3IFPA

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12b4) complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
216
Chain Sequence
VTLKESGPGILQPSQTLSLTCSFSGFSLSTNGMGVSWIRQPSGKGLEWLAHIYWDEDKRYNPSLKSRLTISKDTSNNQVFLKITNVDTADTATYYCARRRIIYDVEDYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 12B4 FAB antibody heavy chain
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 216
sequence length 222
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpA01
3WO4B 4KRPC 4LIQL 1LNUA 1OGAA 4ZO9A 1SQ2N 2HLFD 4G8EA 3ULVF 2UVFA 4DVRH 4KY1L 4X6EA 3W0WE 5TQ2H 3ZE2E 3T1WA 1NCWH 1D6VL 1QBMH 2GW5A 1UT9A 3T0EB 5KG9A 3T1FA 1T5WB 4AIZB 3A67H 3NBNA 1PZ5B 3KPLA 2IG2H 1FO0B 5D5MB 5GZND 1I3RB 4X5LA 5IB1A 3LEVL 4YAQB 1JNJA 4R26H 4R3SB 4UU9A 4NCDA 4KU1A 4OCWL 1CL7I 3SGEH 1FN4B 3TBSA 5F1OB 5J12C 1T7ZA 4XVSL 4YGAB 4KV5E 1AGCA 2XV6B 1TZIA 3FTGB 1O7VA 3NFNB 3H9SE 2IH3B 3O81A 4A6YH 4EZMA 5JIHA 1VGKA 5K9OB 4TNVF 5TF1H 5ID1B 3F12A 2ADGB 3LS5L 2R0WL 5D4QA 5CJOH 1N2RA 3ULVL 5JHLH 3RWGB 1QBLH 2B39A 4I48A 4S2SB 1DSFL 2HMIC 1PQZB 2VDRH 1KXTB 4W4OC 5D7IF 4YHYB 1N64L 2NY6C 3LMJH 4G8GB 1TJIL 4KPHL 5FEBA 5DD1H 2BSTB 2ITDA 3HI1B 1WICA 4YXKL 3NPZB 4DZ8B 3PWUA 3EFDH 4NKOB 1N8ZA 4GQ9H 1QBAA 5EU5B 3CUPB 3S9DB 3SDAD 1CZ8L 3HR6A 1IGCH 4U6VH 1MEXH 2RHEA 2YD2A 4OLXH 4UOW1 3AREA 5I1DB 1FNSH 1S9WB 2R4RH 3TT1L 3HR5B 4PJ7A 5BOPA 4LEOB 1G7MB 1JF1A 4UINL 2IGFL 5CP3H 2GUOB 4ZUTB 1AJ7L 4HBCH 4MD5B 3RUGE 2GTWA 3CCHB 3UJTH 3VFVA 4WO4B 4XWOD 3REWA 1L7IL 4M9OA 3RJDA 4M5YH 2C3WA 4IRZH 4ZXBD 4U6TA 5ELIA 3MCKB 5BZWB 2H26A 3S5LA 2FD6H 1NGZB 3IB4A 4PJBA 1ZXQA 1S78D 2BNRA 4JHAH 1CD1B 2HKFH 5J4MA 1T2QL 3L9RA 3S96A 3S97C 1XIWA 1FV1A 1A6UH 1T7XA 3X17A 2YZ1A 4GXVH 4JN1H 1XT5A 3MV7A 3GGWA 2AK1H 2R9HC 2RCSH 3QIUC 1PDKA 4F80A 4MA1B 4ZFFB 1TZGL 2EZ0C 4DN4H 2R69L 2YR3A 2DIJA 1HH9B 4JQXA 2UY6A 3BP5A 1F4WL 1OTSC 4C55A 4Y1AA 4MB5A 4LSPL 1ZSDA 5DQDL 5HYEA 1LGVA 4MDIB 4J4PC 1D5ZA 2Y9RT 5E4IA 1U8OA 4EJ1C 3MOAL 4XXDA 4IRJA 5IWLC 3JV4A 3TO4D 1OY3B 3LS4L 4I13B 5HHOD 1FYTA 4K94H 1S7RA 3IDUA 3ZYIA 5KSUB 3UYRH 5C0JB 4XPAH 1MCDA 5I16B 4X7TA 4O2CB 1I1AD 4N8CL 1KULA 1JMZA 4MA3A 3RWFB 4DKFH 4MCYB 4U33A 1RURL 3MNZA 1E27B 3K8KA 5J13C 4ODWA 3CVIL 4MB3A 3RY6A 1IE5A 1BFVL 4AENB 2GCYA 3QB7C 4JZNA 1B4JL 1CG9A 1AKJD 1FCCA 1S7TB 4PTTA 1MAJA 1Q0XL 4F7MB 1KTRL 2QKIB 1A7QH 4G6FD 3D69B 4WTXA 4OQTA 4Y4HB 3D1MC 2VDPH 2NXZC 3NABH 5F44A 4JFQB 1C12B 2HT3C 1KGCD 1UZ8B 3NIFF 5CINH 1BD2D 2JE8A 3UX9B 4NZUH 2XZQL 5DC0A 4L9LB 4NC1C 1XGRB 3KYOA 5ISZA 5MERB 3AY4C 1P7QA 3S3PA 2X4PB 3N1QC 4R2GB 3TBVA 3CFJB 4JHZA 4WGVB 2JIXA 1KCVL 2YPLB 4P48A 1JGUL 2NY0D 2Z31B 4MWFA 4M48L 1T3FA 3W39A 5KS9F 4APQA 5MEOB 1GZPA 2VXSL 4N0FB 1A2YA 3VXRE 4XBGB 3CFKB 4P57A 1X5AA 1TNNA 1EVUA 4P9HH 4QYOA 1ZGLP 1KLFA 4U1SA 3JV6B 1EFXA 4JPVL 2OTWB 3MXVH 3RI5K 5LGHH 4XPFL 1CXFA 3QCTL 3RNKB 5F7MC 4KK8D 1TQCB 1QRKA 1X7QA 2VISA 1BVZA 4XX1G 4PGJA 4PRAB 5E7FA 1OARH 3HUJA 1ITCA 1A7OH 2FX8H 3VXOA 2GIYA 3S36X 4HUUA 2EKSB 3RWIB 1HHKA 3P2TA 2XTJB 4JDVB 5C1MB 2OJZL 2XY1A 1UM6H 5DEZA 4KKAD 5C9KA 1CFQB 3U4AA 2R2CA 1GC1H 4KGJA 4Z7VA 4XP1L 4JO3L 1D6EA 1N5AA 1AGEA 1PX4A 2F58H 3OZ9H 3C5ZA 4XP5L 2WM0A 3VD7A 5LAXA 3PXJA 1FFPA 2DQTH 4M61A 2UZIL 4NC1E 5KAQG 1DLHA 2A83A 4R9HA 5HHVH 5I1EL 3P9MA 3MBED 4G6AC 3PG2A 5JXEC 1A4KB 2PYEB 3HZVB 5BO1H 1Q9WA 4QHNA 1U6AH 3DVGA 2J4WL 2AQ3A 2X4OB 1AHWC 4IDJH 3HCVA 2X09A 2Z92A 3PWJA 4RGND 1KIRA 1SHMA 4ZNEA 2OQJA 1DQJA 3PWLA 4XP6L 4MQTB 3IS0X 2YC1B 5BW7C 3TGXA 1A6ZA 1R24B 5HY9B 1J10A 5DVOA 1QSED 3PP3K 4XAKE 5D2NB 3DXAB 1GSMA 2MKWA 2WBJB 3BGAA 1KIPA 2UWEA 3WL9A 3QXAA 3VFRA 3MV8E 3O2VL 2OSLB 3G5ZA 2GY5A 2V5RA 4TUJA 2P5EB 2XXCB 1H8OA 1A5FL 3HA0A 4HIHA 5F1KC 3VXSA 4J2XA 1PYWA 5BS0E 4L8SA 1NCCH 2AEQH 2WIIA 4X4ME 5EWIH 5HHQB 3EYFA 3QXVA 2VABA 2NY1D 5IFHL 3J7HA 5KSAA 4NQED 3AS2A 4D0BA 5B3JE 3NA9H 1E4JA 1IAKB 1EO5A 4LCIH 1UH4A 1FL5A 3MLYL 4DGVL 1BOGA 1P4LA 5D2LB 1D5MA 4BQ6A 4ODUA 3V5KA 1DCLA 5D7JA 4KKLC 4PJGA 2HFTA 5IMKB 1G7JA 3LB6C 2QSQA 3F8UB 2QADD 3MRIA 5KN5A 5J6GA 3GIVA 2W9LA 1T83A 4PJEE 1GZQB 1Z5LA 5DD5H 3L3DA 2VLJE 4X6FB 3U2SB 3GI8L 1NMBL 1CDGA 1EBAA 3DTXA 4RFEA 3SBWA 1URLA 1UKTA 4UB0H 3LQMA 1JP5A 3KXFA 1KN4L 4OM1H 1T4KA 1U92B 4PGBA 1U2HA 5F6IC 3N06B 1QFPA 4TVSa 3DX9A 1BGXH 4UBDC 1YEDB 5FK9A 3JUZA 3S3SA 4L8BB 1NSNH 1H15B 5IJVA 3RVTD 5JHDD 2HVKB 2VQTA 1ADQL 2GSIB 3BEWB 4GJTB 4CU6A 1AD0A 3VG0L 2VXQH 3E2HB 1AIFB 5KSVA 4AMKL 4W68A 1VFMA 1QFWM 1UC6A 4CJ1A 4LL9A 4PJFE 4F15C 4JM2B 3M1BA 5IW3A 3UTSA 3GMMB 3JWOL 1EVTC 1ED3A 1DEEA 3HPLA 3DX7B 5CEZH 3ZE2F 5MENB 1ITBB 2VLKB 1CFNA 5GGUB 3LKSB 2HFGL 4JY4A 4WUUB 5ACMA 3QG7H 1DQDH 4XBPA 3NOIA 3LN4B 1N0XH 3P4OB 3REVB 4AL8L 1OHQA 2FJGA 2WINA 1OCWL 5GS1C 5ADOH 1OF2A 1CE6A 5DUBB 2EYSA 3HE7A 3KPRE 4HUWB 3G6JA 3FN9A 3VFGL 4RMWA 2OTUA 4PGCB 1JPGA 3P4MB 2HH0H 4U0QB 4I0KA 4NN6C 2ADIB 2A0LD 4XVJL 5EU7C 1KIQB 2Z35B 4FRWA 2F53E 4YXLL 3HG1A 4FTVB 4K3EL 4KV5F 4R4FL 1I8KB 4QT5B 4R4ND 3MFFB 1B2WL 1XGTA 3B43A 3MLRH 4PGEA 1WAAA 3GSRA 4KQ3L 5F7NC 3WXVL 2NX5A 4OKVB 1JGDA 5LGKA 5EG6C 1I9IL 5MEPB 5F3HB 3MLUL 1LEKB 5F1IB 4HIJA 2DQJH 4LGRB 4JEGB 3OXRA 4GG6E 1KBGH 3EOBB 3MV9D 4G43B 2GJZB 3AMKA 3KPPA 2D7NA 4HJGB 3MJ8B 4P4RB 3MLXL 1GGBH 4UOW0 2ED7A 5LBSH 1IGYB 5BV7H 3PP3H 1K6QL 5DHYA 3SQOL 5IFJA 5H37G 3PQYD 4B5EA 4LP5A 3UZVB 2AJSH 5EOCJ 2R23A 2VSCA 3Q0HA 4R97B 5BRZE 1GOFA 3KYAA 2W59A 3BT2H 4PRPD 2NZ9D 5AUMA 3K4DA 4JJ5A 2P8MA 3TF7C 1A3RH 4JFYA 4Z7QE 3QH3A 1KCSH 4LLUB 4OF6A 1RU9L 1SMOA 4QTHA 4R96B 3U1SL 1AXTL 4Z7WA 3U9PL 4CADB 4ETYA 1YNLL 1HKLH 1ACYH 1ODAA 2B1HH 3DUHA 2RFXB 3BD5A 5ESQA 3C8HA 1F4HA 1H3WM 4Y0GA 3MRNA 1KLUA 1B88A 3GO1L 2AJXH 1AY1H 3RX5A 4LLDA 4JG0L 1WZ1L 2ID5A 3RGHA 4H25A 3U36B 1OTUD 3FO2B 4E42B 4YEFA 1DP0A 2L7JA 3OKMB 3SGKA 2MPAH 4KRMB 2YRPA 1WC7A 5GS0L 3ET9F 1M7IB 2MWCA 3FFCD 2CMRH 5C0CB 4ZFZB 1NUFA 3B4NA 2BCKA 5E03A 1J5OH 1UB6A 1VFAA 1ONQA 3DBXA 4YPGA 2ZCLH 3T77B 4BQBA 1TCRB 4NHCH 3SDAA 4J23A 4U4BA 1BQHB 2XACC 1QFWH 2Q20A 4OFYD 5IGXH 4KZDL 2CIKB 3DSFH 4N0CD 3BHBA 3C5SB 3UPCA 1HOCB 2ICWJ 3SN6N 2DTML 3BIKA 4FQJH 4JE4B 4OF7A 4UIKL 1F4XH 5EPMA 1P84K 4UT9H 1EJ6A 1Y0LA 3BKJL 1RZFL 3T2OA 1C5BL 5EB9A 4B41A 2PR4H 4IMLA 4Y4KC 3QO1B 1H0DB 5HYIA 1GGIH 1OAQH 2EDXA 4PJ9B 5E8OA 2HTLC 3PWVA 4NQCB 2VLMD 1B0RA 4ZXBA 3PABB 2C3VB 2NY7L 3CLFH 1TTUA 4FQIL 5C8JA 2I60L 2W65A 3Q6FA 5EZJB 4FZ8H 1N4XH 4GBXB 2BVQA 2VXUL 1CGSL 2DRUA 4LMQI 1FIGL 3AXLB 5E2WL 2PO6D 5E5MA 2D0FA 2W9EH 1NGYA 1TVHA 1LO4H 2EC9T 5HGAB 1H3VA 5HPMB 4LSTL 4F7CB 4C83B 2DLTA 1MFBL 5EU6E 4JKWA 4OCNC 5FHAH 5IMOA 1NBYB 4ZQKA 4M9PA 4MJIB 5D1QC 4O2FB 4PY7A 5IOPA 2JELL 1EHNA 1AGBA 3RTQB 4NFCA 1M71B 4G6JL 1FFNB 1TQBB 4YH6A 1OP3K 4Z7OE 3MNWB 3RVWC 2DLGA 5HHOA 3FONB 4HWNA 1X5YA 1KB5H 5GSRB 1I1AA 2HJKA 4MAYC 5L2KE 1MVUB 1UCBL 5HBBA 3G5VA 1NMAH 2W60B 4OZIB 1RUMH 12E8L 4M1DL 3IFLL 3B6SB 3P73A 3GKWL 3KWWB 3VGFA 1AP2B 3RU8L 1LE5A 1AC6A 4HDIA 5F1NB 2YOCA 1PW3A 2XN9B 5DUMH 4P2YA 3EOTL 3MXWL 4L3EB 1AKJA 5I19H 2BRRL 3GJFK 3W2DL 1XGUA 1T89A 2FLBT 2VKWA 5J11C 1DFBH 3HPJB 3B83A 3ISWA 1I4FB 1D9KD 1C5DB 5L0QC 2DWEB 4X9GA 4CVXB 1AGDA 3VE0A 1BD2A 3EFFA 4P4KC 1R3IH 1MCRA 1G7PB 4YK4C 2YRLA 4EI5B 1N59B 4N0UA 4PRNA 4OJFL 2RGSA 1I85A 1MSPA 4GUPA 5ERWB 1ZT4A 3P9LA 4R8WH 3UBXI 4KJYB 1JNLL 5A1AA 2X1PA 4OZHB 3UPRB 2EEBA 2NY3B 1KTKE 2RB8A 1FNHA 3GMOA 1OP5K 1IGFH 5DR5L 1XH3A 2LTQC 4LFHD 3WKNA 4WCYL 1MREH 3VWKB 4R0LB 2E27H 4MDJB 4OCYH 5JO5B 2VLRE 4YHOH 4H0GA 1CL7L 1NH6A 1HDMB 1MUJB 5CP7B 4P3DA 2NW3A 5DD0H 5J1SC 1RUAH 2C3XA 1RHHA 4OZGA 5TQ2L 4PJIE 3BKMH 5SWZD 5BVJB 2ESVD 3MRDA 1QBML 5C9JA 4LQFH 4X8JA 4F7PA 2IBZX 2WWKT 3A67L 4Y5VB 3OMZA 1QQDB 3Q48A 2IG2L 4CBPA 3OR6B 5FV1L 3RVVD 1OAXH 1KN2H 1X5ZA 4EDXA 3E0GA 4I18B 4FG6C 5E2JA 4P2QB 1DQQB 1RZ7H 3U4EB 4Y19B 3VFOA 5HHPA 1G84A 4JPIB 2DM3A 2X1XR 3ARGB 3PDOA 5FOBB 3L5JA 4A6YL 3PIQB 2C3GA 5BV7B 4G6ML 2YPKA 1MAMH 3MBEA 4LGSB 3TPKA 1OLZA 3RIAK 1INDH 3QUZD 4ZUSB 3SDCD 5TF1L 4Z6AT 1U91A 4MX7A 3SKOA 3O3EB 1U3HC 4PRHB 3SO3C 4OQTH 4LVEA 4UI2A 4GAJH 1W2KT 1OT1A 5FYKH 2BVOA 5B3JF 1LO3H 1ZEAH 5KVEH 2VLLA 3IAPA 3RBSA 5E1AA 4M6OH 1PEWA 4RFNB 3O3DA 3LMJL 4P23D 5DD1L 1QSEA 2CO6B 4OD2B 3V6OC 4PJEF 5DMGC 2JJTA 5E8PA 1OP3H 3EFDL 2GJ6B 3IDIB 4GQ9L 4X6DA 4XC1H 1LK3H 1G0XA 5I76A 1IGCL 1MIMH 1TLKA 1UM4H 1JUFB 1MEXL 3QDME 1FVEB 4U6VL 4LMQE 3UROR 4ONGH 4K3JH 5JDJA 1I7ZB 5IVNA 1FNSL 2R4RL 1NCDH 2AQ2A 1YQVL 3I3BA 4HC1H 3E6HA 5D6DA 3NVQA 4NQEA 3PNWB 4F37K 3HS0A 5FA3A 1H3UA 4NO5A 4PD4J 3UJTL 1HXMB 3O6KH 5SWSB 5FV2A 1NCBH 4NKIL 1AD9B 5C0AB 2RBLA 2NY2B 3ARBC 3V4PH 4M5YL 3GJFH 4HWBA 3RVUC 2VDOL 5C86A 4ZFOA 2WUBH 3MRFA 4QRPE 2R0KH 4S1QH 3ZHKA 2FEEI 3QYCA 4PJFF 1OGAB 2BSRA 3PHQA 4G8EB 2HKFL 5D96C 4X6EB 3H2WA 2AK4E 1VKXA 4WW2A 4L4TD 2JCCB 1OGTA 1VADA 2ERJB 1A6UL 5HD8C 5KG9B 3T1FB 4GXVL 4JN1L 1XF2A 2FGZA 2AK1L 2RCSL 3NZ8B 3TBYB 2X1OA 3V6OE 4WUKH 1CF8H 4G9DA 4LQ1A 3C6LC 4MLIA 3FQUA 4L29A 4I1NB 4YIQA 1OP5H 4UU9B 4DN4L 2BC4A 5JHDA 2BERA 5KTEH 1WFOA 1YUHA 4NFBA 5I74C 1J11A 2FIKA 4AY0A 2CH8A 4NNYA 1W8NA 1FE8H 2ZP0T 3BE1H 5HHXL 5BXFA 3IAGC 1TZIB 4LSRH 2Q1EA 1FAIH 3HNVH 3VGGA 1OAYH 1XGYH 1VGKB 3BZ4A 5I8CB 3O2DH 4LFHG 3S34H 2B7DT 3FZUD 4X6BA 3QAZB 4XPAL 5IFAH 3GDBA 1N2RB 3MJ7B 1EUUA 4OV5A 3HB3C 4GG6F 4I48B 1INEH 2EDLA 3T0DA 4M6NH 4Z77A 4Q97A 3FB6A 3LAFA 3BZDA 2FR4B 2OZ4A 4IIQC 5MHSE 4G9FD 1UXWA 1UYWH 4LPXA 2HP4A 1FNEA 3W9DA 5E2VH 5F7YC 4MMZC 3LHPH 5FO9A 5HHME 5DWUH 2HTKD 4NT6A 2G75A 1N8ZB 1A7QL 2D9QB 5MEQB 4HKZA 5F9DC 3MJ9A 2VDPL 3G04B 3SJVE 3NABL 3AREB 3I85A 5JR1L 3K2UH 5CINL 3GSUA 5INCA 3GUTA 2VUOA 1J0KA 2OR9H 1PG7W 1RD6A 5EC1B 3V9FA 1VPOH 1KJMB 3MV9A 2E6JA 4NRYA 1QR1B 4JLRB 4BQCA 2R0ZH 4LVNB 4YC2B 3PQYA 4CVWA 4FMFA 2DDQH 1HHGA 1J7VR 2DMCA 5JPMA 4MGXA 3S5LB 3DYOA 4JG1H 1F45A 4PRPA 2G5BA 4P9HL 3LD8C 2BNRB 5T1MB 1CDHA 2OXHA 5DHVA 4M8QB 3QR2A 3F5WB 3L9RB 3S96B 4BQ9A 3WO4C 4ELMA 1XIWB 1H5BA 1NMCC 3P77B 3EYQD 1IGJA 3MXVL 3UTPE 4GH7B 1YMHA 3MV7B 5CUSH 4WRLA 1UM5H 3T0EC 2FX8L 1AQDB 2NY4B 4GRMA 3EBAA 1UM6L 3SGDH 3PUCA 3C6SA 4X4XA 3BP5B 4JZOA 2WUCH 1JTTA 1GXEA 4Y1AB 1GC1L 1M05B 3NCJL 1NCNA 1IGIL 1IGTA 1X5HA 1U8OB 2F58L 3K1KC 3OZ9L 3R0NA 4F3FB 3EJZC 4XXDB 5IIEA 3KHOA 1JGVH 1XCTA 3ES6A 4IRJB 2DQTL 1KNOA 3FFCA 3S36L 5EUKA 1V3JA 3JV4B 4MXVE 5H2BA 3UPAA 2O5ZL 5HHVL 4L8CB 2IC2A 1FYTB 5EBLA 1S7RB 3PV6A 5HI4D 4OSUL 1AE6H 4O58H 5DJ2B 3MLSH 2OXGA 3IYLW 4OFYA 1P9MC 5BO1L 3B3IB 5F71A 3RX7A 1IKFH 4UDUA 4IDJL 3P0VH 4NZDA 3BJLA 5DD3H 3P0YH 5BOZG 4TTGA 4ODWB 1UJ3B 3H3PL 2GCYB 2XWTA 1CG9B 3WNLA 5GS3A 2NTSP 2VR5A 3X3FL 4MMXC 3D85D 3ULVD 4X7FC 2QBWA 4JRYD 4UT7L 4Q9QH 3H3KA 1CLYH 2Y36H 3MYJA 4PPTA 4JFPA 3RL2A 1JVKA 4Z7OF 1GAFL 2PO6A 5FFLA 4XTRC 3U7WH 1GOHA 1NCCL 2AEQL 2EEDA 3KYOB 3NFPA 5EWIL 5D5ME 4CDHA 4CL7A 1V05A 1AXSA 5ISZB 3DIFB 3V4UH 4NKQB 1FFOB 1P7QB 5ETUA 5I1KH 5IROA 1A6AA 3NA9L 3BDXA 1RZKH 2AGJH 4LCIL 2X7LA 2JIXB 2ADJA 4LEXL 4MWFB 1T3FB 3MNVB 2D3VA 4HHAA 3AVEA 2X1WL 4NHUB 1MJJA 1GZPB 4WO4C 1A2YB 2IANE 3RL1A 1J0YA 5KZCB 4P57B 4YXHH 2MNUA 3O3AA 2CLZB 3QIWD 1UACH 4U49A 1MHCA 1MJ7H 5DD5L 1EFXB 2Q7YA 1G9MH 5DFTA 4ELKA 4Y4FD 1IC4L 4UB0L 1CD0A 4JFED 4C4KO 1TJHH 5E0QA 1W72L 5IHBA 1HILA 2ZSWA 3P0GB 4OM1L 3B5GA 3K4ZA 4DCQB 1U95A 3HUJB 3IJYA 3VXOB 2J6EH 4HUUB 4LPVA 1BGXL 1JGEA 1HHKB 5BMFH 3HLAB 5IBUG 3V0AC 2EYTA 1NSNL 2V5YA 1QA9A 5LQBH 3A6CH 4Z7VB 1D6EB 2XKNB 1KTDA 2OCFD 4PRID 1M6OA 1N5AB 1AGEB 1MH5A 2VXQL 3AM8C 3ZKNC 1RZJH 1OAKH 5I9QC 3C5ZB 5E6ZA 2ARJA 5LAXB 4MLSA 3VMPA 1FFPB 2AP2A 4NQDE 4CNIB 4M61B 5C0FA 3ALWA 1DLHB 2A83B 1R3JB 2AI0H 3P9MB 2V5MA 4NWUH 3QUMH 3IFNL 5C08E 2X4SA 4K2UL 3RZCD 5DHXB 3PV7A 5D1ZB 4OUOA 1Q9WB 4UOJA 4QHNB 3DVGB 1CICB 5CEZL 4PJIF 3WUWG 4TPRH 4L1DA 3HCVB 4R4BB 4M7LT 5ALBL 3QG7L 1DQDL 1KIRB 3X11A 1N0XL 1UWXK 1DQJB 3NCYS 4LRNH 1CBVH 4KKBC 5TE6H 4P46D 4QRUA 1A6ZB 4NQXA 2N1KA 4HT1H 1HSBA 1NL0L 3K2MC 1F90H 3WL9B 1I8LC 4NO0D 4Z18A 3VFRB 4ZAKD 3HAEH 2DM2A 1ZVSB 3G5ZB 3MMEB 3CK0H 3H8NA 3OAZK 4TUJB 1NGQL 5C09D 5JW3H 1LEIB 1AR1C 4M03A 2OJEA 3ESUF 3AS1A 1JHLL 3ARFD 3MLTA 1PYWB 1GOGA 4KXZH 5SX4H 5C0RH 4X80H 4U3XA 1V3MA 3I84A 2VABB 4L5FH 2BRQA 3AC0A 2DQJL 5SWZA 2ESVA 4D0BB 1KBGL 1TETH 2PW1A 4L9LC 3IFPA 1FL5B 1BOGB 1P4LB 3CSGA 5LBSL 3QULB 1YDPA 3V5KB 5BV7L 2VXTH 4ODTH 3AU1A 3B2VH 4R2GC 4QGTA 5J6GB 3FRUA 2AJSL 4I9WD 4UT6H 3GIVB 1Z5LB 3AGVA 2Z31C 4HKJA 3L3DB 4KJWD 3BT2L 4U7KA 4NDMA 1YEHH 3EOAA 2O5YH 4LAJH 1A3RL 3RVXD 4IOIA 4KK9D 4HUKB 2ZUQB 5DJ0B 4N5ED 3V52H 4I3SH 4AG4H 3CMGA 1A1MB 3UCRA 2ZG2A 4GOSA 4PGBB 1JPTH 2B1HL 1HKLL 3QUZA 4CJ0A 3SDCA 1KPRB 3DX9B 4QXTA 2HLAA 2MQ0A 5FK9B 4YHPA 5DJCA 4KTDL 4KVNL 1NGPH 5IJVB 5DJ6A 3G6AA 3TM6A 4WEUD 5DK0B 2C1OA 3DSNA 2E7CA 1XR9B 4K8RL 2XTJC 1CU4H 3SE3A 3MRLA 4Z0BL 3WJJA 2MPAL 2Q6WB 3L1OH 3QFJB 4P23A 2R1YA 4GXUM 4RA0C 1J8HE 2CMRL 3QDJD 2V9QA 1J5OL 1CFSA 2FJHB 2P42B 3SPVB 3UTSB 2UV3A 1V7NL 5JZ7C 3C9NA 5DUPL 4L3AA 4NHCL 3PWPE 4HGWB 1ED3B 1DEEB 4AZ8A 3HRPA 3MSPA 5AZEH 3BN9C 1CFNB 2X42A 4JY4B 3HN3A 4D8PA 4XBPB 1B0WA 2V5TA 5I18L 1F4XL 3ZLQC 2EYSB 3HE7B 4UT9L 3G6JB 3T0AA 4HLZG 1P53A 2RIKA 2OTUB 1S7UB 4JKKA 1JPGB 2PR4L 5JIPA 4WGWB 1GGIL 2FHBA 3RWCB 4QOKE 5CCKH 4YO0A 4LPTA 1Z3GH 2VDMH 3CLFL 5D2NC 2Y72A 1XGTB 4WFFE 1PAMA 2WBJC 3GSRB 2NX5B 4FQ1H 1I9RH 1ERNA 3I6LE 4XCCH 2OR8A 4HIJB 4R90H 4L4TA 3OXRB 4I3RH 1BLNB 2XTJE 1UWXH 2W9EL 4FNLH 4TUOA 3RWEA 3KPPB 1S7VA 4NN7B 3X13A 2DQHH 5JW4N 5DHYB 2FH8A 1E4WH 4IRSC 5D6CA 4LCWE 3GB7B 2PCPA 5H37H 3TCLA 3H9YA 3OAZH 5AUMB 4JJ5B 5FHAL 4XWGH 4NZJA 1GIGL 1D3CA 5IEKA 2R29L 3OQ3B 2PYEE 2H2SD 1TVDA 5H8DA 4U1HA 2X4UA 4QTHB 5CJXA 2X05A 2GSGA 1IEHA 3DVNB 2MCG1 4Z7WB 1P5UA 3QPQC 2DN7A 1DBMH 3HB3D 3IVKB 5ESQB 5K59E 4NM4H 4MA8H 3BGFB 5CEYA 3RPKA 1KB5L 1X5FA 1BMGA 4OFDA 5C0NC 3BPNB 3ZHLA 3ARVA 1NMAL 2KZWA 4H25B 4LKXA 1RUML 1RAMA 5JMOC 4MNGA 5ITBL 2LE9A 4OLVH 4G9FA 4JR9H 5GGTA 3CDYA 3F65A 2LU7A 5DUML 1D5BA 3VXNA 1K2DA 5I19L 1EO8H 2BCKB 1VFAB 1ONQB 3LKQA 3IDYC 4F7EA 5C0IA 1DFBL 2ARWA 3SGJA 1VFUA 1RIUH 1OD7A 3JBG7 2VN4A 4OLYH 4JM2C 1QSFD 5C70A 1S7WA 3WCYA 5HVWA 5FYJE 5D2LE 4LCYA 5EPMB 1F6AA 3KVQA 1Y0LB 3HZKA 2APVA 2HT4D 4NZRL 1OAZH 2YUVA 5INDA 3VFSA 4PJHB 2IH1A 4QRQA 1DBKH 4CDGC 5DURB 4R8WL 4IMLB 3O9WB 5EZOH 1OT2A 2AQ1A 3ZE1E 1S8DA 5A3IC 1B0RB 3K1DA 4K94C 1IGFL 5JQHC 4BM7A 1BZ7A 5ICZA 2PXYB 5TE7H 2DL9A 4WDIB 1DLFH 4MXVF 2BVQB 4LHUG 4M8VA 1A6VH 3WS3A 2X4TA 1RUAL 1QFUH 1ACZA 4JGJA 3VI3E 3D2UD 5GRWA 1KENH 2EDKA 1JHKL 1T0PB 4PY8I 5FUCC 2I07B 4P0DA 1FVDA 1U3YA 4P5TC 1H8SA 1H8NA 1OAXL 1KN2L 2VKXA 2AJZA 4U7SA 1CQKA 3NA4A 1RZ7L 2BY3A 4XGZA 4PY7B 4ZPTA 4Y8AA 4KI5D 5E99H 2ICWA 1OTTC 1ORQA 2JJSC 5HHOB 1MAML 2AXFB 3SE9H 1INDL 2N56A 3NCMA 1KEGH 4OF0A 2LABA 4S0TD 2HJKB 1GH7A 3ECBA 3BPLB 1TIUA 3DETD 5D5MF 3RGVB 2ORBH 3GSOA 2VQ1B 3G5VB 1L6XA 1MNUH 5FO7A 4PLKC 2A38A 5FM4A 3P73B 5FYKL 3HI5H 1LO3L 3MRKA 3VGAC 5I6XB 4WFHE 5KVEL 1LE5B 1LO2H 3RQ3A 4G8GD 1CCZA 3L7FB 4M6OL 3FFDA 3PGDA 3PE9A 4CUCA 3WJLC 1UG9A 32C2A 4BJLA 1XGUB 1INQA 4I0PC 3D85A 5KSBA 5JOPE 1D5XA 3KYKH 3TJHD 7FABL 5JQ6H 1RJYA 5ESAA 3PWNB 3WLBA 4MA7H 4JRYA 4XC1L 2COQA 1AGDB 1UM4L 5E2TH 1BD2B 3EFFB 2H6PA 5F9OH 5T3XH 4K3JL 1CDUA 1XFPA 1H3GA 3IJSA 2FEEL 1NCDL 4HC1L 4TNWK 1HQ4B 3HMXH 4PRNB 5DHVH 3HTLX 2DL2A 3VFWA 1CLCA 1ZT4B 3P9LB 3BN3B 5ABDE 4XNYH 2NY0B 4M62H 1J12A 3IGAA 1NCBL 3GMOB 3FRPG 1XH3B 3V4PL 2VITA 4FS0A 4K9EH 1FZMA 3GEWB 3ZMRA 2WP3T 3QIWA 4PJ9C 4UNTA 1JYWA 5ENWA 2R0KL 4S1QL 1U9KA 4HULB 4H1LG 4P3DB 2NW3B 1RHHB 3FQTA 3NN8A 4OZGB 4Y4FA 2VZVA 4JFEA 5B8CC 3F7VA 5CJ5A 4ZFGL 1BF2A 1KACB 4X8JB 3LN5B 4D9QE 2B1AH 4HPOL 2R2EA 4CN6A 5CIPA 1YPZE 5J3HD 5DA0B 4WUKL 3EO9H 2LAAA 3CXDH 1OB1A 4YHLH 3VFPA 1HCVA 1R3HA 4YDKL 4EDWL 5JW5A 4PRIA 4XP9H 3VFOB 2M1KA 5HHPB 5JA9A 1FE8L 3DWTA 3BE1L 3B8YA 4JQVA 5ILTH 3HNVL 1S7XB 3MBEB 5FGBA 5DRZA 3RZCA 1U91B 3RTQC 3O2DL 3S34L 1A6WH 4MX7B 5IFAL 4JQIH 3SKOB 3L7EA 5DA4A 4PRBB 5EO0B 1INEL 2BVOB 4M1GH 4RGNB 3NIGE 1ZHKB 2LAGB 1BEYH 1J05B 1NFKA 3GSNL 1G7HB 4P46A 5E1AB 2NW2A 4DGIL 1UYWL 1BFSA 1RQ5A 1QSEB 5KANG 4O02H 1Z0MA 2B5IB 4K55A 5FM5M 4NO0A 5DWUL 4ZAKA 3MO1B 2WQRA 4X6DB 4V1DD 35C8H 4Y4HD 2DJUA 2W91A 5I76B 5K9QG 5EU4A 5C09A 1I8IB 2GKIA 4Y16B 4U2YA 3ARFA 4XPGH 1IRAY 3QXUA 3K2UL 5EORH 4GO6B 3FN0H 1MFEL 5I1LA 2OR9L 5HHNA 4NQEB 5CZKA 3QNYA 2CLVA 3HS0B 5FA3B 1S5HB 1VPOL 4IOFD 1PY9A 4YE4H 1T04A 3ZKSD 1I9EA 2YPLD 3TFKC 3PL6B 5DYOB 2BNQB 2Q3AA 3SCMC 1E28B 2R0ZL 4RFOH 3O6MH 4JY6B 4MJIE 3DO3A 4M93B 1A4JA 4ZFOB 2DDQL 3WFZA 3MRFB 2NY3C 3U79A 5E5UB 3OB8A 1MFDL 1WVZA 1H3XA 4PLJC 3OV6A 3VXME 3PHQB 5DQJA 2Q8BL 3MA7A 3VWKC 4R0LC 4KTEH 1ZS8A 2FATH 3RP1A 4WW2B 1OGTB 4ONFH 1U8PB 2A6IB 1VADB 5IVXB 4ZNCD 3WHXA 2CLRB 2B2XL 2VZ1A 4AEEA 3T4AA 4LASH 1YY9C 3JVGC 3WIFA 1O5DT 3UJJH 3OX8A 3OF6D 3R06A 1G0YR 1UM5L 2KZ1B 3BQUB 3FQUB 1QFHA 2XN9E 4POZC 5JHDB 4OAWA 4Y5VC 3VXRD 1YUHB 3WNMA 2WUCL 2FIKB 4QKXB 5AD0A 3SY0A 3UYOD 3LQAH 4WTWA 3OKNA 5E8EB 2A74A 3EYVA 3SKMA 4TSAH 3OPZL 2E7LA 1JGVL 2XZAL 3QDJA 3QI9D 2JTDA 5IB2B 3BZ4B 4J3OC 1RUPH 1WT5A 2AXHA 4X6BB 1A6PA 4JFOB 4PV9A 1AE6L 4O58L 2VSDA 3BYYA 1M1SA 3DI3B 3SHSA 4P99A 3NZHH 4GMTH 4CVZB 1IKFL 3TWCH 1Y6KR 4M43L 5I66B 5I17B 2X9WA 4Z77B 3P0VL 5DD3L 3FB6B 3E3QC 3EYSL 1U8QB 1UXWB 4LVHC 4HPYH 1FNEB 5FDYA 3LV3A 3S7GA 5IEHA 1P6FA 2EO9A 5FO9B 5DQ9B 1JE6A 5I1AA 2ITCA 2G75B 4ZUVA 4RFNC 1BVLA 3KPSE 1FP5A 3BH8A 1W0YT 2P5ED 4KVCH 4JFXB 1CLYL 3QQ3B 4P5MA 1MCQA 5IF0B 5INCB 2XWBB 2PTVA 3GUTB 2CRIA 4PP1D 3IU4H 5GGRB 5K59F 3U7WL 1WFUA 4LU5H 3CU7A 2J8HA 4NRYB 5FGCB 2ED8A 1MCIA 5I1KL 5T1DL 2OBGA 1RZKL 2AGJL 3QUXB 4J3VA 1YJDH 3AS3A 4PREA 5DJZA 5ID0A 3CFBA 5HGHA 1NUNB 4WEBH 3PQYB 3HKFA 2FECI 1HHGB 5ADPH 5C07E 4HF5H 2K7QA 4MCZA 1S3KH 2NY2C 4YXHL 4D0DA 2G5BB 4X98B 1X6NA 2ZPKL 5DHVB 1RSFA 5IP4A 3HE6B 4Z8FH 4IDLA 4X99A 3TJEH 3ARTA 5T3ZE 4ELMB 2F5BH 1G9ML 1XCQA 1ES0A 5C2BH 1K4DB 1IGJB 4NPYB 1TJHL 1YMHB 3E3QE 1OQOA 4S1SH 4U1KB 1J8KA 4AIOA 3EJYD 1MFAH 4JAMA 3OJ2C 4M00A 4J3TA 3OBAA 4X6CA 5D2LF 1HE7A 2J6EL 1A7NH 4KKNA 3DROA 3FRPA 4N9GA 5BMFL 1NFDA 4GRMB 4ZOCA 3JTTA 3C6SB 3MUY1 4ODSH 4X4XB 1NLDH 3O6LH 2DTSA 5LQBL 3A6CL 3KDMA 1FNLA 3FHQA 3ILPB 2Y1VA 3GFUA 2KL6A 3FQWB 3KPNB 3ZE1F 4O2EA 5EUOE 1RZJL 1IGTB 4HGKC 4G6KH 1OAKL 5HGGS 2KUTA 5DSCB 3ES6B 1XCTB 5D93B 3FFCB 5H2BB 2I5YH 1MLCA 3FT4B 3PV6B 1ORSA 4NWUL 2GI7A 3QUML 4L3CB 4PJXF 3TV3H 5IK3B 3MRCA 3THMH 2EDOA 4KDWA 3SO5A 1QSFA 1IJ9A 3LRGA 4DTGH 3OJMB 4TPRL 4WUUD 4FZEH 1LDPH 2CSPA 3VI3F 5TDNB 4HJJL 5MP6L 2JB5H 1JHTA 5DFVC 5ANMB 3CSYA 3C5JA 3CFDB 3UDWA 3WUZA 1CBVL 4LRNL 3SOBH 3V0VA 2H2PD 2XWTB 4LOUD 3U9UA 2PF6A 4HT1L 1Z2KA 1CE1L 4LSUH 4RWYH 2M8XA 3BISA 1F90L 3V4VH 4UV7L 3IRZA 4OBSA 3L5WA 3MYJB 5IUSA 1I1RA 4LVOB 4LKCA 1WBYA 5C0RL 4H8WC 4X80L 3NFPB 3QUYD 3AREC 1AXSB 1RJLA 2OMNA 4DW2H 4K7PY 1OSZA 2VUYA 3D2UA 5ETUB 1A6AB 1TETL 4JVWA 4AIZA 5JLZB 3MUJA 2R2HA 2ADJB 5DZNA 5D71H 1I3RA 4HHAB 4OLZH 3QEQE 2F53D 2VXTL 4UNVA 2ZNWA 4ODTL 5DJYA 5IB4A 4R3SA 2MMXA 1WWAX 4YC2C 1F58H 1FJ1A 1MHCB 3V0WH 5CGMA 2Q7YB 1YEHL 4NQVA 4ELKB 3FTGA 2F5AH 2IH3A 4X7EC 4N1EA 1RIHH 1TJGL 5M94B 3IU3A 2QV2A 5GRYA 5FA4B 3QDAA 3S35X 1EV2E 4I3SL 1HILB 2OR7A 2ZSWB 4AG4L 1XIWC 5ID1A 1JPTL 3IJYB 4DEPB 1FORH 3Q3GA 1JGEB 3ARXA 2MJWA 3VRJA 3RWGA 2EYTB 4ZTPH 1NGPL 4KK6D 4S2SA 1PQZA 5BRZD 2YUXA 3HC4H 4TNVK 2XXMB 2WLYA 4EBQH 5L8JB 1KTDB 3S35H 1MH5B 2ZSVA 2NY4C 1CU4L 3RKDC 3EYUH 2ARJB 4JQXC 3CX5K 4G8GA 2D4FA 3HI1A 5F9WC 4A2LA 3BKCL 5C0FB 5I75C 1YNKL 2D4DA 5C0CD 4K23H 4DZ8A 3GSXA 4PJ7E 3ZL4H 3ETBF 1GVIA 1BQSA 4IRJC 5GZOD 5JUEH 4XPHL 4OFVA 3MLZH 4U1LA 4OCSH 5AZEL 4G80B 5JNYA 4HGMA 3AB0B 2YWYA 5HDLA 1YYMH 5LCVH 4MNQB 4EIGB 3QRGH 4W4NA 4LLMA 3X11B 1X5JA 3BPOC 2GUOA 4F9LA 5HGBA 3EDDA 3BKYL 1VGEH 4NQXB 1YPZF 2G9HA 1T0NB 3RFZC 1MY7A 1NQBA 4UDTB 3RY6C 1CGYA 4PJBE 2QJDA 2RJMA 2E9JA 2WK2A 2ZCKH 4NQCD 5F21B 1ZTXL 3BP7A 2GEEA 4RWHA 5CCKL 4HH8A 2BVYA 5IHUL 5BZWA 1BBDH 1Z3GL 2VDML 3RX8A 4LIQH 2OJEB 1NGZA 1R5IA 4XI5C 1CD1A 3GBLA 4GBXD 3MV7E 5EBMA 4KY1H 4FQ1L 4BFEA 1I9RL 3QEHB 4NRXB 5IBLC 4XCCL 1UWEH 4R90L 4HX1A 2J8UE 4Q6YA 4JFHE 4I3RL 2QLVB 4X83A 4FNLL 3IFPB 4GKSA 4PR5B 1J0ZA 4TOYL 1PJ9A 5JW4R 5T1LB 5IB5B 4ZFFA 3BVNB 3AU1B 3FRUB 4QEGA 4EXKA 4HKJB 3WS6A 4APQC 4WV1A 4XVSH 1PVHA 2EXYC 4KTYA 1FYTE 4ZSOB 4XWGL 4ORGB 3EOAB 5JOEA 4OGAC 3LY6A 4IOIB 4ENEC 3EDEA 3ZT7A 4D9RE 2C7UB 4MVBC 2G5RA 2A9NH 4XNXL 4HUNB 4XNZB 3SDCB 5KSUA 2R0WH 1JWUA 1DBML 3EZJB 4QXTB 3ZDXE 4YHPB 4NM4L 3QXDA 4MA8L 4O2CA 5DJCB 3ULVH 3E8UH 5J57B 3G6AB 3RWFA 3VD5A 2C1OB 3FN3A 1BVKB 5EU6D 4MCYA 5GGSB 1IC5H 2HG5B 4M6AA 2WZPD 5GJSH 4KMQA 5KVMC 1WFNA 4KPHH 1A9EA 4JR9L 1OSPH 1Y18A 4P23B 5F3BA 1CTNA 2BOBA 3RAJH 5L7XL 3VXQA 1ZVHA 2XZCH 1EO8L 3C5ZC 4F7MA 2QKIA 3TVMB 1CZ8H 3D69A 3LDBB 3BEVA 4V1DA 3C9NB 4Y4HA 3BH9B 4BFBD 1J1PL 1RIUL 4KHTH 1C12A 1UZ8A 4OLYL 2E3VA 4BUGA 1BIIA 5FUOH 4D8PB 4YWGL 4XBEH 2WBKA 3CAFA 1J1XH 1S9XA 1ZAGA 4EI5D 3DRQA 1G6RH 3QZWG 1OAZL 2A73A 1KYOK 2X4PA 4NJ9H 5SV4A 1DBKL 3CFJA 4DGYL 2YPLA 4E0RA 4FQHA 5A2FA 5EZOL 3NCBB 5CD3A 5B21A 5CEZD 4HLZH 4ACPA 1K85A 4QGYA 5MEOA 3BAEH 1PLGH 5TE7L 2EO1A 5T1KB 5CBAB 4HJ0D 1CXEA 3JV6A 4PJ8B 5FECA 4X4ZA 4L4TB 4QF1B 3V5DA 1DANT 4TUOB 4RMSA 3BIBX 4E5XA 4YBLB 3WNOA 4L8SC 3LZFH 1S7VB 2CDFB 1G7IB 4HMEA 3UTZB 1KENL 1FGNH 1TXKA 4PRAA 4B53A 5KSAC 4LSVH 3OF6A 1TZGH 3RWIA 3QEGH 3QNZB 2R69H 4JDVA 4GRWE 1CDYA 1ZHBB 2VWEC 5D6CB 3VXTA 2YPVH 4OLUL 5I1GL 4HK0B 3VXRA 2PCPB 3TCLB 5D7JC 2Z9TA 3T0BA 2FHCA 3WN5A 1BFOA 4Y19D 1T83C 4JFDD 5BVPH 4NP4H 2VR4A 1BZ9B 2X4UB 2ED9A 3O8XD 4U1NB 3ARGD 2GSGB 2R1WA 4Z76B 3QI9A 5DGQA 3LS4H 1WV7T 3SBWC 1A4KA 2HVJA 1RUKH 4PLOB 4QLRA 1QLRA 1FSKC 2J12B 5CEYB 4N8CH 4D94A 3HZVA 3SE9L 4Y2OA 5DRXA 4OLWH 1BJ1H 2ORBL 2X4OA 1MNUL 5H35A 1BAFH 4MNGB 5AEAA 4QO1A 3HI5L 4A6YA 1FLRH 1BQUA 1I3GL 4LCCA 3UP1A 5I1CL 2UWEE 4G9FB 5IR1A 1LO2L 1R24A 2ZG1A 1CDBA 3OGCB 5FF6B 3LKQB 4HCRH 3VXSE 1A3LL 4F7EB 1NBQA 5C0IB 4M3JA 2GJ6D 3DHJA 3D0VB 5JQ6L 1UXSA 2ZUVA 4KMLB 2XWJB 5FAAA 4MA7L 4K8RD 2P5EA 4L4VD 2X2YA 4ZOAA 5E2TL 3HC3H 3VFMA 3GRWL 5IBUB 1S7WB 4RAVB 5F9OL 5T3XL 3OTTA 4XNUH 5FOJA 1FNGA 1P69B 4LCYB 4MD0A 1WITA 1F6AB 3HZKB 3HMXL 3IKKA 4PJGE 2VH5L 2IH1B 5L6YH 3RY5A 1KCVH 1NCUA 3TIEB 1F2XK 5SWSD 3HE7C 4XNYL 4XC3L 1Q1JH 4M62L 4Y8DC 5IESH 3MCLH 5J1TC 1QRNB 5EUOF 2CJUH 3HRZA 3J8F7 4NQTA 2PW2A 1GZQA 4Q0XH 5CP3A 3WUWB 5EO9A 1E4KA 2W0PA 2W0KA 3KXFE 3U0PA 4X9IA 5GISH 4QHMA 3WS3B 2I9TA 2GFBA 1Q9KA 1DANU 2HLFC 1XEDA 4NO2B 1V7MH 1U92A 1CIUA 2APTA 4HKXA 5B3NA 3VA2C 1YEDA 2B1AL 3BRDA 2EDBA 1FVDB 4L8BA 2E7BA 3CXDL 1HZHH 4F57H 3CC5A 4YHLL 4PJEA 2YD7A 2GSIA 1DZBA 5GZNC 1A47A 4XMKH 2AJZB 3R8BB 4QRPD 2GT9B 3WMSA 2V2TA 2VDNH 4XP9L 4XP5H 4XGZB 4Q6IA 2FIRT 3UTSE 2Q3ZA 4ZPTB 2M26A 5I1EH 5ILTL 1ORQB 4JPKH 4U0RC 1XMWA 2YHGA 4RX4D 2VIRB 5IW6B 1QVOA 4O9HH 5CAYB 3ECBB 4WEMB 2MTPA 3VU2A 1A6WL 4JQIL 3N85L 5GGUA 4C59B 5FO7B 2EE2A 2GTZA 3SDYH 4WUUA 1K8DB 1KCUH 4QHKI 3LN4A 3MRKB 5F88B 3ESVF 1BEYL 3BPNC 3DGGA 1VERA 1JZ5A 3HG1E 4HUWA 1I8MB 3FFDB 3PGDB 2EDRA 4YDLB 3O11A 1QLEH 4PGCA 3SGKC 32C2B 3TA3D 5GRUH 4O02L 3MGTA 4K3DH 1WAAE 2LQRA 2Y5TA 3GHBH 3Q1SH 5KVFL 3GNMH 5IQ9A 3O2VH 2Z35A 4JB9H 3C2SA 3WLBB 2I27N 4JRYB 35C8L 4HIXH 1NLBH 3MFFA 4GAFB 3OAYK 4LARH 1A8JH 2Z8RA 3SDAC 3IJSB 5TQ0H 1T7YA 5F3HA 3V79C 5IFHH 3QUYA 4PGZA 1Q94B 3R1GH 4KAQH 3EOBA 5MHSD 3OKEB 4N9OB 4G43A 3QDGB 1F4YH 2IFFH 3MYZA 4YE4L 4DGVH 4HJGA 3AROA 5I73B 4P4RA 1GL4B 4QRRE 1JZ4A 2F53A 3EO0A 4XWOC 4RFOL 3NPSB 4U05A 3BD4A 4ZXBC 3C8DA 4Z7WE 4J8RA 2R15A 5F8RC 5E9DB 3DECA 4PJ7F 4KTEL 3NN8B 4LLUA 2FATL 1S78C 4R96A 1K3IA 4GG6A 4JFEB 4KGLA 4ONFL 3QZWA 4H1LH 4FQXB 3TPUA 4CADA 2IQ9L 3AUVA 3QHZL 2RFXA 3WDJA 4LASL 3QEUB 3BESR 2R2EB 1I3UA 3UJJL 6CGTA 5F6HJ 1MPAH 1LE9B 4IS6A 4CMMB 2C4FT 1ADQH 1Q8MA 5BRZA 3U36A 2FBOJ 2FEDD 3FO2A 2VNCA 1R3HB 2Q76B 4OZFH 4Y1AD 5C0DA 5JW5B 4PRIB 3OG6B 5HYJB 5SV3A 3L3JA 1MCHA 4GAYA 3L3OA 4PJBF 1JFQL 3OKYA 3LQAL 1MCLA 4H5SA 2E9WA 3ULUH 1M7IA 4TSAL 4RAHA 5C0CA 1BIHA 1A21A 2FH6A 3T77A 4J3UA 4DOHE 4PS4H 4LHJB 3TO4C 2Z4QA 1BQHA 3L7EB 3RZWA 3QNXA 2J8UF 4AJ0A 5I71B 2CIKA 3NZHL 4TVPE 4GMTL 1NEZG 5KOVC 1HOCA 3JTSB 3WNNA 1I1AC 1OCWH 4FQCH 3BPLC 3MUGB 3TWCL 3ARZA 4OGZA 2YA2A 5LG1A 2NW2B 4FHBD 4CKVX 1X5XA 1U8NA 4HS6B 4HPYL 3TBWA 5LXGL 4WHYG 1YEFL 5I6XC 4M7JH 4NNXA 1OWRM 4IOSD 3QO1A 1H0DA 1EJOH 1PKQE 1LD9A 4K3EH 4NQCA 4XCNA 4R4FH 2C3VA 1ZGLM 5L2JA 3QPXH 5FYKD 1Z9LA 1T89C 5C09B 4HZLB 4QHKJ 2WWKO 3RWHA 4U1MB 4KQ3H 2BJMH 2DLEA 5C3TA 1I7RB 1WK0A 3ARFB 4KVCL 5EZJA 1S9YA 3EGSA 3MOQA 4GBXA 1I9IH 3CNKA 4LGPB 4F58H 3ZDXF 3IU4L 3QNYB 1MLBA 5CSBA 3N1GC 1IL1B 1F3RB 1SY6H 2X4NA 4LU5L 4KC3B 3MLXH 3FOMA 4K71B 2R1XB 3TZVB 1T22A 3MPCA 4JREB 1I85C 1YJDL 2Y07L 4LDOB 3OWEA 1W0VA 4WEBL 3KNBA 4OFPA 4C83A 1MY5A 1CXLA 1FRGL 2NY0C 5KZCD 1K5NA 1I1YA 5LVEA 4ZYKA 3VD3A 1MCCA 4HWUA 4V2BA 1JZ7A 2EE6A 3OAYH 4YBHA 3WKMH 4Z8FL 1EFXD 3KPTA 3TJEL 3DO7B 2J8OA 3BW9A 3U1SH 3U9PH 1M71A 2ZZUT 5C2BL 1RUQH 3FONA 4QTIH 2DYPD 3OX8B 3ALPA 5GSRA 4RMVA 4KK8C 2YUWA 1MVUA 3PP4H 1JWSB 1A7NL 3LH2H 1WZ1H 4OAWB 2IAND 4ODSL 5EU6A 3PGFL 1NLDL 3O6LL 2GHWB 5AD0B 4TSCH 3SY0B 4KKAC 3UBXG 4LHUB 1F8TH 3P11H 2DD8L 5GS0H 1W72A 4WI3A 5F1NA 3IDNB 1ND0A 2A74B 3C60D 4G6KL 1EPFA 1KGCE 1WZKA 2HAZA 5DJ8A 3QDJB 1BD2E 2PTUA 5T5NF 2I5YL 4DQOH 3QWRD 1PKOA 4HH9B 1I4FA 4PV9B 5K33A 4MQSB 5D1ZD 3TV3L 4N0UE 3MBEC 4X5WB 4ODHL 4WTZG 1CICD 3L5XH 4Z95H 1T1ZA 3V8OA 4JGMA 1HNFA 1LDPL 2JB5L 4DFIA 1G7LB 3MGOA 1RZFH 1KCKA 3NCCB 4EI5A 3SOBL 4RGNC 4GRWF 1JIBA 4KJYA 5IEHB 2DBJA 4FFVD 4OZHA 2VAAB 4LSUL 5I1AB 4RGMB 1BVLB 5C08D 1GPOH 5EOTB 3FAXA 2JJTC 5B39G 3RRQA 5CS7A 1QFOA 2B5IC 4U7MA 3GZKA 3AS0A 3BFOA 1CGSH 1WZLA 1FIGH 3ZKXC 5E2WH 4PP2A 1HDMA 5CP7A 4AH2A 4JGUA 1J0HA 5DJAA 5DC9B 1DUZA 1T7WA 3T3PE 5T5FH 5BVJA 4DW2L 5C71A 2UY7A 1RPQA 5D6DC 1KPUB 3D25B 1DBAH 2NY1C 1UFUA 4XCEB 2I26N 5ID0B 5D71L 4XT1C 4M4PA 2P7TB 3WLWD 4JFZL 2E8ZA 3OR6A 4OLZL 2OS7A 2UWEF 2EDHA 4ZPVA 4MCZB 4OLEA 1F97A 4I18A 4D3CH 5IHLB 4M93C 3U4EA 2QADC 4Y19A 3INUL 4X99B 4JFDA 2D0HA 1FDLH 4JPIA 3O8XA 4B7LA 1XCQB 1VSCA 1ES0B 3ARGA 3TT3H 4E9LA 3IRPX 4PJIA 4WFGD 4ONHA 2AEIT 1RIHL 3P30H 5C0GA 2F8VA 2V7NA 4WW2C 4JAMB 5L9DH 4X7DC 4P2RE 4YHZH 2MQ3A 4KROD 3DROB 4N9GB 5EZLB 4JRXD 12E8H 2GJJA 3C08H 4Z7UE 3JTTB 3IFLH 4PJGF 2O61B 4ZTPL 5F96H 2X44D 4ZO7A 4YPJA 1QSEE 1CLZH 3GM0A 3ROOB 3S35L 3RVTC 4H1LB 2V2XA 3EYUL 4O5LL 1S9KC 5F7UA 2D7OA 3B9KD 3MXWH 5E1HB 3BWUC 4EN3D 3B8SA 3CZFB 3QFJD 4RDQF 2FDBP 4LPUA 1KF9B 2BRRH 2FL5A 1SVZA 4XZUA 4K23L 5A2KH 5I2IA 1YMMD 2F74B 3OR7A 2FNBA 4LAQH 43C9A 1QBBA 4BK5A 3ZL4L 1DVFD 1C5CL 5JUEL 3EZ8A 4RZCA 1FVEA 1QSFB 1UB5A 1QOKA 4L4VA 3P9WB 4F7TB 1I7ZA 1TENA 4OCSL 1GGTA 1CVRA 3L3GA 4CMHB 1YYML 4DJMA 5LCVL 4WU7A 1VFOA 3QRGL 3C5JB 4X0KB 3ILQD 5FO8A 3U9UB 1VGEL 2AEPL 4N5UA 3BP6B 1HXMA 1J8HD 4X5XB 5DR5H 2FX9L 4QXWA 4WCYH 4DUVA 3IDMB 4WIQA 3BO8B 3PWPD 3WIHH 2G60H 1HQRA 3D6GA 2A0LC 1HYSD 1BBDL 1DN0B 1CL7H 3RY4A 2RAMA 3EDKA 1U8JB 2NX5D 1NEZA 4LKCB 1WBYB 4R4NC 2Y6SD 4EUPG 2JCCA 1RJLB 1UWEL 2OX5A 4KDVA 1OSZB 3UMTA 3D2UB 5E6ID 3D39D 2E8YA 1ZT1A 3MZGB 2R2HB 1IC1A 4QHLB 4P49A 5FKAA 1X9QA 3NZ8A 3TBYA 3D87B 1JNNL 4KDTA 3D9AH 3V6ZA 4RMTA 5DJYB 5IB4B 2Y4SA 3JWDC 2H3NA 4QRPA 1FJ1B 4JFFD 1WAAF 3TYFB 3I6LD 4NQVB 3W0WB 2NZ9C 3IU3B 4G6MH 4RX4A 2A9NL 5I8CA 1OP9A 2DLHA 4G7YH 1UKQA 1H5BC 5CHNA 1YEJH 3Q3GB 2YD4A 4YHNB 4Z5RA 4HBQA 2H8PA 3MJ7A 3VRJB 1JJUA 3E8UL 1N3NA 4K9EC 2D2OA 5TH2A 4PJAE 2ZSVB 2FR4A 1IC5L 2EDTA 4JZJB 4NJAL 5GJSL 1OTUC 5TDPB 1OSPL 1SEBB 4UAOB 1OAUH 3MQIA 4PJCE 3TA3A 4WY7H 1KB5A 4G8IA 3RAJL 3TN0D 2NLJB 3GSXB 5HDOA 1MF2L 2XZCL 3MUHL 2HFFA 4Z7WF 4OCXH 5D93C 5MEQA 3FCTB 4C56E 1RMFH 3G04A 4U1LB 3WFHB 4KHTL 5JNYB 4FQ2H 3MV9E 1YQVH 3F58H 5FUOL 4LLMB 1MI5E 2DLFH 4XBEL 5HGBB 3UBXA 1J1XL 3L95B 4N0CC 4Y5YA 4KRPB 5EC1A 2B4CL 2G9HB 2IBBA 1KJMA 1IZJA 1G6RL 1TDQA 3MLWL 4OZ4B 5DURD 1S7QB 3M8OL 2BSSB 3A0OA 4NJ9L 4NKIH 1QR1A 4JLRA 2BK8A 3O9WD 4PRPE 5C7XH 3VXUE 3MOBL 3HI6H 5DD6A 2NY5L 1CFVH 2VDOH 4MYWB 2AV7B 3BP7B 2SEBB 3MODH 3I9GL 4OB5H 2ZG3A 1VESA 1R5IB 2PXYD 3BAEL 4WTZA 4S10A 1X5IA 4M1CD 5EIIA 5T1MA 1PLGL 5EBMB 4M8QA 4Q9CA 1IAII 1V3LA 2NQCA 3F5WA 2BY1A 5HXMA 4HX1B 3GMQB 4LVOC 1J1OH 3P77A 2EIZB 1C7SA 3K46A 2YA0A 2PO6C 4GKSB 3LZFL 4RBPK 1NPUA 3DJ9A 2DBLH 1FGNL 3ELAT 4PYHA 4LSVL 2WANA 4NUJA 2VZTA 5IROC 1AQDA 3QEGL 1K9TA 1Y6MR 2YPVL 1B0GA 3GHEH 3FFCE 1UWGH 3TEUA 1M05A 4WV1B 1ZGLB 5HHXH 2EKJA 4MZ2A 4F3FA 1NC2D 5BVPL 4XNQA 4NP4L 2XRAH 2FX7H 4L8CA 5I30H 1JWUB 1RUKL 2X40A 5DJ2A 2QSCH 3QXDB 5L8LB 2WW8A 4MQ7A 3B3IA 3RGVD 4OLWL 2YBRA 1TVBB 4MS8D 4DEPC 2K7PA 1RZIB 5JW4M 3EHBD 1N7MH 3FT3B 1BAFL 1FLTX 2FWOA 2HJFB 3CIQA 1FLRL 1UJ3A 2VLME 4TVPL 2PETA 1A9EB 1M7XA 1QD0A 1WIUA 1HK6A 1Y18B 5F3BB 4XHQA 2Z8WC 2BOBB 3U6RA 3VXQB 2DF3A 4HCRL 4OI8A 1VEPA 1ZOXA 3BEVB 4V1DB 1PGRB 1UVQB 4I2XA 3QIBD 1OPGH 2JKXA 5JR1H 3DV4A 1D9KC 3HC3L 1BIIB 2YMXH 4XNUL 4XPTH 4HV8B 1I7UB 1S9XB 2J88H 3AB0C 3DRQB 3DIFA 2XFXA 4K7FB 2A73B 5DMKA 1FFOA 4FXKB 4LDEB 4NBXB 5L6YL 4E0RB 3TH3T 4FQHB 1C08A 5CD3B 3FB7B 3FQRA 4KUZL 3MNVA 1Q1JL 5JOPD 4NHUA 3S37L 4LLYA 5IESL 3MCLL 4I77L 4HC1A 4JPWH 5GGQH 2CJUL 3QIUB 2CLZA 5HPOA 2G2RA 4Q0XL 3VXPB 5FECB 5GISL 1JNHA 5JDSB 3V5DB 3CXHJ 3GI9H 3O45B 4E5XB 2OLDA 2XA3A 4P9MH 4YFEA 3GJFA 1V7ML 4DCQA 1KJ2L 5AYQA 2BFVH 2DYPA 1EHLH 4LF3B 3VXTB 3QUKA 3ZT5A 3HLAA 3NFSL 43CAA 3X12A 4AEHH 4JY5H 2IANA 3VXRB 3KS0H 1HZHL 4F57L 2ICES 4XMKL 2XKNA 2KBGA 3NCJH 1IGIH 3WN5B 3RVVC 4LSSH 1BFOB 2VDNL 4LSQH 3C60A 3S36H 4CNIA 2CXKA 2R1WB 2PTTA 2O5ZH 1G9NC 3QI9B 1R3JA 4JPKL 2H32H 1HNGA 2MHAA 3QWRA 1P4IL 4OSUH 5IVZA 2HVJB 4ORZC 5EO1A 1QLRB 2EDYA 4O9HL 1Q0YH 5D1ZA 4RBPH 3KPOA 3DV6A 5DRXB 1CICA 3CFCH 3T3PF 3QUZC 4XNZC 3SDCC 4GKZB 3OGOE 5F93C 5HI5D 4R4BA 3MZTA 5H35B 3SDYL 1KCUL 5CZVH 4A6YB 1ZE3C 2IJ0C 3H3PH 4LCCB 1HHHA 5IR1B 4HUXB 4LSDA 4LLWB 1JTOA 4JKPH 2P4AB 2IEPA 3SE3C 3O2DA 4AYFA 3HAEG 3WJJC 1NAKH 1T0MA 1QLEL 3X3FH 4R7NB 2Y25A 5GRUL 5E7BA 1KB9K 4K3DL 3GHBL 3Q1SL 4K3HA 4P23C 3GNML 5AYUH 5C08A 1UXSB 4JB9L 1ZVSA 1RK0A 3MMEA 4UT7H 5GSVA 4HIXL 1LEIA 1NLBL 5SWZE 4Y16D 3VFMB 2DKUA 2ESVE 4B50A 1GAFH 1T2JA 4LARL 2VOTA 5TQ0L 1FNGB 5I15L 1AI1L 4MD0B 3HMWL 4UTAH 3C09C 4H88L 2YXFA 1DL7L 3R1GL 4KAQL 4NQSB 4Z7UF 3F6IA 4LEXH 1F4YL 2IFFL 4FFZL 3PL6D 2BNQD 3QULA 4EI6B 3ULUF 2ICCA 3MV8B 4JO1H 3ME0A 3HRZB 1BJMA 1T1YA 1RK1B 2PW2B 4PJDA 5EO9B 3V6FB 2JJUA 3U0PB 5BS0B 3C87A 2W1NA 4QHMB 1JRHH 3TH2T 1IC4H 2I9TB 2GFBB 1Q9KB 1VFBA 5DJ0A 1BP3B 1W72H 1I7TB 1A1MA 3O41A 4MZ3A 5DLMH 5FIEA 1ZLVK 4FFWD 4P2OD 1KPRA 4HKXB 4X7SH 2ZCHH 5IVOA 4YBLC 4GG8A 1MPAL 4JRXA 1QG3A 3BQUD 1T80A 3CC5B 5DK0A 3KHQA 3MRBB 4PJEB 4GKNB 5E00A 1A0QH 3HZMA 1N6QH 4HG4J 1XR9A 5F72S 2VLJB 5FYKU 1LO5B 2H9GA 2V2TB 3VXMD 1JRHI 2ICWI 4Q6IB 2Q6WA 3B9KA 3D3VE 4EN3A 3QFJA 3MC0A 1HIMH 1IVLA 3ULUL 3T4YB 3IFNH 4RCAA 1QVOB 2NYYD 4GMSL 5DI8A 1YMMA 2FJHA 1QSVA 4K2UH 4J3SA 1SYSA 3SPVA 3OXSB 5CJXC 2FO1A 1DVFA 4HGWA 3DGCR 4PS4L 1MHPH 4OF3A 1U8LA 2GTZB 4R7DA 1P6AB 3FZUC 3G6DL 4NM8H 5ALBH 1HN1A 5B4MD 1CXHA 1ZV5A 4FQCL 3DGGB 4TYUA 3N50A 5KBNC 3VD9A 3O11B 1S7UA 1NL0H 3BWAA 3EDFA 4KRLB 4PJFB 3MGTB 4M7JL 1J8HA 2Y5TB 5IQ9B 4HWBL 1EJOL 3RWCA 1KC5H 5HYFA 4WU5B 1B3JA 1BF8A 4JM4H 4TTDD 1NGQH 3PWPA 3QPXL 2HTKC 4HAFA 1JHLH 4GLRI 2BJML 3SGJC 2N7AA 2MFNA 3RIFF 3TESA 3QUYB 2P47B 2D7TH 4OGYL 4F58L 2KH2B 4EQ2A 1BLNA 4OCLC 5E6IA 3D39A 1JZ8A 2EIDA 1T20A 1SY6L 1QNZL 2BOCA 2GK0A 1T03H 3QUXD 1IEBB 4PJAF 5CZXD 5GJTL 2F53B 2JB6A 3EO0B 5T3XD 3KPSD 3GB7A 5C0BD 1AFVL 4JFFA 4PJCF 4U1IB 2D7QA 4J8RB 4X4YB 3HE6D 2EXWD 1TCMA 5ITFB 3WKML 2M2DA 3CFEB 4HWEH 1DE4A 4GG6B 3DVNA 6FABH 3QZWB 5D1XD 1J86A 3TPUB 3WFDH 5AAMA 2Z8VC 2WAHA 5KJRH 4XCFL 1RUQL 3IVKA 4QTIL 3EYQC 4KTDH 4KVNH 1F3JA 3P4NB 4IS6B 4E41E 1BQLL 2DQUH 3PP4L 3RUGF 5EU7E 3LH2L 5BRZB 4HIIB 4PJ5D 3T3ME 3VJ6B 4K8RH 5C0DB 1BOYA 1WSST 4Z0BH 1JWMA 3L3JB 4GAYB 3L3OB 4TSCL 1F8TL 2J1KA 3P11L 1NAMH 4H5SB 1EA9C 1EIBA 4ZDHA 1IEAA 2B0SH 3TN0A 2DI8A 2J6EA 4N0YH 4P5KB 7CGTA 3CDFA 1V7NH 4DQOL 3MRJB 5DUPH 1P5VA 4YFLI 2Z4QB 1ZLVH 3H7LA 1F02I 4NO3A 3QNXB 2OL3L 2C26A 2X41A 4NN6B 5HI4C 2AJUL 3EKCA 1ETZB 5A16A 3L5XL 1Q38A 4Z95L 2DQIH 1L9MA 1MCOL 2P5WE 4Q58C 5I18H 2ZOKA 2IPKA 1UH3A 1D5IH 1BECA 3IDJA 2WP3O 3RWDA 1XF5A 2HN7A 1SBSH 4PJHA 2H32B 1U8NB 3EJJX 4MXWL 3QUMA 3TBWB 3D48R 3GIZH 4NNXB 3JWDL 3O9WA 1BREA 3P4LA 1LD9B 5F7KC 4XCNB 1UA6H 1CGWA 4WHYH 5L2JB 5FUZH 5GS2H 1GPOL 2DQFA 3P40A 3RWHB 3ULVC 2PXYA 5DZOA 1KELH 2X4RA 5JMRA 3F62A 4WDIA 5ACZA 3EUUA 1S9YB 3EGSB 4AT6A 4JHWH 3ZYOA 1HEZB 2AAVA 5GXBB 3Q2CA 1EERB 5CD5D 3Q5YA 4ERSH 1MLBB 3DURA 5T5FL 2X4NB 3FOMB 5LGJA 1DBAL 3HAEA 1T22B 1KT2B 2I07A 1W0VB 3KNBB 5IMMB 5EN2B 5I73C 5DMJB 3LCYA 4ZS6D 1K5NB 1I1YB 1PY4A 2DS4A 3VFUA 4ZYKB 1GIGH 4GQPH 4D3CL 2R29H 3NPSC 4PJXA 3GK8H 3VFNA 1NC2A 4GAGH 3QIWC 3V5HB 3NCEB 2V7HB 1PX3A 4UIMA 5DZLA 4ZUUA 1FDLL 1UJTA 4FMKA 3CLEL 3BW9B 5E08H 3TT3L 5DVKA 3VFTB 3VW3L 2R4SH 3P30L 1WBZB 2AXFA 2JK5B 3KLSA 4Y4FC 2ATPB 5L9DL 1EUTA 4JDZA 1H3PL 3MACH 2YD9A 3D0LA 4FN0A 4YHZL 3W11D 3RGVA 3VGBA 3QEQD 2VQ1A 4KK5D 3NCFB 3C08L 3CX5J 5CMAA 5EU6B 5F96L 5L88H 5ITBH 1CLZL 3G9AB 2DICA 1IM9B 1YEEL 5KSBE 4KJPD 1W72B 4JO2H 3UYPA 1ND0B 3L7FA 4NRZA 4PV8B 5DJ8B 1MFNA 1AR2A 1CLOL 4MJ6A 5K93A 4JQVC 3UTTD 4JANA 1OLLA 5ECJE 1VCAA 3PWNA 2CDGA 3QIBA 4KFZC 4LAQL 1CXKA 4LCUB 8FABB 4Y4KB 3OHXA 1OOAA 3ARPA 5L2KB 1JPSH 5FGBC 2UZYB 3RZCC 4OIAA 1IT9L 4TULL 1T1ZB 2VQUA 4MNQD 3Q5TA 4BSWB 3RDTD 3MGOB 4NZRH 1HQ4A 2FSEA 1T2XA 5M7QA 1FL6A 3SKNA 3MCG1 5F70A 3QRFM 4Y5XA 1KTLA 4P46C 4M7LL 4UILH 5JIIA 3K4AA 3QQNA 2QHRL 3GSWA 3WIHL 2G60L 4MXQD 2P46B 4JFEE 1KOAA 4ZAKC 4PP2B 2EEAA 3CSPA 3H9HA 4AH2B 1I3VA 2HRLA 5DJAB 1DUZB 1WTGT 2ZUYA 3ARFC 1WCBA 4Z9KB 1BJ1J 4NIKB 4XMPH 5AZ2L 3BYTA 5D1QB 1JHKH 1SYVA 5E4EB 5FKPB 3LN5A 5T1LD 4LDLB 4U3HA 3KLHD 4HUVA 4QY8B 2CK0H 3RKPA 2DIBA 3D9AL 4ZPVB 4K71C 1WEJL 4EEEA 1U3ZA 2VLRB 3BRGC 1TMCB 4JFDB 1GRWA 4NN5B 1JL8A 3O6FD 1ULVA 3O8XB 4KJWC 1AGFB 4PJIB 4ONHB 5C0GB 1S7XA 2V7NB 3RVXC 3L6FA 4AM0A 4KK9C 1EMTH 4U31A 4G7YL 4N5EC 1Q72H 1YEJL 1YPZA 2I25N 4I0PA 4PRBA 1FL3A 1P7KA 3BZEA 4OGXL 5EO0A 5DS8A 5E5RB 1E4XI 1ZHKA 2HT2D 5E2UL 3QJHA 1J05A 5I8OH 1G7HA 2V2XB 1FQ9C 2PKDA 4DN3H 1MIEH 2FL5B 2CK2A 5FYJU 4OUUB 3RNQB 1OAUL 2KKQA 4XZUB 4WJ5B 4WY7L 1EZVY 3U30C 7FABH 5I2IB 3OR7B 3TVMD 43C9B 3MO1A 1WIOA 5HI3D 2E7LC 4OCXL 2YK1L 4ZUWB 2VO5A 4RZCB 3MR9A 1UB5B 4L4VB 2Z0BA 1CD8A 1I8IA 1RMFL 4WFEE 4Y16A 1WT5C 5D7KD 1IBGH 5FGSA 1K8IB 3L3GB 4FQ2L 1KYOJ 3F58L 4WU7B 1M7DB 1NAMB 4XP4H 2VDQH 5LWYH 2DLFL 1MHEA 2ILLA 5FO8B 1P2CA 2YEZA 3OJVC 5I1JH 1S5HA 1FO0H 1HYRC 2VC2H 4BSVA 5DMYA 4M7ZB 1C16A 3C2AL 1R5WB 3PL6A 5DYOA 1HHJA 2BNQA 5C7XL 1E28A 2X10A 4JY6A 3HI6L 1CFVL 2HWZH 1HQRB 1DQML 3MODL 3QDMB 4OB5L 1RHFA 1XGQA 4XVUD 1BM3L 3QQ4A 5T1KD 1NEZB 2R0LH 4ODXA 4PJ8D 2A9MH 4PG9B 2Z91B 5GRZA 1U8PA 2A6IA 5IVXA 2EECA 5EDXA 4ZFGH 2CLRA 1J1OL 1ZT1B 4EUPH 3G08B 4OFKA 1T5XA 4P2OA 4HPOH 5FKAB 2DBLL 4EOWH 4XVTH 1MCPH 3BQUA 3V6ZB 3VRLE 1BWWA 2EDQA 4EDWH 4YDKH 2H3NB 3PJSA 1NANI 4QRPB 3GHEL 1UWGL 2O26U 3VXMA 1U3HB 3SO3B 1L6ZA 5E8EA 4D9LL 3FO9A 2XRAL 5J9PA 2FX7L 5IB2A 2H2SC 5CHNB 3STBA 5I30L 4JFOA 4Z5RB 5D7LD 1KJVB 5DDHA 2QSCL 2H8PB 2DB8A 1CYGA 1N3NB 4CVZA 3FB5A 1TITA 5I66A 5I17A 5TH2B 3H0TA 1WJ3A 3PDGA 1N7ML 3GSNH 3PDDA 2APBA 1ZHLB 4XB7A 1U8QA 4DGIH 3U0WH 3SDXE 4M6MH 4EXPX 3TA3B 1KB5B 4G8IB 5DQ9A 1IQWL 3EIFA 1KLGB 2HFFB 3UAJD 2AJ3A 2BMKA 3DYPA 2ZOLA 4Z7QF 1OPGL 1OWWA 4JFXA 4YDJB 3QQ3A 1PEZA 5IF0A 4RISL 1JZ2A 2XWBA 1MFEH 1G1YA 2CRYA 2YMXL 1E6OH 3IAQA 4Q9RH 4KUCF 2LVCA 4XPTL 5GGRA 3UBXB 2F54D 4Y5YB 2J88L 4CMHC 1UQSB 4YNYB 5DMIH 3ZHDA 3U82B 1UH2A 5D96B 3UDWC 3BIAX 1NBVH 3T3MF 2HT4C 3QUXA 3VMNA 3KJ6H 3LPFA 1A1OA 2J3SA 4DK6A 3GRWA 5DD6B 1ZA3B 1XR8A 3JWOC 1QRND 4N0RA 3KPSA 4U1GB 2R8SH 5C0BA 4U6XA 1MFDH 3KYNA 5C3LD 4JPWL 5GGQL 4X98A 3HMXA 5EIIB 2Q8BH 3HE6A 3VWJD 3FMGH 4X6CE 1YEIH 2WWMD 4HMDA 1K4DA 2B2XH 2GAZB 5D1XA 3WEXA 1NFDE 3GI9L 4NPYA 1EBPA 1WFTA 1T6VN 5JW4Q 4U1KA 4P9ML 4EKXA 1VDGA 1YYLH 4G42A 3DMMD 2BFVL 1EHLL 2ADFL 4NUJB 4B7IA 2Y5EA 3A6OA 3I6KA 3R0MA 5B39B 1B0GB 4PJ5A 1LEGA 2QTEA 4AEHL 4JY5L 1YNTB 4LRIA 1DN2A 2XG4A 3ILPA 2IPUG 4S1DD 4K7PX 3K8LA 3FQWA 3KPNA 4LSSL 4MSWB 3I6GB 3TNNA 5JA8B 3OPZH 4LSQL 2Q8AH 1LP9E 5J56B 4XNQB 1NEUA 5DSCA 2N4IA 2XZAH 4KQ4H 5D70H 2E6PA 4ZTOH 3FT4A 2QQNL 4KI5C 4L3CA 2EYRA 4K7PH 5IK3A 2ZJSH 3MRQA 1Q0YL 4MQ7B 1FZJA 4XH2A 4ESKA 3CFCL 2VR9A 2YBRB 5BJTA 4M43H 5EOCL 5TDNA 5ANMA 4BFGA 1JCKA 3DETC 1RVFL 2FWOB 5TGBA 3EYSH 3CFDA 5CZVL 3OG4B 4DZBA 5I0DA 1AO7E 2IQAA 3IDGA 4JKPL 4YUEH 3U6RB 3VA6A 4YHYC 1GHFH 1NAKL 9CGTA 3O4LD 4I2XB 4UAOC 1U58A 5AYUL 2FRGP 2WQ8A 3DV4B 4JRWA 5T5NG 1IKNA 3F7RA 3TJHC 3T0EE 3VRIA 4NFDA 1VB9A 3CU1A 4LNRB 1FC2D 4D2NA 1BBJA 1YN6B 4UTAL 2XFXB 5DMKB 5H94A 3LD8B 3QSKB 5T1DH 5EOQL 5F7DA 3QDGD 5JLZA 1Q9LA 4F9LC 1C08B 1J0JA 4L8DA 1FNFA 3FQRB 1NMCB 3JV0A 1XZ0B 4KKCD 2W9DH 4FP8H 4LLYB 5KSBF 4XRCA 1T66D 4JO1L 4Y2DD 4WW1B 4U1JA 4KI5E 2QR0A 4X8XA 2ZPKH 1S5IL 2G2RB 4JDTH 4A2MA 5E94A 3MREA 5JXAH 5E9DD 1JNHB 1JRHL 3PHSA 5GHWH 1C7TA 2DM7A 4J1UA 3ZKMD 5FA4A 1NBZA 4FQXD 1KCRL 3GJFB 2PUQT 3ARDD 5E95B 5DLML 2DYPB 4FXGB 3L5HA 4X7SL 4WI2A 2ZCHL 4QRRD 1LHZA 3QUKB 1RZ8B 3QEQA 2CR3A 4G8GE 43CAB 3X12B 4QWWD 5C6TH 4F8QA 2IANB 5EFIA 4MA1C 5J3HC 4KZEH 1A0QL 1R3LA 5HYJD 1JYVA 1N6QL 4NQUA 2CO7B 4EUPB 3C60B 3FQXA 4J3XA 3WS6C 2L4OA 4WV1C 2VL5A 2PTTB 3EYOB 4JKMA 2IAMD 1HIML 4PBWD 2C4XA 2MHAB 2AV1A 5E8NA 1QSZA 1WF5A 5IVZB 3UTTA 4L4JA 2IPTH 3SGEI 5EO1B 5I8KL 2DOCA 4WWID 2K9UA 3KPOB 4H0IA 2MCPH 3DV6B 1QPPA 1MHPL 3OKKA 4G80A 4HJJH 5MP6H 5I1IH 3SKUD 1DJSA 4MNQA 4NM8L 4OIBA 1KEMH 3RDTA 5CFHA 1HHHB 2A6JB 1B4RA 1HHIB 4MNHA 5FYJH 3WDHA 1LO0L 4NQDB 1CE1H 3H42L 1T0NA 1T0MB 3NACH 4UDTA 1UCTA 4UV7H 1ZWIA 3BGMA 5C08B 1KC5L 4RDQG 1RK0B 5GSVB 4JM4L 4P59H 4H26B 3GSNB 2ATKB 3IXAA 4TVPD 4Y4HC 3GMPB 4YFLF 4XHJD 4OI7A 2X4QB 3QEHA 1HCFX 4NRXA 1SJVA 3STZA 5CLWA 2D7TL 2NR6D 4XCYB 2WV3A 1A7BA 4W6XB 1P1ZB 4PR5A 4J6RL 5IHZA 5T1LA 8CGTA 4XNMA 1T03L 3ZO0A 3TZVD 5FYLE 5IB5A 4IOFC 3BVNA 3I2CH 4ETQA 2FJFA 4DKEH 1T1YB 4PJDB 3G5YA 4U3CA 4ZSOA 4ORGA 1NDGA 3O6FA 4WWKD 1TJGH 1VFBB 2C7UA 2J8UA 2XG5A 4HWEL 3T0VA 6FABL 3O41B 5I9QB 3WFDL 4KMTH 5CSZB 5KJRL 3HFML 4X9HA 4KROB 2ICEA 4GG8B 1P4BH 1EEYB 1A7PH 1TQCC 4URTB 4JRXB 2DQUL 2EICA 2VDKL 1BVKA 1NCAH 5E00B 3HZMB 5GGSA 2EDFA 2HG5A 2H9GB 5FCSH 4LHUD 3VGEA 4V1DE 3B9KB 2BHZA 4EN3B 1MJUH 3BKCH 1NAML 2VL4A 4OF8A 1YNKH 4RGOH 4PG2A 1VA9A 1RIVH 3WN5C 4YLQT 4AEIL 2PNDA 2B0SL 2ZKHH 3DVFA 3LKNB 5DI8B 4O4YH 1YMMB 4N0YL 3TVMA 2PYFA 1F13A 1SYSB 1DVFB 4XPHH 2MOVA 3BH9A 5IT2H 3QI9C 1SM3H 2XICA 1U8LB 4PB0L 3EDJA 4R7DB 5CSGA 2QQKL 3V7AG 3CH1A 2YPLE 2DQIL 3I75A 3BKYH 1D5IL 3EO1B 4DFHA 4U2ZA 1SBSL 3VRLF 3BWAB 3IS1X 3B2UD 3ZSSA 4LCCC 4NKDB 3GIZL 1J8HB 4HK3J 1ZTXH 1FVCB 5IHUH 1UA6L 3CVHH 3PWPB 5FUZL 4I4WB 4NBYB 3T09A 3HHRB 1KELL 5T1KA 5CBAA 4OD3L 4TRPH 5DEGA 2EH7H 4JHWL 1G1CA 2VERN 4PJ8A 1IAOA 4QF1A 2D9CA 1EEZB 4ERSL 4YR6A 5E6IB 3D39B 5IW1A 1T20B 4PP1C 4TOYH 2CDFA 1G7IA 2BOCB 2GK0B 1MQ8A 3UTZA 4YX2L 3M17A 5E56A 3QNZA 4MQXD 2JB6B 4QOKB 1FZOB 1X4ZA 1ZHBA 5J89A 4M3KB 4HK0A 2AXJA 3SDXF 4JFFB 4DKAA 4YBQD 4KJQD 1LK2A 3QDHA 5J8OA 3GK8L 4M7KL 1BZ9A 4GAGL 4ISVA 4U1NA 3NAAL 1DE4B 1E4KC 4XNXH 5E08L 4Z76A 2V2WA 2VAJA 2R4SL 5EA0H 5BQ7A 2EDWA 5D7LA 1F3JB 3O0RL 3MACL 4WENB 4IBLT 2NXYD 3EJYC 2YSSB 4LCWB 1CR9H 2P24A 4PGDA 3UC0H 3SDDD 5J6HA 2E5EA 5D2NE 5L88L 3DXAE 1JWMB 1Z0NA 3L3HA 4HQQL 1DEDA 1EAPB 4JO2L 5L7XH 3E2HC 4ZDHB 3OGCA 1LDSA 5FF6A 1IEAB 3NCYP 2P5EE 4U6HB 4YGVA 3TN0B 4Q6IC 1HH6B 3D0VA 1J1PH 4P2RD 4YHMH 2BZDA 2XWJA 4NO3B 4X6CF 1Z6JT 4GW5A 1JPSL 4RAVA 1NFDF 4N90D 4YWGH 5A16B 4HFUH 5IKCA 3DVIA 1F11A 3VG9B 2ZOKB 2IPKB 4Y89A 3ULUD 1IFHH 2F54A 3IDJB 3RWDB 4YJZL 1XF5B 2HN7B 4Z7NE 1TTGA 3BDBA 3QUMB 4DGYH 1OM3L 3TIEA 2ZUUA 2H2PC 2A6DA 3UTOA 4FQQB 4LOUC 2I9LA 5JORA 4YDVA 2Q86B 4RAUA 3QHFL 1QRNA 4UILL 2DQFB 3QQ9D 1LP9F 2X4RB 3JSSA 5GRVK 3S6CA 3WUWA 5ACZB 4AT6B 4IRSB 3VWJA 5D72H 5CKGA 1QLFA 3IJHB 5DJXA 5TDOB 1CVSC 3DURB 3SE4A 1J87A 3VDCA 4NO2A 4F8TA 4XMPL 1QUNA 3QUYC 5LGJB 3HAEB 3IF1B 3DMMA 4OM0H 4BZYA 2CK0L 1AQKH 4OLUH 5I1GH 3ZTJH 4GT7A 1SJHB 2CRZA 3G5XA 3IFOA 25C8H 4PFEA 5E6YA 3VFUB 2GT9A 2CRMA 1E4XL 1SBBA 4PJXB 4G5ZH 4R97C 3VFNB 1NC2B 3OKOA 1QP1A 3W0WD 4UIMB 5DRNB 4ZUUB 3Q6GH 1GCFA 5DO2D 5DT1L 3GJEA 5MENE 2VLKE 4M5ZL 2VIRA 5IW6A 4WUUE 1T1WA 4NWTH 2XI9A 1EMTL 4JDZB 3D0LB 4MHHI 1P7HL 1Q72L 1TPXB 5DF0A 3IDYB 5CGYD 1C1EH 5CMAB 5AAWA 1K8DA 1Y6NR 1XAUA 3OKLA 1GYAA 5FDWB 4P9HC 5FM8A 1I3GH 4NZTH 5F88A 5I1CH 1X44A 3H7BA 1KG0B 4KK6C 5I8OL 4FTVE 3GMLA 4CN1A 1I8MA 1JGLH 4NRZB 4DN3L 3AMLA 3H9SD 2EIEA 1QHPA 1AH1A 1MIEL 4ZG1A 4KI5F 5C6PB 1A3LH 4GRLD 2KPNA 5SWQB 4MJ6B 3AAZB 4JANB 3DUUB 4WHCA 3O4LA 2CDGB 3QIBB 2J5LB 4DUXA 3OHXB 3GRWH 1II4E 5FUCE 1VEOA 2CIIA 1IBGL 5GZOC 4RQQA 5GS0D 1FYHB 2XPGA 1GC1C 2LV4A 1IZKA 1RZGB 4XP4L 2VDQL 5LWYL 2FSEB 1Q94A 2VH5H 4KRPD 1FL6B 3SKNB 3OKEA 3KS0J 3QDGA 4Y5XB 3QFDA 5I1JL 3LEYH 1X3DA 1FO0L 1KTLB 3ZTNL 2GQHA 2VC2L 4XC3H 4FOMA 3DHMA 1X6LA 5T33L 3KLAA 1CQYA 4Y2DA 1IAMA 2WNGA 3GSWB 2HWZL 4C56D 5HDQL 4BEL