN4A 4FZ8H 3GXIA 5B8CB 4X8CA 5KVGE 3CDZB 2XVBA 4M7JL 1TQBC 3HZVA 5FA4A 5FGCE 1D5ZA 5KYWB 3WFBH 5E0FA 5DS2A 3H3PL 5DHVA 1T1YB 4QRUB 5ESQA 3M7FB 3IXTB 4JHAL 2WLYA 2QVMA 5GSRB 1NUDA 2EYTA 4FTVA 4FZ8L 3A0OA 4JGMA 4RH4A 4NP4H 3EH5B 3NN8A 1GC1H 1KB5A 3P30H 1S9VB 2VZUA 4G8GA 4GG8B 4ZUSB 1TTFA 5KVFE 4Z7VA 4RWHA 3W56A 4AW4A 4K8RL 1LGVA 4LLDA 4NP4L 4JFXB 1WZMA 4YSCA 3LS5H 3P30L 1PG7H 4XCEA 5F9AC 3D0LA 2VLRD 2VL5A 1F18A 4IJ3B 4P4KD 4PRHA 1E5ZA 4OIAA 4NDMB 3TV3L 2AJXH 3LMJH 1JXFA 2YAMA 3P02A 1VSCA 3SPVB 3VFUB 5JNYA 1RZGB 3UBXB 1BQHB 3EG9A 3LS5L 3REWB 1CD1B 1PG7L 2VR9A 3GJFA 3LKNA 4FQJL 2P5EE 4MNHB 1BF5A 1IAOB 1KGCE 4O4YL 3S3JA 3LMJL 1YY8A 2WYIA 3M8OH 1F00I 2Y2WA 3MDJA 2BOLA 5E23A 3DX9A 3B1UA 4JW3A 5GSVB 5DJ0A 3TFKC 2A77H 1NPUA 5T1KB 2FWSA 2Z65C 4QYAA 4O02A 3QULA 4JY6B 1PBYA 2GITB 4JDEB 4FFZL 1Q9KB 2NY4D 3C2AH 3QNZA 1G7MA 4MD4A 2BNQD 1J0YA 4U4BA 2W9DH 3IMBA 1G5AA 3I9GH 1BXAA 2DLEA 2VZ1A 3DJSA 2DQGH 3C2AL 3EFFA 2CD0A 3BXNA 2VLKD 2WCGA 1U21A 1GYCA 3FJTA 4NFCA 3NSYA 4GB9A 4Q58C 4RMUA 1EAOA 4QO1A 2DYPD 2AEPL 2ESVA 3WENA 3CHOA 2D9QB 4NQCB 3VI4F 1OP5H 4DKAA 3GXFA 2MNWA 1XDTT 5C0ND 3H6AA 1MWAL 2BO0A 3RPIB 4QCIA 2X9YA 4RDBA 3WIIH 5KANI 1OQOA 2A83B 3Q2LA 1VESA 3F00A 3KVDD 3F12A 3GXTA 3CD4A 3LEYH 1OV8A 7PCYA 2TRYA 2WZ0A 2BP0A 2XQ0A 1YMHA 3VH8B 4FQCH 1M53A 1NUFA 2MKWA 2PWHA 3SDCA 2MEJB 5CXPA 1Q90A 4LPXA 2B1OA 4RESB 4UIMA 2ZXQA 2GYSA 5LJYH 1CQKA 4R9HA 3ME0B 2A6JB 2COVD 3OKYA 4FQCL 4KC3B 3VXTB 2EUZA 3LKPA 2X4TB 4H2AA 5DYFA 4A04A 4HDIA 1JK8A 2R8SH 2DLTA 3HG3A 1DTUA 1X6NA 1VADA 1ZTMA 2KC0A 1EMTH 4DEWA 1FL6B 4WI0A 3FU8A 3IDUA 5E56A 1GMIA 3EF4A 2D7PA 3FUDA 1T6WA 2K6ZA 2HXAA 2YKKA 4NNYA 2GFBA 1ONQB 4PS4L 4AXWA 2R8SL 1SVCP 2HJLA 1V7NH 2BJMH 1PU0A 1KF9B 3B9KD 4MA3B 2ATAA 1KFAL 4J1UB 3ROLB 1BZ9B 3PPEA 1VCBC 4XCCL 1N0LB 4XPHH 4MNQE 3HOGA 1IILE 4MMZA 5AOIA 1QASA 3TFBA 4XZ4A 3CFEA 2GUYA 1V7NL 5B3JF 3N2JA 2BVOA 3LSOA 3IN0A 4APQB 4HKZA 3VD3A 4HU2A 2P8PA 4NEHB 4AENB 1M3IA 2BSRB 2SODB 5DI8A 4UNTA 3E6HB 2APBA 1A9BA 4JMNA 2BHFA 5FUZH 3L5XH 1ZANH 4ALAH 3F62A 3QJFB 4LLAA 4PJAE 1N9PA 4A2DA 3TEWA 4LDOB 1C9SA 1RZQA 3GDCA 4F24A 3PHAA 4X9HA 3GIZH 1NCIA 5FUZL 3MRFA 5T3ZL 3TYGH 3L5XL 3KL5A 3L95A 4ALAL 3U9PH 4KITB 4QHNA 1A3RH 4RGMC 4GP4B 4MWFB 3G08A 3LTVA 4RLDA 2NY6B 4AE0A 3KPSE 4X50A 3PGDB 3PY9A 1J12A 1NDMA 5EZLB 3GIZL 4GEIA 3W82A 4S2SA 3DI2B 3O3AB 3TA3B 3TYGL 3ASWA 5HI5D 4TV3A 3R19A 5JW4M 1XB3A 1A3RL 1CXLA 3J2PA 1G7IA 2APTA 2IWKA 2OBGA 3B7RL 4NZRH 1CFMA 3NCYS 3SE3C 3TGXA 1I1AD 2HUEA 3NG5A 3HPLA 1FVDA 1P84K 2BY3A 3E8UH 4P2OB 5E5RB 2A9NH 3MJ9L 3MNVB 4G70B 3RKPA 1CURA 5DJDA 1BLIA 1BYPA 3VFMA 2XKUA 2BVQB 1GOGA 1SXSA 5TDPB 2J1ZA 3D39A 4YHOL 3R8QA 4JO3L 1CPUA 2KPWA 4JPQA 5GZOA 2A9NL 1LO3H 2BWQA 5IV2A 4PQXA 1P84J 2DKMA 3FO1A 1S7UA 3DSNB 2X2UA 4RMTA 1FA4A 4Z7WB 3BPNB 3QORB 3R0MA 3OKMB 2GI0A 2IADA 5D72H 3DX6B 4ALAC 2WC7A 5DUBA 5ANMA 1GTNA 1LO3L 4PJXE 3RKDC 4HHAB 4CBZA 4Y1AA 1ZEAH 1MRCH 3S8FB 4G83A 2E7LA 3KLQA 4ZOBA 2FZ3A 2VDRL 2X4PB 3CDGA 3RU8H 2CALA 4U6XA 3WTTA 5D72L 1KFGA 5BW7C 4LCUB 3MU3A 1Q4NX 4MAYA 4QXUH 4C8XA 3FQUB 1ZEAL 1MRCL 4MQXD 2KZKA 3HZKB 5D1ZI 2YQ2A 3E6FA 3PP3H 4YHKH 2VQ4A 4Y9BA 3RU8L 3U25A 3GLEA 4KI5D 1BM3L 2Y0SA 3K81A 1N59A 4CC4C 4UM9B 4HOXA 1NFIA 1SDDA 5AVZB 3OXSA 4GUPB 4QXUL 4MJHA 4GRLA 3GHPA 4JY5H 3CK0L 4DPCX 3FMGH 5AD0A 4L3CB 3DVGA 4EMZA 5B1BB 1FUNA 4Z7OB 2PCPB 5EO1B 4BELD 1E3XA 4G7QB 2EKSA 5D5MB 3FMGL 2VUOA 4AYSA 1WFIA 3IT8D 3FB8A 2NY1D 3FRUA 2F1BA 2EO1A 2VJ8A 3KLSA 2YBRB 3M7OA 5I66B 3L7EA 3WLWD 2CO1A 3WE1A 3QS2A 3FFCD 5AALA 1NJ9B 4K3DH 1OHQA 1PLGH 1IC7H 3CDFA 2HVBA 2WQAA 4J6RH 1UD5A 4AGOA 1JV5B 1M42A 3P9LA 4G11A 1TZIB 3Q1EA 3T0EB 3OLDA 2FJGA 3BRDA 3V7AG 3JWDH 4YS4A 3OKLB 4U6TA 1IC7L 3OKKB 1FP5A 3IWVA 4J6RL 4AGMA 4NQQA 3RY6C 1IE4A 3NYKA 4XP4H 4I2XE 3NK4A 3MRKA 3KNBA 4F7TB 3QG7L 3JWDL 4I48A 4PW3A 2Z8RA 2XCMC 2P24A 1RUQH 4WSGA 5J13B 4LMQE 1VFUA 1D2PA 2J55A 4GMTH 1P7QD 2C9QA 3DV6A 3Q2WA 4UAHA 4XP4L 3DPBB 1R3JA 3GBDA 3PL6D 1HHIA 3EYUH 4LAQH 3W5NA 1WVZA 1KT2B 5EU6E 2E74C 4W9FC 1Z9OA 3KHQA 1RUQL 3AABA 1JZ5A 3CN3A 3X17A 3CMOH 4JM2D 5E2TH 5EC1A 5DU7A 4KTDH 4JG1H 4YZWA 2ZUQC 3G5VA 3H4FA 3CBRA 1ZA3B 3EYUL 4LAQL 2I9LB 4I85A 3GSRB 4HJIA 2YRBA 4Q9RH 2AJYH 2ZOKA 5E2TL 3DHJA 5F1IB 4KTDL 1PLCA 1DCEA 2XV6B 5MENB 3U36A 4I3RH 5HI3D 3M6DA 1TCMA 2OSYA 3WE6A 5KYUB 1F4AA 2V2TB 2FK9A 5IBTL 3RX7A 4L37A 4Q9RL 3W39B 3AG2B 2HTKD 1MVFA 1A02N 4RMWA 1IX2A 2OTUB 2MOVA 2X10A 4I3RL 3K71A 3AM8C 3JWDC 1F2XK 1FGVH 4LL1A 2E0PA 4J3SA 4OD1H 1A6UL 1CS6A 1C12A 1PLBA 4IRJA 2P5WD 4AQEB 4HIQA 5HYSA 2BLFA 1WISA 4KRNA 4N1HB 2GHZA 5F89A 3LN4A 4Z9KB 5J11C 5FGBC 4OD1L 1FO0H 1MH5B 5AKVA 3LN5A 2NNFA 4AVHA 1GKOA 3LV3A 4OZFG 1CFBA 1SXZA 2XWEA 3RAJH 3FS9A 1THAA 1Y18A 3RYMA 2RMNA 2N7BA 2UUDH 2PXYD 1NCUA 1FO0L 4ZS6C 5KN5A 1FI8C 2X09A 1K8IB 2WLHA 3AMKA 4X6DA 4MMYB 3N1QC 3LKSA 1R3LA 3RAJL 4WWKA 5ACZA 5BMFL 1HI6A 3FH7A 3NSXA 1TJHH 2EC9T 5AVSB 4LFHG 3QH3B 2EP6A 1BOGB 5IM7B 5I1LA 2R2BA 3FTGB 5IQOA 1MIEH 4LEEA 5HYJD 3EBHA 1YEKL 4EUPG 3FB7A 3ZT5A 2HFEA 4MX7A 4HH9A 1HDMB 1YPZF 3N41F 2CMRL 4B9ZA 3NPZB 2M8XA 1S9YB 2D7OA 12E8H 4PJ7B 5IEHA 5HJBA 2JI3A 2H6PA 2W59A 4JREB 2UX6A 2CG9X 3KYMB 4JKNA 5EA0H 1NBZB 3JV6A 2CIIA 3BT2H 5GRUH 1ED3A 1JYNA 4JRXD 2D7NA 3QW9A 5IW6A 3BQVA 4LRIA 2ZG2A 5B4MC 3HZMA 2WWMC 1K8DB 1RFDH 5CIPA 1T1XA 4Q9QH 5EA0L 2XA3A 4GYBA 4TLTA 3BT2L 5GRVL 4LKXA 5CMAB 5GRUL 3FQ1A 4OGAD 4Y4KD 3FOMA 4TUJB 1SOSA 3NIGE 3TVMA 5EDXA 4OFVA 5DFTA 4BH7A 4G9FB 1RFDL 2RFXB 5IVNA 4Q9QL 4KK8C 4KNQA 2H0EA 1DQTA 1JPGB 2IXQA 4N86A 3BKJH 1TSHA 2VQUA 2H4EA 4Q52A 5E6SB 4QRPA 1WZLA 3FNKA 4B9CA 1H6UA 3A4FA 3UYPB 3KS0J 3MRBA 4WK4B 4WFFD 2AITA 4NWUL 4R3SA 1F41A 1FZMB 4WW2C 1JPFA 2K9UA 3MKGA 3WNPA 1AY1L 4C56A 4JQIH 3BH9B 1U8LA 3S5ZA 1TU2B 1DLHA 3UMNA 2H6UA 3ZU8A 1PZ5B 3LZFH 4WLCA 3NJVA 5FF6A 2QLYA 2YD8A 3QQ9D 3GINA 3BSZA 5HP5A 4PGEB 3WJMB 1EXUA 4M48H 3CX5K 3K8MA 4GFXA 1ZLEA 4J3OH 3J27A 3QZLA 3JQOB 4RQQB 4D9QE 1A6ZA 2FUTA 5D1ZA 1H9VA 4OJDH 3QUYD 2E46A 4LNVA 5AUMA 1EBPA 2CDGA 2WXPA 1ROWA 4JFVA 3H4HA 3QUKA 2EH8L 3CUPA 4M48L 3GSNH 2VXUH 3BMVA 3K91A 5C6PB 2AV1A 2GJ6B 2A99A 1HK6A 4KKNA 3TP4A 2FO4B 2OA9A 1JGVL 4X9GA 3IDJA 5D1XC 1GZQA 2MSPA 2R29L 2E7MA 4NUMA 1AZVA 4EVNA 3DTXB 4HCRH 5TFSH 4A66A 2VO8A 4L4TA 5SWZA 1VGEH 3S37X 2YD1A 2ADJA 1PKQA 3FHQA 5FO8B 4JDTH 1MRDH 4AQZA 3ZT6A 4CMHC 3IK2A 4GNKB 3QUXD 4Q7DA 2EE6A 4MD5B 3FT4B 1QZ1A 3KW7A 3L3HA 4Q6IC 2JKTM 2VDKH 1OK8A 4FXLA 4HCRL 4ZOCA 1AHWA 1T22B 4M8QA 3PXJA 4G42B 1JMXA 3MJ7B 4UQ3A 1MRDL 2QMJA 1P5UC 5A1AA 5IMOB 1H6EA 5FYKD 1K2DB 4IM8A 5DWUH 3SDAD 5FFLA 4PJGE 4D9RE 4OLVL 4B5ZA 4DVBB 4ZUWA 5MEPB 1QATA 4J3OC 1JNJA 3NJHA 1O0VA 3ZBMA 3SCMC 1VZIA 4N90D 5DSCB 2J1KA 3LZRA 5D2LB 3RZCB 1E4WH 5EEWA 3IFPA 4MCZA 4B3VA 2OL3L 3QNYB 5DD0H 3OLIA 3HLAA 4XTRD 2YAPA 4PREA 2OYPA 3QNFA 4G3YH 1TVBB 4JCWA 1WRFA 5LHDA 3UZQA 4XX5A 1E4WL 4XNBA 2BSED 4QRSA 5DD0L 1UWXK 5F44A 3BUIA 1SVZA 3JWNE 2YWZA 4TL5A 2FUQA 3MA7B 4G3YL 2F54D 4C4KO 4F91B 2CJUH 3N5AA 3IKCA 3PGCB 5D7SH 3C9NA 3U0WL 1SEBA 4QMEA 3ZDXF 4NO5B 4XPAH 4QOKA 3ZDYB 4IKIA 5FK9B 1DUYB 5ICYB 3O6FB 4LHUA 3IE4A 2CJUL 3BEWA 4R5VA 5D7SL 3OVUB 4A7SA 43CAA 4I3SH 3GUFA 3L7FA 5F7EH 1CTOA 3LDBB 3L8QA 2RQ8A 4QXVA 1WZAA 3O9WA 3KL0A 1ANUA 2TSBA 4LSTL 1GVIA 1KBKA 4N2DA 3VXSE 3ARYA 4MNQB 4CDHA 4I3SL 1CFNA 3TU6A 4L8CA 3FAWA 3MUY1 3RX8A 4AQ8C 2UXTA 2WXQA 3PE9A 3UYRH 1KGJA 4FFZA 1ZDSA 3IJYA 2D31A 4PJ9C 1II4E 2IANA 1RJZB 1FIEA 2NCMA 3MFGB 2WXJA 5D9SA 2VJXA 2YQBA 2V5TA 4Y4HC 5IKCA 3GB7B 1BECA 1FG2B 3UYRL 4HISA 4HIPA 3DV4A 4LASL 2FLBT 5KBNC 2XICA 2FL5A 1DJGA 4WCYH 2YEZB 5I15H 1NIAA 4F2ME 2ODHA 1WS8A 3FO0H 4J3BA 3HI5H 2F68X 1XSJA 2Q86A 2XZQH 1Z2KA 2QQKH 5CEZD 4GG6A 1EZVY 1KIRB 3BDYL 5JA8B 2B77A 4W4OC 4OGXL 5F9JA 2CSPA 1CTNA 5F3BA 3KPSB 4XAWH 5GS0H 2R4RH 3TLRA 2ZX6A 1F8TH 3BLBA 3OB0H 1MWAA 4F3FB 2RTTA 1R3KB 3E38A 2ZP8A 2HJFB 3HI5L 3NCJH 4IEFA 4WW1A 5F96H 1AXIB 2UVEA 2OSWA 2QQKL 4LSSH 4W9LC 4HIEB 1SUHA 3DHMA 3GRBA 4L1HA 3RNQB 2JE8A 1S5HA 5HD8D 2HT3C 5DYOA 5GS0L 4NT6B 4OZIE 3O3UN 3A22A 4GKSB 1OF2A 5FHBH 3VX1A 3NCJL 5F96L 2HG0A 5CGTA 2IALA 4LSSL 3AMLA 1AJ7H 3NUKA 4ONGH 3G5ZA 3APCA 4JRYE 3U4EB 2HFFA 2FYYB 5FHBL 4WW2F 1JJUA 1N18A 4E9WA 2CM6A 3W37A 5E08L 4OBSA 4ONGL 1E2WA 2YD3A 4M3HA 4HIXH 5D7JC 2ROYA 3P54A 1ZY9A 2GVYA 1OP9A 1DQDH 3SE4C 2BIIA 4Y8AA 3LIUA 2EJ1A 4EKJA 4KX9A 3EBGA 4LPUA 1A0QH 1PLAA 4HIXL 4ZPVA 3V55A 4NAMA 4M1DH 4PU2A 1K6QH 3QDMD 4YSQA 2IQ9H 2NY0C 3A4EA 4FL4B 2EE9A 4BWTA 1Z9SA 3KVQA 1NIFA 3C5SB 2XV0A 5DHYB 3NH7H 5GS0C 5D1QB 4ZO9A 3RFZB 3SE3A 4QT5B 1A0QL 1NMCB 1R5VA 4MASA 1YPZA 1E5AA 4HS6A 2J5WA 2IEPA 4M1DL 3RDTA 1DVQA 1K6QL 5CCJA 1NCBH 2IQ9L 4FXKA 4Y2OA 3UAJC 4N0FA 4P04A 1Z6JT 5MEQA 4AZUA 5DJAA 3ULUH 3NH7L 3MRLA 4OM1H 4AI7A 2Q10A 3RWGA 5E8PB 4B53A 2OMTB 2DJMA 4X6CB 4ODTH 2YPLD 1NCBL 2AI0H 2VLJA 2ODIA 1BQUA 4JPIB 1HHKB 2ICCA 3QDGE 3RWDB 3ULUL 5J3HD 1T7XA 2AQNA 3DX7A 1EAPB 3JV5A 1IKOP 4XP9L 1JPTH 1G6VK 4JFSA 4EEEA 4XNQB 3K6SA 1AXTL 3MTRA 3CSFA 4DO5A 5IQ7H 1TCRA 4YH6A 4PJ5E 2X1QA 2WOBA 5IMMA 4X7FC 5F7FA 4X8JB 1KJVA 2J2ZA 5HVGB 3SGEH 5KSBF 1P1ZB 2GCYB 4ODBD 3K46A 5B39G 4PLJC 4DZ8A 2BRRL 4Y16B 5DTFB 2LOEA 3MRGA 4PJIB 3SYPA 4ORGB 5ACLA 4P2QD 4ZOAA 5IQ7L 1EZSA 4MDJA 1GGCH 3QA3B 4ZUVA 4G8FA 4KTYA 4GO9A 2EYRB 3DROB 3MJ9A 4WI4A 4AVKA 1ZHBA 4IIQA 1NOFA 3V4UH 5IB3A 2CZNA 2YGOA 1XVSA 3CZLA 4LIQH 4MAUL 1N6VA 2VMFA 1VEOA 4MJIA 4P3WA 4RFOH 4X5QA 3RGHA 4AMKL 3IETA 4G80B 4FLHA 3RL1A 3T71A 7FABL 4AEHH 4O9HH 4NKOB 3UAAA 5EOQH 2ZUTA 4CNIB 1A14L 1PSKH 4OF7A 3NAAL 3V4UL 1M05A 3ULUC 4YC2B 4LIQL 2YXVA 3KCPA 3RBGA 4L3EE 4RFOL 3ECVA 2ZXAA 4PBXA 2WIIB 5AZ2H 3VE0A 32C2B 5EU6B 5DJZA 1P4LB 4AEHL 4K15A 1S8DB 3O4OB 4PJDA 2Q2LA 3QARA 2N1TE 3GJFK 5ITFA 4NIKB 5IB2A 4ELME 1PSKL 1Q0XL 2ZOTA 3BN9D 1ODUA 4A63A 1EFXB 5EHFA 5CSZA 4BZ2L 4ELDA 3UPRA 2F2HA 4V1DB 4PVMA 4LOUC 4W9EC 3WFCL 3SO3B 3OM3B 3PJSB 5L7XL 4A7GF 4HGKC 4WI2A 4D8OA 3DA0A 3F64A 2GIMA 1ACYH 2JELH 1T04A 3TN0B 3VQMA 2PPFA 4MDIA 2HN7B 4AWJC 4YUEH 5AW9B 1ND0A 3NRPA 3DX8A 3UEZA 3RY6A 3MV8E 2IFFL 3QXDB 3O0RL 1O5DT 4RNRB 5C3TA 3HUJE 4XR8C 2B0SH 2EIBA 2P4AB 3D7PA 3QJUB 4MVBC 3SJVD 2X1PA 2X42A 2VR4A 3AAZA 1DHKA 5LAXB 2H32B 4YUEL 4NQXB 4CN6A 4U1HB 5SWSA 2BIHA 2V7NA 4CJ0A 5B8CC 2ZXCA 4MCMA 1NCHA 2Z1PA 4K9JA 1EXHA 3P3TA 4XP1H 3VXUA 2B0SL 2R7EB 5C09D 4MB5A 1NDGB 1PYWB 5C9JB 2DM2A 4YVUA 3Q8FA 1JG9A 2VNCA 3WG7B 2VR3A 2YSSA 4Y5YB 1RUMH 1JUFA 1PL3A 1D5BA 2QKSA 4XP1L 2EVIA 1KG0A 1RCYA 3IBEA 4ADJA 3QUMB 5C0CA 4MHHI 4I87A 2TSAA 5F3FA 1QSEA 3H1ZA 4PYHA 5CJOL 4XBEH 2A4CA 3KD4A 2JKRM 5HPOA 5CJXC 3UTQB 3LRKA 2X4RB 4IJ3C 3ZUCA 3HC0B 3SE9H 4Z8FH 3FTXA 4FFWD 1GY1A 4WHCA 4WWOA 1W0YT 3WTXA 3IGFA 4H8WL 1G5GA 1K3IA 1TZAA 2LABA 4XBEL 3K0YA 1AZUA 3AM8A 3H9HA 1OOAA 4X7SL 1ZV2A 5I82A 1KN4H 2UWEB 2CRYA 5GJSH 2DQIH 3UL4A 4Z8FL 5DJ6A 1FV1A 4HK0A 4ZAKB 5CLXA 2CLZA 4GI8A 5HHVL 2PKDA 3BIKA 5AOJA 2X6MA 2YGNA 4KRLB 1YUHA 2C9XA 3FW6A 2FX8H 3NTCL 1J0JA 1KN4L 1MFEH 2DQIL 3GS7A 1NEUA 3FDWA 3S97C 1TIUA 4JM4H 4E9RA 1CLZH 1ZLVK 2EXSA 5LN4A 4PJ6A 1LQBC 1MVYA 4ZXBD 3FQXA 2J8OA 1WAAA 1MFEL 2CE6A 2F08A 3MR9B 4P23A 4JHUA 4F8QA 1Y6KR 5E2WH 3THMH 4UOZA 3V4LA 3NIGB 2VM9A 1AD9B 3U0TB 2X4NA 4JM4L 5BXFA 1CLZL 4UDUB 4JFDA 1ZT4A 3FB6A 1NEZG 2EDEA 2E3VA 4U1NA 5FO9B 3BJLA 3MRNA 1UKQA 4IBQA 4RMVA 5E2WL 3F65A 3THML 1YMMA 3HC4L 2EDMA 3PUCA 1A6TA 2X6VA 4KGLA 1WAPA 4JB9H 3V10A 4ZZFA 1S7WA 4LSPL 1J1PH 5FYJE 3VFVA 3AY2A 1PZ3A 5ABDE 1XF5B 2NX5D 2FEEL 3BKMH 1WCBB 3AWEA 1G4RA 4JB9L 4GSRA 4U1IB 2X6BA 3V6OC 3FF8A 4OCXH 1AGBA 3CZFB 1WK0A 2FJHA 4FNRA 4X4MA 3D08A 1JWMB 2KLSA 4HLZG 5EU7C 1KBWA 3G6JF 3KGTA 3RWJA 2VDQL 1SXNA 3BKML 3QXVA 2RD0A 4RA0C 3AW5A 3UJJH 4JFHD 5M94B 2QSCL 2QSQA 3FCSA 5EU3B 1FO0A 5E8NB 1NBQA 1NCWL 1KPRA 3QNXA 4OCXL 3U4KA 3VRIA 1EHAA 5J7CC 1U3NA 2VAJA 3U6RA 2BNRE 2XWDA 2G75A 2J6EL 3ZXAC 4WO4A 4LPCA 5J6GB 3UJJL 2DWDB 2Z1KA 4P2RD 2VE6B 3ABZA 1HCZA 4TLKA 4N8PA 2WLLB 2ZONA 2JXMB 4LQ1A 5E6UB 5C0FA 2XY2A 2OM5A 3DGGA 1L9NA 1UXLA 3HBQA 1MCHA 3GNML 3L5IA 3QEQE 4U7SA 1ZSDA 3VXOA 5A2LH 1I1FA 1QLRA 3LZNA 2Z4QA 3C5ZD 5IROD 5K39B 3QJHB 3CX2A 3L54A 2ITDA 3ZHNA 4MJ6B 4O5LH 4OJAA 4X6FB 4H26A 4IU3A 2AXGA 4UAOB 1OSZA 2H3NB 3VGHA 1DYZA 1HNYA 5DGQA 3U7AA 3TPUB 2JCCB 1AGFB 2VLLB 1P7BA 4ODVL 1KUMA 4APQC 1L5GA 2PTTB 4ES9A 4O5LL 4CKQA 4UOW0 4KKLD 1T83C 1BV8A 4Q4EA 1PNDA 3FTVA 2JJTC 4PBDA 2BHYA 4OKVA 3PIQA 4WI7A 5AKRA 3L9EA 4MB1A 3MJ8B 4HKBA 4Q14A 5BPPA 2VLRE 5H94A 1GIGH 4KQ4L 5EUOA 3SY6A 1ZIBA 2VERA 1ZVSB 3LKOB 3KWUA 3PWVA 1AGEA 2F6AA 3SZ6A 4DKFH 2NY6C 4P46A 1B3IA 1ETA1 3MX0B 5F7WC 1GIGL 4IBYA 1AI1H 1LLAA 3BW9B 5E1IA 5C0BB 3TA3C 3TJEH 4F7MA 2EIEA 2DQFB 1RUAH 1Q1JH 1G7PB 3EJQA 4FQIL 4NHCH 4YEEA 4G8AC 2KYIA 4TM9A 5DHDA 5DRZB 4LFHD 2ZIDA 3SKMB 4E5XA 5BRZD 3OL2A 2C26A 3RWFA 1F5WA 2VLMD 1AI1L 5BZWA 7CGTA 1P5UA 3TJEL 4X4YB 1YY9C 1RUAL 1Q1JL 1ZA6B 2GSGA 4NQDD 4P2OC 4WUUD 5LUMA 2DTML 2ZKXA 5JPNB 3N1MC 2LLGA 2XVKA 4H1LA 1JZHA 1CDUA 2AGJH 3L5WA 4LNRB 4YAQB 1UA7A 4M4RA 3ECWA 4J3UA 4M6AA 1QI4A 1OP3K 3IYLW 2VLKE 2AGJL 2G9HB 3NFNB 4WIQA 1HZLA 1HH9B 3X1FA 4DFIA 3BPNC 3QORC 1K72A 4K7PX 2R29A 1QBML 4L8BA 4LCWB 3ARUA 5KVEH 3UTTB 4F5CE 2XNAB 3SD5A 3DLQR 1L7IH 3FAXA 5IK3B 5MERB 1OP4A 2H0PA 4TSBH 2GTWB 4G9DA 2B9BA 1OSYA 2Y06H 4ENED 1AOZA 1Y1UA 1IBGL 1OAZL 3K0WA 5LAPA 1R9FA 1JN6B 1V8HA 4HCRA 5FO7B 3SGEI 3FOLB 2GJRA 4FQXB 2PR4L 3LD8B 3S5LG 1ZLUK 3VDAA 1XH1A 4FNLH 4JN2B 1HINH 3QPKA 3DYMA 2Y06L 4BCYA 4EDWL 2WXOA 3ARDD 1CC3A 2NW3A 4KK5D 5ICZA 4F2MB 5EBLA 1J7VR 5K59E 2OMYB 1T20B 1G6RB 4X98A 5ECJE 4FNLL 3QUGA 2YGPA 3PNRB 1HINL 4M1CD 3EFDH 3QDJD 4R4BA 3AS0A 1JMZA 3VXQB 3WEXA 5B3SB 2QPDB 2GBUA 2QSTA 3EJJX 1RL1A 4NPKA 4POZD 2AJUL 4POUB 4W9DC 3V0IA 4PR5B 2QGEA 1A8JH 4TOYL 1KWGA 2OL3A 2HJKB 4XOEA 3HMWH 1H0DB 2YK1H 1P53A 2OXGA 3EFDL 1GOFA 4XCFL 4LU5H 1YN7A 4WNQB 4OZIB 2JQMA 4AQ8A 4MJ4A 2K45A 4YBQD 1OO2A 4C4UA 1KPVB 1N8ZA 3HMWL 2YK1L 3DMMB 5IB1A 3LEVH 4PJ9A 1JL8A 1FZJA 3T8XB 3LKRA 4ZDHB 3UTZB 1E67A 3BISA 3T0EC 2XHNA 4Y4HA 3BP5B 2DM7A 1U30A 1CDHA 1Z5LB 2FGZA 4NXKA 1J5OH 3D3VE 3PWJB 1ES0B 2H1PH 2DIBA 5D4HA 3LEVL 1GZPA 4AIZB 1J9RA 2XXFA 2IBBA 4Y19A 4Y2DD 1ITCA 3ZO9A 1JXDA 2I7OA 1J5OL 3ESVF 3FRPA 4U6VL 5J13C 2H1PL 4W4OA 1KXTA 4MSWB 4XNYH 3KE0A 3PQYA 5FYLH 3L3JA 3PDGA 4C4KT 4JNXA 1W80A 1DJXA 3OR6A 5CM1A 2X88A 3CFJB 4HXAH 5KZCD 1R17A 2AQ1A 1IQDB 1ZTXH 4XNYL 1TTUA 1OPGL 5FYLL 3TJPA 1AGCA 2JJWA 1SGKA 2PP9A 2BY2A 3IE9A 3TBSB 2EDXA 3G5XB 4O51A 3A23A 4HXAL 2WN3A 4MKMA 5D7LD 2BVPB 4CSPA 4LEOB 2MRYA 3NJLA 1ZTXL 4PRAA 3EHBB 3HG1A 3H9SD 5KSAD 4GQZA 4H7VA 2I26N 1MNUH 3ESNA 3FQTB 1W15A 4X99B 4YXKH 2E6PA 2EXWD 2PCYA 2X1WL 1QSFD 4PGCB 4AG4H 1MAJA 4KOBA 1CI5A 4OZHE 2P8LA 1UCBL 3MLWL 3HHSA 2UV3A 3X3GH 4JFEA 2Q87A 4JE0A 1CXKA 5E03A 3QDGB 1KCSH 2OP4H 4YXKL 2ZX5A 1MY5A 2CUMA 2E9BA 2IH1A 2AMUA 1KGXA 3I02A 3L6FB 5D7JA 4W70A 4DP0X 3VXSA 4NN6B 4JFWA 3MUZ1 2FWOA 5BZDA 4F33B 4PJ5B 4BQ6A 1M2VA 1FL3A 3GLZA 1KCSL 2OP4L 2A6KB 2G2RA 2R2CA 3NEXA 5CEYA 1BSIA 3I75A 1IARB 3O6MH 2BDNH 1I1CA 2F18A 5FDWA 3FSAA 3ZE0E 1U93A 2HFGL 5EMYA 1JGEA 3U9UA 4EN3B 1F0LA 3PHQA 1JZ2A 1SJXA 2K0RA 5G4MA 4OZ4A 3O6ML 1A3LH 5EG6C 3IU4L 4MZ3A 2RALA 2AXJA 1D6EB 1EV2E 2EXYC 3BGAA 4HS3A 3HAEG 4F2FA 1FYHB 2HX8A 2W1NA 5I1EL 4E68A 4WFEE 2XC8A 4BUQA 3BUQA 4H0HB 1E28A 3D9AH 1TEGA 3HG5A 4UOW1 5INCB 3VQ1C 3HW7A 1K4CA 1R3IH 3ZL1A 5IOPB 2V3FA 2YMXH 4P5MB 4RBPH 4XXCC 5DA4A 5EFIB 3B2VH 2G30A 3G6JA 5J0BA 4MNGB 5HGHA 3RWHB 2EEAA 4O00A 1LEGA 3QJQB 4KI5E 3FFDB 1OGSA 3ALXA 3CSTA 3CFNA 3BRGC 1HEZA 1DQML 2GBAA 1FZOB 5C3IA 2LU3A 4IK6A 1PJWA 4QXTB 1R3IL 5DQJA 3GMRA 4U1JB 1HNFA 5IWLC 1YLBB 3B2VL 4UWQB 3IJHA 4WKZB 4ELMB 1IRAY 1NMAH 3NP4A 1XZWA 5I8KH 1YEEH 1OT2A 5HHPB 1IGYB 4JREC 3X12A 4AH2B 3RUGA 2P5PA 3OHMB 3QJXA 4CVWA 4ETQA 2V2XA 3B7SA 1XGPA 4UANA 3MACL 4AC2A 1AD0A 1KPUA 1OTSC 5E9DA 1CFVH 3RY4A 2K4AA 4BFIB 1YEEL 5L2KD 3MV7E 1E4XH 3UTSB 4L1SA 2XA8H 1MKFA 2HX7A 2DDQL 3MV8B 3S4SG 3WHXB 1CFVL 3HUJB 4M03A 4AQAA 5I18L 3FB5A 3S96B 3SBRA 5BVPH 4ZTPH 1WBZB 2XA8L 1OE3A 1Q0YH 4U1LA 2CK2A 2F1AA 3MREB 1JPSL 3FFOA 5C0AD 6CGTA 3QS3A 2Y36L 3T4YB 5BVPL 5F97E 5C0DB 2DL2A 1EJFA 4M5SA 3WY1A 3KPQA 1Q0YL 2J25A 1QX1A 4LARH 3NZ8A 4PGZA 3GDBA 4OV6F 1IGIL 1QRNE 4KUZH 1T89A 2IDCA 4JVUA 4GKOA 4DK3A 1F4WH 3AXLA 2WSPA 3QJSB 1MCNA 4QNPF 1EDHA 5JHDB 4BWWA 2EADA 1H8OA 1U8OA 2IWGA 4JHVA 5SWQA 1TMQA 3FT3B 1D7DA 2XTJD 1KB9K 4Z7OF 2OXHA 4KUZL 1QTPA 2VXVL 1WSST 5KSVB 1M57B 4WKXA 1I9IH 4NFDA 4FTVD 4Y0GA 4LPTA 3TF7C 2A2QT 4DH2A 3O45B 2YUWA 1QYGH 5L8JB 3WAJA 3QI9A 1U8JA 4NZTL 3BWUC 2R15A 1I9IL 4HEPA 2XFXB 3Q8EA 1OTUC 1IGMH 5B8CA 5TGBB 3KG5A 2JIXB 3QXWA 3R06B 1S7XB 1QYGL 1WFJA 2YD2A 3P11H 1QD0A 3MCG1 1T1YA 4QRUA 2WUCH 4PRHD 3RNKB 3SBQA 1YEDB 5BZXA 1E43A 2OTWA 2Y24A 3ISRA 3IXTA 4RIRB 2GB2A 4WTWA 5DURB 5GSRA 5I0VA 2GABA 2DQ6A 1N3NB 4QJ4B 1IGML 4U3SB 1WG3A 2NRDA 2P5WE 3FCBA 2DLHA 4BZ2A 3ARGB 1S9VA 1LDPH 3P11L 3WXWL 2EVGA 2HMIC 2O61B 4ZUSA 2WUCL 1QUNB 4HIHB 3QP3A 1EHLH 4F7EB 1FH2A 2ITCB 1WFTA 4QHUB 4D0DA 4NLAA 1NGWB 1USZA 3HI1B 5IBUG 5FW6A 4GP5B 4JFXA 3U48A 3WFEL 4TLUA 5BUGA 5CJXA 3CFMA 4OBRA 1RULL 2N1KA 1E5CA 1NGXB 1EHLL 4NDMA 1V05A 4FP8L 1KMGA 2ZUVA 3VFUA 4QTIH 4QLWA 3UBXA 2Z35B 1BQHA 1KEMH 3REWA 1CD1A 4MNHA 4P5TA 3DSFH 3QAQA 1IAOA 4YSDA 2JTYA 4BXSV 2JCWA 3RZCC 2A6DA 3RA7H 4QTIL 4LGRB 3L4WA 1RVFH 3IDIB 3X13B 2XQBH 1SHSA 3KGSA 3MCYA 4NS0A 3DSFL 4M5YH 1YO4A 3N43B 5GSVA 4K94H 3B2XA 3C5JB 4Y1SA 4YHYB 4LLVB 5T1KA 5J56B 1TKWB 1Z32X 2ESVD 4BSWB 4ZSOA 4JY6A 1RVFL 3DJ9A 2P7TB 4JDEA 4KXDA 3QG6A 2XQBL 3RRQA 4NUGH 1Q9KA 2NLJB 5FC9A 1AG0A 2QVTA 5HY9A 3MLTB 4HZAA 2JKJA 4RZCB 3H85A 4K94L 5CR8A 1J5HA 2BNRB 3IMTA 4PV9A 3OAUL 2LAGB 2WKOF 3WEBA 4AEIL 2WXRA 4O2FA 3C6LA 3UAFA 5A2JH 3M1BB 1D2OA 1E2ZA 4ZFOB 3ILPA 3DX4A 2GUOA 2GSIB 4N0UE 4NUGL 2CBOA 4MAZA 1T66D 2VR8A 2R2EB 1CD0A 4PRPB 5CCKH 2XZZA 1E8ZA 4IRSB 5JPMB 4XC1H 3O6FC 3SDCD 1JHTB 1OZTG 2DICA 3B9EA 3ZIMA 4NQCA 3K6DA 2VZVA 3NA9L 3QEQB 4IHOB 5DEZA 2YLKA 4LXFA 4LCIH 4JFPB 5CAYB 3LDBC 4NNPH 1UWFA 1NLDH 3RPIA 3UDWC 4Q74A 4P5RA 1L0YA 1SYSB 2L3BA 3CCHA 3VCLB 1TJIH 2BSTB 2MKLC 4JFOB 4HUVB 5BZZA 3V6OA 3WHE1 4AUJA 3ZKND 4LCIL 3ZQ9A 2AZUA 4NM8L 1EA9C 2H0FA 3MPCA 1PNCA 4WFFE 3KPNB 2UY6B 4NNPL 1NLDL 5C86A 5AKTA 1HSAB 3VH8A 4F9LA 5DRNB 1N0XH 4QJ5B 3BKYL 4F80A 4K94C 4N5EC 4XO5A 4LCCB 1FFNA 3ZZSA 3WIAA 4DP4X 3ME0A 2A6JA 4NBZB 3VXTA 3ISYA 4PJBE 1PJ9A 4OT1L 2X4TA 4PJ7F 1R19A 5EF3A 2YSTA 3QJTB 2NDGA 3U83A 3OKDB 5FCUL 2L7QA 4FQHA 2LLLA 3IPEA 3B3BA 2WIMA 1FORH 2X2JA 3I50H 1HL4A 3OBAA 4H2CA 1HYSC 2HTLC 1SN5A 3SHSA 4PG9B 2P28B 1UB5B 3ESOA 4N0CD 3R1GH 4AT6A 1I7ZB 2DQUL 2DMBA 4MA3A 3T77B 3GMPB 4KH2A 4J1UA 3ROLA 1GTFA 1FORL 4H8PA 4U1KB 3KLKA 3I50L 3M1CA 5ACMA 5GPRA 1RPUA 2D3JA 1I8KB 5IT2L 2IOIA 4UTBL 1EEUA 4UILH 3R1GL 2CKNA 1HQRA 4QXWA 3ZTJH 4BA0A 3HB3D 1S7TA 5L88L 2H45A 3FHAA 1FPTL 4LCYB 4APQA 4G8EB 1A2YB 5I30H 2C4XA 4AENA 2ENQA 2BSRA 2MIZA 1H3GA 3CH8A 3EDJA 3E6HA 5DRXB 1T83A 2J6EA 2JJTA 4JANB 1MW3A 3O2DL 1A7RL 1J05B 3T4AB 5HJGA 2BNUA 3KBEA 5C2BH 5KTEH 5C0RL 2WLMA 1MCRA 3P3YA 5HSFA 3HS0A 3QIWB 1W0VB 1BQLH 2QSVA 4RMRA 5FYKE 2P47B 4CC0A 3ETSA 5CJQH 3B83A 1U33A 5KBLA 4JX0A 5KTEL 1BVOA 4MWFA 5F21B 1AQDA 4JG0L 3H2QA 4GRWE 1CDJA 3D39D 3DRQB 4N90E 5EZLA 4G1EA 3TA3A 5GZOD 5CJQL 1JF5A 1OCWL 2ZICA 4FL4C 1GS8A 1ZCRA 4TNFA 3EW3B 1CZ8L 4NO0D 2BCKB 5D1QC 3BWUF 4YHIA 3RFZC 1IBZA 3T2QA 1NMCC 5A2FA 3ARPA 2WWNA 4DP1X 1DBJL 1C16B 3F7KA 1X5YA 1WV7T 4P2OA 5CP7B 2B7DT 2MCMA 3LB6C 1M7UA 1WITA 3L4ZA 5ICXB 3RWIB 2B3IA 5HBBA 3UTOA 5TDPA 4XNZB 4GMSL 1A4KB 3HNTH 4TQPA 1TO5A 4MAYD 1JZIA 4KXZH 1HWGB 2Y69B 2HLAA 1OTTD 3DSNA 2WVVB 4DQOH 4Z7WA 4JEGB 2H9GB 3OKMA 4OGYH 4X42A 3QC6X 3DX6A 3HNTL 3QCVH 5DUMH 1UCTA 2ED6A 1LO5B 1KLUB 4HAKA 3VDBA 4C47A 3H53A 4GRLD 4HHAA 4ZUUA 1B9ZA 2DBJA 4HWNA 2FRGP 5K9OA 4YHPB 2X4PA 2MPAH 3B9KB 2VN5A 4OGYL 1IEBB 2VYRE 3QCVL 4LCUA 4PJFE 4XPTH 4Y16C 1DZ0A 2BERA 1FF5A 2BHZA 4MS8C 5C0GB 5EEZA 2P26A 3FQUA 1YNLH 3HZKA 3IAQA 1NC2A 4LVOB 4Z18A 3TIDB 3D3VB 2H32H 3ULVD 4QHMB 4XPTL 4BSVB 4UM9A 3GSVB 2PYFB 1E4XI 4GUPA 2D4FA 3EYVB 3F7YA 4G6FB 5HHOE 4IBWA 1SY6H 4L3CA 1VCAA 1QNZH 1XAKA 2PCPA 3OJVC 5IFHH 1YJDH 4FKHA 2G3MA 3DTUB 4HXBL 5HGAB 2O30A 43C9B 1GXEA 3C2SA 2QQNH 4YC2C 5D5MA 4H8HA 2I25N 4RAVB 1SY6L 3V0EA 4KKCC 3O4OC 1ZGLB 5IFHL 1PZ2A 2YBRA 3QUMH 1S7RB 5CEZE 4XN5A 5AB1A 5I66A 4DIXA 1F2QA 2CO4A 2TAAA 2QQNL 4O2CA 2F53B 4ZW6A 5FEBA 3PAZA 4I1PA 1OAYH 3W3BA 5CGMA 1MAMH 3SO3C 4H88H 4Q89A 2YQGA 1JV5A 3QCTH 2IAMB 3QUML 2FT7A 4MJ5B 1TZIA 3JT0A 1XGYH 3T0EA 3TN0C 4ZNEA 1IKNC 2X9ZA 2CK0H 5TF0A 3LCYA 3OKLA 4OZHB 1OAYL 3UX9B 4H88L 1KTRL 3D09A 1YA5A 3QCTL 4IHBA 3VUAA 5JHLH 3EZ8A 3IBOA 3FPYA 3WD5L 2WLIB 4F7TA 4TSCH 3F8UB 2L04A 5FGSA 1SHWA 3MRDB 4NCC1 2G3ZA 1MG2C 3Q5OA 5AVQB 5HHQB 2GKIA 2OMZB 3KPRE 3DPBA 5JHLL 4A2HA 2Z91B 4LP4A 1HEHC 1NH6A 2DQDH 4TSCL 4XP6H 4Y4FB 1AHMA 1ULVA 3P0GB 5F7DB 5CZKA 2JQZA 1F6AB 1MJJB 1YJDC 4IU2B 4PJAF 1UACL 4IS6B 1FVCB 4Y5YC 1O6SA 3B2UC 5GGQL 4KUCF 1KWKA 1ZA3A 2DQDL 4IRJD 2R9HD 2DI8A 2I9LA 3GSRA 4OIIL 3JV0A 5T3XD 1MELA 5F1IA 3T1FA 4H20H 4OZGB 1I82A 3CFDB 4P99A 2Y72A 4XMLH 3WUWA 5MENA 1SYVA 2JKWA 2X9WA 2A4ZA 1EXGA 5KYUA 2HP4A 3QWQB 1CFSB 1ODAA 4FJZA 4KKAD 3OKOB 4YHNB 4LL9A 3W39A 1T0NB 3V5KB 2BFVH 3KPMB 4XMLL 1T5XB 2OTUA 4N2HA 3MBWB 2AJZA 5IREA 4IOFD 2ENYA 3TT3H 4UM8B 1BD2B 2FQEA 4AQEA 2IGTA 1MWOA 4ZAKC 3BE1H 1IGJB 2YPLE 3QUZB 3BH8B 4FXTA 4C83A 5IUSA 2AK4B 1DBBL 4E5XG 1MH5A 2CLVB 1YZZA 2VC2B 5HYIA 1Y6NR 4J3XA 3TEXA 4DSYA 4CILA 4GI6A 3NIDE 3SYAA 3OF6A 2FECL 3MV7B 1Z5YD 3RBSA 2UYLB 1KZQA 4U6YB 1XB8A 2XFGB 3FU9A 2R69L 1JXGA 3VM5A 5H35B 3ZHLA 1NCGA 2YMTA 4Z6AT 5J06A 4NFBA 3WEAA 5IEKB 4MMYA 3GO1H 3K4AA 4ADGA 3RGVA 3S3BB 1D5XB 1I7TB 1TFHA 2UY7A 3QZPA 4XXCA 5LNGA 3NSFA 5IIEA 1DBKH 2W9EH 2ZG3A 1OW0C 3MXWH 5IM7A 5F9WB 2ZWSA 3AXIA 4PJ8B 1KYOJ 2Z92B 5DS8B 1IKFH 1T3FB 3GO1L 3TZVA 3AQDA 3FU3A 1A4JB 1NFDE 4LLYA 3RVVD 5GXBB 5HVHB 5IWLA 3TCLB 1EO7A 3OAZH 4D0BA 2QHRH 4KK6C 1DBKL 1YEWA 2EDYA 2W9EL 4KMLB 4UQBA 3MXWL 1LEKB 1QRNB 1E9QA 4I5BB 1S9YA 5TQ2L 3TVMD 2VL4A 5CP3H 3OAYK 3ESUF 3Q2NA 5KYYB 1IKFL 3HZYB 1U8KB 3AU0A 3KYMA 1T6BX 4LLQB 3F01A 1NBZA 2IOMA 3S8GB 3BZ5A 3ECQA 4B7IA 2QHRL 3NJNA 1J8KA 3MV9B 2K4WA 1TOXA 3RP1A 4QRPD 3B9VA 1JV2B 1K8DA 2PWDA 5SX5K 4GAAA 3MA9H 2GEEA 1JZ6A 2E7DA 1RP9A 2IDFA 4UV7L 3DJRA 2JF1A 4OM0H 4TULL 4IKKA 1JWSB 3LH8A 2IBZX 4TUJA 4PP1D 4J3TA 4C56D 3I6SA 5MHSD 4Z3FA 1NGQH 1UXMA 4XBMA 1OB1B 5FM4A 1FNAA 2RFXA 3QEUB 2A73B 3L3OB 2R56H 1WT5C 1BBDH 1PDKA 2MWCA 1JPGA 1MW2A 1QBAA 1X7QB 1IZKA 3IRZA 3SQBB 1U91B 4WI5A 3BWZA 3AS2A 4IOIB 2F9BT 4CA4A 1EERB 1MJ8H 4IYKA 1A3QA 1AGDB 1SMOA 5TPWH 3NBNA 1IV8A 3KLHD 3PAVA 5D1ZD 4GW4B 1BBDL 3JWNH 3SE8L 3ECUA 1FZMA 2EDLA 3RPBA 4WU5B 2R0ZL 3ZTDC 1MJ8L 1WC7B 2YR3A 1XT5A 1J1OL 4BQ8A 1TU2A 4UAOC 5C09E 2DS4A 2PW2B 4IDJH 4TTDC 2W0FB 2R0WH 4QD2E 3VFSB 1GOHA 4PGEA 1KXHA 4YQXH 3WJMA 5IGXH 3RVWC 1I75A 5B38G 3GPEA 1MFDL 4EKXA 4HIJB 3EGXB 3DIFB 1GW6A 4RQQA 4L4TD 4IDJL 5SWZD 2PXYB 4LHQB 2R0WL 3MV11 3HS8A 2CBTA 5F9OH 1MN4A 4K5NA 5IGXL 2HVKA 3HNSH 1UXSA 4YQXL 5KYXA 3V79C 3J7HA 1OD7A 3V52L 4BQBA 2RACA 2MHAB 3F7VB 2Y7QA 1RUPH 2GJ6A 1CGVA 4WTXA 2ENJA 3QO1B 1N6QH 5F9OL 3ZZ1A 3ZL2A 3HNSL 4BIKA 2NDFA 1RHHA 3I6LD 4X8XA 3QXAB 3DTXA 1AFVH 1RUPL 3SSGA 3KXFE 6FABH 3ZHKA 5FAAA 1NMBL 3L5HA 4AV4A 5FO8A 2YOCA 1JCKA 1CGXA 3L9RB 3VTAA 4JHZA 4NRZB 4MD5A 3FT4A 3MGOA 4JGJA 4QDGA 3JWNC 3GHEL 5DEJA 1AFVL 4N8VA 2ATKB 4GP8B 1T22A 6FABL 2ED8A 4G42A 1G6RH 1YRKA 2B2XH 3MJ7A 5EBWA 3DARA 3WNIA 2OV0A 2BZDA 4N0UB 4CGTA 1OKEA 3LRHA 1AAJA 4I0CC 2Y23A 3NFSH 5AOLA 4EQ2A 5JPNC 4M6OH 1K2DA 1WA2X 5AWNH 3DOIA 4LMQI 1P2CB 3FQRB 4QPEA 4Y4KB 1G6RL 3H54A 3N85H 5E4AA 5MEPA 1WBXA 1AR1D 4QRTB 3TT1H 1C5CH 4ILDA 4KZCA 2YPKB 3WV0A 5DSCA 2Y6SC 3BUPA 3NFSL 1H8SA 4M6OL 1NGPH 5D2LA 5AWNL 4KHXL 4D7BA 1JYWA 3UP6A 1U3HB 3N85L 4KXZI 2ZYSA 5ID0B 5AB2A 1MJ7L 4QOKD 1NPJA 2XPGB 1C5CL 2H7WA 4MGXA 2XN9B 3EYQC 3B9AA 4HUWB 3TT1L 1DJHA 1TVBA 3QIBB 4KWUA 4LHUD 1RIUH 1U8PB 5TE4L 1P4UA 3RJQB 1FAIL 3FHEA 4NX0A 1YECH 4X0KB 2YKLL 2NX5E 3PV6B 4XOAA 5D71H 1VDGA 4PGDB 3EO1A 1Q9OB 2WGXA 2ZX7A 3KH3A 4B9YA 4FKKA 4LAJH 4EZKA 4FQXC 3LD8C 1BVLB 3QIUB 4OCYH 5JDSA 3VXMA 1URLA 3PGCA 3HBPA 3HJ0A 2WQ8A 3H55A 5IB5B 2CR3A 4UOJA 1OANA 2DH3A 4PJCE 4JFHE 5BOJA 4NQEA 5IQMA 4UNUA 2A1WH 3DYPA 5FK9A 3GBMH 3STLB 3A6CH 3QXUA 3V0AC 3O6FA 5ICYA 3VGAB 3Q01A 3DI3B 3GKWH 1NICA 2IAND 3GD1C 3UTPD 2OKMA 2XXMB 1PG7X 4WVRA 4P2RE 2A1WL 3GBML 3A6CL 3UDWA 5JQHC 1HKLL 3NIGF 2BOBB 3MRHA 4AEEA 3CFKB 3KYAA 3VFPB 5DLMH 1H19A 5B7MA 4HULB 1QMUA 4Z7UA 5JW3L 2X0WA 2FR4B 1IC5H 3DMMC 3B56A 5B7FA 3MCKB 1SDYA 2P45B 1QLEH 3B1TA 4KNTA 3WFDH 3GB7A 1FG2A 3FZUC 1WEJH 1IAIH 4AUYA 1Z3GH 4GKLA 4HWZB 3L3DB 1CU4H 2YEZA 4TQEH 4X5WB 3VI4B 4F57H 4JJHA 4IMKC 1WEJL 1IAIL 1KIRA 3VXRE 4JRFA 1A7BA 2Y5TB 4XMKH 4GRWB 4XXDB 1CU4L 1R3KA 5CF3A 4DT2A 1P6FA 2HJFA 3NJJA 4P2YA 2PUQT 2O5ZH 2J5LB 4F57L 3S9DB 4HIEA 3I3BA 1OARH 4KJYB 1H3TA 2HRGA 3NCYP 4L1LA 4TUOB 3FKUS 1G9ML 4WENB 4LOEA 4OF8A 5KW9L 2O5ZL 1KGIA 3ZE1B 3NACH 3TTSA 1S9XB 4JJOA 3EHBC 1OARL 4U0QB 2VDPL 5BRZE 2VH5L 3U4EA 4MXQC 2HVJB 5JIQA 4MA8H 1NZRA 1DCLA 2SEBB 1FE8L 2XSKA 3RWCB 3NACL 2VLME 1D5RA 2B8OT 1ORQB 3IXAA 3ORJA 4NQDE 4YDVB 4WUUE 5EBMA 1JZEA 3CN0A 2APFA 2LE9A 4H25B 3RDTD 1HZKA 2NNAB 3BD3A 3RX9A 4M43H 4MA8L 5DVLA 1QWNA 4I7ZC 4NN6C 1INDL 2NNCA 4LRNL 2DAVA 5E2JA 5DC4B 4HGWA 3SKUD 2AEOA 1ITBB 3DXAA 5MP6L 4Z7IA 3D8MA 1S9WA 2VLJD 1HSBB 4M43L 2FECI 4JPVH 5GQBA 1KXQA 1W72B 3QQ3B 4EN3C 3E3QC 3C5SA 4UTBA 1SLVA 5D1QA 4Z95H 3L81A 5T3ZD 3RFZA 1JPEA 4R4NC 3RDJA 1XCTB 3Q2VA 2C9AA 3MLXL 1HJCA 4I4WA 3QZWA 3O0LA 4JPVL 3RKDD 3O11B 3TPKA 2DMGA 2G4GA 3IF1B 5HHOB 1TG8A 3AROA 2FGWH 2FVNA 3FXIC 1U9KA 3O2DA 4OUUB 4Z95L 1IFHH 2UZIH 5E8PA 5E00A 2OMTA 5IR1B 4X6CA 3BWAB 2VOTA 5CHNA 3IGKA 2PR9A 3QZMA 1HHKA 5AG9A 1T2QL 1KYUA 3RWDA 4B0MB 2FD6H 3U4AA 2VQ1A 2UZIL 1IFHL 1EAPA 3TYFB 4IDLA 3OAWA 4GLRH 1Z9LA 4XNQA 1GR7A 5AVUB 3LZPA 4LDEB 4UQEA 1U3YA 4MJID 4Y5XB 2H41A 1ZLWK 4RWYH 3TV8A 2YOAA 4MA1B 1HVXA 1D7CA 2OK0L 1OT1A 2O5XH 2Z93A 2O93L 2NUTB 3P4NB 3DC0A 2CCLA 2GCYA 2DKSA 4OTXH 4Y16A 5C0EB 4QWWD 1BW8A 5DTFA 5C07B 3NJMA 4K3JH 4PJIA 5EORH 2OCFD 3CAFA 4ORGA 4UUJB 3T1WA 4IOSA 1QBLH 5CZRA 4RMSA 3D25B 1EZVX 1VLXA 3DHUA 3DO4A 1QAWA 4KI1A 1C1EH 2EYRA 3DROA 3RHWK 4GSXA 1NBVL 4OTXL 5GZNC 2KQMA 3V8CA 1WIUA 4K3JL 3WKQA 4ZO6A 5EORL 4G80A 2D3NA 4AIXA 2YS4A 3MQIA 1C1EL 1TPXB 1K9TA 4NKOA 3CC5B 3LPWA 5IP4A 3BVNB 4CNIA 3IPBA 3KPRB 4HEME 3ARZA 3A21A 1AYRA 3O8XB 4U1SB 3V5DB 5KSUB 2AAVA 1UJ3B 2WIIA 1I4FB 4ETYA 32C2A 5EU6A 4DZBB 1P4LA 1DFBH 3D5OF 2D0GA 5I24A 4KNUA 4A2FA 5IG7A 1HAWA 4HV8B 1SOXA 2Z6FA 4DUWA 5J9PA 5IBLC 1O6TA 2QGCA 1VACA 3PJNA 1EFXA 1CDBA 3MRJA 4JQVC 4V1DA 4TTGA 4MS6A 1GGYA 2E7BA 5LQBL 3PJSA 2JV6A 4HZLB 1A7NH 1DFBL 1G43A 1L6XA 1U41A 2AQQA 3DWTA 3ARWA 3K1KC 5AOKA 3VXUD 5GGSY 1FFTB 2G5BB 3QUXA 4W9IC 1IT9H 3RJOA 4LDCA 3AT8A 4HSAC 2GJPA 1IKNA 4XHJC 3SQOH 4CU6A 1I7UB 4HMEA 2W91A 4W81A 1TNNA 2HN7A 4HUCA 4DCQB 3K72B 5FYJH 5FUOH 1A7NL 1XD1A 3ET9F 4FJYA 5D7LE 3WS6C 1A7OH 5ALCH 3QXDA 4L4VB 1I8MB 4K71B 1IT9L 4NSKB 3SQOL 4OZIF 3ECBB 1QSFE 5F7HA 1WGOA 5LAXA 3VFOB 4AC4A 5C0CD 4NQXA 4U1HA 5FM5O 5FUOL 4HFWB 5ALCL 4G5ZH 4N4YB 3ZDZE 4J3VA 2C1PB 1OM9A 1SY6A 1PYWA 1TQTA 3A47A 5C9JA 3GBNL 1MCBA 1RP8A 2RH0A 4PSPA 4LB8A 3SDXE 2YHGA 3BOVA 3NIDB 3BVTA 3ARGC 1GJIA 1UOLA 2FQGA 5ADOH 1X5AA 1M7DB 4YDJB 1VRSA 1YYLH 5FA3B 4KKBC 1KNOA 4FABH 4MLIA 4PJEE 3WN6A 4AKQA 3QUMA 4Z3TA 1JI1A 2F8IA 2EDKA 2ZKHH 2ICWB 4F8PA 1AHKA 1EHNA 2K3TA 3FSOA 1D7BA 5ADOL 3UTQA 4ZFOL 2F54A 4BGLA 2X4RA 3C6EA 3HC0A 2X7LB 3LEXB 4FABL 5FOBB 2VWEE 2DZEA 1HXMB 4PJHE 3EUDA 3L3IB 5L4IA 4NBYB 4PVLA 1CVRA 3RL2B 1NFDB 3RHWF 4ZS6D 3OMIB 2UWEA 5IF0B 4GI9A 3RURA 3GHBH 5JHLA 2PPAA 1HTYA 2ETWA 1RMFL 4BFGA 2PCFB 3B2MA 1FFPB 4ZW8A 2WNXA 4MMXB 3QYMA 2QGBA 1F6FB 4G43A 1OAUH 2LTQB 3R8BB 4P3CH 5JIKA 1DLFH 1YMMD 4YHYC 1WWBX 2GK0B 3CVCA 4Q6KA 1AZBA 2J7LA 2FWUA 3FO2B 4NHUB 1N5YH 4KXBA 5I75B 3EJSA 2EZ0C 1OAUL 3K6NA 1P5VB 3MR9A 3BPCB 1DLFL 2X87A 3ZYJA 4XH2B 5E4IA 1AD9A 3U0TA 3FT0A 4ACPA 4UDUA 1BF2A 1FHGA 4UDTB 5L2KE 1CL7H 1N5YL 4JDVB 5FO9A 2WZ5A 2AKRB 5KS9E 5CD5C 3JTSB 1LK3H 5B4MD 1OW0A 1MXGA 4BE5A 2WWMD 2XG5B 1G7JB 5AW0B 4IRSC 1LQSR 3UIZA 2E9GA 3MO1A 5JPMC 4K2UH 5JLZB 2F74A 4LLUB 5BOZG 1MF2H 5HDLA 1CL7L 3DTDA 3ZTNH 5E9AA 3W81A 1FNEA 1KIUB 1LK3L 1N5AB 3VXPB 4HOZA 3ABKB 2J73A 2Q3AA 2VABA 1WCBA 1BQRA 4K2UL 4KK8D 5GGTH 1S5IH 1MQKH 4DP8X 4U1IA 4XMXA 2D3VA 3RIFK 5A7EA 1CFQA 4G72B 3ZTNL 1DVTA 3R18A 1QG3A 1QFOA 2AV7B 1DO6A 1ZHKB 4K5OA 4U1MB 3WY4A 3ZY7A 1JHKH 3R7QA 2MOQA 4J6IA 1S5IL 1MQKL 3CIQA 5EU3A 4KJPC 1HHHB 1L9QA 2R69A 4HJEA 5E8NA 3BVWA 3I2CH 1NEPA 1KTCA 4NOFA 4EXKA 4OFQA 4NC1E 1ESOA 4LCCC 5I0ZA 3P2BA 3VGDA 1TFPA 3AWFA 4ZMAT 4ZD3L 4ELMF 1MHHA 4BHUI 5J6GA 1RZJL 2DWDA 1WT5A 3AT0A 1JZ8A 1WUNT 2VE6A 3G6AB 1NBYB 3I2CL 1R0AH 1J9CT 3HCVA 4FTVE 3HE7B 3X14A 5HYQB 2APXA 2FIRT 3FT2B 3GC3A 2CKBL 3V2AR 4OAWB 5DHXB 4G8GE 1MJUH 1U8NB 3N41B 4Z7VE 4KDVA 5IHUH 1ZSHA 3KXFB 1ID5I 2ZAHA 4OR1A 2LU7A 4A37A 3QJHA 4XNMB 2VM4A 3H3KA 3SDYH 1L3WA 4WK0B 1T21B 3PU7A 3HUJF 2C9RA 1J8HB 4X6FA 3IFLL 5IUCA 5FFOA 4PRHE 3C75A 4I18A 2H3NA 2GBTA 5IHUL 2FHFA 1U92B 3TPUA 5D1XD 4XWGL 5HXMA 1F02I 1AGFA 2JCCA 2VLLA 4LQFL 5CP3A 3SDYL 2WXGA 3X11B 5HVWA 2PTTA 5SV4A 4K0OA 3RI5F 3LRMA 2BVEA 2MQCA 1CVSC 2GG1A 3FO9B 3RPKA 3WL9B 3T4AC 3OTTA 1T1ZA 2ZP9A 3DRTB 4FHJA 4XMVA 4ELKB 3GQFA 5J57B 1F4YH 5CR1A 2JK5B 4NM4H 1CDYA 1MCIA 1CN4A 3GMQB 3OSKA 3WOVA 1T03H 4Z76B 1U4FA 3NJKA 2F8XC 1N70A 3QIWC 4OCRH 4ISVB 4UZUA 1HWWA 1ZVSA 3LKOA 2XXGA 1BQKA 2NW2B 4E9SA 4GAJL 1NWPA 3R0NA 1REIA 3DPDA 4J4PC 3PCYA 3EGSB 4XVSH 4XO8A 3W9DA 3MX0A 25C8H 5I5JA 3U9WA 1XH3B 4J3OD 3BW9A 3IMWA 1LYQA 4JRWA 5C0BA 1SZNA 1AMXA 2AQ3A 2DQFA 4HJGB 1G7PA 5EN2B 3SCMD 3W57A 4L8DB 5DMJB 5DRZA 1JHLH 5HPMB 4BQ9A 3B4NA 2H2SC 3MVSA 1BDYA 1Q94B 4XVSL 1WS7A 1RKRA 25C8L 2XWJA 5MEOB 2NXZB 2FCBA 4ZMXA 3RIFF 3INUH 4NRYB 1THCA 2ESVE 4P2QA 4RDQG 4X4YA 1JXKA 1LO2H 2G60L 5A3IC 1JHLL 5JPNA 1RK0B 2YRPA 1NCNA 3P9WB 4AYBA 2LLNA 4YAQA 1OGAB 1KBBA 3D2UB 1GGIL 3QE5A 3FK3A 4XNZC 3GK8H 1MLCB 3INUL 4ODXA 4BK8A 4JO5A 4D9LL 2X5PA 1LO2L 2VR7A 5AAMA 1D6VH 1SJHB 4CDGC 3HRZB 3SBPA 3KLDA 2G9HA 3NFNA 2XJLA 1HH9A 3PWUB 5T1LB 4WO0A 1BXXA 5C08D 3BWSA 4R2GB 4LCWA 4URTB 4HIIB 3UTTA 2XNAA 1D6VL 4GLRI 1LMIA 4JG5A 4Z5RB 1I9JH 1HJBC 1HOCB 4WTZG 4LL4A 5IK3A 4YHML 3BAWA 5MERA 4CVXA 1XBRA 3B9KC 3BD4A 2GTWA 1VZGA 4XPFH 5BCAA 2EO9A 1BYOA 1X6LA 1MLBA 3RWEB 2J8UA 1JN6A 4X7TA 1LEIB 2BP8B 1T2JA 3FOLA 5I2IB 4FQXA 3SYOA 4LVOC 1I9JL 2QT6A 2YZ8A 3LRSB 5DWPA 1ZRUA 3QGVA 1FYTD 5DD1H 3LXUX 4BFNA 1O7DE 1X5MA 2FB4H 1TR7A 5BUPA 3M46A 1PTZA 2E76C 4F2MA 3GMMB 2OMYA 1T20A 1G6RA 3N43F 4JFZH 3HVDA 2EDJA 3TS8A 3OG6B 4PCSA 4PJ9D 2ZUQB 3VXRB 3GSWA 3UAEA 4NYLB 3CJJA 4WI8A 1JVLA 4KO7A 3VXQA 4Y4HD 1QFWL 3CVDA 2J3SA 2PF6A 2W92A 4PR5A 2GY7B 1JGDB 5I8CB 4Y89A 5LCVH 2HJKA 4OZFB 3RQ3A 5EOCH 4DPAX 4KKQA 4DTGH 4WNQA 2Y22A 5JW4R 3BRFA 4Y19D 1MIML 3CSYB 2Y5QA 4ES8A 1KPVA 5LCVL 5EZIL 1WZKA 2NTSP 5KUKA 3DMMA 3MYZA 1JNLH 5EOCL 3PQYD 3DK2A 5CU5A 3U6XS 1QUPA 4HWBH 3T8XA 2IAMC 3WNJA 4FN0A 2AFNA 2XWRA 3VMNA 1DE4B 1Z5LA 1U42A 3PWJA 3KWWB 5A7BA 1ES0A 3MJ6A 1JNLL 4AW7A 2HT3D 5DLLA 4XMPH 4EUPB 1HCFX 1WQVT 4ZODA 4AIZA 2BVTA 1G7QB 3FN3A 4N2AA 3NZHH 4PCTA 4XI5D 1TETH 2F58L 2J4WH 5IW1B 4HJ1A 4IMKA 4GW1B 3CFCH 4YL9A 5EU4B 5F0JB 1RIHH 2VRKA 2VC2H 1EVUA 3G5YB 3HG1D 4MSWA 1UB6A 5DHEA 4XMPL 2P80A 1LMKA 4E41B 1JSYA 2XN2A 3B5GA 5IJDC 1RHFA 1OB0A 1TETL 1QFUH 3CFJA 4G6KH 4Y4FC 2BS8A 3D1MC 4JFED 3CFCL 4OCNC 5FCSH 1AS8A 1F3RB 1IQDA 1RIHL 3EOTH 4PTTB 4Z7QE 4WUKH 2KLRA 5D7JD 3EZJB 1ZHLB 2CNZA 4HKXA 4PEEA 1J86A 4LBEA 2A9CA 4G6KL 3TBSA 4HW6A 1MI5E 4LESA 1A9EB 1IAKB 3D39E 3MOBH 2BVPA 4LEOA 3CG8A 3EOTL 5AYQA