2I9LB

Structure of fab 7d11 from a neutralizing antibody against the poxvirus l1 protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGAELAKPGASVKMSCKASGYTFTRYWMHWVKQRPGQGLEWIGYINPSTGYTEYNQKFKDKATLTADKSSSTVYMQLSSLTSEDSAVYYCARTTVDGYDFAYWGQGTLVTVSAAKTTAPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords Antibody 7D11 light chain
publication title Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein
pubmed doi rcsb
source organism Vaccinia virus
total genus 47
structure length 219
sequence length 219
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2006-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i9lB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i9lB02
5ACLA 3U83A 2BOCB 1INDL 1G6RL 3DV6B 4G6FD 1NJ9B 1J86A 3JV4A 5DD5L 1NGPL 1QLEH 1WICA 8FABB 3ZSSA 3CGTA 1YEEH 4KGLA 3GHBL 3TO2A 4I0PC 5IHBA 5EOQL 3FCTB 1IT9H 4OZ4A 4U33A 3BPCA 3O8XC 4HUUB 4LSVH 5E8DL 5F1OB 1AGFA 4YDIL 4OZGA 4YX2L 2F5BL 4ODHL 5DFWH 4U6VL 1OTUC 1QO3B 1T04B 4Q6IC 1S7RB 4HPOH 1DBJH 1RUAH 2VN7A 2P45B 3EFFA 4HF5H 4KTYA 1R24A 2C4XA 1CF8H 5DEZA 3VFMB 4HXBL 2CK0H 3HC4H 4AQ1B 2NXZD 1C5DA 3WDHA 3ZT7A 3R4DA 3EOAA 1W8NA 2C3VA 3W39B 3T77A 4LHUD 1EAPA 3TBSB 5KSVB 1FJ1B 3KAAA 4U1LA 3SHSA 1FL6B 1KYOJ 1DEEA 3TM6A 4LLWA 1KBGH 2C3WA 2ZCHL 3BGMA 4N0UE 4PG2C 5E1HB 2FBJL 1EBAA 2G75B 2CGRL 3V0AC 1BGXL 5E8EB 1G7JA 5T1LB 5AG8A 1KLGB 2XKNB 3N9GH 3PGCB 5HHMD 1MRDL 1UJTA 5EO0B 1B0RA 3QQ9C 4HULB 2IAMD 4LL9A 4XNZB 4FQJL 1I7RA 4GKSB 2VISA 4R6UA 4M7LH 3FRPA 1R3HB 1RAMA 5HHQA 2NY3D 2VJXA 3P30L 4M93B 2OYPA 3LDBB 2I60H 2HN7A 2KQNA 2OM5A 4GFTB 3HKFA 1G6VK 2BVTA 5BV7L 4A2MA 4ORGA 1VKXA 3QULB 2NPLX 3GRWL 1NPUA 4ZDHB 1LEGA 1RJZA 3D2UB 4PJIB 4O2FB 5EA0L 1D5ZA 4KJPD 1LO2L 3PV6A 2IJ0C 1XEDA 4APQC 5J1AA 3TO2B 4S1DD 4MAUL 4NGHL 5C07B 4KKLC 4WI6A 2NXYC 4O2EB 1KN4L 2P5EB 2I9TB 3P9MB 5J56B 2DTMH 1YEGH 1P4BL 43CAB 3B4NA 1E6JH 1A5FH 4GQ9H 4L29A 3GSNL 5T3XH 2B0SL 3K2MC 1A2YA 3KJ6L 3VWJA 15C8H 1NDGB 1HH6B 1YEHL 3NBNA 3HE6B 3MOBL 3ZZ1A 5KS9A 1JZ2A 3QH3A 3VJ6A 5KVFH 1GGCH 2EH7H 1MRCH 3EO0B 4PRPE 1R3KA 2Q1EA 2WIIB 2I07B 3TIEA 3S36X 4EXPX 4KHXL 4TQEH 2ATPB 4M48L 4XNUL 3HUJE 2C3VB 1J9CT 3O4LB 5HY9B 3AMLA 4XVUC 3W2DH 1IE5A 3IRPX 3VA6A 4J8RB 4LLVB 1XR9A 5C92A 2C3XA 4G9FE 4OFVA 2NNAB 5JXAL 5DEFA 4NCC2 1YMME 3C2AL 4I3RH 3WJJC 4WDIB 4RAUB 1G7JB 4PJIF 3NA9H 1MVUA 1AC0A 4CGTA 1A8JH 5C0BA 1A4JB 3D69B 1JNLH 2Z4QB 3X3FH 3SQOH 4GRMB 5FOBB 4OZHB 5T1LD 1OAXL 1FLTX 3REWB 1LD9A 2V5SA 4MB5A 5HYIA 4OZGF 1C08B 2JJWA 1J8KA 1W72H 3CFEB 4LSRL 3MRBA 1Q38A 1A7PL 3RFZC 2FBOJ 3Q48A 2AGJL 1CD1B 5DRNA 1E4JA 3INUL 4WFGE 1IAKA 2FEEL 3TA3A 3K3QA 4KI5E 1JVKA 4D0DA 4NUGH 2HKFL 1E4WL 3N1PC 2R2BA 5CWSA 3D2UD 5SX5H 1FNEB 1OTTC 3BJLA 1LE5B 2A74A 1HWGB 4RQQA 4WWKB 4WTXA 2X70B 2GK0A 3RHWK 5C07D 1K5NB 3QDME 4X5XA 3T8XB 3VXSE 2P5ED 3Q1SH 1MCKA 4GW5B 2WBKA 2BVQA 3PP4H 1NAMA 3REVB 5I1AB 1BAFH 3QCVL 1IGFL 5F9DC 2JJUA 4LPVA 4WU7B 5C08A 5ANME 2H1PH 4ZO9A 3RVVD 5DHYA 4Z5RA 1E4XH 2R0WL 1OAYH 3HE6D 5CGYD 4ODVL 4X7CC 5HGGS 5HHPB 4L8BA 3AU1B 1HN1A 1EJOH 4ZFOL 3QO1A 4K9EL 1BOGB 1YEIL 1JHLL 1NSNL 5E24E 5E08L 4LRIC 1ACYL 3GI8H 3MRJA 4KHTL 4Y5YA 4F3FB 5EOTB 5J13B 3SPVB 2LAAA 1FRGH 1M1SA 2HKHL 4A6YH 2DMBA 1A02N 5FO8B 4QGYA 4U7SA 3VDBA 2DL2A 3O4LD 5J12C 3P9LB 4JHAH 1MCWM 3RJDA 4ZS6D 2X4OA 4ZUWB 4HKZA 5HI5C 1BWWA 4WY7H 1QP1A 2BJML 3OF6A 2CXGA 3HNSH 5GPRA 1NCBH 1RUKL 1F90H 4Y4KB 5JNYA 4LDEB 4HIIA 4ODTL 3ZE2E 1H3TA 3BQUB 3QDGE 4NT6A 4HS3B 1K4CB 4HKBB 3TNNB 4CN1A 1NEZA 1DVFB 4PJAA 1TJHL 1HXYB 3QEUA 4QRSA 5IIEA 1HZHH 4Y16B 1DZBA 2KKQA 4HDIA 3RWJB 3WNOA 4QY8A 1CLYL 3LEYH 3U30B 1KEGL 2D7MA 4RA3A 3WFBL 4RNRA 5DK2A 5B38G 3DYPA 1FL3B 3WIIH 5KS9F 3OQ3B 1WT5C 1CTNA 2VDOL 1TQBC 4J1UA 1Q72L 1P7HL 1LILA 5IMKA 1NCAH 4WI9A 2CUMA 2ZOLB 1N7MH 5CZVL 3U48A 2ICWI 1PEZA 3IAPA 3MLXL 2J8UA 5F21B 4OV5B 4YH6A 4FQCL 2GQHA 1D6EA 5T5FL 3PF2A 4QLRA 3ZDXF 3LQZB 4U3HA 3TJEH 1GH7A 4ONGH 1JTPA 4BFIA 2A74B 2FCBA 3G08A 3LS5L 4BSWB 4TUJA 4IS6A 5BV7C 1UWGH 5D7SH 3BKYH 2EEAA 3WFEH 4JG0L 4QNPF 3D85A 1BQHA 2UYLA 3L3GA 3B5GA 3NVQA 2BVQB 3BFOA 4H25A 3GFUA 1QFWI 3HRPA 1AH1A 2W0FB 5IB2B 1TZIB 3ZO0A 5CGMA 5C0GB 5I0DA 3HAEA 3ZKQD 4WWKD 3T09A 4MJ6A 2QR0B 1KJ2H 3AROA 4FFWC 3WFDL 1NANI 2R4RH 3MFFA 3LHPL 2YN3A 4OLUH 4X4MA 5DDHA 2EYSA 2C1OB 4P3DB 4E42A 3L3DA 3ULVF 1M6OB 2BK8A 3QUZB 5DQDH 4QRQA 5SWQA 3AGVA 1MFBL 1JK8B 3CXHJ 3STZA 4QHUB 4YZFF 3G5VA 5D6DA 3LIZL 1XGUA 2CLVB 1C12A 4KMLB 3HNTL 1LEIA 3F7YB 3IFLH 2H2PD 3KPQB 1IGMH 1IARB 2VLJE 2VKXA 2OR9H 1F4YL 1MLCB 2GSGA 1ZA3A 43C9B 3NFPB 1C8PA 2GK2A 1I9IH 2H32B 3VFWA 4R4BA 4FFZH 2IFFL 4S1SL 3FT4A 2YPLE 1BZ7B 4IMKA 2NX5E 4OF7A 2XNAA 4Z7VA 4Y4KD 4ERSL 3B6SA 4S0TD 1AQKL 3U4EB 3MROA 3BQUD 1AGDA 5FK9A 5E7BA 1DVFD 2MPAL 2CLRA 4OIIL 3V7AG 4U49A 3VFVB 3ULVD 4Y16D 2Y36H 5FHAL 1HNGA 4X5WA 3O2WH 1HCVA 5I1EL 2VOTA 4JANA 2QLVB 1YEDB 3NFNA 2QBWA 4PG9B 4V1DE 1CFVH 1ZE3C 5GRYA 3RVTC 3U0WH 1W0WB 5IESH 2XY1A 1OP3H 3O3AB 3FO1B 4HUVB 1Z3GH 2AJ3A 2W9DH 3NCYS 1BMGA 4ODWB 2HLAB 3NFSL 4ISVB 4DGIH 1YNKL 5H94B 2MQ0A 2XTJB 1NBZB 3L3HB 4Z95H 4JZJA 4JHWL 1NLBH 3I50L 5DUPL 4K3DH 5CILL 1R6VA 4FQLL 2XZCH 3BUTA 1J1XH 4JVPA 4YPJA 5K9QI 2X09A 5K59E 2ED7A 4PR5B 2X4QA 3P73A 2R9HC 4LCCB 2Q8BH 3PHOA 2HJKA 1MCFA 5DDHB 2PO6A 2FX8L 3IFOA 4PV8A 3FTGB 4CUCA 1RULL 3GMLB 4GRLA 3MGOA 4NP4H 3KPPA 2DDQH 3TBVA 1V8HA 2PKDA 1U2CA 4MWFA 1M05A 3V5DA 3MLYH 3G9AB 3T3PF 1UB6B 5FGCB 1H3PL 2GAZA 4XAWH 1KB5L 3CDGB 3PNWB 2B2XL 4OCSH 3QUZD 3PWVA 4DN3H 5FGSA 5JHLH 2EXWC 4M02A 1JPTH 2AV7B 3MRFA 4HT1L 4YDVB 4ZUTA 4K9EC 5ERWB 3MGTA 5EDXA 4WW2B 2J3SA 4PYHA 4JG1L 3KLAA 4KJWD 3TYFB 1BM3H 2V5TA 2BNUA 2OP4L 1U8PA 5LAXB 4ZNEE 1CR9H 1T66D 4NQVA 3RWCB 5FDWB 2CH8A 1XGRA 2HH0H 5CBEA 3BN3B 1HHKB 2LU4A 3SGJA 3VW3H 2P44B 1T89A 4OFIA 3MLTB 3SDCA 1UEMA 2DJ4A 4N9OB 5E8PA 2WUCL 3C6SA 2HLFD 4M62H 5FM5M 5JOFA 3U46A 5JORB 3TWCL 1S7SA 2PUQT 4Z77A 4HLZH 5DVNA 2JK5B 3AS0A 4TPRH 2RFXB 4GXUM 2QHRH 3X14A 3VGBA 1IVLA 1BVZA 1RHFA 1VGEL 5TFSL 4M5YH 2NTFA 4JKPH 2UZIH 3KR3L 3UJIL 4TNVF 3MLRL 5GZOD 2YRZA 2X1XR 2Y6SD 3EAKA 1KLFA 4J3UA 3QIBB 4Y4FA 2WBWB 2VL4A 3NCYP 3PGDB 5CJOH 3C6LB 2DLIA 5KVDH 1D5IH 1OGAB 3IDNB 1OW0C 2XTJD 4MA8H 5CP7A 2HJKB 2Z35A 2R1YA 2UWEE 2EIZA 4MA3A 2EECA 1PLGH 4K23L 1A1OB 1U91B 3GIZH 2AW2A 5D5MB 3VG0L 4AMKH 2R1XA 4NZDA 1G9MC 4G7YH 1CFQA 3HR6A 2R4SL 4PLNC 4MMZC 2ZUWA 4PJHA 3MRCA 4DCQB 1WQVT 4ZOEA 2AJYH 1FFPB 1MCHA 3S34H 3KJ4B 4P23A 3LEXA 5DWUH 1UEYA 1MCOL 1ZVSA 4HUNB 4HWZB 4XPFL 2DYPA 2PXYB 1IGTA 4U6TA 4RISL 2GFBA 2YRPA 4Q58C 4QCIB 4MDIA 1EO8L 2LVEA 4EN3A 3CVHA 4JAMB 4PRPA 4P4KA 4C83B 5GISL 2Q76B 3HNVH 4JFOA 5IG7A 4DK3A 2AQ2A 2DWDB 1XF2A 4HXAL 2VLMD 2E8YA 2DQTH 3MOAH 4LVOB 4RX4A 2B8OT 1X5ZA 1W8OA 2AK4A 3EHBD 3VXME 2VLLA 3WIHA 5HHXH 3DHMA 5DD6B 2R8SH 1ETZB 4P4RA 2IBZX 3MMEB 4G9FA 5IEHB 2A6KB 4NJ9H 4RZCA 1U92A 4N0UB 5JW5A 1OSPH 5EBWB 1XMWA 1YMMA 2UY7A 1A7QL 4OGYH 3FT3A 1HHGB 4CAGA 3PJSB 4HS6A 4M6OL 4XC1H 4M7JH 4YPGB 5D5MF 3F62A 1DN0A 4YHIB 2HRPL 1IGYA 4HUXB 5GJSL 5HYSG 3SDDC 4G3YL 2R23B 3WLWD 1Q9WA 1FVEB 3ZDYF 1AFVL 3HZMB 4HKXA 4JREB 5DRWB 4K2UH 3S5LA 4XVJH 2EO9A 2DQDH 4NQEA 3WNPA 4KZDH 3OKLA 4GG8A 4U0QB 2CMRL 3K0WA 2WWKT 3DURA 5GZNC 3RTQC 4TTDD 1IT9L 3QIBD 3SE9H 2LTQB 4JFHD 5EIIA 3C6LD 3V6FA 1NGXA 4MA7H 4XBGB 1F6AA 1OGAD 5DT1L 4UT6L 3WHE0 5I1KH 1UA6H 2AJVL 5K9JH 3SKOB 5GRUL 1G7HA 3EJZD 5L2JA 1KPUA 3GMNB 4HF5L 3RWFA 1J0IA 3QDMA 4ZS7H 1FH5H 1CF8L 3VXSA 3TVMB 2DLEA 4X4XB 4UOJA 3ZMRA 2IALB 1KCUH 1LP9E 3RP1A 2X4SB 5DJDA 1KN2H 1IGCL 4I48A 5HGHA 5AZEH 5HJ3B 2NY6C 2F19L 3NH7H 3HUJB 1A22B 1F2XK 3EW3B 4MA1C 1I1AC 4KVNH 3ZKNC 2ITCB 2PXYD 3ZE1E 2MFNA 4NZRH 5DQJB 3AAZA 3K80A 3QWOA 3NCBB 4G9FB 1FNSH 2Q6WA 3MCG1 4GG6B 1CICA 1BBDH 4X6CB 1AD9B 4QYOB 2XYCA 3G6JE 4JGUA 2OI9C 1H5BA 4OFKA 5L2KA 4HZLA 1AJ7H 3NZ8B 3RDTA 1T03H 3V6OA 3WO4C 4JY6B 3MREB 3DBXA 3ZT5A 4LLQB 3TN0A 1JN6B 1OPGH 2NCMA 4NRZA 3UEZA 5CEZL 5JXEC 1T21A 1ZHLB 2F74B 2BCKA 3OKNB 1C7SA 2IMMA 2XWJB 2EDRA 2Z8VC 4LK4A 3QEGL 2FWOA 1OT2A 2B1AH 2YZ1A 3QDGA 3K8LA 4JDVB 3VA2C 4MD0A 2ZG2A 2MHAB 1DJSA 5DR5H 1OF2A 5HYSB 5IB3B 2A9MH 5IW6B 4X0KA 3PWPB 5D1ZC 1MCDA 2BHYA 4LNRA 4KMQA 4KH2A 1M7DA 2FR4B 4WO4B 5J89A 3BZ4B 1DLFL 4OF6A 2JLLA 4U6HB 4XMLH 1OGTA 1MIML 2R0LL 1B0GB 2BVOB 2DTML 5HTSA 3JWOL 3HUJF 3QEHA 5I17B 1UWXK 4LEOA 3GSUB 2HWZL 5J6GA 3VWKB 1UB5B 4QXUL 15C8L 1B9ZA 3RL2A 3L5HA 4ODSL 4GG6F 4X6CF 2AEPL 3BP5A 4LPXA 3PXJA 1BEYH 4H8WL 5GGUA 4P9ML 4JY4A 1T2JA 3QUXA 5DJXB 3O6LL 4ZXBC 3OGCA 4MXVE 4NO0A 5ANMB 4NWTL 3RAJH 1GJIA 4HCRA 5I75C 4AK1A 3K7UA 3TVMD 3VFRB 5C3LD 2Y9RT 3MRDA 4LSUL 3Q3GB 4Y5XA 1RD6A 4XZUA 3C5SB 1U0QA 4XPTH 4OM0L 4I3RL 5DMIH 2P24A 4QRUA 1R5WA 3QUMH 4FP8L 1WZ1H 4XT1C 1RZKL 3OKKA 5A16A 2X4PB 1Q0XH 4KGJA 4MMXC 3OR6A 4JJHA 1DDHB 4KY1L 5IMOB 4EI6B 1A6ZB 3GMQB 3BZEB 4G9FD 5JW4Q 4U1NB 4YHPB 4GH7B 4Q7DA 4JHBA 3CH1B 3OHXB 3EFDL 4UBDC 1BVKA 5B4MD 1JPFB 1SMOA 1W72L 4L3AA 3DMMA 5E7FA 3Q6GH 2D9CA 5J57B 3V5KA 3VXTA 4HV8A 5KVGH 5TE7H 1KEML 1NDMA 4QWWC 4OCXH 3VRLF 3GKWH 4OD1H 4DUVA 5DFVC 3PWPD 3FQUB 3MYJB 2D7PA 4PRIE 1T83A 1T5XA 3TBYA 5GS0D 2DQCL 4WO4D 4OLWL 1XCTA 2X4UA 5DJYA 4XP5H 5C6WH 3T0XA 2IG2H 5HHVH 1X4ZA 1AHWA 4LSDA 3SDYH 5AAWA 5C0JA 4WFGD 4NQCE 4IMLB 1UVQB 3EYFA 4NZTH 5C2UB 3BKCH 3SE4C 4WUKL 1U8KB 1WIOA 5DHXB 1QR1B 5D70L 3HI5L 1DBBL 1AR1C 1DUZB 3VWKD 4AT6A 5GGQH 1E4XL 4D3CH 3RIFF 3DROA 3PXHA 4XX1E 1EJOL 3MUZ1 4D0CA 1KSRA 4B5EA 3PQYB 4O2CB 1MWAB 3GGWB 4V2CB 3VH8G 4HGWB 3TJHC 2VO5A 2EDQA 1FRGL 4Y19E 1I7UB 4A6YL 2W92A 4YHLH 4IHOB 4F7MB 4Y8DC 4M8QA 5T5NG 4U1GC 2LVCA 4LLYB 3GHEH 3LKNA 3WFZA 5GGVH 3EDDA 5SX4I 1KXTB 5I18L 1NCBL 5DTFA 3VXPA 3OKMB 4AIZA 3A6OA 2P8LB 3DTXB 3H3BC 2VLJB 5I8EA 1EO7A 4XPGH 4WI7A 2I24N 2YPVL 3GEWB 4HUMB 5C9KA 5JQ6L 1JV5B 3GO1H 1VEPA 2XWTA 2YPLB 3HZYB 3T4YA 2VDMH 2VWEC 3GM0A 3SGDH 1DQQB 2NX5B 4HZAA 4PTTB 5DJAA 5J3HC 3ZKXC 4YR6B 5DMGD 5C0FB 3O11A 2X1PA 3FB8A 4XBPB 4MXQC 2OTWB 2OZ4H 5BO1L 2NY0B 3O6KL 3GSQB 4RGNC 4LCYB 3SBWA 2FSEA 1YY9D 3K74B 4GSDH 2MQ3A 4YWGL 5J4MA 4NYLB 1BJ8A 5MEQA 2B20A 3GSXB 3U6RB 1P2CA 2YA0A 3GMMB 5A2KH 4RMUA 1QBBA 4M6NL 1MUJB 2X4RB 5F3HB 1UWGL 3ORJA 3HE7A 3BKYL 4V1DB 3LKRA 3UTSA 5F9WC 4K94H 2RCSH 2ZWLT 1WTGT 2P7TB 1L4IA 2J8HA 3RVXC 3V4VL 2CJUL 4PGDA 1T7YA 3OXSB 3OPZH 4GW4B 4H88H 5E2UL 1AP2A 3FFCA 1A3QA 1FCGA 3RWIA 4XHJC 3KHOA 1D5BA 2DM2A 4YGAB 1NEUA 2J6EA 4Z78B 3D3VE 3WE6B 1S7QA 4G6KH 1IEBA 2R4RL 3JWOC 4LSSH 4D0CB 3BW9B 1L7TH 1TFHA 3PL6B 2V6HA 3RGVC 1KIPA 4KKAD 2D0FA 3DVIA 4NBYB 3L3IA 2VXVH 1QBLH 1CZ8L 2UWEA 1OSZA 3MQIA 1J1PL 2DBJA 1A6VH 1MNUL 3VH8B 2BSSB 4YGVA 2DF3A 1FDLH 2DQFB 3TBTA 4GAJH 3AM8C 2NY2C 4PJ9B 4H26B 3L9RA 5HGDA 3PQYD 2HT3D 4FQIH 5EZJA 4N8VB 3W5NA 5H8DA 2Z31C 2OR9L 3ILQD 3F65A 3MRKB 4OZFG 4HBCL 1NL0H 1J0KA 4OCYL 3HI1A 4NO3A 1WZKA 2DQJH 1UG9A 2EYRA 4UIKH 4I0PA 1QNZL 1I8MB 2XKUA 1VFAA 1C7TA 5F93C 2IC2A 2FGWL 3O8XA 4GMSH 2P4AB 4PJXB 3T4YB 4KMTH 4TULL 3LKPA 2VLJD 1QYGH 3EOBA 5F7YC 3DVGB 4UT9L 1RZKC 5C0RH 4Q6IA 25C8L 3PDGA 3A6BH 3EDFA 3BZFA 3EZ8A 4PRNA 1IQWH 1U8QB 3IDGB 2YPLD 4F58H 1B4JL 3IF1A 5DJCA 2NX5D 4QRPE 3L5WA 5I71C 5IVOA 3MRMB 4PY7B 3WNKA 5C0IB 1KJ3H 5MEOA 5K59F 2NY0D 4KWUA 5IESL 1U36A 3HTLX 3RZWA 1J8HE 1TMCB 5D2LE 1Z3GL 5BQ7A 2W9DL 3H2WA 1HOCB 4MNQB 2Y5TA 2EE2A 5F70A 4WIQA 4N0FB 5ILTL 4DGIL 1B6UA 4PG2A 1PW3A 5L0QB 1E6OL 3BP6A 4K7PH 3B5HA 3UROR 3W11C 5ADPL 3ALPA 3BGFC 5GRWA 4V1DD 1PZ5B 4IOIB 2V2XB 4DKEL 3DVFA 4WGVB 3P0YL 3U79A 4MVBD 5CSZB 3MODL 1CD8A 1A0QL 1FFQA 4HD9A 2XT1B 3FQXB 5KSAB 4MD5A 1BIHA 5DJ6A 5DJ8B 3S3PA 4PJXF 2OBGA 2VIRB 1T7XA 3TBTB 3BISA 2BVPA 3PL6D 4NNPL 5L8LB 4CMMA 1MRFL 3KXFE 3V0WL 1CGSL 4D9LH 3CXDL 1DQML 5C1MB 5D96B 3VXUE 4JR9L 4JZNA 1F00I 2DM7A 3CFKB 1MI5B 4APQA 5I1CH 3T2OA 1G1CA 2Q8AH 4PJ9D 1X5LA 4G6AC 5TF0A 2ZSVA 1CYGA 3GBNH 4QF1B 4KJYA 4JM4L 4QT5B 3RL1A 4YUEL 2YBRB 5C0CE 1U95A 5TE6H 3VFSB 3QFJE 4GLRI 4OM1H 3X17A 3GI9H 3T1FB 5IBTL 1FFNA 1VFOA 3PE9A 2H26B 4HWNA 3P2TA 3T4AB 3FRPG 3S4SA 5JQHC 3CFCH 1FGNH 4ESKA 6CGTA 1EBPA 3THML 2ZCKL 4QRTA 4ZSOB 2VXSL 1QKZH 3VXMB 5HGAB 4YHMH 2R1WA 5CJ8A 4YHOH 4CN4A 3O3EA 3G6JA 3MA9H 4LKCB 3U4BH 1KCRH 2DQIH 1ZGLA 3UBXI 2UWEF 1DANT 1NMCB 2V2WA 2Y5TB 2GUOB 1G7PA 4TVPE 1K6QH 1IKNC 1F5WA 4M5YL 4DUWA 4PJBE 1QBMH 4DVBB 4PRHA 4U6YA 2IANE 5I1GH 1X5JA 1OARH 3JV5A 1OAKH 3WJJA 4ZOCA 4JPKL 4F9LC 4MNQD 3WN5B 5TF1H 5ID1B 4IIQC 3E1F1 32C2B 4RWYH 4MQXD 1G9NH 1KFAH 4PGEB 3IJHB 4KZEL 5ITBL 5TQ0L 1MEXL 4X7SH 1UWXH 4Q9CA 4YXLL 5D7JC 1TIUA 1QZ1A 3O3BA 2B4CL 1FNFA 3DUUA 2DLGA 5HI3C 2UZYB 5A43C 4N9GB 5A40E 1MCBA 1G7IB 2IFGA 4JZOA 3D9AH 1NFIA 2GITA 3ARRA 1OTSD 2NMSA 4MXWH 5T33H 5KSAD 3RWEA 4TN9A 1FN4A 2ICWB 4ODUB 2MCG1 2OJZL 1KELL 1QFUH 1LO3L 3L5JA 1CDGA 5DD1L 2B5IB 4ZPVB 3BYTA 2YUXA 3HPLA 4NKOB 1L6XA 4TTGA 1MHPH 4TSAL 4PJFE 2P46B 1EERB 1M71A 1R0AL 1EO5A 4FQXB 3KNBA 4C56A 1A3RL 3FN0L 3K81A 1CBVH 1I4FB 1LP9B 5D2NB 3MZGB 4UB0L 1MI5D 2NLJA 1KIQA 5JW3H 4Y5VB 3HN3A 1T20B 2LAGB 2DQTL 4OAWA 2A0LC 5D93C 3ZE0E 1G6RA 1T7VA 4X4YB 2DBLH 2EC9U 2W07A 5HHXL 3O45A 5INCA 2NZ9D 5EOCH 3TESA 3PDOB 5FYKD 4HUWB 1WEJH 3CIQA 3VFUB 1QUNA 3P0VH 3GDBA 4C55A 2E9WA 2LU7A 3OR7B 4Q6YA 4PRAA 3DARA 3DYMA 2O61A 2WUBL 4XC1L 4PP1C 1SYVA 4QTHA 1I8IA 3CCHA 1G7PB 3JTTA 3VXMD 1OAZH 2AXFB 2IQ9H 4LRIA 5J1TC 1EGJL 3LQAH 5IK3B 4HS8L 4IOFC 2R29H 4XCFL 5DUMH 4JFFB 5EC1A 1FVDB 3IXTB 4LLAA 4OT1L 3RNQA 4F37K 4GMTH 3OB0K 4GS7B 5CIPB 5M7QA 2NY4B 3R06B 4M7KL 3SN6N 1TJIL 1A7NH 4IRSC 2EXYC 1FZMA 3MUGA 2IQAA 5DYOA 1LE9A 1LP9F 3U0TB 2WP3O 3PWNB 1FO0A 1QHOA 1KENL 4JFPA 1UA6L 4PRIA 2XRAL 3I6LE 4DOHE 2VDLL 3LKQB 1WT5A 5I1HL 5D7LE 4BH7A 3QXUA 5A3ID 4D9RE 1C16B 2XZAL 4MJ4A 1HSAA 3LN9A 3DIFB 3T3ME 5GIRA 5TGBB 1P6AB 3P4MB 3I75A 5IVNA 4AH2B 2F15A 4HPYH 4PJCE 1PKOA 1T1XB 1JZ3A 4EDWH 1XH3A 2NLJB 3ZHLA 4CVXA 4KVNL 4HX1B 4OAWB 4XXDA 1NFDA 4L8SB 3GRWA 5TE4L 3BGAA 4FQXD 1T22A 4O9HL 1BBDL 4Y19A 5E5RB 1RVFH 5EWIL 1S9WA 4KUZL 2VQ1A 2J8OA 2BY3A 1INQA 1ZLSH 1N2RB 5FM8A 1AJ7L 5HDBE 5FDYA 1T03L 1BOYA 1X5XA 5DK0B 3FOLB 3EJYC 3GSNA 4JLRA 4KI1A 1OPGL 4YDJA 2G2RB 3D0VB 3SKMB 5B8CC 4IDJH 1JZ5A 3OKEA 5HHOE 1RU9H 2B1AL 2QSQA 1FZOA 3FAXA 1YDPA 4XVSH 5EOCJ 4M7ZC 4G8IA 3BDYH 3X3GL 1RZ8A 1FBIH 3MRLA 2OJEA 2XACC 4FG6C 4U3CA 3RNQB 3GSWA 3WUWG 1F13A 4QHKI 2MOVA 2OQJA 5TDOA 4G6MH 3CLFH 4MHHI 4LLDA 1G7LA 4JFFD 2YC1B 1BQHG 1YYLH 1JPSL 4GXUN 2VUOA 3M1BB 1I8KA 3F5WB 4ZFFA 2WINA 1FYTE 4ZNCD 1DBAH 1FO0B 1WBYB 1D5MB 3DWTA 3QRGL 1NH6A 5TDPB 4MXVF 2Q86B 3CMGA 1RIUH 2NY4D 2GT9B 1RK0B 3ILPA 3O2VH 1CS6A 4ZG1A 3BRFA 3U0PB 1KJVB 4AY0A 2EDWA 2J88L 3EDEA 2D2OA 2IPTH 1DUYB 1SY6H 3UZEA 1NLDL 4NQCB 4LBEA 2LABA 3L6FB 3LCYA 4TSCH 5SV3A 3EYSL 3HZVA 5FYLL 5IOPB 1ZVYA 4QXTB 5C0AB 4HWEL 3RGHA 3VFTA 1Q94B 1N59A 1YEFH 2A1WL 1ZS8B 3FO2A 5CZXC 4PJ5E 3GMPA 3NZHH 1OTTD 3TCLB 5JMOC 1S7WB 2E3VA 3ES6B 2HAZA 4I3SH 4WEBH 5DMYA 3VFPB 3FQWB 1INQB 3BAEL 4FXKA 4XI5C 1KTLA 3MCKA 3NCEB 4Y2DB 3MJ8B 4PJ8C 3QIWC 5CCKL 1CVRA 3GSOB 2CPCA 2ZG3A 4CNIA 4O5LH 1T6VN 3RPIA 5GS0H 5ENWA 1IEAA 1MFCL 2DMCA 1UM6L 1EFXB 4J4PC 1CN4A 2BDNL 4ONHA 5TE7L 4IJ3B 5CD3A 4NN6C 1EEYA 5AEAA 3UTTE 1T2XA 4ZFOA 5IM7B 2FO4A 4ZD3H 1KG0A 3C87A 3QO0A 1OWRM 4M1DL 1MJUH 3B83A 5KBNC 2VWEE 1RJYB 1WWCA 2E9IA 4QRPA 2OXHA 1PSKL 2CO7B 3P3YA 3X11B 1RZJL 1J8HA 5D9SA 1MLBB 2AABH 4NQXB 1T1WB 4GUPA 2RB8A 4PB0L 3WD5L 2OLDA 3MCLL 3BKCL 5B21A 3GMRA 5FA4B 5GRJL 4HIHB 3RWDB 5GGVY 1OQXA 1GC1L 3C5JA 3QXDA 2OL3H 2NXZC 5TH2A 5J7CC 5EZLB 2EDKA 4JN2A 3MRRB 2EKSA 1MREH 1IAIL 1LQSR 3D3VB 1N59B 1FG2A 3NTCH 3AS1A 1UXWB 3Q5TA 4NQCD 3F7VB 2W1NA 3QIUB 2RJMA 3P4NB 5A2FA 5C0AD 4DUXA 2HJFA 1IC1A 4BQ9A 1CT8B 1KIRB 5ETUB 1AIFB 1EXUA 3ZLQC 5T3XE 2AK1H 2BY0A 3E6HB 2Y72A 2GCYA 3DRTA 4KK6D 2GI7A 4U1MB 1OW0A 3B9DA 4KXZH 2IAMC 3GNML 4MCZA 3VXUA 3H0TB 3CFJA 4XPGL 2P8PB 3WS3A 2C1PB 2C4FT 4R2GB 3DX6A 3H42L 1E4KC 5IV2B 3UP1A 2EO1A 3RPIB 1A21A 1VEOA 2NW2A 1O7SA 3GO1L 4Y2DD 7FABL 4XCNA 2K1MA 2BSRA 2ZG1A 5ESQB 5ITFB 2VDML 5C09A 2HYMA 4LF3B 4P5TB 3BP7B 2YD6A 3GB7B 5C0CA 1BQUA 1UXSA 2F5AL 2N56A 3QFJA 3EJJX 1LEKA 3TPUA 4EXKA 2R2CA 4GSDL 1JE6A 2XA8H 3GJFB 2XFXA 5FYKU 2FO4B 3V4UH 4KJPC 3VGFA 4OUUB 1YN6B 4S1DC 1EFXD 1JFQH 3NABL 4EUPG 5EU3B 3O2DH 4JY5H 3VXQA 4DFHA 1V3MA 5DEGB 2IPUK 5H37G 1SVCP 3EO9L 1JZ6A 5D2LB 1JWMB 1U3HB 2BMKA 4AL8H 4HG4K 2O5XL 2XG4A 1EAJA 1R5IB 2NY5L 3OTTA 5BOZG 5FUZL 4XC3L 3W0WE 4QHMB 4JM2B 4RBPK 1MWAH 1SM3H 4S1QH 1J11A 1N8ZB 1S9XB 2NW3B 5C70A 2HVJA 4KROB 4AG4H 5JIHA 2AV1B 5ALBH 1WCBA 3QFDA 3P77B 1QQDB 2OSLA 1KJMA 2EDOA 4ORZC 3SDDA 1XF3A 1NCCL 1YUHA 4MYWB 3D3VD 5GGSB 2YMXL 2JCCA 3MV9E 5BRZE 5F88A 4PGBB 4WW1B 1N5AA 2I9LA 5E2VH 3KXFB 3QIUD 3ULVL 3KDMA 2DQJL 2CKBB 3KLSA 1HINH 4NQSB 5I8KL 5KSUB 1ZGLP 5E94B 4KFZC 3RTQA 3FO0H 2APFA 1VSCA 4EDXB 3NIDE 4M3KB 5TPWH 4TNWF 5IFAH 2R9HD 3IU3B 4PJFA 1UYWH 5D2LF 4DN4H 4XNZC 2XPGA 1IC4H 4QHNB 4R2GD 4NSKA 4E5XB 3A6BL 4G9DA 2X89A 2G9HA 3LH2H 3TH3T 4FA8A 3MRNA 4OJFL 4M93C 4K7PY 4JM2F 3LDBC 2XFXB 3FONB 1DFBH 4OLXH 4R7NB 1CL7L 5C0EB 5D1QB 5IT2L 4P5TD 1W0VA 2XN9B 1RHHB 5ISZE 4ZUSA 5JPNA 4MNHA 3UO1L 3BPOB 3GIVB 1S3KH 3ARWA 2AXJA 3NAAL 4EUPB 5JPMA 3EYQD 3BP4B 1S9KC 1I1AA 2X9XA 2DI7A 4TUKL 4XNQA 4YBHA 1FIGL 1X5IA 3D25B 3EOTH 4C4KO 3ECBA 3QPQD 5ICXA 1QEWB 3OB0H 2H9GA 5E8OA 1UJ3A 1K8DA 4PJBB 5I1IL 5CJXC 1BFVL 2JTDA 3FB7A 2IANB 3KYNA 4ZFGL 1YQVH 2R2HB 4QHLB 3UX9B 3M8OH 4JQVC 2D7TH 4P3CH 1IBGL 1I8LC 4U1IB 3RVVC 4O51A 1W0YT 5E8NB 1U3HD 3HE6C 5CGYC 2JELH 3MRGB 4BFBD 3CLEL 5DRZA 2L7JA 3RA7H 4X7FC 5JXEA 1H3GA 2R15A 1NCTA 3LS4L 4JM2D 3U1SL 1U8HB 1ZTXH 5DA0B 5DZOA 5E6IB 1ZT4A 4KROD 1R3IL 5D1ZA 3H9HB 3MRPB 4R3SA 4OFYD 4MLSA 4XP9H 3U7YL 1ZANL 1KNOB 1RV6X 4ZS6C 3SKJH 3DRQB 1AGBB 4F57H 3KDMB 3MNWA 4LDLB 2IMNA 5I1CL 4YHZL 1NC4B 2VLRE 4RAHA 3C8KA 2HTLD 3RTQB 2Q3AA 5CHNA 5I76B 1MFDH 1NKRA 4Z7NE 2HFFA 5EO1B 2V7HB 3FMGH 1T1YB 5EC2A 3KXFD 5TE6L 3G6DH 4LLUA 4OM1L 1QLRB 3C08L 4PJFB 5JUEH 3G5XA 4UUJA 4G80B 3O6MH 2DLFH 4N5UA 3BN9D 2CDGB 4HHAB 4PJBF 4G9DB 1X44A 3FRUB 1TNMA 2ORBH 5DHVH 1FAIL 4KRPB 1U8OA 1QKZL 4PGCA 1MFNA 5FUCC 4XXCC 1KT2B 2BSTB 2DD8L 4D9QD 1FNGB 2PTTA 5ABDE 1WBXB 1NBYB 4MD4B 4HW6A 3SOBH 1RJLB 4BZ1H 5EIQA 3FKUS 3QCUL 4ZXBA 3UJTL 5D7IB 5F97E 2EEBA 4QKXB 1NGYA 1K6QL 4NBXB 1AKJA 2AAVA 1QBML 5D1QD 3VI4E 1CGVA 1XGPB 1SYSA 2XN9D 4HJGA 2J4WH 1OAKL 3KHQA 1CFNA 2VR5A 5JHDB 5HHOA 3FB7B 3QDJE 1C5BL 5TF1L 4WWKC 1VEMA 4RWYL 4PJEA 2D0HA 3E6FB 2VSCA 3KPOA 4G5ZH 3WFCL 4ZMAT 5BVPH 4ODBD 4UZGA 4TVPD 3I3BA 4YIQA 3HG1A 2VDRL 5J9PB 4P5KB 2IAND 5I1JL 4F7CB 4J3OC 2W60B 5FGBC 1U8JA 4K94C 3QXAB 4PJFF 4PY8I 4FZ8H 3KVQA 4WFHE 4Y4HB 3FN9A 4X6BA 1WFUA 4UINH 1CDUA 2NY1B 4JFXA 1R3JB 1RFDL 3S35H 3MR9A 4OCRH 4GOSA 2NY5C 1YPZE 4R0LB 1PX3A 5FKAA 3S37L 4WTWA 3H3PH 3WFHA 2V7NA 4HLJA 4OZFH 5FB8A 1QFUL 3ZE0F 1MHEA 2H2PC 2Z8RA 2WLZA 4DOHB 1JJUA 1GZPA 4JO2L 4OTXH 5J13C 5D7LB 2N7BA 5E6ID 1MHPL 5FYKH 1YNLL 4D8PA 5D7IF 3S97C 3ULUF 1JWSB 3UTPE 1CBVL 1OL0A 5DJ2B 4L3CB 5EUOE 5ALCL 4OZIA 2EZ0D 3O3DB 3MA7A 1FIEA 4MNGA 1LMKA 1NC4D 4Y4KC 5FYJE 3IXAA 4LU5H 3RTQD 3QEQE 4PJDE 4PJCB 3BQUC 3VMOA 2DBLL 1DVFC 1HI6A 5F96L 4JFDB 1BWMA 4WI4A 4J12A 1HCFX 4YEEA 1PVHA 3QHFH 4MDJA 4Y16C 2CO6B 2EDYA 3FQNB 3SE4A 3FFDA 3U30C 3VE0A 3SCMB 1AO7A 3QNZB 4YK4B 3UTZB 1QSFA 4NCDA 1LO0H 2BXZA 4YLQT 5I75B 1ADQL 2A6DA 4KRPD 3STBA 4BKLB 1XGYL 4XCYA 1OAZL 1A64A 2IQ9L 3VD5A 3LQAL 2OMBA 1DEDA 3MXVH 4UTBL 3T65A 4TRPH 2E9BA 1YJDL 4Z76A 2DQEH 1A14H 1KIUA 4EBQL 4L8CB 3VD9A 4H1LA 3ULUD 5IGXH 2CDFA 1MOEA 5JR1H 4BJLA 1BQLL 3I6KA 1BF8A 4UV7L 3WEXA 3HC0A 4OLZL 3JV6A 3PHQA 1M4KA 3AREB 2R2EB 1JGEB 4PP2B 4WNQA 5JHDD 1AQDB 4U1KA 5HDLA 1BIIB 4B53A 5DI8A 3OKDB 3PGFH 3RRQA 1F4XH 2ADJB 1BZ9A 4BM7A 3E8UL 4PJCF 1FYTB 1LK3H 2LFGA 1IEHA 4OBSA 1OCWL 3UYOD 1Q9LA 5T3ZD 2VAAA 3TV3L 4BFGA 3QUZC 1NCUA 5CGTA 2ESVB 2QHLA 3WIFA 4Y4HD 2F54E 2FDBP 4U1JA 5DJZA 3VU2A 3WXVH 2NY1D 5E4EB 1U42A 3UBXG 1U93B 3WL9B 1K8IA 1S7TA 4XPBL 1UKQA 1Y18A 4Z7QE 2VDNL 5HDBF 4HPYL 2BVYA 1L0YA 2XWBA 4TOYL 3WSQH 1QFWH 1BFTA 2IH3A 4EDWL 1S9YB 3FB6A 3TGXA 5D7LD 1DSFL 4D9RD 5FECB 2VXTH 1T66C 5DC9B 4JO3H 4NQDE 3HLAA 5EORH 1NANH 4Y89A 3CSBA 3MACH 4WTZG 3ULSA 2X6MA 4MDJB 3BH9B 4XAKD 1JRHH 1JTOA 1FPTH 5IW1B 1UQSA 4PJ5B 3C8HA 3MV7E 3U4AA 1AXTL 4OD2A 2HLFC 3BRDA 1Q9OB 1HKLL 3LRSA 5IB4A 1VADB 4JFDD 3C60B 5HVGB 1VA9A 1CDHA 1GGBL 3RGVA 2PCPA 3VD3A 4IDJL 4WUUA 1AGEB 5IVXE 1I3GL 3SGDI 3MTRA 3SCMD 1JTTA 3BO8A 4JQIH 2FL5A 3MLWH 3AM8A 5ESVA 4E0RB 2F53A 3FB5B 1HIMH 5BJTB 2Y6SC 3L95A 1CE6B 3RX8A 1JGVL 2Z31A 3P4OB 4G6ML 4G43A 4ODXB 5C7XH 5FF6A 1REIA 2XTJC 4M43H 2P5WB 2H3NA 1UKTA 2YWYA 3UTTB 4F7PA 2W65A 3ROLB 2GJ6E 5DLMH 3DXAE 4ELMA 2C3GA 1HSBA 4NM4H 3NMEA 3ARED 1YMHA 3B9EA 3VRJA 1HILA 3LEVL 4LCCC 3DX8B 3D1MC 4RIRB 4KK8D 4NM8H 4XP4H 4RBPH 3CVHL 3P11H 5KANG 5BS0B 1IGIH 1PQZA 3QQ3A 1TZGL 5T1KB 4J3XA 2E7CA 4OQ1A 5IUSA 3QQ4B 1FYTD 4WJ5B 5CEYB 1J0HA 3UYPA 1DBMH 2ATKA 4KTEH 3I2CL 3UBXB 3ZDZE 3W0WA 5GHWL 5MP6H 2A83B 1ND0A 4X98B 2ESVD 5KTEH 5DK3A 1W72A 1TETH 1XGTB 5BZWA 4CADA 4WW2C 1IAOA 4HAFA 1BVLB 4X8JA 3EHBC 1ONQA 1BBJA 2D03L 1YN7A 2F9BT 4LVEA 3OZ9H 4JPVH 4NKIH 1JUFB 3WMSA 1RUML 1RUQL 1WFOA 4KQ3L 5EZOL 3TP4A 3DECA 2BHUA 4PJ5D 3L5XH 2H2SD 1QSEB 4O5LL 3KYMB 3UC0L 1MH5A 3RNKA 1WK0A 5KSBB 4ONFH 1NGZB 3WLWC 3C60D 2F8XC 2VAJA 4GRWB 1CK0H 4LCWB 1QRNE 5HHME 4YQXL 5JIPA 4F33B 3L95B 3O3UN 4Z9KB 4FTVA 4MQ7B 5F6HJ 4B41A 4FQ2H 4G43B 2KPNA 4GT7A 4M3JA 3JWDH 2ADGB 2VITB 2VNCA 4FXGA 1XCQA 4PIRF 5GQBA 1NAMH 3BKJL 4BQBA 1XT5A 4UILL 4UIMA 3VCLB 3LQAC 5E03A 3QIBC 3D39B 3BESR 4A6YA 3PWJB 2PW1B 3C6LC 1YJDC 2HFEB 2Z9TA 1ZSDA 3VRJB 5EZIL 2QEJA 4RDQG 2W9EL 4P57A 4XNYL 5IFJB 1RMFL 2P5WD 3EJZC 3UTTD 1XF4B 4NN7C 3QT2A 1FGVL 2VH5L 4F15B 1XIWB 3B9KB 4X80L 4Z7UA 1FFOB 2AKRA 4P2OB 1SJEB 4ZYKA 2OTUB 4P5MB 3LZFH 4MXQD 1JPST 3W0WB 4RMTA 4J6RL 5MEPB 3G5ZB 4HG4J 5BS0D 4YE4H 3NTCL 5T1KD 3KJ4C 2X10A 5IJKC 4Y88A 2F58H 3C5ZB 1IKNA 1PYWB 1H8OA 2PXYC 2VXQH 3VGAB 1H15A 5C6PB 5CZKA 1KGCE 1ZEAH 5E2TL 1K85A 1NFKA 2Z8WC 4U31A 4LFHD 5EN2B 1DQDH 5CD5D 4OKVA 3WJLC 4MHHG 1JGDB 2EYTB 3FZUD 1J88A 4F9LA 3I6GB 1QPPA 1JNHB 4IIQA 3BYYA 2ADFL 4N8CH 5I73B 2Y06H 1H0DA 1MFAL 4LVOC 5DGRA 4OGXL 1WCQA 4MJIA 3V6ZA 4AJ0A 3MV9B 1F42A 1IJ9A 5EU6A 5BRZB 2XIDA 3P40A 2CXKA 3S4SG 5IMMA 1GHFH 5IB5B 5D7JA 2ARJB 1CGYA 2IF7A 4OSUL 1JNJA 3I3EA 1CLCA 4UV4H 2VLRA 4K3EL 3LV3B 4GKNA 4R96B 5T3XD 4MSWB 5EIVA 1A1NB 1TZHA 2ID5A 2ZCLH 1KJ2A 4L9LB 1N3NB 2APXA 4X5LA 1QSED 4HFWA 3OAZK 5GRVK 3QCTH 4JN1H 4L4TA 4Z7WB 3EYUL 5HVHB 1F4AA 1SJHB 3MSPA 4FNLL 4LCWD 1BX2B 4JREC 3T08A 2H6PB 2AJUH 2JIXB 3UPRA 3GUTA 1P1ZB 4JRYB 3CUPB 2FATH 1RZIA 3PIQA 5E70A 1ZSDB 5ISZB 3UTQB 3BT2L 1RIHL 2WANA 1HDMB 5E56A 1MPAH 2JJVA 3EGSA 3MNVA 4GKOA 5CS7A 4AL8L 3MLPA 3D39D 2LTQC 4RAVA 4HFUL 2O93L 4CMHB 3S3JA 4Z0BH 3MV8A 1NAKL 3U7WH 1GOFA 4NJAL 1MWAL 3IJYA 5C6TL 1ZHNA 2D31A 3C9NA 1XIWD 3ARVA 3MRQB 3B9KD 4LSTH 5M94B 2YKLH 4UI2A 5DS8A 3DX7B 4P2OD 1P5VA 3TVMC 1IQDB 4HIJB 1TTGA 5K33A 2X7LB 3NIDF 1IKFH 1NBVH 2DAVA 3W0WD 1MJJB 2BRRL 1AXIB 3N1GC 4S1RH 4FZEL 2SEBA 3C5ZD 4MQSB 4R7DA 4Z7WF 2FJFA 4IIQB 3F7PC 1IL1A 4Q9RL 2VUYA 5HGBB 1YPZA 1IAIM 5A1AA 3X13A 5C2BH 3BXNB 3CC5A 2X9YA 1X7QB 3FQTB 3MO1B 4LQ1A 1T0MB 4IRSA 1KTDA 2MCPH 3WKNA 1ZOXA 2YR3A 2ZKHL 5B39A 1JI1A 3QXTA 1UH2A 3B9VA 3WKML 2XXCB 1T5WB 2Z93A 3G6AB 4DN4L 3MV9D 5B4MC 5BRZD 3W81A 2DQUH 1KF9B 4JPIA 5F7EH 4JKLA 5EUOA 4PYGA 5FCUH 5DD3H 3CSPA 1WFNA 4ZOBA 3QEQA 3OX8A 3UXFA 1UM5H 1WAAA 5I8CA 1WFTA 3JSSA 3G5YB 1KXVC 4R4FL 3KYKL 4XGZA 4J3VA 5LG1A 3SKUD 3E3QE 5GS0C 5MERA 1QG3A 1RZIB 5HDQL 3CVIL 4OZHE 4WO4C 3D18A 3LKSA 1LNUB 5DD0L 1HQ4A 5LXGH 2D9QB 4G6AD 4FQ1H 3NCJH 4K55A 2LV4A 1KCSH 1S7UA 2JIXD 5FUCE 3HI6H 1IC7L 3U9UB 2E9JA 4JRYD 3RX7A 5IHZA 3PP3K 4P9HL 2IPKB 3SE8H 4LPCA 4PBVC 1MJ7H 5ISZD 1OLLA 2D7TL 5IKCB 1A9BB 1KPRB 3VWKC 3QDJB 1EIBA 2EDFA 5FA3A 2CD0A 5CP3A 1OB1A 3H7BA 1PGRB 5L9DH 3EYVB 2OMNA 4ZODA 1YEJH 2VDKH 1JYXA 5B8CA 5BXFB 2QQKH 3VXNB 4Z7NF 2ADIB 4KUCD 4NZUH 3VG9B 1J1OL 4QXGL 2V17H 1FHGA 4U4BA 4WCYH 5K9OA 2F8VA 4PJ7B 1VHPA 4X6EA 1S8DA 1DE4B 1JZ4A 3KPMB 2BVEA 4LEXL 4DVRH 2VLKE 1JL8A 4I8DA 4XWGH 3CC5B 4F7TA 5BMFH 4Z0XB 2R0KH 1RZFL 2HG5B 3IYLW 2Y7QA 1ORQB 2AJSH 2F54A 3OAUL 2AS5M 1CGUA 3HS0B 4YHKL 2APWA 5IFHH 4A2LA 5EBLA 4RGOH 2DLTA 4EOWL 1ZWIB 2E6JA 4D2NA 1JNNH 5EUOB 4K8RD 1QVOA 1AGCA 5DMGC 3VI4F 3QNXA 2VE6B 3OKOB 3T04D 5JA8B 4PJDB 4OIAA 1UZ8A 4NQDA 4AM0B 4YHYB 1V7ML 1YY9C 5FCSH 1I9JH 3IDIA 4EUPH 1WBZA 5AUMA 4JFZL 1JWUB 1J7VR 1WITA 3EUUA 4JFYB 4NUJB 1S5HA 5H37H 2DQHH 2E5EA 3RQ3A 4ZQKB 2VDQL 3LN4B 1HEZB 4LVNB 3VXOA 1EJ6A 5KJRH 1P4IL 3LVEA 2YN5A 2BNQA 3KPLB 3K4DA 3HRZB 5IVXA 3F58L 1J05A 4U1SA 2GEEA 1YPZF 3LMJH 2VZSA 1JGUH 2QL1A 5I6XB 2ZUQB 3K8KA 3DV4A 4PJ8A 3QIWA 4DTGH 4NRYB 5LBSL 1M7IB 4NNXA 3FOMB 5F7WC 1BP3B 5DQ9A 4OCLC 3MUY1 1A7OH 5FIEA 3ZYZA 2X9WA 4KKAC 4M4PA 4C4KT 5DVKA 3QDJD 4KQ4H 4M7ZB 1FSKB 3S35L 1JGLL 2K7QA 5EUOF 1UCBH 1MHHA 3IKCB 4XP6L 1U58A 4J4PA 2Y07L 5SV4A 2ENSA 2HT3C 3GJEA 4PJDF 3ZKMD 3DO7B 3QJHB 1VFMA 3QWRD 3IB4A 3ILQC 1BJ1J 2CIKB 4DKFL 1OLZA 3AFLA 5EU5B 2YPKB 3CX2A 5L7XH 4O58L 4UU9A 4WFHD 2F54B 2RIKA 4GAGL 1MFEH 1EGJA 5IEKA 1XZ0A 2A6JB 3X12B 3PWLA 4D0BB 4GKZB 1C1EH 3CFBA 3KYAA 1G84A 1G7MA 4XVTH 5JDSB 2VXUH 3IFPA 3Q5YA 4CW1A 3AY4C 4PJGE 2ZUXA 3H8NA 1Y0LB 2A77L 1Q9KB 4N90E 2X4NA 3HMXH 2ARJQ 1MAKA 4W4OC 1QSVA 1SEQL 3IDMA 2QQLH 3UTPD 1II4E 3ULUH 2OR7A 3MRHB 2MWCA 2ZSWA 1F3DH 4LPWA 2YD5A 3KPNB 3DUSB 3MV7B 4KU1A 2FJHB 2AEQH 4KVCL 4P46B 5FYJD 1OM3H 3ROOB 2NY0C 3T0EE 5ACZB 1I1FB 1HQRB 4RMRA 2JB6B 1LK2A 2A9NH 4LHUA 2OR8A 4TRPL 5AYUH 3NN8A 4MJ5A 5SX4H 4AEIH 3IDJA 1FNLA 4LKXB 1HYRC 1B88A 5D72H 3GMOB 4YBLB 1YNTB 3DSNA 1CU4L 2VABA 4NO2A 4G8EB 5IGXL 2ZPKH 2G60L 5GXBB 5D6CA 5JR1L 2Y25A 4Z8FL 3MJ7A 3T3PE 1IFHL 2P8MB 2YEZB 3FHAA 1QRNA 5T3ZH 2E8ZA 5GGRB 4DZBA 1ED3B 1KLUA 2IAMA 5KN5A 4MVBC 5EB9A 4NHUB 3UYRH 3KPSE 5C8JA 1XGQB 4K7FB 1E4KA 5KVEH 1X4XA 1F4XL 4Z7QF 4KTDH 1T3FA 4PB9L 1I7ZB 1CD9B 1ULVA 5GSRB 5JO5A 3EJYD 2GJ6B 2QTEA 3TPKA 3DXAB 4P9HC 4XCEB 3SKNB 1T80A 3PL6C 1TTUA 5TDNB 5E2JA 2WWKO 2XTJE 1YEKH 5DVLA 5BOPA 4CJ1A 4FQQB 3WXVL 5IQ9A 5IVZA 4YNYB 2WZPD 3Q6FB 3HFMH 2GSIB 2FYYA 4NDMB 4PJ9C 2O5ZL 4NHCL 1MCIA 1YY8A 2BOCA 3DV6A 5MENE 1NJ9A 4YHNB 2P49B 1ZT1A 3CFBB 8FABA 1IC5H 5CJQH 1G7MB 1HXMB 1KOAA 2PTUA 1NMBL 12E8H 2F54D 1RZGB 5IVXF 1IM3B 3FCTA 2EH8H 1FPTL 1T7WA 5IBUG 4HUUA 4XMKL 1CLOL 2AJZB 5ICZB 3J8F7 1NGQH 3CMOH 3VGDA 1QO3A 1T04A 1S7RA 1M7XA 1ORSB 2CRYA 2FECI 2VLME 3QISA 1G0XA 2X5PA 3W82A 4BQ8A 3W9DB 4JCLA 3NGBB 5DUBB 1JF6A 5LGHH 3IDJB 3VFMA 4LQFH 4MCYB 3IFNH 5JOPD 3MV7D 4NO2B 5I1DB 4P46D 3OAZH 1UM4H 3MLZL 3W39A 4LCUB 1F3DJ 1PX4A 4Q0XH 3TBSA 1CLZH 5KSVA 1FJ1A 1HE7A 2KH2B 1QRNB 1FL6A 3V7AE 4MQXC 1PKQE 3N85L 3ISWA 3V52L 3LD8C 2XI9A 1GGIH 1RI8A 2XZZA 5L0QC 2G75A 2A6IB 5E8EA 5JLZB 5F44A 3L7FB 1JF1B 5T1LA 2BNRE 4NM4L 4PRDB 4Y1AE 3MLUH 1KLGA 2XKNA 3PGCA 1G7QB 5D71L 2AXGB 1Z9MA 2WV3A 5HYJB 5EO0A 4JJ5B 1R5VB 3L3OB 1I3RB 4HCRH 4OF8A 1OTSC 2QKIB 4GKSA 5FOJA 1R3HA 5KSAC 3P11L 3BVNB 1S5IH 1JIBA 1L7IH 2EC8A 3RHWF 3S88L 4JFHE 1SEBB 2GJ6D 3DXAD 4OLVL 2DQGH 1AE6H 5C0ND 2PYFB 3QULA 1FE8L 4L5FL 1YY8B 4ZDHA 5D96C 4XPAH 2WMPA 1I9RH 3D2UA 1TETL 4PJIA 1H8NA 1JPGB 1ZT1B 4O2FA 4R90L 1HH9B 4L9DA 2APVA 5D5ME 5C07A 3ZKSD 4ELKB 4O2EA 2P5EA 3BIKB 2I9TA 3P9MA 3MLVH 43CAA 5CJXA 3RWHB 5ADOL 3ZDYE 2NZ9C 5AZ2H 4KK5D 4JPVL 1TTFA 4JQVA 3N1MC 1I8LA 2EDBA 3HB3D 4OLYH 1NDGA 3VFNB 1HH6A 3HE6A 3CK0L 4RFOL 5HXMA 4MZ3A 3EO0A 2WIIA 2I07A 4ONFL 2MTPA 4Q9QL 1DQLH 2ATPA 3GBML 3ARBC 5F9OH 4EJ1C 3O4LA 4YDKL 2X40A 5HY9A 5DSCB 5F7FA 1NMCC 1FL5A 4J8RA 4LLVA 1A1MB 5DC0A 3GSVB 1YC7A 5DXWA 5LKNA 1FO0L 1WZMA 4GLRH 2NNAA 1A6WL 2NTSP 1MCPH 1K4DB 1DQTA 4NKDB 4WDIA 4LSQL 4RAUA 1X6NA 2CR3A 1ES0B 3WN5C 1QRND 1B90A 1U8IB 2XZQH 4NQUA 3TYGH 1C5CH 3QUMB 1A4JA 3D69A 1F8TL 3PP3H 2Z4QA 1NUGA 4GRMA 5FOBA 4OZHA 3QG6B 5F7KC 2JB5H 4S0SD 5A3IC 3REWA 2W0PA 5HYJD 3MJ6A 4XXCA 1C08A 3ZTNH 3CFEA 2KUTA 1TPXB 1SBSH 2HFTA 5I16B 4WV1B 3TIDB 4UQ2B 1MAMH 1KCKA 1UWEL 1GIGH 1CFTB 1TQCC 1CD1A 2B5IC 4X9IA 4P2QE 4NPYB 2OZ4A 1ODAA 4EQ3A 4OB5H 1DQDL 4FQXC 4FQHB 5ESAA 1RIVH 4ALAH 1FNEA 4NKMB 1WWBX 1LE5A 5D2NC 2HFGL 4WWKA 4NWUH 5IWLC 2I5YH 4QRRE 1ZKAA 2X70A 4Y5VC 3A67H 5EPMB 3HR5B 1EZVY 5FFLA 1K5NA 3CSYB 5E5MB 3T8XA 2X4TB 5BZDB 4GW5A 1A6AB 1R3LB 5I30H 1RURL 2E27L 3BKMH 2QQNL 3EYOB 3REVA 5I1AA 2VZVA 4UV4L 4GRWH 1KGCD 5FGBA 3QB7C 2Z8SA 4UT7H 4WU7A 5CSBA 4Z18A 3STLB 5KZCB 5HHPA 3DSFH 1F3RB 3AU1A 1B0WA 3PG2A 4PS4L 1JF5A 2GKIA 1BOGA 1FL5B 3QCTL 4OCNC 4BA8A 4FQPA 3IS0X 5B3NA 4F3FA 1CDCA 4U1HB 5EOTA 1ZV5A 5TQ2H 3SPVA 4GG6E 5GRZA 4X6CE 4CVWA 5FO8A 1CFSB 1KB5B 4E41E 1Q0YH 1D6VL 3ARGB 3ARFB 3P9LA 3RU8H 4GS7C 3LPGA 3BEWB 1ZHBB 4ZUWA 5FYJU 1GXEA 5LQBL 4QOKB 4Y4KA 2DS4A 1MPAL 3H9SE 3LSOB 5I8OH 2NY4C 2O5YL 2VB5A 3BQUA 4HJJL 1K4CA 4HKBA 4HS3A 3TNNA 1DVFA 1HXYA 4HQQL 3JTSB 3P0GB 4Z0BL 3U7WL 3IT8D 3PWPE 4Y16A 5I1LB 3RWJA 2ZNXA 5HYQB 1MJ8H 5F7DA 1FYHB 2CK2A 1FL3A 5FHBH 1CFBA 2IBZY 1FC2D 1IRAY 4ZUVB 2BP3A 2EIEA 3CZFB 1KPVB 2ZOLA 5HPMB 2A2QT 1AD0B 4OV5A 2IADB 1NBVL 2BFVH 3HMWL 3OL2A 1OWWA 2FH8A 5ESAB 3LQZA 1P69B 3MRIB 2CRMA 3QYCA 3HPJB 4PRBB 2VSDA 1EHLH 2JJTC 4BSWA 4YAQB 3L5IA 4L8SC 3BJ91 3WXWH 4XBEH 3N1QC 3MZTA 3OMZA 3SDXE 3VRLE 2VLKB 2W0FA 3RUGE 1TZIA 4MX7B 4UTAH 2CIIB 5IB2A 3WHE1 5C0GA 4EVNA 2EE3A 3IVKB 2FHFA 2QR0A 3AXLB 3TLRA 4UDTB 4JPWH 3L3JB 3OV6A 4AIXA 4OZHF 4DW2H 1V3LA 2VDPH 5F7EL 1U41A 4AZ8A 2C1OA 4GBXB 4P3DA 1MY5A 1M6OA 1HHJB 3QUZA 4XMPL 5IB1B 1CCZA 1JK8A 5E6ZA 4QHUA 5L88L 5KZCD 5B3JF 1MIEL 1FZKB 2CLVA 2BC4B 1EMTH 2WAHA 4H1LG 1T6WA 5KW9H 3F7YA 4JGJA 4NNYB 3PWUB 3KPQA 3O9WB 3M17B 5DMJB 5LWYL 5HD8D 3ARSA 1MLCA 5AD0B 43C9A 3NFPA 2XA3A 5E9DE 2JJSC 5E99L 2H32A 4LSPH 5ICYA 5GGSY 5LCVH 3ARGD 1ZMYA 3ARFD 4RGMB 3RI5K 4RMSA 5CUSH 1BZ7A 2R56L 3SE8L 1X5AA 2KL6A 3QWQB 2XQBL 1CDYA 4QOKD 5FAAA 5F7DB 4CL7A 3U4EA 5INDB 3IDXH 1VFBB 1TVBB 4XTRD 4ETQB 1CWVA 1LDPL 5L9DL 3KYOB 3VFVA 1P4LB 2BX5A 1BREA 4OQTH 4PUBL 4O02H 3CZJA 1PD6A 4Y0GA 3DGCR 1YEDA 4X7TB 3LN5B 4PG9A 2CKBL 3KWWB 5IMLB 1W0WA 3JZ7A 1IAII 4PGZA 1XR8B 3L1OL 3FO1A 3O3AA 4HUVA 5KVMC 2FIKB 3WLBB 1O0VA 4K8RH 5I19L 3O0RH 1N6QH 5AWNH 4ODWA 2HLAA 2RR3A 3R8BB 2YD3A 4ISVA 4KK6C 4OV6F 1G9ML 4YJZL 2NY7H 5H94A 3L3HA 1NBZA 2R0KL 1QACA 2AJSL 1A3LH 4LRNL 4XPHL 4EVNB 3QHZH 3CPLB 2LU3A 4I77L 3BWAB 4TUOB 2VC2H 4CJ0A 3PQYE 2GJJA 1LO5B 4Y2DC 4PR5A 5LGKA 2BY2A 4LCCA 5GGTH 1RQ5A 1EUTA 2VLKD 5MENA 1JRHI 4ZTPH 5E00B 4HWBL 2VZ1A 4IDLA 1T1ZB 3FTGA 4Y8AA 3W5MA 3GMLA 1OY3B 5IJVB 4R26H 4ETYA 4JO4H 5F6HI 4LIQH 4PV9B 4XNXL 4L3EE 4P59L 4PJGB 5J11B 35C8H 3AS2A 1UB6A 3SY0B 3CDGA 3PNWA 4GBXD 2J2ZA 1MCWW 5T1DH 4NO5B 1S7VB 4IJ3C 3GK8H 4TVPL 2AV7A 4X83A 4YDVA 1K3ZA 1TCRB 3TT3L 5ICYB 5ERWA 3T0EB 4WW2A 2FD6H 1QBAA 1RUPH 2FX9L 4O00A 1FVCB 3TYFA 3OJDB 3O9WD 1TJGL 2D4FA 3CFDB 1JGUL 5LAXA 3I9GH 4M5ZH 3VFGH 5GSVB 3RWCA 5FDWA 3JV0A 5IHUH 2C7UB 1HHKA 5B38B 3TFKD 3HC3H 3IETB 3I02B 1A7OL 1BFOB 2QQQA 3MLTA 4HKJB 5IQ7L 4YFLI 2CSPA 3EO1B 5JORA 3KPSB 3U9PH 5F6IB 2JK5A 5LGJB 2RFXA 4G6JH 4YXHH 4XCCH 1ZK9A 4HMDA 2WQRA 1JYWA 1INDH 1G6RH 4PJGF 5LJYH 3T2QA 5F7LB 1SHMA 4LCIL 6FABL 3QNYB 3QIUC 5L7XL 1ADQA 1D5XB 4QHKJ 4GAYB 3SDAB 4P2YA 1Z2KA 4UDUB 3QIBA 5EOQH 4AEEA 3PGDA 3C6LA 5SWZE 3FL7A 1OGAA 3IDNA 1C1EL 5FYJH 1A47A 5MENB 4IRZL 5J1SC 5IR1B 2COQA 3U2SB 4FHBD 4YX2H 4R2GC 1JHTB 1A1OA 4ODHH 1U91A 1WISA 4U6VH 5D5MA 1K2DB 1FQ9C 1DBKH 1UC6A 4OCWL 5HSFA 3ULUL 4B7LA 1KCVL 1P7KB 4P5TC 4HXBH 4X99B 4DCQA 4LHJB 1FFPA 1PEWA 4BH8B 4HC1H 1F3JB 4KRMB 5CINL 1V3JA 2HT2C 1W2KT 2A9NL 4GJTB 5IJKA 1ZXQA 2YRLA 3EYQC 4HWZA 4N90D 3JXAA 2PXYA 4QCIA 3QPQC 4PJXE 5FO9B 1QTYT 4JAMA 5F1IB 2AQ1A 1IGJB 2ZCHH 3WJLA 4JDZB 4C83A 2FBJH 3NCMA 5T1MB 2CGRH 2Q76A 1BGXH 1VACB 3D0LB 2DWDA 2FX7L 4IBLT 3T0ED 3KLHD 1FG9C 1HYSD 5I74B 1MRDH 1UGNA 2IEPA 1U3HC 4MAYB 2E7MA 3QZWG 1QLFA 4FQJH 5DD6A 1ETZA 1PKQB 3MMEA 1J0YA 5IEHA 2A6KA 1GPOL 4N0UA 3M45A 5EBWA 4JM2C 3S98A 2H8PB 4G8GE 4MNQE 2IH1B 3F12B 2DMKA 1HHGA 2BNRB 4Y1AB 4DK6A 3PJSA 4AENB 4KROC 4YPGA 1INEH 1YEKL 1NCWL 3DJ9A 5D8JL 3GRWH 2V5MA 4GO6B 4YHIA 4HUXA 3KPSD 5AAMA 3EZJB 2R23A 4HIXL 4DZ8B 5F1KC 1FVEA 5EA0H 1FORL 2YD7A 1LO2H 3HZMA 5DRWA 2HTLC 1GGYA 2R69H 4MAUH 4NGHH 3U36B 1A7RL 1KN4H 1U6AL 4JO1L 1A6PA 1NGWB 2M8XA 2I27N 4HK0B 1P4BH 2BOBB 5CJBA 3SJVB 4WW2F 3NA4A 5HHNB 3GSNH 2B0SH 4NN7B 3SDAD 1QD0A 3BN9C 4M1GL 2V5RA 1YEHH 3MOBH 3DVNB 4XBGA 4GXVL 2XG5A 5MI0B 5DRXB 3PV7A 5MEND 3SKOA 1SMAA 4DGVL 3AC0A 2DN7A 2GYSA 1MI5E 4WHTB 5FUOH 3MUHL 3GMNA 4LPYA 1PFCA 4XNUH 1JYVA 1KC5L 1FZJB 2YK1L 4N5ED 1CGTA 4M9PA 3TVMA 5D1QC 4X4XA 3R1GL 5FYKE 2IALA 3S37X 1I3UA 2AQ3A 3BI9X 2X4SA 2B1HL 4EQ2A 5JXAH 5HJ3A 4P2RB 1SY6A 3BPOC 4UOW0 3HUJA 3PABB 5FKPB 2ITCA 4AEHL 1F4WL 1MF2L 4ZSOE 1GGIL 1PY4A 5DQJA 3KPRE 5DZLA 1QLFB 4ZO7A 1T2QH 4FABL 3A6CL 4GG6A 4WEUD 4X6CA 1AD9A 3QZWB 1QA9B 4QYOA 3S6CA 1QFOA 4E41A 1I7TB 3NZ8A 2FB4L 2PW2B 4KPHL 4MAYD 2CDEB 3D87B 3MREA 4JFEB 4JY6A 3PHSA 2PF6A 4LLQA 1JN6A 4LSRH 2HTKD 4RFEB 1ZHLA 2F74A 2VL5B 3MBXL 3OKNA 1A7PH 2XWJA 4F7EB 4QXWA 3TZVB 4JDVA 4KKCC 5EFIA 1CE1L 4ZTOL 4X6DE 2BNRD 4WHDA 2MHAA 4Y1AD 2AGJH 5E1AB 5E6IC 5HYSA 5IB3A 5IW6A 1DL7L 3OXRB 4FXLA 3INUH 1P7QB 3H3KA 3PWPA 2Z92B 2HJLB 2UVEA 1MY7A 4XPAL 3TC9A 1I9RL 4BK5A 1E4WH 1QLEL 1WC7B 4JDTH 5KAQG 4WO4A 2FR4A 5E0QA 3BZ4A 1YEEL 5I66B 2EZ0C 4U6HA 2P1YA 5EO9B 5SWSB 3FO9B 5CAYB 1B0GA 2BVOA 3V0VB 4P2QB 5H35B 2MJWA 3SJVD 2MKLC 4LSVL 3TNMB 3LKOB 5I17A 3WS6C 3ZYJA 3GSUA 3QCVH 3EOYG 1UB5A 2BXYA 2ITDB 3VWKA 1IGFH 2EDXA 2PR4H 3F6LA 2EDLA 4X9HA 4HPOL 1DBJL 1RUAL 5E4IA 4QRRB 4ODVH 3UAJD 1WUNT 4KRPC 2ZZUT 2DL9A 4K9EH 2N4IA 4L4JA 1YEIH 2CK0L 1JHLH 4RWHA 3HC4L 1NSNH 3NPSB 4F8TA 4KAQH 3VMPA 5E08H 5D2NE 5EU4B 3RUGA 1ZGLM 1OT1A 4KHTH 2HKHH 5DJXA 5ANMA 3ULUC 4PBXA 2OL3A 4WI3A 3VFRA 3BD5A 3DO3A 5FXCH 1DR9A 1KBGL 3Q3GA 1F02I 3VGHA 2BJMH 3C5SA 2OTPA 1RUKH 3OGOE 4P2RD 4ODTH 3WNMA 4WU5B 3N9GL 1TJHH 2XZQL 3TYGL 4E41B 2X4PA 4JFQB 1I1YB 4OI8A 4CRPA 1MCSA 1CLYH 1DDHA 1DLHB 5IMOA 4EI6A 1A6ZA 2QADB 3GMQA 4M7LL 1KEGH 3BZEA 3WFBH 4U1NA 4YHPA 4JFFE 2B39A 3CH1A 3H9SB 3OHXA 1QSZA 2I60L 2VDOH 3N50A 5EFIB 4Y4HC 1GOGA 4X6FB 5F9JB 5DJ0B 2UV3A 4BYHA 2NY1C 1JPFA 1FV1B 3MLXH 4JFED 3RY4A 4L8DB 4R0LC 1VGKB 4FQCH 5T5FH 1MAML 1GSMA 1FAKT 3TZVD 3MJGX 2DKUA 4QO1A 1F11B 4JB9H 3LS5H 1U8MB 1P7QD 3L7EB 3FQUA 4LP5A 3MYJA 4PLKD 1YEGL 4JG0H 3LRGA 4KRNA 1E6JL 1A5FL 1RIVL 4GQ9L 1KV3A 2Z91B 4IRJB 4EI5B 2J12B 4ZO8A 5T3XL 3MBEB 3QXVA 4NWUL 5F3BB 5SWSD 3RKDD 4I4WB 5K9KB 3WFDH 1VENA 5KVFL 1GGCL 2EH7L 4P2QD 4I9WD 4Q2ZB 4B7IA 4IMLA 1MRCL 1UVQA 3LHPH 1BD2B 1U8KA 3IJSB 4U6XB 3SDXB 1QR1A 1DUZA 4TQEL 5I2IB 3RUGB 4WRLA 5FGRA 1MFBH 3SCMC 3IKKA 2APBA 4YK4C 1BLNB 4QRRD 2EDEA 3LIZH 4I2XB 3W2DL 4PTUB 2YSSB 5C0BE 2R0ZH 3PQYA 2OL3B 4O2CA 1MWAA 3HNTH 3GGWA 2DIAA 1A9EB 1PG7H 4HGWA 3QUYB 4AIOA 1I7UA 4OIBA 4IHOA 3C09B 4F7MA 2AVGA 5HVFB 5E5UB 2K3TA 1YECH 2WLYA 3NA9L 2A73B 2IFFH 4LLYA 4S1SH 3MNZB 4NCC1 5GS1B 3BEVA 1JNLL 2ED9A 3AREC 3OKMA 5CMAB 3X3FL 4XRCB 3SQOL 4DWHA 4EIZC 2GHWB 4JHZA 5F7MC 4ERSH 2P8LA 3DTXA 2VLJA 1A4KB 1AQKH 4YO0B 1ZHKB 1V05A 4BUHA 3AY4A 4HH9B 4KK8C 2MPAH 4PREB 3T2NH 5E9DB 4OIIH 2GJZB 3AUVA 5F9AC 4NN5B 3V5HB 4E41D 1HWHB 3L3KB 4W4OA 1JV5A 5FHAH 1KCLA 2XOTA 2YPLA 2QADD 3HZYA 4F2MB 5I1EH 2OXGA 1DQQA 2NX5A 4PTTA 5C0FA 4YR6A 3K1KC 3LRHA 4XBPA 3H9SD 2OTWA 3SO5A 5EUKB 3GSQA 4J3TA 1U8NA 4LCYA 3SDXF 2CLZB 3RUGF 5E4EC 1U8LB 4R4ND 3IDYB 4NUGL 3TO4C 4NYLA 1UADC 3K46A 3GSXA 3U6RA 2W9LA 3GMMA 1YNKH 4XB8A 1EEZB 1N0XH 3H9YA 1MUJA 4WGWB 2X4RA 5F3HA 1YZZA 1T4KB 2FJGB 4JHWH 3WHXB 3I50H 5DUPH 4V1DA 5CILH 4K3JH 4FQLH 3G04B 4QTIH 3Q1SL 3R0MA 4ZAKB 2WBJB 3RBSA 3PP4L 2P7TA 2YXMA 4IRJD 3TH2T 2H41A 4EI5D 3MBED 4FFVD 1BAFL 3OXSA 4GW4A 2GTWB 2FX8H 5C0AE 2H1PL 2BZDA 2H2SC 4Z78A 1OAYL 3WE6A 4BQCA 2YZ8A 3BW9A 4XH2B 5BW7C 3C60C 3PL6A 1PDKA 4PY8J 4XHQA 5DGQA 1H3PH 1KB5H 1BD2D 2B2XH 3GI8L 1ZA6A 4CDGC 1S9VB 4FFYH 4I18B 3Q5OA 3VH8A 2BSSA 5JW4R 5CLWA 2DQFA 4HT1H 1T0NB 4PJ9A 4H26A 4JHAL 4JG1H 4L3EB 4N8VA 4WY7L 3BEVB 2EIBA 3DUHA 3HNSL 3QUYD 1F90L 3MRKA 1U9KA 1NUFA 2OP4H 1WWAX 5LCVL 1I8MA 1HZHL 3O6FB 4S10A 3RY6C 3LEYL 3QJFB 1MHCB 4PJXA 3VXRB 3WIIL 2WUCH 3IDXL 3TWCH 1QHPA 3DVGA 2C4FU 5E9DD 1WZLA 4ZNEA 3RPKA 1NCAL 1N7ML 1B4RA 1U8NB 4OQTL 1U8QA 3ARUA 1A6UH 3IDGA 3ZYIA 3UPCA 1J12A 3H9ZA 3FQRB 1VGEH 5TFSH 3MRMA 3TJEL 1TVHB 4PY7A 5C0IA 4ONGL 2D0GA 3KR3H 3UJIH 5CD5C 3MLRH 3FZUC 5D7SL 4CN6A 1DTUA 3BH8B 5CEXB 1HOCA 4LLMA 4MNQA 3WFEL 4UAOB 1XF5B 4N0FA 1JMZA 4X4ME 3FT2B 4CVZB 1ZT7B 4S2SB 5C0DB 2NR6D 1KJ2L 2BVUA 4K23H 2VC2L 1PZ5A 4IOIA 2V2XA 3VG0H 4ZAKD 2WBJD 4U3XA 1SJXA 2BSED 4OLUL 5CSZA 5SWZB 2DWEB 3FQXA 5DQDL 5KSAA 1CDIA 1ZA6B 5FM4A 2Q7YB 1G1YA 4JO4L 1E28B 5DJ8A 5FV1L 4RRPG 2VIRA 2ZUTA 4ZUUB 1S78D 1MCOH 2I25N 3IFLL 3WYRA 3VRIB 4Z7VE 4RISH 1IGML 5C9JB 1EO8H 2DICA 3GK8L 4BZYA 1NKOA 1NUNB 1ZAGA 3BUYB 1T7ZA 1I9IL 3B2VH 4HIEB 3K4AA 3CFKA 1MI5A 5GISH 4FFZL 5CBAB 1H8SA 2FD6L 4OZFA 3ELAT 3HCVB 1RUPL 1EV2E 4L3ED 4QF1A 4HAGA 4QT5A 4DQOH 1CG9B 2YBRA 4RMWA 3I9GL 3IDUA 3VFSA 1V5JA 3T1FA 5D1XB 5IHUL 5GJTH 2H26A 3OJMB 3O6FD 3BPNB 1O7VA 4ZFZB 3T4AA 2Y36L 1A7QH 2MNUA 4F15C 4F37F 1XIWC 3B9KC 3O2WL 3MPCA 5A2JH 1PZUB 4ZSOA 3VXRD 3VXMA 3ARDB 4P2OC 5DHVB 5HGAA 1EVTC 4Q9BA 2HRPH 4X9GA 1CFVL 5GJSH 3U0WL 3SQBA 4CKVX 4LKCA 4YXHL 4XCCL 4G8GB 4ZPTB 4LLMB 3BDBA 2GUOA 3C5ZC 4WFFE 2DLHA 2V2TB 4DVBA 4M1CD 4D94A 1HHHB 4Z95L 3VGAC 3LD8B 1AY1H 1GZQA 1MCJA 1E27B 1NLBL 5T5NF 4K3DL 2CMRH 4O4YH 2XZCL 1J1XL 2B7DT 3WN5A 4NFBA 4X6DA 5ID1A 3W9EB 32C2A 4PPTA 5F89B 5EU7E 3OG6B 2Q8BL 5FYJL 3DNKA 5I73C 4PGEA 3IJHA 3UMTA 5DT1H 5F72S 4UT6H 3OJVC 4TVSa 2AJVH 4OKDA 5GRUH 3QA3B 4NP4L 2P43B 1WWWX 2DDQL 2J7LA 4N9GA 4GW1B 1DBKL 1MCRA 1G7IA 3MLYL 1G9EA 4W6XB 4H1LH 5BVJB 4XAWL 3BHBA 5H2BB 5SWZD 4OCSL 4L9LC 5F1NB 4DN3L 5JHLL 4HC1L 3O41B 1JPTL 2ICWA 4ODUA 4M00A 5J6HA 2IBBA 1IGCH 2FZ3A 5HVHC 2F19H 4ZPVA 4OZFB 4NKOA 3DGGB 4V2BA 1BM3L 4NQTA 2EDJA 4JVUA 3IGAB 3VFOB 4D9QE 4FQXA 2K9UA 1I4FA 2CRIA 1DQJB 1CR9L 1LP9A 5D2NA 5IWLA 2HH0L 5IF0B 3QI9B 4Y5VA 2DI9A 4JRWA 1T20A 3VW3L 1H3VA 4TSBH 4X4YA 5EBMB 4KRLB 1RK1B 4CMHC 2XN9E 4BUGA 5FO7B 3PDOA 2OX5A 4M62L 4HUWA 3VFUA 1NC2B 5D1XD 3NCCB 3KPRB 5CEZH 3AB0B 4TPRL 2W0KA 3ARBB 3OR7A 3QEGH 1UCTA 2A38A 1D9KB 2QHRL 1INEL 3LPWA 4ENED 3ARDD 2AXFA 3JV4B 1KUMA 4JKPL 4H0GA 5IK3A 2UZIL 1DLFH 4JFFA 1GZQB 1FVDA 2R69L 3IXTA 4G8GD 1MIMH 1OVZA 2R0LH 5CJOL 4OZ4B 4X6DB 5KVDL 1D5IL 3BPCB 5IHLB 2MKWA 4PJHE 1IZJA 3JWOH 5CIPA 4MA8L 5HPOA 1AGFB 3NPZB 1PLGL 4MZ2A 3R06A 4OZGB 2HWZH 2PTVA 3GIZL 2E6PA 4K8RC 4QXUH 4AMKL 3U0TA 4G7YL 3EFFB 3PWNA 4ODSH 5GGRY 3IAQA 2IPUG 2AEPH 1R24B 3BHBB 4H8WH 2VQUA 1C5DB 2AJYL 5FUOL 1IAMA 4P9MH 5K93A 3LKQA 3EOAB 3S34L 3V2AR 5J6HB 1C16A 2QJDA 5DWUL 3O6LH 2FZ3B 1NUDA 1TQCB 3T77B 1EAPB 2AK4E 4NWTH 1A7BA 4U1LB 3RIAK 3S35X 3DIFA 3T0BA 5D7KE 1YC8A 1DEEB 5TGBA 3P4MA 4LLWB 4U2ZA 4LSUH 3BGMB 4AH2A 3HNVL 4OM0H 5DO2D 2VR9A 1T1XA 2JJTA 1PG7W 2XICA 4FP8H 4HX1A 3MOAL 5FYLD 1RZKH 1VFUA 1B0RB 4L8SA 5F1SA 2FIRT 5ECJE 2R8SL 1T2QL 1I7RB 4KY1H 2VISB 4X6DF 4NJ9L 5HHQB 1OSPL 3QI9D 4RFNB 1YA5A 5D7IE 3ULUE 1WIPA 1N2RA 4OGYL 5KANI 2HN7B 3EFDH 4J3WA 5DK0A 3FOLA 2VKWA 4M7JL 4NQEE 1URLA 4ORGB 1VKXB 1QR4A 2DB8A 2G2RA 3D0VA 3SKMA 5JHDE 3ZKMC 1NC2D 1LEGB 1RJZB 3KPRD 4L4VE 3VG9C 3ARBD 1D5ZB 3R8QA 1KEMH 3PV6B 2FHBA 4K3HA 4K2UL 5J1AB 1D9KD 4H5SA 4XVJL 2WWMD 2DQDL 4KZDL 1LO4H 4JDTL 5HYFA 2DQCH 4L29B 5T3ZE 4OLWH 2JJSA 3WCYA 1A2YB 2YC1A 3V6BR 3SE9L 3VWJB 3M1BA 1V3KA 3F5WA 5KS9B 3QH3B 4MA7L 4POYA 3VJ6B 1WBYA 1D5MA 5I1KL 5TDPA 5K9JL 2Q86A 4W68A 1R3KB 3SGKC 3FHQA 4WUKH 3TIEB 3AVEA 4J3SA 1OD9A 2PR4L 5D70H 3HI5H 1DBBH 4NC0B 2GT9A 1RK0A 4POZD 4MJ2A 3U0PA 1KJVA 3DYOA 4ZS7L 1FH5L 1Z0NA 4M61A 4G7VH 2ZOKA 1P6FA 1DUYA 1XR9B 4KAQL 2UVFA 4X9BA 4YBQD 4YHYC 1KCUL 4NQCA 4XAKE 4KK9D 3L6FA 1KN2L 5IOPA 5AZEL 4QXTA 5DEFB 5C0AA 2VERN 3NH7L 5L2KE 1Q94A 4JFDE 3V6OE 1MVUB 4JQXC 1ZS8A 4LVNC 5C0BB 4NZRL 1UACH 4U7MA 1NEZG 5I18H 4GAFB 3KS0H 1FNSL 3TCLA 1S7WA 3C8DA 3ES6A 4NKQB 3VFPA 3FQWA 2X1OA 1LD9B 3MJ9H 2YPVH 1D7FA 4Y2DA 3MJ8A 2ZUQC 5I6XC 5JQ6H 3Q2CA 2KBGA 3GSOA 3MRBB 3MOQA 3ZT6A 4CU7A 5I0ZA 1JI2A 2BY1A 5BO1H 2ERJB 3O6KH 4U0RB 5DR5L 2A9ML 5DRNB 1FSKC 3BDXA 4H5SB 1FCCA 1IAKB 3TA3B 2J5LB 4YWGH 1EFXA 4D0DB 4YFLF 2CR6A 2R2BB 5CWSB 3LB6D 1PAMA 3WUWA 4JB9L 4M6NH 4RQQB 4XMLL 2GK0B 4DKDC 5IM7A 3ABZA 4X5XB 5EBGA 2ILLA 3ARYA 3HAEG 1RJYA 1NAMB 4PLJD 3V4VH 2CJUH 1CGWA 1VERA 5E2UH 5C08B 2ESVE 5DHYB 3VWJD 4Z5RB 3X11A 1MLBA 4NQXA 2KQMA 4L8BB 3QO1B 1T1WA 1BEYL 4M61B 2ZOKB 3NIFF 3NIGE 4N1CA 5FA4A 1I3VA 4HIHA 3MRJB 4Y5YB 3RWDA 1CZ8H 1J1PH 5EZLA 3VGEA 1MNUH 5L8JB 3RAJL 4P46C 3MRRA 2R0ZL 3D3VA 1PG7L 1UXWA 2X4OB 4HKZB 4RA0C 3F7VA 4IEFB 1KXQE 4XPTL 5JNYB 1ZLUK 3C2SA 3QIUA 5DMIL 3P4NA 4HBCH 4YBLC 3QUML 4HIIB 4OCYH 4HJ0D 1YECL 2ZUUA 4NT6B 1WZ1L 1NEZB 1CT8A 1KIRA 1WIUA 2E7BA 1AIFA 3QEUB 4PJAB 5ETUA 1QNZH 4QRSB 1CQYA 5IIEB 4YEFA 3TBWA 1JBJA 3E6HA 1Q0XL 1F2QA 4HDIB 5C0BD 4QY8B 1PJ9A 3T0WA 2FGWH 4U1MA 4RNRB 5DK2B 2PYEE 3H0TA 4TULH 4YC2B 2P8PA 3T2NL 2C1PA 3CX5K 2YD8A 2RHEA 4P0DA 4J1UB 4UT9H 5IV2A 4NOFA 2HRLA 25C8H 3KS0J 5IMKB 1PY9A 2J8UB 5ESQA 5ITFA 3BIBX 3V4PH 3Q6GL 4P5TA 4LF3A 3BD3A 1B4JH 1D6EB 3BP7A 5C0NC 3GB7A 5KVGL 3T0VA 2N1KA 3WUWB 4BFIB 4OGAD 2P5WE 4OCXL 3G08B 3GKWL 4IS6B 4OD1L 4TUJB 4BELD 3GJFA 9CGTA