4O5LL

Crystal structure of broadly neutralizing antibody f045-092
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSASGTPGQSVTISCSGSRSNIGGNTVNWYQHLPGMAPKLLIYSSNQRSSGVPDRFSGSKSGTSASLAISGLQSEDDADYYCASWDDSLNGVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab F045-092 light chain
publication title Receptor mimicry by antibody F045-092 facilitates universal binding to the H3 subtype of influenza virus.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o5lL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o5lL01
3TN0D 2V5YA 1HXMB 2X4TA 3KR3L 3R0NA 1ZLSL 3B8YA 1T7VA 3TBTB 3MMEA 4PJBA 1I8KA 2AK1L 4FFYH 4KQ4L 5A3IC 4NZRL 4HWZB 2AKRB 4XI5D 1PEWA 3IDGA 4E5XA 5DK3A 3FHQA 5B3JE 5AAWA 3LKQB 4PJCB 4FNLH 3S5LA 1MFBL 2AXHA 4N1EA 5DUPL 5JLZB 1LO3H 2A83B 1FPTH 5FDYA 1VENA 3AVEA 4POYA 2XXCB 5CCKL 4HUUA 1D9KA 3FT3B 5C6PB 5F8QC 4N0CD 3VDBA 4QT5A 1C16A 5IMLB 4X7SH 2FR4A 2JLLA 3UTQB 4TUJB 1D5MB 1VPOL 3H7LA 4MNHB 1K8IB 3DRTB 4LIQL 1T1YA 5GRJH 1OY3B 4UILH 1FVDB 4LVOB 1CGXA 5F9AC 3KPMB 4RMWA 4N8VA 2VABA 3NN8B 1BHGA 5EN2A 4JLRA 2DD8H 5MEOB 1WITA 4Y2OA 3T77B 5JDSA 5I8CA 4D0DB 4FFWD 2F5AH 3CXHJ 3O3AA 3BKJL 4YHLL 3ARFC 5E6ID 4PJ8D 3B9KB 3OSKA 5SX4H 3SPVA 3MGTA 2D7TL 3IJYB 4G9FD 4HGKC 4AZ8A 1RURL 2JIXB 1HXMA 2AJZB 3SGEH 1T03H 5ESAB 3MBXH 4RX4D 3TBTA 2YZ1A 4PY8I 1HYRC 1K6QL 3DUUB 4LSVL 5DSCB 5TQ0H 2Z91A 4K3EL 1F00I 4HWZA 4NN6C 2AKRA 2DYPD 3QDGA 2B0SL 4ZUTB 2ZNWA 3QI9D 4Q6IB 5E8OB 4AM0B 1OAYH 1IGYB 3KLSA 1WAAA 2EO9A 3LKQA 3IB4A 5T3XH 1G7QB 5TPWL 3KYNB 1W72H 4X6EB 2X10A 3H9SA 3WDIA 5I1CL 4BZYA 1KLUB 2EZ0C 3NIDF 2ARWA 3VD7A 4QGYA 5FHAL 2OXHA 3NA4A 2IGFH 1KUMA 3SJVA 4MHHI 1CL7I 3QDMD 3BZEB 4JDTH 3L6FA 4ODTL 4ONHB 5BRZA 1JWSA 1PYWB 4KRPD 3SGKC 4KROD 2Z8SA 4RDQF 1R6VA 1HI6A 4NBYB 5CP7B 3QEQD 4TUJA 3ZO0A 4PB0H 4NNPL 5HI3D 3WFEH 2E6QA 4H20L 3U0WL 4MNHA 3SDAC 3DRTA 5JZ7C 2ZCLH 4F7MB 1E6JL 1MFAH 1FVDA 1UM5L 4Y2DC 2DJSA 2R4SH 4OGXL 3T77A 2B8OT 2EDOA 4D0DA 3ARDD 3D87B 4Y4HD 3TN0C 1NDMB 2JB6B 3NPSC 3BH8A 1EJOH 1MAJA 2F8OA 3IJYA 1PX4A 3KPOA 5J8OA 1OB1A 3QH3B 1JPGA 1ETZB 1LO5B 1SMOA 1DVFA 4M61A 3IXTB 4XI5C 1NCAH 4OD3H 3ARYA 2WINB 1JGEA 5LAXA 4GMTL 3CUPB 4HMEA 1N7MH 1CDCA 3DSFL 3P0YL 1J5OH 1A5FH 5EOQH 2AAVA 4AM0A 3E6HB 4WGVB 2DI8A 1G7QA 3KYNA 4PJEE 4Y4KC 5F1NB 4K2UH 2GYSA 1QBLH 3GI9L 4N0CC 3UC0L 4GRLA 2W0FB 3OJMB 2FYYB 4LHUG 3DX8A 4LASL 1JI1A 5HYJE 2F9BT 4ZUUB 3MRCB 2G5BA 3T0ED 4NKQB 3TO4A 1U3JA 4NIKB 3MFFB 3N1GC 3S3SA 1YEJH 4X6CA 5CINH 4FFWC 2J6EL 4ACPA 3TVMA 1UZ6F 5EULV 3CFKB 1U93B 1MH5A 5E6IC 3QUXB 4PJ8C 3JWOH 5F9WC 4UAOC 3T3MF 2DL2A 3JTTB 5HHME 2DLFL 1KPUB 5IM7B 1U92B 4X7DC 4E41B 1I7RA 3ZTNH 2GK2A 5BVJB 2CKBH 2N56A 5DMJB 2BNUB 1ED3B 3QUKB 1FO0H 1QLFB 1M7DB 1OQXA 2FLBT 1WGOA 3TO2A 1CICA 3FTGB 4M1DL 3R1GL 1N59B 3S5LG 1QSFA 3ZDXE 4I3GA 3CUPA 2HVJB 1MIEL 5E9DE 4CJ1A 4NQEA 3TT3L 5GRXG 1G6RB 3JV6B 1S78D 1UXSA 1T66C 4URTB 3D0VA 1LVEA 3RQ3A 2DICA 3MRIB 3RGVB 3NTCL 3V5DA 2YD3A 4CVZB 3PL6D 4O5LH 4C4KO 4Z7WF 3PGCA 2W0FA 5CILL 4NGHH 2V7HB 3D25A 4HQQL 4K7FB 3JV4B 2C9AA 5HI3C 3RZCB 4A2LA 1DFBH 4YHMH 2VDLH 2H26B 4N8VG 3MRHB 5D1QA 1PG7H 2A2QT 1FN4B 4QRTB 4ZFOL 5J1AA 1ZLWK 3ARDC 1YQVH 3JVGA 4Y4HC 3EYSL 4S10A 5D1XB 5HDBE 4HJ0D 2I24N 4PJCE 5IWLA 4GRWB 4RRPG 5JHLL 4NCC1 1J9CT 1B0WA 4WW1B 5GISL 2UV3A 4WCYL 5GZND 1NCBH 1B4JL 3GSUB 1KPUA 5EOCL 1U92A 3MCKB 1MHHB 5DR5H 3VRJB 5BVJA 3JBG7 4M8VA 3X11B 1BOYA 4NO2A 2XRAH 3LZFH 5B39G 3TGXA 3SKOA 3SQBA 4IBLT 1QLFA 3B9EA 1R24B 3SDYH 2V2WA 1RJZA 3DWTA 4ELMA 1DUYB 1LO0L 4ZTOL 1IQDA 4FN0A 3TIEB 1RU9L 1ERNA 2VN4A 2YD4A 3KPPA 3TBWA 2R0WH 4Q9RL 4HZAA 5GS2H 1K2DB 1G6RA 2YSSA 4M62L 3JV6A 5E99L 4L8DA 1MRDL 2FECI 4WY7H 4NO3A 4JN1H 2IEPA 3CMGA 4Y16B 5IB4B 4XPFH 1NANI 2V7HA 5L0QC 2X4RB 1Q0XL 4IJ3B 5ELIA 3I2CL 3JV4A 4XPGH 1IKNA 4YBLC 4XRCB 4X7EC 5FOJA 2CDEB 2E7CA 4EEEA 1A9BB 1YEFL 3RUGA 1Z0NA 3MRHA 1KCUH 4KAQL 5F7WC 3SDXB 1NUNB 2DQDL 1ONQB 4EQ3A 2ICEA 1FN4A 2AGJL 4YNYA 2R8SL 4J3OC 2CDFA 1F4WH 1RZ8B 4PG9B 1NGWA 5GZOD 4BH8B 2OZ4H 4O58H 4PJIF 3GNMH 1TIUA 5JHDA 1A1NB 3T04D 2GK0A 5CP3A 1NUFA 3SE3A 4KKNA 4WTWA 3RX7A 4MDJB 3VRJA 3I75A 5HGBA 3GK8L 3UTZA 1FJ1B 4J8RB 2GUOB 1OCWL 4DWHA 3FZUD 3MUGB 1CLYL 3GKWH 4L9LC 1YNKH 4DN3L 1R24A 1S78C 3TH2T 3VU2A 2QTEA 4F57L 1C5BH 4NSKB 5HYJD 4KVCL 2AXJA 3QXTA 1TXKA 43C9A 2IC2A 4JJ5B 1X6LA 1QHOA 1LO4H 4NN5B 4NJ9H 2WBJA 4YQXH 2X2YA 1EAPB 5LQBH 1IC7H 5EWIL 4X5XB 4RAVB 5IB4A 5ISZA 2BFVH 1DBBH 2VQ1A 2FBOJ 3PG2A 4ZMAT 2PF6A 2BHYA 2F54B 3C5SB 3QUYD 1LK3H 4XRCA 1PLGH 5HHMD 3QIWB 3UBXA 4AJ0A 4HFUH 2AW2A 1WVZA 4HJ0C 1UKQA 5DHYB 3WIFA 2PCPB 3CMOL 5GZNC 2YD9A 2Z8VC 1A3RL 1RZ8A 4PG9A 1AO7E 5E7FA 4IMKA 3FCTB 4JB9H 4BH8A 2DIBA 4JRXB 4PRAA 4X80L 2CIKB 2FBJL 1S3KH 1HINL 2APBA 3CIQA 3MACL 5DFVC 3KJ6H 3KLDA 4XBGB 4U3CA 3EOBB 4PGCA 1OHQA 4OZGA 1TQBB 3NZ8B 1MF2H 1UFUA 5A43C 3CVHB 3Q48A 1FJ1A 2Q76B 3O4LB 3VI3F 4FQXA 1XFPA 3HS0A 2I27N 3MUGA 1E4WH 2B4CC 4FFYL 4RAUB 5D7SH 3DYMA 3VA2C 4DKFH 1JI2A 1FCCA 4Z0XB 5IJVA 2ESVB 3CXDH 5ESVB 3WIHH 1DQDH 4YXLH 4BUHA 4JDVB 2YBRB 2VAAA 4YHYC 1EEUA 4FNLL 1XR9B 3T2OA 3DLQR 2Q7YA 3QULA 4LLQA 1WZLA 4ONGH 3PP3H 1LO3L 4E41E 3BKYH 2FO1A 1FPTL 1KC5H 5TDPB 1ZV5A 3TEUA 2ZOKA 4RAVA 5CSZB 4LEOB 5EOTB 5TE7H 5A2KH 1I75A 3QXWA 2DWEA 4XHJC 3C5SA 4H5SB 5C70A 2RBLA 4X7SL 2W91A 3D1MC 5GZOC 5CD5D 3R4DA 5ENWB 5DHYA 1Z9OA 3R8QA 4PTTB 2ATPB 2Y9RT 4FS0A 1XGPB 3MUJA 5GRJL 5SWSD 4UILL 1F42A 4OLYH 4F9PC 3FCTA 5HDOA 5FF6B 2DD8L 3VJ6A 1KXTB 4OLWH 4OLVH 2F5AL 4JY4B 4Z9KB 5FFLA 1WSST 3H6JA 3FZUC 2ZSVA 2VSCA 3NZ8A 1EVTC 3PWVB 4YDJB 6FABH 5EDXA 1T03L 2EDEA 3MBXL 4OQTH 5F3BA 2VB5A 3QEHB 3B9KD 4RAUA 4JPVH 5TQ0L 2JIXD 5D5MB 3CX2A 5HHQB 4HJGB 4Z0XA 2ESVA 2HFEB 1HIMH 1UA6L 3NIGE 1CDGA 4GRWE 1OAYL 4JDVA 5C0CA 1SY6H 5T3XL 5CEZE 1XR9A 1W72L 1P69B 3F7RA 1B0GB 1KN2H 4JGMA 4EVNA 3AGVA 2RJMA 4TUOA 1S7UB 2VH5H 3H3BC 1J0HA 3QUYC 3BHBA 2IGFL 1PGRB 5CSZA 3VFSA 5KBNC 4LEOA 3O41A 4JDTL 1Y0LB 4H5SA 3RTQA 3RIAK 2B20A 3CH8A 4PB0L 3IJHB 3WFEL 1MFCH 1KENH 4XPBH 4AG4H 3H9ZA 1KB9K 2X1QA 2ZCLL 3D3VA 4U2ZA 2CO7B 1MFAL 1RIHH 4BH7A 5ICZB 2BX5A 4S2SA 2NY6B 2GIYA 5FF6A 4P23D 1TVBB 5D6DC 1OT1A 5K59F 2R4SL 5HGDB 4JY4A 2IANE 3VRIB 4NCDA 4ODUB 4KZEH 1EJOL 4LKCB 4NZTH 1L7IH 1KJVB 4J4PD 4NN7B 2IWGA 2Y5TB 2M26A 1MCNA 1T83A 3DV6A 1NCAL 4OD3L 3QG6B 3F7QA 5BXFA 4ZNEA 3QEHA 1U8NB 2LAAA 5DEGA 3SDXE 5IHLB 1KXQE 3GI8H 3C6SB 5D5MA 4HJGA 1N7ML 1T20B 3SGDI 3PABB 1R3KB 4PY7B 1A5FL 5T5FH 5EOQL 1J5OL 2YPKB 3GSNA 3S37X 1JZ3A 1AGDB 5SX5K 4K2UL 5L8JB 5DEFA 5GJSH 1QBLL 1UKSA 1QQDB 1AO7D 4F2MA 1JYWA 5CD5C 5HGAB 1Y0LA 1JVKA 4LVNB 3CZFA 2NYYD 5DQDH 2A6KA 3WJJA 4TUKH 3DVNB 4P2QA 1YEJL 5JPMB 4PJAB 4YPGB 5CINL 1R3LB 1GHFH 3KGRA 2Q7NA 3S4SB 1PY4A 3JWOL 5HGDA 4HK0B 2BMKB 1BLNB 3WUWA 1HK6A 4FXKB 2X9WA 5J11B 4KK9C 4QCIA 3QUXD 3ZTNL 4UB0H 2CKBL 3K46A 4I1NB 3B9DA 3O81A 2F54E 1CFTA 1BECA 1KJVA 5IMMB 3BP6A 1JUFB 3RX8A 2X70A 4ODHH 2EDBA 4MA8H 1FO0L 2E8YA 1CDYA 4PD4J 4XGZB 3V7AG 4MA1B 4DEPC 3BXNB 4OLXH 1YN6B 3C6SA 4PJFF 4RWYH 3FQUA 4LSRH 2CDGA 1F3RB 1NFKA 3BGFB 3SDDC 4JRXE 4UTAH 4Q6IC 1VKXB 4KQ3H 1JRHH 2ITCB 1X6NA 1MAMH 3B8SA 4QF1A 1AGDA 2R1YB 3LQAC 3RDTA 4O5LL 3Q1SH 2A38A 1QQDA 3O6MH 3OPZH 1D7FA 5D2LA 4NO0B 2DF3A 4NGHL 5DTFB 5FKPA 3HI1A 1GC1H 3RGVD 1FZMA 1W2KT 5CBEB 5MP6H 3O4LE 3L3DA 2MTPA 3NGBC 3P73B 3QIUB 4M5YH 2LAGB 1PDKA 1W8NA 4ONFH 1DFBL 4YHML 2VDLL 4K71B 1IGMH 3VWJB 2X4SB 1PG7L 3DVNA 4P23C 4GW4B 1JIBA 5F7NC 1SJVA 4PJAA 3RZCD 2UY7A 2JK5B 1YQVL 2QQLH 2FJFB 2HJLB 3PV6B 3O3UN 3S36H 3MROB 4QO1A 3ULVE 3W39B 1I85C 3MUY1 4KC3B 1MHCB 1N3NB 3VFRB 3NZHH 4J4PC 4JFOB 1NCBL 2HKHH 5D1XD 1F4HA 5DR5L 1S7RA 3O4OB 4HEPG 1XIWA 1J1OH 5IMMA 2VC2H 2XRAL 3LZFL 3ZT5A 3DYPA 3RWJB 3FAWA 4M7ZB 3N9GH 4N0YH 1UZ8B 1ND0B 5F7DA 3DECA 4JRYE 2E7LC 3SDYL 3NAAH 1MCWW 2L7JA 4NC1C 3H0TB 3VCLB 4P4RB 2P8PA 3TV3H 1U3HD 4PJGA 3CC5B 4KK6D 1Q1JH 1UXWB 2R0WL 5FKAA 3GEWB 1ACYH 4JANA 3ZT6A 2YD2A 4RWHA 1NCTA 4WY7L 2R1YA 4JN1L 1J0YA 4Q58C 5F88A 3VGHA 1NAMA 2NYYC 4XPFL 4OSUH 1FL3B 3VG9B 2CQVA 3NVQA 4TQEH 5DTFA 2GT9B 5FECB 4FMFA 4OF7A 4XPGL 3QIUA 3QCTH 2IAND 3V0VA 4EI5A 4Y16D 3VWJA 4N5UA 2X4SA 1KCUL 3VXNB 4R4BB 2JK5A 4Y0GA 1YMHB 1F4WL 2FJFA 1IAKA 2HJLA 2BK8A 5J0BA 2OZ4L 4O58L 3QUXC 2WWKT 4FTVB 3GNML 4WDIB 5EU4A 5L7XH 4GW5B 1MHCA 1AGEA 5EC2A 4XCYA 2J8UF 5I1IH 1QLRB 5F6IB 5F7YC 1KIRB 3INUH 4I77H 4ZODA 5JXEA 5F89A 1HYSD 1MOEA 3DO3A 4WEMB 1CXFA 1U91A 4Y1AB 5D2NE 5D7KE 4C55A 3CFEA 3GKWL 2W65B 3UYPA 1YNKL 1ND0A 4JFDE 3H0TA 1M71A 1C5BL 1U8OA 3CC5A 3CU7A 2UYLB 1I8IA 5AD0A 2P43B 5GSRA 5C9JB 1ZGLA 3QSKB 1MWAA 2JTDA 1LO4L 2DIJA 4NJ9L 3RGVC 2F53B 1XGYH 1S7SB 5LQBL 2HJFB 1IC7L 4PTUB 5MERA 2VERN 4JFEB 1FL3A 2BFVL 1XZ0B 1DBBL 1A0QH 1N0XH 4RSVA 3V95A 2D9CA 1LK3L 4FMKA 3RZCC 3BKMH 1PLGL 4HF5H 4M7LH 1TZHB 3HPLB 3AREA 4HFUL 4JQVA 5JOFB 4RA0C 3R06A 1MY5A 4HJJH 2F54D 4R4BA 4HG4K 1DQTA 4UV4H 3DXAD 4U1MA 3QIWD 3WUWG 5FYJE 4JB9L 4KUZH 4LNRA 5D1XC 3C60D 2WANA 1VDGA 4FTVA 4WDIA 2YA0A 1S3KL 1I1AC 5CSBA 1KIUA 3KJ6L 1HHHA 2HLAB 3EO1A 4F3FA 2EYTB 1QOKA 4JRXD 2RHEA 5ALBH 3VXMA 1MF2L 2QSTA 3BN9D 1UH2A 2X42A 4L8SA 5KSAD 5IW6B 4R90H 1MLBA 4U1SA 1JGVH 1U3HC 5C2UB 2X4UB 1E4WL 1IC5H 3DHJA 3T2QA 4XWGH 5D7SL 1Q94A 4PS4H 4PJAE 4DKFL 5DD1H 1KIQB 1BBDH 1QFWI 3GJEA 1UCBH 3O4LD 2R9HD 1J10A 1ZHLB 3BIAX 3CXDL 3WIHL 1DQDL 2UYLA 4YXLL 2ADJA 5DI8A 3VDCA 2DBLH 5C9JA 3U7YH 3BO8A 1W0YT 3X3FH 1F3JA 4NKMB 2FJHB 2OMNA 3MYJB 4ONGL 5CBAA 2H3NA 3BKYL 1KC5L 4JFEA 4D0CB 1QSVA 4Y16C 5TE7L 3ULVD 3TCLB 1QBBA 2WUBH 1LK2B 2APXA 1A7RH 4M6MH 1TZHA 4M4RA 1JMXA 2MQ3A 5ERWB 3TZVA 3BWAB 4R7NB 3MGOB 3D39E 4O2EB 2XFXB 4OLYL 1IGFH 1HOCB 2PO6C 1NKRA 3VH8B 2IALB 4K55A 4JRYD 4U7KA 4OLWL 1PSKH 3D85B 4I3SH 1WBXA 2UWEA 4OLVL 4WV1B 4JREB 2HLAA 4M3KB 4XNQA 2EYTA 1YA5A 3BKCH 3MV9B 2AXFB 5IW6A 6FABL 3X14A 1UEMA 2GI7A 4JQIH 5I1AA 4OQTL 1ZHKA 4CL7A 3VFPA 2X4UA 1DQQA 4G6MH 2AV7B 1TFHA 3G5ZB 4JPVL 1KIQA 3MLZH 2NNAB 4KZDH 1HIML 5F97E 1SYSB 5L2KB 4Y5XB 1SY6L 2XV6B 4HZLB 1NBQA 1TVHA 4P2CG 4K3DH 1KN2L 1YDPB 2VH5L 3D6GA 4YPJA 3P40A 4D0CA 5GGRB 2MCG1 4JFFA 1WUNT 3T3PF 2WSKA 3VFNB 2DM4A 4G6KH 1F2QA 1BBJB 3QUZA 3QIWC 3MRRA 5ERWA 3LVEA 3C60C 3DMMB 2XPGA 5DMKB 5I76A 4OF0A 1MFCL 1KENL 4XPBL 3MGOA 4AG4L 1AGBB 1XGRA 4O2EA 1RIHL 5D7KD 2XFXA 4K8RD 1HILB 3VH8A 1QVOB 5DK0B 2AK4E 4JFDD 4HW6A 5KSAC 1G7PB 5DRZB 1XGQB 5CJOH 1BWWA 4KK8D 5HHVH 2LVEA 4MWFB 1IEBB 1FYHB 1UWXK 2NY6D 1X5YA 3QDAA 4KZEL 2G60H 4AT6A 1EDQA 4NZTL 1VEMA 1L7IL 4QRSA 3FT2B 4BSVB 4AEHH 4FOMA 1F8TH 2R9HC 4U1NB 1PKQB 2CXGA 4KFZC 5E2WH 3G5ZA 1XF2A 2B5IB 3GI8L 2CSPA 1EZVX 1SM3H 4UNTA 5EO0B 4EDXB 2EE6A 5I8EA 5L2KA 3B5GA 5T5FL 4EKXA 3QXAB 3S3JA 4K9EC 3HE6A 4A2MA 1FBIH 4HZLA 4EN3C 3ULVC 3GZKA 3C8DA 1T80A 5HYEA 1AXSA 1YY9C 5GJSL 2HFFA 3WL9B 1GGBH 3DVIA 2ED8A 5FYJD 3AXLB 2BERA 1RY7B 2Y72A 2V5RA 5A1AA 3VXPB 3LAFA 3O6FB 4Y1AE 3VFNA 3WS3A 1N8ZA 3O3EB 1J0IA 5L6YH 5C0BA 2Y23A 5DQDL 5EU7E 4TUKL 5DMKA 1QHPA 2GAZB 4IRSA 5FM5M 1KJ2A 4NNYB 4B41A 1GHFL 1T5WA 1PVHA 1S8DA 3MRPB 1F4AA 5B39B 1HILA 3EDJA 2X6MA 5DK0A 2D3VA 4X4MA 1KCVH 2F53E 4HIJB 1G7PA 4NQCB 1VERA 3UTSB 2BRQA 4TOYH 5I1DB 4MWFA 4QGTA 4C57C 3WNPA 5T1LB 3HR6A 5DRNA 4PYGA 4UB0L 4L4TD 1WICA 4UIMB 3U30B 4WWKB 3GIVB 1NLDH 2VKWA 4MMZC 5KOVC 3PWNB 3FT2A 4ODHL 4BSVA 2VTFA 4MA8L 4V1DA 1HQRB 4M1CD 2HT4D 4L8BA 4U1NA 3DROB 2X4QB 2CO6B 2GKIA 2Y06H 4HC1A 4OLXL 4RWYL 4AYFA 5I19H 4LSRL 1JCKA 3H7BB 1VADA 1YEHH 4FQIH 3CK0H 4UTAL 2PXYA 4KQ3L 4ZAKB 1JRHL 3VXRB 1G6RH 5EU6B 5IJKC 1MAML 1F6LL 1QRNA 1A4JA 5J7CC 3Q1SL 3WL9A 3D39D 3O6ML 3OPZL 1UADC 4PJ7B 5HPOA 3BP5B 4TNWF 1GC1L 5MP6L 3VXPA 4LLVB 4D9RE 5I9QC 4M5YL 2DTSA 3V5HB 3O3EA 1U8MB 4ONFL 5D2NC 1IGML 2ZNXA 4NO0D 3DX7A 3P11H 4K8RC 3TA3A 3QDJB 4QKXB 2BSTA 2GAZA 2QQLL 5DURB 1Z9LA 1ZTXH 1JTPA 4NNYA 3U79A 2RGSA 4KK8C 3S36L 4P2YA 1QSZA 2NY6C 4QHNB 3CCHB 3S36X 3SHSA 3NZHL 1NEUA 4HIJA 5D6CB 3VFWB 1SEBA 5CEZH 3UTSA 4H0HB 4XC3H 2HKHL 5CP3H 2BXYA 2WNGA 2YS4A 4CVWA 4DGVH 3OG6B 1J1OL 3PV7A 4NN7C 3GIVA 4D9LH 2VC2L 1IZKA 3CX5K 3AM8A 1WTGT 1HQRA 1MJ8L 3N9GL 3RY5A 4N0YL 3NAAL 5CJ8A 3TV3L 1K3IA 4YK4C 4YWGH 3ZKMC 4M93B 1Q1JL 3VWKB 2FIKA 3GSOA 1IM3B 2QR0A 1CGSH 4ZAKA 1ACYL 5IW1B 4MA7H 3VXRA 4P5TC 2C1OB 3IU4H 1OP3K 3AC0A 3U0PB 4IOFD 5CEXB 4ENED 3EBAA 3LS4H 3QQ4B 5DF0A 3MV9E 3QRGH 4OSUL 2DLIA 4TQEL 1ZVYA 2AK4D 2P47B 1II4E 1G7JB 4NZDA 4LLVA 2H1PH 4P3DB 3IF1A 3QCTL 4LVNC 2UY6A 1HQ4B 4JKKA 3L1OH 3LEVH 2JELH 1ZWIB 4X6FA 5F96H 4L29A 4CW1B 3PIQB 2V5TA 1WTLA 2EYRB 1DQJA 1MCIA 4XB7A 5I73B 5FA3B 4NO5A 5EPMA 4DVBB 1NEZB 1WT5A 5CKAA 4I9WE 5IFAH 4G42A 4MCZA 4JFXB 5L7XL 5F6HI 5CIPB 5D6CA 3L95B 2VLLB 5I1IL 3LD8C 5J11C 3IAGC 3QXDA 4FHBD 4U7SA 4PRHA 3INUL 4I77L 2HT4C 3SGJA 5HPMB 4M7LT 4DGIH 4PIRF 1RZJC 4D3CH 5GXBB 3HZKA 1S7VB 4G9DB 3U6RB 1NFIB 3B43A 2WAHA 2VDMH 1EXUB 4MA1C 2ICWA 2YOCA 1JNJA 1TENA 1MI5B 3EYVB 4Y1AD 4G8EB 1ZS8B 3QIBB 3BGFC 1XMWA 4J1UB 4OF8A 2Z92A 1TCRB 5C07B 5IW1A 2WUCH 5HDBF 3P30H 4PJCF 2C1OA 3KYMA 1I3GH 1XGYL 5CEXA 5IMOA 3QQ4A 5HYSB 1BQHB 1NBVH 1CFNA 4JCMA 4CADB 4ZS7H 2DWDB 3NMEA 1OLZA 3W9DA 1A0QL 1N0XL 5EOCJ 1G7JA 4HULB 2F53D 2KZWA 3BKML 4M7LL 4HF5L 5IG7B 1PKQE 4YGVB 4K71C 4F7CB 2HVKB 3BISA 5GGUA 1AC0A 5GGSY 3CH1B 2MFNA 3RNQB 4HJJL 1ZWIA 4UV4L 2EYRA 2VLJA 2IQ9H 5FA3A 5A2IH 3CDGB 1NEZA 4KUZL 4CDHA 1OSPH 2D9QB 3ZKSD 3WO4B 3FO9B 1BWMA 3RWDA 1A1OA 5ALBL 2F8XC 5DZLA 4PJ9D 3G6JE 4PJHE 3M8OH 4R90L 5ACZB 3CVHH 1JGVL 1S7VA 2C7UB 2J3SA 2J8HA 2I5YH 3MUHL 4UDUA 5DDHB 1MCKA 1IC5L 1M1SA 4XWGL 3ULSB 4AENB 1EXUA 4PS4L 5DD1L 5KZCB 1BBDL 5E8NB 4NYLB 5DRXB 1UCBL 1WCBA 4KDWA 1MI5A 4D9RD 1MJ7H 4JDZA 4N5EC 2JB5H 4ENEC 4ETQB 1AY1H 2DBLL 3V6FB 3U7YL 5C07A 4U1IA 1J86A 4JHZA 3X3FL 3FB8B 4NQCE 3L9RB 1B90A 3MO1B 3GMNB 5M7QA 5HYSA 4PP2A 4CADA 3CDFA 5TDOB 1EO5A 1GL4B 3TNMA 4UQ2A 2WUBL 4M6ML 5IG7A 1A7RL 1P2CB 2ENYA 2HVKA 5D96C 1AD0B 1ORSA 3CH1A 3OMZA 2E9JA 2BOBB 3PWPE 3FT4B 4KTEH 2V6HA 5DJ0B 1GGYA 1IZJA 3VXRE 1IGFL 3BAEH 5EU6E 4PRBB 5DJ2B 2YR3A 3ZTJH 4L8CB 1PSKL 4I3SL 4D0BB 1OGAB 4Q6YA 4H26B 3F7PC 5LVEA 4PJ7E 4R96A 4BQ9A 4Y5YB 2FGWH 3VE0A 3BKCL 1RJLA 5CGMA 3MOBH 3HLAA 4JQIL 3O6LH 2PTTB 3GHBH 1FNEB 4G6ML 1K9TA 5IFJB 4HXAH 3MV9D 4AENA 2BXZA 2R2HB 5EU7C 5C86A 4LAQH 4FFVD 3QDJE 4NYLA 5DRXA 3MLZL 1NJ9B 4KZDL 3KXFB 1G7HB 4XMKH 4M1GH 3N50A 4OFYA 3S35H 3T8XB 1MVFA 1WLHA 4NFDA 3MRJA 1IVLA 4LHUD 1NKOA 1G1YA 3FB8A 3GSNH 4K3DL 4NKDB 4X4XB 4NRYB 3L9RA 3MO1A 4HIHB 3OKNA 4HS6B 1AGCA 3STZB 1FZJB 4I9WD 3SY0B 1I3VA 2XQYK 4GQ9H 1LEGB 3S96B 3MRFA 2A6IB 4G6KL 3OGCA 3SBWC 2AJUH 1HSAB 43CAA 1P2CA 5GS1B 1S7XA 1AD0A 2FSEB 2XYCA 4MB5A 4ODVH 3H3PH 1EPFA 2DKMA 4UI2A 3LPFA 1LGVA 4QRPA 3DMMD 4XVUC 4DAGH 5DJ2A 1DN2A 1SHMA 5C0AB 1C7TA 4PJ9C 4WHCA 1OGAA 5CJOL 2IQAB 1FG2A 1I9IH 4JZJA 2EDYA 5HHVL 1CZ8H 5HTSA 5A40E 3VGDA 2G60L 5GS0D 2NTSP 4NM4H 2DIAA 4AEHL 2PTTA 3VD4A 1F8TL 2QADD 1BVKA 3BESR 4MGXA 5HVHC 3FB5A 5KTEH 4PJDA 4OUOA 5E2WL 2R2HA 1U8KB 2YRPA 1SM3L 4YHOH 4WI8A 3UJJH 3W5MA 3KXFA 5DWUH 1G7HA 1YJDH 1RIUH 3F65A 1KOAA 1IEAB 5MENB 1A2YA 1NGYA 2C5DC 2P44B 1FBIL 5T1KA 5E94B 1HHGB 1RZGA 1EUTA 4JQXC 5HVGB 3C2SA 2L7UA 4X4XA 4NRYA 4X9GA 4YHIB 1N6VA 1GGBL 3OJDA 2NY0B 3STZA 1A6UH 3MNZB 1CGYA 1JV5B 3S34H 4XZUA 1LEGA 1BVLB 2A6IA 5L6YL 2A6DA 1RK0A 5GS1A 4Q9QH 1MI5E 4GSDH 1AGFB 3O6FD 1NAKH 1PX3A 2FRGP 4DJMA 5DS8A 1DR9A 3CFDB 3DO7B 5E2JA 5C07E 3NIGF 3BFOA 4YFDB 4HAGA 4GRWF 1KCVL 2YN5A 4WV1C 4FA8A 4KMQA 3T4YA 2HJKB 4TOYL 2LV4A 1KTKE 3UP1A 2O5ZH 3EGSA 5IKCB 3SQOH 4HKBB 4FFVC 4NQCD 4D9QE 1NLDL 3TNNB 5EIIB 2BNQA 1RZKC 2XWTB 4G8IB 5T1LD 1C5DB 4X5LA 3HC4H 2Y06L 1VGKA 1U8KA 4WWKD 1CYGA 5I19L 1YEHL 4FQIL 1MCPH 3CK0L 3GMMB 4UV7H 4BZ2H 4OLEA 3HI5H 3NFNB 1G6RL 1NBZA 2R2BB 5E94A 1HHGA 3H9HA 2F74B 2R23B 4RMUA 5IB5B 3ULUE 3PWPD 4PYHA 1P7HL 4JFYB 4EUPG 4YXKH 4X7TB 1NAMH 5EU6D 3B5HA 1JV5A 4O9HH 2AJ3B 5FK9B 5KG9B 3HN3A 4PLNC 2BVEA 3F7VB 3BPLB 2FO4A 5GRVK 5I8OH 1FHGA 3P11L 3QJFB 4CU6A 2B1HH 3WNNA 1PEZA 1AGFA 1M7IA 2OTUB 5ADPH 2D31A 5KN5A 4HWNA 4GKNB 4MDIB 1ZTXL 3CFDA 1LEKA 5A2JH 3P9MB 3U48A 3QHZH 5TGBA 4G43A 1WBZB 2DQFA 5GS0C 1FNGB 3QDJD 3VFUB 1MEXH 5DURD 4OFVA 5CEZL 4XC3L 1BD2B 5IBUB 4OZFG 2QADC 2HAZA 4GAGH 5E5MB 1UQSB 3QFDA 4DGVL 4HKBA 1IBGH 5DVOA 4D9LL 1IL1B 1D9KC 3TNNA 4KRLB 5I1LB 2OL3B 4MD4A 4NUJB 2AABH 5ESQB 1C5DA 5K9KB 3SE8H 1M4KA 3SCMA 1DE4A 3L3JA 5IV2B 2PNDA 4YWGL 4DZBA 1I1YB 4Q97A 4Z7VE 2DRUA 4F37K 3T1FB 1AP2A 2W0PA 3GMMA 5KVDH 1I3RB 4KDTC 1CGSL 3NFNA 3RVVD 1CD1B 4MA7L 3BZ4B 2F74A 2R23A 4MJ4A 4AEEA 3EDKA 5C0JA 3VWKD 4P57B 1RUQH 4JFYA 2JJTA 3TIDB 1ZLVK 2P5EA 2IPUG 4X98B 3DUSB 3QRGL 1BZ9B 2PYFB 3C8KA 1EHLH 2H1PL 4R2GC 5GIRB 2NY7H 4PREA 1X3DA 4R3SB 5IK3B 3TYFA 3C5ZA 3L1OL 3MOAH 3QJFA 3LEVL 2JELL 5IEHB 3GM8A 5F96L 4G5ZH 4MDIA 3ARBD 2XXMB 1NMBH 3N1FC 5IFAL 4LLWB 4JRWA 4WUUA 2NR6D 2V9RA 1CXKA 2H32B 4PGJA 5CMAB 1BD2A 2C3GA 3LHPH 3AB0C 1G7LB 1UQSA 4DGIL 4RAHA 4D3CL 3STLA 4X6BB 1XCTA 4WWKC 1J88A 2BY0A 1A6ZA 1RAMA 4XP6H 1OF2A 4NUJA 2VDML 4RMSA 4WI5A 5ESQA 2XOTA 2ZZUT 4WO4B 5K9KA 2H9GA 1N5YH 3KJ4B 1LO2H 3A0OA 5IV2A 3QPXH 3MV8A 3BZDA 5E1HB 3SO3B 1I1YA 1O0VA 1NMAL 3R8BB 2W60B 2P5WA 1MRCH 5C0AE 3HMWH 1I3RA 1OL0A 3V7AE 2VISA 5IF0A 2WUCL 4G6AD 3P30L 4X0KB 5ITFB 5C09A 3ULVF 1FFPB 4HUVB 1EFXB 1I3GL 4QHMB 3QIBD 2P48B 3ZSTA 4Z7WB 4HV8B 1NBVL 3V6OE 4EJ1C 4P2RB 4X98A 3DUSA 1LMKA 4ZS7L 2EIZA 2XN9E 5GIRA 2XT1B 4HKZA 4KI5E 2VLKA 3O6KH 2OQJB 3RWCA 4HHAA 4U1KB 5KVFH 4ZFOA 4M03A 1XF4A 1AHWB 2HT3D 4D9QD 2NY3C 4DFIA 2Q86B 2IQ9L 5MENE 2MKLC 4RFNB 4KY1H 4U1LB 5D93C 4ZS6D 3WE6B 1OSPL 1IJ9A 2W59A 2CUMA 2KDGA 5K9QG 2H32A 4OCNC 4W70A 1QSEE 4X6DB 4XH2B 2GJZB 1IGTB 3BQUD 2VJXA 2UVFA 3M8OL 4ZSOA 2XTLA 3V2AR 4G7YH 3CVHL 1T89A 3O8XB 3EYOB 2I5YL 4WJ5A 1CDIA 2JF1A 3RVVC 3TO4C 5KVGH 4NHUB 2MHAB 4HUXB 1MJ7L 4Z7UE 3MV7B 4LLUA 2JB5L 5D7LB 3VWKC 4G6FB 4JGJA 1F4YH 1AY1L 3T0WA 4OKDA 1BOGB 5F1IA 3TVMC 2LU7A 1FFPA 4E42B 5GHWH 1YEKH 2NW2B 3GGWA 4QHMA 3I9GH 5FO8B 4Z7WA 1F13A 3NFSH 4M02A 2CLZB 2F5BH 2XTJC 1A8JH 3EW3B 4OV5B 2PTVA 3W9EB 4AMKH 1S7TA 4B50A 4HWBA 1M05B 2DLGA 2FHFA 3VD3A 5LCVH 3ARBC 4LHQB 4B7LA 4Z77A 1AHWA 4KTEL 4Q2ZB 1VSCA 2ARJA 5A16B 3BAEL 5C92A 2APTA 4PJIB 5INDA 4ZFGH 3L3GA 3WE6A 3NIDE 5I16A 4ZQKA 5IFHH 5FB8B 1J8KA 1LD9A 2Y4SA 2FGWL 4D8PB 2PTUA 4JVWA 1ZT4B 3NCCB 3TC9A 3QZWG 3U46A 5I15H 3PQYA 4F37F 3MOBL 2V9QA 3O6LL 4LPUA 3GHBL 3O8XA 4RQQB 3EYOA 1A7PH 1UH4A 4PJ5B 2GTWB 5HXMA 4HXAL 3ABZA 1JF1B 4LAQL 1NH6A 5F7UA 2EDTA 2MHAA 4MX7A 5D1QC 4HUXA 4X83A 3MV7A 4XMKL 4M1GL 3QIBC 1RZIA 3H3KA 3S35L 3JVGC 3EJJX 4QOKB 4FP8H 2QQQA 2LTQB 3GSNL 1FL5A 4E42A 4C54A 2NW2A 4H8WH 4H1LA 5DFWH 2DBJA 2PW2B 3LQMA 4RGMC 4OZ4A 2YEZB 1EVUA 2OJEA 5C0GB 4GQ9L 4OV5A 2C4FU 1YMMA 1J0JA 2HT3C 4E9LA 1I7TB 2X4OA 2AJUL 5T33H 1J11A 1JPTH 1S7QA 3WBDA 2BY3A 4HLZH 4LSPH 1FZOB 2P1YA 5EBGA 5JXAH 3GSXB 3VXUA 4ODVL 3H3PL 4NT6B 4BK4A 4RFEB 4IHOA 1WV7T 4DAGL 5A16A 3UTTA 3BQUC 1MUJA 4GKSB 1HNGA 1I9IL 1CZ8L 4D8PA 2E27H 5C0AD 1ZT4A 5B4MD 4NM4L 1DJSA 1QPPA 3ZYJA 5KTEL 2ERJC 1JF1A 3LKPB 1D5IH 4YHOL 4HC1H 3N1MC 2PW1A 3UJJL 2XN9D 2ARJQ 1H15A 1UZ6E 5DWUL 3RY4A 4CN6A 1YJDL 1RIUL 4KI5D 3BEVB 1BX2A 5LGHH 4QOKA 4FQCH 2VR4A 3ZDZE 4WI3A 5JPNA 3QQ9D 3MC0A 5MEND 1A6UL 4YE4H 1CG9B 3S34L 2YEZA 4NUGH 2EKSA 3SE3C 1QACA 5E8EB 5DD3H 3TWCH 3SDCD 4FQPA 1K5NB 1MCOH 2ICCA 3Q6GH 5DMGC 1QSED 3M1BB 3E2HB 3GMQB 4TVPH 2WV3A 4H25B 5JW5B 4GSDL 4Q9QL 5C0ND 1NAKL 3GSXA 1KTLA 1HCFX 4NT6A 3ILPB 3KHQA 1N2RB 4NWUH 5C0FB 3GBLA 4GKSA 1S9WA 3O3BA 1D5ZA 4P2RE 3W0WA 1F2XK 4J3TA 2O5ZL 4Y5YC 3SQOL 5C0CD 4JKMA 1P7KA 5EUKA 4AH2A 4Z76A 1TZIB 3MJ8B 4UIKH 2Z4QB 4HIEB 1UWGH 3HC4L 4KDVA 4NQSB 2EIEA 3LKPA 4MQTB 4YDLB 4MCYA 1MCPL 3JZ7A 4MNQB 5C2BH 4I13B 5TQ2H 5DHVB 5GSVB 4UV7L 4WFGE 1RQ5A 3D0LB 3VD5A 4BZ2L 3HI5L 1JZ6A 4YBQD 1W72A 4JM4H 2R2EB 2GW5A 5L9DH 3BRFA 4HDIB 4X6DE 1A22B 2P8MA 3OX8B 4YXKL 1NAML 4O9HL 4R97B 4G8FA 4IRZH 2Q6WB 1K5NA 2NPLX 4MQXD 2FEEL 4L3EB 3M1BA 5I8OL 2B1HL 1HHJB 5ADPL 5D7LE 1MVUB 1QR1A 1YUHB 2PETA 5H2BA 4LPCA 2QSVA 1UKTA 5FUCC 3ILPA 3REWB 5J6GA 3QHZL 3HG1D 5C0FA 4L9DA 1Z3GH 5B4MC 1MEXL 3MTRA 3PWUA 5JUEH 1QR4A 1P5VA 4MJ5B 3RIFF 2OCFD 3I02B 4GAGL 4P5MA 5HHNB 3HRZB 5E70A 4LKXA 3V6OC 3WNLA 1IBGL 5DA0B 4HMCA 5C8JA 1AI1H 1TZIA 5IBTH 3MJ8A 2AABL 3QP3A 2Z4QA 4XCNB 3OTTA 3B2VH 4HIEA 4KI5C 5DFTA 3SE8L 2EDKA 4X5WA 1UM4H 1ITBB 1T3FB 5E4EB 4LDLB 1F90H 5DJ6B 1IAIH 4XP1H 3MNVB 5LGKA 2XKUA 1CT8B 3GSQB 1SBSH 5KVDL 4PJIE 5E1AA 3QQ9C 5D1ZB 1GZQB 3C09B 2JJVA 4F15B 4I2XE 4APQA 3OKOB 1DP0A 4XAWH 4NWTH 2H2PD 1RUQL 2MQ0A 4HDIA 4FQHB 3SDCC 3TLRA 5FGBC 1R0AH 5BJTB 1CN4A 4P3WA 2FH6A 4Y4FB 3QWRA 3C6LD 4FQQA 1EHLL 3GMRB 5C0NC 2Q6WA 4PJ5E 1HSBB 4ZD3H 2VXVH 2NY7L 1CE6A 4L3EA 1MJUH 3MOAL 1TPXC 2CLRA 1BQUA 4PG2A 2EDHA 4J3XA 1JMZA 4G5ZL 4F8QA 1LE5A 1NMBL 4XXDB 1ZHBB 3LEXA 3TH3T 2AJYH 2OI9B 1YY8A 5HI5D 1CU4H 2NX5B 4Y19B 3LRGA 4U1JA 4MSWB 4JZOA 5EBLB 1U95B 4MJ5A 3LHPL 4OUUA 2VUOA 5CGYD 4BJLA 4OF6A 3O2WH 1ORQA 3HNTH 1SJEB 2OR8A 1L6XA 3QQNA 4XP6L 2CIIB 4U0RC 2CR6A 2OR9H 1FSKB 2VL5A 1N5YL 1B6DA 4POUB 4PJFB 4YBQC 4AIZB 1J8HB 2I9LA 1LO2L 3IDNB 2V2XB 3QPXL 4LVHB 3OBAA 3QJHB 3MNVA 1A6WH 1MRCL 3LKRA 4PLKD 3S98A 4WO4D 4WHTB 3ROOB 4JCLA 3HMWL 5D1ZA 2C3WA 3WDHA 1PFCA 3OKOA 1ZEAH 3JV0A 3I50H 1FYTB 4MVBD 5FM5O 3ILQD 4MQXC 3U7WH 3LY6A 3IFPA 1A64A 2R29H 4WNQA 1NSNH 4MD5B 1K4DA 3T0BA 1EFXD 4F80A 1IKFH 3O6KL 4HUWA 1H5BB 4P2RD 4ZXBA 3OG4B 2X1PA 1T83C 1KG0A 5KVFL 3VXOB 1DQLH 1MCEA 1I8LA 1G1CA 4R0LA 3KLAA 4XXDA 2CUIA 4KY1L 4Y19A 4N8CH 1T5XA 3TBYB 4MSWA 1X9QA 3VFOB 1MCJA 3ARFB 4N0FB 3ULUH 1E4XH 4WFGD 3B2UC 1WZMA 4P9MH 3X13B 8FABA 2RAMA 4G7YL 3D18B 4P46D 3ROLA 1KCRH 2CIIA 4WFFE 1JNNH 4K94H 5T1MB 4PJFA 5KVGL 4AIZA 1J8HA 4NN6B 4HBCH 2V2XA 3EO0A 3RWEA 5I0DA 3ESVF 2H2PC 4MLSA 1A3LH 1F4YL 4NC0B 1WZKA 3ZE2E 3RBSA 3L5XH 3BUYA 2X9YA 4IIQA 3VXSE 3BP4B 3WEXB 3C6LC 1YEKL 2LE9A 5GHWL 2O93L 5D7LD 1MPAH 5MEQB 2MNUA 3I9GL 4G6FD 3RHWK 4N90E 4DOHB 2YD6A 5DXWA 3NFSL 3GJFB 4JFHE 1OSZA 3MGAA 2EXYD 2BNRB 4MD5A 2F5BL 2XWBB 2FWOB 4AMKL 2CGRH 2ZP0T 5FV2A 5F71A 5LCVL 3IRPX 3HB3D 1BGXH 1JWUA 2EE9A 1AH1A 5HI5C 4KKBD 3SDAB 4MNQE 3OR6B 1DLHB 2OZ4A 3MJ7B 5KOMC 1U8HB 4Y2DB 1ZT1B 3SKNB 4ZFGL 1JPFA 5CGYC 1YYLH 2HKFH 4TULH 5IFHL 3VFOA 3QNZB 4LBEA 3ARFA 3NPSB 5MHSE 4XMPH 2OTWA 4MD0B 3X13A 5I15L 1MFDH 3L5WA 1U8PA 1ZHNB 5DQ9B 35C8H 4Z0BH 3WNKA 1A7PL 2DQCH 5GPRA 2HG5A 3QT2A 4PLKC 3LS5H 1HKFA 25C8H 2YUZA 1XT5A 2KZ1B 4ISVA 5T1MA 5DC9B 5DO2D 3EYFB 1IILE 5JIHA 2C3VA 2OJZH 5DJ8B 4PJ5D 3MRBB 3VFVA 3ILQC 3ECBB 5EZLB 4JN2B 4KXZH 5DZNA 5E08H 2B39A 4FP8L 4TVSa 4YDVA 4Y4KB 3WEXA 1UACH 3QA3B 4H8WL 4R7DB 5MEQA 2DAVA 5CAYB 4A6YA 3NCEB 2BNRA 5JOPE 2BOCB 5AZEH 3P9LB 4QHKJ 4U2YA 3G6JF 2VIRB 4HFWB 4PJHF 1G9MC 2A73A 1KELH 1TCMA 3DI3B 4FQ1H 2AVGA 2OBGA 3FRPG 5T33L 3LSOA 2EECA 1JPTL 2WZPD 5D7JD 3JWDC 4LSPL 3FJTA 5BV7C 1HWGB 5JXAL 1CD8A 5AWNH 4JO3H 2DKUA 4I8DA 1DLHA 3C9NA 4PRDB 4JKLA 4KI1A 1U8HA 3BRGC 4WWID 4PJ8B 1ZT1A 5F9WB 4MQ7A 4UAOB 5GGSA 4XPAH 3TN0A 5JNYB 2J8UA 2X40A 2WLZA 3T0DA 4P46C 3QR2A 2E27L 4MD0A 3U2SA 2F15A 4CVXB 4LSUH 5DQ9A 5ALCH 2DYPB 4YHPA 3AAZB 3TJHC 1UWEH 4EUPB 1D5IL 2J7LA 4EI5C 4HC1L 3EYFA 1QLEH 4GOSA 5J3HD 2IADA 4W4OA 2HTKD 5DJ8A 3V5KB 5IB1A 2M8XA 5LGHL 1KPVA 2EXYC 2NX5E 4I48B 1GXEA 3QWOB 4FQCL 4UZGA 2EDNA 1OP9A 1NGZB 1OGTB 4CMMB 1Q9WA 1DQMH 4TTDD 3PXHA 4YE4L 3HB3C 5F21B 4OZIB 4NUGL 5DD3L 4H0GA 4TSBH 3TWCL 4ZTPH 3P9LA 2VIRA 4ODXA 5JXEC 1MCOL 3Q6GL 4KKBC 4ELKB 4PJFE 4TVPL 3RRQA 4OZFB 3S7GA 4HD9A 5DC0A 2NW3A 1G7MB 1DEEA 4WFFD 3FOLB 2VN7A 4NWUL 5E6IA 4PJ8A 2DQHH 3WJLA 3WXWH 3QWQB 1A4KA 4G9FA 4Y5VA 3NOIA 1FYTE 3E6FA 4RX4A 4PR5B 1GIGH 4CVXA 3VXSD 5DO2C 4OQTA 4PRIB 2DYPA 4N90D 4UIKL 1UWGL 3QI9A 4NDMB 4JFHD 1IAOA 5E6ZA 3RBGA 1JHTB 4LLYA 4YC2C 3BD4A 4JFFD 2PKDA 3HAEB 5C2BL 5TQ2L 3V5KA 2XZCH 1KGCD 3FN9A 4JM4L 4ZOAA 4I48A 3QDMA 5HVFB 5L9DL 3QWOA 2VUYA 3L7EA 4MNQD 3GIZH 3O11B 2R1XA 3BT2H 2D4FA 1X5IA 3QEQA 5D7JC 5L0QB 3P4OB 1VHPA 4ZPTB 4IRZL 1MCWM 1NCCH 4YBLB 3VXTB 3G5VB 1I1FA 4OD1H 5DC4B 3BOVA 1QEWB 5MHSD 3RVTD 5HY9B 1H0DA 4MNGB 4XB8A 4XWOC 4O4YH 3ARDA 4Y4HA 2Z8RA 4ESKA 2X1OA 4LSTH 1JGLH 3FOLA 3T65B 1KT2B 3PGDB 1ES0A 4ODSH 1Z3GL 4H0IA 1IMHC 5FYJU 3GMLA 1MNUH 4OLUH 4DOHE 5JUEL 3I6GA 3BPCB 4OCSH 4NQTA 2AQ1A 3BI9X 4LLDB 3L3KB 2GTZA 1AI1L 5J3HC 5IBTL 4JR9H 2HTKC 1F4XH 4K7PH 3B2VL 1NC4D 4NQVA 4F7EB 1H8SA 2NY1C 1UM4L 5JOPD 3KPSB 1CBVH 1E28A 3TZVC 1F90L 2XY2A 3REVB 1IAIL 4XP1L 3HAEA 5B21A 1SBSL 2QKIA 5H94A 4TTDC 5BZDB 5TJWK 4NJAH 4XAWL 4NWTL 5I74C 1IC1A 1UJ3B 3SO5A 3T0EA 1R0AL 4GXVH 5ECJE 1WFNA 3RL1B 2C1PA 1YECH 4ZD3L 2VXVL 3QO0A 1WIUA 3L3HB 1MJUL 2W9LA 3CSYA 4Y4FD 1C7SA 1MCFA 1HDMB 5IQ9B 2X44D 1UVQB 1CFSB 3IAQA 5TH2B 5L8KB 3T65A 2EE3A 1S5HA 3O45A 3PGDA 3I6LE 4M6OH 2AJYL 4YIQB 3DBXA 4S1RH 1CU4L 1AXTH 2WWKO 5E8DH 1CFVH 4QRQB 2H32H 1GCFA 1WWAX 4YAQB 4ORZC 1CIUA 4LLDA 4PBWD 3S8WA 3O2WL 4V2BA 3HNTL 2NX5D 2PXYD 1GGCH 1EEYA 5D7IE 4NOBA 3CXHK 1EH9A 1DCLA 4F7PB 3ARGD 1QRKA 2OR9L 4L9LA 3FB6B 3BSZH 3QISA 3HNVH 4GH7B 4C58B 4GAJH 3QUZC 1MREH 4OCWH 2APWA 1E4JA 2AJXH 3NIFF 4HGWB 4YDLC 4GXUM 3REVA 5JR1H 3LKOA 3PL6A 1A6WL 4L3CA 3WNMA 4LPTA 1HH6A 1CD9B 5EZOH 4GLRI 4JAMA 1VEOA 1ZEAL 3I50L 3U7WL 3Q5OA 3DIFB 2QSQA 3F5WB 2R29L 2FZ3A 1NSNL 3P4LA 4ZYKA 4HKXA 1CDBA 1FYTD 2BHZA 3RU8H 1IKFL 2K3TA 4HWBH 3L3HA 1NGQH 4XP9H 1CVSC 2ZG3A 1K4CA 1DQLL 5CLTA 5E03A 3QZWB 5FYLH 2I60H 1CFSA 4JPWH 4X4YB 1J87A 4Z7VF 3PHQB 5LG1A 4YIQA 2OK0H 3IU3B 4RGNB 4N8CL 4QRQA 4HK3J 4QRUB 3ULUL 4OZIE 3I6KB 2R1WA 1E4XL 3BGAA 4Q74A 5CD3A 4Q9BA 5AUMB 4P9ML 5CJBA 1UC6A 4OLZH 2ZSWB 1Y6NR 3WIIH 1KCRL 2G75B 5BCAA 4F7PA 1JNNL 4K94L 1A7NH 1CGTA 1IARB 3ARSA 3FB6A 5EIVA 3L3IB 2DKSA 3MLYH 3RI5K 4LRNH 3WHE0 5H37H 4HBCL 1A3LL 5B38G 5ETUB 1KJMB 2R56H 3MNWA 4IRSC 4KTDH 3L5XL 4S1QH 3I3DA 5BQ7B 1MSPA 3HUJF 4I4WA 1MPAL 3QUYB 5KAQG 3DIFA 4HXBH 4H1LH 4QRRB 3UAJD 4U1HA 4Y4FC 4OZGF 4IOIB 4PRIE 1FLTX 2CGRL 3Q6FB 1CF8H 1BGXL 4O2CB 4G80B 3MLXH 5C0DB 2Y25A 5DJAB 2OX5A 1CCZA 3ZYIA 4ZO8A 4F9PA 4OTXH 3QUMB 4BSWB 1U8LB 1YYLL 2QHRH 2HKFL 5IQ7H 3SDAD 1D6EB 1A6AB 2PXYC 3IU3A 3IVKB 4PJEA 4TULL 3SE4A 5EZIH 1TTUA 4C83A 3BMVA 1L9NA 1NUGA 15C8H 2R39A 3ARGC 4XMPL 4Y2DD 3EO9H 2FNBA 1MFDL 2XA3A 3MLTB 35C8L 2ZSWA 3A6CH 5HYJA 3AU1A 2K9UA 2G75A 2DQCL 4IMLA 1ZGLM 2VLRB 2F58H 4HCRA 1FSKC 3LS5L 4KI5F 25C8L 3WV0A 4MNGE 1T6VN 4DTGH 1KYOJ 1P4IH 4LVHC 4POZC 5A2LH 2OJZL 4LGRB 4QXGH 4GG8B 5ETUA 4UU9A 3QO1B 5E08L 3WFZA 5ICYA 5BQ7A 4RIRA 1UACL 3O3DB 4P4KD 3WHXB 3QUYA 4BELD 3G5YB 3F62A 3VGEA 3EOAA 3I6LD 3TP4A 4Y4KD 5HVWA 5AZEL 3GBMH 2IPKB 2D0GA 1KELL 3NCBB 3CPLA 1UCTA 3Q6FA 4HIIB 4FQ1L 4WFHE 4TNVF 5SWSB 1H5BC 3JTSB 3SKMB 2VZTA 3KPSE 1CFQA 5JO5A 1WEJH 2BRRH 3DX9B 1XH3A 5EBWA 1JBJA 5LGJB 5AWNL 2XKSA 3IDXL 4JO3L 4LIQE 1EFQA 3DVGB 4MYWB 4XCCH 5E9DA 4Z7UF 2I26N 5D6DA 3PWJB 2R15A 3HZMA 1YNLH 4Z7NE 3QUMA 4BSWA 4XPAL 3IVKA 4FXGA 2ZUTA 3SE9H 4YR6A 5I6XC 1F3DH 1FLRH 3A6OA 1UENA 4LSUL 1P4BH 4Q7DA 5ALCL 5EORH 4ZO6A 3G6DH 1UWEL 3RGHA 3V7MA 1FFOB 4DEPB 1EHNA 4OGYH 2ED7A 4LCCC 1QLEL 2I07B 4DKAA 1KJ3H 3SDDB 4XPTH 5JQ6H 4GG8A 1YNTB 3ALWA 1EK3A 1OM3H 4PJCA 3LV3B 4ZUSB 3UAJC 5FO7B 3BMWA 5DD6B 1YN7B 5JLZA 3KPQB 1FIEA 2DTMH 4KGJA 2A83A 1F11B 1DQML 2X41A 3BPNC 1T66D 1T7WA 1U8IB 3E0GA 1ZLWH 1FGVH 3FT3A 4TSBL 3IGAB 3F58H 4ZTPL 3NGBB 3BIKB 3N85H 5F9JB 5SWSA 3SKMA 5IMLA 4XBPB 3EYUH 3CNKA 4P23B 3UTQA 4QXWA 1D5MA 1U3YA 3DX9A 2DQEH 4HK3N 5LGJA 1K8IA 4OIIH 3D2UD 1ZLUH 3IJSB 5I75C 3MQIA 3KPMA 3IS1X 3NN8A 3ZHDA 4HAFA 4OD2B 3PWJA 1SVZA 2DQHL 5MEOA 3WXWL 3ME0A 4QTHB 4C56E 3D5OF 3RI5F 1KNOB 3B9KA 1GIGL 2EDQA 2JIXA 2AJZA 5K9QI 5KSUB 1CGUA 1R5IB 1FFNB 5ESAA 1BJMA 1TITA 4NPYB 2HN7B 3DUUA 2H8PB 5DSCA 2CK2A 4IS6B 1ZSDB 4PRID 3ZKQD 4QXTB 4P4KC 3S37H 4ZUTA 3PDDA 3FKUS 2XZCL 4Q6IA 1AO7B 1YNTA 5E8OA 4QHLB 5HYIA 1IGYA 2CRIA 4RGNE 4X6EA 5FO7A 2Q3AA 3VD9A 4M5ZH 1T6WA 2HT2D 4JZNB 1KLUA 3GIZL 3KPQA 1F11A 2VXQH 3IFOB 3V8OA 1CDUA 3BT2L 1QD0A 1XGUB 3BZEA 3HR5B 3QNYB 1NCCL 4JFQB 4ONHA 4LRIA 4PRNB 1PYWA 4OD1L 1Q38A 3QPQD 5CP7A 1G9NC 4P23A 2BVQB 3NCMA 2FEDD 1MCHA 1KFAH 4O4YL 2EDWA 4LCWB 5JW4R 2C4XA 4BSJA 3MODH 4U6XB 3GSRB 3MRLB 4F7MA 2VZ1A 2WP3O 4LSTL 1JGLL 1PKOA 2NY5H 2NXYD 3MA7B 4ODSL 1I85A 4OD2A 3QQ3B 3ALXA 5CJXC 1MNUL 4OLUL 3HC3H 4IOSD 3DX6B 4MAYB 3HPJB 3ZDZF 4OCSL 1T2XA 4RMQA 1MY7A 1NDMA 2JB6A 4QRRE 4KHXH 1KNOA 2B7DT 2UVEA 3QH3A 4X9FA 1ETZA 1LO5A 2XQBH 1JJUA 3IXTA 4JR9L 1F4XL 4HPYH 4K7PL 1VFUA 5CZVH 1D5XB 4NPYA 2E7LA 2H8PA 2WINA 3MLVH 4K7PX 1RVFH 3FMGH 1RFDH 2MQCA 4JM2D 1CBVL 4PGZA 1ZSDA 4OI7A 4QXTA 4WFHD 5J6HB 5AZ2H 1AO7A 1CLZH 2EC9T 3KPSD 1LILA 3E6HA 5JQHC 5I66B 3ARZA 4LPXA 4NJAL 3P0GB 5F1NA 4WTXA 1TLKA 4GXVL 2FYYA 5DMYA 4XNUH 3RNKB 4M4PA 1XGUA 3OHXB 4ZUUA 2WM0A 1CR9H 1YECL 2VLRE 4JFQA 3MRCA 4KPHH 4BKLB 4PRNA 4MXVE 7CGTA 1FNFA 2BSRB 1YZZA 3MFFA 1I1RA 4GFTB 1CTNA 5F7EH 4U6XA 3MRLA 4XT1C 1EHAA 3CFKA 1U93A 4U6HB 4U1GC 4M6OL 5FV1L 3QUXA 4NRXB 4S1RL 2XACC 1AXTL 1I1AB 5E8DL 1CFVL 3WUZA 3JTTA 5IM7A 2EYSB 5C08B 4CN4A 4E41A 4X6DF 1ZLUK 3S97C 5DFVD 1GGCL 2BNUA 1P6AB 1ED3A 1U3HB 2AI0H 3HE7B 5SWSE 2FL5B 3V0AC 3QUKA 1XGTB 1M7DA 5DJZB 4YFLI 4UDTB 3BSZL 3HNVL 2VDOH 3FTGA 4GAJL 1MREL 1N59A 4OCWL 2AJXL 2VWEC 5H8DA 1QFHA 1URLA 2HVJA 2HT2C 5JR1L 4PJXF 2BSSB 2LFGA 1BIHA 1SBBA 1AR1D 5KSBF 5I66A 1EO7A 5EZOL 1S9YB 3MRIA 3RGVA 3V52H 4CVZA 4QWWD 4UTBH 1N6QH 2YK1H 2GHWB 2IANB 4G3YH 1GJIA 3QPQC 1DBJH 3MR9B 3FFCE 2FEDC 4RMVA 4K7FA 4C56D 3RZCA 3RU8L 2CMRH 5E95B 4HWBL 5F93C 2BSRA 2HH0H 5KW9H 2H26A 1NGQL 4XP9L 2NXYC 3NPZB 1B6UA 1WISA 2GSGB 2Y5EA 5DD5H 4I3RH 4XHJD 4QRTA 5FYLL 2I60L 2BVYA 4JPWL 3QNXB 4XBEH 2PO6B 5D1XA 3TFKD 4U6HA 2EH8H 1EV2E 5DK2B 2OK0L 4WW1A 4LF3B 1EGJA 1NC2D 3AMLA 5CUSH 4CGTA 5MEPB 3R0MA 1JGDB 3GSUA 3MCKA 1MHHA 2BSED 2Z31D 1FFQA 3X11A 4RGND 1FL6B 2J8OA 4OLZL 4JM2C 1U3HA 3MA9H 3MRKB 3WIIL 2FL5A 3WKMH 4MA3B 3OF6D 3I3BA 4X8JB 1AIFB 1A7NL 5IESH 4UDTA 1JHLH 4F33B 4TSAH 1DUYA 3MLYL 4LRNL 4FZEH 3TIEA 5IVXB 3ZZ1A 2Q20A 5BS0D 3LB6D 5GQBA 3BGMB 2R56L 4KTDL 1K2DA 1B0RB 2DQGH 4S1QL 2EH7H 1CGVA 1S9YA 1UJ3C 3IKCB 1EBPA 2IANA 3MBED 2QJDA 4HXBL 4Y16A 3V9FA 4Z7OF 4A6YH 3MR9A 2Q87A 2X4RA 3U9UB 3IDIB 2CKBB 3PGFH 4LFHG 3DXAB 4CVUA 2CDEA 3HZVB 1CF8L 5IW3A 2K7PA 1A9BA 4QRRD 4WI4A 4NC1E 3C60B 4MXWH 1T1WB 3MLXL 5HHPB 3SDXA 3ZE1E 1ONQA 5IIEB 4WI6A 1XF5B 4ONOA 3QNXA 4OTXL 4WEUD 2MCPH 1SEQH 3P4NB 5DK2A 4GXUN 2QHRL 5IQ7L 5KSAB 1A1NA 4LF3A 5EZIL 5MEPA 5DJCB 2GEEA 15C8L 3CLEH 3OR7B 3EO9L 3IDYB 1IAIM 4MDJA 3RZWA 5C1MB 1X5GA 2DLHA 1A6VH 1FL6A 3A6CL 4J8RA 3MRKA 2GUOA 3B5TA 3LDBC 5KVEH 5F1OB 2RB8A 4EOWH 2F58L 4X8JA 2YMXH 5SX5H 4DTGL 1GOHA 3BW9B 4LCWE 5FYKU 1AR1C 4NSKA 1P4IL 4QWWC 2VLRD 4QXGL 3K4ZA 4JJ5A 3I84A 4PD4K 4MJ6B 3FB7B 3HFMH 4EN3B 4K23H 2JJSC 2CRMA 1OAQH 1EAPA 5BO1H 1H3GA 2UWEF 4X5XA 5C3TA 4N1CA 1EMTH 3QAZB 4YHKH 3U9UA 3IDIA 5C9KA 3GBML 3QBTB 4L4VB 2F54A 3LOWA 4LP4A 3QIWA 1UB5B 4YHNB 1Z6JT 3TFKC 2K7QA 3C60A 2DM3A 4LCUB 3IFNH 4JRYB 1WEJL 2BRRL 1T1WA 5BVPH 3BP7B 1CQYA 2Y7QB 2PCPA 1BP3B 5IIEA 4I0CC 3SCMC 4XCCL 3PNWB 2D7PA 4JRXA 2RQ8A 4KJWD 3QRFM 1YNLL 3ZE2F 2CIKA 2Z31C 4PV9B 3DYOA 4RGNC 4XBGA 4BQ8A 3EOBA 3SE9L 2HFGH 3HHRB 4QY8B 2JJTC 1FLRL 1Q8MA 1T7YA 5JOEA 3CVHA 3J7HA 3CDYA 1P4BL 2Q76A 5EORL 3O4LA 3G6DL 4KK9D 3LB6C 1S9VB 1G9EA 4OGYL 1BFOB 1CIDA 2PN5A 4HIXH 3FFCD 4RFOH 2R0KH 3PXJA 4S1SH 3C5ZC 4U6VH 1QBMH 1KJ3L 4XPTL 5ESVA 5JQ6L 3KNBB 2XICA 1IFHH 2YBRA 3MBEC 1OM3L 5T3XE 2KH2B 3BD5A 4M8QB 2Q8AH 3BX7C 3SDDD 5C08E 2DMCA 2DTML 5EZJB 3SKJH 2B1AH 5TDPA 4Y89A 2PR4H 3CAFA 2ICES 4PLOB 5EOTA 1LDSA 4JEGB 1FGVL 5I9QB 3F58L 3N85L 4NM8H 5F70A 5GRZA 5D2NB 4B7IA 3EYUL 1L4IA 1AXIB 5ENWA 4JRYA 4JFDB 1A9EB 1IT9H 1L9MA 2DQEL 2VZVA 3GJFK 2Y7QA 4JVPA 4PTTA 2ATPA 4OIIL 5EC1B 1XGPA 3G5XB 3PNWA 3BZFB 2J5LC 1A7BA 3IS0X 5C0IB 4PV9A 4CUCA 3VFMB 5T3ZE 3TT1H 4JFPB 5EUOF 4ZPVB 5F8RC 4QY8A 1N64H 5SX4I 5FUOH 4KK5C 3PWVA 4YDJA 5EH1A 1EEZB 2D7QA 3K4AA 3HCVB 3SGEI 1TZGH 3VFGH 1X5KA 4DZ8B 3EFFB 3UXFA 3RFZC 2P8LB 5DT1H 1V5JA 4YK4B 5HHQA 1RULH 1NFDE 2FIRT 2ZJSH 2HFEA 3S37L 3N1QC 3MRNB 3HAEH 4EXPX 2VDRH 4P5TB 3MRMB 4JHAH 5IJKA 1B0GA 4M5ZL 4M8QA 1S7UA 3IDMB 4Z8FH 2VXQL 4X9IA 3VXUD 3UBXG 5EA0H 3KYOB 2OM5A 3HZYB 2NQCA 2X4PB 4WTZA 1MFEH 5D2NA 1FH5H 4GKZB 5CWSB 4IM8A 1TJGH 2A6JB 4ZUVB 3IJHA 4KJWC 3Q5TA 4JFDA 5IVXE 2GITB 1KFAL 3UPCA 1F5WA 3MODL 1TTGA 4HS8H 2DS4A 2Z93B 1UJTA 4IRJB 3PUCA 2YXFA 2V2TB 2NY5L 5ICZA 3MPCA 2CLVB 1OW0C 1TVBA 3BZFA 4GS7C 5IR1B 4L4TB 5IBLD 5I0ZA 4LCWD 5C0IA 1ZGLP 3HC3L 3VFMA 1RK1B 4K7PY 1P9MC 2FX7H 3LD8B 3OB0K 3QCVH 4DUVA 5FCSH 2GJ6E 3VRIA 2WIIB 4ODUA 4KHXL 3IFLH 4LKCA 1P7QB 1EEZA 1T1ZB 3HCVA 5I2IB 1SYVB 2XQBL 2Y5TA 3DXAE 4MAYD 1CL7H 2OTPA 5D4QA 4HPYL 3QG6A 2AXGB 1I8MB 1U8NA 5CZVL 5BMFH 2X89D 3MLVL 1RVFL 4ZFZB 3FMGL 1RFDL 4Q0XH 2VRAA 4R8WH 3BYTA 1T20A 3D39B 3PABA 1R3KA 1A6TB 4J3SA 4PY7A 5AZ2L 1CLZL 5HGGS 1LP9E 2YPKA 3BDXA 2EXWD 1VFAB 1AKJB 1I4FB 3WN5C 5SV4A 5GGQH 3X12B 4XNUL 3UYRH 5KS9B 5HGAA 3HZYA 3AMKA 1OLLA 3C5JB 1RJCA 1CR9L 3WFCH 2D0FA 4KPHL 3TBSB 3C87A 1KV3A 4GKZA 4OCRH 3B3IB 2XNAB 5I1JH 5JPMA 5CGTA 1Y6KR 4TN9A 3KPTA 4YPGA 5F7EL 4ALAH 3RL2B 4Y88A 1FCGA 1R3LA 3RPKA 1OOAA 3O2DA 4K3GA 5FXCH 3S4SA 4I0PD 4QYOB 1INEH 3HI6H 5AG9A 4HK0A 2BMKA 4JO1H 1BLNA 1VFBB 3KPRB 4FXKA 1MCDA 5B38B 2XY1A 4XVSH 3FOMB 5DYOB 4QLRA 3IETB 1I1AD 4L4VE 3BEWB 5T3XD 1RUAH 3UTPE 5E0QA 2AEIT 1JUFA 1I7UB 2AI0L 1Q9OB 1SYVA 4LAJH 1NCDH 5LBSH 1ZAGA 5C08D 1BVZA 1X44A 4XGZA 2AXGA 5FOBB 2B4CH 2VDOL 5HHOB 1WFOA 1YPZB 3BXNA 1YN6A 3T0XA 2DMKA 3HE7D 4MJIB 1MCRA 5HI4D 5JIPA 3D39A 2AQ3A 1VKXA 2JCCE 1J1PH 2ITCA 3MRDB 2AK4B 1KXVC 3H42H 4R4ND 3V52L 3GMPB 4JHBA 1VFAA 3FFDB 4UTBL 4Z5RB 1N6QL 2YK1L 1MHEB 2IPUK 3AY4A 1HEZB 1T4KB 3EKCA 4EI6B 3WFDH 4G3YL 3PF2A 3X12A 4GBXD 4NO0A 3U36B 1DANU 1DBJL 5CBEA 4LSSH 2XKNB 4CMHB 3DETD 3P73A 5T3ZD 2CMRL 3L3OB 3UO1H 1PAMA 2HH0L 4FZ8H 5KW9L 5D96B 3ZTJG 5JIIA 3M07A 3B3IA 5IUSA 4GW4A 5DD5L 4I3RL 3KPLB 5IBLC 4XVTH 3PV6A 4XBEL 1I3UA 2ICWJ 3MROA 1IM9B 2IAMD 2EH8L 3W39A 1C8PA 5I71C 1N3NA 1RSFA 1XCQB 3EJZD 3VFRA 5HGHB 1J05B 4JFOA 5CUSL 1VFBA 5IGXH 4MAYC 3JWNC 1N6UA 2PO6D 4E0RB 3TPUB 3ZYZA 4HUMB 3IETA 4YDKH 4UT6H 1P1ZB 3SOBH 1I7UA 3MA9L 4PUBH 1EX0A 3WKML 3RWJA 1S9XB 2H6PB 1T22B 5IESL 4TPRH 1UZ8A 2FX8H 1JHLL 1VACB 4HCRH 4MZ3A 4TSAL 3VCLA 1J1XH 3OKDB 2EXWC 4FZEL 4P4RA 3CZJA 3GB7B 1UXWA 1F58H 3B6SB 4PRPB 2FX9H 5L2JB 3TCXA 3CFBB 5D70H 4DCQB 2DQGL 3EOYG 2EH7L 1O5DT 2AK4A 3GMPA 1Y18B 4YQXL 2EC9U 4LGSB 1MHEA 3CJJA 4OZHE 4EI6A 1BJ1H 4WTZG 5HHXH 3U36A 4A6YL 2VL4A 3WFHB 2GT9A 5FECA 2YPLB 2XKNA 3PGFL 1I7ZB 4LU5H 2RIKA 4TTGA 5D7IF 4YJZL 5BW7C 2GJ6D 5HJ3B 4GQPH 5SWZE 5JORB 3VXNA 1FNLA 4MXWL 1NCWH 4I0PC 4WGWB 2AJSH 2O26U 4JPIB 1UWXH 1YMHA 4B53A 4NFBA 2OYPA 2G9HB 2PYEE 4M6AA 5JA8B 1JK8B 1ZA3B 4I0KA 4BA8A 4PJ9B 2MCPL 1SEQL 4BFBD 4GW5A 3WD5H 1XCQA 3QUMH 5HGHA 1OD7A 1QLRA 2D2OA 1KIRA 3HC0B 3U4BH 3CLEL 4E0RA 3CU1A 1A6VL 3V4PH 1P1ZA 3HE7C 1NANH 3KLHD 1X4XA 1Y6MR 3AFLA 4Y1AA 4EBQH 5JW4Q 1S9XA 5KVEL 5HVHB 5HI4C 1T22A 2ADGB 4EOWL 2W65A 3RWHB 4NZJA 2YMXL 4ZUWB 3OKDA 2EEBA 1WBYB 4R4NC 3G08B 1OARH 3T1WA 3MYZA 2VOTA 5ANME 4GG6B 2IH3B 4L4TE 4LLMB 3DURB 3HFML 3QEUB 4DCQA 4GBXC 4K23L 1VFOA 2J2ZA 3ARRA 4P2OB 1Y18A 1OAQL 2F53A 2R0ZH 3BPOC 3DETC 1S7SA 3ETBF 2HJFA 5BO1L 1TJHH 2YA1A 4PTUA 4YHZH 1MCCA 1WC7B 1OTTD 1EMTL 2EC8A 4J3WA 5HDLA 4EN3D 3OAZH 1XZ0A 1QZ1A 4OZIF 1LEIB 4YHKL 2W92A 1YY9D 2DQIH 2CK0H 2A77H 2HTLD 3SBWA 3HPLA 3MX0A 4NQDE 5JOFA 3BIBX 5HJ3A 1BQLH 2IAMC 3IFNL 3IDUA 5BVPL 4L4VD 1U6AH 3UTPD 3EJZC 4TNWK 5C7XH 4JPIA 1KN4H 4XP4H 4M7KH 5E4IA 2G9HA 3O9WB 1VESA 5E5RB 4NKOB 4PJ9A 1Z5LB 1QBAA 1BEYH 1V7MH 3NH7H 1J7VR 3QHTC 4K07A 2HFGL 1LNUB 1FQ9C 5F9OH 5KS9E 2N7BA 5GS2D 1AQKH 3K8LA 1Q72H 5CS7A 1UB6B 4HS3B 2C3HA 1BJ8A 4NCC2 1ADQA 4GT7A 4XX1G 2E9IA 4HPOH 4XTRD 4HIXL 4LHUB 4OAWB 4RFOL 2R0KL 4S1SL 1RUMH 4U6VL 5MI0C 1QBML 1ZHLA 3BWUC 2NXZB 1IFHL 2QQNH 2CXKA 2VXSH 3DURA 2WMPA 4JQXA 4NKMA 2FJHA 3JWOC 3MYJA 3KPRE 2Q8AL 3LQAH 3SKJL 2B1AL 1T2JA 2NLJB 2ZUQC 4WW2C 1U41A 2AV1B 2PR4L 3ISWA 1GOGA 5FAAA 1X4ZA 1LEIA 1YQ2A 3TCLA 3WFBH 1X5HA 1VGEH 3MLSH 4NM8L 2BCKB 1LK2A 4KJQD 2X4TB 2HFTA 5HHOE 1YPZE 5FEBA 2AERT 3MMEB 3BWAA 4MJIE 4R7NA 1IT9L 3ZDYE 5D8JH 1KCKA 3LEYH 1I9EA 1GAFH 2D7MA 4PBXA 1HOCA 2IALA 3RP1A 4CU8A 4E5XB 3D85A 4OCXH 1FC2D 4WV1A 5L88H 2X5PA 3OKYA 2VQTA 1GH7A 1JZ5A 3S5LB 4WI7A 3TT1L 3KLHC 1J18A 4XXCA 2QADB 5F7LB 3IDYC 5HBBA 1N64L 3MV9A 5FUOL 2AXFA 3LIZH 4HSQA 2KPNA 2Z0BA 2DJ4A 1TZGL 4HUUB 4JM2F 1D9KB 1X5ZA 4R26H 3VFGL 3PP4H 1JF5A 2AV7A 4QT5B 1OP3H 1C16B 5DT1L 4OAWA 1RULL 2NNAA 2ZJSL 1SYSA 4XCEB 4Y5XA 5EIQA 2VDRL 1T1YB 5SWZD 4O51B 5I1EH 1OTTC 4JHAL 5FDWB 4N8VB 4R0LC 2VABB 4ODBD 5EN2B 3ZKMD 4CN1A 4Y7MA 4Z7NF 1YDPA 5JDSB 5I8CB 5J4MA 4Z8FL 3DI2B 2HTLC 2NLJA 3O3AB 5EA0L 2PYED 5GGRA 4P5TD 5I8KH 2W9EH 3QAZC 3UJIH 3RKDD 6CGTA 3G6JB 4PJHB 4R2GB 3SPVB 1Q9KB 2X05A 3MGTB 2BCKA 5GGVH 2W9DH 3VGAB 4OCYH 1BBJA 1MFEL 1FH5L 3KS0H 1DDHB 1TJGL 3DMMA 1IQWH 3OAZK 4O2FB 4HS8L 4PRPE 1AGBA 2Z91B 3QDGB 1NLBH 1QVOA 4U6YB 1DLFH 5DRZA 1XGQA 2FX7L 4IRJD 3QCVL 4IIQC 3H9SB 1IEBA 3EZ8A 1P4LB 3AB0B 4XPHH 4J23A 3IFLL 4GUPB 4I18C 2X7LB 3ELAT 2YPLE 3EUUA 4XTRC 3SJVB 1KLFA 1CL7L 1HZHH 3L6FB 4ETYA 4JHWH 1MIMH 1QFOA 3WS6C 1JWSB 1PKQA 5BMFL 5BRZB 1P7QD 3ZKNC 7FABH 1HI6B 5EO0A 4Q0XL 4EDXA 4J12A 1FG9C 4YUEH 3PWPB 3QFJE 4R8WL 4OIBA 4XCEA 3QXAA 4KDTA 4NQDD 1QFUH 1CXIA 4O51A 3U9PH 1MHPH 4HMDA 5FDWA 1U2CA 1E4KA 4KJQC 5GGQL 3AXLA 3UYRL 2O5XH 4NZUH 3BH8B 3UCRA 3G6JA 4PJHA 1AKJD 4LMQE 3T2NH 3O6FA 4RRPA 1Q9KA 3WFCL 3KPOB 1OB1B 3C2AH 3PWLB 1JPGB 1MCQA 1DVFB 1MLCB 4M61B 4OCRL 1DDHA 2VAJA 5I1JL 1PY9A 3KVQA 4O2FA 3V0WH 4ALAL 2NY3B 1JGEB 5LAXB 3ZE0F 2VR9A 1IGCH 4GG6E 5B39A 3MRPA 5D93B 1UA6H 3SGDH 1INEL 3HI6L 1BAFH 4U6YA 1LHZA 4GRWH 1FRGH 1WFTA 3RA7H 2I9TB 5B8CC 4JO1L 4NQCA 5D71H 1P84J 1X5AA 1EGJH 1CVRA 5I1DA 1P4LA 4MJ2A 1FORH 4H88H 5T1LA 4XVSL 3AS0A 4GUPA 1ROWA 2X7LA 4GRLB 4UIMA 1RUAL 4WWKA 5DJDB 3PWNA 3KPRD 3DX8B 1NCDL 5LBSL 4G8GE 3QEGH 5IROC 2XG4A 2G5BB 1W0VB 2B4CL 2X4QA 3DROA 1G0DA 4QXUH 3TO4B 3L5IA 1DL7H 3H7BA 3PWPA 4X6CB 4YBHA 4W6YB 5DVLA 5HHOD 3GRWA 3TVMB 1JRHI 1J1PL 5EU6A 3H42L 4U6TA 3RKDC 4MJID 1MH5B 4N5ED 2WK2A 1JNLH 3WFDL 5T3ZH 1V3LA 4PJ7A 5C0RH 3BP5A 2XTJB 1I7RB 4LSSL 4AEFA 4LMQI 2J1KA 2AEPH 3V5HA 4S11A 4XNXH 1U8MA 1WWWX 3UO1L 3PWLA 3ARBB 4FZ8L 1GGTA 1MLCA 1SJXA 3VH8G 3NCYP 4YFLF 5JMRA 1JHKH 3OJVC 3QDJA 4XVTL 3TO2B 1CICB 1TNMA 1Q0YH 4IRJC 2VDNH 1QSFB 4PB9H 4QHNA 4NQEB 4W4OC 2P46B 4JPKH 3CCHA 1FFRA 1UXSB 2I9TA 5FGSA 3D0VB 3VFWA 5IGXL 3V5DB 4JO2H 1IC4H 1IM9D 2J4WH 4YDKL 4YH6A 2WQ8A 3PGCB 3MZTA 4UT6L 4WHYH 5DVKA 5DJXB 5DJDA 3SOBL 4PUBL 4IDJH 2XWJB 3D25B 4OFDA 4TPRL 2FX8L 4MXVF 1W0VA 4HCRL 4PJBE 1JYNA 1DEDA 1CS6A 1J1XL 2UZIH 1D6VH 4U3XA 5D1QB 4MXQD 3VWKA 3HNSH 2EEAA 3FO0H 1F58L 1IM3A 2DMBA 2FX9L 3OXRB 3J8F7 3RJQB 5J1AB 5HD8D 4LDEB 5D70L 3THMH 5FUZH 1U36A 3E8UH 4PGBB 1NMCB 2E9BA 3WJLC 4D2NA 4YZFE 5DHXB 1JYXA 4HGMA 4PRPD 3U0PA 3U83A 4Y5VC 4ZFFB 2C4FT 4NRZB 4RGMB 4HLZG 5HHXL 2D7OA 2EDJA 3EHBD 4LU5L 4P3DA 4OBRA 4NO2B 3ARBA 1HQ4A 3SKOB 1NCWL 4CU7A 2YPLD 3QI9C 4CW1A 2AJSL 2V2WB 3PIQA 1RJZB 4ELMB 2NZ9D 4DVBA 1IQDB 3FQRB 3LKNB 1WWCA 3KPPB 3TBWB 4ZG1A 2O61B 2VZOA 4JFXA 4P99A 3B83A 3BQUB 3WD5L 2AS5M 2YSSB 4DVRH 3QHFH 3QUML 4L8DB 2Q1EA 5CIPA 3KWWB 3L95A 2FECL 2VLLA 3QFJD 4NO3B 4OF3A 4BZ1H 3U4BL 2KL6A 4XVUD 2H2SD 2FDBP 5HPMA 2RR3A 4KRPC 1A3QA 4KROC 3V4PL 5DJXA 4G9DA 4ZOEA 2MSPA 2XWJA 4EBQL 3U6RA 1NFIA 4BYHA 2ERJB 1TJIH 5IHZB 3BYYA 3RUGB 1F6AB 3EYVA 1OARL 4G8EA 1ZS8A 3QIBA 2ICEB 3QDGE 5J13C 1AJ7H 4J1UA 4YNYB 1TCRA 3OXRA 2CDFB 5DJYB 1RI8A 1JGUH 1NGWB 4K9EH 1WAAE 1VB9A 3ULVH 1JE6A 5J1TC 2R0ZL 4PGBA 3UDWA 3H9SE 4LPVA 1TJHL 5JHDB 4ZFFA 1BQHA 2GK0B 5DUBB 4NRZA 4YHZL 2P24B 2DWDA 4RGOH 5LWYH 3HA0A 4P2OD 3SJVE 3HRPA 2DQIL 3I75B 4CMHC 5HGBB 3LQZB 2CK0L 2A77L 1YYMH 3UTZB 5BRZE 1TQCC 3AUVA 4YGVA 4F7CA 1YC7A 5FGCB 2VDQH 1BQLL 4LLAA 4JO4H 2NMSA 3RNQA 1U6AL 3JV5A 1KCSH 5C7XL 2VXTH 1KN4L 4XVJH 4XP4L 2ZCKH 4M7KL 4Z7VB 4G8GD 1QNZH 1T7ZA 3CDGA 3FQRA 3LKNA 4DUWA 43C9B 2O61A 2CH8A 1BEYL 3BQUA 1V7ML 3NH7L 3KWWA 3OV6A 4OCLC 3FO9A 2WBJB 5IOPB 3O9WD 3FO1B 4QHKI 5F9OL 2MKWA 1AQKL 1GRWA 4NBZB 3T0EC 1Q72L 5ISZB 2P7TB 5ACZA 2ZUYA 2C7UA 2VQ1B 4MXQC 5DDHA 3MJ9A 3ULSA 5HD8C 1IRAY 3EIFA 4HPOL 3UBXB 5IHZA 5E8NA 3P3YA 1KCLA 1RUML 1WZ1H 4WIQA 1F6AA 3ZE1F 2FHBA 3OXSB 4JG0H 3WIFB 2BZDA 4ETQA 2QQNL 3V6FA 2VXSL 2HYMA 3LN9A 5DJYA 4V2CB 3HUJB 1ZE3C 1EUUA 4PRAB 3LQAL 1C08B 3EHBC 3GMNA 5FHBH 2NXZD 5DUBA 4ZDHB 3ZLQC 1R3HB 4PGCB 2P24A 4OT1H 5TDOA 4OZGB 3WFBL 5GGTA 4IDLA 3O2VH 1VGEL 3MLSL 32C2B 3K8KA 4EQ2A 3LQZA 3EYQD 1UEYA 2NZ9C 5DQJB 5LJYH 4FQXB 3QXUA 3HS0B 4K8RH 4MAUH 2BOBA 2EDRA 4X6CE 5D8JL 3FT4A 3LEYL 1QFPA 1GAFL 1QFWH 5DJ0A 4Z7VA 5IJVB 4PRBA 3PL6C 4L8CA 2H2SC 4OCXL 3CGTA 4D0BA 4PLJD 5L88L 2VAAB 4H26A 1EZVY 3D69B 1O7VA 3B9AA 1FNSH 3QULB 4LLQB 2Q7YB 4DQOH 5IOPA 3FO1A 2XTJE 4OKVB 4Y5YA 3ZL4H 3S88H 3LIZL 2ZOKB 2P7TA 5E6YA 1GC1C 2XN9B 4R26L 1FNEA 2DWEB 3PP4L 5IFJA 5AEAA 3NACH 1NJ9A 1ZLVH 1D9KD 3CFCH 1QSFE 3L5HA 3OXSA 3AS1A 2ID5A 2O5YH 4NQEE 3T8XA 1AC6A 5I1EL 5DMIH 1ZANH 5FYJH 1CD0A 3HUJA 1X5JA 4NKDA 4P2OC 1U3ZA 3VJ6B 3SDCB 4L1HA 1C08A 4HIHA 4HS6A 5D72H 1QSEB 4PGEB 4ZDHA 1FZJA 1L0XA 1R3HA