2KBGA

Solution structure of the second fibronectin type-iii module of ncam2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
102
structure length
102
Chain Sequence
REPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neural cell adhesion molecule 2
publication title Solution structure of the second Fibronectin type-III module of NCAM2
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kbgA00
2DMCA 4XP9L 2ICWA 1JGVH 3MCKB 3T0EB 2AP2A 3TA3C 5HVHB 2D0HA 5DK0A 3W0WE 3ARBC 3PP4L 1KV3A 3EDFA 3VXUA 3CMOL 2B8OT 1TPXB 1HEZA 5GS1A 3P11L 1HILA 3DX7A 2JIXA 4UT6H 1UXWB 2YXMA 5FO7B 1K4DA 4X8JB 5J06A 3HC0A 4OBSA 2AEIT 5JXEA 3S6CA 1MY5A 2R2BA 4HK3N 4L3EA 4IBLT 3PHQA 3QXAA 4O02H 3VD7A 4NN7B 2IGFL 3WKNA 3ZKND 4KY1L 4Q9CA 4JM4L 1CK0L 3D25A 3GFUA 2F53E 2F54D 1WZKA 1XIWB 2AXGA 4KHXH 5DGQA 2VDNH 1GYAA 4QHKJ 4HK0A 1WBZA 5F7NC 5F7EH 3CJJA 4F57L 3NH7H 4POUB 2K1MA 3ULVL 1CR9H 3EJZC 5EU6B 4M5YH 1NCDL 5HDQL 4DGVL 3IS0X 5E6IC 1S9XB 3QUZA 3B6SA 4XPHH 4TVPD 1KCVL 5LGHH 3WS3A 4XVUD 4PRDB 1MCPL 4LCCB 2H9GA 4LRNL 1WC7A 1I1FB 2F8VA 1TNMA 3S5LB 3MRHA 1SVZA 1ES0A 3C09C 5JMOC 4NQCB 4P9ML 2ORBH 3HKFA 4OZHF 4O58L 1UJ3B 2CIKA 3LKOA 4BH7B 1TDQA 2CKBB 3MXVH 4MXVE 1ZLUK 2F19L 3UZVB 1H15A 3X3FH 3UTTB 5DEGA 4Z76A 3N85L 5C09E 4KKBC 5GS1C 4GKOA 4NZRH 2DI9A 3OHXB 1AJ7H 2ZCHL 1F3DH 1JNNL 1UYWH 3BP5A 5C09B 3WIIH 2JCCA 4FQCL 3T08A 3HMWH 4I48A 5IMMB 5I0DA 2EXYD 1T1XA 1ND0A 1NLDH 5FYJE 4Y5XA 4PJGE 3NFSH 4HZLA 3TZVB 3VXSB 2VISB 1J0HA 3GJFB 3VI3E 3OQ3B 4U1IA 1RZJL 1B6UA 1K9TA 2IG2H 4LF3B 5D9SA 3E6HA 3WKML 1ORQA 3V6OE 5IV2A 1RJYB 4M7ZC 4MZ3A 2I24N 1F5WA 5D7JD 3QUZC 5FO9A 2VUYA 3ARPA 1D9KB 3HI5H 4Q58C 1L6XA 4OGYL 3RJQB 5I1HH 1RHHB 1NEUA 2PW1B 1IC4L 1T04B 2GJ6B 1BFVL 5IMLA 5D2NE 2DAVA 1T3FA 1IQDB 1CGTA 4BKLB 4I3RL 4DCQA 3MA7A 4O9HH 8CGTA 1RK1A 4M61B 4ISVB 5D1QA 3L7EB 4HQQH 2Z91A 4POYA 2DLGA 2H3NA 1UH2A 5E2UL 4CN6A 1NGYB 3TH3T 2V2XB 4FQHA 5M95B 2VZTA 3H9SA 1CFVH 3S88H 2NXYC 4GRWF 1NDGA 5KSBA 3O2DH 3FN0H 3TJEH 1LP9A 3IJHA 1FNHA 5I75C 3Q3GB 5KTEH 1A6UH 1X5AA 4PV8A 1JWUA 1QSFE 4ORZC 2BERA 4U1GC 1Q9OA 4WU7B 1B0RB 4MZ2A 4KRMB 1P1ZA 2J8UA 4TSAH 3QIWC 4FFVD 3MV7B 3KYKH 4AIXA 1X5LA 4KVNL 1XIWD 4XXCA 4PGDB 1PEZA 5DEZA 2RFXB 4EVNA 4NP4L 5HYSB 4E5XB 2VXSL 5MEOB 3BGMB 4HIXH 4HIEB 1A4JA 2H2PD 1IFHH 1K85A 5BOZG 5E95B 5EU6D 1OGAA 3JWDH 4LHUG 4PJ9C 1RAMA 4HG4J 4S1RH 2R4RH 3O6ML 4GKNA 2R23A 4RDQF 3U0PB 2OM5A 4WY7H 4LCWA 3V7MA 5IVXA 1DBKL 4MHHI 5IW6A 1HXMA 2FJFA 4WJ5B 5C6TH 4M5ZL 5D6CA 3CX5K 4PB9L 4PRPD 5HGHB 4DUXA 1NPUA 1N0LA 3T3PF 4Z7VE 5DQDL 3PGCB 3ECBB 1LO2H 1FCGA 3PP3H 1PFCA 5EG6C 5ISZD 3ULUL 3GJEB 2XWTA 5T5FH 5CCKH 1T7XA 3UTTD 2HKFL 4FXGA 3BRDA 5D1QC 1VKXB 2NY2C 3LS5H 4HIJB 2GSIA 5SWZD 3VFNA 1RUMH 3SQBA 5C0BA 3AC0A 4DGIL 3UTSB 2BC4A 4C56A 5K59E 2PW2B 4J3WA 5KW9H 4HWZB 1JNJA 1KN4H 2J8HA 1GAFL 4MVBC 1OARH 3FZUC 2MWCA 4AEIH 2GT9B 2QHRH 4XX1G 1MCIA 4PLNC 2H8PA 4WNQB 4LCYA 1DFBL 3TYFA 5J9PB 2P7TA 5CSZB 1ZLVH 3TZVD 5J1AB 4I5BA 2NNAB 1DQML 4JR9L 3QHZL 1JPFA 5IF0A 3IGAA 4XXCC 3HC4H 4IDJL 1HXYB 35C8H 5JQ6H 1WGOA 4NZDA 3WXVL 5MEPA 5F9AC 1HZHH 5F9JA 1CD1A 3X13B 1ZHKA 3IYLW 1JGUL 3SGJC 4LP4A 2EO1A 2Q8AH 1OTTD 4HW6A 1FGNL 3EO0B 5C0EB 1OAQH 1D9KD 2GJ6D 3ARFC 1QA9B 3U7WL 4GW5A 4LPYA 4DKEL 1BPVA 4HJJL 4P2OA 1CFNB 3FCTA 3IXTB 4F15C 5EC2B 3OF6A 3SEPA 5I1JL 4XCEB 3WLWC 4KROC 2NR6C 5ESQB 1EEQA 4WHTA 3OKKA 3FO1B 1KB9K 3P9LB 1RV6X 4JJ5A 5HYFA 1XGQB 4ODVH 1RZ8B 2Y1VA 4OLWL 4K71B 1R5WB 4X5XB 2AK1L 3NTCL 2D2OA 3P4MB 1EMTL 2PTTA 3RWCB 2EE6A 4YO0B 4Z8FH 5I1KH 5BZDB 4RFEB 3LMJH 4HLJA 5A16B 3CFKA 1JGLH 1T5XA 4XP5L 1MHCB 3RVVC 1QR4A 4F7CA 4W6XB 3MJ9H 3MV7D 2WV3A 4JFPB 3RDTD 2UUDK 1HKFA 5A2KH 1S7QB 1A4KA 3E6FA 4HXAH 4CNIA 1N4XL 5IFJB 1KIQB 5FAAA 1IQWH 5INCA 1VFBB 2P5WA 4LSSH 5LBSL 4XP1H 4YBQC 4Q97A 1JHKL 2A6JB 2YUWA 3BIKB 3GMPB 5KSUA 3O2WH 4RBPH 3IFPB 2FSEA 4LDLB 5EC1A 3IDMA 4YEEA 4PGBA 4F37F 4LVHC 3I6GB 4WWKB 2ZPKL 2VZUA 1CVSC 4S1DD 1BBJA 1CDJA 4WI5A 4L5FH 3PIQB 4ZO6A 5JA8B 1ZA3B 3SDDA 4MD5A 5E5MB 1S8DA 1WCBA 1GSMA 1SEBA 3ARGD 3A67H 4WW2B 3QDME 2Q3ZA 5IVOA 3P0YL 1FZJA 1E4JA 3HUJF 1CS6A 2EE2A 2C1OB 1HYSC 1U0QA 4HHAA 1FNSL 2IFGA 3HFMH 2OL3L 1JFQL 5FA3B 4QRSA 1YECL 1VERA 3FT3B 2XRAL 4HS6A 4LRIA 3UTSD 2VAJA 1QBML 3RTQD 1NGZA 4J4PD 3V52H 1P6FA 1A1OB 3RI5K 4L9LB 1HHGA 2PR4L 4OF5A 4HKXA 3D85B 1YQ2A 1MVUA 3GBNH 4KUZH 3FQTB 1UC6A 2ZP0T 4JQIH 2GQHA 5JHDA 1C08B 3LH2H 1GGCL 1BECA 4KUCD 4CUCA 5SV4A 4AT6A 4XMLH 1OAKH 2Z92A 2YOCA 3O2DA 3BIAX 3VD5A 4QOKB 1I7TA 2AJSH 4OTXH 1ZHBA 5C0AB 4I3SL 5GZOD 4Z7WA 1X5JA 2BNRA 5CZVL 5JW5A 3IJYB 3KG5A 5L88L 3RWIB 4JKWA 4OFIA 1YPZB 3G04A 4XCYA 1FZKB 2FLBT 3ARDB 1U8JB 1B4RA 5E8PB 3VFSB 1FL5B 4G8EA 3I50H 4NSKA 1G7HB 5EORH 2FECL 4PJHF 5FO8B 4X6CF 1F4WH 3HE6B 4UBDD 4NRXA 4ZFZA 1OSPH 3LKPB 1KB5L 4PREB 4O5LL 5E00A 1KNOA 4F3FA 5B39A 1NBYB 3CUPB 3SJVE 2AI0H 2AGJH 4MB5A 4PJ7B 4UUJB 2W0FB 4IOFC 3CGTA 2RCSL 4UOW0 1EO8H 5D5ME 4GG8B 1W8OA 3BMWA 4X4ZA 1S7UA 1IGCH 1I1CA 2B7DT 1FFPA 4YXKH 1JYNA 5H35A 3KYOA 3TBSB 4JY5L 5DJ0A 4PTUB 5HYJA 2HLFD 4PJDB 4QXUH 4HBCL 3CFJA 3QXVA 5F9WB 1PSKH 4WVRA 4P2QE 1P7QA 4F9LC 2DRUA 3L3KB 2GTZA 5FUOH 4MJIA 5EO9A 3FO0L 1WFOA 1T1YA 2I60H 1OP3K 1HOCB 2AJXL 1G7QB 4K23H 3LRSA 4D9LL 1U58A 1KCRL 5D7SL 5HJ3B 1TZIA 3BQUA 3DVNA 5J1TC 2NW3A 3MNWB 5DD0H 3FO9B 4LLYA 4LARL 5A2IH 5D70H 4K8RD 3E0GA 4FS0A 3C08L 4TUJA 5C0ND 4M62H 1N64H 3I6LE 1TCRA 4WWKD 5JMRA 2GHWB 3QEUB 4MCYA 5J13B 1F4XL 2VMFA 3JV4B 3O4LE 4Z7NF 5CS7A 5DVLA 1WWCA 2Q7YB 1A7NL 3RRQA 5BS0A 3JWDC 1QTYT 2CDGB 4OLZH 4NPYA 4U7SA 2JJSA 5EOTB 1T1WB 3LZFH 1LK2A 1KJ2B 3GMNA 2BY3A 4UQ3A 1NC4B 3BW9A 3S37L 1ZGLB 4L4TA 4YHZL 2BCKA 3WNOA 1BBDL 4L4TE 5MI0B 3D85D 2X70A 1IEBB 3CDCA 43CAA 5IESL 4NFCA 5JNYB 1KT2A 1TJIH 5CWSA 4FQLH 2VB5A 3NBNA 3ZO0A 5DXWA 3OMZA 1D5BA 2ZCLH 3FQNA 2Y6SD 3EFDL 4OCYL 3D0VB 4RMSA 1H3WM 4MA3B 5AUMA 4QOKD 3IFOA 5C0AD 2A6DA 5L8LB 1YEFL 1K5NB 4YH6A 1I8MA 3FN3A 3CDYA 5CP7B 2PXYA 2C3VA 2VXTH 4P5KB 4E41A 3BQUC 2VLKA 4IIQA 1JZ6A 2C4XA 3MJ9A 4WV1B 5BOPA 5GSRB 1FSKC 5CZXD 4HAGA 5GRUL 3ILPA 2VLKE 2VDQL 3I2CL 5IB1B 5I1EL 5H2BA 1P7KA 4NC0B 5ERWB 3N0PB 5IQ9A 1MFDL 4M1CD 1KEGH 4OZHE 5GQBA 1IAII 1KPVB 4R8WL 1VPOH 1I7RB 2VLLB 1D5ZB 4JO1L 1QRNB 3ESVF 3VFPB 1XEDA 1OTUC 3C5JB 5CUSL 3NA4A 3PGDB 3GBML 1HN1A 3MJ8B 4TRPL 1YEKL 2NLJA 4NT6A 4X99B 3EHBD 4ZO8A 1QSEE 4PJBB 3TBVB 1JUFA 3TBYA 4CBPA 1CLOL 3C60C 4R4FL 3SE9L 4JFYB 4JG1H 3MV8B 3MBEC 1V7ML 5FDYA 3OKEA 5KSAB 3MV11 5CP3H 4KKAC 4OGAD 4JM2D 3SKJL 4M1DH 4RFNB 1FFRA 3F8UB 3SDXA 2ICEB 3ULVF 1AE6H 5L7XL 4X6DF 4LSPH 4W68A 1QR1A 1YJDH 1MH5A 3NPSB 1NCWH 2Z31A 5T5NG 1NH6A 3ME0A 1YEIL 2YD8A 1DZBA 3KPNA 2F9BT 1JYWA 32C2B 5ID1A 3P9MB 2PXYC 4XNQB 1A9EB 3E2HB 1AIFB 4DW2H 3IAGC 3BUYB 4IIQC 4F33A 4RISL 5TGBB 5EIQA 2D3VA 4XNXL 2FO4B 5DRZA 3BPCB 2FEDC 3DURA 3GIVB 1FNAA 4KH2A 3VE0A 5ADPL 3AB0C 3B43A 3VFGL 3F62A 3OKMB 4JZNB 4Z0BH 5FCSH 1I8IA 3KDMA 1HE7A 3DXAB 2X4OA 4KJQD 1FYTA 3LIZH 1WJ3A 4XC1H 1FFQA 4OV5A 5AZEH 2X1XR 4PR5A 3RWDB 4KAQH 1RZIA 3T4YA 3NCJH 4UOJA 4ZFGL 2XKNB 3QCUH 4GRWE 3FB8A 3O4OC 3BD4A 2ITCB 4R7NB 4Z7UB 1IAIH 2ZJSL 3G6AB 1F4HA 4OCNC 3ROLB 5C08D 4ONFL 2YN3A 2DLHA 2WWMC 4P59L 4P4RB 4M7LT 3UJJH 1TQBC 3HA0A 3MJ6A 1C8PA 4U1KB 4YHOH 3IDGA 1HSBB 4HSQA 1DANT 4KV5F 4CMMA 3GSWB 3V5KB 3LV3A 3AAZA 2APVA 3M17B 2AV1A 5B3JF 3ZL4L 4N5ED 4MQ7B 1CDUA 1MFCH 3DETC 4XNUH 2C1PA 1WWAX 2NTSP 3KJ4C 1A7RH 4CDGC 3VXTA 1A8JH 1BLNA 5EN2A 3MODH 1ONQA 2AEWA 1FVCB 4BH8B 1KG0B 1NJ9A 2UWEF 1MFAL 1JHLH 1G6RH 2CDFB 3QI9A 4ODSL 5IBLC 1Y0LA 3U6RB 3RNQA 1EO5A 3VGAB 1G9NH 1FZMA 3OGCB 3T3PE 4LLUA 3EOTL 4U6HA 5AD0B 4NQTA 4NWTH 5HHQB 1XR9B 1FE8H 1QRND 2DQFA 5B21A 2APTA 1F3RB 1KIPB 3QG7H 2PYEA 3PWLA 1I9IL 3U4EB 3CSBA 3IFNL 3CDGA 5EBMA 3QQ3B 1X5GA 3I9GL 2RHEA 4X6FB 1YDPB 1IEAB 2HVJA 1JTTA 2PYEE 4M7JH 3TWCH 3RU8H 2E6PA 1YQVL 3LDBB 1FNEA 5EWIH 4LOUD 4Y4KB 3ZTJG 2EDDA 5F1OB 4PRHA 5KSAD 4XC3L 5CJQH 3RIFF 3TNMA 2BX5A 5F6IB 4D9RD 12E8H 1B88A 4NKMA 4ZS6D 3T04D 3GM0A 4M02A 5A2JH 3BN3B 2DQDL 1BQLL 4AIOA 4F7TB 2Z93A 1YN7A 4AENB 4KMLB 3MRKA 3OB8A 1JTOA 3WDIA 3QEHB 1CGVA 4QTHA 1MFEH 2VABB 5JPNB 1CGXA 1HKLH 2KL6A 2P24A 2YPKB 2CLVB 4U1SB 4A6YL 4XCCH 3VWKB 2YPVL 4ZNEA 4RGOH 3STLB 4X7EC 1J86A 4HKJA 4OZFH 2XKSA 3ISWA 1UM6H 4NN5C 3WO4B 3MMEA 4TUKL 3MLRL 3TVMC 4XCFL 3ULUF 1M05B 4D0BB 2G5BA 2P45B 3KPQB 3DXAD 3BGFC 3FB5A 3IXAB 1I1YA 3CDFA 3TT1L 3PGFL 5CSBA 5T1KA 1F58H 4PS4L 3QISA 5ILTL 5FB8B 3WSQH 1IAKA 2CIIB 3H8NA 1MY7A 3VFWB 4AG4L 3ZT7A 3WFBL 1XCTA 4I0PB 5KVEL 1Q38A 2UYLB 4MX7B 1X4YA 4NJ9L 2JTDA 4I9WE 4M00A 3NIGF 5DHVH 3GKWL 4FFYH 5DWUL 1MWAL 3U36A 3KYNB 1TVHB 1Z2KA 1PJ9A 1TVDA 4U1MB 3VRIB 4P99A 5HYIA 1CGSL 3P4NB 4HJ0D 2BRQA 2EKSA 5E7FA 3L3DB 1KLGA 2FR4A 2W0KA 5CP3A 4P9HL 5MENE 4X7FC 4DKDC 1VEMA 3A0OA 2G2RB 3TCXA 2R1YB 5B38A 3ARYA 2GK0B 4N9GB 5DD3L 2KZ1B 9CGTA 4RWYL 3RKDD 4OQTH 3FRUB 4XVSL 3TNNB 3AY4C 5KVFH 1NMCB 2YD9A 3C5SB 4FFWD 3SKMB 3SGKC 3CVHB 4O51B 3WCYA 3NFNA 4Y19D 4IOIA 4JFOA 4CMHB 4M43L 2OTUB 5I8EA 3U7AA 5DJYB 1DBAH 2VZ3A 3EDEA 5MP6H 1IC5L 4HUUA 2HTLD 3CIQA 4JO4L 5EZLA 1GZQB 5JDSA 5KSVB 4OIIL 1WTLA 3HUJE 3VG9B 1AR1D 1FO0A 2E27H 4NJAL 1XT5A 5DVMA 1KCVH 1CT8B 2R4SL 4LRNH 4WFGE 3MRDA 1UACL 1RVFH 1KIRA 3DPBA 1DBJL 4Y4KD 3CSPA 1JV5B 1D6VL 3L5WB 1DDHA 3QT2A 4FQ2H 5DEFA 1U8HB 1RIVL 2I5YH 3OGOE 3HTLX 4GG6A 4DQOH 4OLEA 4ETQA 1C16A 4XTRD 1WAAF 1XGPB 4YDIL 4D0DB 1KCSL 3H9YA 3MACH 2DDQL 1GOFA 2JJUA 5FOBA 2F54A 1YEEH 5F7HA 4AEHH 1B4JH 4NO5B 3ORJA 1GGBL 1TIUA 1I8KB 2XPGA 3N85H 5CEXA 3RP1A 1ZEAL 2Y07L 4LCUA 1MJJB 3I3DA 4JGUA 5D7KE 2ZCHH 4ORGB 3GSXA 5E9DB 3EIFA 4PJHE 5I9QC 2RQ8A 2VXUH 4X6CE 1WIOA 4S1QH 2JF1A 1ZTXH 1YJDC 4ALAL 2EC8A 4NKDB 2KZWA 3OKYA 4OI8A 4OLYH 2GTWA 2NW2A 1B90A 3L1OL 1CVRA 1R5VA 1EDQA 3H42H 3UTQB 1WZLA 2PO6C 5SWSB 5D96C 3LQAH 1G6RA 3MTRA 5GRVK 3QDHA 2J88L 4C58B 2MCPL 1ZS8A 1E0OB 4LU5L 4GLRI 3ARXA 1MQ8A 3P3YA 4MAUH 1WBYB 1UWEH 4HS3A 4OGYH 4KTDH 5JA9A 4WHYH 5IM7A 3DWTA 2F58L 1KC5H 2YD5A 4PP2B 3VJ6B 3ZE0F 3RAJH 3QBTB 5C07B 4ONOA 4V2CB 2P8MB 4R7DB 5HHPB 2X2YA 5TDPB 1QFWI 3ZKNC 4IRJC 2JB5L 4ZFOL 2YKLL 4ZPVA 4LASL 3AREB 5TDOB 1URLA 2FJGB 1P9MA 3HMXA 4JVWA 3TEUA 3FQRA 1MELA 1SM3L 4DKAA 1MRDL 1A2YB 4Y2OA 2DKUA 3O3UN 5TPWL 2M1KA 2I07B 1EO7A 2VUOA 2CLZB 2JB6A 5D7JA 5HHMB 1DP0A 2BOBA 1R3IL 1ADQL 4LPXA 3B9KC 4DEPB 2F8XC 4RMVA 1EXUB 2G9HB 4Z7NE 1Q9LA 4LLAA 2OJZL 4NUJB 4ZS7L 3K8KA 3GSNH 4HCRL 3LD8B 2ENYA 4PIRF 4JANB 3MCKA 3BD5A 4OZFA 3H3PL 3UTPD 5GISH 4ZUTB 1N6QL 2YHGA 4WDIA 3QEGL 4LLMB 5DQJB 5DLML 2V7HB 1G9NC 1WCQA 4RIRB 5A3IC 1UXWA 5FYKL 5FO7A 2BRRL 4M1GL 4XPFH 4PB9H 1OSZB 3HAEB 2EC9U 3LQZB 4AEFA 3GSOB 5DQDH 4X7CC 1MCHA 1IM9B 2EXYC 4LVOC 4X9IA 3ULUH 1NUDA 4U0QB 1NFDB 1XIWA 3MA9L 4ZD3H 3RY6A 3QPQC 1S3KL 1Z5LA 3QYCA 4MHHG 3QWQB 4AH2A 4LVNB 1MAML 5I8OL 5EU6A 1FBIL 4NRYB 5C71A 1P7HL 2A73B 2WWKT 3BN9D 1TZGH 4MNGB 5E9DD 2CUHA 1ZE3C 5EBLB 4PRDA 4LCCA 1QFWH 3SO3C 1I1FA 1L0XA 3S5LA 4IEFB 3MLVL 3QEQB 1MFBH 5D7JC 3GRWH 2VDOH 1FDLH 2V5SA 5A2LH 3BKML 3GUTB 2WINB 4NQVB 1UJ3A 1XR8B 2OR7A 2DQUH 3DO3A 4NGHH 3ZHKA 4BH7A 2CKBA 4PRPE 5SWSD 4UAOB 4MXWL 1E6OL 3BZDA 2DQCL 2OP4L 5FA4B 4XWGL 4F80A 3TIEB 2SEBA 3UTTA 4X4XA 3W5MA 2XQBH 5HVHC 1WBXB 2VL5B 3CVIH 5ISZE 1PX3A 2AJZB 2VLJB 3ALWA 4FQXD 5KOMC 5JIIA 1RUKL 5SWZE 4GXVL 5F93C 3EFFB 5HSFA 3T2PA 1LDPH 5E4IA 4OIAA 2E6JA 2XY2A 4U4BA 3KPMA 1NMAH 7FABH 1HQRB 3HHRB 3DLQR 3F7VB 5IMMA 2WBJB 3ULVE 5C07D 3C6LB 3DX9B 4K8RH 1MCOH 4X6DE 1CL7I 5D1ZB 4Y16B 4POZC 1HHHB 4MSWB 3TZVA 1QFPA 1I9RL 25C8H 4FFVC 3VA2C 5D4QA 2VL4A 3H6JA 3AXLA 5CFHA 3VXSA 4DTGL 2D7TH 2X1OA 3GJFA 2PTUA 4YGVA 1OGTB 4GAGL 1MIEL 5CBAB 5T33L 3NZHH 1NGXB 4OLWH 1RULH 4KJYB 4LF3A 5C6PB 1OVZA 2H2PC 3GIZL 1UM4L 3B5TA 1RJYA 2BSTA 1FH5L 1X5XA 4MJ6B 5HHMD 3DSFL 3O6KL 5IW1B 1D9KA 4Q9RH 2XICA 1MI5E 1GOGA 1KCKA 1RHHA 2J5LC 2PW1A 4LCCC 1T04A 2GJ6A 4N8CL 1BAFH 3LHPH 1IQDA 4BKLA 3SY0B 4M61A 3NA9L 5GRJH 4PJIB 1UJ3C 3L7EA 1INDH 4F58H 1RY7B 4RZCB 5EUOB 3QHTC 2R69L 1NGYA 4WI2A 1CDIA 1CICB 1PD6A 4U0RC 5DMIL 5F9OH 1KB9J 3HRZA 3INUL 1UWGL 5I1GL 1FLTX 3K2UL 1GOHA 2AXFA 2DQGL 4IS6A 3OZ9L 5DC9B 3WUZA 5ITBL 3HR5A 4QHNA 3DVIA 5ALBH 4WU7A 1B0RA 3PWVB 4FTVD 2C3XA 1EEYB 3MV7A 4ZUUB 1PAMA 4G5ZL 3RDTA 5B3JE 1CQKA 3BFOA 1U3ZA 3UDWC 2CLRB 4PGDA 3K74B 2RFXA 1YECH 2IFFL 1J0IA 4OM0H 3TZVC 4E5XA 3FO2B 5MEOA 3BGMA 2BXYA 5E8NA 3BYTA 2YN5A 3QJFB 2ZUWA 2FX7L 1CD0A 1ZOXA 3EAKA 4NO3B 4QKXB 4NM4H 3QNYB 3VXOB 4Q6IC 1QVOB 4LLVB 3W39B 1CL7H 3GSQA 3L3HA 4FXLA 3WL9B 3U0PA 3G6DH 2BSED 4QXTB 4RDQG 5IWLC 3MGAA 1OTTC 3QEQD 2UWEB 4WJ5A 3EJJX 5L0QB 1FRGL 1GGCH 2YZ8A 3QRGH 1JWSB 1JI1A 1OT1A 2J4WH 5KANG 2V17H 2OR8A 5GS3A 1AHWC 4F2MA 2M8XA 3ARGA 4I3SH 3PGCA 4LKXB 2AEQH 4FQJL 2FBOJ 1ZLUH 2AJVL 1MUJB 3GI9L 2DM3A 3HS0B 1VKXA 4HIJA 4GQ9L 1WWWX 2HN7B 3BO8B 3GSUB 1Y6KR 5LWYH 3T0WA 3FFCE 1FAIH 1CN4A 3UTSA 3GSNA 1WT5A 3D6GA 4J4PA 3RTQA 5HI5D 4RGMB 1L6ZA 3MOBH 4HWZA 4JFED 3MRJA 4JFQB 5BV7B 1NMBH 2GT9A 1QPXA 2EXWC 3F5WB 3U7YH 3J8F7 4WNQA 4JQVC 4JFDB 1N0XL 1DQDL 4Y16D 1FC1A 1K4CB 2EIDA 4JCMA 5J1AA 4K94L 2NNAA 3RDTC 3PQYE 3RY5A 3OSKA 4P46D 5FYKU 3D18B 2DLFH 4M6OL 1HXYA 5GGTH 3RI5F 1MOEA 3WBDA 3X13A 4UDTB 3ZLQC 2LU7A 4HBCH 1JZ4A 1CGWA 1CU4L 4P3CH 2E9BA 4FMFA 3QHFL 3EO0A 1RK0B 5C0EA 5F88B 5KAQF 4C57C 3MOAH 3ULUE 1FFOB 1QA9A 5EU7E 4WO4C 5IFAL 1T21B 1U8QB 2AJXH 1A6ZB 1UVQB 4K3DL 1IGIH 3IXTA 4PP1D 4KPHH 2H1PL 4URTB 4PRIB 3ARGC 4XNZC 4QRQB 2EDLA 3QZWB 5FDWB 4XCEA 2Y5EA 2CPCA 1A7OL 5ESQA 3GRWA 1OLZA 4M6NL 3FO1A 1TNNA 3C08H 3OL2A 2B5IB 1CICD 3P9LA 4L4VB 1XGQA 4X5XA 1GPOL 5E1AB 5GGRB 5IJKA 3CZFB 3NIGE 3P4MA 3RTQC 4J4PC 3RWCA 3UPAA 4YO0A 3KPSB 3QULB 5K9JL 2E9IA 2FH8A 2X4NB 3R0MA 1GL4B 1LO0L 4RFEA 5BZDA 4G7YL 2ZUSA 3RWJB 5A16A 5KVDH 2VITB 1A7NH 1MHCA 1I7ZB 4JDTL 4JFPA 2L7UA 2JJVA 3ZZ1A 3PWUB 3EO1B 2CDEB 1S7QA 4IM8A 4OCWH 3RPKA 3KR3L 1ERNA 2P47B 3S37H 4G6FB 4D9QD 1AQDB 5GZOC 1FVEA 4G6MH 1AI1H 1VFBA 4A2MA 4NQSB 2X9XA 5I1DB 3BIKA 3GMPA 1MF2L 5FHBH 1JTPA 4RX4D 5AG9A 3IFPA 5DJ8B 2N1KA 3ULUC 3FQUB 4P2YA 5EU7C 1P6AB 3I6GA 3K81A 1LD9B 5B38G 4WWKA 2OBGA 2R8SL 4P2RB 4UBDC 4OCYH 3PIQA 4HWBH 3QSKB 2YC1B 1HHKB 1IT9H 4J8RB 2YPLB 5KVGL 2FGWH 5ADOH 2CK2A 3T1FA 2F15A 5AYUL 2C1OA 4M48L 3EYOA 4LAJH 1HDMA 5FA3A 1FYHB 2A9MH 4H0HB 2DQTH 3FT3A 1ED3B 2EDHA 2A77H 4WU5B 5GRUH 4MNQB 1TETH 3K1KC 5J1SC 1A1OA 4H8WL 4L9LA 2E7MA 1MCNA 4QF1A 1YMMB 2APXA 3D85A 4K71C 3WLBA 4RGNB 3BHBB 3FQTA 2MPAL 2HLFC 1C08A 3KGRA 5T3XD 4JFDD 2VDMH 2QADB 4NQEE 1IBGL 1CDCA 2XI9A 6FABL 4QOKA 3QCTH 4YUEL 1DEDA 1U93B 5CGYD 5C0AA 4HC1L 5EU5B 3IJYA 3AMKA 3RWIA 5GHWH 1YPZA 4ELMF 4HS8L 2Z8WC 1FZKA 4UDUB 1Q0XH 4EN3D 4HULB 4GRLB 3ARDA 1U8JA 4G42B 3VFSA 1FL5A 3K8LA 3EYUH 1FPTL 1UWXK 4JFZL 4KK8C 4K8RC 4LLWB 3EKCA 3WEXB 1G7HA 3VI4E 4NDMB 3GO1H 3HE6A 3BDXA 3MFGB 4WFFD 4Z7QF 4RMUA 5MEQB 1MAKA 3LKPA 2W9EL 1P4IH 2VDPL 4JO2H 4WWKC 2CK0L 5DJAB 3UAJC 1Z3GL 4J12A 1OAXH 5DFTA 2OL3B 3CUPA 2C7UA 2W60B 1YEIH 2YWYA 3BP7B 5FGCE 1I3GH 2N4IA 4PJ7A 4UUJA 2W0FA 2ARWA 3CPLA 2XTJD 3Q6GL 2WQ8A 4L4VD 5FGCB 4GG8A 1KCUH 4FNLH 1VFAB 4RISH 4AY0A 3DRQB 2VSDA 1Q72L 1H8OA 5F9DC 2B0SL 4PJDA 5CD3B 2DM2A 3ZE0E 3KPSD 4LKCB 2HT4C 4OCXH 4UV7L 4LAQL 4JM2A 1QFUH 3X11B 4PJFF 1R24B 1PZ5B 3L3KA 1LK3L 2UUDH 5C0CB 1RIHH 1ZSDB 1HOCA 1G7QA 4R4NC 2Y6SC 5C0IB 1QSZA 5HJ3A 5C0GB 1SJHB 4G6FD 1TVBB 3LKSA 3DYMA 5CBEB 4YZFF 5F7UA 4L8CB 4FZ8L 2ZJSH 3FO9A 1M7XA 1KFAL 3WFDL 4JPVH 3MLTB 1FFNB 3IT8D 4HEME 4OF7A 1YEHL 3LRGA 2EECA 1I1RA 3F7YB 4TUOB 4KJWC 3MV9B 1KJVB 1NC2B 3CU7A 4MB3A 5CZXC 4R96A 3UBXB 1KB5B 1LVEA 1MCFA 1A7PL 3SE8H 5E08H 2NY7H 2EYTB 3ILQD 3QEUA 5GGTA 5EBGA 4M1CC 5DUBB 2Q7YA 1BQHB 2YPLD 2X4TB 4YHYB 2DLIA 2CDGA 5D2LF 3QUXB 4QRPE 5EOTA 1T1WA 5HI3D 2O5ZH 1KJ2A 3UZQA 5JXAL 1DBML 1R6VA 4JRYD 3ZE1F 3EHBC 4MNQD 5K9OB 4OZFG 5C08A 3RGVB 3QXWA 4LSQH 2EDYA 4Z18A 5LXGL 3PABB 1IEBA 2IANE 4M7LH 3MSPA 4RGND 5BVPH 5JNYA 1A14L 1WISA 3UJIH 4N8VG 3VFTB 4OGAC 4JM2C 2QADD 4MA3A 3GGWA 3ZDYF 1JMZA 4R26H 3VXPB 5TDNB 2LABA 5TE6L 3IDXH 1NAKL 2BNUA 4K7PX 3HNSH 5CP7A 4P5KA 4TN9A 4X6BB 3HI6H 4GRLD 2XN9B 1KTLA 4WV1A 4Z9KB 1ZXQA 2AEPH 5ACZB 4M6ML 5GSRA 5DTFB 1WLHA 3DUUB 3MCLL 3HG1E 1CE1H 2HRLA 5IB1A 2MMXA 2W92A 5JPMA 1X5YA 1JNLL 5ERWA 3KPPA 1I7RA 2VLLA 3OJ2C 1D5ZA 2BVYA 1QRNA 1LO3L 1EBPA 3L3IB 4MA8L 3VFPA 1BF2A 3C5JA 5DVOA 3PGDA 4AM0B 3MJ8A 2BMKB 4X99A 2EDBA 4A6YH 1RUAL 4Z7OE 3MLPA 3ZMRA 1A0QH 1EEZA 1CLCA 3DVGB 4BFIB 4PJBA 3BZEB 3TBVA 1BEYL 4YHMH 3HPLA 3MXWL 2X42A 3NN8A 5KSAA 4XHJD 1EJOL 4OAWB 2OSLB 2PCPA 5C0FB 4O4YL 4NN6B 3BYYA 5DT1H 4KQ3L 1ZLSH 2APFA 5GJTL 1EJ6A 2ICEA 4I18B 3RWHB 1IARB 5C0CD 4D9RE 3AM8A 2HLAB 3PGFH 1OP3H 4PS4H 4P4KB 2DLEA 1C5CL 2V5MA 4Y2DD 4N0UE 5L2KB 3NCCB 3MX0A 5CMAB 1F4AA 2OR9H 5D71L 3P9MA 1T2XA 4XNQA 1A9EA 2DBJA 4HDIB 1NBZA 5FYJL 4HPOL 3TM6A 3RVXC 4ZYKB 1CD9B 3BUYA 2DKSA 4J1UB 5AYQA 1S78D 4WGWB 1TQCB 5DUPH 1NC2D 1MWAH 4PJXF 3CK0H 5TGBA 2FO4A 1IKFH 3BKJH 3BPCA 3GIVA 1R0AL 3GB7A 4K2UL 3OKMA 4XMKH 2BVTA 2EYSB 3DXAA 5E2TL 4JDZB 4PUBH 1IILE 1JPGB 3D69B 1G9ML 3G5VB 4G6JL 5DD3H 2EH8L 4JHBA 4S11A 3WXWH 5FUZL 3P73B 4XH2B 2ITCA 4R7NA 4Z7UA 4EUPB 1H3GA 5D1XB 3IU4H 3WS6A 5EO0B 2WUCH 3BRGC 4P4RA 3VGHA 1EVTC 2IQ9L 1T7WA 1UH4A 3ZKMD 3D2UD 4U1KA 1HSBA 1U8PB 1IGMH 3BEWA 5CEYB 3UYOD 4ZS6C 3V5KA 4YK4C 1I9EA 2XZAL 2I25N 4LCIL 1J8HB 4GW4A 3NPSC 1J1PH 1JYVA 5SX4I 4KI5D 4YBLC 1IM3B 4BQ6A 2NY6C 2XN9D 4E42B 1CE6A 4K7FB 3E2HC 1FVCA 2I26N 3S97C 1KG0A 5F1IA 5ID0B 1CLYH 3U6RA 1P4BL 3VXRE 5I76B 1U8LB 3CMGA 3BJ91 1G7IB 1DQLH 5AD0A 1ETZA 4Y19E 1XR9A 1QEWB 4JVUA 4J23A 4HXBH 1NDMB 4NIKB 3BDYL 2QQKH 1NEZB 4JO3L 2Y07H 3LEXA 1E4XL 2IADB 3PL6C 2X6MA 5E99H 3CCHA 1KELL 4NFDA 2FH6A 4Z78B 4U31A 3DROB 1N6VA 1IEAA 2IBZY 4QYOB 2VO5A 1MIML 5D7LE 4H26B 4BQBA 3ULSB 4Y4KA 2IBGA 2Y23A 2VLRE 1KEMH 4QRTA 3SPVA 3O9WB 3KS0H 4G9FB 3WS6C 1A3RL 2FX9H 1JF5A 3QIBB 5DJXA 5CD5D 2QL1A 2WP3O 5C0DB 4Z77A 2Y06H 1U95B 4L3ED 3SDAD 1UJTA 1QLRB 1F90H 1C5DB 5DA4A 4W4NA 4F7TA 4ZAKB 4P4KD 4AENA 1A5FL 2AERT 2D4FA 2QKIB 5L2KD 1MRCL 43C9B 5I15L 1TJGL 2H41A 1MCRA 3W5NA 1RZGB 5JPNA 4ODBD 2YPKA 1JGVL 4AEEA 2LAGB 5EPMB 3TYGH 3G9AB 3VWKA 2PF6A 2XYCA 3PWPB 1OP5K 3BISA 1FIGH 4M6AA 1HH9B 1FVDB 4I0CC 3IB4A 5HGDB 5GZND 3EDDA 2H2SD 2BNQE 1X5ZA 2FIKB 3C2AH 4U3HA 2FJHB 4FFWC 4ZTPH 4UT6L 5IK3B 1M05A 1JZ8A 5SX4H 1QACA 2BNQB 2YKLH 2HG5B 3KPQA 4L8DA 4N1HB 1L7TH 4UB0H 2HTLC 5E24E 4O02L 1AR1C 3HAEH 1KXVC 2E7HA 3QDGB 5F7MC 3HPJB 1QP1A 5FB8A 5TPWH 1UEMA 4KHXL 4OFYD 1JE6A 3BI9X 5F7EL 3VFWA 3NH7L 2XZQH 5D1XD 4P5TC 4I0PA 5K9KB 1CR9L 2R0KL 2UYLA 4MX7A 3O41B 3LDBC 1T80A 3AROA 4M5YL 3S3JA 4ZS7H 1DUZB 4XPHL 3KYNA 1TVHA 5B8CB 5JR1H 5LGHL 1OAZH 4XTRC 3VRIA 2HKHL 1NUNB 1RUQH 3P4NA 1T5WB 5HVFB 3L3DA 4ZQKA 1N6QH 4JPKH 3V5HB 2DQEH 4P48A 1J8HD 5FM4A 2ORBL 4LPWA 4CVUA 3BUTA 4JY4B 5IBUB 2G2RA 4G9DA 4YIQB 3MXVL 5F1KC 2R1YA 3F58H 3BRFA 2NY5H 2GK0A 4N9GA 4ZOAA 4M1GH 4WI8A 3X3FL 3VFMB 5JLZB 2DYPD 3FRUA 3CNKA 3TNNA 2J6EA 1PKQB 3C5SA 1BD2E 3SKMA 5HTSA 3MLUH 1H3PH 3QJHB 4YXHH 4LVEA 4IDLA 1BD2B 3PDOB 3QUYC 1N3NB 4NZRL 1FNLA 4G8GB 5DJYA 1AJ7L 4WUUB 3OKOB 5DUMH 1UYWL 3I6KB 3WIIL 5KSVA 1AO7D 3HMWL 3FOLB 4Y88A 2I9TA 1E4WL 4NUGH 2IMMA 3DIFB 5FYJU 1OHQA 3O45A 3X14B 2EZ0D 1NLDL 2L7JA 3LEYH 3NFSL 4KKLD 1GC1H 3P77B 1CYGA 1QKZH 2NXZB 1CT8A 3DTXB 5JOPD 2HFGH 3V4UH 3NIDF 3H9SD 2MKWA 2IAMB 3KPTA 1G7MA 3F65A 3O9WD 4G9FD 3UTZB 5DI8B 3W9EB 3VGEA 1F8TH 1Y6NR 5I8KH 5GGVY 1XGPA 4JRXB 3HI5L 4FMKA 4MXWH 1BHGA 2W59A 5I1HL 2GEEA 1T6WA 2BSRB 4ZAKD 3IKCB 2GY5A 3S96B 2NY4B 4DWHA 2XKUA 4HK3J 4ELME 4L29B 4XB8A 1RUKH 4O9HL 4ZUSB 4CJ1A 1MJJA 4PJEF 4ORGA 1TMCB 1W0VA 4HQQL 5E9DA 4HGWB 4Q2ZB 4XBGA 1T03H 3PWPD 1OGAD 4LQ1A 3IFLL 3A6CH 1OM3H 4QRRB 4X9HA 5J12C 4C55A 2R9HD 3O2DL 3FN0L 4G7VH 2VZVA 3TJEL 3QNZB 3F12B 1I7UA 3UTQA 5KTEL 1A6UL 3NACH 5TFSH 3K4AA 1AXIB 1FN4B 4RAUA 5SWSA 1BZ9B 4KXZI 1CZ8H 3D39B 4P0DA 3B2VH 4TSAL 3VG9C 3F7QA 4OLUL 3VRLF 3KYKL 4S0SD 3NABH 3FQXB 3CAFA 1FH5H 5H94B 3JUYA 3RWEA 4NOBA 5I73B 1TCMA 1WBYA 4KRPD 1BP3B 1IFHL 4KZEH 4WTWA 3JWDL 1TJHH 4RRPG 4PJFE 4PP2A 3LS4H 4S1RL 3VJ6A 2R4RL 2XV6B 1E4KA 1J8KA 2OJEB 5C07A 4WY7L 4TVSa 2P8MA 3QXDB 5HHPA 4LHQB 4EJ1C 1W0WB 1QLEH 4U3XA 3MZTA 5C6TL 4YFLI 1RUPH 2G75A 4AQ1B 1KULA 5TDOA 4YZFE 2R69H 2DTSA 4MQSB 3QAZC 2FJGA 1HNFA 1KENL 4N1EA 1LO2L 4OZIF 5I1GH 1GIGH 4S10A 4ENED 4F9PC 3PUCA 5CCKL 2I07A 2CLZA 3BN9C 2EO9A 3LS5L 2EE3A 3Q1SL 1RUML 3T2OA 3TJHD 5DDHB 2P8PA 2G9HA 3E8UL 4HZAA 1EZVY 1KN4L 1OARL 4AEIL 2VDKH 4JANA 2QHRL 2XACC 4NQDE 2FEEI 4DK6A 5BV7H 1ZHNB 1A6VH 5D2LB 4ZUTA 1G1YA 1WFNA 3ZE1E 1RIUH 3BH8B 3O6FC 4OCRL 4LLMA 5DQJA 5T3XH 2HRPH 4PRNB 4BUGA 1SBSH 2V7HA 4RIRA 3HC4L 2EIZB 4FQXC 2IAMD 35C8L 1YZZA 4MQTB 5DRNA 5CEZL 2L4OA 5JQ6L 3O2VL 3HAEA 4KXZH 3M8OH 4X4MA 4JFXB 3LQZA 3GSOA 4U1LB 5LVEA 2Q8AL 2X4PB 4FTVA 3SCMC 2XXMB 1RJZB 1NFDA 3ZDYE 3SGEH 3MPCA 1FZOB 4FTVE 4HAFA 4CW1A 1G9EA 4U1JB 2NY4D 5EOQH 4BYHA 3MYJB 1FL6B 5HY9B 3JZ7A 3MJ7B 4Q9QH 5ICZB 4HUXB 4HFUH 4NRYA 1MEXH 2A73A 2HFTA 2NZ9C 4UT9H 1DSFH 3I02B 4CU8A 3FKUS 5ESVB 5EBLA 5MHSE 3MRIB 4QRRD 3QEQA 3MRLB 2VZSA 1HSAB 2Q20A 4ODVL 3B3IB 1CCZA 2ICWJ 4M93B 4I4WB 3GUTA 4RNRA 3BE1H 2DI7A 5IB5B 4X80L 4QHLB 4NQVA 3TV3H 2QQNH 1XR8A 3QFDB 1ITCA 4Z8FL 4KQ4L 3SDDD 3WUWA 3SQOH 2FZ3A 2H26B 1JGLL 1X3DA 5FA4A 4BFBD 3TIEA 3MJ9L 4UV4H 2VL5A 2E7LA 2AJZA 1N8ZA 3OXSB 4HXAL 4NNXA 5HPOA 3EFFA 2R2EB 3ARWA 3ZTNH 3VH8G 3CXHK 1IQWL 4LSSL 4XP1L 3F7VA 3PXHA 4P3DB 3O2WL 4JFEE 1WTGT 1U8IA 4JEGB 3RX5A 5E8EB 4Y16A 1ZT7B 4D8PB 3SKNB 2F74B 1C7TA 4L5FL 4M6NH 4P46A 1OGTA 4HWEH 4S2SB 4JHWL 1ACYH 3A67L 1NGXA 3WN5A 4KJYA 2BNRD 4LVNC 4PY8J 5EULV 1K2DA 1T1ZB 2ESVB 3KLHD 3UCRA 4F8TA 3GNMH 2VWEE 4PJXE 4JAMB 4MJ6A 2MCG1 5IW1A 5EO1B 2IQAB 5DZNA 1FG2B 1XGYH 3T2NH 1F2XK 4U2ZA 5DHYB 2VSCA 1SJEB 1EV2E 3I85A 1UGNA 4CDHA 5F7DB 4OCMC 3V52L 1P69B 3B9EA 4Z0XB 4JKMA 2X7LB 2Z35B 4EXKA 4HIIB 1AKJB 3GBNL 4KUZL 2NY5C 1J05B 4PJIA 3RIAK 4HT1H 3EDJA 4JQIL 4QHUB 2P5EB 2FIRT 4LPCA 3LH2L 3SDCD 4XVTL 3NCMA 2HAZA 5EUOA 4RZCA 2X1PA 4XMLL 1JYXA 1OAKL 1AD9B 1NBVH 3RUGA 1CICA 2AJSL 2R1WB 4OTXL 5C2BH 4YX2H 3MCG1 3OJVC 4FQQB 5GGQL 5KVMC 2R0WH 1VENA 5A1AA 5JIKA 5IW3A 2ZOLB 3ARTA 5IJVB 3CFCH 3IJSB 1R3HB 2ZZUT 3I50L 5KVGH 2C4FU 1EEYA 4YDJB 3RWGB 4L3AA 1F4WL 1GC1C 2CRMA 1VSCA 3OXRA 3MGTB 5DD1H 4MJID 4OIBA 2CRIA 3EW3B 3KPOB 2QBWA 2JCCF 5IIEB 1IC7H 3MLSH 1OSPL 2Q3AA 3FO2A 4QEGA 4MJ5B 1MLCA 3QJFA 4P46C 2ADJB 2J1KA 5AWNH 4NO3A 1QRKA 3QNYA 2VYRE 2W9DH 3VXOA 2VWEC 2AI0L 1UM5H 3WN5C 4D9QE 2AGJL 2QEJA 1QVOA 3L6FB 4LLVA 3W39A 4RX4A 3WL9A 4QXTA 4N90E 2MPAH 4K3GA 1EO8L 1BFOB 4RMWA 3FTGB 1IJ9A 4Y5VB 5IBTH 1JWSA 4YXKL 4MCZB 4QXUL 5FXCH 4LKXA 4YHPB 1IGFH 2WQRA 1PSKL 5E6ZA 3IVKB 1H5BB 1MUJA 4PP1C 5BS0D 1F6LL 1WQVT 3IDNB 4DN4L 5FUOL 4OF3A 2HN7A 2KPNA 2I60L 3GSUA 1D5XB 2BSSB 5E03A 4K23L 4QY8B 1ZVYA 5FK9B 3OAYK 1H0DA 5DD0L 3BPNB 3GMLB 1BWWA 4JFQA 5D70L 3RWFB 1INEL 1PX4A 3BSZH 3F5WA 2CK0H 4L4JA 3EYQD 5J4MA 3BIBX 1B2WH 4JFDA 3EO9L 5CJ8A 2HH0H 5ECJE 4M62L 5ANMA 5KSBF 4WENB 1EH9A 1K4CA 3WNMA 3KPRB 1LP9F 1MHPH 2DLTA 3HZKA 1EHLL 2OMNA 2OK0H 3D18A 5ANME 4NRZB 3LKQB 5ESAA 2MHAB 4MD0B 1F97A 4QXGH 3QO0B 5GGVH 2J8UF 4XPBH 4LBEB 4OLZL 4V1DE 2A83A 2EDNA 2V5RA 4UDTA 4OUUB 4E41D 3LZFL 3T77B 1PY9A 4LHUB 2OQJB 2AXHA 4JDVA 5F88A 4V1DB 5KAQG 1AY1H 3UTOA 1AH1A 1LK3H 4M9OA 1S5IH 1K8IB 1T21A 1U8QA 1A6ZA 1UVQA 1A6TB 1P84K 1CFQB 4XAKE 4MA1C 1IRAY 1TJIL 2ERJB 4Y1AB 5IVXF 4PRIA 1IVLA 4FQLL 2P5ED 1QYGH 5FDWA 3QZWA 1UADC 3WFDH 2ZCLL 2R2HB 5BRZE 5ABDE 4JFFD 5M7QA 4L4VA 2IALA 2HWZL 2EEAA 3HR6A 2XG4A 5E1AA 3G6JB 5GGRA 3CZFA 3QH3B 5IP4A 2XTJE 3SKOB 1I1AB 2VXTL 1WUNT 3KPSA 3QULA 1CLZH 2X4NA 1SYVB 4BZ2H 5K59F 3GJFK 5F7LB 3RWJA 4O2CA 1DLFH 4BSVB 3SO5A 5E2WH 5HD8D 3PWUA 1GH7A 2CDEA 4ZFFB 3WE6B 2B1AH 5HGAA 1KEGL 4JKKA 2RGSA 1VPOL 1AQDA 3DBXB 1PKOA 4ZXBB 3LKNB 4JY6B 4I8DA 2G60H 4OBRA 5BVJB 4EN3C 4XWOC 4IJ3B 1S7WB 2AK4E 5DJ8A 3CFBA 4Z95H 3NCYS 2JELH 4NCC2 3FQUA 3DMMB 4EDWH 4LMQE 4O2FB 1LD9A 1MRFH 1E28B 3GKZA 1NCUA 5KS9B 4P2RA 3U9PL 1DTUA 4JG1L 1F6AB 2YC1A 3OR6B 4Y4HC 3N9GH 3QWRD 1JRHI 4J8RA 2YPLA 3C6SB 4NBXB 3RNKB 2A6IB 5I74C 4M1DL 3RHWF 1OQOA 2LU3A 1AE6L 4ZDHB 1Z9SA 3DVFA 4LSPL 4JRYA 2HMID 1YJDL 3NIDE 2Q8BH 3O8XB 4WU5A 3SBWA 1NCWL 2XTJC 4MNQA 3VXMB 4E0RB 4PG9B 4QGTA 3BPOB 2B5IC 4F7MB 2FATH 4JRYE 4NNPH 4PGCB 2X89D 2OTWB 2IPTH 2AJUH 4DW2L 3OAUH 4HJGA 1F3DJ 2HFEB 5JTWA 1X5KA 4PLJC 1FJ1B 1UEYA 1J10A 1U93A 4NBYB 1KJMB 3MYZA 4H20H 4TULH 4WGVB 3WDJA 3LIZL 4XC1L 1BGXH 4GRLA 4HUWA 4PJEB 5DJ6B 4KAQL 4LLWA 5CIPB 3WEXA 1BM3H 3NCJL 4LHUD 3C9NB 4LNRB 4L8SC 1IAMA 3KXFD 3QCUL 4NDMA 5IQ7H 5C9KA 4YHKL 1N59A 3O0RL 1IAIL 5MEQA 1A47A 3UPRB 2V9RA 4Z5RB 3QI9D 5DO2D 5CJXC 5DJAA 5DQ9B 1XCQB 3UJJL 2OL3A 3BPLC 2W60A 3S36H 4YHOL 3VRLE 4YDVB 5GGSB 3HCVB 4D0CA 3BP7A 3DOSA 4TVPL 2HTKC 3T8XB 2D7QA 2JLLA 4UIKH 1SHMA 5DJDB 5HI3C 3QFJE 1WZMA 1VFAA 1MCJA 1VEOA 4HUVB 4XNUL 3DRQA 1ZMYA 3TO4B 1I1AD 1JRHH 1PGRB 4CVZB 1A7RL 1RZFH 5CD3A 3DI2B 1GGUA 2UZYB 3MODL 3OG6B 4RGNC 1R24A 1PZ5A 1G6RL 1NGWB 5C0CA 1ZSDA 1G9MH 1OTSD 2QADC 5IOPB 3CD4A 1G9NL 1NCAL 2ZOKB 5C0IA 2Y5TB 1R3KB 1HINH 3K4ZA 1TVBA 4NWTL 4OZIE 1H9VA 1FE8L 5CBEA 4U1NB 4ZXBD 1QFWM 4XI5D 4DGYL 3C5ZC 2FLRT 3RVUD 4YPJA 1AGDB 3QG7L 3F7YA 5HHOB 1RZ7H 4GRLC 3VGDA 3L5XH 1F00I 1ZWIB 3ZSTA 1KJVA 1NC2A 3V95A 4Z7WF 2XQYG 4UNVA 1U8OB 3DMMD 4H1LH 1KB5A 3TWCL 4M7JL 1G7JB 4NO0D 3RU8L 4H0GA 5EZJB 5EWIL 5D7IB 4ZOBA 5DUBA 4PJCB 5CJQL 3LB6D 1I75A 4H8WC 2X4TA 3NAAH 2O5YH 12E8L 4EBQH 1U36A 3ROOB 2O26U 4HUNB 5T3ZD 1NBQA 5HBBA 3FRPA 2FX8L 2XTLA 4N0FB 4PJ5E 3H7BB 3VXMD 3AS2A 5K9OA 2FD6L 3TA3B 4Y4FC 3ARBB 1P4BH 3PABA 1MFEL 4ZUWB 1HKLL 2GFBA 5C1MB 2MQCA 2LQRA 4NO2B 4XCCL 3D2UA 3U1SL 2VLMD 3BP4A 4RGOL 4UTBL 3VFTA 4G3YH 3QUKB 4RQQA 3OWEA 1UM6L 2V2TB 5FM8A 3NMEA 5A43C 3VXPA 1KELH 2P8LB 4PGZA 1H3VA 4X7DC 3D3VB 4Y2DC 3RPIB 1VACB 2WM0A 3QDJB 3DV6B 4X6BA 4YHNA 1FAKT 5E56A 5FM5O 1BIIB 2XN9A 2ZSWB 5C70A 2M2DA 1MCBA 2VE6A 1F58L 1UENA 1UWXH 2YRPA 2Z9TA 1YC8A 5FGSA 3JBG7 5DTFA 2LU4A 2ED9A 4PLKD 2NX5B 3WSQL 1D6EB 4ZOEA 4JG0H 3IDJB 5E6IB 1AD0B 5CKGA 1F4YH 1T89C 1J7VR 1M7IB 1ZHLB 3N06B 5DZOA 1E27B 4FFYL 1MRCH 2J2ZA 4X5LA 5FUCC 1TJGH 2EDEA 4TNVK 4LHJB 2BMKA 3P30H 3C09B 1HI6B 3MUZ1 3OB0K 3DVGA 4JPWH 1TENA 1QSVA 4BFIA 3BZEA 3WUWG 2AVGA 3W0WB 5DA0B 5AG8A 4RMTA 2C3GA 3VXUE 1AGFA 3MUGB 5HVGB 2VAAB 4OAWA 4BELD 2OSLA 3B5GA 5C0FA 4OQTL 3DGCR 3SDAA 1HEZB 5KVFL 1UB5B 2QR0B 1HILB 2HLAA 4FABL 3VGFA 4P4KA 4L3EE 3QIUD 3HC0B 2HJKB 1DBAL 2GJJA 1XF1A 3JTTA 5MP6L 5L2KA 5CMAA 2DMKA 3JV6B 2F53B 3M1BA 4PGEA 5GS0D 1PBYA 2R0KH 4KI5C 4HDIA 2E27L 3KYMB 1CGYA 4ZYKA 4CADB 4J1UA 3BDBA 3ZYJA 1BZQK 4R2GC 4TSBL 3H9HB 3HRPA 4P23B 3MRBA 2K7PA 5D72H 1RVFL 2HKHH 4FQ2L 2CD0A 4M7ZB 1K6QH 3STZB 2I5YL 1TXKA 4DQOL 4DJMA 1JPGA 3D69A 4IRSB 1WC7B 1HHJB 3CLFH 3G5VA 4ZOCA 3MACL 2AKRB 4RCAA 4X98B 1YEEL 4OFYA 4L8BA 4AEHL 1B4JL 2DQIL 4XH2A 4LIQL 5D1XA 3LCYA 5K9QI 3TA3D 4JZJA 2CIKB 3LKOB 3ARBD 5EO0A 5IVZA 2GI7A 1KPUB 4A2LA 3I3EA 4YWGH 1NAMB 5GXBB 1S5HB 4YDLC 5DEGB 5CD5C 1U8PA 2VXUL 1UKQA 4G80B 5CEYA 2AJ3A 1E4WH 5DC0A 5JXEC 4S1QL 1FL3B 1CDGA 4WHDA 1ZTXL 3SDAC 2JCCE 5I75B 1S7VB 1MJUH 4LSDA 4OLYL 1J8HA 4U1GB 4M03A 3D3VD 3H42L 4UU9B 3NIFF 4PJGB 3QDJD 1IE5A 3ARQA 3QIWB 3WFHB 1IM3A 1T1XB 4C54A 3SDXF 3LQAL 1WZ1L 1JN6B 4PTTB 4E42A 2DYPA 4K7FA 4KK6D 4RAVB 2X1QA 1ZGLM 5FYLD 3S4SG 5ID0A 3L5JA 3EJZD 3DV4B 5EIVA 4Y8AA 3STBA 3UROR 4MAUL 5I18L 1LO4L 1UWEL 5I76A 2H2SC 4KTDL 4PJ9B 5E6ID 3I3BA 1G7IA 1QEWA 1AO7A 1ORQB 1KC5L 1NDMA 1NEZA 5I8CA 3G5XB 4KK5D 5D2NB 5CZKA 5DMKB 3RAJL 2GIYA 2IADA 1AO7E 4H1LA 3MOQA 3T0ED 3ZKXC 4Z78A 1CG9A 4J3XA 4XRCA 3DROA 3IFLH 4QYOA 1I9JH 3ARVA 3W0WD 5I1CH 3OKDA 1JWMB 3ULSA 4DCQB 3MA7B 4OCSH 4PBXA 1RK1B 1MCKA 1VA9A 5D1XC 2YS4A 3O9WA 5D1QB 2B1HH 2NY2B 4ERSH 4JZJC 4G9FA 4OJFH 3NCBB 3S35H 5JOPE 2O93L 1S9WB 3T65B 2D0FA 3H9SE 5C0DA 2VDRH 4M3JA 5FF6B 5KSBE 3LEVH 4PJAA 4KKBD 5CJOH 1QLRA 1AXTH 1C5DA 3RGHA 1LP9E 1REIA 4UINH 4B41A 5JQHC 2ZUTA 4ZAKA 4OLUH 3V2AR 3Q5YA 1QSFB 5E70A 4PJAE 4FQIH 5H37H 2NPLX 4Y5XC 2QKIA 4UQ2B 2YRLA 1ZKAA 3GSNL 4JREC 3V0WL 43C9A 2J8UE 4NKIH 2F53D 3NZ8B 3T3MF 3UEZA 1RZGA 1Q9OB 3CH8A 4APQB 5LQBH 2GCYA 1P1ZB 2DMBA 1EUTA 3PWPA 1TTUA 5GISL 1HH9A 1A6WH 1FVDA 4DKFL 2A6KA 3RQ3A 1UH3A 5HGDA 4P23D 2FIKA 1G9MC 3T2QA 2FJHA 1OGAE 5IK3A 2V5YA 4KC3B 1XF3B 4LSUL 5FOJA 4XPFL 1NFIB 4LCWE 5IVXE 4NZJA 4NQCD 5L9DH 4UZGA 3V7AE 1KENH 1JMXA 4IRSD 4KVCH 1BWMA 2PYFB 3ARFB 3D5OF 4C4KT 1D7FA 3MO1B 5F96H 4Z7VB 3HPJA 4WTZA 1UZ8A 2EZ0C 3TCLB 4ZD3L 4MNHB 1RU9H 1XF5B 4FG6D 4ODUA 3Q1SH 4XBPB 5KG9B 4F15B 2B2XL 5K9KA 3O41A 5CSGA 4KROB 3E8UH 2XWTB 1TZGL 1T20B 3Q6FB 1DUZA 5C09D 5C0BE 5IB4B 4V2BA 3VFNB 4C56E 5IMKA 1QFWL 3PDGA 1XFPA 4KK9D 5LGKA 1MFBL 2CO6B 3GRWL 2BC4B 1FDLL 2VDOL 3V5HA 4OCRH 2YD3A 4ZAKC 5TE7H 4JY4A 4QCIA 3VXSD 1X6LA 5I1IH 5B4MD 2DQUL 4NGHL 4YIQA 2VDLH 5DC4B 3D0LA 4LCYB 3VFMA 5JLZA 5CEZH 4YC2B 2XQBL 3O2VH 3CVIL 1PKQA 4I5BB 5E4EC 4MAYB 1W72H 1JZ7A 4BA8A 3QJHA 4YAQB 3IGAB 4BK5A 1CIUA 2A38A 3PDOA 1XMWA 3VFOB 4PJ9D 4DVBB 1N3NA 4G8GA 1LDPL 2R9HC 3OKOA 3I6KA 4UTAH 3LN5B 5MEPB 1NMAL 3FOLA 7FABL 4DZBA 3P4OB 4R97C 4LVHB 4ODWB 4K8RL 1MCOL 2YSSA 1LQSR 1XZ0B 3MRPA 25C8L 3P77A 3L3GB 2D7TL 4CVXB 1NLBH 2WANA 3NZHL 2IAMA 2WIMA 1RULL 3LN4B 3MQIA 4WFEE 4KRPC 1IEHA 3UTZA 5DI8A 5JUEH 3W9EA 4X80H 3E1F1 1RURH 5BZWB 3V0AC 4KQ4H 1P4LB 1ZK9A 4XBEH 4Q9RL 1VGKB 2BSRA 4RMQA 4NZTH 3IKCA 4MVBD 1QSFD 3S96A 1BAFL 1Q0YH 1WV7T 3LHPL 1UXSB 4U6YA 1LE5B 2PTTB 3REVA 5DURB 4L29A 1C1EH 1DLHB 2FDBP 4WW1B 4ZUSA 5GRJL 3CFKB 4CRPA 4APQD 1INDL 1XGTB 4F58L 4HGWA 4Q2ZA 4NKQB 1YMHB 1OP5H 2ARJA 4QHMA 1KN2H 4ENEC 1KTKE 4QRRA 1KBGH 1N7MH 3NFPA 4OD3H 1LEKB 1U6AH 3E6FB 5F9OL 5IGXH 2P5WE 4JPIB 3F12A 3U9UB 2NY0C 3MFFB 4K9EH 1FN4A 4EXPX 4X7SH 3MRCB 4JHWH 1BZ9A 5ALBL 2RAMA 1DUYA 3D39A 5EC1B 3ARFD 4P2OC 5DJ2B 5LCVH 5HVWA 4KDTA 3RBSA 2BOCB 4PGBB 4P57B 1OT2A 4OFVA 3JWOL 4TSCH 3FQXA 3QDMB 5H94A 2WK2A 3L7FB 4OM0L 4AJ0A 1AXSB 3Q0HA 4X5WB 4BZ1H 2YUXA 4KROD 4NCC1 2NR6D 2ILLA 1VESA 1BVKB 4NM4L 2IAMC 3CXHJ 3FMGL 2P43B 3MNVB 3DNKA 1CL7L 5JW4N 5JZ7D 2OJEA 3QUMH 4QRSB 3G6DL 4IMKA 2ZSVA 5DYOB 2I27N 3QXDA 5E6YA 4LP5A 1W0WA 1IL1B 1WITA 3QRGL 4XVTH 2ICES 2J4WL 1II4E 3VDCA 1A7QH 4GG6F 2V17L 5KZCB 5JHDE 5I0ZA 2IH3B 2NY4C 5DK2B 5FGBA 2AEQL 3RVVD 4TPRH 5GGQH 1T7YA 3NGBC 3GHEH 4Z7WE 2BNRE 1WFUA 3MRNB 4MAYD 1ZHBB 4KJPD 5LWYL 4PV9B 3N50A 1FAIL 4R4BB 5JW5B 1A6PA 5DDHA 3JWNC 1UCBH 4YBQD 3MOBL 4KZDH 1JK8B 1OF2B 1NMBL 3MBXH 2UZXB 2VR5A 2OXHA 3U7YL 4LSRH 4NSKB 3SDDC 4KU1A 3SDCA 4W6WB 3RX8A 1DL7H 1RFDH 2BVQB 3BH8A 1S7XA 1XAUA 4KDTC 4LQFH 4PRNA 3UXFA 3W82A 3SJVB 2EIZA 2DJ4A 1KNOB 2DLFL 1IAOA 3ARSA 3QPXH 5I73C 2Z8VC 1NKRA 2IH1B 5GGTL 2YUVA 4LRIC 1UZ6F 3B8YA 4GSDH 4JFXA 5D5MB 5HHVH 2VKWA 1F42A 4U1LA 2X4PA 4P3CL 3VRJB 4TNWK 1KIUA 2W91A 1RJZA 3WIHH 5L6YH 4HGKC 5M94B 3MOAL 4DN4H 5ENWA 4IMKC 5HYJE 1WIPA 4WI7A 1FZOA 4P2QB 5H35B 4U1JA 1RHFA 3MYJA 5DURD 1FL6A 1G1CA 5HY9A 1IGIL 4MJIE 3MJ7A 4KPHL 4HUXA 1MPAL 1XF4B 2OLDA 5FGBC 3MLWH 1JGDA 1ADQA 1CXLA 3I02A 4K3HA 5ESVA 1INEH 5BMFH 3KLHC 2G5RA 3TIDA 3MRIA 3MRRB 5DD6B 2B4CH 3MRLA 1J1OH 3EO9H 1HSAA 2FO1A 2DI8A 3B3IA 4I4WA 1WWBX 2X09A 3W11D 5IB5A 4LLYB 2XNAA 4QHLA 1FSKB 1EHLH 3QFDA 3EYVB 5IKCB 1Q94B 2ADGB 4EDXB 5KVDL 1QHPA 2XOTA 1W72A 4HX1B 3O4LB 5CEZE 1ULVA 3SDCC 3QDMD 2OX5A 4OCWL 4M8VA 2X9WA 5BS0E 3OXSA 5C7XH 1LMKA 3SE4A 2R2EA 4MWFA 1OLLA 2XWBA 2VN4A 4G6ML 4GAYB 1AI1L 4IRZH 3AS0A 1BMGA 4IOFD 1JNHA 2R1XB 4P3DA 1LK2B 5FHBL 3MROB 4UQ3B 3BW9B 5E8EA 3C60B 4L4TB 3WDHA 4ODHH 2EDXA 3SKNA 1EK3A 3MBEB 1SEQH 2F74A 4LEOB 4ACPA 4HWBL 4TYUA 5KZCD 3TFKD 1IT9L 2HWZH 2ZUQB 4PBVC 1DQJB 2FGWL 4B7LA 5ADOL 3GEWB 1T1ZA 2GJZB 3VMNA 4PD4K 3BOVA 4JAMA 3ARDD 5C8JA 4NNYB 2A9ML 5EO1A 2IQAA 1JJUA 2DQTL 1FC2D 3BVNB 5DHYA 4E41E 1SJEA 2A77L 4XT1C 1TETL 1V8HA 5F7DA 1QHOA 2PXYB 3HE6D 3EUUA 5FV2A 3E3QC 4Z0XA 2MQ0A 2ADFH 2VLKB 2X7LA 4NHCH 5GJSH 4R0LB 4XB7A 1P84J 4Q74A 4ODXB 1J05A 1L7IH 2M26A 3ESUF 4QHUA 3LPGA 2P5EA 3GI8H 4KRNA 4OZHB 2DBLL 1PEWA 2VDML 3AB0B 2VH5H 2D4DA 4JFFA 3QCTL 2R1WA 4DVRH 3SJVD 2EIBA 2JJSC 3FQWB 3PV6B 1I3RB 1WEJL 5C0JB 1XH3B 2DM7A 4JFFE 5GHWL 3SE4C 1Q0XL 2CH8A 2ZOLA 5LG1A 3U9PH 5IJVA 1QSEB 2PUQT 2C3HA 5E94B 5C86A 3EYUL 3IJSA 1R3HA 2NLJB 3O4OB 5C2UB 3EYQC 4YDJA 3WJJA 3GO1L 2HVKB 2APWA 3MGTA 3KPOA 4P2QD 3PHSA 5IIEA 3NIFE 1P4IL 4JO2L 4MJ5A 4KKCC 1TQBB 3SDXE 1OAXL 1E6JL 2ADJA 1U92B 3QUMA 5CKAA 4XGZB 4P5MB 3T0DA 3L6FA 3V6ZA 2GW5A 1I3GL 2BHYA 4FZEH 3U46B 1BFOA 3FFDB 4KMQA 3V8OA 1FO0H 1CXIA 1KCUL 4FNLL 4Y5VA 5C0RH 5LJYH 5JO5A 1LNUA 4RWHA 4MCZA 2QTEA 3QWRA 2HJFB 3TC9A 4YHPA 4OCXL 2VQ1A 3I6LD 3IVKA 1QFUL 1H5BA 3IDNA 1IGJB 2KDGA 3O4LD 4QRUB 4YEFA 1RIHL 1MSPA 3DURB 1D5XA 3BH9A 1FYTE 1T0MA 4QY8A 1NC4D 1O7VA 5D93C 4YPGB 5CLWA 4YHKH 5FK9A 2OZ4A 2X89A 4H1LG 3O0RH 2XY1A 1CWVA 4K9EC 5CGTA 1DEEB 1MJ7L 4JPVL 3RWFA 4GRWB 2R0ZH 2FYYA 5DFVC 3BZFA 4PR5B 5GS0H 4XMPL 3RX7A 5I71B 3C60D 3CSGA 1QBLH 1RMFH 2ZG2A 3SE8L 5E08L 2HT2C 2NY7L 1SYSB 4TVPH 5DSCB 5SWQB 4NRZA 3LKQA 3T3ME 2MHAA 5L2JB 5I2IB 3QO0A 2DIJA 5TF1H 3V0VB 3RJDA 3DRTB 5DGRA 1FCCA 5BO1H 4HKBA 2Z31C 4DFHA 3WIHA 4OUUA 2A1WH 3T77A 2O5ZL 4UILH 1X6NA 4I2XA 4LHUA 2FRGP 3KXFA 3LY6A 3VDBA 1QNZH 1EUUA 1R5IB 4ZSOA 1K8IA 1OWRM 3KXFE 2WSKA 4LSQL 1NCAH 3HNTH 3QXUA 1CFQA 4M7LL 5BVPL 4Y1AA 4ZSOE 1H3TA 1EAPB 3UJIL 4NN5B 1J9CT 4OT1H 2FEDD 3V7AG 3TVMB 4DGYH 2R2HA 1Y0LB 5EU4B 4JKLA 3BGFB 4X6EB 3L3OB 1KXQE 4R26L 1DQTA 2HMIC 3G6JA 1S9YB 3IDXL 3QH3A 3HNSL 1I1AA 2WWKO 5ICXA 4OD1H 3U83A 3HI6L 1QZ1A 4XNYH 1SYVA 2PYEB 3V8CA 3MV8D 1YEDB 2AEPL 4GAFB 1FLRH 3HMXH 4BSVA 1CE1L 1MQKL 2HVJB 1YNKH 2ATKA 4WHCA 4PRHE 1V3LA 5FYLH 4ZFFA 3WE6A 3MUHL 2FX8H 1ZVSB 4YE4H 3DBXA 4LFHD 2QSCL 2CO7B 3HZVB 4ZXBA 3LKNA 3MLZH 4JY6A 2FD6H 3QA3B 4KUCF 5ICYA 1RPQA 4CJ0A 3QWOA 5E8DH 5BVJA 2YD2A 5KJRH 1S7WA 2Z93B 3DMMA 1A0QL 3U1SH 1KYOJ 3MRKB 3PWJB 4UTBH 4NO0A 4O2FA 3X3GH 4S0TD 5T1MB 1FNGB 1E28A 5KS9A 4YHML 4QTIH 2RB8A 1F6AA 4ZNEE 3EJYC 1M6OB 3OR6A 4X0KA 3QI9C 5DO2C 3C6SA 1IKNA 5DT1L 4BQ8A 4GS7C 1ZLSL 1KSRA 4ZDHA 3OJDB 4G8IB 3VGGA 4HH8A 2LV4A 2AW2A 1S7SA 2FBJH 3O8XA 3VXMA 4WIQA 4PG9A 5IHUL 1OY3B 3FB5B 4HF5H 3OAYH 4PGCA 1I1YB 2OR9L 4ONHB 1R3JB 5B22A 2OTWA 1I1AC 2E3VA 1BJMA 4GW1A 3GM8A 2HFEA 4WEBH 5DUPL 2DN7A 3AVEA 3CK0L 5F72S 2BFVH 1C7SA 4PRBB 1IKFL 3BKJL 1M71A 4JN2B 4Y5YA 2MJWA 4XMKL 4H25B 2Q86B 2IF7A 1KJ3H 3LKRB 4PUBL 5GRWA 2C5DC 3OTTA 4XI5C 4G6AD 5DJ6A 3RVUC 5MENB 4KHTH 3C9NA 1KLGB 2CKBH 2Y36H 3WXWL 4OV6F 1LEGB 3UPRA 4Z5RA 3IU4L 4XVJH 4FABH 3I84A 4AIZB 1JF6A 4X4YB 3DX6B 1VB9A 2WUCL 2YEZB 5DQ9A 5I9QB 4KWUA 1XCQA 5B38B 3VW3H 1YNLH 3EYFB 2EYRB 2EDWA 4YDVA 3HCVA 1IGML 4N0CC 3TVMD 1NAMH 3F6IA 4LSVH 4JFOB 3T8XA 5DJDA 3HUJB 1IZKA 4XAWL 4FA8A 2HYMA 1HK6A 2PO6B 4HUUB 1G7PB 4TSBH 4HUVA 1J1PL 5D96B 1QO3B 2ID5A 4CVZA 2OI9B 1Y6MR 1YNTB 1P5UA 4J3VA 3GJFH 3VXQB 1EVUA 2V7NA 2J7LA 3JV0A 2GITB 5I16B 1NGWA 5IEKB 1CLYL 4ZUVB 4GG6E 5IOPA 3U2SB 1KIRB 3QIUA 2Y5TA 1R3KA 3B9DA 3L95B 2JE8A 4G43B 5DEFB 3W2DH 4NYLB 1DQLL 4Y5YC 2DQIH 1WVZA 4HXBL 4U1NA 5EFIB 4OKDA 4LIQH 2QQKL 2DWEA 4KFZC 2F54E 3EOBB 4IRJB 2UZIH 4CN1A 3PNWB 1ZWIA 5E99L 3CU1A 2XXCB 4YQXH 1XGRA 3VWKD 1U8OA 3P0VH 2XPGB 1G7JA 4PLKC 2I9LB 1YPZF 2IPKB 4PY7B 5D7IA 5IB3B 4PJHB 2DTMH 3VI4F 4TVPE 4X6CB 4ODTH 1KEML 3UC0H 4FFZH 4PJCA 1Q1JH 4RA3A 3G5YB 2FX9L 5J8OA 3GSXB 5H37G 3TO2B 3ZDXF 2ZKHH 3ROOA 4BUHA 3PHOB 2Y06L 3TH2T 4U6TA 3B9KB 1RQ5A 1F90L 3CC5B 1G84A 2OYPA 1WZ1H 4OZGA 1BVLB 4N0FA 1EGJH 3BT2H 5B39G 3TA3A 4OZGE 3ARBA 5I18H 1UZ6E 1LO4H 3C8KA 4I0PD 4ZUWA 5INDB 4M8QB 3TYGL 4PJ7F 4NO2A 5TH2B 1ZS8B 1FGVH 1FIGL 1DANU 2VR9A 3BXNB 4NM8H 3QUKA 5J0BA 1OL0A 4I9WD 3C2AL 2V2TA 2W9LA 4HS3B 4ZTPL 2FL5B 4PJDF 2P8LA 3QIUC 3D3VA 1PQZB 3RPIA 4JM2F 1VACA 3QDJA 5FKPB 1L7TL 1O5DT 2LAAA 3KJ6H 3KLDA 4LVOB 4UB0L 4YR6B 1D5MB 3MLXL 4AQOA 1BIIA 2FHCA 2ZSWA 5GS0C 1U8KA 4U6XB 3ARUA 2R2CA 4PRAB 3T4AB 5MEND 2GKIA 1D6EA 4ZPVB 2LE9A 1GZPB 4B50A 2XZQL 2YRZA 5I19H 3FQRB 4FXKB 1AD0A 5E6IA 4XVUC 3N1QC 3S3PA 4Q6YA 5EOCJ 1DVFB 2GAZA 1M7IA 3IRPX 5I6XC 1ZHLA 3WD5H 3C8DA 3SO3B 1E27A 3H9ZA 3V0WH 5EU3B 5D8JH 4Y8DC 5D7JB 5JR1L 2K9UA 3ZHLA 1JBJA 1OAZL 4WI3A 3T0EA 1RUQL 2DKMA 4LGPB 4JPKL 2DQEL 4DKFH 2PO6D 3W0WA 3T0EE 2V9QA 4U7MA 1TITA 3AFLA 5E2VH 2JKXA 3EZJB 2XA8H 3MUGA 3BWAB 2VAAA 3V4VH 3F58L 3NCYP 4X8JA 2NY5L 4OZFB 4LSUH 1MREH 5LGJB 4WFGD 4LGRB 4WDIB 4N0RA 1UB5A 2QR0A 4OCLC 3MLUL 1H3PL 2ZCKL 4YXHL 4N8VB 4B0MM 2WUBH 2BVUA 5EBWB 1CTOA 4GLRH 2HJKA 3MZGB 5DUML 3WNKA 4P49A 1C5BH 4LDOB 3BEVB 2BXZA 2NZIA 3JV6A 4GMTH 2F53A 2BDNH 2B2XH 4NUGL 3S37X 3KYMA 4IRJD 1OD9A 1S7RB 4CADA 1P9MC 3LPFA 3LEYL 1S9XA 5DVNA 1EFXB 3TGXA 3RA7H 1GC1L 4KK6C 1YY9D 3H9HA 4P23A 1Z5LB 4AH2B 1QD0A 1QKZL 5EU6E 3WHE0 4QXWA 5CAYB 5D7KD 1CDYA 2BJML 2HFGL 4LPVA 5DHVB 2JK5B 3MRQB 3V4UL 4O2EB 1NGPH 1YEGH 1HH6B 3STZA 4XPGH 2HJLB 4NQCA 3CX5J 4YHLH 1F8TL 5I8KL 4KTEH 4ZTOL 2J5LB 2DQHL 4IRSA 3B9KD 1HHJA 4KK5C 2ZUYA 4NQCE 4I77H 2AKRA 4X98A 2E6QA 3T0EC 4PRPB 1ACZA 1OPGH 1TPXC 1K8DB 4Z7OF 3UTTE 1JZ5A 5ISZB 2NY3B 1H8NA 1KPUA 3OHXA 1SY6A 1NAMA 2SEBB 3ALXA 4X4XB 5C09A 1T03L 1S5HA 5SWZB 2DL9A 3QCVH 3A6CL 4U0RB 3RZCB 5JDJA 4G80A 4PJBF 1OM3L 5A3ID 4LK4A 1FL3A 2DIAA 1IC1A 3UYRH 1H3UA 1S7VA 4NN7C 4TQEH 4G7VL 4NBZB 2DD8H 3R0NA 5ETUB 4X6DB 3KPMB 4UU9A 2VISA 3NACL 1U3JA 1XIWC 4PJGA 5TFSL 1VEPA 3QIWA 3ARED 3WFHA 3RY6C 3VFUB 5AAWA 2AQ3A 1JN6A 4PTTA 1CZ8L 3B2VL 4M4RA 3VXSE 1FNFA 3QPQD 4RAVA 3NABL 3TN0B 1QBAA 3AXLB 4KGLA 3DV4A 4YDKH 5JORB 1NL0H 1PW3A 4U3CA 3L5IA 4YGVB 3V6OA 4FP8H 1WICA 4P23C 4PJ9A 1A9BB 5CILL 3BKCH 3GMMB 1DVFD 4Q6IB 4KZEL 2D31B 1FORH 1DQQB 1MI5B 1TJHL 2BSTB 3LS4L 3G5XA 1VFOA 4LIQE 5D2NA 5DMKA 2GJ6E 2YK1L 3DJ9A 2VIRB 4ISVA 4IRSC 4BQCA 3OB0H 1QLEL 1AHWB 5IEHB 4LSTH 1RUPL 4YFDB 5DFWH 2KUTA 4MA7H 2V2XA 1JWMA 4FG6C 4J6RH 5F7FA 3BWUC 3LOWA 3EBAA 3LPWA 5HYEA 3PF2A 2CSPA 4OF6A 1S9WA 1GIGL 3T65A 3Q3GA 1HHIB 4GKZB 5F6HI 5BXFB 3O81A 5FF6A 5IHBA 3BMVA 4Z7UF 1EGJA 3EOAB 5F1NB 3UO1H 1IM9D 3HRZB 1CDHA 1QSFA 2FHBA 4KK9C 4OGZA 2AXFB 3JWOH 4J3TA 2WZPD 3LRHA 4PPTA 4IS6B 4UQ2A 3KNBB 3UMTA 3UJTH 2EH7L 5HYSA 3SOBH 3MV7E 3NZ8A 5JW4Q 3HR5B 4QHNB 4HIEA 2VDKL 1VADB 4POZD 4APQA 5B4MC 5BV7L 1A6VL 3IETB 3RDTB 3H2WA 1EFXD 1RIUL 3FMGH 5T3XL 2HRPL 3S98A 3OKLB 1SBSL 2R29H 1ROWA 2N7AA 5E8NB 2O5XH 3N1MC 1XF3A 3V6OC 1D9KC 3FB6B 2BP3A 3SGJA 1NFIA 2BY1A 3AU1B 5HGHA 3AS1A 3M8OL 3GSQB 3IAPA 3L3HB 2PYFA 3ARFA 3ECBA 4WO4B 5D2NC 3MO1A 5KN5B 3GJEA 4Z7VA 5DJCB 3TCLA 4OSUH 1XGUB 5F44A 4MNHA 1A1NB 1XF5A 1T7ZA 4XBPA 5KG9A 5EOQL 4F2MB 2W65B 1MHEB 2Q1EA 3ARGB 5IMOB 2VLJD 1GGTA 4XNZB 4DN3H 4Q9QL 2NY3D 4HFUL 1MEXL 2PW2A 1T20A 3FFCB 3Q6FA 4UT9L 5IB4A 1DSFL 3B5HA 5CGMA 2PTVA 1RD6A 3UTSE 3RZCD 4QHKI 3ZYIA 2WBJD 3LQAC 2CXGA 2ATPB 3GSNB 3C6LD 3RTQB 5D1ZD 1FV1B 5J9PA 1EEUA 5I30H 5CSZA 1BJ1H 3ULVD 3BE1L 3MRJB 4PYHA 3TV3L 2QQNL 1F13A 3SQOL 4CU6A 3PQYB 5GRVL 4APQC 2H6PB 3IRZA 4UV4L 3TN0D 2XFXB 2OTPA 4MAYA 2VXQL 4YAQA 2VXVH 4PFEA 5EOCH 3MNZB 2XZCH 3B2UD 4ZO7A 1Y18B 2Z4QB 3VFOA 4DVBA 3ZTNL 1KJ2H 3LN5A 1MI5D 3HLAB 3WJLA 2FEEL 1X5FA 3P4OA 4NZUH 5DMYA 4HIHB 4S1DC 1CFNA 5TE4H 4ODWA 1HCVA 2DF3A 5EC2A 1L9NA 1MPAH 1P2CB 3NOIA 1XZ0A 3DO7B 1GVIA 3DX8B 1L9MA 4DOHE 2X44D 1ZT4B 5C9JB 3L3GA 3WNLA 4CVXA 4DOHB 4HWEL 4UI2A 1ACYL 4ZODA 4YNYB 2YD6A 1RZ8A 3LN4A 4JFHD 3ZYOA 1R5WA 2FCBA 1G0DA 3BZ4B 1JZ3A 1WT5C 4MMXC 3GNML 5BZWA 15C8L 1P4LA 3O6LH 3GK8H 5JZ7C 2GYSA 1VGKA 1XGYL 3T2NL 4HEPG 2V2WB 2C3WA 3H0TB 4PB0H 1LE5A 1V7NH 1UXSA 2EXWD 3TT3H 1QQDB 4OLVL 4ZO9A 1DLHA 4WW1A 2ARJQ 1CBVH 1AR2A 4HT1L 1SJVA 5IFJA 1KIQA 1XGTA 1YMHA 3GSVB 3HNVH 3IS1X 2A6JA 2EDTA 1NBVL 1U8MB 4YC2C 2AXJA 1LEKA 2NY1B 2IBBA 5C2BL 2GSGB 4MAYC 4YX2L 4TNWF 3R1GH 4KJPC 4JPIA 1FVEB 5F7WC 2R0WL 5HDBF 3U9UA 1WK0A 4FQ1L 2UVFA 3ZYZA 3MFFA 1ZA3A 5E5MA 3K46A 3CFCL 3MRCA 1OAYH 1CF8H 4P2CG 1NGQH 3WJLC 4F7PB 4WW2A 3GHBH 2FWOB 5DJ2A 3MLYH 4IMLB 4WO4D 2BOCA 4P57A 2KQNA 5DD1L 3QDMA 3ZKSD 3A6BL 3TPUB 2W07A 3L7FA 5TQ0H 1IC7L 3MLSL 1QG3A 4Q0XH 1AXSA 4W70A 4X5WA 3VDAA 4AL8H 4MS8D 5AWNL 3T1FB 1CFTB 1BVKA 1QFOA 3U4BH 2W9DL 5EH1A 2YBRB 5JW4M 1UM5L 3FFCD 4D3CH 3EYOB 4N1CA 3MNVA 5IJKC 3RKPA 1HDMB 2E7BA 2DQJH 5KANI 5DYOA 3MR9B 4ZG1A 4F7EB 1IL1A 3ARZA 5IBTL 2DBLH 1B0GB 2R0LH 1UB6B 4L9DA 4QF1B 1KPRB 5T1LB 2J8OA 3WLBB 2IH3A 1AGEB 4KRLB 5DK2A 4F9LA 3KVQA 4NQEB 3FJTA 4S1SH 1IGFL 1QUNA 5F89B 1WEJH 5ITFB 2KQMA 4QOKE 4ESKA 3PQYD 5C0AE 4LPUA 5E8PA 3MRNA 3IU3B 4X9BA 4PD4J 1Z0MA 3O3AB 1AC0A 4PV9A 1YPZE 2X4RB 4X7TB 1GJIA 4R4BA 1M7DB 5FO8A 5A40E 5C0NC 5E8OB 1NUFA 5HDOA 1JK8A 3ZDXE 3W11C 1OF2A 3BSZL 3ULUD 4PREA 5IFHH 1DBBH 4GRWH 1E6JH 3S34H 1B2WL 1NBYA 2HH0L 4PRID 2BVQA 4WW2C 2VNCA 2FNBA 1MHPL 4KMTH 3SJVA 2OK0L 1EHXA 3UYPA 1JPSH 2R56L 4K3JH 3HZMB 4QXGL 1MNUH 2IH1A 4PJ7E 3WFEH 2C7UB 5GGVL 4XPBL 3TBSA 5GRYA 5D5MA 3A6OA 4PTUA 1MFNA 4L9LC 3VRJA 3CPLB 5IB2B 3KS0J 1BF8A 2Y25A 1AY1L 4DAGH 4PJDE 4P2QA 3V5DB 1S5IL 3THMH 1C12B 2Y9RT 1B3JA 4MDJB 5JW3H 1F2QA 4JM2B 4YXLH 3TFKC 1XF4A 2DOCA 2X4QB 3U30B 3MNWA 1QYGL 2W0LA 1NCBL 4MD4B 1MJ7H 2AV7B 3MRRA 4BSWB 4XMPH 5DD6A 5J6HB 5FHAL 3ARDC