4AV4A

Fimh lectin domain co-crystal with a alpha-d-mannoside o-linked to a propynyl pyridine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVNLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 32
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av4A00
4AV5A 4AVIA 5IQOA 5AB1A 4X50A 3BFWA 5AALA 3JWNE 4X5PA 1PDKB 2UY6B 3ME0B 4AUJA 3JWNG 3SQBB 2VCOA 3JWNH 4X5RA 3BWUF 4CSSA 2XG4B 5LNGA 5IQNA 5CGBA 2J2ZB 4BUQA 1TR7A 4AVJA 5IQMA 4CSTA 5LNEA 3ZL2A 5FWRA 4CA4A 3RFZA 2JMRA 1QUNB 4ATTA 2UY7B 1UWFA 4XO8A 4XOCA 3ZPDA 4XO9A 4AUUA 1KIUB 4X5QA 4AVHA 5JQIB 5AAPA 3MCYA 4XOEA 4J3OF 5F3FA 1N12A 5F2FA 4AV0A 4XODA 1ZE3H 5ABZA 3ZL1A 4AVKA 2JTYA 4XOAA 2WMPB 5FX3A 5FLUA 5FS5A 3BFQG 2XG5B 4XOBA 1N0LB 4AV4A 4LOVA 1KLFB 4J3OG 4AUYA 2W07B 4J3OH
chains in the Genus database with same CATH superfamily
2FEDD 5IGXL 3FQ2A 2YGPA 2NY4D 1BAGA 2X3BA 1FV1A 4HC1A 1DEEB 3MV11 2WXQA 3LNGA 4OLXH 1OZUA 1RFDH 5A7EA 3VE0B 5I66B 5C0RH 2XZQL 4IHBA 5I30H 4OZ4B 4WTXA 1RP8A 2PETA 1YY8B 4GBXA 1Y7VA 3OZLA 3DUSB 1MWAB 2GPZA 4JPVH 3MKKA 3IDNA 5DD5L 3V0VA 3QCUL 2R69L 1GYAA 4PRHE 3CFCL 4FQJL 4G7SB 5MP6H 5TPWL 2JK5B 3CU7A 2HJFA 1QKZL 3GKWH 3W37A 3IU3B 2ESVB 3BC9A 3MCLL 1WCBA 4WEBL 1T1WA 1I7UA 5F9OH 2CRMA 3Q6FB 4NHUA 3IETB 5IF0B 4P05A 5C0BE 1SHWA 4LKCB 3CFIC 4NENA 1F42A 3ASWA 3FT4B 2WBJD 4RBPH 5HHXL 2VDRH 2IOIA 1SOSA 1DFBH 1E50A 1EJ8A 3ZYIA 1A1OA 1DJSA 1YEGH 4G8EB 1OSZA 3VM5A 2AFNA 2BCKB 2VXVH 4PU2A 5L0QC 1UKTA 2ODIA 5I73B 1D5IL 2NY2B 5CZRA 4L8BA 3KE0A 2G5BA 3TYFB 5CLYA 3BPNB 2CMRL 4FABL 1A1MB 4JREB 2NR6A 2BOBB 4J4PA 2NXYC 3G6DH 3CFJB 2H8PB 3VXSD 3NEEA 1MW3A 15C8L 1BJ1J 2ERJB 1QW9A 4JVUA 4LLDA 4W9ZA 5D1XC 4APQD 3CLFH 4O58L 3RX8A 4LLYA 2RH0A 3LDBB 1SDDB 2IOOA 5KS9B 1OCWL 3PUUA 2VDOL 3UZQB 4R7VA 1XTLA 4D7PA 4RGNE 1QSFD 3SKMA 5JOPD 4QWWC 2BVPB 3ZN6A 3ZZQA 5I1LB 3IFOA 1BX2A 1HSAA 3D6GA 4MJIE 1JZ5A 2ZXCA 3CVHB 5EU6E 2WB7A 4N26A 3GO1H 3CLEL 4RGOL 3UZVB 3FFCE 3QYCA 2HFEA 2V9TA 1QHQA 5FV2A 2PR4L 4NC0B 1Z9PA 2ZG3A 1HJCA 3VCLB 4P5TB 4HCFA 1RV6X 5E8DH 4XCYA 4LKXA 4QHKI 1WK0A 3HE6A 1G7HA 5C08A 5CBEB 2BVTA 2G5UA 3FZUC 4S0TD 5AUMB 3OLGA 3MSPA 2PW2A 4N4YB 2GSMB 4FZEL 2BCMA 4P2QB 4IDJL 4Q9QL 2PCPA 4HUWB 1UJ3C 5HJBA 1VENA 3DROA 5AENA 1LO0L 3WY4A 3KL5A 4LL1A 2J1KA 4YSOA 2GK2A 1XGTB 3D1MC 4WGWB 1SXZA 5DJ2A 2GB2A 3OR6B 2K3TA 4I2XB 3DUUB 2VERN 4DUVA 3ULUH 3ILQD 1DL7L 1IBZA 4ZI8A 4L3FA 3C09B 1UWEH 3C8HA 4RFNC 1IVLA 4K5OA 3WI9A 4NPYA 3QJHA 1W91A 3QJRB 4RIRA 1OSPH 1WEJL 3LEVL 1GAFL 2AV7B 4WKZA 1ZTXE 3C5ZA 4XP1H 4G8IB 4WI6A 4J1UB 2BNQA 3J8F7 2B08A 4JLRB 1RUQH 2YS4A 3TEXA 4ZAKC 5IJDC 1SYSA 3UTQB 2VRQA 4MJHA 2MSPA 2FX8L 3F12A 3CFKB 2AI0H 2YIHA 3FULA 4M7JL 6PCYA 2VE6A 4ELMB 4Y5YA 2JSFA 4XAKE 2D3NA 2P5PA 2P49B 4C56E 4FNPA 4MNQB 4X0KB 2F7PA 1CLOH 3K6FA 4A6YA 1FORL 3RZCA 25C8L 4OFYD 2J6EA 4PWEA 3ALPA 3AM8A 3ULVH 4ZX4A 3OMNB 1U58B 2F7IA 4U6HB 4GY4A 1KJVA 4XP5L 3O45A 2VXTL 2XOTA 2H1XA 2R1XB 4YDNA 3RWCA 3WIFB 3MZGB 1SLXA 5DUPH 3HG1E 1F00I 5IG7B 2ZF9A 4DGUA 4A7TA 5IFHL 4U0RB 3K5RA 5C0EA 5HJ3A 5DRXB 1R5VB 4NRXA 4XO9A 5C07D 4UDUB 1KJ2A 1MCCA 1MWOA 3HE7B 1KXQA 3QG7H 3KPMB 3VI4B 2F19L 4CC1A 2CKNA 2HTLC 4JFXA 1RPQA 5E6IC 1YEHH 5A7BA 3MJ9H 3TA3A 1SMDA 4JFHD 4NO5A 2F1EA 3BMVA 3OXRB 2VDNH 4GT7A 1FG2B 2WB1A 4M3KB 5D6CA 1P7KB 2IIJA 2XC8A 2CAKA 3OJDB 3B9KC 3WNMA 5JPMC 5DS1A 4M3HA 5I0WA 1KTDA 1K8DA 4UQ9A 5T1DL 1UCBH 2YD0A 4QAMB 4PTTA 1GY1A 2L4OA 4NNYA 5GRYA 2K1MA 1E4XL 4KTGA 4AQAA 4Z7AA 5LJYH 3DIVA 2GITA 2JLPA 4N25A 5K33A 2YD7A 1KG0A 1U3HD 2J6WA 2GAZA 1N6VA 2NDFA 3AXLB 3I2CH 5LBSH 2J25A 2B5IC 3QEUA 2KZBA 2Z8VC 3SDDC 3UEQA 4PGJA 4PI2A 3WFDL 1LMKA 4I18A 4ZMNA 1NWPA 3DIFB 4KRNA 4AUYA 4CSPA 2VW4A 2GVYA 3RWIA 3RAJH 2IMMA 2XVKA 1D7BA 4XMKH 1A6AB 2R27A 5D7IF 4PY7B 4BQBA 1C8QA 3FB8A 4ELKB 5HGHA 5KJ7E 2OMTA 4ZUVB 2VLJB 3EXJA 1T5XA 1IT9H 2DYPB 4QOKB 1CU4L 2DRUA 4NKQB 4AYFB 5KVDE 3WELA 4KK8C 4XNXL 1HIMH 3AABA 1WIOA 4GAGL 1CF8H 2Z93A 3DX6B 1JGLH 3D52A 3B83A 3G5YB 2JJSA 2VO5A 4ZTPH 5B39G 3TT1L 1EJOL 1MCOL 2B16A 4AW7A 2HB0A 2BFVL 5F7UA 2Y7MA 3T1FB 4XPGH 1RIVL 2NY1C 3VSTA 3GXFA 4UB0H 3TN0D 3U1QA 4IS6A 4FFYH 5HI4D 1JRHI 4X5RA 4PREB 5DJ8A 1RUPL 1F2XK 3W9EA 2IH3A 5IEHB 1ASQA 2VM4A 4NB7A 5L0QB 4J23A 2A9DA 1MPAH 4UDTA 3NRPA 3OKYA 3SCMA 2X09A 3QVAA 5HD8D 2R0ZL 2NXYB 4HGKC 3DJTA 2ZKWA 3DX9A 3KGUA 2YD6A 1ZLVK 4J6IA 4FA7B 4ZRGA 1BAFL 3L4UA 5T1KB 3VFGH 4D8PB 4LVOC 5D1XB 3B2UD 1HL8A 2JMRA 5DUML 1ICTA 3BCFA 3NTCL 2WUBH 1RZ8B 1WBXB 2P7TB 3FQWB 5DJYB 1MEXH 1GIGL 1R46A 1Z3RA 2X4TB 4U3CA 3FUNA 2UY7B 3VUAA 5C08E 3GMQB 3EW3B 4EVNB 1A7QL 5EF0A 3MTXA 4OQ1A 4Z7OF 1KXTA 4I9WE 4JFFD 3GHEH 1MKFA 3WN5B 2NY0D 1BXAA 2ZCKH 3GHPA 2LTQB 2AQ2A 2FGWH 3CC5A 3A4DA 1X4XA 1ZWIB 3OKLA 4GRMA 2HRPH 4NQSA 3ULVD 2ZUUA 2LV4A 1KCSH 3WKML 1GZQB 4KTYA 3MRHA 1CWVA 1QFWM 5F1KC 1OGSA 3HHSB 5I8EB 3WV0A 4DQAA 3MRBA 3UC0L 3O4OB 3DYPA 5C6PB 3C6LC 5CIPB 1IJNA 3AMLA 5E1HB 1DDTA 4UWQB 4BCXA 1IZKA 4J12A 2I7OA 3CH1A 1U8NA 4PJHA 4UZUA 5FOJA 5FGCE 5TJWK 2WXGA 1WICA 5IK3A 4HWZB 3GBMH 1UXSA 4RFNB 1ETZA 3PDOA 4BUHA 2X9XA 1ES0A 1EJFA 4XVSH 2GIXA 2VDOB 3PWNA 2VITA 3IU4L 5DQJB 4A7QA 5I1EL 2DLHA 4G6MH 4O5LH 4Y4HA 4X50A 1MNNA 4M1CD 3MLUL 1MCWM 2YRPA 1KSRA 4FFWC 5EC1A 4GSRA 4IRJA 3UGXA 1AMXA 5BV7L 2GQHA 3C60A 3IGFA 3JTBA 5KW9H 2Z31C 4ONGL 3PWUA 1B4RA 1TQUA 2NZ9C 3QO0B 3U9UB 4N6RA 3U7YH 3W0WD 1TU2B 3GIZH 2IBBA 5FR3A 3HJ0A 2YXMA 3KPLA 2LABA 5GGRY 5F7HA 1BP3B 5GJSL 1RIUL 1ZDQA 1ERNA 1IQDA 5EZJA 2XQYA 5IB4A 1CFNA 1UWGH 2CR6A 1MCKA 4LMQE 4TRPL 2VRAA 1DDHB 2VSMB 1KXQE 1I7ZB 5DMKA 5ICXA 3RFZC 5E4IA 1JGVL 4XPTH 5FFOA 3UP6A 1ACXA 3CTTA 1JWSA 2Y7QB 1GS6X 4XWOC 3T4YB 5DHVH 4OCRL 3IFLH 3FRPB 2YAHA 4NKDB 3E3QC 5KZCD 2DQMA 2RCSH 5TDOB 3ZSTA 3CFQA 3BW9B 4IMKA 1AP2A 1J1XH 1GZHA 1W72H 3FB6B 4FTVD 3NIDB 1F5WA 4JQVC 3CHPA 2OMUA 2WBJA 1QR4A 3L13A 4K94H 1RCYA 4M7LL 2H6UA 5FK9A 4KXAA 1JPST 2F53D 3QDGE 5E6IB 3F2LA 2X4RA 1UA6H 3MLRL 4KH2A 5BV7C 5IFJB 2HRLA 2YXFA 4TVPH 4RA0C 2FYYB 4M43H 3AREC 1RJYA 3R06B 3KYAA 2IGFL 2V2XB 3GGWB 4FXKC 4OZGA 4QUOA 3VXSA 3HB3D 3RTLA 1M3JA 4NP4L 1MFDH 2DEWX 5TQ0H 1HSBA 1FZMA 1LK2B 4GH7B 4YAQB 3RRQA 1SHXA 4UZGA 5F3HB 3L3IA 5AOLA 4APQA 1F3DH 4BK8A 1CB4A 2KS0A 1HFUA 2NLJB 2B5IB 1RVFL 2NUTA 1Z9OA 1ZPLA 3BQUA 4HS8H 3B7RL 3CZFB 5LBVA 3VFUA 2CBTA 2CBMA 4L48A 1CQYA 5ESAA 4NUMA 1XXDC 2QTEA 1JPSL 2CJSA 5B38A 2EH7L 5I8KL 2X4UA 3O6FC 4RQQB 1PG7H 2PW1B 3KM2A 1T7WA 4PRDA 5FGBC 2CUHA 3TIEB 1EDHA 5EUKA 4OLUH 4DESA 1OB1B 4JFYA 2A74A 2AQQA 4Y2LA 5IROC 5FYLH 4EOWL 4H2AA 4P2CG 4MA7H 5AKVA 2ZYSA 3RWDB 4DCQB 1NSNL 2LOEA 1DQML 5I82A 4DHLA 5DHDA 5IQ7L 1WFJA 4M5TA 3VSVA 3IDYC 1UADC 1RJZA 3QDJD 3O6LL 2XQ0A 4I5BA 4M8UA 1XGPA 1BQ5A 4MQ7B 3EYVA 3MRJB 2HRGA 3VYNA 3V4VH 1L9TA 4FQCH 5C3TA 2OZ4L 4UINL 3X13A 2EC8A 5LWYL 4ODVH 3U4KA 3ZTJH 1JFHA 1G84A 2EZ0C 1OD9A 1ZLVH 4YGVA 3ZMEA 3RL1B 5FA3A 2X4QA 1I8MA 5EEWA 4E9VA 2VCOA 5E6YA 2D4FA 4MLIA 4R0LC 2HH0H 2ZCZA 4RCAA 3TBSB 1UXWA 2JELL 1J11A 4JE4B 2EVIA 3IK2A 2DQUH 5EZPA 3LIZH 1CC3A 4LVOB 5IFAL 3C12A 4HKBB 4F57H 1CGYA 1KXVA 3P9MB 4HALA 1PBYA 4QY8B 4NO2B 4P23A 1BG1A 3T0EC 1FYTB 3NJFA 2GI7A 4J27A 4QF1B 2NY3C 3HTLX 3BZFB 5IQMA 2WZPD 4JGNA 3S7GA 1IZJA 2WWNA 5FCUL 2V17L 4PS4L 1TJGL 3QUXD 3MUJA 5DEZA 2K9FB 1NCJA 3GS4A 3GSRB 1AY1H 1A7PH 1GGBH 4R96A 4JFQB 5FO7B 4DVBB 5IT2H 4OFYA 3TF7C 2JQZA 4P8QA 3OKMB 3IXAA 4W6WB 5D7JA 5F8RC 1PY0A 4IRSB 2N7AA 1LO5B 3KXFA 3PGCA 2DTMH 1GS8A 2Q6WB 1NTDA 3V95A 3OHXC 4PJHE 1OY3B 4OF0A 1BZDA 3S3DB 1AKJD 4P4RA 2WXJA 4D7BA 3JWDH 1KEML 1MQKH 3VWKC 1Z1WA 2ITFA 5C07A 3QULB 2BHFA 3IB4A 5EBLB 1H0DA 3GB7B 3C6LB 2GSGB 2ZX8A 3L4TA 4JS7A 3QI9D 4OTXL 4XTRD 2AJSL 5DD1H 2A6JB 1N67A 1ZANL 4QHLA 3WNJA 1N5AB 3D3VB 3PDGA 2IALB 2JKTM 2JCCB 2IG2H 4O02A 1M4KA 3UCRA 1GYCA 3ARXA 1E6OH 1T89A 2Y25A 4TPRL 3KPSB 1VGKB 4RMQA 3RL2B 1KGJA 5FGRA 1UT9A 1F11A 4LHUD 2AGJL 2PABA 4HF5L 2WLHA 3V4LA 3CN2A 1MOEA 3U0PA 5CXPA 5E2TL 4PV9A 2F2HA 4XOBA 4JQXC 4M93C 3AROA 2ADIB 1QLFB 2KLTA 1U3HA 4OGYL 5LUMA 2YD9A 3GMLB 4KHTL 5ALBH 3CSYA 1FGNL 3SY0A 1NFIA 3W11D 4CMHC 2I69A 3RJDA 4DGVL 1GXEA 3T3ME 5D71H 2AEIT 1AQMA 3PGFH 4NT6B 4WEMB 2HA1A 3FYIB 3H85A 5HHNA 2X05A 5LAPA 3MLTB 2OMBA 5KSBA 3POCA 4LBEA 3FU7A 3ZSSA 1IGCH 3BSGA 3RFZB 4TQIA 1NMAL 3VD2A 4KV5F 5C0CB 2H0PA 1HCFX 1PTZA 2OMYA 4Q97A 4RH4A 5FYLD 5BUAA 2ZWSA 1VJSA 3FAWA 4AYGA 1JWUB 1TLMA 4ZYKB 4GRLB 3ALWA 5CCGE 4Q52A 4NDMA 3F8UB 3W9DA 1JZDC 1UD5A 3BLPX 2DJMA 3ARBC 3A6BH 1BXUA 1TSRA 1Z5LB 2FH6A 3KL0A 5D7LD 5L4MA 1F02I 1L6ZA 5J6HB 2I9LB 1HILA 1ZHNA 1LO2H 2A38A 3JT0A 3WD5L 5BV7B 1D5XA 1GOGA 1MNUL 4HUCA 2Q76B 1NBQA 3T8MA 1F97A 4AVJA 3IGKA 4XT1C 4DO6A 3RDTC 1I3RB 3GXDA 5E8EA 1AQHA 4C4KT 1CD8A 5GJTH 2FEEL 5DEFB 3FQXA 1M7IA 3RWGA 5JOPE 3GHBL 4Z23A 2PYEB 3UO1L 3FUKA 4OZHB 1FYHB 1MLBB 4U1MB 3MOAH 3S3CB 1G6RL 5GGTH 2EACA 3H9SD 1OAUH 5C6TH 5K39A 3EIFA 5E7FA 4YHOH 2V7HB 4WK0B 3H42L 1VEOA 4TSAH 1IU1A 2BIQA 4JN1L 4XBEL 1J48A 1NGQL 1SYVB 1VEPA 5KSVA 4HPOL 2YQBA 1SDYA 3N42B 5CJQL 4ENEC 1QTYT 4ZSOB 1SJVA 3NCMA 3NIFF 3TPUA 5BOZG 3W1ZA 4NJ9L 4ZUUA 5E2JA 5CEXB 4JFFA 2FGZA 3Q44A 3S2CA 4UTBA 3QZOA 1R4XA 1ZLEA 4YUEL 1IC5H 1HINL 4Z78A 1DN0A 5B8CC 3CZLA 5AVZB 3TWCL 3MRLB 4QO1B 3D39B 1UD2A 4CMMA 1PIFA 4YHYC 2FH8A 3WFEL 2P5WA 2YKKA 1SRDA 3FMGH 3IBOA 4YHPB 1HKFA 2BSBA 4L4VB 1KZQA 3ZRFC 1IKFH 3IDYB 1DLHA 3BLBA 4MRCA 1JL8A 5TDNB 5CS7A 2O6CA 3BZ4A 4F93B 1Q9OA 4Y1AB 2AJVH 5I6OA 5E6ZA 4GMSH 5IHWA 3ZDXB 2XBZA 2DQHH 3REVA 4MX7B 1OM3H 2WVUA 3SKNB 1WPCA 3TV3H 4JZNA 4H7VA 4NUQA 1JGDA 5BZDB 2PYFA 5IBLD 1MVUA 4NFCA 2NT1A 4TM9A 4ZMWA 4OFPA 2MHAA 3JV4B 3GBLA 4XXDB 1PFOA 1NBVH 2WXHA 3GMPA 1NCAH 5DC2A 3T6QC 2NW3B 5F7DA 5ID1B 5PAZA 4JRXB 3RX7A 5KYWB 3WTTA 3G6JA 4HJTA 2EDWA 5HDBF 4FFVD 4BWTA 2VERA 3T0EB 2OCJA 4YIQA 1QFUH 1U92A 2NY3B 3KXFE 4HIJB 4IRZH 2CO1A 2CBOA 2CA3A 4PB9L 2ZJSH 3KS0H 5B39A 4L1SA 2AXFB 1ECYA 5JIMA 5T1LA 1TJIH 5FYJD 4HJGB 4EBQH 2APBA 1N10A 4N3TA 1TJHL 5C07E 1VADB 3FUEA 5K9QI 3CFUA 3LMJH 3LEXA 3LY6A 2CHWA 2W0FB 1G1KA 2LR4A 2ZPKH 3WIHL 2E9IA 1IAII 4ZW3A 1B2WL 1OGTA 4OM1L 1SOKA 4YSDA 1SY6L 4RX4D 3OHXB 5HGAB 3OR7B 1GGIL 2XZAH 2YPLD 4PJIF 4F24A 3WLWC 2LU3A 4DZ8B 2X87A 4JFEB 1A3LL 4U1HB 3M45A 4O00A 3IJEA 4FTVA 2UWEF 4PCKA 2CHDA 2GIMA 3KYKH 4Z3HA 2VMEA 5DJXB 1YMMB 1L9QA 2F53A 3B4NA 3VD7A 2VZOA 1HOCB 2BS71 4MXWH 2XWTA 4J8RB 1NKRA 1QFOA 2ILLA 4NZUL 4NYLB 1Q1JH 4ABWA 2ICEC 3D4GA 3RVTC 3VSUA 3B7YA 3WL9B 4CVXB 1JK9B 5DDHB 1FG9C 4F1ZA 1MJ7L 3O0RH 4HKXA 4MMZB 1TQCB 2G3NA 3TJEL 4NI3A 3EJPA 2NY7L 4AGMA 1U8OA 1XVSA 3IGAB 1MRDL 3NQIA 2WSKA 5CSZB 5FW7A 4F7EB 4IJ3C 3VD0A 3QXWA 4KH9A 1UM6L 4KKAC 4V33A 3HMXH 5KSBE 2Y5QA 2WMPB 2XKUA 4OFQA 3OQRA 4XN1A 1QSED 2ZOUA 4O51B 3VRIB 3M1CA 4Z1PA 1MCIA 4YSPA 4YDIH 1G9NH 1YPZA 1U93A 2FATH 4XC3L 2WUCH 5F6HI 2BK8A 2VXSH 2ZD0A 5GGSY 3BKYL 3D18A 3QIUB 1OAZH 1PSKL 2UZXB 3T6XA 3OF6D 5DJAB 1HZHL 4MTMA 2FT8A 5EIIB 3HN3A 4ZFOL 4H4NA 3SD2A 1P5UA 2NX5B 1BEXA 3LB6C 1YEIH 4NCDA 4QRBA 3LXCA 4HKJB 4WI2A 3ZDZE 1UGKA 4WLCA 1CDHA 1WD9A 5IB2B 3NJNA 1PF3A 4Y9GA 3QP3A 5AVVB 2AXGA 1T3FB 3QDJA 2Z8SA 4F3FB 1INDL 3AG1B 3HKZA 4UNIA 4XE5B 4U1IA 1A65A 3ARBB 1HL4A 2VUYA 4NXSA 3VU1A 1GW6A 1RK0B 4ICXA 1YECL 4UV4H 1JHLH 4AQ1A 3VB9A 3RIFF 1NCGA 1KYAA 2AEQL 5H2BA 3NSFA 4G8GA 3FN0L 2X3CA 3GUTA 1SEQL 3HCVA 4JM2F 3HLAA 3LZQA 1UKSA 2KYIA 3RDTB 1XSJA 5HHMB 1AR2A 3CZUB 4GXVL 2VB5A 3O3UN 2QGEA 2P52A 4KFZC 4N8CH 5DXWA 4ANUA 2BDNH 2FWOA 4L3EA 4JFFE 3UACA 1E42A 1I9IH 4Z8FL 3IWUA 3OC8A 3A67L 2GBUA 5FWRA 4FNSA 1E9QB 2M26A 1DO5A 3IF1B 1UXMA 2OJEB 2WNGA 5CHNB 1QZNA 1QO3B 2WZPA 1W8EA 1TTBA 4NP9A 2P5WE 1X3DA 1QR1B 1W80A 5L2KB 4PGDB 4D0DA 3OKOB 3KYOA 3QUXA 2VWEC 1VPOH 5ESQB 3ZGIA 3H7LA 4FNLH 1ETA1 5GS1B 3EH3B 4PD4K 1IFGA 4KY1L 3G08A 3ARWA 3F00A 4MNQD 4BK4A 2FWUA 4C47A 2DZEA 2YRZA 2QGBA 1N70A 4N20A 2C3GA 5CNHA 3S5YA 4RAVA 1KCKA 1QPPA 1XH1A 2QR0B 5C0NC 3ARGC 4G11A 4AJ0A 3T0WA 2HWZL 1AKJA 1LGVA 1IEAB 5DVMA 1AXSB 3HS0C 3I9GL 3CFBB 1P2CA 1YN6B 4PJ7B 1AIFB 3MV9E 5CINL 3V9FA 5CKAA 1MHPH 4MHHG 3PREA 4U3SB 1AQDB 3HE7D 2A83A 2IWFA 3U48A 4PJ8A 1EPFA 4BH7A 1AGEA 3P3UA 4NO3B 3SGKA 1KEGL 4RFOL 4ETQA 3G6JE 4LEEA 3MLZH 3O9WC 4Z7VB 2FEJA 2E59A 1SFHA 3FHQA 4NO0B 1TO4A 5GSRB 3W2DH 1XH3B 1CGTA 4G7VH 2FBOJ 2W38A 4IOFD 5DJ6A 3V9CA 4ATWA 4GRWE 2QADD 1YNTB 3ELQA 1BZ7B 1G7JA 3O3EB 5CWSA 5KVGL 3SPVB 1JAEA 2XTJE 2BFGA 3FCSA 4QXUL 3OHMB 2X0UA 4XRCA 5JXAL 2EIMB 5KBKA 3BHBB 5HVWA 3QWOB 3HRZA 3PWJB 5I76B 4OIFA 5IOPA 4FFZL 3DGGB 3GS0A 2V2WB 3EO0B 3QW9A 3VGDA 3ESNA 4FTVE 3FQYA 4KI5F 2D31A 5D9SA 1B0GA 1JF5A 1XIWC 1IGTA 2Y24A 4YWGL 5KN5A 3ETBJ 4WFGD 3MGOA 3UTSD 1LHZA 2IPUK 2X38A 2F53E 3Q8AA 3QJVB 4HXBH 4QOKD 5ANMB 4RMWA 3R18A 4BFJA 4LAJH 3STZB 3IJYB 1O7VA 2VZSA 1LEGB 1F4WH 3APFA 3LKQB 4ZPVB 3V8CA 3IPBA 2I5YH 3W56A 1X5ZA 2WQAA 4HUVB 3ZE1B 1QZ1A 2ZWKA 5G4MA 5CFHA 1G1OA 4JKWA 3MRMB 3I6LD 3OKDB 3KLKA 2ZX6A 3L3OB 5LQBH 5D7LA 2OMZB 4YVNA 1AHWA 5D72L 4MCZB 1HCYA 3QEHB 1JXGA 2XWJA 2VNCA 5JIPA 2CBQA 5TE4L 1AO7E 4CUCA 2WLJA 2PUQT 3FRPG 3X1BA 1H3PL 5F97E 5IBUB 3RNQA 1OARH 4DKFL 1YPZE 4Y2DD 2J5LC 3OXSB 2IDUA 1CZ8L 2DBLH 1IILE 4NHCL 2YFNA 2VDQH 4Z76B 1FPTH 3EOAB 4IJ3B 1HQRB 3O0LA 3KLAB 5T1KD 4OZFH 1PY9A 3BVNA 5LKNA 4BM7A 1JZIA 1HC1A 1WC7A 1ETJA 5EZOH 1HI6A 1DQVA 4CJ1A 3AS1A 3GMNB 4XCCH 1A02N 1J0ZA 1JZHA 1UQSA 2EXWD 5I6XC 5SWZB 3MFFA 2JJTC 4XPHH 4DKEL 1RZFH 1I31A 1XF3A 3QIWC 1VRSA 1FL6A 3RVXD 1KLUB 4LCCA 1T2JA 1T7XA 3CK0H 4ODWA 3GSOA 1LYQA 1A25A 3BKJH 4XCFL 3MLWL 3NVQA 1OPOA 1Q0YH 4OJEH 5EOQL 5FECB 3IDMB 3TCLB 1BFSA 4KHXL 1X5YA 1RUML 2GTQA 4G8GE 4KUCF 4L2LA 1NCWL 3KR3H 3TNNA 3ZKMC 4MQSB 5D6DA 5J0BA 4E9TA 1PZ2A 2X1QA 3CN0A 3J7HA 5D2LA 4LCVA 4X7CC 5GGVH 4BFBD 2AK1H 3H9HB 5L8KB 4PBWD 4HULB 3QUHA 3ASOB 5HYSB 1WT5C 4AEEA 4B95C 4L3EE 1U3ZA 4N8PA 1XHHA 3QDMA 2ED7A 4N22A 1CLYL 1OKEA 1LVEA 2F68X 1WFTA 4XMZA 1ECZA 4YHLH 3RWFB 2DLFL 4KXBA 5MEPA 5MEOB 5FW6A 2COQA 4B9JA 1SXNA 2EIEA 1X9QA 4YXLH 3N43F 1KIPA 5AAWC 4CRPA 4YBQC 5F1IA 2FEEI 3TBWB 4FC3E 4FEIA 5FFGA 3INUL 1N0XL 2E9WA 2CPCA 4ZFOB 1FCGA 1DEEA 2BO0A 3CXDH 4G7YL 4I1NB 3CMGA 2ZUSA 3EGDB 3VE0A 3WYRA 3ECQA 5E2WL 3HUJB 5I66A 5L88H 2UZIH 3VVWA 4OZ4A 2VL5B 2XDHA 3QAZC 4XZUB 3NFNA 4AQZA 1YY8A 4QT5A 1BVLB 4AJWA 1MWAA 1OE2A 3SQOL 1IEHA 4QJ4B 2DM3A 3K3QA 1CQKA 5EO1B 1FLRH 3CZSA 5GRUL 4RX4A 2JK5A 4EN3D 4LSPH 1Q0EA 4H5SB 2WINB 4LASL 3IU3A 3MHZA 2ESVA 3ARGB 3LH8A 3LSOB 4KGLA 4ERSL 4S10A 1MRFH 3Q6FA 4X5QA 2DWEB 1IGJB 4HWBL 3IETA 5EWIH 5IF0A 2CLZB 4LKCA 2Y07L 1PU0A 2FVNA 3FT4A 5JHDB 2DYRB 1C8PA 3C5SB 3L1OH 5AYUL 4F5CA 1W8OA 3RTQD 1YNKL 5LGHH 2FD6H 5DK2B 4AGQA 4F7MB 4G8EA 4BA8A 2BCKA 3EYSH 3ZXAC 5C0GB 3L3DB 3BZDA 1IMHC 1DVYA 4WVRA 5KUMA 2WYZA 4N0YL 3TYFA 1A1MA 2BOBA 2WKGA 5E70A 2H8PA 4FQHA 4ZODA 2DLGA 5K1JA 4UM8B 5I1GL 5CR8A 2D2OA 3MLXL 1XGYL 2HKFL 4UYPA 1LP9F 2MWCA 2QKIC 1S7TB 3FB5B 5KS9A 1SDDA 2HFTA 3ZQXA 4AEHH 3UZQA 4KQ4H 2B1AH 3SE8L 2DWXA 2Q0ZX 5D1QC 2BVPA 5I1LA 4JM4L 1ZMYA 3JWOL 3RWJB 3HG3A 3LZNA 3OF6A 4QTHA 4PCTA 3CVHA 4F8OA 1UZ6E 2AJYL 4I77L 4QGTA 3UX9B 5ID0B 4ODSH 2YMOA 1DBJH 4Q6IB 1QHPA 1Q72L 1NLDH 1XFPA 5GZNA 1EZSA 5D7LE 4PRAA 2VDLH 3KDMB 3VCLA 4K3JH 4P5TA 3S3BB 5KVFL 2O6PA 1KMGA 5F93C 3VMOA 5J3HC 2W60B 5I1JH 5CBEA 5AUMA 4M6NL 5E94B 1SVZA 1T83C 4MJJA 4ZOEA 4NXKA 3P2TA 4P2QA 3IAQA 4HUWA 2JI3A 3MO1B 4WQOA 4NZDA 1R5WB 2CKBL 4LFHD 5KTEL 5IHZB 4ZMAT 4J3BA 1F2QA 1GHFL 2NYKA 4S1SH 4YHKL 3SDXF 1XGTA 1L0PA 3WUWB 1CDJA 2B15A 5GRVK 3OR6A 4I2XA 2J2ZB 3DUUA 3O8XB 3WTSA 4Y9CA 3WXVL 4IDLA 4R8WL 2D7TL 2W9DL 1EEQA 1W9XA 3LJ3A 4WNQB 3QPXL 3MLVL 2BX5A 3DX2A 4IKNA 2AV7A 2J5LB 2WCSA 3MRKB 4G8IA 4J1UA 4AI7A 1C5CH 1SLVA 4JLRA 2VMDA 5DO8A 4QRPD 1EHAA 3KLSA 2P8PB 5JO5B 3FQTB 4YDKL 2F8OA 3JWOC 5A3ID 2XI9A 3T2QA 2VN4A 2QQKL 3O11B 1AD0B 3UTQA 4MVBC 2P42B 2EVHA 1R17A 2WCGA 3V5KB 3KJ4C 1JVOA 3V6OA 1TCMA 3MDJA 3V0JA 3V4UL 1O6SA 2DH2A 4LSVH 5I6XB 3CFKA 2IH8A 3D9AL 3HNVL 4MAYC 4UQ2B 1A0QH 1XH2A 4U2YA 4ELMA 1NLBH 4G80B 5HDQH 1X44A 3QIWB 2DAVA 1WA0X 2XN1A 2Y22A 3LPFA 3PNWB 3OV6A 4MNQA 1ADQA 4X0KA 2FECL 2NUPB 3MXVH 1E8YA 4H0LC 4LLUB 4K55A 5D2LE 1RU9H 1AS7A 4BXSV 4E68A 3U0WH 4IRSD 1U58A 4U6HA 1O6TA 3QGVA 3NIGE 1KV7A 5D7KE 3QDME 5C86A 1FNSH 5HHVH 5I2IB 1SEBB 2EYSA 2XTSA 4YDMA 1KGXA 2R1XA 4ZMZA 3WIFA 1BOGB 1RZIB 1FGVL 5T5FA 3ZE0E 1L7TH 5IG7A 3L8QA 4LSDA 5DRXA 1R5VA 4UDUA 1FFOB 3BD5A 2DI9A 3HE7A 3UBXI 4FQ2H 4F2EA 3AQYA 3KPMA 3JWNC 3UMNA 1ZLUH 5ELIA 4GW5B 2OA9A 2WQ8A 1JCKA 3A6CL 1U2YA 3LZFL 4KVNH 4N24A 2ICCA 4ODHH 3OXRA 4K71C 1FG2A 1P7KA 5KBMA 4YQXL 3OJDA 3BUDA 1F3JB 1S7QB 5FM5O 4I0KA 5DQ9B 2BNUB 5FW8A 2NNFA 1RUKH 5EBWB 5AB9A 5JORA 2WTPA 4UOQA 4YK4C 1YNLL 3AAZB 4WU5B 3DJZA 4HCGA 5FYJE 5B1CA 3WS3A 4O9HL 3W81A 1DZ0A 1FNFA 1WD8A 3B7UX 4FLOA 5FYKH 5AB0A 1KBKA 3AXLA 4IKLA 1T20A 1UB6B 1ZKAA 1MJJB 3CDZB 3P54A 1J9TA 2YLKA 4OJYA 2DKSA 1B6UA 3EOTL 3ZKXB 3MRDB 2XKNB 3DIFA 1IGML 2ESVE 5IVZB 1DBMH 4ZNEA 2KZWA 2CXGA 4NAQA 1A6AA 4PY7A 4ELKA 3ARFC 2C9SA 1QUPA 4FQ1L 4X7SL 4ZUVA 1ZVYA 2VLJA 3ZQ9A 4F91B 4P07A 2DYPA 4QOKA 5C0FA 3L95B 4AYFA 4X0NA 1MCRA 2K8MA 2HMID 4F5CE 3R0MA 1YY9D 3DX6A 3A4AA 4H88H 1BFVL 4BHUI 3G5YA 1S7WB 5KSAD 4WUUD 4OAWB 1XQ4A 3LQMA 1EAJA 4IOSD 3MCG1 4FQQB 4GRLD 3VB8A 4JQIL 2K4AA 3U4BH 4PHXA 5FYKU 3ESUF 4M6OL 1NIEA 3TU6A 3LQAH 4TNWK 2VAAB 2M83A 1CD0A 4PREA 2AXHA 3FTWA 3DRTA 5AW6B 2H9GB 5DD6B 5IEHA 3QAQA 4DQOH 1KB5H 4K8RL 2Z34A 1PKOA 3UIZA 5KS9E 1VHPA 2C3WA 2X41A 2WK2A 3DXAB 3MV01 1TTAA 4HPHA 4IU3B 5EU7C 1Y1UA 5EMYA 2LE9A 2PYED 3SO5A 3W5NA 5T1KA 5IHLB 4D8PA 2O1AA 2VLRD 5D1XA 4WWOA 1II4E 1F1DA 5ECJE 4WNSA 1P6AB 2PP7A 1DVSA 1RZ8A 1I4FB 4H1LB 4KKBC 4GUQA 1WBXA 1ODAA 2P7TA 5JQHC 3QCVL 3FQWA 5DJYA 3R8QA 4BE5A 1XSKA 2X4TA 4OT1L 5D1QB 2UY7A 3Q06A 3GMQA 3CC1A 2D7OA 4EVNA 3QPQD 4F33B 2BSCA 3DJRA 2CUMA 3SE4C 5IUSA 2DQIH 4P2QE 5L9DH 2Y69B 1AZVA 1CDGA 2V7NB 3QCTH 4NM4H 3WN5A 4WW2F 4CBPA 5B3JE 4WFFD 5CCJA 3QNFA 1VFAB 2Y6SC 4WW2C 2JLLA 4NQCB 5IY5B 4NZFA 2EUXA 4AQ8A 2RALA 4JY5H 2GBTA 3L9BA 2WLZA 3NA4A 3D39D 2NRDA 1ZWIA 3V5DA 2ZKHH 3FBQA 2CBPA 3MLSL 2XACC 3I6KB 1MW2A 3MVSA 4M6AA 1GZQA 5HXMA 3QJXA 4OVVA 3EZJB 3IE4A 4PWIA 1WH0A 3MBXH 2KQMA 4K8RC 3VRLF 4Z7UF 3R8BB 2P45B 5EIIG 3HHSA 1EVUA 1FIGH 1WHPA 2WANA 4ZUSB 3DYOA 5I8EA 2F54B 4Y1AD 2VLME 5CIPA 2F58H 1ROWA 3QEQD 4FULA 4MXQD 4CC0A 4UOW0 4TL4A 1INEL 2VXUL 4I85A 4LU5L 2HLFC 3D48R 3T3PF 4A66A 1IAKB 2JKXA 3BWUF 2NXZD 4G59C 3TJHC 3RE0A 1AG6A 4G1EB 3BWUC 2MKLC 5DQJA 4D0BB 1RERA 4K5PA 1NCDH 5HGGS 2E6QA 3OLDA 2H3NA 4LE8A 5FM4A 3SE3C 5E5RB 3IE9A 5ILTH 1QVOB 2DKMA 4MNQE 3BUYB 3HR5B 4JRXD 4YSRA 5SX4H 1AXIB 3BEVB 3QO0A 3U9UA 4UILL 2VXQA 1TU2A 3ZTNL 5GS0L 1CL7L 5FKPB 3WGVB 1A3ZA 4XH2B 4MAYB 3NT0A 4XHJD 3BSZH 2FJGB 3DI2B 4PN6A 4Y9BA 2LFEA 2QHRL 3S8GB 1KACB 1B3IA 4HAKA 3TFKC 4J39A 1AXTL 2BSED 2CKBB 3AQXA 2A9BA 2MCAA 2H5UA 5I23A 1DDHA 3O3DB 4HUUB 1IC4L 1I7ZA 3VI4E 2Y7QA 3NCBB 3T4YA 1ZE3C 2PXYC 3FRPA 1PLGL 3WNIA 4JFED 2A4CA 5TDOA 3BWSA 4KTDL 3BW9A 4WI4A 1Q38A 5CP7B 3FB6A 2QSTA 5HI3D 2EE3A 1Z9LA 3T0DA 2E9GA 2OP4H 4FXTA 2YO3A 4TULH 5E6IA 4L9LB 4OD3H 3RU8L 3QQ4B 4K71B 2QVKA 4AIXA 1ZTMA 1QACA 1HAWA 5FC9A 1IV8A 1OTSD 2FYYA 1XMEB 1HXKA 1JN6B 3R06A 2G60H 2AJXH 4FGMA 2MNWA 4OZIF 2V2XA 5EOTB 3GGWA 5GS0C 5HPMB 2E7DA 4YK4B 2WTOA 4YAQA 1LK2A 4ZNEE 1OWRM 1NUNB 4TUOB 5F3HA 1J05B 1GKOA 4PCSA 2VLJE 2ITEA 1UH3A 3OVUB 4JMNA 5E1AB 1AJ7L 2NLJA 5J1AB 3TJPA 4DFIA 4QOKE 1V27A 2ZWYA 3CZFA 3V0WL 3CMOH 1F86A 5D70L 8FABB 4B96A 1ZIAA 4DP6X 4YZFE 3ZZLA 4XNAA 4OIAA 1PFCA 4PLKC 1SXSA 1MF2L 3QIUD 5IJBC 4RQQA 3ARFB 2PW1A 3CXFA 4P2RB 2OMWB 3TIEA 1UFGA 1XAKA 1I8LC 4MA8H 1QRND 1OB1A 4P59L 1Z3GL 2WTRB 5D7SH 4DO5A 2JI2A 2NX5D 2F5BH 2GYSA 3RWDA 2FX9H 3QORB 3NN8A 4DCQA 1BXVA 1BM3L 2VGLM 1H3GA 3WTXA 1J8HB 5CP3H 4JHWL 2FJUB 2I9TB 2XV2A 3KDPB 1T6WA 2A77H 1B88A 4JGUA 4D9LH 2O26U 3EXLA 1IE4A 4FDWA 1P53A 4QTIL 4MQ7A 2Z4QB 3WKNA 3FS9A 3MRJA 4D9RD 3NK4A 2FO8A 4POZD 4KO5A 1DQKA 1KIRB 3L9RB 4BK5C 5EH1A 2B0SH 3FT3B 5D1XE 1HXYB 2R4SL 2Q2EB 5ADPL 1JNHB 3RL1A 1MFCH 1QFWL 1DZBA 1VERA 3VXUB 4M00A 2K4WA 2AK4D 2H26B 3P0VH 5HHMD 5AZEH 1LWJA 3TBSA 4EXKA 4ODTL 4X4YA 4JO1H 4WWKB 3I9AA 3L1EA 4QEGA 1TZGH 2O5ZH 5B7MA 2HVKA 3UPCA 4A55A 5J5EA 1F4XL 2BNRB 4HIXH 2N0MA 3V5HB 3FN9A 2XY2A 4HKBA 3NZ8B 3CUPB 2F5AL 3C75A 1BV8A 3GPSA 1GMEA 1KZYA 3P9MA 4QY8A 4XZ4A 3ECVA 4NO2A 12E8L 1IGYB 2BC4B 1FYTA 3IAPA 3IN0A 2VR3A 4HIIB 4HWNA 4QF1A 1NAMH 4R4NC 5IBUG 4A67A 2AF2A 3BZFA 4HT1L 3S98A 4P46B 4OJDH 4YS4A 4WWPA 2XIIA 3P73A 1OF2B 3JT2A 1R3JB 1NBYB 2MQ0A 3BH8B 2VUOA 1PS3A 3DJ9A 4KJWC 3U2SB 3GSRA 1R0AH 3O2WL 5FO7A 2IBGA 3RGHA 4DVBA 3GIVA 3OKMA 2YBRB 3MLPA 4IRSA 2P5EB 4NGHH 1LO5A 2Q6WA 3STLB 2VR8A 4UAOC 4G6AD 1DANU 2V37A 3OWEA 3VDAA 2BY2A 4KOBA 3NA9H 2W1NA 5DFAA 4HPYL 5EBLA 3QHZH 5HHQB 3PWPB 3GB7A 4HLZH 5DZAA 4L8CB 3GSQB 1L6PA 1RLBA 4TUJB 4EI0A 5CR1A 2APSA 2D0FA 4F7PA 2A6JA 2FBJH 1N5AA 3A3YB 5I8OH 3GI8L 2JCCA 3F7YB 4FXGC 2QPUA 2IFFL 4YVUA 3JV6B 1V8HA 1VGKA 3CDFA 4HSCX 4NO0D 3RL2A 2CM5A 4NKIL 3SY6A 1XV8A 1UZ8B 5I5MA 1MIML 1C1EH 4AUJA 4PV8B 3L5XH 4DP7X 3UBHA 2YPKB 4DKDC 3V6ZB 4JHAL 5E8OB 4C4BA 1RZKH 2FB4H 3U1SL 2ADIA 3WFCH 3KVDD 2CRZA 3GMLA 4NSKA 4OV5B 4QDGA 1U2HA 1FNEB 3QXDB 2E47A 3P11L 4F8PA 3JTSA 4BWUA 3I3BA 4TNGA 1NGYB 1LO3H 3V6BR 1U4EA 4F2MB 3NFSL 4NT6A 3LQZA 4W68A 5D7IB 3ATFA 3FTGB 4FYQA 3MLTA 1FNHA 1Y6KR 1W15A 3NIDE 4PYHA 5GSVB 4ONFL 2H6OA 4UT9L 1SM3L 3RFZA 2VYRE 1BWMA 5C0CA 5ICYB 2QVFB 2ZUWA 5KSAA 4Z0BL 3KH4A 2A7BA 2E27H 5K9KB 1AI1H 4UAHA 2X2HA 4AQOA 1K85A 4IOSA 4PJAF 1JWUA 3VG0L 4ZYKA 1OWWA 3BFOA 4GRLA 1J5OL 5CJ8A 5FUZH 4LSQH 3S35L 4FQXC 4AUUA 5F70A 2BP0B 2ZXQA 4JQVA 2WWOA 3P2DA 4AGNA 1Z5LA 3QUZC 5J6HA 4XMWA 2I9LA 3U0TB 2OZNA 3CHSA 2IGTA 2Q76A 5A2IH 4I3RL 4YE4H 4IOIB 2DMHA 3DVGB 3U9PH 4F7KA 5BPPA 2WKLA 5DEFA 4FYTA 5G5DB 2KZKA 3MNDA 4ODXB 2CALA 2E9JA 2J20A 2PYEA 4OZHA 1VACB 1MLBA 4FKHA 4BZ2A 2ZONA 4G5AA 3S5ZA 4NWTL 1KBGL 5ESVB 4G82A 1I7RB 1ZCRA 2BHUA 2A6DB 2V7HA 4PW3A 1ZRUA 2CR0A 3TEYA 3OMAB 3VTMA 1PLCA 3G3LA 5DO2C 1SYVA 2QQLL 5HHPB 1TNNA 2BY1A 4ZSOA 1HCVA 1R3LB 5I6KA 3O2VL 2Y2TA 4MS8C 1MG2C 1MAML 5D1ZB 1E4KA 1TTRA 1DBKH 4L1TA 2Q5BA 2DH3A 2VR9A 2BW5A 5CZXD 4U1JA 3MRLA 4ABUA 2XETA 4QO1A 3D39A 4HC1L 2E5EA 3LV3B 1DR9A 3QXAB 5JMOC 3BVXA 2GEEA 3PUCA 1GCFA 1OW0A 4YHPA 5DQDL 2VZ1A 5IWLA 3TT3H 4M6ML 3D0AA 4PBVC 4MGXA 5CUSL 1SXAA 1MSPA 4JKPL 2MOVA 4BFIB 4A7GF 3HC4H 2HPOA 1EGJH 3LTVA 5HI5D 4K7PX 4Y1AA 3WJJC 2Y3AA 3QEQA 4P9HH 3GTTA 4XNQB 5BUPA 4HJ0D 2PCFB 1IFHL 3BJLA 3SKNA 4F9PC 1K5WA 3H9ZA 2HVBA 4KK5D 1UH2A 1FYTE 3F83A 2CU9A 3BX7C 5GPRA 5BZDA 4N85A 4IW4C 3SO3C 4OJFL 1FO0H 1OT4A 2YK1L 4NFBA 3WN6A 3JV4A 2LAGB 3IYLW 4MD5B 1VA9A 4XXDA 2N1TE 2Z1PA 4EIZC 4C57C 2NW3A 3WUWG 3BKMH 2WO4A 4TNVF 4RMRA 4JRXA 5ID1A 5KYWA 2X28A 2YFOA 5EEXA 2OK0H 3MNVA 1Q9WB 3CU1A 4AENB 1TZAA 3EHBD 3T0EA 2I7SA 4OU3A 1JS4A 4URTB 4HIJA 4PWHA 1EAQA 1E6JH 3BAJA 1E5AA 3BIAX 4AYDC 2AXFA 3R1GL 4XNZB 4EI5D 3PG2A 3DO4A 4HJGA 4NRZB 4QKXB 2BSEA 1OIOA 1UACL 1VADA 1J8SA 1WF5A 2W0FA 4K23H 1MFBL 2V8MA 3B1TA 4TLTA 1R47A 3CXHK 3D3VE 3NACH 2OZ4A 5B4MC 4UAOB 5HGAA 3OR7A 4TQEL 1WWBX 2AC0A 4P4KD 3KPSE 1QA9A 3HZYB 4JFEA 4U1HA 4GKZB 3LHAA 4UQ3B 4DTGL 4W9CC 2EDTA 4DVRL 2ADFL 4PY8J 1KJ3L 4KI1A 3EYUL 4KKZA 2F9BT 5CCHE 4KMTL 5DJXA 1YMMA 1N0LB 4BZYA 5JHDD 3T09A 1HOCA 2GY5A 4J8RA 3QYNA 4FXGB 3WJLC 2EDHA 3BGAA 3CNKA 4NYLA 4Y5VB 4J3OH 2J12B 2QZ5A 4WAFA 5AG9A 3WL9A 2KT6A 4CVXA 3P40A 1JK9A 5DDHA 3OGCB 3U7WL 1LWRA 2J57A 1OTUD 4MMZA 4OLWH 4F7EA 2CGRL 1RULH 3IGAA 5CSZA 1TNMA 4J3XA 2NR6C 5E2VH 4J4PC 2B1OA 1TZ8A 2WMPA 4NN6B 1KN2H 3MBED 1K4DB 3ZDYB 3Q5TA 4BBWA 4AIZB 3FOMB 3VRIA 4GI9A 3S35X 4G9FB 4P5SA 3WO4C 3FO9B 4KNSA 1JRHH 1NDGB 3CX5K 5C0CE 1Y0LB 4EZJA 2O93L 1G4RA 1A1NB 3D69A 4MDIB 4EJ1C 3QIUA 3E3QE 1KGWA 4NCC2 3RKDC 4E9LA 2UZXA 4ZXBC 3VFOA 4KPHH 4JHUA 2OXHB 5DJAA 5EIIA 1CL7I 1CYXA 1E27B 2NX5A 1O5DT 5ICUA 2I25N 2YUWA 4ZMLA 3FO0L 3CPUA 1AOHA 4WI8A 5F7AA 3OZ9L 4EE2A 5IB2A 1MW1A 4YEFA 3HE6C 1C5BL 1Y18B 4JPSA 3HI5L 1T3FA 1OVZA 4Q56A 4F3FA 3ZHKA 1L9SA 5L6YL 2PO6D 2N3JA 1ZVNA 3ARBA 3NJVA 1YEKL 3B2DC 1RK0A 4A6YL 3QUZB 4Z3IA 2FQFA 3KPOB 3EJZD 2PYEE 5HYJB 1QI4A 4HJSA 3L3KA 4GPVA 3ZDWA 1EO8H 4GMTH 5CKGA 1E40A 4KKLD 4B0MM 3PQYB 3O8XD 4JAMB 1WBYB 5DCCA 3RDTA 3Q9PA 2CK0H 2AK4A 1AC0A 1P0SE 2XX1A 1A6VL 4K3EH 4KFMA 1URLA 4ZSOE 3F7KA 5T3XL 2NZ1A 1PCSA 4NZRL 1SNRA 3BIKB 3C5ZC 5E9AA 4XODA 1TYEB 3ZL4L 5CEZH 2XPYA 2R2BB 1CBVL 4KKQA 3TBYB 3DMMD 3QR1A 3L3JB 3VI3A 1E9QA 3WEAA 2YXWA 1ILSA 2YGNA 4HP5A 3IF1A 5DFTA 4FMVA 3D39E 4WF7A 1WE5A 5CHNA 1QO3A 1S7RB 3EJUA 3F7VB 3HZMB 1NAKL 5T3ZL 1QR1A 4JFPB 5L2KA 4PGDA 4ISVB 3DO3A 1UYWH 1LDPH 3OKOA 4I0CC 3D0LB 4L4VE 4L1BA 5ESQA 1BVNP 2QQNL 2EDJA 5GS1A 1UG9A 4Y5YC 5I1KH 3SKOB 3AT0A 3K1KC 2VKWA 4Y1AE 4H1LG 2A1WL 3PAUA 5ALCL 4ZMPA 5C0DB 2WBKA 4GAJL 2AEPH 4FYSA 4BSWB 4GKNB 3CHRA 1TZHB 3BN9C 1CR9L 3CDYA 3QFGA 1IEAA 1YA5A 1ZLWK 2YJLA 4HSQA 3UTPD 3ZRSA 1AXSA 2AVFA 3Q2WA 1F3RB 1YN6A 3CFBA 4PJ7A 1AIFA 3MLYH 3N9GH 4U3SA 3RY5A 1AQDA 1BG9A 3QUMH 3S8FB 4M5ZL 3MQIA 3O6MH 1QPKA 5F96H 2XXCB 2W80C 4NO3A 1Z32X 4JRXE 3NCWA 1J1OL 4Z7VA 1NM4A 1L9RA 3BUTA 4NO0A 3TA3C 3IGLA 4EQ3A 5GSRA 3OSKA 4JG1L 2AAAA 4YDLC 3QNYB 5AAMA 3T0EE 4B3EA 2XKSA 5HYSG 1O9WA 3SDCD 4J3OD 1HHHB 1YNTA 2YBGA 1BZ7A 1UA7A 4HIEB 4LCYB 4V2CB 1DVZA 3O3EA 1FVCB 2Q3AA 2W65A 4M5YH 3ATAA 3S3JA 3SPVA 5J13C 1TZIB 5DA4A 3ECWA 4JY4B 4MWFB 4FNQA 1GGCH 1NC4B 2F8VA 2DEXX 4QXTB 1CXIA 3L4YA 1KGCD 3BHBA 3N6YA 1QX1A 3QWOA 3ZL2A 1AOZA 5HGBA 1FV1B 4N0RA 3BUBA 5FA4B 5BOJA 1BJMA 1F6AB 3PWJA 1XB8A 2RHEA 5I76A 1BVNT 1KFAL 5SV4A 4I18C 2CUIA 3DGGA 1HU8A 3EO0A 1WCQA 4JFEE 1I9RH 1IGFH 2WZAA 4EIUA 4Y4FB 1YEJH 1THCA 5DZ9A 1JFQL 1AYOA 4EZKA 4EDWH 1FQ9C 4JB9H 1M9WA 1IRAY 5F9AC 3IDNB 1YMME 5ANMA 4HIQA 4M62L 4JY6B 1SLWA 3HFFA 3STZA 3IJYA 3QFJB 2XXMB 4WFHE 1LEGA 2EXTA 3LKQA 1KUMA 2HJFB 2L0DA 1EH9A 1ORSB 3EDEA 4KZCA 4HUVA 3GK8H 3CHXA 3BP4B 5JDJA 2H2PD 2JJSC 2VZUA 1I7UB 3MRMA 1FAIL 1OPGL 3OKDA 3L3OA 4QPEA 4HS3B 2V6HA 3SOBH 2OMZA 3C9NB 3AG2B 4MCZA 3QEHA 5IGXH 1RZPA 3Q9QA 2HT2C 5F89B 5TE7H 1ADWA 5I1CL 3I3DA 2XFXB 2ZXBA 3KM1A 4KTEL 4ZMTA 2MCPH 4Y4KB 4IBUA 3TO4D 1QBML 2XZQH 3BGMB 5LDSA 3DXAD 1YYMH 4G7QB 4HSAC 2ADJB 1NINA 4LIQL 3OXSA 1AQKH 4M1DL 5E8PB 5DD5H 4DAGL 4Z76A 3QCUH 1EBAA 3EOAA 1HQRA 2ATKB 2R69H 5EO0B 5HTSA 4C55A 3K80A 1WGVA 4FG0A 1VAHA 1GYWA 4N0UB 5TPWH 3GMNA 3M88A 4GQ9L 2ID5A 4XNDA 5IQOA 1CFQB 2NX5E 4JZJA 5DYOB 5CEZD 1NCUA 4N9OB 4AWJC 3ZIYA 5BNXD 3B37A 3WIHA 3V0IA 5SWZA 3UJIL 1UEMA 4AYMC 4ZXBB 5GRJL 3TCTA 1KLUA 4Q2ZB 5HHXH 2AW2A 3MCKB 3PY9A 1QP1A 4XE0A 5DURD 5K1VA 3PXLA 5FECA 3IDMA 3RB5A 1WA1X 2E7MA 3TCLA 2ED6A 4PRIB 1J5HA 5CN1A 1D5IH 2QLVB 4Y1SA 3S36L 1T4KB 2VO8A 4LKXB 3HE6B 4FABH 1G7HB 1OAKL 3SDYH 4AYEC 4D9QD 2WP3T 4RDQG 2FO4B 1OK0A 5HHME 4LVNB 1N6QH 3B3IB 1IBGH 2X7LB 15C8H 3K46A 3VFMB 2R0KH 3H9HA 4PJCB 4L5FL 4PJ6A 2E4TA 4GXUM 3UAEA 1S5HB 3QA3B 3QEGH 4PJHF 3DURB 1I3UA 2Z9TA 1TF4A 1IL1B 3HFML 2FRGP 2PN5A 1Q1PA 2GG1A 1YEFL 4RGOH 2FX7L 3CLEH 4RMVA 5L2KE 3VSQA 1IE5A 3MTRA 1UWFA 4LOUD 2D4DA 2VQ4A 4WKZB 1Z66A 2DQEL 2VJXA 3US9A 1AR1B 4Y4HC 5CGTA 1NL0H 2NTFB 3TBWA 4J6RL 5CFAA 3C60C 4WI9A 2FEDC 2NY4C 3MA9H 4IDJH 3EGDA 4QXGL 5MENB 4Q9QH 3HUJA 4R4FH 5TDPB 2W9LA 2VL5A 4XZUA 1BVLA 1T21B 3K72B 3KLDA 1M3IA 3NZHL 2JKLA 1J5DA 1I8KB 4PJ7E 5I5RA 3QJFB 5EO1A 1B0RB 3O81A 4GQRA 5CAYB 4Y19B 1ZLWH 3P77B 1YMHB 3FQRB 4KMLB 5DMGD 4PB0L 2HT3D 2APXA 2FK9A 4H5SA 4MZIA 2WINA 3X1FA 3F04A 2V9RA 3ARGA 3CVCA 4R4BB 1MDTA 1SF5A 1D3CA 3LSOA 4Z7VE 1WEJH 3LEVH 1GAFH 4PQXA 3R7QA 1A7NH 1JVLA 2DWEA 1IGJA 2WC7A 3MRGB 3O45B 4L1LA 4HUMB 4U1SB 5A2BA 4G2AA 2CLZA 4MA1C 2IBZY 4N5UA 1U8MB 1PW3A 3ETTA 2GJ6D 3DTUB 2AABH 1X5XA 4IMKC 5JHDA 3NBNA 4AVIA 3C5SA 4NIYE 4EZLA 2H0JA 4XI5D 3NFPB 5AFAA 4PR5B 2WBJC 4TOYL 5DK2A 4F7MA 3ZT6A 2FX8H 3HC3L 1WA2X 3I9IA 1ASPA 2HRHA 3NH7H 2YA1A 4JFXB 4UYQA 3GSNL 3QJSB 4DW2L 4NO5B 4M7JH 5C0GA 1M56B 3L3DA 4WI7A 2X6CA 4PYGA 5DVNA 3X12B 2R8SL 1BBDL 5LGJB 3WG7B 4BDVB 1ND0A 1AGCB 3DHPA 3GRGA 4R7XA 4XP4L 1OQOA 3CZGA 4UM8A 3TWYA 1B6DA 2ARJB 4KOCA 2R4RH 2DWDB 5J13B 2BSTB 1KB9J 4M8RA 2W88A 4B9CA 5DFWH 2BIIA 4AC2A 3TASA 5I19L 1S7TA 4GSUA 4HEPG 3EDDA 2OL3H 2Q8BH 2IC2A 4JRLA 5ANME 4XP5H 4U1NB 4M7KH 4MCYB 2XRAH 5H94B 1BW8A 1NPUA 3PJSB 5JHMA 5T5NF 2GW5A 4L8SC 3FF8A 3RWJA 4DP8X 3VFPB 1H8NA 2K9UA 3T0XA 1S3RA 3QXTA 3WTYA 1DJWA 1X7TA 3ARFD 4P2RD 5ID0A 2F19H 1XSOA 2EIDA 3NABL 4Q6IA 4K3DL 1LK3L 2JV6A 3KBFA 1CK0L 3C08L 3Q3GB 4Y16B 4NZJA 1T1YB 2HN7B 3KDMA 2XHNA 4BZ1A 2W60A 3ZMNA 4MQXD 2A74C 1U33A 1XGQB 3B2MA 4ZX5A 3QORD 5E94A 5J12B 4I0PD 3P0GB 3WOVA 4PRPD 5T1DH 4ZMOA 3MO1A 4G3YL 5IOKA 1R5WA 1RFDL 1J8HD 4L8DB 4PG2C 4YDZA 4YPGA 4XO8A 5C0RL 5IHZA 5DC9B 5FXCH 3V7MA 1NUDA 3K2UL 4KWUA 3WFBH 3OC5A 3WUWA 2MIZA 3FO1B 5ANHA 4KQ0A 1EZUA 2J2ZA 3FDWA 4LHQB 3O8XA 4GI8A 4JM2B 2DQFB 3D2UB 1OOWA 4ZMVA 4HOXA 3OGOE 3ILQC 4NC1E 4PW9A 5I9QC 1OCZB 4WNQA 1VFBB 3GKWL 4EDXB 4ALAH 5IJKA 4KC3B 3I50H 2WZ5A 4Y88A 5SWZE 3ARSA 3L9EA 4YFDB 3UROR 1D9KB 1CBJA 3CHQA 5F9OL 4Z3TA 5JR1H 4OJCA 4X80L 1M1XB 3E6HB 4H8VA 4WWKD 2P8PA 5JO5A 3DX9B 1XL4A 2B2XH 3FQTA 4FFZA 3F7PC 1CU4H 4RFEB 3ZUCA 1N18A 2BNRD 1U4FA 2HJLA 3DMMA 3S36X 3O11A 5IZ7A 4O02L 4IQHA 2VDRL 3MUZ1 4GAGH 4ZFZB 3V5KA 4CGUB 3LVEA 1YEWA 1QLEH 1G5GA 5AW7B 3VXNB 4AXWB 1YEGL 1EJOH 4PBDA 4UQ2A 1D5MB 4JR9H 4XMLH 3FCGA 4P46D 2VXVL 4FCHA 4NZTH 3NEXA 4G80A 3BGFB 1RIVH 3QIWA 1E9OB 1FBIH 2UXGA 3CCHB 3PNWA 3KW8A 5EDXA 2NQCA 2NUPA 3MV8D 4LLUA 1RUPH 3WE1A 1EEYB 4OUUB 4XN5A 3EF4A 4H25B 1DN2A 1JERA 4WHDA 1JI1A 2QHLA 5I2IA 5LXVA 1SEBA 3PHSA 4DK3A 1BOGA 1RZIA 2O6EA 5BRPA 1BGXH 1WSST 1BAFH 1FFOA 4LSSL 4BQ6A 4WHYG 3CFEB 1NKOA 1JV5B 1WT5A 3GO1L 5BVPH 4Q58C 4GW5A 2OS7A 5F0LB 3NTCH 3WJMB 1TFPA 2YR3A 5I26A 1R6VA 1GIGH 4FA8A 2OMVB 1WTGT 5E8DL 1N5YL 2XN9D 1S7QA 2ZXGA 4H8UA 2C1PB 4CN6A 2MOGA 1IAIH 4UNTA 5DQ9A 2BNUA 3ATDA 1V3LA 3HUJE 5EBWA 5ERWB 4IIZA 1FFNB 2BVQB 4RSYA 3AAZA 4WU5A 4K0OA 2J43A 4Y4HB 4G6KH 1KDJA 1NMCC 1UB6A 3P30H 4PG9B 1U3HC 5H8DA 1MJJA 2KHAA 3CDZA 3JZ7A 4LMQI 2BMKB 3ULUL 4N6RB 3MRDA 3P3SA 1FAKT 2XKNA 4PTUA 4XPAH 1BSIA 2YAEA 4QR7A 5IVZA 4BKSC 3KPLB 3UC0H 2XV6B 4DETA 2H47C 4XP1L 4FLRA 3WO3B 3QG6A 1IQDB 5KSBF 1RUQL 3P9WB 3L95A 5GGQL 2ENQA 5BW7C 4ZQKB 1FP5A 1ITBB 1S7WA 2LLLA 4OAWA 1NEPA 2BM3A 2AI0L 4IIQB 2YEZB 5K9OB 4FQQA 1E65A 2AZAA 3MLUH 1ZJBA 4UTBL 4M29A 3B2VL 2UVFA 2W92A 2JQAA 5FS5A 3X2QB 1Q94B 1EDQA 4BGDA 2JI1A 3NDZE 2VAAA 2FIRT 4PS8A 5I74C 3TN0C 4DGYH 1KJMB 5K59E 1X5JA 5HI4C 3MOBL 2H9GA 4Q0XH 3GJFK 5DD6A 3ZDZF 3ULVL 2JCWA 3MREA 4B3VA 2PP8A 3DXAA 3HHMA 4AV5A 1HESA 1IC7H 1YJDL 2F74B 4IU3A 4XP6L 3ULUC 1H5BB 4TTDD 3EZ8A 5HD8C 5DUPL 4QJ5B 4FXLA 4N28A 4OZGB 2BP8B 2KH2B 3VXSB 4X5PA 1KYUA 1DQJB 1CDUA 1JWMB 4FKEA 3TL5A 3QG7L 3VH8B 3WKPA 5FHAL 3L7EB 1S46A 4H1LA 1I4FA 1YEHL 3B2UC 4OVUA 3SGEI 5F0MB 3LPWA 1E2ZA 4PJGB 5D1QA 5DHEA 4LDLB 4L8SB 3V0DA 5AVTB 1QSFB 3IDXL 4B60A 4POUB 4F33A 4F8TA 4PJBB 2DICA 2IO5A 2QGCA 2YKLL 3VXRB 3POHA 1EUTA 2V7NA 1UCBL 4M7LH 5D1ZD 3CD4A 1Q8MA 2WOBA 1VFAA 4NQCA 2NY0C 3Q8CA 3MLRH 4NAJA 2V3FA 2VM9A 4ZK8A 4EUPH 4XNYL 3WHXB 3HOGA 2D9QB 3ULAB 5LBSL 1J0YA 1FL3B 1T83A 3VW3H 3I6KA 4Z18A 2BRQA 1KBBA 3GSNB 3ULVC 3CH8A 4PJXB 4NP4H 4OGAD 3RWEB 1CDIA 5HYSA 4FNTA 1QNIA 4ZUSA 4BKTC 1PLAA 2F54A 3N1GC 1RJZB 4XMKL 5DMJB 2BS9A 1TVDA 2D3VA 1YJDC 4PVNA 2N01B 1E30A 1RVFH 3IJ7A 3BDYH 2ZAGA 3H9YA 3ZGHA 5EIQA 4GP8B 4M7ZC 3UJJL 4L0YA 1WFUA 3IVKB 1RXLA 5I9QB 4H44C 2WBWB 5EBGA 1OAXH 1TFHA 2VDMH 4XN4A 3TO2B 4G1EA 2F08A 4D0BA 1A8ZA 5E4AA 4E9SA 1N7ML 4UT7H 1M7UA 2MQ3A 4OGZA 2H3XC 4UMGA 1F3DJ 5DYFA 4M1CC 4XPGL 1QVOA 4JKNA 4EOWH 3BUYA 3HR5A 3HJEA 1QBLH 1CE1L 3T4AB 3BEVA 3G6JF 4FFYL 1V55B 1A4AA 2KMWA 1DQMH 4CL7A 3CPLB 5FKPA 5I1IL 2J56A 4YFLI 4XH2A 3V0WH 4MAYA 1VFMA 1ZOXA 3ZTEA 2FJGA 2EINB 4EKJA 3O6LH 4XCEB 3D12B 3ORJA 2CKBA 2DM4A 2H2SD 3MMEB 4PRBB 4HUUA 1CXKA 3RP1A 1M7XA 1J10A 1SBBA 1XGRB 2WUBL 5CD5D 4JN2B 1P84J 4IMLB 2HLAB 1MEXL 3S0PA 3VACA 4GP4B 5CP7A 4CC4A 1TPXC 2DQJH 2VZTA 3DX1A 4NZ8A 3TLRA 5I5IA 3TVMB 4LESA 1OB0A 2XXFA 2Z7YA 3GHEL 2QL1A 4L9LA 1M42A 1QFPA 3QQ4A 2CK2A 2ZCKL 4MA3B 3EO9H 3ECUA 1WLHA 2UV3A 1J87A 3BUPA 5TH2B 4Q6YA 2QGDA 4FHKA 2APWA 1JZ2A 3NJIA 2WLLB 2KI6A 3WEOA 3B6SB 5EOCL 5F7FA 2CQVA 2VDRB 1JN6A 4R5TA 3EJJX 2V17H 3MNZB 3K2IA 1TJGH 5EOTA 3C8KB 2R29H 4PP1D 3NUKA 1B4TA 1KDIA 5IV2B 1IM9B 3FO2B 3HB3C 5BZZA 3NSDA 4HHAB 4IBYA 4TUOA 1J05A 5LNGA 5H37H 5E1AA 3VD1A 3V79C 3WXWH 5J1AA 4ZDHB 3K6SB 2J4WL 5AQ0A 3V52H 5DZNA 3EUUA 1I9JL 4DH2A 2I07B 5C7ZA 3S3SA 1QEXA 3DDGA 1NPNA 5FCSH 2HPTA 1T7ZA 1CD1B 3BXNB 3G7TA 3ARFA 4P2RA 2WQVA 2Y7SA 5B3NA 2DV6A 2BP5M 1INQB 2OMWA 3KGSA 1TTFA 2AJSH 4X7EC 1ZANH 3BAIA 3B5GA 2WTRA 3KMDA 1TSHA 3V8OA 1P5UC 1HCZA 3A0OA 3QORA 4LXFA 3RX9A 4LLQB 3U7YL 3Q05A 4R5XA 5EN2B 2C26A 1J8HA 3QZLA 2K6YA 1JDCA 5E2TH 2I9TA 1IKOP 5C09D 1A3RL 3DXAE 4PLJD 3MNWB 3GJFH 5GISL 2Z4QA 2G5RA 3SDXB 1JTOA 2XBTA 1EXGA 4KHTH 1UWGL 3TN0B 5I74B 1AKPA 2A9MH 2H1PL 3NJHA 1FGNH 3CDGA 3PAZA 4FN0A 1BQHB 1KIRA 2WVTA 3L9RA 5KBPA 2ZUXA 3CV5A 1HXYA 3FT3A 3GFUA 2YQGA 4DGVH 1JNHA 4W9EC 3WFZA 5I0VA 1F1GA 2HXAA 3VXUA 1H15B 1A3QA 2YAPA 2H26A 3DVFA 3E80A 3IFLL 1XB6A 5D1QE 2QEJA 2WLYA 2RCSL 4PMEA 4WWKA 3T0BA 2J44A 2YQ3A 2QSCL 3OAUH 4PVMA 1W6LA 1W72L 3WENA 2QPFA 1HWHB 2BNRA 2WQSA 3V5HA 3M07A 1NUFA 3NZ8A 1LE5B 4NQCE 4UIMB 2ORBL 1IGYA 2E4FA 2KUTA 4O2FB 2WWKT 2BC4A 3AU0A 3L16A 4HIIA 4S1RH 2EDMA 3W3BA 4P46A 2KDGA 1IARB 4PGEB 1OF2A 3CFTA 4V1DD 4M43L 3SE4A 4F20A 1R3JA 1OF0A 1NBYA 4R90H 3NOIA 1IC1A 3BH8A 2YPVH 2ICWJ 1QSZA 3U2SA 2ZNWA 1CT8B 1F41A 3QUXC 2G75B 4OFDA 4JQIA 1MFDL 3DDFA 5TQ0L 2NY0B 2F54E 2YBRA 3UCQA 1X5FA 2P5EA 4PGCB 3VWJD 3LRKA 3ROOB 3STLA 2XV3A 4N0CD 3KPRD 4CMMB 1BQUA 4HS8L 1T7YA 3GHBH 3K5SA 3LH9A 3F01A 1ZK5A 1UTDA 5DUBB 5DD0H 3BAYA 1G6RH 3COOA 4Z7QB 3GSQA 4L8CA 1UT2A 4TUJA 5E5LA 1LXMA 1PG7L 1I1AD 1CYGA 2COVD 2G4GA 1COBA 3H42H 3F7YA 3QI9C 4OLUL 4XTRC 4BXVA 1HL9A 1XD1A 1NGQH 2F7RA 4HEPA 5FYLL 4X6DE 4PUBL 3SGKC 2XN9A 3JV6A 3L5WB 4HPOH 2Z1KA 3REVB 1DVFB 4CKVX 3EFOA 1UZ8A 1WTLA 3NZSA 2WAHA 4NJ9H 4PV8A 3IRZA 1CI3M 5KVFE 1XO8A 2VDNB 1ZHKB 2RIKA 2YPKA 3MUGB 2J1WA 3V6ZA 2MJWA 1J12A 1G7LB 2MTAA 4YUEH 5E8OA 5ECGA 3SE3A 4YC2C 3TWCH 4X98B 1HJBC 1M57B 1EERB 3NQKA 4OV5A 4AZ8A 4MB4A 1FNEA 3V4VL 5D8JH 3QXDA 1NGPL 3SE9L 3IDIB 2YWYA 3W0WB 4HFWB 3CBKB 1C12B 2CPUA 2ENJA 3W11C 1NGYA 5CGYD 4X6FB 4F2MA 3C6SB 2OJ1A 4TNFA 5BZWB 1ZLSL 3HRZC 4TQPA 4FNRA 1S78D 5D7IA 2CNZA 3FTGA 4DNLA 3HN8A 1WHOA 3VDBA 2EUZA 4Y4FD 1QQDB 5GSVA 5IB1B 5A2FA 2CM6A 3LIZL 3GINA 4P99A 35C8L 3LEXB 2E8YA 1MJUL 4MYWB 5ICYA 4F57L 2W0KA 4LF3B 3OAYH 5K9KA 1P4LA 1NOLA 2KPNA 5KZCB 2EABA 3LXBA 1UZ6F 4NBZB 4HU8A 4OR1A 1KLFB 3BT2H 2M8XA 4PS3A 4HVBA 3U0TA 1A7PL 4GSDL 5IT2L 1EO7A 1NFDB 2CHZA 1Y07A 2V33A 1F13A 3HG2A 4NQDD 1R3IH 4Y4KD 4IOIA 4HGMA 3DVGA 5IUCA 3AT9A 4ZS6D 2XBDA 5G5DA 2ODHA 4ODXA 1EMTH 1TJHH 1VACA 1CMOA 1MQKL 3HB3B 2N0KA 1IAMA 1EHKB 3EG9B 4W1TA 1U8OB 4P2RE 4X4XB 5ESVA 2FBRA 2J8UB 4TUKL 2H0EA 3GXMA 1SY6H 2A6DA 2IMNA 4AYBA 3HG4A 5KJRH 2E7HA 5HHPA 3QO1B 2IG2L 4UIKL 3KS0J 1A3LH 2RB8A 1Z0NA 3U4EB 4YMPA 1KFGA 1R3LA 1U93B 3B5TA 3MRQB 3EUDA 4KJPD 1J8HE 2QMJA 1A9BB 5D1ZA 4Z7WB 2XA8H 1NDTA 1I8LA 1QABA 3T6VA 4XC1L 5DZOA 2YD2A 4DN3L 5I71C 1TO5A 3ZUNC 4LCCC 4ZPTA 3GXIA 1O9ZA 3LV3A 4NZUH 3QXAA 4Y8DC 8CGTA 2MPAH 1D2PA 3WNLA 2MMXA 1MCPL 4UM9B 3ABMB 3TJEH 5FYJL 3VXUE 2NTSP 4RRPM 4BFIA 4YHNB 1MRDH 2JB6B 2V5YA 3GRWH 4R7LA 5FUOL 3NSCA 5EU7E 4E2OA 5ITBH 4PJDE 2K45A 2Z7UA 2IPTH 2ZWLT 5CCKH 1UM6H 1H6UA 3G04B 4XNQA 2QT6A 4N8VB 2FR4B 2BNRE 1MCLA 5HGDB 3TYGL 1IGCL 3NIGF 4XOEA 4LDOB 4CSZA 2PCFA 2HLEB 1SOQA 1SXBA 4DJMA 4NN5C 4XC3H 2Z91B 1DTUA 5HSFA 4ADIA 3R4DA 4KZ0A 3BKYH 1RH8A 3ZE0F 3N3EA 1AMYA 1PSKH 3APCA 4F2FA 4MNGB 3GMOB 5IBLC 4MD5A 3FFDB 4YL9A 5DVOA 4OIIL 4K5LA 4KKRA 4IBWA 1F6LL 3A6BL 1AR1D 2BIMA 3P3RA 4NOFA 5E9NA 2YGQA 1LO2L 2P5EE 4FFVC 4PP2B 4QCIA 2D03H 2OTUB 2DBJA 1WFOA 5MEND 4RZCB 3CHOA 1PG7X 2OM5A 3NJXA 5DFVD 3FQUB 5JIKA 3ZQWA 4NN7B 5GJTL 2HTKD 4NRZA 4K3HA 3ZHFA 3PWPE 5AWNH 4ADGA 3B9AA 3MOAL 5GGTL 3FN0H 1FSKB 2R1WB 4UT6A 2B9AA 4Y19D 3SJVD 3DK0A 1OAUL 1HQ4B 4YHOL 1OXYA 1ZHBB 2B20A 1WZ1L 1HHGB 4TSAL 1NCIA 2O30A 3I6SA 3HZYA 4UQ3A 3V9EA 4GKZA 5J11C 1SQ2N 4GXVH 4YBLC 3F5WB 3CVHL 3FK3A 1F8TH 5CLXA 5DHVB 5SX4I 3EJYD 1N0LA 1AGBB 2IV8A 2WQXA 1IC5L 3QI9B 2EIZB 3W57A 1W72B 4M5SA 4BH7B 1FRGL 1NUGA 4Y5VA 4JDZB 4W9HC 1P4BL 4KQ3H 1PY4A 2MPVA 3OGCA 5G4NA 4JG0H 4OZIB 3Q5OA 4OFIA 4LHUB 4DOHB 2IQ9H 4F2ME 1BM7A 4JREC 4YC2B 1G7JB 2AJVL 3LZOA 4XN7A 1K4DA 3RUGB 2ERJC 4AIZA 3A23A 1WZAA 3DJSA 1JIBA 3FOMA 3M8OL 4GMSL 5IMOB 2ZCLH 4G9DB 1L4IA 1YQ2A 2DQHL 1G94A 3FO9A 1V3JA 4G9FA 4I88A 4EN2A 4A04A 1NDGA 1OM3L 1Y0LA 3LDBC 1BZQK 3I9GH 4YSCA 1A1NA 3MYZA 4MDIA 4F9LC 5AOIA 4JUSA 1H3TA 2OXHA 5JUEL 3DRQB 5IIEB 3F65A 1KIQB 1E27A 4LLMB 1YUHB 1Z7JA 4KVPA 2WVSA 1NCAL 1B0GB 4Y16D 2XSKA 3WAKA 3O4LE 5KN5B 2P46B 4E41D 4FLSA 3WY2A 1ZA3A 2HJKB 2Y5TB 4AOFA 2J8HA 1QFUL 1Y18A 4BV1A 5CEYB 1LD9B 4BFEA 1CGUA 4JKKA 1L7IL 3EJRA 2ZJSL 1ADQL 2UXTA 5KVGH 2BVEA 2KZ1B 1EZVY 3QUZA 4GXFA 3KPOA 4QXUH 5I1HH 1ZLDA 4EBQL 5HYJA 2ZAHA 4TVSa 3BFQG 3AW5A 1JF6A 1OHZA 2EJ1A 3DX8B 3PQYA 4H26B 2FJFB 3RQ3A 1L6XA 2K3HA 2ZPKL 4JAMA 4JM2D 1WBYA 3D2UD 1YSOA 3N40F 2OBGA 3V4VB 5JXED 1DQDL 5T5FL 1K2DB 1J1PL 2XZAL 3CBRA 5D93C 3C09C 4PGZA 3PJLA 3ZKSD 1BPLB 2AJZB 3BP7A 5AVSB 1D9KD 1NIDA 3BIKA 4FJYA 3VGBA 3O41B 1Z0MA 2R2BA 4X9HA 3TBYA 4ZX3A 3L3JA 3AWEA 4Q9RL 3ATBA 2J88H 3H9SB 3APNA 1RL1A 5D4HA 2KDYA 4IKJA 3APMA 3F58H 3BJ91 5E51A 2ZUQC 3F7VA 3HPLB 3CAFA 4XCNA 3V6OC 4JFPA 5E8NB 2Q20A 4ISVA 1YEDB 1SXCA 3D0LA 1ET7A 5E95B 1JPTL 3O0RL 4KKNA 5D72H 3ZHDA 3BI9X 3SKOA 1IB5A 3MUUA 5I71B 4HIPA 5TE4H 3X17A 2BJML 1E2WA 1U91B 3FQ1A 1JJUA 5C0DA 1H3PH 3KPRA 2O72A 4LCWD 4BSWA 4KVCL 1E8ZA 4GKNA 3VD5A 4NWUL 3UAJD 3DK2A 1TZHA 4DKFH 1AFVH 3MN8A 4YDIL 4HKZB 1G9NL 2XIBA 4OI9A 1DQIA 1FDLH 1PZ3A 2VDPH 1UWXK 4NHCH 4UNUA 5B38G 3QUGA 3WJJA 1OAZL 5FO9A 2J5WA 4U0RC 3GSUB 3FNKA 3RVUD 4JDTH 5I0ZA 3I75B 3VI4F 4UTAH 2X6UA 3HE7C 3IT8D 3VFSB 4JL2A 4KO6A 1XXFC 3PIQB 1KGUA 1YEIL 2JJUA 2G0KA 5BRZE 3H2QA 3QNYA 1EDYA 2YAQA 5C0BB 2VR4A 5KVEH 4IOFC 1HHHA 4BFNA 4LCYA 1PLBA 4HIEA 5JW4R 3FTVA 3ZR6A 1FVCA 2QADC 1WWAX 4KU1A 5D5MB 1ACYL 4WHCA 4LBAA 5MEPB 4XCFH 2R29A 1TZIA 3UTTD 5EOQH 4UV4L 4JY4A 4MWFA 4UCFA 4HMCA 1NC4A 1JHLL 4QXTA 2ZOKB 3ZLQC 2QSVA 5ABZA 1HN1A 1H9VA 5FA4A 3NRFA 2EIKB 4QHUB 3GXUB 5JHBA 1F6AA 1XAUA 1P7BA 4JFDD 1KYFA 3K2KA 2P28B 1TZOA 3EFFA 4GSXA 1PPIA 4Q14A 3U30C 4KKPA 4Y4FA 4KI5D 3NFNB 1BREA 1JNLL 1N8ZB 1G9NC 3QIBD 4QT5B 3VGEA 4LK4A 4QRFA 2BDNL 2ZCHH 2ZOLA 3ZT7A 5JQ6H 4KAQL 3PLYA 1I9EA 4JY6A 5AD0B 4KGJA 3CZEA 1FH2A 3QFJA 4JO3H 5MERB 5DGRA 2ICWB 2PPEA 2QDVA 5IBTL 3RZWA 1ORSA 1BXXA 4PJAB 5J11B 2DLFH 2YPLB 4IKKA 4YBLB 4KRPD 3U6RB 3BP4A 1D6VL 3GBNL 5EU6B 1S7SB 2GBAA 4B9ZA 3SBQA 1EEUA 3IMBA 1ET8A 1WDAA 1WUZA 5AEAA 5J9PB 4HS3A 1YQVH 3C9NA 4H2CA 2C9RA 3INUH 3MRPB 5AW8B 2WXOA 5F89A 5A6MA 1MLCB 2V5MA 3WJLA 1MFVA 2Y7NA 2XFXA 1BA9A 1PAZA 4Y4KA 5GHWH 3ZDYE 4NNPL 1G5AA 5E2WH 3TA4D 1M71B 3BGMA 5DEGB 4G9FE 2ADJA 3TC9A 5E8PA 3P4LA 3MKGA 4Y2DC 2ATKA 2H4EA 3KVPA 4NNXB 5EO0A 1N68A 2V3DA 1WZMA 4FQHB 1JCVA 1F4YL 3PL6D 3KL3A 1QYGL 4N0UA 1AZRA 1CFQA 4PD4J 4XMTA 5DYOA 4LASH 2AS5M 3Q13A 5AYQA 5DJZB 1TCRB 4QMEA 4ERSH 1QSEB 3MLZL 4MMXB 4HWBH 3QZWB 1PEZA 5JMRA 2AEWA 3ILEA 1VLXA 2EXWC 3MUHL 1K72A 4G7VL 1ORQB 3W2DL 5TE6H 2RACA 4ZXBA 1HE7A 2YHGA 3VXRD 2X1XR 4XO5A 4Q2ZA 3MCKA 4QTHB 4FS0A 3RVXC 3WN5C 4LGRB 3BZEB 4JG9A 5LAXB 4TLKA 5HYJE 2AJ3B 2VXQL 2XQBH 3AACA 3SYPA 2LTQC 4X8GA 6FABL 4PRIA 4PRAB 4AQ8C 5EV7A 3GZOA 4N0YH 1S9WB 3GMMB 1T4KA 3PQYE 1RZJL 2N56A 3GUFA 2FO4A 4HQQL 3B3IA 2YEQA 3EKCA 4C56B 3KJ6H 5C3LD 2X7LA 5I1GH 3MLXH 4LPCA 3HMWH 2ZX9A 3VFMA 4PJCA 2R9HD 1TVHB 3O4OC 2WGNB 1V54B 1S5HA 3UYRL 1UASA 3QA3A 3DURA 4HXBL 3SE8H 4R84A 1AHMA 3B8SA 4JM4H 4XNMB 3AUVA 1A7RL 3M1OA 1IL1A 4HJ1A 2IDQA 4JZOB 5D93B 1BZ8A 2AJYH 4I77H 4LPXA 3HNTH 2WLNA 1Q72H 3ZOAA 1TENA 2KL6A 2RQEA 5JZ7D 4D8OA 1HHJA 1BQHG 1MH5B 2Y7OA 5KVFH 1KY6A 2NTFA 4QAWA 2WPGA 4WO4D 3QJOA 1GYVA 4ZG1A 3VFWB 4D94A 4ELDA 1W2KT 3FT0A 5MENA 5J57B 2ZUQB 1O6SB 1QNZH 2XPGB 5TDPA 3KWVA 1KTKE 3GTNA 5KTEH 3ZIMA 1T21A 3K72A 1LO4H 2XVGA 4UANA 4ACPA 1RZJC 1I8KA 4P2AA 4YHKH 4KK6D 4PJ9B 3QJFA 2GT9B 1B0RA 2VDQL 4AH2B 4Y19A 3V4PH 4M1GL 3P77A 1YMHA 3FQRA 3WXVH 4R8WH 1UWXH 4KUZH 4B9YA 3D4ZA 5EZOL 4KITB 1SQMA 3DX7B 4W6XB 3QPXH 4R4BA 4PJIA 1SDAB 4EN3C 3EJQA 4PJEB 1MFMA 3NPSC 5FO8B 3JWNH 3QR0A 4WZ9A 3MRGA 4U1SA 2EYSB 3P4OB 5F71A 1U8MA 2ZT9C 4P5MB 1RZFL 2AMUA 3OD3A 4BCYA 3NIDF 5KYUB 1IBFA 3TVMD 2XG4B 4JPWL 3Q2CA 3NFPA 1EFQA 3CK0L 2EDLA 3PWLB 4PR5A 2DI7A 5DRWB 4MD4B 3DYMA 4L2YA 3BKJL 3V4UH 2DQCH 2DJSA 2X2UA 3DETD 3RTQC 2FUQA 1GGTA 1Q0YL 3D9AH 1JPGB 3HNVH 2WNKA 4GUOA 4A2LA 4DP5X 1BYOA 3DSNB 2YSSB 3D4YA 4KX7A 3X12A 2VN3A 4CJ0A 5LGJA 3CE1A 3HAEH 4BDVA 1AGCA 1P1ZB 3BVTA 3KR3L 3IFNL 4GO8A 1QASA 2QADB 3UBFA 2A0LD 3FH7A 2ARJA 3LKNB 2DWDA 1IM9D 3K4AA 3KZ8A 2BSTA 1V7MH