2I9LB

Structure of fab 7d11 from a neutralizing antibody against the poxvirus l1 protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGAELAKPGASVKMSCKASGYTFTRYWMHWVKQRPGQGLEWIGYINPSTGYTEYNQKFKDKATLTADKSSSTVYMQLSSLTSEDSAVYYCARTTVDGYDFAYWGQGTLVTVSAAKTTAPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody 7D11 light chain
publication title Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system/viral protein
total genus 47
structure length 219
sequence length 219
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2006-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i9lB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i9lB02
1FNLA 4KDWA 3QQ3B 3MMEA 4ZUTB 2YPVH 4I3SL 5H94A 5KZCD 3L3DB 1P69B 1EVTC 1G7HB 1CIDA 5E03A 1A7QL 3HE7C 3SDAD 3T0ED 1R0AH 3CPLB 4FG6C 5DJXB 4ZNCD 1I1AD 5E2UH 1D3CA 4Z7QF 1JZ7A 3NCMA 3NPZB 2R2EA 3OB8A 35C8L 4HLZG 4NC0B 3RU8H 2IPTL 2GJ6E 2IMMA 3A6BH 5F7EL 1SJEA 5CILH 3RBGA 3DBXA 1A6WL 5C0CB 1G9NH 1G7JB 2VH5L 3SDCC 1JFQH 4Y4FA 5HHMB 3V5DB 1MFEL 3V5HB 3FQXA 1IFHH 4JPKH 5EU4B 3BWUC 1VGEH 2YA2A 5JW4R 4L3ED 2FYYA 5D6DC 1BVKA 1W72B 5BRZA 3T2PA 3UC0L 5ICZB 1KPRA 5BJTA 4WEBH 4XGZA 4K7PX 3GDBA 3ILPB 1NFIA 4F7CA 3KAAA 5EUKB 5KANG 1OAZL 4PRPE 5HGAB 3MQIA 3NN8B 5D1QC 3TNMB 4LDOB 3WIHL 3WBDA 1HQ4A 1S7VA 3VFVB 4DGIL 4DEPC 5IIEB 2NY0D 3E1F1 4P46A 1MH5A 1P4LB 1BECA 1RIHH 3BRFA 2X9YA 4OZIE 2ARJB 3VFPA 1NAKH 3NTCH 1HH6A 1IT9H 2J8UA 3LN9A 4JQVC 5T3XH 1G84A 1ODAA 3IVKB 4P9ML 1SJHA 1KPVB 2EDXA 3QCUL 3SKJH 2HKHL 4OZGA 5F71A 1BREA 1WK0A 2Y72A 3QUXC 4QRRD 3ZMRA 2HT4C 4P2RB 1BOGB 5DC9B 2WWMC 5HGBA 1HHHB 5DC4B 2Z93A 4XMKH 5AYQA 1MAMH 4O51B 2BSTB 2W9EL 1LP9A 1YMMA 4PP2A 3FOMA 4X4ME 1PYWB 4PBXA 2EO9A 4OLVL 2VLJA 3PWJA 3QEQE 4JM2D 5I16A 4BSWB 1A5FL 5GZND 3U0PB 2H32B 1VACB 1DQTA 2VSCA 2OR9H 4U6XB 1KCUL 4ODXA 5CEYA 5CEXB 3ZKXB 5IB4B 4DN3L 1LWRA 2I27N 4IOFC 3QI9B 2YSSB 3CVHA 1T66D 2QHRL 4Y1AD 4FQ2H 1B4JH 1LD9A 4MA3B 4HULB 4HWEL 1JF1A 4MA1C 3LN5A 3W9DB 1HXYB 2R1WA 4NOFA 2FX9H 3BEVA 4I48B 2Y36L 3WDJA 2GJ6B 1GCFA 4X80H 3V4UH 5MEPB 2DMCA 3NVQA 3WJLA 1CFQA 5F1OB 3JTSB 1F4WH 1FJ1A 4WW1B 5EIIA 1FSKC 3I6GB 1LDSA 4XPGL 5FIEA 4O2EA 3QAZB 4H1LA 4MXWH 4Y4KD 1CVRA 3QFJB 5DZOA 3VFNA 1HILA 3BKJH 5FKAB 2BSSA 5JZ7C 3GK8H 3SQBA 3WNKA 4XCEA 5F7HA 2Z8WC 1JZ6A 2JB5L 1OGTA 1INQA 5TH2B 1V5JA 4PJDA 4ZFGL 4PRPB 1FZKB 4YHIB 2Q86A 3GSXA 4UTBH 2VLKA 5C0DB 5ESVB 3VFWA 4YWGL 1ZWIA 4XWOC 1UCBH 1JV5A 5L2KA 4QRSB 4CNIA 3QQNA 3VDBA 3V6ZB 2XQYK 4O2CA 3B6SB 1TPXC 5E56A 4OZIB 1I3RB 4G8EB 3P30L 4QNPF 4YHMH 4JFOA 3TIEA 3DXAD 4OCYL 1MCKA 4P5KB 1WVZA 4K9EH 4BH8A 1UEYA 2R1YA 3PWPA 4XHJC 2V7HB 4LLMA 2WNGA 4D9LL 4P23C 1Q9WB 5I6XC 1G6RA 4PRAB 1FFOB 1QBLH 2E5EA 3VXTB 5E94A 4ZFOA 5GGQH 1TITA 4RAHA 1AGFA 1U8MB 5GGTH 4YHOL 3NCJH 4XVJL 1FBIH 1JHKL 1KC5L 4APQA 4Z76B 3QEQB 5DK0B 1OPGH 1ED3A 3FFCA 2A74A 5FF6A 3K81A 3GM0A 4W4OC 1F90L 2XWBA 5I18H 4U0QB 3T4YB 2W1NA 4RWHA 5D2LE 2Y6SC 1FQ9C 4ZPVB 5F96H 1DEDA 1YPZA 1BOYA 3HE6A 4OZ4A 1IC5L 3NZ8A 2J8OA 3DYPA 1XF3B 1X5KA 3ARRA 4S1RL 4XP1L 1WC7B 3CFBA 2HN7B 1YN6B 3H0TA 3RKPA 5HJ3B 2NY4D 5KSBE 3G5XB 3NZHH 4ZODA 1WWWX 5EZIL 4JB9L 2BVEA 3GRWA 5I17B 1BZ9B 1X4YA 3ZTNL 4LVHB 4RA0C 4OLUL 3MLSL 2XZCH 2DF3A 1NCBL 3DX9A 3CLEH 3SCMD 1EAPB 2DQTL 1LEGA 4OCRH 1BFTA 2CIKB 4MAUL 5IMLB 3PJSA 2VERN 3HPLA 5DMIL 3EYOA 1FNHA 1PG7L 2YRPA 4HH8A 4YZFF 1FN4B 5BS0E 3MLRH 4KHXL 3S35H 1DFBH 4X6DE 1ZLUH 1FNSL 3RVTC 5E6YA 3MV7B 2HRLA 1K6QL 3DV4A 4NN6B 2P8PB 2LAGB 5DEZA 2K3TA 4NQCB 4N0UA 5JNYB 4Z8FL 4PV8A 5C0FB 3VG9C 3ZTJH 5T3ZH 5ACZA 1BFOB 1T5WB 3F58H 1YEHH 3QPQD 5IMKB 3MJ9L 5DHXB 3OKEA 4ELMF 4XWGL 4OT1L 5EZLA 2PXYC 1QHOA 3L95A 2WLYA 1PZ5A 3PQYD 4M9PA 3O6FD 3AUVA 3OKKA 2EDTA 1Z5LB 2AJZA 4O4YL 4P2OC 3M17B 5E9DD 3WFBL 3VXRA 43CAB 2E7LC 1J05A 1ORQB 3CSYA 4XP6L 1IGMH 2GQHA 4NRXB 1NL0H 1KSRA 4LHUB 2APVA 5F72S 5EO1A 3GMMB 1UB6A 5D1XB 3QXTA 4UT9H 3VXMA 1LE9B 1J8HD 1JPGB 4WTXA 4JREC 3FTGB 1KPUA 4X99A 3QDGA 4NZUL 1JGDA 1CS6A 1X5GA 3WO3B 3MRBB 32C2B 5H8DA 1IM9B 3ECBB 1BD2E 1EEZB 4IDLA 1XIWD 3QO0A 3RWJB 2NTFB 1GZPB 3OF6D 4NKOA 4PJ7E 2EKJA 1ONQA 5EORL 3KPSD 1CL7H 4KAQL 1D5IH 2ADFH 4YO0B 1J1PL 5J12B 1MCQA 4CW1B 3O11B 2XA8L 5D2LB 5ISZB 2AEPL 2GTWB 4G6FB 3O4LA 2YWZA 2FH8A 4LU5H 5DD1H 2WUBH 3G5VB 1CLYL 2E3VA 1S9WA 4QHUA 5IW6A 3OAUH 4C57C 5DJ0A 5KTEL 2J6EH 2VXQL 2DYPB 1CGUA 3MXWL 3DVNA 2C7UA 3LIZL 3U0WH 5KSBB 5AUMB 1A14H 3QG6A 4AL8H 4BM7A 4HIIA 3BGFC 4NO3A 4M7LH 3VH8G 2E9JA 3W2DL 3REVA 1JRHL 1QSFB 3O3DB 4RGMB 3C60C 1KTLA 2HH0L 2NX5D 4ONHB 5JW5B 1OP3K 2YUXA 4CVUA 4K2UL 1SY6L 2PW2A 4ONOA 1R3LA 1XF4B 5FDWA 1OQOA 3D85A 3KXFD 3EJJX 1DN0A 3HB3D 5L7XL 1WTLA 4IOIB 2WQRA 1NGZB 5FO7A 4KRMB 3V8OA 2C3VB 4RGNE 5E2VL 3IDUA 6FABL 4N8PA 3WSQL 2DTML 3MV8B 4M6MH 2DIBA 2H3NA 2X89A 4WIQA 1MF2L 3KPRE 1Q0YL 2GEEA 4JR9H 2VL4A 4P49A 2NW2B 1S7UB 3HRZA 1U3HC 1W0VB 2X4NB 1F58L 1B0GA 2HJFA 4XPHL 2RFXB 3LEXA 3L3HB 3MLTA 3WIHA 1U8IB 2XIDA 1Z3GH 4NHUB 3MXVH 5C0IB 1I85C 3TYGL 5C6TL 2OK0L 3MBED 3O9WD 3Q3GA 2DQDL 3IJHA 4FZ8L 4KKBD 3DNKA 1GGTA 4OLZH 4IRJC 1NLBH 1BAFH 2D0GA 3K4AA 3HMXH 5IVZB 1IZKA 4HWNA 4U2YA 5DVNA 5K33A 2R2BA 3MRFB 1J12A 3QWRA 4AT6A 5DTFB 2EE9A 4G9DB 1UXWA 1TQBB 2NLJB 1MVFA 3MRNB 5BMFH 4PJ7B 1CF8H 2HFEA 5JW3L 3DHJA 4IM8A 3GSQA 3GMRA 5D9SB 1LO5B 4BQCA 4YHLL 3T8XB 1MCOH 5GJSH 2BOBB 3FN0L 3E6FA 3X12A 3DSFL 1A8JH 2XV6B 1DUZB 5C9JB 2VZVA 2VE6A 1ZANH 5C0BB 1RUPL 4V1DE 3D18A 2FX8L 4NKDB 3BP5A 3T3PE 4JFED 1WIOA 4UQ3B 1S9YA 4XVSL 3RDTB 3PIQB 1U91A 4ELKA 4H0IA 1DDHA 1KT2A 1DN2A 2DD8H 2NW3A 3D9AH 3IS0X 1LEKA 3PL6D 3RIFK 3P77B 2X1OA 5DK2A 3QHZL 3RKDC 4U1MB 5F1NB 3RWEA 3RX7A 5D5MB 1GAFH 5AYUH 4GSDH 1DBBL 3QDMA 2B7DT 3SE9H 1N0LA 1A1NB 1FV1B 4MJIA 4ONGL 4AENA 3RUGA 5CGMA 1CLZL 1I8MA 3CFCL 3VWJD 2V2XA 3MRMB 5LGHH 2QSCH 4N1HB 1H3UA 1YMHB 3NAAH 4P4KD 4XH2A 5T33H 4BQBA 1FL3A 1GPOL 4HPOH 4JAMA 3WDHA 2CDEA 5AD0B 5BZWA 2NY5H 5CJOL 4YBQD 1VENA 3FB7A 2JF1A 3F7YB 4NJ9L 3SDXE 3OJMB 1AFVL 1CTOA 3S96A 1CDJA 4YFEA 1JN6A 4J4PA 3ARGD 5E2WH 1U3ZA 1RULL 3OJDB 4NRZB 2NY2B 2AV1A 4HFWB 4LASL 3WFDL 1CE6A 5I75B 3GHBH 2GFBB 5TDNB 1EGJL 5T1KD 3GHEH 1Z0MA 4Q9BA 4XXDB 1FFPA 3C5ZC 2NY1B 5EZJB 1A7NH 4AG4L 5ACLA 1S5HA 1YEGL 1YEEL 3OKDA 2AJYH 4LF3A 4D0CA 4JFXA 5JOPE 5CWSB 4Y2DC 1E6JH 2NY7H 3CXHJ 2GSIB 5IB3A 3Q6FB 4H88H 5D2NB 3QXDA 2UY7A 1MFDH 2HA1A 1GHFH 4P2YA 4ODHH 1F3JA 1EHLH 4TRPL 1AJ7L 5HGDB 4TYUA 4TOYH 4N1EA 1U8QB 1KFAH 1EXUB 1NFDE 3WJJA 1YJDL 2GAZB 1SEBA 1DBJL 2W9DH 3G6JE 4X5XB 4RMWA 1JBJA 3GSRB 4J8RA 3EOAB 2HTLC 2NXYC 3EIFA 3EO1B 4LEOB 1JNLL 1ZV5A 3ES6B 4HSQA 1FNGA 4ZG1A 4FTVB 4GW5B 4KV5F 1RUKL 4OQTA 4Y7MA 3MRQB 2PNDA 4ORGB 4PJIF 4JKLA 2BNRB 1FIGL 2FHBA 1C16B 5D7LE 3O0RL 4QYOA 1A6AB 3MV11 5E5UB 1P5VA 2J3SA 3HS0A 4Y4FC 4C55A 4F9LA 3HI6L 1DP0A 4ODWB 3GB7A 5CJ8A 2R0LH 4HJJL 1QRKA 1NBZB 5J11C 3Q6GH 5C09B 1VCAA 3CSBA 4X8JB 1QHPA 3IDIA 3L7EA 3IS1X 4K07A 1MCEA 4WHTB 1ZLVH 4GKNB 1A0QH 3CFJB 1SYSA 1XCQA 1G7LB 4AK1A 4EUPA 4O2FB 3D39B 3TH2T 5IR1A 3NCCB 4P46C 3KJ4B 1BWMA 1J0YA 2VXSH 2DLHA 3DOSA 3OX8B 3SDXB 3NA9H 1TVBB 1U8PA 2BNQE 3U7AA 1IQWH 3KPQA 4OB5L 4MMZC 5GS1B 3RZCD 4NO0A 4PJ9A 1ZA6A 4PRHD 1BP3B 1CU4L 4WENB 3ALWA 2V7NA 3R8QA 2MKWA 2QQQA 3WUWG 3BP4B 1EO5A 5F6IB 1LDPL 1Y18B 1QSED 5EO0A 2B0SH 4ERSH 4F7PB 4PJCE 3QCVL 1HIML 3FQRA 1MHHA 3H42L 5F9WB 2FJHA 4MCYB 4XBGA 2AP2A 3MRCA 4OCSH 1NBQA 5HVFB 4LSRH 5HDQL 4I5BB 1EHNA 1K85A 4YHNA 2A9MH 4JQIL 3WEXA 5GRUH 2B5IC 1L0YA 1NFDB 4ZPTA 3MGAA 3P11L 3K46A 3GMNB 3DO3A 3STLA 1E27B 2V5RA 1WAAA 3MRDB 3FQNB 4MA8H 1D6VH 5BV7B 4DZBB 4KTYA 4S1QH 2BFVH 1A6ZA 4GMSH 1YA5A 3T0EE 1W72H 5FHAL 2CLVB 2VQTA 4K71B 3JWOH 1F2QA 1AGCB 4X6CA 3QQ4B 4NCC1 4UUJB 4PB9L 1C5CL 1BVLA 4ZNEE 3KLHC 2NYYC 1T7XA 3IDMB 4ZFFA 1NCWL 3A67L 5DVKA 1DVFC 2AXHA 5TF1H 5IFAL 4PJFA 2OI9C 3F12A 4PJBA 3RVXD 4G9FB 4FQJH 5FHBL 3ULSB 5I76A 1JGLL 1KENH 2ITCA 5ECJE 3ABZA 3MUGA 5KVMC 2MKLC 2BHUA 4UIMB 5HYJA 4L3EE 2FBOJ 3TIDA 5C0GB 3BH9B 3IU3A 3MRRB 3TT1H 3SJVA 3NIFE 4A2LA 4PJ8B 3ULVL 3FO2B 4IJ3B 5IW1A 4QRPA 4G8IA 5TQ2H 5GGVY 1T22B 3PGFL 1KLFA 1OB1B 1HHKB 3HCVA 5JORA 5TE4H 1U93B 2P4AB 1RJYB 2HJKA 1BBJB 4YX2L 3GBNH 1TXKA 4JFZH 5F97E 2QHLA 3RQ3A 3LRHA 1N4XH 4Z5RA 3GJFA 5C0EB 3HFMH 2H32H 1R3JB 3EOYG 5FM8A 2VDPH 3KYKH 1CYGA 5CLTA 3MA9H 4OI8A 4M02A 1OQXA 5IHUH 5JIPA 4QRRE 4YR6A 3FZUD 3NGBB 3QUMB 2IF7A 3KPOA 1NLDL 1FHGA 1IC4H 1IGTA 3BN9D 4JN2B 4R8WL 4MYWB 3DMMA 2HKFL 2V5SA 3BZFB 1J5OH 1AHWB 1ETZB 3U9PH 3G5ZB 5HTSA 3G9VA 3KGRA 1U8HA 5L6YH 2RQ8A 2I5YL 3AC0A 1FZJB 4PGEB 3R0NA 5DUML 2IQAB 3UJIH 4Q0XL 1VPOH 3HE6C 1RZIB 4GG6F 2Z8RA 1RZ8A 1NCTA 5SWSB 3QYCA 5I1JH 4GXUN 3RIAF 4LNRA 4Y1AE 4Z7UE 3GSNB 3OKNA 4HIHA 1OW0A 1EFXB 4R0LB 1BJ8A 1SEQL 1N59A 3ALPA 1CCZA 1I1AB 2BP3A 5C0RL 5J9PA 4M9OA 5GSVA 3D0VA 3VFMA 1CN4A 2IBZX 3GSUA 5BQ7A 4FQ1H 1DR9A 5EO9B 2EIEA 3BDYL 3X3FH 2BY3A 3VFSB 1BEYL 1DANU 5ENWB 2A0LC 5IEKA 4DUWA 4IIQC 4GG8B 4LSUL 1P6AB 4I0PA 3O6MH 1FZOB 2ADJA 4WW2F 4WTZG 5E08H 4YE4H 4DFIA 4GG6B 1ZS8B 1M7IA 3BN3B 4ZOAA 4FABL 4CJ1A 3L9RB 5GISL 4FQLH 5DRNB 5I74B 4MJ6A 1ZA3B 1MJ8L 1MWAB 5HI5D 4NO5B 4M6AA 3SY0A 4KI5D 2W59A 3EZ8A 1JYNA 3LKNB 4NNYB 1N2RB 1I4FB 1OAYL 1FFQA 3BGMB 3D69B 2OL3B 3EOBA 2OTWA 1S3KH 1SHMA 3C6LA 4HMCA 2FX7H 4TVSa 2ADGA 3PV6B 3FO1B 3QZWA 3WIIL 5F9JB 3D3VD 1FVEB 2P5EB 3BPCA 4GQ9L 4WO4D 4P9HC 3UBXA 4Z77B 5E4IA 2NY3D 1S7WA 1P7QA 4E5XA 3DXAE 3DUUA 2VQ1B 3D0LA 1N6QH 2HLAB 3BHBB 1D9KA 4HC1A 2H26A 4JHBA 1W8NA 4HUNB 2ZOKB 3Q5OA 5DD5H 4PLNC 2Q8AH 4V2CB 1NJ9A 3WYRA 1M05B 2B1AH 2C3GA 3UPRA 1YEJH 4HXAL 3N06B 3BKYL 4FMFA 2A6DA 1A7RH 3MNZB 3AAZB 4EOWL 4KK5C 3RTQA 2PTVA 4AEHL 2D0FA 3BZ4A 1T1YB 4TUOB 5GZOC 4OUUB 2VABA 4LRIA 1T0MB 2Z31C 5FYJL 2PCPB 1NC2D 1OD7A 4JHWH 3S36L 4NN5C 3OHXB 43C9A 4DVBA 4JRXA 1T5XA 2A6KA 1C5DA 4HH9A 2FO4A 4XTRC 5JHLH 4CU6A 1QFUH 3VG0H 4NZDA 4NN7C 5D7IE 1J87A 1WGOA 1NCDH 2VZOA 3T4AB 3QNZB 2D0HA 1VB9A 2COQA 3DGGA 5GSRB 3ZT5A 4QTIH 2XTJC 4JDVB 2P43B 1CFVH 1AGDA 1ZEAH 1TETL 3VA2C 3BYTA 3GBLA 2ERJC 3QDJA 4JCMA 4WFFE 3S5LA 4LBEA 2WWKT 5F9OL 3QIBD 4J3UA 3PXHA 4RMQA 4LVOC 4YDIL 4QHNB 4DQOL 3KPTA 3BSZL 5L88H 1INDL 1YC8A 3TNNA 2ITDA 4KROC 5CZVL 5DQJB 1GGCH 1RIUH 4F7TA 1S7XA 2GTZA 1GOHA 5EN2A 1QBMH 3EYFA 3BP7B 4CDHA 2FECL 1MRDL 5DJ8A 4TNWK 3JV5A 4RMRA 3V6FB 4HKZB 3F5WB 4KK9C 1MY5A 2XWTB 5J06A 5DJ2A 3WNNA 3MLVH 3LB6D 3PP4L 5JO5A 3GJEB 5E9DE 2AEIT 3L6FB 1WIUA 1I3VA 2IPKB 5GRVL 3S97C 1D5BA 4FFYH 3RU8L 4HWBH 3Q5TA 3JV0A 2NQCA 5DGQA 4U6HA 3S37L 4HS3A 4GRMB 4KVNH 5CILL 4MA7H 5JMRA 1MCFA 3VD7A 3J7HA 1G9NL 5HDBF 4FFVC 1N5AA 1J8HE 1FNEA 2JK5B 1CGXA 1UWXK 3QA3B 4KWUA 5T1MA 3UYPA 1BBDH 1DANT 3FRPA 4JPKL 5F7FA 2DBLH 4X5LA 4S1DD 1QFWI 4MSWB 2YMXH 4YNYB 3LKSB 4FFWC 4YHKH 4MXQC 4WY7L 3LKRB 3BESR 2EO1A 5HPMA 2HJLA 5AEAA 2VITB 2DQJH 1XGYH 3KPSE 3SKNA 4F2MA 4Q2ZB 1A9EB 1R5IA 5EUOA 2QTEA 1V3JA 3BPNB 2BNUA 3IAQA 3N0PB 3AMLA 4LSVL 4PY8J 3U7YL 5HYSB 5DRWA 3UTQA 4MAYD 2GI7A 3NTCL 1Z0NA 3U6RA 1P84K 1HHGB 4UILH 5D7IB 3ZSTA 4OZHE 3BMVA 3IFLH 5E1AB 1TQCB 4GW4B 2NY4B 1KEGH 3WS6A 1VEMA 2J88H 4QXGL 1KJ2L 4HKXA 1KIRA 4FQCL 4QCIB 3MYJB 3VRIA 2VLKD 3EJYC 4ZUWB 2KH2B 4RZCB 1BQHA 4EDWH 4X6EA 3TH4T 4RIRA 4LKXA 3TV3H 4XMKL 1RZGB 5T5FH 2NX5E 3CH8A 5I2IA 5F3BB 1IARB 4G6AC 3OQ3B 3LOWA 3S4SG 5DFVD 2AEQL 1MHPH 1N8ZA 2WINB 3KXFE 3QJHB 4PV9A 4I18B 2OR9L 2JCCA 1SMOA 2NY6B 3PWPD 3AROA 5KG9B 1HYSD 4J4PC 4BJLA 1IGCH 5C3TA 3RBSA 5I9QC 2ICES 1AIFA 1WT5A 2X10A 1X7QA 2LU4A 1J18A 1QFWH 1KF9B 4FA8A 1I1RA 1S9XB 4LLUA 5DO2D 4FQ2L 4X9IA 2RCSL 3UTSD 2ZG3A 3C2AL 2CGRH 3KYNA 1MFAH 4YDJB 5M94B 1LEIB 2QR0A 1KJMA 5E9DB 4P3CH 5FA3B 4P5MB 2FX9L 4APQD 4AIOA 5B38A 5ICYA 1MCIA 5E8NB 2PYED 5DJAA 2NNAB 3DUSB 5T1LB 1PY9A 4X80L 3V4UL 4B0MM 4TULH 4GH7B 2X1WL 2VZSA 1S7SA 1F4WL 1L9MA 1ZTXL 1BHGA 3HAEB 4LFHD 1J0KA 2VXUL 5JLZA 3QH3B 2APWA 5D7SL 3WJJC 4HLJA 3BKJL 4HK3J 1MI5E 3EYVB 1F6AB 1EO7A 2B1HH 3GK8L 5HVGB 3DO7B 3ARQA 1KELL 1TZGH 3HE7B 1F5WA 3MLZH 1KEMH 4N0FB 5EU3A 3ISWA 3LPGA 3O3UN 1F6FB 5L2JB 4ODVL 3MGOB 1DTUA 2DM7A 5A1AA 1UCBL 4PJ5E 4HEME 4X83A 5TE6H 1IGJA 2CLRB 4PRDA 4IRSA 4MVBD 2NPLX 1I9IL 3W0WD 4RCAA 3AS0A 1A7PH 3SDCB 2GHWB 4C83A 4F9LC 2BCKA 2ILLA 3ULUL 4JFEE 4HWZA 2PN5A 1CDUA 4LPYA 2AJ3B 4OM1L 4OLYH 4X4MA 3UDWA 5DURB 1TCRB 3FMGH 3VCLA 1MLCB 2WQ8A 4G43B 4O00A 1AGEB 2JJVA 1FO0L 4D8PB 3QXAB 1XZ0B 5D1QB 5GGQL 5GGTL 3PABB 1F4XH 4DEPB 1JJUA 2D7TH 1OTTD 3NCJL 4DFHA 5MEND 5CSGA 5TE7H 15C8H 1FBIL 2YD2A 3TPKA 3ZKNC 1TTGA 4K8RL 1OHQA 2VISB 1PG7W 1ITCA 3MCG1 3VXOA 3FT3A 2ZG1A 4NCC2 3RVUC 4E41D 1A02N 4G42B 3B8YA 4PTTB 5F96L 5D6CA 3QUXB 3MNWA 1WV7T 1IAKB 4P4RB 5DD0L 5J56B 3FO0L 4KMTH 5TDOB 3V9FA 3VI4E 1RK0B 3KYOA 4M1GH 3NZHL 5DXWA 4YGVB 1KIQA 1E0OB 3CLEL 5C7XL 2DLTA 3INUH 4OCRL 4YAQA 4R4NC 2FATL 2BOCA 5DMGC 2VDRH 3NCEB 3OPZL 4U3XA 4H20H 2B8OT 2CKBB 1C5BL 2KUTA 3C6SA 3S35L 3HZMB 5JTWA 1MI5B 3V2AR 5SWZB 2F19H 4CADA 3TBTB 2FD6L 4MA1B 5BVJB 4KXZH 2FSEA 4ZUSA 1V7ML 1Y0LA 3DRQA 1IZJA 2X70B 4JANA 1YEHL 4OBRA 4GRWE 3QIUA 5IKCA 2XN9B 3KG5A 2EDKA 3IXAA 3ZE2F 3IF1B 4I4WB 1WICA 4MMXC 4PJ5B 3V7MA 1IAII 3TVMA 5HHPA 4PRIA 3D2UB 2E8ZA 3IKCB 3TPUA 2A2QT 5AZEL 1DQML 1K2DA 1NL0L 1YEKH 4RX4D 1FP5A 2AABH 3CLFH 3GIZL 3OBAA 2ATPB 1PKQB 1JPTH 1WCBB 4KK8D 4NGHH 3CFDA 2BDNH 4UDTB 2XACC 4EDXA 4YDVA 2LFGA 5HGHA 2X89D 3RGVA 1F6LL 5F7DA 2XA3A 3ARPA 2PW1B 3CUPB 4OV6F 4WHYG 1GJIA 3NACL 1G9EA 5D72H 1XGPB 2VLME 3CK0L 4ZQKB 4KK6D 1PQZB 1I1FB 1TPXB 5MEOA 1VGKA 3MFFB 3P4NA 3ZKMD 3WFCL 5KAQF 4EKXA 1BVZA 3MV9A 1KXTB 4LU5L 5DD1L 3TT3H 4P0DA 2R56H 4PRHE 1A4JB 3QWRD 5DS8B 4HBQA 2J6EL 4FHBD 1T1WA 2YA0A 4HS6A 4G6JH 1IAOB 1KIUA 5KVGH 5EOTB 5BS0A 4X6DA 4AL8L 5JQ6L 3SPVA 5F88B 1QSEE 4LAQH 1QR1A 5DJZB 4M7LL 2HFFA 4DK6A 5D93C 4M8QA 1NDGA 3DMMC 4JVPA 1IAIH 3MREA 4KMLB 4Y4HA 5CSZB 4YIQB 5BV7H 4LP4A 1CICD 3ARFA 4IMLB 1HN1A 2ZUWA 5I1DB 3DWTA 4LFHG 3SOBH 5ID0A 2VWEC 2V2TB 4P59H 1CBVL 4H26B 3MBXH 4MNQB 1M7DA 5LWYL 4QOKB 3SGEI 2AK4A 1Z9OA 2VOTA 2YBRA 4G8GB 2WLZA 1E4XI 1CG9A 4KRPC 3UP1A 3W81A 2GIYA 3LD8B 1HKLH 1OD9A 5IFHL 1YC7A 1KCVH 4QWWD 1OW0C 2Y7QA 4IEFB 1OM3L 4WV1C 4GRWB 4M6ML 3PNWB 4XZUB 4IRZL 4YDKL 3QEHB 4DCQA 1NFKA 3QDMD 3VFOA 2ZCKH 3ETBF 5DWUH 3P0VH 5MERB 1JZ5A 5SV4A 5HI4C 3CZFA 4J1UB 2Y5TA 3IDYC 1BD2A 1Z3GL 3NCFB 3MXVL 4WU5B 3T65B 3QUYA 3U46A 2HT3C 4I0PC 1X9QA 2DTSA 3WNLA 1JZ3A 3RPIA 5A2JH 2MHAA 5CMAB 4GKZA 4PRBA 5CHNB 2MCPH 4XNMB 1S78D 4NUGH 5K59E 4OLZL 3QUZC 1NLBL 1BAFL 1MVUA 2V9RA 4KHTH 3VWKA 4C56D 3AREA 3N9GH 4M5YL 4LP5A 3IETA 5DRZA 1FYTD 1XCTB 3BT2H 1KJ2A 1MY7A 2DJ4A 4WI8A 2PXYB 3IJSB 3IJYA 5BMFL 4P2OB 1BGXL 4Z7VA 3C6LC 3RX8A 1LHZA 1R5WA 4DUVA 2HFTA 3OGOE 2G2RB 5GJSL 3OAYH 5C8JB 3OAZH 4U0RB 1D6EB 3WE6B 2FLBT 1JNHB 3DIFA 4QHKJ 2AQ2A 1QBBA 5ANME 3SGEH 3S9DB 1EBPA 4JY4A 3WNOA 3RZCB 4JREB 1D9KC 1E4XH 4PRHB 4Y5XB 1YY8A 5CFHA 5DSCA 3DARA 4HUUA 2P42B 1S7RB 4K3GA 2DD8L 3ROOB 3CX5K 4MX7B 5ALCL 3T77B 4A6YL 4ZD3H 1UADC 1F3DJ 1Q9OB 1G9MC 4KUCF 2PYFA 2XICA 1ACYH 3GSNH 4GSDL 4LLYB 4ZFZA 4HIXL 4MD5A 4MS8C 4FQXD 2BSRB 4NBXB 4JFFD 4JGUA 3UPAA 4JFYA 4PG2A 1UH3A 4U1LA 5LXGH 4J3SA 4LRIC 5LGHL 3KPRA 3KWWB 4TTDD 3IFNH 5HSFA 3T2OA 4UV7L 4H0GA 1YN7A 3OKLA 1FH5L 4H8WH 4XPBH 3TO2A 3I75B 4BSVA 4TVPE 3U0TB 5I1AB 3HLAB 3P9LA 4FXGA 5J7CC 3GM8A 1JPSH 4HUVA 4ZAKD 5CP7A 5I1CH 2J4WH 4U1KA 3SGJA 5SX4I 3BGFB 4D3CH 1ADQA 3DETC 4LHQB 2H6PA 1DLFH 1JWMB 4L3CB 5JMOC 3C60B 4WUKL 4LCIH 4Z7WA 3GHEL 4LK4A 3BP6B 2HRPL 3M45A 3SKMB 4NQXA 3LV3A 1A7NL 3MOBL 3QULB 1T0PB 4I2XB 5IOPB 1I9EA 2NY7L 3EFFA 4TQEH 4X8XA 2FO1A 1NMCC 5F21B 4H88L 4QXUH 4GAJH 4OZFG 4EXPX 1MFDL 3JWDH 4PJ9D 1EHLL 1T20B 4BKLB 1X5FA 4TOYL 4LLDB 1NC4D 1KFAL 1HHIB 2FJGA 4WCYL 1ZAGA 3JV6A 4V1DA 2ED7A 1I7TA 3CSPA 2W9DL 1RHHB 3G9AB 5FGBC 1U3HB 4KI5E 1DJSA 3V79C 1I8KB 1FO0A 1UJ3A 5DHYB 2UV3A 3BOVA 3L1OH 3O3EA 4PR5A 3TCLB 1YNKH 3MLYL 5D1ZA 4YFLF 1KLUA 4MHHG 3HC0B 4NC1E 4UINL 4UT7L 4I1NB 3D3VE 3CZJA 1GL4B 5ANMB 4PY7B 1QRNB 5TFSL 3JWOC 1XH3B 3FAXA 4IRJB 3A6CH 3NCYS 2W60B 3FO9A 5KSAA 2C1PA 4OIIL 3PHQA 2GT9B 3T1FA 4WUUE 5I0DA 3FCTB 2IALB 1QO3B 5SX4H 5E2JA 4PY8I 3M1BB 3RA7L 3QNXB 5E2TH 3IU4H 1KCLA 3HPJA 4S0SD 2F74B 2HT2D 1A0QL 3BH8A 3MR9B 3QEGH 2A6IB 1B2WL 3LS5L 2ZUVA 4Y88A 2Y5EA 3ILQD 3MFGB 4OGXH 1W2KT 2PO6D 5J89A 5JOEA 4LGSB 2VXSL 2OZ4L 4NQDB 5HPOA 1NSNH 1ZHKA 2N7AA 1EZVX 5KVDL 1FGVH 3TESA 1MHEA 4ODBD 4AJ0A 5F89A 3NA9L 3QRGH 3HG1A 3BKMH 3IXTA 2X05A 1JUFA 1IQWL 5HYJD 1GSMA 1W0YT 2XZAL 4YC2C 5AAWA 4U7KA 3EFDL 4OM0L 5C0JB 4F7EB 1CZ8H 3ARUA 3QEUA 2ZPKH 1XR8A 3TJEL 3QDHA 1OWWA 4Z78A 5IFJA 4NDMB 5D7JD 3JV4A 3FQTA 4LRNH 4N68A 3AVEA 5FCSH 3TWCH 3UTTD 2UWEF 1A3LH 3WLWC 3G6JA 1FFRA 2Z91B 1DQDL 5JW4N 4OCSL 5E8PB 3BQUD 3S4SB 2A9ML 3SQOL 5GRUL 3EDJA 1WT5C 2IC2A 5GJTL 1CI5A 2H1PH 4OZGE 3VFUB 5D7LA 1AR1D 4PJHF 4Y19D 1Q9LA 2ICWJ 5I66B 1E28A 5DVLA 3PDOA 1M7XA 1OAKH 2XRAH 3C5ZB 1D6VL 4XNQA 4TNVK 4DKAA 4L8CB 3DLQR 3TBVB 1YMME 5IQ9B 3RWGA 1WWAX 1Q94B 2VLJE 4NZRH 3MOAL 4F9PA 3T2NH 1QQDA 5FM5M 2EICA 4ODUA 2UWEB 4Y2DB 3TN0A 4L4VB 2NY3B 5SWQA 5TQ0L 4OI7A 3EJZD 4PLJC 4CRPA 5C07B 1F00I 3B3IA 3LSOA 3LKOA 3OTTA 4MGXA 4WUUB 1T21A 3R0MA 1YNTA 3MMEB 5H94B 1Q9KA 2BJML 1U92A 3QG7L 1SBSL 3BD3A 3TJHC 3WNPA 1A6PA 5BO1L 4DKDC 1VEOA 4HJ0D 2EH8L 5B39G 3G5YA 2BNQA 2R2EB 4EQ3A 2MFNA 4D0BA 5TQ2L 1VFBA 2DLEA 1TJIH 2VZUA 2Z9TA 1HNGA 1SJEB 5TE4L 3ARZA 1N5YH 1JHTA 3T04D 5FYLH 3DBXB 3T0DA 4IRSC 1CGTA 2GK0A 4BH7A 3LEVH 5KVFL 3L3KA 4RBPH 2NCMA 4Y4FB 4P5TD 4ZYKA 1WITA 2CDGA 2QQKH 3GBNL 2AK1L 3FQXB 4TN9A 4JFZL 4X4XA 4PJCA 4DW2H 5J11B 2FYYB 1BVKB 5BRZB 3QIWA 1KPRB 5BJTB 3OG6B 2VDPL 4XGZB 2IAMA 3RY4A 3U7WH 3KYKL 5MP6H 4HKJA 1NFIB 4F7CB 1R3KA 4PJDE 3ZKQD 2VNCA 5IHUL 2Y1VA 3LQZA 4OD1H 1NMAH 3MJ7A 4JO3H 2VLKE 1LP9F 1X4XA 4NZJA 1HQ4B 3GMOA 1S7VB 3GSOA 1I1YA 1RIVH 1S7QA 4P46B 1MH5B 3RWDA 3CXDL 2CO7B 2RAMA 1G0XA 4P3DA 3CNKA 5EBLA 3VFPB 1HH6B 5JXED 2MPAL 4MB5A 2XXCB 2J8UB 5GXBB 1WZKA 3SDAA 5L6YL 4FOMA 3T0EA 1MCWM 5CP3A 5IF0A 1SJHB 4LVHC 5DMKA 3PWPE 3S8WA 4Q9RH 4KY1H 4OF7A 5HBBA 4OZGB 1VPOL 2IJ0C 1LVEA 1JGVL 5CIPA 1FYHB 4Z7NF 1JWUA 1T2XA 4ZNEA 3HAEH 1PKOA 5HGBB 4L1HA 4M7LT 2Z93B 3ZE0E 3C8KA 3UTSE 5J13C 4CMMA 1LP9B 3PP3K 1AY1L 1YMMB 4PP2B 3EYSH 2O5YH 3FOMB 3KLDA 4PJAA 4R4FL 5FOBA 5JUEL 3VJ6A 5F3HA 5CZXD 5C0AD 2VLJB 3S7GA 3I3DA 2ZJSH 3PWJB 3RTQD 5I16B 3GI9H 3LQAL 4FQ1L 4L3EA 3S3SA 3L7FA 2EH7L 4ODXB 4GBXD 5FGSA 1P4IL 2F58H 3K8MA 3DTXA 2EXYD 3SN6N 2Y06H 4LVNC 2B5IB 3CVHB 2DQEL 1WWBX 4YQXH 1LD9B 5E08L 1OTSD 1RFDH 4YE4L 1JF1B 5HHNA 3LN5B 1CQYA 5K9KA 2R1WB 2F54D 2ZWLT 3PDGA 3BEVB 4WFHD 2RIKA 4A6YA 4C58B 2FCBA 2ADIA 3QIUC 4WWKD 1J9CT 4QRUA 4UTAL 2WWKO 1JL8A 5D1XC 2DJUA 2R29H 1P7KA 1G0YR 4ZSOE 2BXZA 5EBMA 4BK5A 1CFQB 2E7HA 4YEFA 3ARWA 1FJ1B 5EIIB 4OSUH 1S3KL 2FX7L 2OM5A 4O2EB 1OL0A 4QRRA 4H1LB 1BZ7A 3W0WE 3EO9H 3VFNB 2OI9B 3O41A 1HILB 1CLOL 4K23L 3GUTA 2VIRA 2BSSB 1AD9A 3O2DH 3PWVA 4XCEB 2YN5A 1OGTB 1INQB 3B9EA 4PJDB 5KSVA 4X9HA 4GOSA 4QO1A 4JM2A 2Q86B 1JYXA 3GSXB 2BSED 2VLKB 5DD5L 2Q8AL 1OT1A 1CD9B 2VTFA 3F7VA 3VFWB 1ZWIB 2GW5A 2B1AL 1JV5B 4HW6A 4FNLH 5L2KB 4CNIB 1IMHC 1P4BL 2OJZH 3O6LH 2IEPA 4YXKH 3ROLA 2BC4A 4OTXH 2PKDA 4Y5VA 4O2CB 5MENE 3OB0H 5BXFA 4UV4H 1A7RL 3HI5L 2P7TA 4Y1AA 1NCNA 4Z7UA 3IYLW 3F6LA 4JFOB 1YUHA 3TIEB 4MCZA 5EG6C 2JIXD 3MJ8A 1DQLH 4BH8B 4QHMA 1LO2H 1YPZF 2R1YB 3PWPB 4LQFH 3T0WA 5DZLA 4LGRB 4E41E 4LLMB 3VXUD 4ONFH 1NGPH 4FFZH 1OVZA 4LCWA 1G6RB 4JHWL 4PLOB 4GKSA 4OCWL 4WRLA 4X6FA 4CGTA 12E8L 3MPCA 1N64H 3U2SA 4BQ6A 4PJEF 3VH8A 2CKBH 5E94B 1TJHH 4ZFOB 5JHLL 1QFUL 3NIDF 3VG0L 1AGFB 3OGCA 4NO2A 4F57H 1NCDL 1CXHA 1AE6H 4CN6A 4APQB 1IGYA 4Y4KA 5C08D 4AEFA 1ED3B 2HTKC 3K7UA 4Y4HC 3FFCB 3HNTL 2A74B 5FF6B 1HOCA 4OI9A 3ARFC 4N8VG 3O2VH 5F7UA 1OGAD 3CH1A 2XWBB 2X9WA 3K4DA 4MJ5A 5SV3A 1RJCA 1ZXQA 1UM4L 1CFSA 3O4LE 4NKMA 4BZ2H 4PUBH 3IDXH 1YPZB 3X3GL 3HE6B 4OZ4B 4LKCA 3NZ8B 4ZS7H 2AVGA 1EEYA 1X6NA 2DQIH 4KH2A 3CFBB 4OIAA 4N5EC 3H0TB 3JZ7A 5EBWA 3P4OA 3DHMA 2AJSL 1QKZH 4MJ2A 1EPFA 2FJFA 3DX9B 3DXAA 3TYFA 1AO7A 1A1MA 1LEGB 2QQNL 3B5TA 5IVOA 4G7VH 3MLVL 3PJSB 5FKPA 3HPLB 3EYOB 5E99H 1A6VH 5D70H 2V17H 2GJZA 3IDJA 5MEQA 4OCXH 1VSCA 2BVQA 2MCG1 3DV4B 4HWBL 2OZ4A 3ZKSD 4LDLB 2P46B 5DR5H 4N0UB 3NFNA 4PV8B 3NMEA 2UUDK 4KVNL 4MA7L 5ACZB 5EWIH 5FGCB 1ZLWK 3VWKC 1FPTH 1OT2A 5D7KD 4AM0A 3AREC 4MD4A 3ZDXF 4ZO8A 4ZTPH 4RWYH 3CFIC 1CDGA 1BBDL 3C8HA 3OKEB 3V4VL 5DYOA 1U8OA 5EZLB 1LE5A 2UVFA 4HDIA 4QHKI 3ULVD 3L95B 1PZ5B 2FR4A 4HJGA 1AXTH 1X5IA 3OKKB 2YMXL 3UAJD 2AJZB 2VDQH 3VXRB 1OOAA 4AH2A 1HSAA 2FEDD 1NBYA 1J05B 3CSYB 4NM8L 3L3OA 1INEH 4PJGF 1U2HA 5KOMC 2DDQH 3UTPD 2DQJL 5EO1B 2HAZA 2GUOA 1UB6B 1T2QH 2YHGA 2ZUQB 3D5OF 3VXMB 4DKFL 3RIFF 4Y16D 1TZHA 2IMNA 3BUTA 1KPUB 4X99B 3QDGB 1JGDB 3BPOB 1BF8A 1U8JA 3SCMA 2O26U 4NRYA 2FHCA 4Y0GA 2FB4H 3IFLL 3QO0B 5GS0D 4NKOB 1KEGL 1ONQB 2OJEA 2YPLA 1N0XH 2QKIA 3TA3D 4HUMB 4RGNC 1JIBA 4GRWH 4EDWL 3RJQB 2KQNA 3RVVD 4PG2C 4EVNA 3TV3L 3O4LB 4KJYA 5T5FL 5C0NC 5DMJB 4M6OH 1S9WB 4OJFH 4QHUB 5IW6B 1F8TH 2MQ3A 4NFDA 5DJ0B 4NN5B 2D03L 4HUWA 3THMH 1MHPL 3PQYA 3O6FA 1RAMA 3DVNB 2C7UB 1QEWA 4PYGA 3QG6B 2F8VA 4NN7B 1L6XA 5GHWH 4X6BA 4HIIB 3SGJC 3ARTA 5IJKA 4NO3B 3TGXA 2HLFC 3REVB 2CUHA 4OF6A 4JQXC 3QDME 1KTLB 5I1EH 1PLGL 4IMKA 3UYRH 2CGRL 3N1PC 4KZDL 2ERJB 4LQ1A 4MJIE 1J8HA 4XMPL 3RUGE 1GOGA 5I71C 2PW2B 1R3LB 3V4PL 2W0FA 2LABA 4LMQI 4HPYL 5FDWB 3D85B 3K3QA 4LVOB 1DN0B 3C09C 1F3DH 2GSGA 1XGUA 2DB8A 4DVRH 1XIWA 5JDJA 3ARSA 3ULUC 5FO7B 4KROB 3OZ9L 5L9DH 2QSVA 3C5JA 4YHPA 5GS2H 4KUZH 3KPSA 2H3NB 1DSFH 2L0DA 5E95B 3HRZB 1FYTE 2IADA 2B1HL 1B0GB 1UJ3C 1EIBA 2HJFB 4GAGH 1TZGL 3LEXB 3MLTB 3MLZL 3QWOA 3P0GB 2X4PA 4CN1A 5D1ZC 2UZXB 3O2WL 3MZTA 4OZHA 4W68A 3B43A 3Q3GB 5ITBL 3T09A 4K8RC 4ZOEA 1LGVA 3LKPA 1GGIL 3IJHB 5CBAA 3EYQC 5K9QG 3FRPG 1LK3H 3I84A 3KPLA 3RNKA 4ODSH 1BM3L 3MRLA 5A3IC 1A7PL 5KSAC 2R2BB 4JPIA 4ZUVA 4AT6B 2NX5A 4RISL 4U4BA 4NNPL 1RPQA 2QQLL 1UXWB 5J6GA 4OLYL 2K7QA 2EC8A 1CK0H 1A7OH 2HFEB 4XHQA 3FMGL 4RBPK 4M1DH 2EIZA 7FABL 1QPXA 3KXFA 4LSSL 2G60H 1BPVA 3GSQB 3GMRB 1NUNB 2AJXH 5IK3A 3E6FB 3X12B 3DPBA 4JE4B 3TVMD 1ES0A 1R3IH 4M7JH 4NKIL 5GS1C 4UT6H 4I0KA 2VE6B 1F4XL 4QKXB 3D18B 4GFTB 5TE7L 1WEJL 15C8L 1RUQL 1Q1JL 3BD4A 1S9YB 3LEYH 5EOQH 5FYJD 5J1SC 3HC3H 1S9VA 2CXGA 2R2HA 2O5ZL 5CAYB 1U91B 4YFLI 3C5SA 4ELKB 1DDHB 3MRPA 4ZDHA 3OXRA 1KT2B 2NW3B 2B4CH 1LEKB 5GRWA 3WUWA 3DJ9A 3EYUH 1MFBL 3QQ9D 5DK2B 4LCCA 1BQHG 3RWEB 5AWNH 4DN4H 3RGVD 3I9GH 2IQ9H 1UWGL 4PFEA 3QDMB 3MBEA 3O9WA 1L7IL 4HWUA 3B9AA 4RMUA 1XF5A 4MJIB 4KMTL 1D5MA 3RUGB 4AENB 1I8MB 2EXWD 1KACB 3MCKA 2V2XB 4RFEA 4XH2B 1IAIM 3VI3E 2DL9A 2A6JA 1FL3B 1MPAH 4D9RD 4JAMB 5EOCH 3UJJH 3I6LD 2ICWI 1A22B 2CDEB 5BZWB 2VL5A 3ME0A 3KYAA 3INUL 3FB7B 1OARH 2KL6A 3MV9D 3QHFH 3S96B 5BV7C 2EYTA 1JN6B 5INCA 3LH2L 4LOUD 5I9QB 1RUMH 2XQYG 2AV1B 4U3CA 1CE6B 4BQ9A 4K71C 1EJ6A 3UO1L 5HDOA 4WWID 5IP4A 4RQQA 1MREL 4Q9QH 3JVGA 5B38G 5A2LH 4F37K 2H8PA 1FFPB 3TFKD 3MLWL 1FE8L 4JFEA 3BJ91 1KJ3H 1KNOA 3E0GA 1S5HB 5K9QI 4U2ZA 1UA6H 3OKDB 4LF3B 1KN4H 4D0CB 1MJUL 2E6JA 3MLUL 4F9PC 4JFXB 4GRLD 5C1MB 3PL6A 4Q58C 3TN0C 3HRPA 5IB3B 2X4RA 1YNLL 4QHLA 1CXKA 3QXDB 1F3JB 2BVPA 4IJ3C 4PPTA 1YEKL 1GGBH 2AK4D 4ZXBD 2JJSA 2R8SH 3CLFL 4YBLB 4NJAL 4ZOCA 1SEBB 3L5JA 4FQHA 1JPTL 4KJWC 4NGHL 4JG0H 3VWJA 5E7FA 1NQBA 4TVPH 4W81A 1QLRA 4P4KA 1CLCA 4J8RB 3NH7L 4XAKD 4L8DA 2X4SA 4NQCA 1KTRL 1NKOA 1FNGB 1C7TA 1DBML 2EC9U 2J12B 5AG8A 5D72L 2N4IA 3ARGA 4KQ3H 2P8MA 3PHSA 3MRJA 4QYOB 4EI6A 3HS0B 4HG4K 2ZCLH 4PLKC 4NWTH 4OKVA 1TNNA 5MI0B 2XFXA 3QUYD 5ESQA 3GB7B 3HTLX 5T1KA 1AKJD 4PBVC 3MUZ1 4PJBE 3QIWC 3K2MC 3IDIB 1IKFH 3L7EB 4P2QD 4XNUH 2UY6A 4YBHA 3TT3L 4XP4H 2VMFA 1VKXA 4JHZA 5HYJE 4MLSA 4PP1D 1SYSB 1XCQB 3SJVE 1XGQA 2DM2A 5C6WH 4G6JL 2R4SH 5KVGL 5CD5D 4POZC 3X13A 5IWLA 2AXFA 4EUPB 3RVWD 2Z92A 1QR4A 1TENA 5IR1B 3JUZA 1YQVL 1T3FA 5I8EA 1UM5L 1IAIL 5E24E 2F53D 1NDMA 3HUJF 3PWLA 4ELMA 2ZNWA 3B2UD 1U8PB 3LDBC 4UAOC 3SDAC 3BPLC 3T0EC 4HK0A 4P59L 3KPQB 3RWIA 1I1AC 3MBXL 4NO0B 4PJ9B 1ZA6B 3RP1A 4WI6A 4JFQA 3BAEH 2V7NB 1IEBA 5J57B 2WV3A 2FL5A 5IMOA 1HKLL 1NBVH 2ZUXA 1KCVL 5EO0B 1R5VA 2IPUK 4WFED 5DUPH 4MNGA 1HZHL 2RJMA 3FQRB 4X6CF 1MHHB 3RL2A 4AEEA 2ZCKL 4HBCL 2FJHB 3GMQA 2ZKHH 2FHFA 4JO4H 3P0VL 4J12A 4XBGB 3MO1A 3MRCB 5ESAA 1AP2A 3GKWL 4HEPG 4YHNB 4ORZC 4WTZA 4PJFF 5T5NF 3WEXB 5TF0A 1OCWH 4ZPTB 2Z8VC 3H8NA 5C6PB 3STLB 4M8VA 5TGBA 5T1DH 1Y6KR 3WFEH 4L4JA 2NY0C 5JIHA 1I9JL 4MXVF 1G7QA 3VA6A 1XR9A 1A6ZB 2XXMB 4W4NA 3K2UH 2ICEA 4LIQH 3SE8H 3N9GL 4YUEH 1RJZA 3UEZA 2HP4A 3BVNA 4JM4H 3BT2L 4X6CB 4A2MA 4I8DA 1BVLB 4ZFFB 1K9TA 5K9JH 1QZ1A 1NEZA 1ZVHA 2Q3AA 2YRZA 3G08A 3RPKA 1T1XA 1RURL 3MROA 4PJFB 4YPJA 3X11A 2K1MA 3F12B 4PJBB 4XNXH 4CN4A 2ITCB 5I76B 1QSEA 3W11D 3MUGB 4OLXL 3MLXH 1I7RA 4YH6A 5HYJB 4XCCH 5ALBL 2H2PD 4AMKH 5MHSD 3IGAA 3TIDB 3TLRA 4U1GC 1J10A 1E4XL 3IU3B 1YDPA 3SJVB 4JM2C 4P57A 1SBBA 5IW1B 4QRPB 5GZNC 4G8IB 4XVUD 4XCFL 4B41A 3HCVB 3TZVD 1T03H 5JORB 1ZHNA 4ZD3L 1LO4H 4R7NA 1T1ZA 3WIFA 5KJRH 4EI5D 1J7VR 4Y5VC 3DROA 1T66C 2HJKB 2VR4A 2Q6WA 1HINH 1KG0A 2DQCH 4JY5H 4ENED 4Z5RB 3GJFB 3KHQA 4QT5A 2EC9T 4IDJH 5E7BA 5F7MC 5IESH 1HH9A 3P0YH 4H5SA 3CX2A 2CMRH 4H8WL 1DCLA 4JRYD 3BE1H 5CUSH 2HVJA 4YR6B 1NGXA 3CVHH 1TFHA 2JELL 2N56A 2IG2H 4KKCD 4D94A 5I1CL 2DN7A 2J4WL 1L6ZA 3KPOB 4D3CL 2ED9A 1IGTB 4Y4KC 3MRGA 3M8OH 3HZKA 2ZCHL 3DMMB 1DLFL 4WU7A 3QNYA 3BEWA 4LCIL 3NOIA 5FV1L 5CEZH 1U8HB 1PEZA 5CKGA 5F9DC 1IILE 1FVDA 1MNUL 1RZ8B 4M93B 5I15H 3NIGF 4TNWF 5H2BA 4KRPB 3HG1D 1IEAA 4M62H 1GIGL 4JRXE 4K7PL 5EULV 4LNRB 4O9HH 1G6VK 4H1LH 1MCPH 4TQEL 3OKNB 2YPKA 4HIHB 3SDDD 3O8XA 5T3ZD 1JTTA 3I02A 5I8KH 4F80A 1N59B 3C9NA 2F54E 5J9PB 5GSVB 3D0VB 3VFMB 1URLA 4WFHE 3VD5A 4RAUA 3GSUB 5BQ7B 4R2GD 3TO4D 1I8IA 1U8NA 3VGAB 3QDJE 4NPYA 1WIPA 3BUYA 5IEKB 4LPVA 4YK4C 5FECA 4I0PB 2ADJB 5IUSA 2YA1A 4POUB 2LV4A 1M7IB 3O3BA 2PTTA 1GC1L 1GOFA 2R0WL 2VDNL 1HSBA 4MJ6B 2I9LA 5GRXG 1OF2A 4XRCA 3SY0B 2VLRD 4NWUL 4RGOL 5FCUH 2OLDA 3BPNC 1KN2H 1G6RH 3QSKB 4C59B 5EU6D 2ARJQ 3K1KC 1UC6A 1BWWA 4CVWA 1U95A 3EOBB 2D9QB 2OTWB 3L3JA 4DOHE 3C6LB 4G8FA 1F4AA 2ADGB 3QZWB 2DWDA 2WBJD 1GXEA 2B20A 3BPCB 3H6JA 4URTB 1S9KC 3UBXB 4MQSB 1S7WB 2NY4C 1P7QB 2BVYA 5E6IA 4E5XB 1HI6A 3DUUB 1BFVH 4OGXL 1EK3A 1JVKA 3D0LB 3LHPL 1D9KB 2H26B 4J6RH 1NSNL 1FGVL 2EZ0D 5GGVH 3SCMC 3VXUE 3QRGL 1VFAA 1NJ9B 2Q1EA 3BWAA 4Z95L 3MNVA 3UPRB 3ZDYF 5B22A 1BQLL 1CZ8L 1FZMA 4GS7B 4LPXA 5DHVA 2A6DB 1A64A 1C1EH 4WI2A 3RTQB 5C08E 3GRWH 1HQRA 3RGHA 1N7MH 2CD0A 2BZDA 2YZ1A 5CGYD 3BZ4B 1CXIA 4F58H 1OP3H 2PR4L 1OGAE 2VABB 3B83A 3BRDA 1P6FA 1EERB 3QPQC 1Y6MR 1QBAA 1A3LL 5KN5A 3SGKA 4DVBB 2R0ZH 3I50H 2R69H 4JRXB 1T5XB 2A6KB 43C9B 1C5DB 4HH9B 3O6FC 2FO4B 3B9KD 1NAMA 4L8BA 5ACMA 5B3JE 1NMBH 4DKEH 1UGNA 3V0AC 1QLEH 4MWFA 4UU9A 3JSSA 4PJIA 2EYRA 5IJKC 2IAMD 4MZ3A 4JEGB 4NYLA 1QOKA 5E8OA 3DGGB 2OTUA 4YPGA 3D3VA 1KCRL 4I3RH 2H1PL 4WO4A 1AGDB 3LZFH 3FFDA 4IMKC 5ID1A 4MNHA 2YC1A 2VZTA 4JO2H 3QDJB 1OAKL 2F15A 4LSDA 2WBKA 1RJLA 3S5LB 2P45B 2DLFL 4S1SH 3ZYIA 4LBEB 1JK8A 5JR1L 2QADD 5LGKA 1UM6H 1UVQA 4S11A 4NZRL 2BVTA 1KB5A 3GSWA 1XIWC 3TNNB 3KLAA 1I7ZA 3TBSA 1NMCB 4LSTH 2CLZA 4F7TB 1S7XB 2JCCE 1KIPA 2G75A 2GTZB 2C26A 1U6AL 3MRHA 4ODTH 4P9HH 5EN2B 4JKPL 1FAIL 3EYFB 5GGUA 2OSLA 4JFHD 3T0VA 5HHOD 5DJ8B 5D7KE 3AS2A 5HY9A 4XC3H 4G6MH 4NQED 5DJ2B 5ADPL 4JY6A 3ARBD 3ULVE 2PETA 4DOHB 2Y07H 5DD3H 1NC2A 5JO5B 5BW7A 4M4PA 5IEHA 4MQXD 3DECA 2FRGP 4KZEH 5EUOF 4M61A 1D5BB 4BQ8A 2C4FU 2AV7A 3OKOA 4UNUA 1ZLSH 3VXNA 2XG4A 3T08A 4U6HB 4HS3B 2F5BH 3UTPE 5D96C 2P47B 4OGAD 5FYLL 3NABH 3VGGA 5BVPL 2IFFH 3LEVL 2HMID 1N5AB 1FNEB 4HGWA 2Q76A 5T1MB 3U4EA 1NCCH 2AQ3A 1Y6NR 4UI2A 4DW2L 5JPNA 4Q7DA 2IBBA 3S34H 1DL7H 1DBKH 4B53A 3QIBA 4BYHA 3B2VH 4QTHA 1CTNA 2YD6A 4I3SH 5INDA 3HB3C 1LNUA 5HPMB 2HJLB 4OFYD 4OD1L 4F2MB 1GGYA 5EU5A 3SKNB 3PGCA 3DV6A 1R5IB 5EUOB 4JFDD 4GXUM 3VGDA 3LQAC 3VMOA 2BNUB 3MZGB 3KYMA 1RIVL 3E6HA 5DRWB 3UTQB 4QLRA 3V5KA 4EN3D 3MRKA 2DI7A 4U1NA 1TJGH 3ZTJG 1Q38A 3U6RB 2EDRA 1XGRA 5DVOA 4LCCC 4YC2B 4HKXB 1KIRB 3VRIB 1DUYA 3MBEC 3O9WC 3QPXH 5EU7C 1BQHB 3O4OC 4PYHA 4X6EB 4KKBC 3UC0H 4RIRB 4LKXB 5FEBA 1RI8A 5I2IB 4TSBL 5KVEH 3VRLE 3EYSL 2O5YL 1N26A 2FZ3A 3WXWH 2R23A 5C71A 2KBGA 3GI9L 3WIHH 1N8ZB 4PV9B 1S5IL 3EHBD 1CDYA 3Q0HA 2JCCB 1KGCD 2N7BA 1YEIH 2F58L 2KZ1B 1NANI 5JHDD 4LCWD 1AIFB 4M1CD 2Y25A 1X7QB 1X5XA 4LLUB 4YQXL 4FP8L 4Z7OE 4OZIF 2X9XA 3KYNB 4P9MH 3QCUH 2QR0B 2K9UA 1KJMB 3HNSH 4NUJA 5B38B 5ICYB 5DQ9A 4MAYA 5DJAB 4J7RA 3RWFA 4U1HA 3K0WA 1F45A 3PL6C 5GQBA 4UNTA 1FIEA 1H5BA 1S7TA 2IGFH 3VXSD 1S7SB 2ZSWA 4OD3H 2C3HA 3VRJA 4X7EC 4WEMB 2MJWA 1FL6A 3G6AA 3GMLA 5JLZB 3EO9L 3ORJA 4FRWA 3RL1A 4RRPG 3ARDD 1MCWW 3GO1H 1EEQA 4HV8A 4XPFH 3VWJC 4LSQH 4P4KC 3I3EA 2EYSA 1RZKC 1C08A 5EU3B 2JE8A 5C92A 2NXZD 4YBQC 2DLIA 1AO7D 2GY5A 1T0NA 1DLHA 2OJZL 3ARGC 3O6LL 1IGJB 4PRDB 4PRIE 4IRSB 2OBGA 2Y36H 4OTXL 4W6WB 1UCTA 3CFKA 4KMQA 4MDIA 4C83B 2BCKB 4Y5YA 3Q1SL 4HWZB 5FYJE 1A3RH 3UTSA 4JZOA 3C08H 1DQLL 1NANH 1LO2L 2IAND 2C4FT 3EKCA 4LQFL 4XPGH 1E6OL 3VCLB 2PYEA 4ONFL 1NGPL 4KC3B 4P99A 1N64L 1HEZA 4XB7A 3CCHA 4LHJB 2JB5H 4WW2A 1LO0H 4XXCC 2D9CA 4MDJA 4F57L 4ZFGH 1J1XL 1UYWH 4OFDA 5TDPA 1XF2A 5JDSA 1YYLL 4D9RE 1YQ2A 2P5WA 3LD8C 4XCNB 1LK2A 2E9WA 3VXOB 3QHTC 4KTEL 3FT3B 5CJQH 3LS4H 4ZS6D 3WUZA 3MV9E 4O02L 4RAVA 5KS9E 3P30H 2JLLA 2YKLL 5D6CB 2I07A 4ZSOA 3MNWB 3STZA 4NC2B 1CL7I 2DQIL 3IDNA 3KYOB 1L7TL 1HYRC 4HMEA 4N0YL 5J13B 3DSNA 5HHMD 3W0WA 2YPLD 1A21A 1QKZL 4PGDA 3S88L 3BZDA 2YEZA 1KJVA 1KIQB 3IB4A 4YAQB 4DK3A 4YHOH 2BOCB 4XVJH 5SX5K 1WLHA 2GITA 2WUCH 1JHKH 5I1IH 2HG5A 4OQTH 2V17L 3C6SB 1QPPA 4LVNB 2VYRE 4OCXL 1N3NA 2AK4E 3CU7A 3H9HA 4CADB 5DR5L 4Z6AT 4DZ8A 1AQKH 1WFUA 2ATKA 1DEEA 4ESKA 2FSEB 2GK2A 5MENA 4ZUSB 1Y0LB 2C1OA 3LRSA 1U58A 3DRQB 5EWIL 3WN5A 1FPTL 5D2LF 5C3LD 1L0XA 4JANB 4PG9A 3DX8A 3PGDA 4RWYL 3QIUB 3QISA 5IKCB 4U0RC 4XP1H 4XAKE 3IXAB 3GFUA 3UJTL 1G1CA 3TVMB 4E41A 1AXTL 5HHPB 4PRIB 3RZCC 2VDQL 4Y5XC 2LTQC 4JGMA 1IQDA 3TPUB 5KSBF 4EUPH 4FZEL 1K2DB 4P2RD 3QRFM 4HF5H 5FAAA 2DDQL 4J3XA 1HCFX 1ZT1A 1RUAH 3CFDB 1PG7H 4EDXB 5LKNA 4YDVB 1FNFA 2Q7YA 4P2QE 5HGHB 3RGVB 5F7DB 2H9GA 5HD8D 4Z8FH 4NFCA 3GI8H 5IB1A 1WBZA 3QI9D 4YGAB 1L0QA 3BZEA 1AQDA 4Z7VE 4XWGH 4OT1H 4L9DA 1H3VA 1VGKB 2PF6A 3LPWA 5MEOB 3P4NB 4JLRB 4LLWA 4PJXE 4YXLH 3WFBH 1RK1A 2F53E 1MSPA 4U1JA 3PXJA 3KS0H 1P9MA 2QLVB 4XP6H 4M6OL 3F8UB 2GJ6D 3R1GH 4AYFA 4OJFL 3F6IA 1F8TL 1CDIA 3KNBA 4J3WA 3THML 4RFNC 1T1WB 4HS6B 1CDCA 5BS0B 4I3GA 4X6DB 5DEFA 1QVOA 4U1IA 3BX7C 3SPVB 5ITFA 3QFJD 2B4CC 3K80A 1JGEA 5EPMA 1QR1B 3AXLA 2HFFB 4RX4A 4M8QB 4WFEE 4KPHL 1NDGB 3RVXC 3MREB 4Y4HB 2DBJA 1A47A 1X44A 4R7DA 5C2BL 3ARFB 3CFEA 3UYRL 1YEDA 2J7LA 4L29A 3FQWA 5ID0B 4F33A 4HCRL 2V2WA 3QR2A 4PRPD 2NMSA 4OZFA 1M7DB 4PJ7F 1J1PH 2AK4B 3BIKA 1JI2A 3P4MA 1FCGA 3CX5J 2YBRB 1T4KA 2XA8H 1CG9B 2P24A 2AEPH 1UENA 2OQJA 5DLMH 5ADOH 1CLYH 1U8LA 1OTUD 5L9DL 2Y7QB 1N6VA 5D8JH 4DCQB 3O6KH 3PE9A 1ZHLA 1FFNA 4RDQG 2VXQH 3MXWH 3VFOB 3LIZH 5KW9H 4HKBA 4XX1G 3HA0A 2K7PA 4WNQA 3CZFB 4Z7WE 4XAWL 1ULVA 4G7YL 1PJ9A 2Y5TB 1ND0A 1JRHH 1BD2B 5A16A 1UZ6E 3QUYB 1AI1H 3U46B 4YHZH 2AJUH 3FZUC 5D5MF 3RPIB 2MHAB 4GKZB 4PRBB 3IT8D 4K2UH 2OR7A 4OAWA 2ZSVA 3ULUE 3QEQD 3UZQA 1MVUB 3IAPA 3VWKB 3P4LA 5K9OA 3BN9C 4ODSL 1KULA 3AREB 5MHSE 5LVEA 5L7XH 1CICA 3IETB 5DRZB 1KBGH 3GJFH 3TBWA 1KJ2B 2EIDA 5E2VH 1VHPA 3IJYB 3WSQH 2BY1A 1U42A 1CK0L 2OMNA 1A7OL 2DTMH 1IKNA 4NM4L 4M1DL 4Z7VB 1MF2H 1R5WB 2P8LA 2X4QA 3FT4A 1KYOK 1FVCA 4N8CH 4UT6L 3DIFB 3VFTA 3S6CA 4JY4B 3QB7C 3LEYL 5EOQL 1YY8B 4O58L 4OF3A 2OK0H 5DSCB 3QXWA 3UBXI 1T04A 1ZVSA 3GEWB 1DBAH 1IGFL 1QSZA 4HUUB 4FZ8H 5E4EC 4JRYE 5ETUA 3U36A 5IVXE 1EV2E 3L3IA 3EYUL 5KSUA 3MV7D 4DN4L 3I9GL 2YD9A 2PYFB 4M3KB 2IQ9L 2L7JA 4ZFZB 4NQCD 1VDGA 4MD5B 4RGNB 1D5ZA 1T7VA 3LN4A 4JFYB 5JW3H 4U1LB 1QNZL 4LLQA 3KPRB 4AEIL 4C56A 5M95B 5HI5C 4YHLH 5EOCL 3SGKC 1FYTA 5A2IH 4H0HB 1YN7B 3OKLB 4KI5C 5FO9A 4X4YA 1CR9H 3TO2B 4JPWH 4BSVB 1OARL 3QHFL 1RUPH 3P9LB 4B5EA 4FXGB 2FX8H 3HG1E 4HUVB 5CP7B 4AQOA 1G7IA 1QFOA 4LHUD 4U1KB 4NC1C 5EC2A 4CBPA 4TNVF 1BJ1J 3T3PF 3MA7A 4KGLA 5T3ZE 2H6PB 4O5LL 4WO4C 1MLBA 1IC1A 5L8KB 2NY3C 4LLVA 4Z7WB 1T83A 5E8EA 3SDYL 2ICCA 3MRIA 5I71B 4NQXB 3LV3B 1KJ3L 2FIKA 1DBBH 3OJ2C 4PS4L 1IM9D 1FC2D 1KN4L 1RZ7H 3C09B 5HYFA 3EFFB 4XT1C 4BFEA 1I7UA 1BQSA 1GPOH 1A4KA 5AZ2H 1GGBL 4H25A 3T3ME 1UWXH 5CJOH 4FQXA 2R8SL 5ISZD 4JFFA 3HMWL 2FJGB 4G6FD 3VFRA 1AFVH 3JV6B 4V1DB 5B39A 1I7TB 3HZVA 4HC1H 2VLRE 4JG0L 1ZGLM 3SDXF 3DVIA 1UJ3B 1FO0B 2YD3A 4PGBA 1RULH 2IH1A 5EU6E 4X7TA 3WFDH 5BW7C 2E9BA 3O3EB 4PR5B 5FYKL 5D1ZB 3WHE1 2CRYA 1KLUB 2DYPD 3QJFA 1I3UA 1H3GA 4JDZA 3L3GA 1G9MH 1O7VA 1IVLA 4ZAKA 4KQ3L 2F8OA 5J3HD 1YEGH 3KR3L 4NWTL 1QSFD 1CGYA 1B0WA 5EB9A 3FO9B 4M43L 5KSAB 5LGJA 4MB4A 2C1PB 3PHQB 4DAGL 3T1FB 5DJCA 3VD4A 4TRPH 4WI5A 4QF1A 4PIRF 3PWNA 3BRGC 3QIBC 3HPJB 4LLAA 2DAVA 1DBJH 1TTFA 4KQ4H 5J4MA 3BH8B 1QA9A 4AIXA 4G3YL 2R4SL 1K8IA 1NFDF 3MV8D 5IJVA 3G6JF 2X41A 1VFOA 5ABDE 1JNLH 1NC4A 2C3WA 4YLQT 5I8CA 1ZHKB 1MHEB 1LILA 3MJ9A 5F89B 3HC4H 1J86A 1WZLA 1FIGH 3HG1B 3BD5A 2VXTL 3IXTB 3LB6C 4NQVA 1JUFB 2NTSP 1OAXH 1EAJA 1JE6A 5L8JB 1JF5A 1NGQH 2AXGA 3QEUB 4HJJH 1XR8B 3I2CL 5GIRA 3OXSA 3WLBA 2A77H 4Z78B 4HUXA 5IFJB 5IBUG 2VB5A 4MB3A 3JV4B 1NBVL 3FQTB 4R2GB 1I3GL 4ZO6A 4P23A 2B2XL 5DUPL 5F7NC 3AS1A 5TJWK 5FO8A 5BZDA 3KDMA 4HK3N 3G6JB 1UXSA 4F3FA 2E9IA 2ZKHL 4S1DC 4JO4L 2CRMA 4GUPA 2Q20A 2QL1A 2VLLA 2FGZA 3GBML 1H9VA 3QUKA 4PGCA 1EUUA 5EDXA 1OCWL 1VADA 2VAAA 3WHXA 4JFHE 2OCFD 1KB9K 4W4OA 1MCJA 5CBEA 4WEUD 5HHOE 3WJLC 4G5ZL 5D7LB 1Q9LB 5C0BD 5T1DL 3L5WA 1E28B 4M5ZL 4OB5H 3PDOB 2DM3A 2AJVH 1QYGL 2PO6A 1HCVA 4NQEE 2KPNA 3DX7A 3RDTD 4XNQB 5E1HB 4C4KT 4MAYC 4LIQL 3AMKA 4YUEL 4PJAE 3RWGB 3RAJH 4JM4L 4K7PY 1QQDB 4ODUB 3TN0B 5SWQB 1H5BC 3QCVH 4WI4A 4X7FC 4PJCF 5EFIA 3H42H 5K9JL 1FLRL 3B3IB 3LSOB 3LKOB 2UZIH 2VDKL 1T21B 4KKAD 1YNTB 3OG4B 4XNXL 3FONA 2VDOH 5D7JA 5HDQH 1Q9KB 5JOFA 1FCCA 2G9HA 1U92B 3KPNA 3O8XD 4XCCL 4AMKL 3UTTA 4E0RA 3IDGA 1SY6A 3P11H 4BUGA 4G80A 4D0DA 1JGUL 1MCCA 5DFVC 3G5YB 1PDKA 2BNQB 4D0BB 4L9LA 1VFBB 3BQUA 2UYLA 4L4TA 1HYSC 1T03L 1JHTB 2NY2D 2AGJH 3U9UA 1OP9A 4DGYL 5DMYA 2GK0B 4BH7B 5KJRL 4IS6A 5FHAH 3L3KB 4HCRA 2I9TA 3G04A 1SM3L 2CDGB 4ZYKB 5DO2C 4Y5YC 5FDYA 4Y19A 1C12A 3NCYP 2DQCL 4PJCB 4X4XB 5GS0L 5HHQA 4PB9H 4LHUG 1C5CH 2NY1D 5CZKA 3P73A 1NCWH 5JQHC 3QIWB 4APQC 5LAXA 4IDJL 2J1KA 2IAMB 5IFAH 1HXMA 4XI5D 4HKJB 3T0XA 1R3KB 2CMRL 3CDFA 1EA9C 1EO8H 4IHOA 4RFOL 2ZUSA 3LQZB 3MJ7B 1WJ3A 4E42A 4X98A 3GMOB 3GSOB 2IG2L 4N8VA 2XZZA 4XVTH 5E5MA 1JYVA 1I1YB 1KLGA 5I19L 3ULVH 1S7QB 3RWDB 1PD6A 4P3DB 1TVHA 3W39A 1OSZA 3NIFF 5KZCB 3PGFH 2EECA 4K94L 5EBLB 1FDLL 1ORSA 5EZOL 4MD0A 4TPRH 5CEZL 3LDBB 4UAOB 4K55A 5E6ID 3SDAB 4XPTL 3BPLB 3T0EB 4HAGA 2CJUH 5IF0B 3EDKA 5DMKB 4JKMA 2CR6A 2WIIA 1KGCE 2QV2A 4JFPA 4TUJA 4FTVD 2R1XA 1GC1C 1MFCL 5I15L 1AGBA 3O45A 4Q6IA 4LCWE 5CIPB 5JHDE 4OF0A 1JWUB 2BNRD 4K3JL 1ZT4A 1CFTA 4O9HL 4R96A 4MVBC 3C8KB 1IBGL 4CMMB 3TH3T 5B4MD 4HGKC 5C9KA 2RBLA 4P5TA 2DQHL 4PJAB 4MJ4A 3VJ6B 5FOBB 3KHOA 1JTPA 5CD3B 2MWCA 3ZE1E 3NFSH 5C09D 4OFPA 5I8OH 4L3EB 3L7FB 2W0LA 2HFGH 1NLDH 8FABA 5E8DL 4F15B 4OD2A 1YECH 3DTXB 2DIAA 1K3ZA 3D48R 5FYKU 2HKFH 3D39D 4X7DC 5CJBA 1QSVA 5HHNB 2NY0B 1OTTC 3ZDZE 5K9KB 4GMTL 5DUMH 4WGVB 3WN5C 4A6YB 2DIJA 4FQIL 1RZJC 2ADIB 1YY9D 4QRUB 3OSKA 5JXEA 5HYQA 4KKLD 1P7KB 5B21A 1G6RL 2ZUQC 1NEZG 1AO7E 5EBMB 3F7QA 4GXVH 4X9FA 3VFGL 1SEQH 5C0RH 3BPOC 4ZFOL 4WDIA 3GJFK 3NPSB 4QRRB 1BZ7B 2BHZA 4QRTA 3RI5K 3O41B 3VGHA 5HVHC 1UACL 2BRRH 3D1MC 4QRQA 3GUTB 4UMGA 2M26A 2VIRB 1EGJA 3HI1A 2DLGA 1PFCA 5IMMA 1AD9B 3PWVB 1PZUB 4U1GB 2IANE 5C0AA 4P48A 5KSVB 3PHOA 4LSUH 1PEWA 1I85A 2W0KA 4ALAH 4JM2B 1MJ7L 5GGVL 2MOVA 3ELAT 1M71A 5IBTH 3F7VB 1IRAY 5F1IA 4FABH 4HZLA 4GBXA 4HQQH 5JW4M 5GISH 1WUNT 4BFIA 3ROLB 1W0WA 1MJ8H 2BC4B 4Y5VB 3AGVA 5F6HJ 5BXFB 1X5HA 4TSAL 2P7TB 1PSKH 3W5MA 4Y1AB 4Z7UB 1CE1L 1YUHB 1N7ML 1OAYH 3WV0A 4MCZB 3MJ8B 5FB8A 4QHMB 2W9LA 1V7NH 2F54A 1P9MC 3WIIH 5F70A 4M48H 4WWKA 4LCWB 4GQ9H 4GKSB 2R0ZL 3I50L 4X6FB 3U2SB 3WHE0 3VH8B 3FB6A 4J3TA 2MMXA 1BIIA 4DKEL 5IBLD 2VJXA 3OGCB 1QLEL 4NO2B 1I9RH 4UZGA 2IH3A 1IGYB 4Y4KB 5HHME 3MX0A 4G9FD 1IE5A 4I3RL 2YPLE 1H3WM 3H9SA 1HOCB 3LZFL 4KK8C 2YZ8A 2F5AH 3CH1B 5HHXH 4N9GA 2MTPA 4MJ5B 4E9LA 1DE4A 3BKYH 1CFSB 4PJ8D 4NKMB 1MCLA 1N6UA 4EOWH 5IHBA 1JP5A 3AFLA 4ISVA 1JF6A 2ICWA 4LGPB 5EA0H 2YPVL 1UM6L 4KJQD 4LKCB 1MAJA 1P5UA 1EEYB 4Z7QE 3N1QC 4Z0XA 3PQYE 4LSTL 1R0AL 4WGWB 4XBEH 5E2UL 4KK6C 5EBWB 3P4OB 2DI8A 3S36H 5DJ6A 3VGBA 2VC2H 3ZKMC 1FRGH 1TZIA 2FJFB 1X5JA 2NZ9D 3A6BL 4G6ML 3DXAB 5A2FA 3TYFB 1AO7B 1A1MB 2EDJA 2JIXA 1K3IA 2R9HD 2YOCA 3ET9F 5FKPB 1IEHA 4QGTA 2Y07L 4UBDD 5DD3L 1JFQL 3VXUA 5D7IF 3W82A 2GJZB 4YK4B 2V9TA 4KZEL 1IFHL 5MEQB 2BVQB 1VGEL 1ZLSL 1HWHB 3DX6A 5E5RB 1J1OH 2F5BL 3NFNB 3KPPA 4WEBL 2GYSA 3ZL4H 5F9OH 1JWSA 3LRGA 3K1DA 2AKRA 2IFFL 5C08A 4AM0B 4DQOH 4MD4B 2M2DA 1CICC 3WL9A 1INDH 1NCCL 1FORH 1PVHA 1VERA 2X1XR 1OGAA 1U8OB 3OR7A 5CZVH 5DYOB 1T89A 1LE5B 4HDIB 4R9HA 1A9BA 2FR4B 4HJGB 2EKSA 5ELIA 1EBAA 1IKNC 4YXHH 5L0QB 3S34L 1DL7L 1OLLA 4AH2B 1HSAB 1MRDH 2BXYA 1NBYB 1KTKE 1RIHL 3L3OB 5SWSD 3B2VL 4ZMAT 3I3BA 1X3DA 1NAKL 1IT9L 1IL1A 5T3XL 1EFXD 2GUOB 3BXNA 4QWWC 5J1AA 3PP4H 4MLIA 5IHZA 4PJHA 3SKJL 1FL5A 1TZHB 4N0CD 1U8JB 3SCMB 4CUCA 3EO0A 3S37H 2QJDA 2EDWA 4HIJA 1TJGL 4NRYB 1MAML 5DK3A 3N50A 2R2CA 2W91A 4HIEA 4KJPD 2OJEB 2YPLB 4DJMA 5I1LA 1YEFH 2QKIB 3X14A 4Y89A 4LCUA 1HK6A 3QFJE 1ZGLA 1MHCA 3QPXL 3EDDA 1TCMA 3P3YA 1S78C 2V5TA 4EVNB 4KJYB 5KVEL 2VUYA 2WIMA 4WY7H 4BK4A 5CSBA 5HI3D 3WXWL 1B4JL 1G7MA 1MIEH 2DKUA 4HUWB 4RMSA 2RHEA 3PQYB 3O6FB 5DQDH 2BK8A 1QEWB 1MQKH 3R8BB 4WHDA 3V52H 4LSVH 3U7YH 4F37F 1YEIL 4X6BB 2BMKA 1UH2A 2P5ED 5A43C 2EEBA 4WJ5A 1HHJA 5A2KH 4Z18A 4R6UA 1T83C 5EU7E 5ERWA 1J8HB 4Y16A 1C7SA 4QXGH 5HHVH 4OZHF 1KJ2H 4FQCH 3HNSL 4MXWL 2W0FB 1JHLH 9CGTA 4YBLC 1J0ZA 1K4CA 3CDGA 5FK9A 2M8XA 2P5WD 1DQQA 4LSPH 2GSGB 1XGUB 1XIWB 4OLWH 3LKQA 2IGFL 4OD3L 3HR5A 2EEDA 2OMBA 3C5JB 4YHPB 4JKWA 4UTBL 3TA3A 3KPSB 1MRCH 5I73B 2AEQH 4FQXC 1NUDA 3GO1L 3SKOA 1YZZA 4XPFL 4LSQL 2IADB 3V0VA 3FHAA 4TTDC 3MUY1 3GGWA 4QNPE 5MI0C 1KCSH 3QWOB 2X4PB 2XG5A 4YHML 2RCSH 4OCLC 4OZHB 3C2AH 2O61A 4K9EL 3SEPA 4OCNC 1BJ1H 3SO3C 3LKPB 4ZAKC 5D96B 5CBAB 4KXZI 5FYJU 3KPLB 3RNKB 3MRLB 1QBLL 4HT1H 5I1KH 1ZE3C 4JPIB 4HD9A 4ZUVB 2NX5B 1A3RL 5DZNA 4CU7A 5J6GB 3C08L 4JZJA 5GS3A 1ZTXH 2HVKA 1QG3A 3D25A 5DJYA 1DVFA 2VR9A 2VXUH 1OPGL 2EIZB 2DQUH 3KXFB 5D7SH 3T0AA 2BHYA 4R3SA 3MV7E 5I18L 5KANI 1ERNA 5IK3B 1ADQH 4NQCE 1ES0B 1KELH 3PWUA 1LO0L 4PJ9C 1ZMYA 3REWA 3LCYA 4L8SA 4CVZA 1UYWL 4ODVH 1UFUA 2W65A 3V8CA 2V6HA 1S9VB 2R2HB 4TUKH 3C5SB 1ZVYA 3MRPB 4ZDHB 3OXRB 5HYIA 1CXFA 5CJQL 2H2SD 3LS4L 3WUWB 1I9IH 4LCCB 3FRUA 5DEGA 3ULUH 2DKSA 2XZCL 1G7PA 2QEJA 3MBEB 3O9WB 4IBLT 5DF0A 3VD9A 4OM1H 1SYVA 3O4OB 4YZFE 1XF5B 4NKQB 1D5MB 4HG4J 4RMVA 1P2CA 2Y9RT 3MCKB 4HFUH 3RWCA 4RFEB 3MLRL 1IM3A 4WI9A 1DFBL 3DVGA 2A6JB 5IBUB 4HLZH 1RY7B 1ZK9A 1FO0H 1CD1A 2YK1H 5DJDA 2VL5B 3SGDI 3N85H 5T3ZL 2NR6D 4ELME 5I1GH 2EYTB 5INCB 2WUCL 3F58L 5I1IL 3FT2A 4EZMA 2HT2C 4OQTL 2ZUYA 1WQVT 4K8RH 4JN1H 1MCHA 1WCQA 2WAHA 4RQQB 1AQKL 5ISZE 3U82B 1S8DA 4XBPA 2CK0H 2DWEA 2H8PB 3ILQC 1GZQA 2PO6C 2XKNA 1NGYA 1PY4A 1IGML 3NCBB 3CD4A 4JFEB 1KNOB 1B3JA 1K5NA 3WS3A 1RQ5A 4MNGE 2XQBH 3BMWA 5DD0H 1WBXA 3FO0H 3B8SA 4J3OC 5DD6A 4UT9L 2EDBA 3PL6B 5DT1H 4RSVA 2X4RB 4PJEA 2YD8A 1EX0A 4QHLB 3VI4F 2BVPB 4LAJH 5FYLD 2DQGH 5C7XH 4HAFA 1T2JA 1QSFE 4HF5L 2FATH 4WFFD 1K4DA 2DRUA 2P44B 5D7JC 4FQHB 3OPZH 3VWJB 3VXPA 1RUAL 4XPAH 1QLRB 4CKVX 4P4KB 1C5BH 1Z6JT 4IIQA 1CL7L 2P49B 1D5IL 2ADFL 4L8DB 2X4SB 3RHWK 4NT6A 2FD6H 4L9LC 4OBSA 4Z0BH 2NY6D 3BQUC 5KS9A 1V7MH 2WUBL 1CIUA 3GI8L 1C8PA 3ARGB 2P8MB 1MJJA 5IG7A 3MRJB 4W70A 4EI6B 4ETQA 3MV8E 3OAUL 4M7KH 4OKVB 3SGDH 2X4UA 2WM0A 2WANA 2X44D 2XFXB 2XPGA 1AR1C 4GRWF 5ESQB 4EIZC 2W0PA 3U0WL 5T1KB 1A14L 5H35A 4YXLL 1AD0A 1GGUA 4JO1H 4N5UA 5AG9A 5AZEH 1DQMH 3WNMA 3R1GL 1VKXB 5T1LD 1RZFH 5EH1A 3GIZH 3NFPA 3W9EA 1AXIB 2DI9A 1QLFA 1XGQB 4GRLA 3C8DA 3LY6A 3X13B 3EJZC 2AXFB 3BKCH 4FQQA 2Z92B 4QXTA 1A6UH 1T3FB 5I8EB 3PP3H 3JTTA 4M93C 3MC0A 4ZXBA 2Z35A 1J0HA 3NACH 1NDMB 1FG9C 3PWLB 4ELMB 1I8LA 3HE7D 3FKUS 3CK0H 4FG6D 1EUTA 4HK0B 2X4TA 5LCVH 1UWEH 3RWIB 4TTGA 4HJ0C 1SVCP 4JR9L 3WFCH 1ZT7A 4JFQB 1IEBB 4Q6IC 3JXAA 4PJGA 2FL5B 1RMFH 1JPFA 5DLML 3VGAC 2Z31A 5ADOL 5IMOB 4U1SA 5C0BE 1R5VB 1Q0XH 2X4OA 3SDCD 2AI0H 5D8JL 4P5TC 3O6KL 4MNGB 1J0IA 4R4BA 3RL2B 3D87B 3HZYA 3UTZA 2A83A 5KW9L 1AKJA 3GMQB 4X7SH 1B0RA 2W07A 5DURD 2GY7B 3MO1B 5ESAB 1AP2B 5JQ6H 3VXQA 5B8CA 4EBQH 3VMPA 4P2QA 1JMZA 1Z9LA 5IHLB 4U7SA 2XNAA 3HMXL 5D5ME 5TPWH 5IV2A 5D1QD 1AI1L 4YHZL 2AJUL 3FB8A 4DTGH 5TGBB 1CBVH 1CF8L 3OKMA 3H9ZA 2LU3A 1G7QB 5LWYH 4KRLB 3AU1A 1XR9B 3CC5A 3QUMH 5CCKH 2ICEB 1MCOL 2ORBH 4KKNA 4PJXA 1RJZB 3BVNB 2F53A 1KBGL 5JXEC 5IFHH 1JCKA 1ZANL 1OM3H 4IRZH 4YDKH 3QBTB 2E27H 2LTQB 3QUXD 2ENYA 3G08B 1NEZB 2HT4D 1T1XB 3HNVH 2WWMD 3MROB 3X11B 3D9AL 1MUJA 3H7BA 3UX9B 4BSJA 1QSEB 2ZOLA 4N8CL 3LMJH 1I7RB 3O3AA 5F6HI 3J8F7 1GAFL 4GS7C 3IGAB 5EIVA 1HDMA 5AYUL 5F7LB 5CZXC 1YDPB 3RTQC 3SE9L 4P57B 4TSCH 5EBGA 5CP3H 1DBAL 3K4ZA 2QSCL 4GBXC 5D2NE