4AV4A

Fimh lectin domain co-crystal with a alpha-d-mannoside o-linked to a propynyl pyridine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVNLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av4A00
4XOEA 5AALA 4XODA 4AVKA 2W07B 4XOAA 1QUNB 4AV0A 5IQMA 2XG5B 4XOBA 4XO8A 3MCYA 4X5QA 1UWFA 3JWNH 4CA4A 3BFWA 4AVIA 3SQBB 2J2ZB 5FX3A 4CSSA 5LNGA 4AVJA 5IQOA 4XO9A 4J3OG 5F3FA 2WMPB 4AUUA 2VCOA 1ZE3H 4J3OF 5ABZA 5AAPA 3RFZA 4X50A 4AVHA 1PDKB 1KLFB 5JQIB 3ZL2A 5FS5A 3ZPDA 4AUYA 1N12A 2UY7B 4AV4A 4X5PA 4X5RA 2XG4B 1KIUB 5FLUA 2UY6B 2JMRA 3JWNG 5CGBA 4AUJA 3BFQG 4ATTA 4LOVA 3ME0B 5IQNA 3ZL1A 2JTYA 5LNEA 1TR7A 4J3OH 4AV5A 4BUQA 1N0LB 3JWNE 4XOCA 3BWUF 5FWRA 5AB1A 4CSTA 5F2FA
chains in the Genus database with same CATH superfamily
4LPTA 3ARBD 5A40E 3CWGA 3C09C 3CHOA 1R17A 1QR4A 4XO3A 1TENA 4R90L 3V4UL 4NKDA 3G6JF 1XH1A 4IOFD 2WLNA 1E5BA 5A2BA 1EO5A 1EFXD 2VYRE 2CBMA 1UGKA 3GJFK 1NJ9A 1QSFE 3GLZA 4NDMA 4HKJA 4GH7B 3VGGA 4ZFOL 5CCJA 3ZDXF 3MRBB 1A2YB 1JS4A 2XTLA 2BVQB 2IDUA 4AMWA 1BQHB 4PB0H 4H8QA 1I7ZA 4TSCH 4E9VA 1HL5A 2WLKA 4P2RB 2E4FA 4M8QB 1UJ3A 3OPZL 3RDTC 5FGCE 1R3HA 4PBWD 1D5IH 1E9QB 4NPKA 1EJFA 1VRSA 3P02A 3QR2A 5BS0B 2DQ6A 1YQVH 2FEDC 2NUTA 3GSVB 1R5WB 4UB0L 4XPBH 3IMTA 3SYQA 3RIAF 3FO1B 3WEXB 2ZCKH 3IPEA 3FPXA 2HG5B 1SOSA 3K2KA 4BQ8A 3CQPA 5FCUH 3PU7A 4PJAF 4BCYA 4KGJA 3FTUA 4M6OL 4XP4L 1W0WA 5DEZA 1F8TL 1CTMA 4M4PA 4G8AC 3SDDD 1RJYB 5AZEH 1RJLB 2RHEA 2VM4A 4Y2DD 2F9BT 5HJDA 3QQ3A 2RMNA 1U8IA 3QAQA 5D5MA 1EXHA 2AQRA 1P6FA 2NXYD 2UZPA 4YEEA 4Z95L 3BW9B 4DESA 3R0NA 1YNLH 5T8IA 3MYZA 1LDSA 1VJSA 4GRLD 5GSRA 1Y1DA 5DJCB 3EJJX 3QUML 2H8PB 4QYOB 1GTNA 1L7TL 4P5MA 4U1JB 2X4OB 5C08A 1J1PH 3VYPA 3S5LB 4DETA 2NY1B 5CJQL 2DLFH 2VR7A 4LCYA 3OPUA 3LN5A 3BZ4B 2VQ1B 1SM3L 3P4MA 4G6JL 4XHJD 5FHAH 1M3IA 2GBVA 4NGHH 1DSYA 4J27A 4PRPB 5A2AA 3ZL1A 2JTYA 2ESVB 2QR0A 1E6OL 4YSSA 3TBTA 2B0SL 3BFOA 3CIQA 3ZTNL 2VERA 3QUGA 1TZIB 1BF8A 3HMXL 4LPWA 4MQTB 4Q97A 1UH2A 1F2QA 3MJ8A 4J3OH 1MCKA 1QYGH 1E9OA 2VRQA 3N1MC 1WGOA 2JCCA 4OVUA 3DGDA 1KXHA 4GFXA 2P5WD 2D2OA 3WFZA 5F9OL 3B7SA 3DX6B 2Z6FA 1LP9A 2IH3A 3NQIA 1DVUA 1E65A 4MKMA 3K74B 2MFNA 4Y4FC 1JGEA 3K8KA 2WLIA 2X6CA 2J71A 1HI6A 1P1VA 2MIZA 3SGKA 4FN0A 4GQQA 3H42H 5CN2A 2FWUA 4WU7B 2EYRB 2Z8RA 3NK3A 1LE9B 4IBUA 3IVKB 2ZAGA 1C5CL 2BY2A 2FO8A 3GFUA 4I4WA 3NOIA 1M1SA 1MHEB 3WEBA 3S4SG 3ZHNA 3HPLA 2C9PA 4NB7A 5HHOB 1PCSA 2XJLA 5JHBA 4AXWA 4U1NA 1XVSA 4OF5A 1ACXA 1FNFA 2GK0B 4KV5E 4LSTH 2BVPA 5HI5D 3VTTA 3U83A 4JPKH 4JRXD 4UDTB 5FGBC 1ZT4B 1XR8B 2XWRA 4N9GB 5SWZA 1RH8A 3FCBA 1SXAA 1KLFA 1JNHA 1ZV5A 4Z7NF 4OLXL 3GSNL 4JFOB 4NPYB 4NERA 2JJVA 1L5GB 3SPJA 2ADIA 4YQXH 2LT9A 2FT6A 3ZE1E 2ZOLB 3LIZA 3R06A 4EOWL 4FKEA 4NJAH 1N4XH 4FE9A 4QOKA 2PO6D 5T3XL 4DZBA 2HVJB 5CP3A 4WFGD 3KYAA 3OF6A 3QPXH 2DWDA 2ZX6A 1UOLA 2VN7A 2XV0A 3QEQB 4GO8A 4MSWB 4XMLH 4TUOB 5DMYA 3K71A 1U21A 3BUYA 3CPLA 3DRTA 1W2KT 1YEFH 3MRLB 4PIBA 3EYOA 3IN0A 4UQ2B 3VGBA 4BK4A 3HE7B 4U31A 4PJDB 1KCKA 1XZ0B 3P77B 1HC1A 2I27N 4Q9CA 2XG4B 4YGVB 2VW6A 1SY6H 3WNPA 4K9JA 3KPMB 2RB8A 4B60A 1N10A 1U8QB 4P05A 2V9QA 4BK5A 4OZFH 5T5NG 5EUKA 1NGQL 1JZEA 2AJVH 2F19H 3TV8A 5F7AA 1N0LA 5DJ2A 4FFZA 4U1LA 1E42A 1KLGA 3UTQA 2FR4B 3Q05A 4B53A 1BLNA 3A47A 5I1JH 4YHKL 4H0IA 2PR9A 5ESQA 1Q9LA 4K5MA 2JXMA 3UBXA 1INQA 1D5BB 2NQDA 2DQFA 4PJFF 1WFJA 5BRZD 1X3DA 1TR7A 4AI7A 5L88H 3MODL 5GS0C 1NCUA 1OWRM 3LHPH 5DHVA 3SJVE 1YJDC 3INUL 2VDKB 2J6WA 4ZX6A 1X5MA 4JO1L 3LVEA 5CZXC 1KACB 3GJFH 1TJMA 1CGWA 1F11B 2AJXH 3HRZB 4HEPA 4FLRA 3WEMA 4UQ3B 4A7GA 3DIFB 4LE8A 4LLYB 5KVFE 3WL9B 4PJIF 4F27A 1TSHA 3GRWA 4HPYH 4TNEA 2FATH 1GS8A 1K4DB 5HHXH 1YMMD 3H7BA 4H26A 5D7KE 2B1OA 3CH8A 4OIAA 1QUNB 3NUKA 4NUQA 3BAXA 3X3GL 3W2DH 4D9LH 2EDDA 2CGYA 3A23A 4MCMA 1ONQB 1MPAH 2YN3A 4OB5H 3V0EA 3QXWA 3U6RA 2VLLA 4RRPM 5ACMA 3CDZB 1P84K 3TJHC 4YAQA 2R2BB 5LXVA 1JERA 1PX3A 4WSGA 1XGTB 3ZJAA 4CVXB 3IMWA 1CGYA 3SZ6A 2MOQA 2B3RA 5AYQA 5DJYA 3AS1A 4OCWL 1VFAB 3JTTB 3HFFA 1GIGL 4ZMYA 2J6EH 5C0CD 3BP5B 4WGVB 2Q6WA 3V4LA 1VSCA 3AZUA 1SXZA 3RTQC 3UC2A 3FSOA 5EZIH 4LKXA 5IB5B 4H20H 1AC0A 4OZIF 4G7VL 3SGDH 2UUDK 4BFOA 1NBZB 1XCWA 5SWSA 4KO5A 3BSZH 4ZO6A 1JGDA 4N8CL 1NUFA 3D85D 4Z7AA 1NKRA 1KCRL 1BVLB 2X4PB 3WXWL 3RURA 4EUPG 3QFJA 4Q2ZA 3BVDB 3EJCA 4X5WA 2Y24A 4FTDA 4OAWA 4P4KC 1MI5A 2IFFH 3NFPA 5C3TA 3L3OA 2YMXL 3EOTL 4LEXH 2Z31D 3P2TA 4G6MH 3S88L 2ZXDA 3TA3D 4X7FC 3T0EA 2YEZA 1KTLB 2W0PA 3JSSA 3VYNA 4C4UA 1RHFA 2ZCHL 2Y69B 4W9JC 3IN2A 1AJ7H 3N9GH 4NQEE 3U30C 3VRLE 2YBRB 3ILQC 3D39B 4FFYA 5BVPH 4BFKA 1YAIA 4LRNL 2H1PH 4IKJA 4OCMC 3D69B 1JIBA 4ONHA 1D5ZA 1PNCA 3MRBA 1A2YA 3O4LD 1DCLA 1J12A 5HHPB 1LDPH 2BVQA 5AKRA 1BQHA 2WJ5A 2NDFA 2W9DH 3KPOA 3QDMD 3PE9A 4N2DA 2DF3A 4PR5B 3IAGC 3VXUD 4P2RA 4BFIB 3P54A 4RIRB 5KANI 1A02N 3SODB 4Z0BH 3WMSA 4MNGB 4NRXB 2PYED 1VKXA 3KPPB 3I6LD 1AS7A 2VR6A 3QO0A 3WEXA 3FO1A 3UEQA 4MQXD 3TH2T 5E00B 5FYJL 3QJHA 2WN3A 4FL4C 1VPOL 1YYMH 4H7VA 5JXED 4UQBA 3ABKB 3CFEB 4ZDHA 5I74C 12E8L 5GJTH 3CDGB 3CUPA 1JPEA 5TK2A 5IHZB 1E50A 1PYWA 3TN0B 5E4AA 3KJ4B 4OLZH 2VUOA 1ILSA 1QSFA 1ZT7A 2O5XH 4YHPB 2L7QA 4UINL 4Y8DC 1IBYA 3BUPA 2TRYA 3BHBA 3QI9D 5I24A 4JJ5B 5IEHA 3VNZA 2IH8A 1RMFH 1M9WA 4GAGL 4XC1H 1ULVA 3LD8C 3G6AB 3C9NB 3MV7B 4KKPA 3DWTA 3NIFE 4B9ZA 4CN1A 1AMXA 1K2DB 2R4SL 3L54A 5DJCA 1CL7H 4PJ8A 4QYOA 1CFTB 4MNQB 4U1JA 5I8OL 4X7DC 1U8NB 3EGXB 1QFWH 3S5LA 4TSBH 3ZE2B 5FYLH 4M43H 1R1CA 3RY6C 1HFUA 2ZSVB 1J0JA 2M1KA 4J3OG 2VDNL 4UV7H 3ARFB 4B6ZA 3M8OH 4XZUB 1IC4H 4J3WA 5CJ8A 4YIQB 3RPBA 1TZIA 2X53A 4NQDE 3LZNA 4QXUL 5JHLA 1D6EB 2VLRE 3NSYA 3MUZ1 3LKNA 2XWTB 4NFDA 2Z7ZA 2HCZX 1G4MA 4JFDA 5FUZL 3CLFL 1MZZA 1BEXA 1QOKA 2IWFA 1WAEA 4WW2B 4PHXA 2QSVA 4PLKC 1IGFH 4BSVB 2VDRB 2ZYIA 5AOLA 1L0PA 4G3YH 4KFZC 4NT6B 1I31A 1PLAA 1XH3A 2IF7A 3KW8A 1J5OL 4N2MA 2NLJA 3NSDA 4WU7A 3BIBX 2Y23A 1LE9A 4HUUB 3D2UA 4YK4C 4RA0C 4AH2B 4OF6A 1LHZA 4JPWH 5HHOA 1VACB 3NCEB 5DVNA 1YO4A 4TVPD 3K2IA 3OWEA 1KUMA 2GK0A 1JD9A 1KFGA 4Z7UB 5CSZB 3FRUA 1VIWA 4OFIA 1ZGLM 2W8CA 1AFVH 2GQHA 4LLWB 3QJFA 2BSED 1OP4A 4OF8A 3MJGX 2E0PA 3JVGC 5F21B 5GS1B 1DQLH 2R29L 4NPYA 3LRHA 2BVEA 1L5GA 5EU3B 3CJJA 3EYSL 3T0XA 2AJZB 4FMFA 4P2QE 4M1GL 3OGCB 3OZLA 2J55A 2PR4L 1OE1A 2HVJA 3CZEA 3F84A 4Y7OC 2F15A 4DERA 4ENEC 1A6AB 1M4KA 2GB2A 1CLOL 2HFTA 2NCMA 5E8DH 1KPUB 5AVZB 2WM0A 1IKNA 2XXCB 5KZCB 3FHAA 3MRLA 1U95B 4HUXA 3HE7A 3L4VA 4H8WL 4XWOC 2ICEB 1N68A 3D5OF 3MOAH 4Z0XB 3P77A 1RU9H 3WY2A 4OZFG 2NY6C 1PD0A 4E9QA 4K3DH 1IIKA 4YGVA 1L9MA 4V1DE 2UUDH 2DQHH 4NCDA 1B0WA 3CHPA 3MCLH 5ICZB 1YA5A 3ESMA 4ZFGL 1FI8C 2CHDA 4W6WB 2HWZH 5I66A 1KCWA 4JFHE 4H88L 2GY5A 2Y0SA 3BRDA 2FR4A 2ZNWA 3AREB 3UIZA 2Z64C 1CN4A 1QSZA 3P4NB 3RP1A 2G60L 4O51A 4Q4EA 2XQYG 3O6FA 5EOTA 4GS7C 1NDGB 1J05B 4TNGA 5GPRA 3S5YA 4Y4FB 2FJHB 1XGQB 2P5EE 4LGRB 2R9HC 4PJ5D 2UY7A 4RGNB 2WNWA 5I1IH 1A1NA 2B3IA 3O6MH 4WU5A 5F0PB 2VXQH 4EI6A 5JW3L 3MREA 4X50A 4DP1X 3DRQB 3IBEA 3CZLA 3HW7A 4AMKL 3IGAB 4ZRGA 5E6IC 1R3JB 1O7DC 3CFQA 2FGWH 3GPSA 3GI8H 4FQIH 3HRZA 4K7PX 4UQ3A 3UTSD 3KPSD 1BAFL 4DGVL 2V2WB 3C8KB 3DV4A 2ZX9A 1P2CB 5FOBB 5E4EC 5DJ8B 5CHNA 4PJAE 1OSPL 1CC3A 2YKLL 4AL8C 3ULVD 2GT9B 2BVOA 5FEBA 2X3AA 3BLKA 1JF1B 3TGXA 2WINB 3PFQA 2I9LB 4RMRA 3S8WA 1QUNA 6PAZA 4NJ9L 3GXDA 1F90L 2IOOA 3SOTA 1OOWA 1ONQA 5IVXF 1HCFX 2X05A 2MKLC 3W82A 3QJQB 1JZ4A 3CDZA 3LZOA 3W0WD 3MRKB 3TBSA 2YPKB 4GQ9L 1X6NA 4PWIA 5DFVD 4S1DC 3T77A 5EA0L 1XGTA 1ETZA 4CVXA 3SJVA 4IKIA 3ZKND 2OJZH 3AWGA 3N3EA 1AE6L 4WCYL 2IGFH 4PREA 3LQAC 2ARJA 3NIGF 4X0KA 1A7OH 3O0RH 4L5FE 3N40F 3WJLC 1QG3A 5CWSB 1G43A 1CO1A 3FAXA 5IB5A 1DR9A 4QXGH 3D30A 1YN7B 5D72L 2SEBB 1UQSB 5CUSH 1YC7A 4RH4A 5D9SA 3TYFB 3VX0A 2CKBL 3VVWA 3TESA 4FMKA 4GG8B 1ADQA 1BHGA 4R7LA 4ZX3A 2X4PA 4TUJB 4A2FA 5IJVA 4CW1B 2Y7NA 5D7LE 1WWBX 5FW8A 3P9MB 4I1RA 4AOFA 5CKAA 1L9TA 3T3MF 1P53A 4K3JL 3D9AL 1JSYA 3MV01 1W0VB 4LESA 2ATKB 2KMWA 3QZPA 3NDZE 5JORA 2D7TH 4DGYH 1KTLA 2MNUA 4A6YA 4L18A 5DGQA 1M3JA 4URTB 2XN1A 4PJXB 2DOCA 1AQHA 2Z3FA 1ASQA 1SMAA 3GHEL 2YBRA 4P57B 3D39A 1BD2B 5GRUL 5BUGA 3R1GH 5JHMA 4Z3EA 3O45A 3U7WH 3REWA 1RJZB 4HIEB 4TLSA 2ZXAA 5DK2B 4Y9GA 5D2LF 3LRLA 5IQ7H 5TGBB 3VXOB 4HUWA 3B8YA 1GGUA 4AYGA 1LWHA 4RIRA 1PKQB 5AW2B 4GPVA 4G80B 4XC3L 3LZPA 4F8LA 3UO1L 1NCCH 2QELA 1HXYB 2QL1A 5KW9L 1V8HA 2EVHA 2HKFL 3DHPA 3K2MC 5MI0B 4Z7NE 3FQUB 1DVFB 5JIIA 2JF1A 3QUYD 4HCIA 4P5TC 1QABA 4I7ZC 3CDGA 3JWDL 3L4WA 3CDYA 4RISL 3TJPA 4J1UB 4EBQH 4ZK8A 3TN0A 1ZS8B 1T1YB 1QASA 4DAGL 4YHPA 4AEIL 2IPTH 3PUCA 5FYKH 3OX8A 1S7VB 5GGSB 6FABL 1Q72L 1TTFA 4OZGE 2ZCLL 3NMEA 3BP6A 4PTTA 4JJ5A 1EXGA 2B77A 5I6KA 3MQIA 1HL8A 4JX0A 2CGRH 3RTQB 4AQAB 2IALB 1FN4B 1WP6A 1MFBH 1ZPLA 3SDAB 1XTMA 5HGDB 1CFTA 2XC8A 1ECYA 4AQ8A 4GRWF 3MMEB 1ZT1A 3FUFA 3EGXA 3CVHH 4JM2A 3D0VB 5I71C 1U2YA 2LOEA 4U6VL 4DP2X 5A2LH 1FWXA 1IGCH 5GGRY 4NM8H 1OTTC 4P8QA 3B3BA 1RPUA 4MD0A 2V9TA 1T5WA 3GEFA 2PWFA 3BKYH 1HQRB 4HXBL 1QFUH 5KTEL 1E5ZA 3ARFA 2D3NA 4YIQA 1YEJH 4YOKA 3DDGA 3FMGH 3QWOB 1CF8L 2FSDA 4HF5H 1D9KD 4M48H 4KQ3L 5DDHB 1QFPA 3L4CA 3S3DB 4PJFE 3BLBA 4XAKD 2WTPA 1G7HB 2XWTA 1P4LB 4MJ4A 3K72A 4WUKH 4HKZB 4JFZL 3RGHA 3ZHFA 2HRGA 1OPOA 3ZKQD 3WJJC 3CBKB 4YHYB 3OKOA 4BQCA 5CCHE 1YCSA 3NA9L 2DMKA 1JOIA 1NKOA 5CBEA 4BSVA 4D7BA 5L0QB 1SXCA 4AYFA 4B27A 4APQC 2X2HA 2CCLA 5C07B 3ULVF 1KYAA 2O30A 3SOBL 1WAAA 2YQGA 4XBEL 1C5BL 2BY3A 1C16B 4WO4C 4FX5A 4NO0B 1RZGB 2NYZA 3OPZH 2CUAA 2TAAA 1VACA 4JG9A 3TO4D 3OV6A 3GBML 5MEQA 1QPXA 2APVA 5LNGA 5DJ0A 3NYKA 4MCZA 4NQDA 4OIFA 4UBDC 5CSZA 2YK1L 2ZXBA 2VLRA 5I74B 4D3CL 4LLWA 4OFQA 2W9EL 2VM9A 4XP4H 4F7CB 4Y5XA 3W11C 5GS1A 1FZOA 1RUPL 4JFTA 4ABWA 5ADPH 1TVHB 5EU3A 5D1ZC 5JPMA 3L5HA 4JREB 1BFTA 1TNMA 4K94L 3OGCA 4AGLA 4UNVA 3B2MA 1M56B 4GY4A 3LD8B 2R23B 4OZIE 5JQ6L 3WTXA 3L4ZA 1HU8A 4L48A 2WQXA 2CDGA 3BZFB 4LAQL 4LL4A 2P24A 1JZ2A 1GGYA 3B3IB 3QUMH 4HZLB 4K23H 2NXYB 4UAHA 4PY8J 3RI5K 5AUMA 3SKNB 2P5WE 3NJLA 5CJQH 2R69A 2YD2A 1FVCB 5A2JH 1VHPA 2ICEA 2KPNA 2VDML 3L1EA 4DT2A 4G6JH 1B0RB 1NBVL 1U8PB 5IB2B 4U3SA 1AC6A 1I1YB 1PZ5B 2VH5H 4OLWH 4ZMPA 3MV8D 3ECBA 3QG6A 1E6OH 1G9MC 4X4YB 3ZTNH 3F58L 1GZPB 5DD1H 3I6SA 1NAMH 2IBZY 1MAMH 3DTUB 3P4NA 4RZKA 2QGDA 3KLLA 2DWEA 3QIBA 1LK2B 1E27B 3VRJB 5KSUB 2BY1A 5EIVA 5F97E 2H45A 4P3WA 5F9OH 4GSXA 3S97C 4ZTEA 1XGQA 1A7QL 5FW6A 2XVGA 3U4EA 1PG7W 1ZS2A 3I75B 1ILUA 1B0IA 1T22B 3MBXL 1E3ZA 5I73C 4OLUL 1ML0A 3ML9A 1DEEA 4JRXE 1MCOL 2W92A 4OUUA 3CVBA 3NCYS 1AOZA 2A74C 4YK4B 3UERA 1R3JA 1WS7A 1QW9A 1TU2B 4LPUA 4Y5YA 2VE6A 5K9OB 4YLQT 1C5CH 4FQLH 4TULL 1NC2A 3HZYA 1MFCL 4Y4HB 2NZ9C 4JZOA 3D0LB 5KWYC 3OKEB 3T6VA 1GGCL 4KZEL 5FOBA 4V1DA 1M7IA 3VG0L 3DGGB 5KG9A 3Q2LA 1J0HA 3LS4L 1UXSB 1GC1C 2H9GB 4MMXB 2WINA 2I9LA 2WMPA 4M3JA 4WFGE 4YHIB 4R6UA 1X5AA 2DQIL 4L3AA 2Y6SD 2BNQD 3TEWA 3WO4B 5GJSL 4R26L 4ZAKA 5IHLB 5I6OA 4O2CA 3T5WA 1VFBA 5FUOL 3VMOA 3CN1A 1BXUA 1IEBB 1DO5A 5D2NC 3V6OC 1T1WA 2IH1B 5T1LB 4Y2NA 2DKMA 3UJIL 3MRKA 4YH6A 4PJHF 1WIOA 2YPKA 4IYKA 4FNRA 3X1GA 2LTQB 2H0FA 2XTSA 3HB3D 4EOWH 3BE1L 4XMKL 1MDTA 3L16A 4HJIA 3IJ9A 2G9HA 2RQ8A 1YEHH 3CFMA 1AI1L 1KXQE 3ZO0A 1H9VA 2CUHA 2YQ2A 2Y36L 4KUZH 2X1PA 4PP1C 2ADYA 2YRLA 1BXVA 5CWSA 5FA3A 3ZKXC 3LNEA 3COOA 4F5CE 2SEBA 4MMZA 5JW5A 4XCNA 5DK0B 4FCAA 5EBMA 4HETA 2HJLB 4GSDL 4OU3A 5CEXB 3KEDA 4GG8A 1FPTH 4ZT1A 5HPMB 5AZUA 2DKSA 4ODSL 1PG7H 4MA1B 5HHNA 4HBQA 4UTBA 3RL2B 1RUAH 2Y7MA 5BRZE 4WI5A 4CW1A 2OW7A 4YWGL 3GMRB 1U8JB 4RFEA 1U8LB 5IFJB 4MDJA 1TYEB 2ITDA 4QF1B 5AVUB 3H4FA 2A83B 4Z18A 43CAB 3VXMD 1E7VA 4WDIB 2DWXA 4DEWA 3BQUC 5FM5O 4WTZA 4J3OC 3M17B 2NNAB 4YHKH 3DPBA 3OKLB 4PJXA 5DO2D 3E8UL 1YMME 1AQDA 1PSKL 1RK0B 4FQQB 4IK6A 4MFHA 4P57A 1BD2A 1S4IA 4X4KA 5HGHA 4F8PA 1T03H 3MODH 4ZMWA 1BLIA 2WIIA 1IU1A 2WCGA 1CBVL 2K9UA 2YXVA 1RJZA 3INUH 3HG1D 4HIEA 5KUKA 1JK9A 1MREL 3T2PA 5DJDB 2YD5A 4CVUA 2HTKD 3VXOA 1T7YA 1J1OL 2G5UA 3IFLH 4N87A 3T8MA 5E4EB 4Z3TA 4U1SA 1KXVC 1WIUA 3ECUA 4G80A 3OQ3B 2QSCL 3WENA 5MERB 3ZLQC 3T4YB 1TZ8A 4MA7L 4U6XB 1HXYA 3WXVL 4HGMA 5L6YL 2UZIL 4CU7A 4MYWB 4H1LB 5IJKA 4WKZA 3RDTD 3FQUA 1JFQH 3VQ2C 1DVFA 2ZWSA 3EF4A 5C0CE 1JJUA 1HAUA 4HHGA 3VQLA 3O6LL 1Y18B 1H9DA 2FEDD 3AU0A 3BAIA 3P0GB 2ZOUA 3VD4A 2FL5A 3BUTA 1DBBL 1UG9A 3EXLA 3K3QA 2UXVA 4GRMA 1T1YA 5GGSA 1S7VA 2UZYB 4W9LC 3LDBB 3V6ZB 1R9FA 1WZAA 2EYSA 5TQ0L 2IAMB 1JF6A 1EQWA 4OCWH 5ICYB 4FAAB 4NP4L 4C58B 4Q9QH 3MROB 2DQTH 1ND0A 4YUEH 3RZCD 3FQ4A 5LQBH 2AVGA 3SDAA 2CU9A 1E9PB 2P48B 5L4IA 3FB7B 4LOFA 3IRCA 1V7ML 3EYVA 3AM8A 2GJ6B 3NPSB 4G7VH 2WD0A 1OM9A 1UGNA 2YLHA 3D0VA 2Z91A 2LU5A 5IEKA 2AP2A 5KS9F 2FECL 3MXWH 3HZVB 4DOHB 1DZBA 1W8OA 3TO2B 3NEOA 3G9VA 5IMMA 1UYWL 3L3JB 5DQDL 1D5MA 1Z9MA 2J44A 3WXWH 2F74B 1HQRA 2Z35B 4Z3HA 4J4PA 2Y4SA 5DZNA 4PW3A 4HJGA 4F20A 4LQFL 1TZAA 5TH2B 4N6QA 3O4LE 4ERSL 3FH5A 3P2BA 2QPFA 4ILDA 1DE4A 1DO6A 1ZEAH 4L9LA 5E2WL 3GBEA 3QDME 3QWOA 3P0VL 4RQQA 5F6HJ 3VFUB 2OSWA 2YMXH 3MACL 4FXKC 4RA3A 3EOTH 2DQMA 4OZGA 3VXUE 2ZUQC 1DDHB 1P4LA 3S88H 1HH9B 1KG0A 1CDJA 4W6XB 1V3KA 4LSSL 3JV5A 3HA0A 4PY7B 2DI7A 4EZMA 1IAOA 5T1KA 2EXTA 2ZCHH 2PYEE 3RWCB 4WNQA 3I6LE 5I1DA 1F6FB 4L3FA 1AD0B 3FUJA 3KLAB 4NZJA 4LCIL 2JSFA 3ARBA 5GGUB 3VCLA 3L95A 5KVGL 1L9PA 3L2MA 1KPRB 4G70B 3CU1A 1UA7A 2HN7A 3APNA 1IGJB 2P28B 2XX1A 3QHZL 1X7QB 2ZT9C 1LO0L 3ISWA 4CRPA 1C16A 4PH8A 4NO0A 5DEGA 3WDHA 1M7DA 4NQSA 1E90A 4WJKB 4AJWA 5E23A 3B83A 4X6BB 4P5KB 1T2QL 4X98B 1Z9NA 5IVXE 1FYTB 3T2OA 1E7UA 1FGVH 3QDAA 5FYJH 2Q10A 2A6IB 1DJHA 1VPOH 2KLRA 4I3SL 4KI1A 4WV1C 4F7CA 12E8H 3ZDYB 5I1CL 4GAFB 4JFYA 1TVHA 3RIAK 1BQLH 3L5JA 1JYVA 4YHLH 1LK3L 1WUZA 4HLZH 1FRGH 1WBYB 1TMQA 2LHAA 3FU0A 3NIGE 5B8CC 5CM1A 4NKMA 2ITCB 2FO4B 1GJIA 2EE0A 3I2CH 4HQQL 3ZYZA 2IDFA 3T4AB 4TLUA 3ZQ9A 4Y2DA 1FBIH 3X12A 1UA3A 5C97A 4OIIL 3SKOB 2Y3AA 4JFFD 2R4SH 3PHSA 5I71B 4KRPB 3T8VA 5CSBA 2EP6A 1ZD6A 4ZODA 2K7QA 4E41D 5I8OH 5IQ9B 3FAWA 3SKNA 3ZE2F 5AW9B 2JK5B 2AJYL 4PJEB 1FVCA 3T3ME 4F33B 4KDTC 2IADA 2KDGA 4PYGA 1R3LB 4H44C 2DD8L 4HJUA 3BEVA 3EJPA 1C1EL 1QNZL 1YQ2A 2YAMA 3L4XA 1P5UC 1MCEA 1FHGA 2HG0A 4PJ7B 2VDNH 2NY2C 4X4YA 1SJHA 3OAWA 3UZVA 5I23A 4KUCD 1OCZB 4QXUH 2DEYX 4C56D 4L8SC 1E27A 4Z8FL 3CFDB 4NSKA 4JS7A 3F12B 4OGYL 2UVFA 3ABLB 4OZIA 2E3VA 1WEJH 3CLFH 3GSWB 5C7ZA 2X9XA 4WTXA 3W57A 4L1SA 4NAQA 9PCYA 4WW2F 1GXEA 1T22A 5D2LE 3IJ7A 3MJ9A 3P3TA 5CIPB 4NO5A 4CADA 4NNPL 1XCQB 2VR4A 1KBKA 2OMUB 5HDRA 3U4KA 2GTZA 1N8OE 3QUXC 3LMJL 3FB6B 3O0LA 1F56A 2DZEA 1E4JA 4W9FC 4WTWA 2VDOB 1GOGA 3D0LA 3QXUA 4XB7A 1S78C 1B90A 1CXIA 3ABGA 2OMVB 3GHBL 4JLRB 5CZXD 2IBBA 4K9EC 2I07B 4MMXA 2H9GA 2Y25A 4KMQA 3MRQB 3SE4C 1AGCB 4Z7UF 4YSQA 2BS8A 2AGJL 3F65A 3AC0A 3V79C 1CD1A 3AAZA 2X4SA 3H8NA 4PI2A 4KROC 1IEBA 4ZZFA 3KE0A 2BS71 5LGKA 3GYRA 2IH1A 2EAEA 2AV7B 2R29H 3MRHB 4E68A 2Y7QB 2QMKA 3KPNA 1F6AA 3C6LC 3EG9A 3D05A 4HUMB 4YHNB 5KVDE 2DJMA 3SSGA 4JRXA 4Q0XH 4HOZA 1W15A 4NFBA 2V17H 3GRWL 5EO1B 5KJRL 1UVQA 4LLMA 4ZFFA 1ZTXL 5C86A 3NFSL 1ZHKA 1BFVH 3TJHD 4OUOA 5TDPA 4QY8B 1IJ9A 4HXAL 1KC5L 1CLOH 3RILA 5DEJA 3SQRA 3OKKA 5DK0A 5AQ0A 4JM4H 4HC1H 4KXCA 2PO6A 1VFOA 3MCG1 3C6SB 1O75A 4KX8A 2NXZB 2OKMA 5DVPA 4H8WH 2OM5A 1F1DA 3RDJA 4C54A 4IDLA 3V4VA 2H6UA 3RL2A 4GOSA 1JD7A 2X87A 4PJ5E 1MJUL 1ZXQA 4B5EA 3VFNA 2LAGB 1QBMH 2YAQA 4U6YB 1MNUL 1U8LA 1BQRA 2D8KA 4G72B 3O2DA 3WG7B 4ZFGH 4F2MB 3E7JA 4NO2A 4QNPE 4H88H 1EHLL 3HZMA 43CAA 4POUB 4NRYB 4WDIA 2WYZA 2G60H 3T6QC 3IFNL 1GVIA 3UTSE 3KPSE 4YDIL 2H32A 4P4KD 1KXQA 3M17A 4AVJA 4F2EA 3ULUH 1VERA 1EJOL 1A14L 4D8PA 2WYIA 4P9ML 4UAOB 3ULVE 1OF2B 1RK0A 1RZIB 3BIKB 3T04D 3C87A 1RHHB 3WS6C 5D7JC 4AQEB 5GRYA 1MWAB 5AG8A 4HWNA 3T3PF 5IT2H 2X89A 4NN7C 4AMKH 5DC9B 1KGUA 3O2VL 5DJDA 3ILQD 2A9DA 3EH4B 2C26A 2A4CA 3UGXA 2K8MA 3ZL2A 2BS9A 3L1OH 1JHKH 3W0WE 1XB8A 5BRZA 3UG3A 3C60B 4LCUA 3X11B 2JKXA 3X1BA 1X7SA 4XNUL 2F2HA 5MERA 2H3NA 2GKIA 3T4YA 4A67A 4TQPA 4GKLA 4DP9X 3QULA 2G2RA 3D4YA 4H1LA 3BP7A 4FFYL 5GZOC 3QDJB 1B88A 4N0FA 1KIUB 4IS6B 2YFOA 2KYIA 4HWUA 1F90H 1Y18A 3R8QA 4PGBB 5DEFB 4FZEL 2MRYA 2UXTA 2BNRB 1AG0A 1QNIA 2O5NA 3TNNB 3SYAA 1CTNA 5J89A 4GQ9H 2XQ0A 2Q9OA 1WHPA 3MLZL 2W0FB 3V6ZA 1AQKL 2BSRA 2ZE0A 4MX7A 2H0JA 1A21A 1GCYA 5I15L 4O2EA 4QAWA 1UZ8B 1CWVA 1BF2A 4WCYH 4AIOA 5ICYA 2ID5A 2XTJC 3F6IA 1A66A 1I53A 3WN5C 1OGAB 1KJ3L 4FQPA 1TMCB 3N06B 3BAKA 5IIEA 5J1AB 1E9PA 5D72H 2GJ6A 3MRDA 2V5SA 4LFHG 2QHRH 4UQIM 2D03L 1WFIA 4PG2A 2K6YA 2O1AA 1QATA 1QHOA 3OLEA 4KUCF 5DRXA 4A7UA 5K9JL 1WPCA 3UDWA 3ZOAA 3L3JA 2ZWNA 5C0CA 3I9AA 1YECL 4NO3B 4L4TB 4UOW0 2J20A 3NJJA 2Z35A 1NLDL 5F1OB 3LZLA 3PDOA 3PAUA 5CZVH 4N8PA 1IV8A 1QLRA 5B3SB 1RUML 1NBQA 3D9AH 3Q01A 3Q6FB 4U1HB 5EU5A 3W3BA 5A6MA 1CMOA 3UAJC 3D85A 1DUZB 3BQUB 1DDHA 3A4FA 5MEND 4JZJC 3CCHA 4X4ME 1CQYA 3H54A 2E7DA 1HE8A 2FVNA 1UA6L 4HISA 4PY7A 5JLZA 1TQCB 2WKOF 1OQOA 4OTXH 5GS2D 2JKSA 4AQ1C 3K4DA 4PJGF 3GHEH 4P2OD 2JKNA 1P7BA 3CQFA 4NI6A 2VC2B 4P3DA 3PABA 2Z31A 1DEDA 3DX0A 3WUWG 3TA3A 1GZHC 2QZ5A 3SPCA 5JTWA 1MNNA 1IGJA 1LQSR 4LSPL 2QV4A 5E5MB 4MMYB 4LLVB 4GKZB 4LHUG 3CLWA 3THML 1G1OA 1PTZA 1J0KA 2F1BA 3O4LA 4P5KA 4XVSL 5BZWB 3VWJB 3WI9A 2OYLA 4IJ3B 4ES8A 4PLNC 2OV0A 3QDMA 4J3UA 1UWXK 4OZ4B 2V7HA 4JJHA 4AW4A 1BJMA 2AEQL 1D7BA 3J27A 4J8RB 4M5ZH 4PJHE 2MCPH 4HLZG 5DD3H 1H8OA 4UNIA 3JWDH 3Q8FA 3VJ6A 4RISH 5KYXB 4JK0D 1NTDA 2PYEA 4GUPB 4FHJA 3RJQB 2FAUA 1NEUA 1T3FB 4AEIH 4K4KA 4FQCL 5BCAA 1E28B 2OCFD 3C75A 6FABH 4W93A 3AT8A 2ITCA 4UZSA 2FO4A 2A9NL 1C08A 2ZCLH 4U1KB 4AMXA 3MRNB 3FN0H 3EH3B 5EO9A 3SBWC 4DK6A 2P3YA 2BWQA 1N64L 2XBTA 4O5LH 1DUYB 1XSKA 3P73A 1KCLA 3KPLB 3DO7A 1EGJA 1MSPA 4ODBD 1KGXA 2CDEB 2J8OA 4N8VG 4KX9A 4P3CL 4B0MB 4BD4A 1ORSB 1IM9D 2E86A 1NCHA 4XAKE 5IQ9A 3QI9A 1QKZL 1R5VB 4NWTL 4KTGA 1O9WA 4LEOB 2X6BA 4U6VH 1L9SA 2JK5A 5ESVB 4ZMTA 5IVXA 3MUJA 3NESA 4F33A 2ADJB 1JGUL 1R3LA 2WQRA 4GKSB 3QWRA 3FQ2A 3V5KB 4R4BB 1ECZA 2ZUWA 4PJ7A 2X28A 5KTEH 4M6NL 1AZRA 2OL3H 2YKKA 3PHOA 2IG2H 3K6FA 4GP4B 3K4ZA 4XWOD 2JI2A 2ZUQB 4KQ3H 2NZIA 3REVA 3CFDA 4DUVA 1A3ZA 1DBJL 4FF9A 3GRGA 4JFZH 4OFPA 4G8FA 1RXLA 4HH9A 3UMNA 2G5BA 2W07B 1MJ7L 4QJ3B 4FFVC 5AWNH 4N2FA 2XKNA 3NA9H 5CIPA 5BO0D 1T4KB 3ARSA 4FXTA 1XCQA 3CC5B 5K33A 2OMUA 1B4JL 4DWHA 2CR0A 1XAUA 2HRLA 1FO0B 2XZCL 3AACA 4I2XB 1CICC 1IILE 2GJRA 3FB6A 4NKIH 4TNFA 3NACH 4RFNB 4XBEH 3FT3B 2DTMH 1C5BH 3I6KB 4W4OC 1CD0A 5INCA 4BDVA 1GPOL 5E6ID 1NGPL 1TTGA 3GBMH 4UTAA 4ALAL 1GGIH 5DMGC 1MHCA 4JKPH 2PP9A 3M1BB 1NSNL 5LJYH 3MRQA 4MHHI 2ED9A 3LKOB 3CFCL 1AGCA 1ZA6B 5HHVL 3RWIB 1CDCA 1Q4NX 4MZRA 4WWKC 3APDA 1ODAA 4OD1H 4CC4A 4QRTB 4HCFA 4D3CH 3B2DC 2VDKL 1BXAA 2BWIA 1SMDA 3L8QA 1AY1L 1KXTB 4MXQD 4X2UA 1FNGB 1RUPH 2AV7A 3MRHA 4X7SH 1J8SA 5B7MA 4TUUA 2ED8A 1EFQA 3IFPB 3AXHA 3CQQA 4YHNA 4LXFA 3TFKD 1OZUA 2AXFB 3NAAL 5CLXA 4GYBA 5EO1A 4M9PA 1YYLL 4Y2OA 3QG7L 4NKQB 3HI1B 4PEEA 5CO1A 3ARGC 1KOAA 3MV8E 2P8PB 2XQBL 4OCSH 3VDBA 1JFHA 3ULSA 5KS9E 4WO0A 2WQVA 5IF0A 1I1AC 5CN3A 3JV4B 5EO0B 1BZ9A 5FAAA 3RX9A 1ZSDA 1H8NA 2AV1B 3N1PC 4TLKA 1IAKB 2WP3O 3C6SA 4ZUSB 1BVNT 3GM0A 4ORGB 1H8SA 2VDMH 4NC0B 5TE4L 3QEGL 4PV8B 3PGDA 5EOCL 2Q76A 4Q6YA 1NBVH 2NY2B 1UOWA 4X5XB 1G6RH 2LLNA 4PV9A 4M61B 4IBLT 4F2MA 3MJWA 3F58H 4L8SB 5AB0A 5DUPL 4MD4B 1G84A 1BIIB 5IB1B 1AQMA 3TWYA 3IU3A 1YG9A 4LSQL 1QWUA 4D8OA 4EVNB 1ZJBA 1CK0H 5FKPA 1TJXA 2CUMA 5DLML 1ADQL 1HN1A 3KDMA 4MD5B 2Z93B 3LH2L 5ERWA 1OF2A 1RZIA 3BIKA 2MCAA 4AQEA 1R3IH 2HT3D 5GXBB 3EJUA 4O02B 3MBXH 1F0LA 1MWAA 4OLUH 2BNQE 1MCOH 1XMEB 4ONOA 4QO1A 5CD5C 1ZA3B 3O4OC 4AENB 4KNTA 1WYJA 3STLB 4ZFZA 1MCBA 1DLHB 2WWOA 4NM4H 1ZLSL 4TULH 3L3KB 5HD8C 4GG6F 2QQKL 3C60A 4OF3A 1JYXA 2MNWA 2MQ0A 4JG0H 1GGCH 4OBRA 3QWQB 1DL7L 1VGKA 4XOBA 4LDCA 1YUHA 2H0EA 4OZHE 1MVYA 4OCYL 4YHZL 3LS4H 4ZMLA 4J2XA 1ETJA 4JRFA 2IPKB 2WPGA 2R0ZL 3QNFA 1AS8A 2PW1A 3LSOB 1G7PB 2OSLB 1KIUA 4IS6A 4CN6A 1RZFL 2AC0A 3NZSA 3HHMA 5I0YA 5GJSH 4PMEA 5FDWA 2Q7NA 3AWFA 1DANU 4QXWA 4EZKA 5DEFA 2JKTM 5LLIC 3RJOA 1GJWA 2BDNL 2WXHA 3KYOB 5E8EA 3D18A 2WB1A 5GRVK 2JNZA 3WLBB 2FECI 3UJIH 1UWXH 3VWKB 1C5DB 5LXGH 4J6RH 1WGVA 2FIKB 4P5TD 2W0FA 3LJ3A 3BKCH 3BE1H 4XMKH 5E2UL 3V5DA 5TK4A 3LRSA 4HS8L 1AI1H 2AEPL 4J5VA 3P4LA 2Y36H 5HDQH 2IAAC 3W0WA 1LEKB 2OR7A 3P3UA 1XMWA 1ZIBA 3O3UN 5D7EA 5E9DD 5J1AA 3VXME 4NQVB 5IK3B 3CHXA 1CI3M 3ZZ1A 1GSMA 4JE0A 4GSDH 2FX9L 4Z7VB 3S35H 1U33A 1TVDA 5B3JE 4M02A 2WBXA 5DWPA 1NCTA 2HKHL 2P9RA 1TO4A 4I9XA 4RAVB 3G08A 1L9NA 3K7UA 5DJAB 3FU6A 4YWGH 2IDCA 1OTTD 3HG1E 2OMNA 3Q6FA 1WA0X 5KSAB 1ZHNB 2HPTA 3U0PA 1DUZA 3MLXL 1MVUB 5TE7L 4F57L 4WI0B 1G1YA 1I7UA 4NZUH 4L8BA 1S3KL 3F8UB 1HK6A 5E1AA 1MFAH 2NX5D 1FZJA 5TF0A 4PGDB 4ZMZA 3E8UH 1FLRL 2DLHA 4UOW1 1PSKH 4AM0A 2PPDA 4KRLB 4WZ9A 3CBJB 5A6LA 1IC7H 5L2KD 3AG3B 5CILL 1CBVH 1A1OA 3PQYB 1VDGA 5AYUH 1WFNA 5I0XA 1LMKA 1PCXA 5I1AB 4Y16C 4ZSOE 2Z7WA 2C1OB 5AVRB 4HIXH 3MX0B 3FQXB 1I9RL 2KT6A 1EZLA 4LLVA 1J1OH 1EAPB 2D0GA 3BSHA 3ZK0A 2RJMA 1NGZB 2YJQA 4APQD 2YEVB 3OLIA 1HS6A 1HAWA 1JF5A 4XNXL 4G6AC 5L6YH 5BZWA 3QDGB 4IIZA 3VWJA 5EUOF 4WO4D 4NN5B 1MFVA 1Z1WA 4E5XA 1V10A 2HJFB 2VDRL 3H2WA 3IDYC 3GMMB 4ZJ9A 3PPEA 3P1VA 1JXGA 3O6LH 2B9AA 4GO9A 4Z3FA 4BFJA 4KMLB 1QRNB 2HVBA 1DBBH 1M6OA 5KYXA 4RFOL 1NAKL 4NZRL 5HDBE 4QRPB 1T3FA 1CDGA 1JI2A 1A4KA 3VRIB 2YMOA 1DSFH 3VH8B 4B3VA 4H5SB 3AROA 3W11D 3MRNA 3QUYA 3R7QA 4JUTA 2B1AH 3FFCD 3IAPA 5JUEL 3WN5B 1DUYA 3TPUB 5D1ZD 1SLXA 3CSFA 1Z5HA 3RG1C 3L4TA 4IIQC 1ORSA 2NY7L 2D7NA 1JK8A 1K5NB 5IROA 1GAFH 5T3ZD 1R5VA 4IKLA 4MCYB 2QDVA 2HH0H 4MS6A 1S7WB 1XF5B 4GKSA 3V5HB 4PJHA 2KKQA 4U6HA 1JDDA 4N22A 2EDTA 2OMWB 3TBBA 4QD2E 1C8QA 2Y5QA 1JZDC 1V05A 2OW6A 4WW1B 1OOAA 2WCSA 4LQFH 3U7YL 2OBGA 2WHVA 4LSVL 4CDHA 4F7MB 4Y5VC 4ERSH 3HAEB 4P9HH 4W9IC 1JL8A 2P7TB 3L3HA 1TZHB 2K78A 3P0VH 2P8MA 3VFGL 1AP2A 5E9AA 5LVEA 2DJUA 3SB3A 4AQ1B 2IFGA 4LSSH 2EUZA 3T3PE 2R69L 3QJZA 2M2DA 2W07A 3QJTB 4L4VB 3EO9H 1D5XA 4ZUVA 5T1MA 3DURB 1TEFA 3IDXL 2JMRA 1D9KA 5EZJB 3MLVL 4X7TB 3K1DA 5KVGH 3AG4B 4DFIA 1YAZA 5E08H 5EOQH 3QS3A 2HKAA 2EDLA 2W65A 4FNTA 4WFHD 4RRPG 4MQSB 5ALBL 3TBVB 3FT3A 1LO0H 3FQTB 3ARUA 2JKLA 1S9KC 1OHZA 4Z5RB 2CLRB 3NH7L 5E1HB 5I5MA 3I6GB 3P9WB 1EHXA 4UDUA 2Z9TA 3DYMA 4DK5A 1T2QH 1YY8B 3WNLA 4L0YA 3LKOA 1F97A 1BMGA 1ZA6A 1KYFA 1MG3C 1RAMA 2ZSWB 5DTFB 4I3SH 2OI9B 3TO4A 2JKIS 5TQ2L 1CFNA 1DJIA 3ZDYF 5I1CH 4E41E 4YBLB 3LEVH 4U0QB 3HJ0A 3A6BL 1LK3H 5F9DC 1ROWA 5A16A 1AGEB 1SOQA 1WBZB 2AXFA 2VOTA 5T5FA 5BV7B 4HQQH 4RGOL 3GZKA 2GSGA 3HI1A 3L9EA 1IC1A 3HI6L 1F18A 2GAZB 4OIIH 4NNYB 4PRHB 3JV4A 4C56E 1ERNA 1SRDA 2AV1A 1IAKA 3DMMB 4PP1D 5DZLA 1LO3L 4DGIH 4ZUSA 4W68A 4TVUA 4Z77A 3ZTCC 2AJYH 4RSYA 2RR3A 4MVBC 1QACA 3GO1L 2DD8H 2A99A 1TVBA 5EU6D 5G5DA 1XF2A 1TSRA 3X1NA 3CSPA 1QNZH 2DLGA 1CXHA 3QH3B 5ILTL 4LCVA 3TC9A 3VD7A 4NQUA 3FQNB 3EBIA 1QI3A 4M61A 4ZUWB 3UCQA 3ZE0F 1T83C 3FQRB 1BIIA 3PWVB 2G3MA 3U9PL 3ILDA 4PJGE 4F58L 2J1WA 2F5AL 2XA3A 4RETB 3W81A 4Z8FH 2VAJA 3BH4A 3WNMA 1K4CA 4OGYH 2BOCA 3MV8A 2Z93A 4Q52A 5C0IB 5BRPA 5BJTB 2G4EA 2LABA 4P07A 3S7GA 5KS9A 4G8EB 4UTBL 4O02A 1RIUH 1LQBC 2YAPA 3Q3GA 5CINL 3PWUB 1UZ6F 4J3OD 1PY9A 4UOJA 3STLA 1V3LA 1DLHA 4YDVB 4OH2A 5HVFB 3NRFA 1S7XB 3C6EA 2AI0H 1KMGA 3WY1A 3ZDWA 3ZL4L 2YXWA 4GXUN 3BGFC 2AFNA 4XXWA 3UZQB 1SEQL 1P4IL 3EJSA 2YUVA 2IPKA 4WWKB 5JHDD 5DD6B 4AIZB 3ZHKA 3LSOA 1TLMA 2H41A 1JPSL 5C09D 1NFIA 5K9KB 3S0PA 2EDKA 2Y2YA 4H4NA 1HCYA 3KCPA 2DYPD 4HP5A 3FB5B 3TL5A 3VWKA 1C5DA 1L4IA 3DX8B 1BZ7A 2FIKA 4X6CB 5JA9A 3DX2A 5CEZD 2BNQA 4TV3A 4UMGA 4AT6B 5KJRH 4MASA 3VD2A 1ZTXH 4FYRA 3CXDL 3FK3A 3VM5A 4ICXA 4KTEL 1I1AB 1ZHBB 2A9BA 3AY4A 4F93B 4X6DB 3C5ZD 1KC5H 4OCLC 3LNHA 4HW6A 4R8WL 4OGQC 1N67A 2NRDA 4NQVA 1QEWA 2PYFB 3FU5A 4XN1A 4OZHA 2NY4C 4X80L 5KAQF 5IW1B 4Z7VA 1CU4L 1JZIA 1SXNA 4YX2L 3CN4A 4JEGB 3RWHA 2VXVL 4C59B 1KCVL 2A1WH 3I9PA 5CD3B 1AHKA 3SDCC 2VLKB 4Y9FA 1MJUH 3IJYB 5BRQA 5GZNC 2IQ9L 3QNYA 5C0AD 1MNUH 2Q86B 4TNVK 5KVDH 1BWMA 5IV2B 1HNFA 4LKCB 3C12A 2ZKYA 5I9QB 3WELA 1NCIA 5D1XB 1Z9LA 4GRWH 3IFNH 3TNMA 3V0JA 4WI0A 3TV3L 1J8KA 1WD9A 3GTNA 1P1ZB 4YDIH 4KK9D 1ES0B 4WQOA 3SE9L 3KM1A 4DP8X 1EJOH 4M7KH 2OTUB 3MLYH 3B34A 3QJRB 4P9MH 4OVVA 4CMHB 5IMLB 3T2QA 1T04B 3JWNC 3H9SD 3W39B 1XGUB 3EO1A 2VCOA 2HAZA 3HC0B 4H13C 3VXMA 1OF0A 3PQYA 1T2JA 1O9ZA 1HQ4A 3OAYK 4O9HH 4X99B 4RAUB 1QW8A 1CD8A 2C1OA 3AMKA 4XVJL 1A47A 3MX0A 1JRHL 1CR9L 4B50A 5HHMD 3BO8B 5AKTA 2W88A 1EAPA 1R3KB 1SJVA 4DIXA 1IAIM 1HHHB 4XNUH 1OSEA 5A1AA 5CF3A 4YN3A 4BGDA 4LGSB 2EUWA 3HG1A 1QP1A 4I0PC 5ACLA 1T7VA 1BZQK 3KH3A 4ZOCA 4FFYH 3CTTA 5I18H 2HJFA 5F7YC 1CJYA 4BFEA 3GMMA 4IRSB 3N40P 2ICWJ 3ULVH 2DRUA 1M42A 3S35X 4PFEA 4WY7H 4N1HB 2X0WA 4JFEB 1QI4A 3BMWA 4QRPA 5EBGA 4PRDB 5J12C 4JKKA 3UPRA 4JPQA 5TD4A 3WFHA 3MLZH 1JUFA 4H5SA 1AQKH 1SBSL 2A3TA 2E6QA 3LZFL 1HWWA 3NCXA 4ZSOA 5ETUB 3TPUA 4WWID 3CZJA 1LEGA 1LLAA 1T20B 3AS2A 4HIJA 1DQMH 1KJ3H 2EQDA 4IBYA 1FGNL 2PF6A 3IF1A 1WC7A 1FHNA 1E4KC 1A6WH 3ULAB 1N6QH 4G1MB 1E8YA 2EYTB 1LJMA 2F18A 5MENE 5EF1A 3JYCA 4MCYA 4XCYA 5GGRB 3FSAA 4E42B 2W94A 3PL6B 4UMSA 5K9JH 1S7WA 1HTYA 3NDYE 1XF5A 1OCWL 3RZCA 4LVOB 4PGCB 5F2FA 2IJ0C 3C8DA 3HFML 3KWXA 2NCEA 3DOIA 1NLDH 2J5LB 3O6KL 3QA3B 4H8WC 4Y19B 3DOSB 3DECA 4FP8L 1CZ8H 3DUHA 4M5SA 3HAEA 5JNYB 5ITBL 4QHKI 3PREA 1HZHL 4Q4IA 5DRZB 2W95A 5DVLA 5EHFA 1S7QB 4S1SH 3MSPA 4KBPA 1QBLH 4O4YL 1DJXA 1NCWL 3O8XD 5EEYA 5IQLA 15C8L 4MAYC 4KTDL 4L4VA 1RUKL 4PN6A 3OKNA 4QKTA 2Y1ZA 2EINB 4ZNEE 5CJXA 1JV2B 3FOMB 4IBTA 4JFPA 5IESL 4XHQA 3G5YB 3MC0A 3QXAB 4X7TA 4GG6E 2APXA 3WE1A 3KLKA 4KXDA 2JV6A 1EO8H 2VDQH 5LGJA 2E9GA 2K7PA 1Z3RA 3OB0K 1V27A 4LSPH 3WFDH 2QVTA 3Q9PA 5EULV 3FQTA 2VQUA 2XWXA 3QZWG 4LCWB 4Z5RA 4C57C 3THMH 3OR7A 3IYLW 3SKJL 5IKCB 4UM8B 3QUXD 4YVUA 1N5AB 1VCBC 1BYPA 1PFCA 4M1CC 1IM3D 4TM9A 3BPNC 5H37H 3MNVA 3DBXB 1WV7T 4PS7A 4IMKC 1X9QA 4CKQA 2ZSWA 4X83A 4N28A 2EVFA 1S78D 3FSWA 5IBTL 2WVVB 3GMQB 1PVHA 1UEYA 2XZAH 2E7HA 1IFRA 4LDEB 3I85A 2AXHA 1OHQA 1KDIA 2VSCA 4PCKA 2OSYA 4KROD 1AGEA 3GLEA 2V4LA 4L05A 2J8UB 1Q94A 3CD4A 4X6FA 1EVTC 5FLUA 1MZYA 1SFHA 2F54B 1JVLA 3JXAA 3C6LD 4XPTH 1I3GL 4IIQB 4LF3B 4YPGB 4YSRA 5FGBA 4PRHA 4P3CH 5IGXL 3DMMA 5DCCA 4GXUM 3QCUL 1QKZH 4NWTH 5E0FA 4FQ2L 5I1EL 1FFOB 1U3HC 2PP7A 1JGUH 1NCDL 3GXNA 5EDXA 5JIKA 2BHFA 2I24N 3ARPA 4G5AA 4HU8A 4JFFA 1YEGL 3QH3A 2ZG2A 3ARVA 3GMLA 4HMCA 3OHXC 3TONA 4E41A 1V7NL 3MV9B 2QMJA 1DDTA 4M6NH 2WBJC 4GXFA 1CF1A 5E03A 5EPMB 3OJ2C 1H5BC 3QE5A 1IEHA 2JIXB 2CWRA 1A6UL 3MLUL 4PCYA 3VM7A 1J0ZA 1JHLL 4UIMB 3EUUA 1L3NA 1F3DJ 1O7DE 5M95B 3BVTA 1T0OA 4DN3H 3B4NA 1QHQA 1MJ7H 4R83A 1KJVA 2C9UA 4Y4KB 1HNYA 1X4XA 2OX5A 3TP4A 2J72A 3PWUA 4MA3B 1EMTL 3D51A 3DUSB 4K55A 4Z7QB 4AYDC 1B4JH 1LM8V 2AQ2A 5FM5M 3O2DL 1JGIA 1AVAA 1NM4A 4N26A 5IR1B 5D7JD 2VR3A 4YDVA 1DVSA 2IXQB 1CGUA 1S7XA 5EUOE 3ZY7A 1UUNA 4WFED 3N2JA 4XI5C 3RFZC 5H2BB 1GPOH 1P7QB 3NBNA 4EI5C 3MRCB 3U2SB 1NGPH 3OAYH 2O5YL 3Q5YA 2X70B 3FN9A 1OT1A 2NNRA 1NSNH 2IV9A 4OV5B 4AIZA 4F7KA 4QRUB 4MZ2A 2NY3B 2BSSB 5HHVH 5HY9A 3P11L 5E1GA 2FZ3B 3BDXA 5EZOH 4KI5C 2VDKH 1MFNA 5JYLA 2VUKA 1SUHA 3Q2CA 2PPCA 5GZOD 1W72H 3F7VA 2OMTA 3KLDA 4PJBE 3JWDC 2N1KA 1XZWA 4NZTH 2DDQL 1J8RA 2BIHA 2PXYB 4AT6A 1OWWA 3NAAH 3STBA 2X4UB 3HC2A 1UZGA 1A6ZB 1XFPA 4BWWA 1U8HA 2RH0A 5DQ9B 4X6DA 2WLMA 2XN0A 4MBRA 4MAUH 5DJXB 2VO5A 4TL5A 4ELDA 2E27L 3BAJA 5IW1A 2XTJD 4ZI8A 5HJ3B 2BP5M 3H6AA 4IRJD 4JFXB 4PJ9B 5TE4H 2UV3A 4XB3A 1TQBB 1P69B 2EACA 2BVUA 4ZW5A 3IJYA 1XSIA 4Y89A 1C7TA 1CG9A 1AANA 3IDMB 2ARJQ 4LKCA 1OZTG 5DUPH 2QPEB 3M07A 4RSVA 2FX7H 2JQMA 5GRXG 5BO1L 5EG6C 2EDNA 4ECNA 1O7SA 4LRIA 3NZ8A 4M5YL 3D50A 4XGZA 4YDNA 5D1XA 4X8JB 1Z32X 3WUZA 1U6AL 1TF4A 5DLMH 3L3IA 3OZ9L 4ODWB 4AYEC 3HN3A 2OTUA 2BCKA 3LH2H 3UAJD 5IB4B 5IMLA 2Y2TA 3ENEA 4F9LA 1XGUA 3QUZB 4XBGA 4ZW8A 2J21A 2YPVH 2Q87A 2IANB 1ZLDA 3S37L 3BD4A 4M8UA 3ROOB 2Z92B 4P4KA 1IQDB 4Z7OF 4NNXB 3UTZB 4JHAH 4BCXA 3BO8A 3BCDA 5D93B 1TCRB 1PX8A 2QQKH 4FJZA 1HHHA 5GGVY 2J5WA 1S5IL 4XN8A 2UVEA 5T33H 4ZOEA 2ZKMX 8FABB 4OCYH 3OB0H 2A9ML 4XNZC 2VJ8A 5D7IB 1MIML 2XN9B 3VXQB 2R0ZH 3A5VA 3EJQA 4HMEA 4APXB 1RZFH 4N90D 4XCFL 2WANA 5E9DE 5G4NA 3VXSB 3NTCH 1P4UA 4NRZB 1JWSB 4YC2B 2L4OA 2I60H 4BIKA 3PWNA 2RTTA 2JJSC 2N7AA 3CZFA 3IETA 3RGVC 1MCDA 3UTTD 5TFSL 2Y72A 3DNKA 2OK0L 1ZK5A 3IJSB 5I8CB 2JQAA 2XA8L 3BT2H 1A7RL 1Z66A 2AEPH 2BP0B 4K94C 4QHMB 1T20A 4YHOL 2G9KA 5DD5L 4WJ5B 3QIUB 3HR6A 3ABZA 1T0NB 4M8VA 1AKJD 5DA0B 4LOUD 5D96B 1HH6B 2AZUA 2WTRB 4U49A 3DLQR 3LYRA 3PIQB 3S4SB 2H3XC 3PHQB 1AOHA 1UM5L 4XPAL 5EV7A 2B16A 4ODUB 2AJ3B 2APSA 3IDNB 2ZAHA 5KOVC 4M7ZB 4E42A 4E36A 2JLLA 3SDCB 1T89A 2NX5E 2PCPB 3TH4T 3MV11 3ZE0E 4I3RH 5KYYB 3BUBA 4ZG1A 5L2KE 4TN9A 1NMBH 1BVNP 1NCBH 1OSYA 3F6JA 3CAFA 1A3LL 1VZIA 3ZR5A 5JPNB 1EGJL 2YGNA 5HDOA 3RJDA 4G6KL 1EX0A 1EZSA 4HD9A 2I9TA 3MLXH 5TE7H 2E9IA 3NCYP 1OM3L 1TNNA 1G94A 1S3KH 1UZ6E 2DM3A 1HL9A 3HUJE 3KWTA 4X4ZA 1OW0A 3GZQA 3FCTB 3VD9A 1FLRH 4YO0B 3B43A 4KNUA 2CO6B 4KRNA 2WUCH 3G5YA 2G30A 5LDUA 3MNZB 2J3SA 4P46B 4GW1B 4LLUB 5HXMA 1G7JB 2CO7A 5FO9B 4FFVD 5DZAA 4P4RA 4PU2A 3CHRA 4P2OA 4I87A 1VB9A 4BZ1A 4LIQL 1MFMA 4I0CC 5AFAA 1CICD 3WLWC 1GA2A 4OQTH 3RNQB 3FFCE 4ZS7L 1AGFB 1NCNA 1JXKA 3LB6C 2DJSA 3P3RA 2GC7C 4LCCB 4R4FL 4XP5H 1SXBA 2OZ4A 1LWJA 3PUUA 5DUML 5DMGD 1NCOA 1IGTB 3QO1A 1AXSA 1XL4A 3UFIA 2QLVB 3HVNA 1EEZA 5T3ZE 1N3NA 4RFOH 2VDOL 1H15B 1UD2A 4XO8A 1OTSC 4U1MA 3IS1X 4MB1A 1L9OA 4GBXC 3VACA 1MHHB 1EWHA 3BYTA 3KR3L 3FFDB 5CBAA 1USZA 3PV6B 2DYSB 3QAZC 5JUEH 1RLBA 7FABL 4JN2A 4QHUB 2G3ZA 3DSFH 1I9JL 4X9GA 2HFFA 2APBA 4TSAL 2NR6A 3V8OA 5C71A 1UB6B 1KLUA 3CFJA 5IP4A 3HCVB 2NY7H 4A37A 2XBZA 3CVCA 5FYKD 1PS3A 3ARGD 1H3PL 4TVPL 5IHHA 2OULB 3MNMA 1S46A 3QCVL 2YXMA 2ROYA 2F58L 3FUMA 4O2FB 1MHPH 4TTGA 3GMNA 2C3WA 2MCG1 1TPXC 2Y7SA 1RIHL 4R2GB 1IM9A 4NQCD 4OM0L 5GGTA 3WEAA 3ARDC 4ZMOA 3BPLC 1UT2A 3U7YH 4QRRD 4I9WD 3WTWA 5CKGA 4OGAC 4WFHE 5CLWA 4NC1C 4MAYB 3VFGH 4M4RB 2XOTA 4FADA 3EAKA 2QHLA 1KGCE 1IAIL 5KSBF 2MQ3A 1RULL 2R1WB 3BPCB 1JPFB 4J39A 3BAWA 4I3GA 5EN2B 3IDXH 1DN2A 3AXLB 3MLVH 3ZYIA 5J11C 3DUSA 2Q8AL 1DJGA 1E5CA 3AADB 2PWHA 3FO0L 4XMPH 1HWHB 1C12B 3UMTA 4ZPVB 4ETYA 5ALBH 2IXQA 2XACC 2ENQA 1JZ5A 4QRSB 4ZUUB 1P7QA 3NH7H 5CD5D 4H2AA 3MRCA 4GXVL 3ESNA 5D2NE 2VR8A 3V6OE 3IBOA 5HTSA 3RGBA 5HYSA 4HWBH 2Y07L 5HD8D 3UG4A 4NBYB 5IW6B 2AW2A 4OV5A 3H85A 3IK2A 1MWAL 3JUZA 1J5DA 5G55A 1UM6H 4X9FA 2YAHA 5D1QD 1B0GA 3L9YA 4JCLA 3SDXF 4A1RA 1D7FA 4NXSA 3UADA 4YXLL 4KJWC 4NOBA 1BAWA 2WLLB 4X9IA 3VB9A 4S0HA 1FZKA 1NIDA 3EFFB 5EU7C 2F1AA 2XN2A 4CVZB 1GC1L 2DQDL 5EU6E 4G9DB 3SDYL 5DSCA 4UT9A 4RGOH 1RZKL 1A6ZA 1UJ3C 4PRAA 1S3RA 2QV2A 3W9DA 2V2TA 2VDLB 5EUOA 4CL7A 4O58L 5I16A 1KCUL 2EUVA 5EF3A 4IGBC 3N1GC 1CLZL 4UUJB 4LP8A 5DJXA 4IBVA 1JMZA 3SCMC 1S7TA 4N0YL 1A8ZA 1U3HB 2DY2A 1LO3H 4JFXA 2XIDA 3LKQB 3MRPB 3WFBH 3GO1H 3I02A 3EYUH 2F53B 3F7PC 1PX4A 3OHXB 3TZVB 1BFOB 3V9CA 2BFVL 5KOMC 5H94B 4EIGB 3ES6B 1H5BB 3GDCA 4UT6A 3T0VA 3EDJA 1F4YL 1HX0A 1V3JA 4K07A 4A7QA 4PJBA 4UF7C 1JRHI 2EDXA 3CFIC 1A8JH 4HFWA 3U9PH 5BQDA 3UYPB 3FPYA 4X8JA 3SHSA 2ARWA 2PTTA 4R4NC 3BD5A 5D6DA 2UZXA 2BIOA 4ODWA 3Q8CA 3NP4A 1GCFA 5JHDE 4NQTA 1S7UB 2W0KA 3AU1A 3JVFC 3LRMA 4KWUA 1MELA 2E9BA 5CINH 5ECGA 4NAMA 2OMXA 4WUUB 4JG1L 1VCAA 2WGNB 4FXGB 1MF2L 5C09E 3BDYH 3V6FA 2PTVA 1JYNA 1KCSH 2VL4A 1IARB 4HK0A 1TCRA 5E7BA 3TBCA 4WVRA 4EI5B 1UWYA 5I6PA 1JWUA 4KKCC 1MQ8A 4JGJA 3ZDZB 4IKNA 5EN3A 4GLRI 1NCAL 4JPIB 4JFVA 4Y16D 5CEZE 3ATEA 3WNIA 1SEQH 3FT2B 5DFWH 1RJCA 4KU1A 5GS0H 4FYSA 3SY0B 5AAMA 1OAQL 4ZS6C 2Q7YB 3OVUB 2VC2L 4PVLA 3D25B 3WFEH 3NG5A 3QFDB 5F88B 3O9WD 5C3LD 2WY3B 4G6AD 4P06A 1O9VA 3UZEA 4NRZA 1JWSA 1KJ2B 5FCSH 4Z78A 2BO0A 2UYLA 1JG9A 3IRZA 1HINL 1WT5A 3M46A 4X6CF 5F96L 5INDB 2FWSA 5JW4Q 2R51A 4MWFA 1UM4L 4OM1H 1WITA 4JRYD 3BVNB 3CXDH 3T0BA 5EEWA 4QHMA 2WXLA 4MBOA 5C0AE 3QIUA 2FNWA 1T0NA 1C9SA 3KXFB 3PIQA 3QC5X 4R8WH 3S4SA 2H4EA 4ZYKB 1VFMA 3PHQA 2WXNA 4P5TA 4F7PA 4J3XA 4YSEA 1ZOXA 4E9WA 2R0KL 4ODUA 1WIPA 1XSOA 2AJ3A 2I25N 3IDNA 4X80H 1SVCP 1CU4H 4YX2H 4ZXBB 3NCFB 5L4MA 2UWEF 2F8OA 1DBKH 5KYYA 4MXVE 3H9SE 2DMCA 5E9DA 3ZX1A 2DQCL 2IQ9H 3OTTA 3QZOA 5AVVB 5C8JA 2OXGB 2P43B 3TFBA 4ANVA 1OGSA 3V0AC 1F4WL 3C5XA 2FYYB 2W0LA 4HWZA 5HHME 1RKRA 4HZ1A 3WMQA 3V0FA 3H7LA 3PRZA 1I7TB 2YD6A 2JLPA 3TV3H 3SE9H 1WZ1H 2VABA 3TJEL 3U4BL 3VQ1C 1JNJA 3FCTA 4YDJA 5J13C 5D7SL 5I1KL 4MGXA 3QQDA 4PWGA 1H3UA 2QVFB 3MYJB 5AW1B 1OIOA 3NJHA 1KTCA 4P46A 5FV1L 4GO6B 1OAUH 1KEMH 3VE0B 5EB9A 4OD2B 4R97B 2AK4B 4LASL 5FO9A 2VZSA 1U8MA 1CR9H 2NX5A 4UYQA 4TQEH 4WI9A 3ZSSA 1KYOK 1EBAA 4LLDA 4BK5C 4K3HA 4AYSA 2EC9T 4MQ7A 3UOAB 1O6SA 2BOBB 4S1QL 3NCCB 3WJJA 1K9TA 5F8QC 4DP7X 3ATBA 1NFKA 2K4AA 1JV5B 5CS7A 2DI8A 1PBYA 3HNTL 2QFPA 1IGTA 2VXTL 5IVZB 4DVRL 5CGMA 4HT1H 4XO5A 3HUJA 4KITB 4ELMA 3ET9F 1SDAB 1UACH 3WN6A 4WO4A 1AXIB 2MQGA 3L1GA 3N42B 1H3XA 5DJ6B 1W9XA 5DU7A 1AO7B 1SBSH 2IOMA 4EDXB 5LGHH 3FO9A 1T1XA 4PJ6A 1J1XH 3OAZK 4QHUA 4JANA 5HYQA 5SWQA 5FFOA 1S9WA 1N5YL 1NWPA 1MFUA 4LARH 4X6EB 4HOWA 1UB6A 1FGNH 5KEZA 2H3KA 2WO3B 1MJJB 4LSUL 1SLVA 3HCVA 4IRZH 1FG2A 5EU4A 3OXRB 4FA7B 3UC0H 1SF5A 5GRJL 1IO4C 3D7PA 4A2EA 3UJTH 3FFCA 1S9VA 2YSSA 5C0BD 3IXTB 1AHWC 5D1ZA 1M05A 2IDQA 1NUGA 3J8F7 4N8UA 5HYJB 5T5FL 3HFMH 4UU9B 4WENB 5IUCA 3O6KH 1SHWA 4XOEA 1BBJA 4X8CA 2IEPA 4FP8H 1KB5B 4XODA 1NQBA 5ITBH 1HZHH 1YEWA 1HSBB 4I5BB 5FA4B 3OGOE 5BZXA 1Q1PA 4MZ3A 4FQHB 2ZKHH 4O4YH 4XNAA 2B15A 15C8H 1KPVA 1J88A 1RZJL 2WKLA 4TL4A 4KTDH 3V4PA 2HRPL 1R46A 1DVTA 1RUKH 2R1WA 4ZQKA 4ODXA 2A73A 4YMPA 4LL1A 4Z7OE 1UKQA 5EN2A 3QXDB 3E6HB 1YEIH 2FUQA 3AXLA 3H6JA 4TTDC 5IG7B 5IESH 3O3EA 1KELH 5GS2H 3EZ8A 5KSVB 4GB9A 5CN1A 5JXAL 2H7WA 3IGUA 4HJJL 4WWNA 1WICA 4DP6X 1MFEL 3RVXC 1U8KB 2AJUL 2ZP8A 2CPCA 4JW3A 3S96A 4XWGL 4NWUL 2OCCB 3SKJH 4XMUA 3UGUA 4EUPA 5A7EA 4OR1A 5HYEA 4S2SB 3RVWC 3R18A 4X5LA 1AGDA 1N26A 2QKIB 2BNUA 3T0EC 4O02L 4AC2A 1DQJA 1MW0A 2C3VA 2GW5A 5IBTH 4B96A 1FL5A 5E94B 4FYQA 3E38A 3TEZA 2IV8A 2WLLA 3QQ9C 4GBXB 5B21A 3JTSB 4HBCL 4WKXA 4CJ1A 5ALCL 4PIRF 4YGAB 1AZCA 1QA9B 3WS3B 5AW5B 4BHUA 5ESAB 3QNZA 2P47B 2V8MA 5FYJD 3WKML 4NUJB 2DMGA 5L2JB 4IKKA 1ZHLA 2BSTB 3D8MA 3OAUH 1CLCA 4DH2A 1A4JB 4JPVH 3MRGA 4UQ9A 1EZVX 2P5PA 4TOYH 1FDLH 2BP8B 2EILB 4QHNB 4UUJA 2QTEA 3K0WA 3AG1B 2QGCA 1Z5LA 1PZUB 3V6OA 2CLZA 4MJHA 4TYUA 3QCUH 2EEXA 5I8EA 3K6OA 1QFHA 4QCIB 4FQ2H 4XPFH 2E59A 5LCVL 3MRPA 5D4IA 1TPXB 3RAJL 3IFOA 2F53A 2NY4D 4PJCB 3EHBB 3TZVA 4DW2L 1JBJA 4R5XA 3MGTB 4NKOA 3DK2A 2EIZB 4XP6L 1V7NH 4K7FB 4KK6D 4RESB 5CR8A 3OD3A 1HEJC 4LQ1A 4K5PA 2C3GA 2EKSB 3KYKL 3SPVB 5G2NA 1BW8A 2XRAL 5B1AB 5GZND 3UYPA 1A6UH 2BZ7A 3LKRB 4WFEE 1JHLH 3W5NA 3ZN6A 4BQBA 4WK4B 2FJGB 4OF7A 2D31B 3VI4F 5CU5A 5FXCH 2NY1C 5J11B 3MLSL 1M7XA 1E0OB 3FONB 3MI6A 1MUJA 4WUUA 1YPZF 4Z7QF 2X4RA 4HIPA 4FXGA 3RU8L 1RPKA 4FMVA 3RPIA 3RUGB 3GSXB 1SJEB 5KJ4A 3E2HB 3GMPB 1FNEA 1HHKB 4G8GD 2V3FA 4JL1A 3BFWA 2ZYSA 1QLEB 2QT6A 3CLEL 2QGBA 2VN5A 4NKDB 3SY0A 1TJIL 5JIMA 4C83B 3TEYA 5GISL 3L2NA 2XPGB 5CZKA 2GY7B 3QFDA 1NJ9B 1GY1A 1R5IB 3G5VA 2O6CA 2GITB 2DW5A 4HKJB 4I0PD 3HRPA 4DTGL 1KJ2A 3PF2A 4BKTC 4DJMA 2XTJE 3IMSA 1Z9PA 4D0CA 5JHDA 2EDBA 1I7ZB 4AL8H 1KXVA 3B9DA 3WTSA 1TCMA 4G6FD 1RSYA 1UJ3B 4QI3A 3EJRA 1R3HB 1AZUA 1NFDE 5C09A 3BVNA 3U46B 2EH7H 2Q8BH 3QJVB 5I1GH 2NUTB 3MRMB 2DYPA 4FZ8L 2GJPA 3BMVA 2FLBT 1SVBA 1FVDB 4ZYKA 3ZHLA 3QHTC 3DX9A 2FJSA 3OAZH 4YDZA 1W0WB 2XSKA 4N0CC 4WHYH 3FSZA 1QAWA 2WNGA 1BYNA 5ID1A 4QRFA 3K2UL 4QGTA 4FC3E 3DX7A 4LNRA 2ZG3A 3BGMB 3AFLA 3C5ZA 3FQYA 4LAJH 5D5MB 4ZNCD 1NCGA 4RMWA 4Z9KB 2ZWLT 1EA9C 4YSOA 4QXTA 2OXGA 2F7QA 3TBWA 2OTWA 5DR5H 1UXLA 2TSAA 4J2QA 4GQZA 4N2GA 5BO1H 5KSBE 1JVKA 2FYYA 5GSRB 1Q9OB 1I7TA 2VJXA 3B9KB 3L3GA 1DP0A 4P5MB 5C08B 5C0AA 5DYOB 1FIGL 1IKNC 3RRQA 4MA8L 4X9YA 4LCYB 2XUWA 3LN5B 3ASOB 2R2HB 4PS4L 4J3TA 3MYJA 3P4MB 3HE7C 3S37H 2K3TA 4HUVB 4K5NA 5F3HB 2NY0B 2AK4A 1T1ZB 2DBJA 4MB3A 3D1MC 2R56L 4ETQB 3ECQA 3NCMA 4Z3GA 1O7VA 1KULA 1SY6A 3ULUD 1RY7B 1BQUA 5B39A 4XN5A 2CE6A 2XIIA 4JO2H 3MJ8B 1U30A 4OZFA 1E9OB 5KVEE 3KMDA 2BOBA 3UTTE 1S5IH 2JCCB 4QRAA 1UKTA 2X88A 3K6IA 3O6FC 3SDXE 2EUXA 3QIWB 1MIMH 2H6PA 2E8ZA 1LP9B 2IH3B 2CR3A 4ALAC 4K73A 4Z7WE 1JGEB 4XCFH 2WLIB 3CHSA 5ICUA 2XQYA 4JG5A 1HI6B 1ODUA 2ZCZA 5F0JB 3NIDB 4D9QD 4DN4L 4G42B 4FLHA 3ZGHA 5DJ6A 5TFSH 2VWEC 5EZLB 5KYWA 2OK0H 1FG9C 3GJFA 3HRZC 3VGAB 1WVZA 4GKNB 4JO5A 2XA8H 4AXWB 4F15B 3BPOC 1A7RH 3QSKB 5DD5H 1CFQA 5LKNA 2BVPB 1KGIA 2F1EA 1MJJA 2CPUA 2CZNA 3BZEA 4ZO9A 1J8HD 3OXRA 3PJSB 4MDIB 3M86A 5EH1A 3EJYD 2XZQL 4XPAH 5SWZB 3VG9B 3W37A 4HLJA 1KLFB 4MJ2A 1JNHB 1OD9A 2O6FA 3A67H 3DDFA 3IXTA 5F1IA 3RQ3A 1IAII 5DS8A 2CQVA 3GNML 4MJID 2OP4H 3WIHL 4F8TA 1G9NL 3INOA 5BV7L 3R06B 4KQ0A 4POZC 4QOKB 3WGVB 1SYVA 3U0TB 2AXJA 4PVBA 5SX5H 1KB5A 3B9VA 4ONFL 1EGJH 1N7ML 4G6KH 2VLJD 5BOJA 1FNHA 3L4YA 5FA4A 4I5BA 2DWDB 4M7LL 3VGFA 1E8WA 4U3HA 1KTBA 4FQHA 4NCC2 2J6EA 4QRBA 3ALXA 3VA2C 1A4BA 2WBJD 3LRKA 3DRTB 5EDSA 2WUBH 4EZLA 3OB8A 2DM7A 3EYOB 4JRLA 3PPSA 3QXDA 5IG7A 1NPJA 3BSZA 1B3JA 3AS0A 4JNXA 3O8XA 3FQWA 3ML8A 4HIHA 2YPLD 5EUKB 1IC5H 2HMIC 1X5ZA 1I9IL 1N0LB 3MFGB 5DJ2B 1OCCB 3L9RA 1MIEL 4U1LB 1KLGB 5TDNA 1CFMA 2XETA 3UPAA 3UTQB 4BE5A 4LIQH 2ZUUA 1BLNB 5K59F 3VUAA 4HA1A 5ESQB 4PAZA 2O72A 1Q9LB 1FVEA 4KXAA 4DO4A 1JP5A 3TCLA 4OW6A 4XI5D 2C4XA 1INQB 4KRMB 3UBXB 2DQFB 1MEXH 5ISZD 5DUMH 3U1PA 4QEGA 2PNDA 1HEZB 1OP3K 2Y3NA 5E94A 4E5XG 1JTPA 1WJ3A 5FYKE 1IM3A 2AQ3A 2VDOH 2X1WL 4XMWA 4YFDB 1JPTL 4ZOAA 1QA9A 1YMHB 3EBGA 2VKWA 1F3JB 2E76C 5ESAA 3PXJA 2DWYA 3KR3H 5I8KL 3FUEA 5HYFA 1ACYH 3T1FA 3CMOL 4LP4A 4NUJA 1Q0YH 1U91B 3Q6GH 4Y88A 2BSTA 1BJ8A 4KH9A 4NQCE 4PRID 1JTTA 3H7BB 2MWCA 2ORBL 4H26B 4I1NB 4I48B 4TSAH 4I9WE 2A6JA 5LB1A 2BP8A 1R34A 1J5CA 1HEHC 4R5VA 2L7UA 3MRRA 2UWEE 3SKMA 1U8OB 1Q9WA 4XE5B 1PIGA 2AMGA 3K5RA 4KXZI 4KZ0A 4QCIA 3D3VD 2IDSA 2Y1YA 3U6RB 3C6LA 2COQA 3JUYA 4GSQA 4YAQB 3AWEA 5D71L 1QSEB 1GR7A 5FO2A 3TN0C 5LWYL 2IQAA 1CVRA 1RIHH 4OM0H 2Y5EA 2EIZA 2G75A 3FO2A 2EICA 3MLWL 4KVCH 1TFPA 4JO3L 4N2HA 5F7WC 5FKAB 5JIQA 2EKSA 1K3ZA 1F6LL 2OJ1A 3BUIA 3SPVA 1PIFA 5CEYB 1OL0A 1Q1JL 3GZOA 4LKXB 3LKRA 4AK1A 2V3EA 2D7PA 1TQUA 1JGVH 2X4NA 3VTAA 3Q5TA 2BHYA 1PNDA 3KM2A 3GSQB 2D31A 1IAIH 2P44B 4Y1AB 5SWSB 4AQ8C 1UT1A 1RULH 2NT1A 1JGDB 1WSST 4KOBA 1NBCA 2D0FA 3D33A 2G2NA 4KKAD 1PAZA 4YSPA 3DGCR 2Q8AH 4AJVA 3VFVB 1MRCL 1YVLA 1XGYH 4JHWL 3PWPD 4ODHH 5EF0A 2DV6A 3OMAB 3DXAB 1HJCA 1PQZA 4OAWB 3LS5L 1MI5B 3ARFC 3U2JA 3NFPB 4QRQB 2PUQT 3L3OB 1HHKA 3MKGA 3SKUD 1L6PA 3T0EB 1N2RA 2YEZB 2NUPA 3HC3H 3D4CA 2KH2B 3MRFA 3LZRA 1A6VL 4C83A 1A9BB 2VNCA 5D7JA 5E8OB 1GKOA 2XPGA 2DLIA 4YL9A 1SJMA 3MHZA 1J5HA 2OTPA 1NOAA 2FT7A 4WHTB 3DVGB 3CK0L 1R5IA 2ZWYA 4WW2C 2GITA 4BA8A 1W6WA 4ONHB 2CGZA 1BX2B 1D5ZB 2R0WL 2ZNXA 3KPRB 2Y1AA 4U7MA 4AIEA 4DPCX 4ZD3L 4PHZA 1W91A 4YXLH 1JZHA 3U7AA 1ASPA 1F4AA 3KPOB 4JHVA 4NBZB 1Z7JA 5IWLA 1GY2A 3ARWA 4OGXH 1FZMA 3T6ZA 4HJEA 1GC1H 1XIWD 2YUZA 3SDYH 3U46A 2EIMB 3CVIL 1VKXB 3MRMA 3TU6A 3RGVD 4OT1L 2VN3A 2DMBA 5GZOA 4WHYG 3QO0B 3HS0B 4W81A 1FVDA 1CLZH 2YRPA 3QJHB 5A3IC 3G6DL 1WBXA 3BKML 3LQZA 4ZDHB 3HPJB 3CUPB 1BOGA 3O3BA 4JHZA 2YO3A 1PYWB 4ODVL 1P0SE 4JZNA 5GS1C 4P59H 1BM3H 1QSFB 1ZT7B 3BGMA 1JCKA 1I8KB 2XY1A 2VRAA 4FQ1L 3BHBB 3QXTA 2GFBB 4KHTL 3KGSA 4OLEA 5FUCE 2F5BH 1F4YH 3D08A 3KWVA 5IEHB 3TURA 1YNKL 3SGEI 4ISVA 3NRPA 1H3WM 4IRJA 4FJYA 1I8LA 1Q9OA 4J6IA 5FGCB 3B9KA 3RWGA 5BVJA 1NFDA 4PJ8B 2L04A 5I19L 1WA2X 5F44A 1XGZA 2TSBA 5DYOA 2YRZA 3PY9A 4YHML 1OP9A 2HZHA 5FO8A 4BH7A 4JAMA 2R2HA 3FYEB 5I1LA 3BAEH 1WO2A 1EZUA 2ICEC 4HUVA 3DIDA 5F3HA 2X38A 2ZICA 4ETQA 1T1ZA 4XVOA 1CLYL 1EAQA 4YVNA 4E9SA 2CH8A 4C4KT 1RFDH 3P2DA 1NM9A 3U0WL 3AREC 3LKNB 4RZCB 2QDWA 1W80A 4X8GA 4JFDB 4W4NA 2DB8A 3QIWA 4JRYE 5F89B 4YR6A 4KI5F 4AM0Q 1FSKB 2E6PA 2PW2A 3VXRD 1Z9OA 3HS9A 4RGNC 5K9QI 7TAAA 1XH3B 2ZXCA 1FH5L 2VXQA 3LB6D 5FIEA 2NLJB 3HLAB 2RQEA 1NC4D 3POCA 3MRIB 4G42A 4U2ZA 3TVMB 4A2MA 1MCNA 3A4AA 4G11A 1HINH 3D2UB 3VFSA 3KCWA 4XH2B 4QMEA 1NEZG 1YEKH 5B1KA 4Y5YC 4BZ1L 2DJ4A 5EZLA 1BG1A 2MHAA 1OP3H 3O2WL 4GKNA 2Z0BA 3O9WB 5BW7A 4R0LA 3FYIB 2R1YA 3GHPA 1A1MA 5IJDC 1PMYA 3U9WA 1WWWX 5CEZH 4OSUL 4RWHA 3K8LA 3FRUB 4K5OA 2A77H 4NHCL 4AGPA 3PJSA 4MDIA 3UTTA 4UQDA 1LVEA 4BZ2H 1N6UA 2R0KH 4W9KC 3QJFB 5ANME 5DZVA 3SDXA 2BZDA 2GUYA 1WHOA 3MV9E 3BVWA 3EOBA 4Z7WA 4PYHA 4L8CA 2Z8WC 2J2ZA 1AKJA 1CGXA 3S37X 4K7PH 1UD8A 3C5JB 3AT0A 3SBWA 4B7LA 4PSRA 5CCGE 3U0TA 2Y7OA 5AOIA 5TPWH 1JNLH 5HSFA 2VT0A 4UM9B 1KTDA 1F4WH 3VI4E 4KC3B 2R8SH 2BSDA 1OO2A 4YE0A 3V2AR 3ARDD 4G9FD 4FKKA 4GUQA 1K6QL 5CU9A 3TJEH 1YPZE 1U3YA 3HNVL 4HUXB 2BIMA 3FUKA 3A24A 5IOPA 4XO9A 5GGTL 5J06A 3FUDA 1FAIH 4N2KA 1EAOA 1MCRA 4B9JA 1T0PB 3SGEH 4FS0A 5D4HA 4H8UA 5I66B 1UXWA 2MCMA 1KBWA 4ZZKA 3ZE1B 4P23B 5FYKU 2AQSA 2KHAA 1UWEH 4O51B 1EANA 2A4ZA 3O6FB 5EOTB 4LMQI 4RMSA 3N43B 1EHAA 2AK1L 1RUQH 2K4WA 3TH3T 1WZKA