2Q20A

Structure of the germline vk1 o18/o8 light chain variable domain homodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
TDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPYTFGQGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein fibril
molecule keywords Vk1 O18/O8 germline light chain variable domain
publication title Altered dimer interface decreases stability in an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q20A00
4APQC 1ZLSL 1F2QA 3ARGB 3BP4A 1LO0L 1ZTXL 3V5DA 2QLVB 1KEGH 4PGJA 4OLEA 1FVDA 1T22B 4ZO9A 5LCVH 1T5XB 4OGYL 4U6YA 4JDVA 1DVFD 3TPUA 4HV8A 1N0XL 1VFMA 1UT9A 1C5BL 4XP1L 5I8OL 1KPUA 5E4EC 2YSSA 1SYSB 4FZ8H 1UEMA 4A2LA 5E8OA 1JRHI 4HWEH 5L7XH 2ITCB 3OJDA 4OF3A 1Y6KR 4D8PB 3C8KB 3D0VB 3B6SA 3T0BA 3CFJA 2R0KH 4ENED 4UV7L 4BH7B 5FUZH 1AH1A 1ZWIB 4X7DC 4M3JA 4YDVB 3N85L 2WM0A 2CR6A 3ZE2E 3C8HA 3VXTB 1FLTX 1YEHL 3NN8A 4JFQA 3UTPD 2AJZB 2VZVA 5GGRA 1LK3H 1KPRB 5DJAA 2XTLA 1WK0A 3DXAD 1MRFH 1OGAB 4QRTB 3MOAL 3M1BB 1KCRH 2BZDA 3AS0A 3CFKA 4DAGL 1DQDL 5TDPA 1YUHA 4GKSA 2HP4A 2DYPA 5E2TH 1GZQB 4JN1L 2ENYA 5FK9A 5F1IA 2ED8A 3HN3A 4KROB 4QNPF 1KC5L 1F90H 1TDQA 1LO5B 2Z35A 5BZDB 1XGPA 1UKQA 5H35A 4NKDB 3EDKA 4BFEA 5C0CB 3LS5L 2Z91A 4XP9L 5DD6A 1ZEAH 3U1SH 3NPZB 1XF2B 4U6XB 1EUUA 3RA7H 1DEEA 1ZS8A 1F4AA 3I6LE 2VITB 4ZFGL 3UJTH 4N0FB 1JUFB 4P3DA 5CWSB 3CD4A 1FIEA 4XVSL 1HXMA 4WV1C 4QTIH 4XPHH 1IM3B 1FAIL 1LD9B 4K71B 5JDSB 1FNEA 5JR1L 3O8XD 4Q58C 4NYLB 3W11D 4XHJC 2IFFL 3HC0A 5EUOE 3W9DA 5ESAB 2VDOH 1A22B 4PJ5E 4MNQA 5ACMA 4HXAH 3HC3H 2W1NA 2DQJL 3FO1B 5H2BB 3OHXB 5IMLA 3EO0B 4PJBF 4JY5L 4GRWF 3TN0D 2QSCH 4Q9RL 4LPXA 3U7WH 1BFSA 3VRIA 4LLUB 5HHQB 5BVJB 5DRZA 1ED3B 1V5JA 3W0WA 4V1DA 1BVLB 3OMZA 4KRMB 5CIPB 2ADJB 3SDAB 1DR9A 2ARJA 1KJMA 1NBYB 2X4RB 3G5VB 5HYJA 3QWRD 4JRXB 4PJXB 4XWGH 5GQBA 1HK6A 3IJYA 2IADA 3KPTA 5T1LD 3HZKA 4NQDD 5D4QA 2LTQB 4X7TB 4YGVA 5GRVL 1R3KA 1KCLA 1URLA 4RMWA 4F7CA 5DTFA 3B5HA 2CDFB 5D1QC 4OTXL 3HG1B 5D7IA 4UT6H 1TVBB 1RIHL 4D0BA 4RRPA 2XZAH 4Q6IC 3OXRB 2NLJA 1BIHA 5AG8A 3TO4A 1MWAL 2OX5A 2X4QB 4WHDA 4MDIA 1CXFA 3G5XA 1GH7A 2FH8A 4HUNB 4MNGB 4WFHE 4XP4L 4G8EB 1CFNB 4PBWD 4QO1A 5CGYD 5A2JH 4WIQA 3BZEB 2JB6A 2GJZB 3O3AA 3LN5A 1KT2B 1ZLSH 5L2KB 1LO0H 3U6RA 1ZTXH 1R5VA 2WBKA 4IRJD 1GIGL 3HZVB 2PW2B 5EBWB 4LSRL 1U8IB 1Y6NR 2DLEA 5EUKB 4LCWE 4XX1G 4Q9QL 3B4NA 1UWXK 4XP1H 1XF4B 5I8OH 1TTFA 2CLVB 1ZT1A 3IF1B 1MIML 1UVQA 3EJZC 3V6ZB 2NY7L 4MWFA 1YEKH 2HT4C 1P53A 3IETA 1YEGL 3MRNA 1CGXA 4L4VA 3KPRE 1IKNC 5E1AA 4UV7H 5JOPD 4WENB 4XPGL 1T20B 1XCQA 1NCDL 1IT9H 3SE9L 4UQ2B 4H0GA 1J0ZA 2XPGB 4YDLB 1YEHH 2FEDD 3JV0A 3KPSB 4Z0XB 1LGVA 3A6OA 5DK0A 1YMHB 4MJIA 4Z77A 2WIIB 4UT9L 1U8OA 5DJCA 4NO2B 3OB0K 2HLFD 4HHAB 1SYVB 4X6DB 2BVPB 1J8HB 3VH8G 3HTLX 4DN3H 1D9KD 3T0WA 2EYRA 3TPKA 4Y1AA 3MOAH 5HI3C 4WNQB 1PLGH 4JZJA 2BNRB 2E3VA 2ADGB 3DHJA 4ZUSA 1MFEL 1N3NA 3FZUC 1DQDH 3T2OA 3WIFA 3FRUB 1I3VA 4ZNCD 3JWOL 2NXYB 1F6AA 4E5XA 4W6XB 4OF5A 4OGXL 3C60A 1A7NL 1KC5H 3VXSE 5D2NE 4HUKB 2IAMC 1B3JA 1GL4B 3VXME 3BZ4A 3KPNB 3EOYG 1MFBL 5MHSE 5JLZA 4LLDB 1J8KA 3QIUD 4FQXC 3LS5H 4OZIB 1B4RA 4KWUA 4XP9H 3V0VB 3PDOA 5DJ0B 2C3WA 5F1NA 1A9EB 3SKMB 5BOZG 2VUYA 4XPBL 3GSWB 3ARUA 4HS3A 4PRHA 2P8LA 5T1KB 5F7YC 4CNIA 4ZFGH 4XVSH 4L1DA 1UB6B 3VWKA 1FAIH 1OL0A 5JR1H 3BVNA 4FG6D 3Q0HA 5IEHB 3ARBB 1JWSB 2IFFH 3PWLB 1YY9C 2AS5M 2AKRA 4ODBD 2F54B 4NQEE 5HDBE 4WEBH 4N90E 2DQJH 4OUUB 5KSAC 3QXDB 4FMFA 4Q9RH 3QUML 5HDLA 5EC2B 1ROWA 4KV5F 3D2UA 3UDWA 2R0ZL 2MQ0A 4BA8A 1IGYB 3NACL 5IBUG 5TF0A 2X44D 5IB3A 3ROOB 3MOQA 5D1XD 5F7UA 4JDTL 4WUUA 4NN5C 4WGWB 4PRID 2Y07L 4WJ5A 4JR9L 1I7TB 3P4MB 4NNXA 5EO9A 5C08A 1NEZG 4B7IA 1ACYH 3FONA 1WCQA 2HJFB 4YBLB 4E9LA 3PGDA 3MRRA 2OYPA 5D7SL 3EOAB 2RFXB 4MCYA 5D71L 1OP9A 3E2HC 4P4RA 5MEND 4MSWB 5D7JC 3QZWG 2XTJB 1JPFB 3KWWB 1AR1D 5GGTA 1U8MA 2GSGA 4OTXH 3U9PL 1EDQA 2MPAL 2LVEA 4TNVK 1RIHH 5KOMC 1VEOA 2P1YA 1MWAH 2N56A 4IRSD 4XBPA 3T2QA 5I2IB 2W0FB 3HPJA 5EU6A 2FJFB 2PO6C 4AIZB 1MCJA 5DD3L 3LKSA 4POZC 1B9ZA 4XP4H 1I85A 2XKNB 5E94B 4HUUB 1F3DJ 5BS0A 3G5ZA 4HJ0D 3SO3C 3T77A 3TT1L 3D85A 3C5JA 3V52L 4FRWA 4R7DA 1JHTA 1GIGH 1NGWB 4LSRH 4CW1B 1YJDH 2APXA 4CDHA 2HH0L 1HIML 3IDMB 1RI8A 5C86A 4Q9QH 4WFGD 2ZCKL 3FB7B 4D0CB 4G6FB 1I4FB 1QRNB 5DC9B 2R4RL 4HC1L 1CI5A 4LDLB 2C1OB 5I1DB 3S7GA 2NY7H 4Y19D 2HFFA 1ZHNB 1TTGA 2AV1B 1YEGH 2HFGL 1MJ7L 4G9FB 4XP6L 4ELMB 4YAQA 1CQKA 5I30L 3ZE0E 5FGCB 1Q0YL 4XPGH 1WZ1L 3ARDC 2Z31C 5D1ZC 1NCDH 4WWKC 1LEIA 3EOBB 3SE9H 1AGFA 3QIWB 1SY6L 3RL2B 5EA0H 4QRUA 2W9LA 4EDXA 1HEZA 3EYVB 1FO0A 3Q6GL 2VLJD 5EU4A 4UT9H 3U0PA 4X6FB 5CMAB 2Q86A 5EFIA 1PZ5A 1M6OA 2CSPA 2Y4SA 2GAZA 4GKNA 5F9JA 5GRXG 5IB4B 4Z5RA 2EXWD 3W9EA 2DQFA 1MUJA 4A6YA 1OB1B 3GI9L 2EKSB 4LFHG 3PV6B 4PLNC 3RIAK 1XGUA 4OCXL 1MFEH 3NMEA 3CCHA 1KIPB 2HTKD 1MHPH 3WUWB 4ZS6C 3JWOH 3ME0A 5F7EL 1JTPA 5GSVB 3L3IA 5C70A 4Y4HA 3SCMB 3QIBD 3MV7E 3BQUD 4OGXH 1K6QL 3B3IA 2LFGA 2OXGA 3VFNA 1MFBH 1YECL 5IT2L 5DQDL 3D87B 2X10A 4Y2DB 1HKFA 3HPLA 1QPPA 1KACB 2RGSA 3FOLB 4JQXC 5JQ6H 4PP2A 2WWMD 4TVPD 2X2YA 5E95B 4XPBH 4MVBC 1F4WL 5EWIL 1A1MB 4OCLC 1YNTB 4P2OA 5BOPA 3O45A 1I3UA 3OZ9H 3QEQE 2EE3A 5L8KB 3VI4F 5D7LD 2JTDA 3KYOA 2UUDK 4JM2F 4ODVL 5KS9F 1FSKC 4Z95L 1WWBX 4QHUB 4ZUUA 4OBSA 1UM4L 5D2LB 5DHYB 3F5WB 3QUMH 4Y4KA 1F58H 5DDHA 4OF6A 3D69A 3MV8A 3UJIH 4PJ9C 5DFVD 3NACH 3BRFA 5E9DB 2P8MB 1RFDL 1NBZA 2Y07H 4JR9H 5DXWA 1S7SB 1R3IL 2F53D 4AQ1B 4OCMC 1K8DA 1NFDF 3TP4A 5E0QA 2KUTA 5D7SH 4KY1L 2A0LC 2NYYC 4PJBE 4GRWE 1AO7A 4YNYA 5D71H 1VKXA 2GK0B 3SKNA 3DGCR 3O41B 4PJ8B 4YHML 2FYYA 4E41A 1T2QL 5AD0A 4JPIB 1INDH 2QV2A 2ZSVA 1RUML 4MLSA 3U9PH 4LLAA 1QFWL 2MPAH 1WWWX 1GGIL 5HDOA 3TBSB 1QLFB 3UTTD 1T4KA 3BP6A 4HKJB 3MNWA 5IIEB 4HWNA 2OLDA 5DD3H 1MELA 2VZ1A 4ZD3L 3WXVL 4Z8FL 3X12A 1PKOA 3IXAA 1C12B 5J1AA 5C71A 4KKLC 3TT1H 3V52H 4XRCB 5ITFB 1QG3A 4MB4A 4MJ5B 1JZ2A 2HVJA 5HI5D 3G6AA 3JTSB 1Y6MR 2HH0H 1DANT 1HIMH 4UDTB 2IQAB 4EKXA 2ZCKH 1NCWL 5IG7B 1HHIA 3K1KC 5I8EB 4HC1H 1H3VA 1ORSB 5SWQB 3DSFL 4B41A 4J1UB 1CS6A 2JJTC 4QGYA 3V5KB 3O4LB 1S9KC 2YPLE 1UENA 3DMMD 4XP6H 4OD3L 5I16B 4PJCF 5B38A 5I30H 1DDHA 2H2PD 1CT8B 4TSAH 1SY6H 1ITCA 2EDOA 2Q1EA 1D6EB 2EDFA 1TPXB 3VXQB 5T3ZD 3Q6GH 2A6KA 1D3CA 1T5WA 4WFFD 3DVIA 3GJFK 5DUBA 3E8UL 4JRYB 2BFVL 5ACZA 4Y4FB 2A6JB 3GI9H 2ED7A 2NXZC 3HNTL 3KXFE 4OCXH 2K9UA 4MLIA 1QA9A 1DUZB 1KB5A 3BJ91 4NQCA 2H26B 2DQHL 5F7EH 2OR9L 2WK2A 4RNRB 3QWOA 5JW4Q 2X1WL 4GW4B 1KYOJ 1HQ4B 5BV7C 3H42L 4ELKB 1JGDA 1K6QH 2MTPA 4PG9A 5SV4A 4ZOEA 4CMHB 3P4OB 3U4AA 2XQYG 1IEBB 3L5WA 4FP8L 4EN3A 1E0OB 1YECH 4U3HA 5DK2A 2NW2B 5IT2H 1MLCA 1TJIL 5DQDH 5TH2B 1RZIB 1D5ZB 2IPTL 2CRYA 3KJ4B 3KPLA 4K94C 4MNQD 3EGSB 1MCWM 3S3SA 3T3MF 3RGVD 2Y72A 4HG4K 1SMOA 2VDQL 4ZODA 5EWIH 3QUKB 1ODAA 3W0WD 1DBBH 4V1DD 4NN7C 4XAKE 5F1KC 5TE6L 3MBXL 2K3TA 2WW8A 3CVHA 3QFDA 3OSKA 4ODVH 3WIHL 4NFBA 4Z95H 2MCPL 4LSTL 4UINL 3S96A 5HYJD 3L7FA 1UM4H 3T8XA 5D6DC 4PRNA 5TDNB 4MNHA 3CSPA 2JK5A 3DETC 3UTQB 1KG0A 4PJDF 5JHLL 5JMRA 2AK4E 1KPVB 1MRDL 5CHNB 1RFDH 2HJLA 5C07E 5D1QA 5HGBB 3QDMA 5DYOA 3GM0A 2VL5B 3EFFA 4EUPG 1AKJB 3DUSB 1QSZA 1R3IH 1EK3A 4RZCB 5A1AA 3MJ7B 3JSSA 1JNHB 4MHHI 4P46A 1UYWH 1WGOA 4MZ2A 3PWPE 3FFCD 1S7WB 4LSDA 3TO4D 4LLQB 3SKJL 5HYIA 1P7QA 2H41A 1S7UA 3VXOB 2ATPA 1IC4H 4YHMH 5GS0D 4WO4C 4XVJL 1TCRA 1T2QH 2IALB 3B2UC 3N1QC 1RUMH 5C0RL 1LP9A 1UZ6F 4CN4A 2P5EA 1QFOA 3LKPB 4APQB 1YEIL 3C08L 3CH8A 4JPKL 3S37L 3WNPA 3S5LA 3P4LA 4HIXL 4M1DL 1P4IL 2DI7A 5D2NC 3WXVH 4ZD3H 4Z8FH 4H1LA 5JA9A 5JDJA 1BWMA 2DKUA 3CSYB 4LSPL 5FM8A 3RL1B 2HFTA 1IKNA 5EZJB 1D5MA 2FJGA 4L4VD 4M1GL 5E4EB 5JIKA 1S7VB 3V8CA 1PG7H 1MCOL 2Q76A 4WY7L 3GSXB 5SWZA 2IANE 4NRXB 4LHUG 1YYLL 1NCWH 3AS3A 1OLZA 4MJID 4HKZA 4FS0A 2EDXA 2ICWJ 3RBSA 2EYSA 1DVFB 3RWJB 2GITA 4OD3H 4ZG1A 3TBVA 1QBLL 1CD8A 3K7UA 1ZHBB 4WW2B 4NQTA 3D39A 3Q3GA 1QEWB 5HBBA 4XVUC 5B8CA 2Z93A 4XNYH 1JFQL 3IT8D 3MV9E 3ILQC 5F6HJ 3QCVL 1BP3B 1CQYA 5FYLD 5KVMC 3E8UH 3QULA 4XTRD 3UZEA 3O3DB 4G43A 5IV2B 3ULVL 3TBWB 2BFVH 4KQ4L 1NC2A 3DX6B 1VACA 1DQJB 4JFYA 3HNTH 2A77L 1PD6A 3KNBA 3OKDB 3UBXB 2XY1A 1S5HB 1Z5LB 3GUTB 2DQHH 2OR9H 2E27H 2ZJSL 3QEUA 3QPQC 5GRJL 2D7TL 1GSMA 3SBWC 3V4UL 3H42H 3BH9A 4N0CC 1IJ9A 1ZK9A 4L29B 1I3RB 3VWKD 4FP8H 4ZNEA 3ZDZF 4F37K 4RMRA 3U0WH 1I8IB 1TJIH 2R1YA 3QA3A 2IPTH 4DUXA 4WV1B 4X0KA 2AQ3A 5CEZL 5GZOC 4YK4C 3RY4A 5KSAA 4LLVA 2YD6A 4KK5D 5B39B 4LCCA 2VDQH 1JRHL 4R97B 3SDXF 2AJ3B 4N8PA 3FO9B 2AVGA 4XVTL 1XGTB 4WTWA 4JVPA 3GIVB 5TE6H 3FT4B 3MBXH 5FB8B 4ONGL 5DJXA 3QDGA 3U4EB 5I1LB 5D5MA 1RAMA 1G9EA 4UINH 4DN4H 2ED9A 2D03L 2X4UB 5BQ7B 4NIKB 2R23B 1OF2B 4QT5A 3MQIA 1TZHB 3RX5A 5JHDA 4J8RA 1VADB 1MRDH 2A83A 3CZFB 4JFHD 4R8WL 4WEMB 1P2CA 4POUB 5JA8B 4AEFA 1V7ML 2P44B 1MCSA 4HKXB 1RK1A 3TJHD 1AJ7L 3VI4E 5KS9E 2VKXA 4LARL 1CR9L 3LOWA 1B88A 3U7AA 4DJMA 1UKTA 2AQ2A 4GH7B 2PO6A 5EU6D 3GMRA 2VE6A 3SKJH 4LPUA 5DJ6B 5F96L 1C1EL 1WIOA 3VGBA 2A6DA 4MXWL 4WU5B 1MCQA 4PY8J 1HSBA 2HJKA 4RAUA 3RY6C 5GZND 4Q6IB 2R69L 2W38A 4XVJH 3ZTNL 3D85D 1IAIM 1IC7L 3KGRA 3PF2A 5C0RH 2M8XA 5GHWL 1WBZB 3C08H 3CFIC 4PTTB 1F6LL 4ODWA 3GMQB 3S37H 1AQKL 2ZOKA 2IBZX 4MS8C 1KCUH 5DRNB 3T3PF 1NFDE 4M1DH 1P4IH 5EZLA 5K9OB 4XH2A 1ZGLA 2FX7L 2BOCB 4PRAA 3RUGB 1CFSB 4Z7UB 1G7IB 4M1GH 4ONHB 1ZE3C 2V7HB 4HH8A 1OD9A 4QOKB 2SEBA 3ARDA 3CFDB 1SJXA 3K4DA 4PFEA 5D1ZA 4CADA 1MCOH 4WWKA 4PD4J 4WY7H 4QYOA 5JPNB 2FB4L 1U3ZA 1ZT4B 1YYLH 3U36A 1N6UA 4NCC1 1E4WH 3FHAA 3WO3B 4Y5YC 3B9KC 5FUCE 4CMMB 1SJVA 1F8TL 2X89A 3L3GA 1E4XH 4WRLA 5IBLC 2E5EA 1X4YA 3IGAA 5C0IB 1QBLH 4P57A 2F5BH 3BKYL 2D9QB 1LO2L 2R2BB 3T09A 3HNVL 2H8PA 2WMPA 1JFQH 5CD3B 3MRFB 3BN9D 4PJAF 5KSUB 1T2XA 3QCVH 4YIQA 1T89A 3U9UA 3R1GL 2BRRH 4KQ4H 1NMCC 2DMKA 1BX2A 1DN2A 5AEAA 5GSRA 3H9HA 5IF0A 1X4ZA 3AAZA 2A77H 2OL3H 4P4KC 2MJWA 4P9HC 4I77L 3OKKA 4PJCE 4PLKC 4OZHA 1NUFA 4CU7A 3U46A 2IAMB 2ZJSH 3BGMA 4JQXA 5K59E 1CIUA 4L9LA 5GRJH 2D7TH 5FA4B 3N1FC 5HHOE 3V4UH 4D3CL 5BJTA 1G0YR 4FQXB 4LVOB 1JVKA 1BQUA 1HINL 4CDGC 5DUML 4PREA 4P2OD 3G6JF 1R3JB 3RPIB 2FATL 4PJGB 1AI1L 4XI5C 3VFOB 1XF5A 3OR7A 1A4JA 1M05A 3T1WA 1U8LA 4CN6A 1HQRA 1MVUB 3BAEL 5CEZH 1H0DA 4ODTL 3FQWB 5HHVL 5KN5A 2HA1A 2XWJA 4FQLL 2ZUUA 4NO3B 4FFZL 4HUVA 1KOAA 3O4OC 4Y4KD 4L8SC 4DVBB 1JRHH 3MV8D 3K80A 5ETUA 3QIUB 5FCUL 3WS3A 3TA3C 3NA9H 1P6FA 3HMXA 3H0TA 3X13A 3BEVA 4JY4A 2HAZA 4KJYB 4ONGH 3U48A 4WFED 1L0XA 3VXNB 3S97C 1YPZA 3HR5A 5INCB 4ISVA 1RV6X 2VLKB 2D03H 2KL6A 3UZQA 1PX4A 3MXWL 3QDAA 3T3ME 1UKSA 4QRRE 4JFPB 1NCBH 1C08A 1FNGB 3GJFA 1AO7D 2C1PB 3H9SB 5C8JB 5I1AA 4R8WH 3RKPA 4S1DC 4E41D 1V7MH 2JCCF 1MHCB 5C0AB 5E70A 2LQRA 4EXPX 4AT6B 5BZWB 5CJ5A 1AJ7H 5K9KA 4RGMC 5F7DB 4ZXBC 5IJKC 2FIRT 5D7JB 1CR9H 3DIFA 4GG6B 4FN0A 3ZKMC 4IOIA 4K3EH 5I8CB 1ES0A 1NEZA 3TH3T 1FC2D 2ICWI 5F96H 2XG5A 3BWUC 1DL7L 5DHVH 3T4YB 3T4AA 2VABB 4PV8B 4PJDE 2R69H 3ZTNH 5I73C 4F7MA 2XN9E 1IC7H 3EO1B 4M61B 1DQLL 2RBLA 4S2SA 4OLZL 3EDEA 5GHWH 1REIA 3RZCC 1CGTA 1U3HA 1KGCE 3SO3B 2DD8L 5MENB 2CRMA 2NY4D 5F9DC 4ZSOE 5ENWA 2NTFB 4HW6A 4XCNA 1CFBA 2A1WL 2HLAB 4JFEE 3KR3H 2LV4A 4BM7A 1YN6B 4EXKA 1UJ3A 4LCIL 5ISZA 2JJTA 2FX7H 2E9BA 4K3GA 1QLRA 1QSVA 3G9AB 3IVKB 3SGEI 4C55A 3SGJA 3IFNL 4HMEA 4NM4L 4W4NA 2FB4H 3DGGA 4HGWB 1AFVL 1UZ6E 3QRGL 2ESVE 4U31A 5JXEC 4KRPD 1U8PA 2VZTA 4FXKA 2IJ0C 2Z31B 1ZLVK 1SJEB 3ULVF 3V6OE 4XZUA 1MIEL 3O6ML 4H25A 4PY7B 4HH9B 2P24B 1QQDA 4QRQA 2GT9A 3VXUA 1Q72L 3C09C 3MA7B 1CG9A 1A5FL 1AHWA 1LO2H 2OR7A 2YD3A 3U2SB 4YHYB 1U8KA 4MZ3A 4G9DA 4GW5B 2D0HA 4RISL 5I1EL 2QJDA 3I3BA 4G8GB 4NQCD 3SGDI 2DBJA 4P5MB 4LRNL 1H3TA 3R1GH 3QG7L 4O58L 1I7UB 2J8UF 4HFWB 3UPCA 5JXAL 5J11B 4GSDL 3IS1X 1RURH 4EN3D 2ZWLT 3QXTA 4HPOL 4I77H 1BBJB 1TJGL 1UA6L 1WT5C 4LQ1A 3W81A 4PRDA 5JOFB 1INQB 2EIZB 4LCUB 5EO1B 1FBIL 4CVZA 1GGTA 1CXKA 2GI7A 4D3CH 3IU4L 3VH8B 4ZFFA 1HINH 4ZFOA 5DUMH 4XCCL 1LE9B 4GAJL 4LVNC 1RJYA 2FATH 1AI1H 1MEXH 5IB5A 3CH1B 3OF6A 4JKPL 2R8SL 4HIIB 1BF8A 1BBDL 3QIBB 1Q94B 2VUOA 3BAEH 4GS7B 4ODTH 4O02L 3VFSA 3PDGA 5HHVH 4BQ9A 4FQLH 4FFZH 4PJHF 4PRBA 4AL8L 4FQCL 4PY8I 2C7UA 3STBA 1RHHA 1E6OL 4RFNB 5FCUH 1FSKB 5C0ND 3KPRA 4G6AC 1FZKB 3K3QA 4CGTA 4HIHB 1IZKA 3AFLA 5I1KL 2EICA 2IBBA 1EMTL 3CPLA 2CIKB 1Q9KB 3LQAL 3ZDZE 1MCBA 3QDMD 1S9YB 5I66A 2D31A 4X6CA 1NBVL 3P0YL 1NCAH 2E8YA 3KDMB 3QG6A 4P46D 4XB8A 2AJVH 4XPTL 2OQJB 3MXWH 4MA3B 4YPGA 4S0TD 2HT3D 2LABA 1FE8L 1P7QD 4JHZA 4YO0B 1EUTA 4IRZL 1V3MA 3SDXE 1C5CL 4R4ND 5E00A 3R0MA 3ZHLA 1NQBA 1XEDA 4NM8H 1DBJL 1AGDA 2QSQA 1IGTA 3ZYIA 3EZJB 1ZA3B 2OJZL 3CLFH 3ES6B 4YFEA 2QSVA 1DBAH 5FO8A 3TFKC 2P5ED 3JV5A 4TUOA 4LPVA 4JAMA 1NCNA 3AROA 3HE7C 3KVQA 4L4JA 2VIRA 1DL7H 2DLGA 3JXAA 3F7VB 5IBUB 4QEGA 2F53B 5SX4I 4KKBD 2B4CL 1DQLH 4OLZH 1G7MB 4XMPL 3WFCL 5ID0A 3V9FA 4DCQB 1XMWA 2BMKA 4R0LA 4NC2B 3CMOL 8FABB 5SWZD 2DD8H 43C9A 3JV6B 4PGDA 3IKCB 2A1WH 4LCIH 1J1XL 2G5RA 1I1AC 4B50A 1A3LL 4U6YB 4N0YL 4ZPVB 4QXWA 3UTTB 3LPWA 2Z8VC 5HI3D 3W5NA 1EEQA 3IFNH 3SDCC 3GSQB 4GBXC 4NM4H 1TZIA 1VFOA 3D39D 3GKWL 2VRAA 4YH6A 3GMOB 1WFOA 1AFVH 2BXYA 5E8OB 3RVVC 3QRGH 1S8DB 3HI5L 5DURB 3IFPB 1CXEA 3G04B 4QHMB 5CJ8A 5IUSA 2O5XL 5EUOB 4PJ5B 4ZTOL 1BECA 3D5OF 3T3PE 1QSEA 1MIEH 3O6MH 1I75A 1NC2D 4YR6A 3QP3A 4BQ6A 5BRZE 1Z0MA 4YPJA 1OTSC 2P7TA 3RNQB 4ETQA 3ZSSA 5C9JA 1QZ1A 1Q72H 2AEIT 1CXLA 3BEWA 4PBVC 4UUJA 5C2BL 4O2FA 1A5FH 2FJHB 1SEBB 4JM2D 4WHTA 3VXPA 5DI8A 1K5NB 3IAQA 1K2DA 5GGRB 2PNDA 5I1EH 5DJAB 1T0NB 3S36H 3DMMB 5ITBL 3OKMA 1UCTA 5GRYA 4LRNH 4O58H 1KJ3L 2W0PA 4JGJA 3GM8A 2ZOLA 5KJRH 5JXAH 3BRDA 4GSDH 2FX8L 1ETZA 3IAPA 3VD7A 3ZKXB 1FVEA 4PJ7F 1JZ5A 1D7FA 2DI9A 4Z7VF 4QTHA 1CICC 4HPOH 4PP1C 5BV7B 1TJGH 1UA6H 1YNKL 3L95B 2NY1C 1IILE 1FBIH 2ARWA 5KSAD 1KB9J 1SQ2N 1Z9SA 1FFOA 1BQHG 1WAAA 4KTEL 4PJAE 1FN4A 3MUHL 1RZ7L 4KKAC 1X7QA 4LVHC 4U6HB 5MEQA 1TCMA 1BFVH 3QFJE 4GAJH 3THMH 1S7QB 1J0YA 1H9VA 1LEKB 4YUEL 4O00A 3QEHA 3RVUC 3QAZC 1MFAL 2XXMB 1BBDH 1F13A 5F3HA 3BPCB 3PNWB 2H32A 4P3DB 4O02H 1BZ7A 2AABL 2YUVA 3BXNB 4AL8H 3LH2L 4FQCH 4LBEB 1U8JA 2Z0BA 2C4FT 3MMEB 4LF3A 1A1OB 4U6VL 4LCWB 1E6OH 4YGAB 4YWGL 1JZ3A 5JHDD 5IK3A 4M7KL 4G6ML 1X6NA 5I1KH 1G7LB 2CLZB 1EMTH 4XPAL 3RGVB 3MUZ1 3LQAH 2NTSP 2CLRB 3C87A 2I60L 4F2MA 3L3HA 1NBVH 4P0DA 4TTGA 3SDYH 4XPTH 4XNMB 3UPAA 5I71B 4X6BA 3UPRB 4PJEA 5FUCC 5KOVC 2PO6D 3ZHDA 4OCWL 1T1YA 1TXKA 4C56A 3UYRL 4POZD 4UMGA 2X4SB 4HDIB 4NKMB 2X4PB 4BQCA 5C6PB 5HYJB 1I1FB 3VFMB 1C5CH 4OD2A 4F33A 3ILPA 1DBJH 1HXYA 1G6RL 1WWAX 5B4MD 4WHYH 5BW7A 2OJZH 3MRJA 3F7YB 2JIXB 2V2TA 2I27N 2Z92B 2Z8RA 3ZKND 5CCKL 4WO4B 4OZGE 5DMKB 4F80A 1EIBA 2JB5L 5ICXA 5DTFB 3OR6B 4EUPA 3HNSL 1WZLA 2COQA 3DUUA 3I6GA 2HMID 1RUQH 4F7EB 3C6LC 1QPXA 1EV2E 2B4CH 2OL3A 3FFCB 3ZE1F 1FIGL 5GGRY 3WFCH 1I8LA 3ARDD 5DMJB 3VXSB 5D1ZD 5D2NB 2JCCE 3VXMB 3JWOC 1PKQE 2APFA 3HUJA 3HI6L 2VLRA 3B9KA 1X6LA 1BOGB 1J1XH 3KYAA 3MYJA 4P2CG 4TPRL 1N5AB 4Y88A 2X89D 3HCVA 5EZIL 3B2VH 3LKNA 3J8F7 1EBPA 3CFEA 4U1KA 2RQ8A 4QF1B 3L6FB 3C2AL 4HSQA 3GKWH 4OAWB 1RVFL 1A47A 1IL1A 1L0YA 3HI5H 3ZKQD 2OTWB 2UYLA 1X5ZA 1ZVHA 4NQEB 1UJTA 4ZTOH 2DL2A 2EZ0D 5ICZA 5DJ2A 1BIIB 4F3FA 4K07A 5FM4A 3O3BB 1G9NH 4N9GA 4MJIB 2EH8L 3ARFB 4X4YB 3Q5YA 4MDJA 3MR9A 1W2KT 1CF8L 4K3HA 3OKOB 5ITBH 2EYRB 3TVMC 1KJ3H 3JV4A 3KLAB 3NIDF 4FQ2L 4ZUSB 2PKDA 5A3IC 5M7QA 1MCRA 3ULVE 2FX8H 4KKNA 4PGEA 4YDJA 3GMPA 1W72L 4UTAL 3UAJC 1EEZA 3P30L 3KPPB 1H15B 1YNKH 5C0DB 4OFYA 1XF3B 3FRPA 5CKGA 4EDWL 3FB6B 4L4TA 1TITA 2F19L 2GSIA 4KTEH 1RZ7H 5EB9A 4L8SA 1WIPA 5DHVA 1WZMA 5IESL 4HJGB 3BIKB 3NBNA 3TA3A 1OP5K 2J8UE 2Y7QB 5KW9H 4P2RA 1QNZL 4YUEH 3REVA 3LRHA 1EXUA 1ZLWH 4HK3N 1MFAH 5E8DH 3REWB 4I0KA 1DQTA 3KPMA 1CZ8L 1T1WB 3RWEA 2PXYC 3T0XA 5CEZE 2AABH 3LH2H 3BT2L 2HG5B 3BO8B 4FFYL 3BDBA 3VGFA 4FTVA 3GBMH 4YWGH 1T7XA 3D25B 4M7KH 1T83C 4G6MH 4WGVB 1WITA 5TGBB 1X3DA 2GJ6A 3GSRA 4G7VL 4ODHL 2MHAB 1U8QB 2I60H 4JZNB 1T6VN 4ODSL 4Z7OF 4H20L 5IJKA 1OAYL 3VFPA 4YFLF 4P2YA 3VA2C 4PUBL 3RNKB 1B4JL 4GKZA 4OCWH 4OFVA 3V6OC 4M9OA 4PJHE 3UYRH 1P4BH 4KJPC 4KVNL 1HWHB 4BFIA 1BD2E 3QDJA 4KTDL 3R06B 4HWBA 4JFFA 2B1HL 4AEEA 5HYEA 3MRLA 4U1SA 5IW6B 5J4MA 1CBVH 1G6RH 2PYEE 3PGDB 5DEFB 3RZCA 4K7FA 1DQQB 1F11A 1MJ8L 1H8NA 4C83B 4MB5A 1W0WB 4BELD 1U3HD 5CCKH 3TIEB 2JB5H 3GEWB 5A16B 3UXFA 4JGMA 1OW0A 2OJEA 1QRKA 4LU5H 3U79A 3HNSH 3W2DH 2GSGB 5BVPH 2Z8SA 5ISZD 4JG0L 3FQUB 1RZGA 1ZVSA 1RZJL 4I0PC 1QYGL 3MV7B 1DLHA 1FIGH 5JW5B 4QXTB 4KUZL 3DYPA 1B6UA 3RWDB 3CX5J 1LDPL 3VDBA 3T77B 3EJJX 4EOWL 3HI6H 4KI5E 3T0EE 5JXEA 4QRPA 2Z4QA 3GSUA 1AIFB 1RPQA 4R7DB 1A6VL 4TPRH 3DV6B 1RZKL 5A2IH 3NFNB 2PW1A 4OLUL 3ZT7A 5EZIH 5DJ8B 1B0GB 1PG7X 2NXZD 3P73B 4GMSL 1OQXA 2EDEA 5E5UB 3C2AH 4Y5YB 3VXUD 3OPZH 3FCTA 2BSED 1KNOB 2CKBL 2AGJL 3BPOC 3NPSC 4OFKA 1OM3L 2GTWA 4KDWA 2QQQA 2DL9A 3QUXC 2IH3B 4EVNA 1IGIH 4GW1A 4Q2ZB 3OKNA 2ERJC 2AERT 3FJTA 1HSAB 1F6FB 1RZ8B 4OCNC 2E7MA 2X9XA 3P3YA 2EH8H 3HRZA 4F8TA 1VPOL 3KPOB 3NFSH 4LHUB 1N59A 1CF8H 1GGYA 4HWZB 1U3JA 5I1HH 3MRKB 4MXQD 1I1RA 4XXCC 4HPYL 4P4KB 4X5WA 4E0RB 4KJWD 3GO1H 5DEGB 4OZFA 4UT7H 4FQ2H 4S10A 3MACH 5E8EB 1OAKL 5FDWA 3RDTA 1KTKE 2F15A 1II4E 3BKML 1GOGA 4W68A 4PJBB 4UTAH 4GRWB 5HHME 3P30H 4NPYB 5HGAA 3OF6D 1CFTB 3PWNA 3HG1E 4DZBA 1PYWB 1FDLL 5ELIA 1NLBH 3RVWD 4EDWH 2F74A 5CEYA 2VXSL 3UO1L 3KJ6L 2F19H 1KJ2A 4HK3J 5CSBA 3AY4C 1BAFL 1KLGA 3QNXA 4NBYB 4AZ8A 5IFAL 5IESH 4MA8L 5EIQA 4NWTL 1T04A 4X7SL 3V2AR 1JN6A 3NH7L 4N0UE 4X9IA 4TTDC 3QHFH 5L2KE 1X44A 2NNAB 1QNZH 3MCKB 2QQKH 4I4WA 1JWMB 3D3VA 3O4OB 4PJ7E 1A7PL 4Z7VE 3WFEL 1HH6A 1CZ8H 3G5YB 4IS6A 2I9TA 5KSBF 3QQ3A 2J8OA 4HAGA 3BT2H 5AZ2L 5JMOC 4FFYH 1WLHA 2DB8A 4BUHA 1RIVL 1T7YA 4K9EL 5AZEL 1J05B 3OKEA 3MOBH 4N1EA 1T66C 1FGVL 3WN5C 4G7VH 3O0RL 1Z9MA 1JGVL 3QJFB 4ODSH 2YPLB 3ALWA 1NKOA 4H20H 4U1IA 1UXSB 3MV9A 1OAYH 5C09E 3EO9L 3KPSE 2BVQB 1K4DA 4XNQA 4PUBH 5EBMB 5HHXL 1B4JH 5ID1B 5IHZA 4KVNH 4RIRA 3P9MB 4AK1A 4ZXBB 5DMGD 3VFTB 2B1HH 3TV3L 1H3PL 4RMUA 2FBJL 2NQCA 1RSFA 3MBEC 4KUCD 2L7JA 5DD0H 3QHTC 2HVKB 2G5BA 3SQOL 1DZBA 4I0CC 2GUOA 4LOUC 1MJ8H 5EPMA 1CE6A 1AO7B 5LAXA 2H9GA 5CSZB 3KXFB 4DOHE 1G7JA 3HZYA 2FYYB 1ADQL 1QOKA 2ICEA 5F9WC 3LQMA 4RCAA 3FOMB 1A7OL 3CDGB 3E0GA 2B2XL 4O2CB 5F7HA 4RGND 5JUEL 4PJIF 1QYGH 3HE6C 3MNWB 1S7TB 5DQJA 5DD1H 4KUZH 2VN7A 3S37X 2YPKB 5HYFA 4U1LB 3L3KB 5EC1A 1LDPH 4KGLA 3IXAB 5GIRA 5J1AB 2F8VA 2XA8L 3P2TA 1ZHLA 4NQXB 4DGIL 5MEPA 2YXFA 1YYML 3HHRB 1C7SA 4U1MA 1RZKH 4PLJD 4L5FL 1WCBA 1QSED 3FB8B 4OLUH 4RFEA 4GMSH 2Z9TA 5FGBA 2XZZA 2NY4B 2A38A 5IVXF 3MRMA 5EOCL 5L2JA 2DQIL 3ALXA 2NX5A 3GSNL 3ZE1E 1NAMB 5FO9B 4ZUTA 1QO3A 4B5EA 1OQOA 2CKBH 2QTEA 3IDXH 1S78C 1DUYA 1FG2B 1NGPL 4FXGA 3QPQD 4KHTH 3C09B 1BQLL 4NC1E 5HYQB 4F7TB 4DZ8A 1DCLA 1XIWC 4Y5XC 3IXTA 3NCCB 3QUYC 4IMKC 4YHNB 3BP5B 1YEJL 3CIQA 1J5OL 4LMQI 4HCRL 4R6UA 3MLTB 1EFXA 1MCNA 1EVTC 3BMWA 1A7QL 3SY0A 2IBZY 4DGYL 2AK4B 1VPOH 1OHQA 4JFZH 3BH8B 1B0WA 1EJ6A 5C07B 4PGBA 3VFRA 5F7LB 3P77A 1QVOA 4HPYH 4Y7MA 4CJ1A 1MI5A 3LRSB 3PWPB 1OAKH 1QA9B 5CZXC 3LAFA 3BKMH 1KTLB 2GY7B 5KVEL 1I7ZB 1VB9A 5DJZB 4JANB 4QRSA 3QWOB 4OFIA 1AY1L 1OP3H 2D9CA 2YWYA 3DVNA 1FDLH 4IJ3B 1XFPA 1JGDB 2EEAA 2YD9A 2VXSH 4U1HA 4YHZH 3UO1H 1YN7A 2Y5TB 1BAFH 3EDJA 5EU3B 5IFAH 4MA8H 3TIDA 4NWTH 1KJVB 4X7SH 2W60B 2GIYA 1OP3K 4G8FB 4URTB 4PGCA 1MCFA 3TM6A 1JZ4A 3DBXB 4RGOL 3UYPA 4NCDA 5ABDE 1JV5B 3WLBB 3WFEH 4RMVA 3BUYB 3LPGA 4XBGB 2BSRA 4R26L 1U6AL 3CDCA 2CR3A 3C5ZC 5LWYL 1ZGLP 3DX9B 5I9QC 2NY0C 4NNYA 2IC2A 3IJSA 5AZ2H 3B5GA 5GS1A 4BK5A 2IANB 5F88A 4OIIH 4C56D 3HMWH 5AZEH 1VFBA 2XNAA 1U92A 4FFWC 3M45A 1HOCA 4UIKH 4IHOA 1FGVH 3L7FB 3DRQA 1V3LA 4LNVA 3ZTJG 1KYOK 5T1MA 3O0RH 3EYQC 1CD1A 5FGCE 3MGAA 1JGVH 2DQEL 2CO6B 2HT2C 4JY6A 1QFWM 3LRGA 3SPVA 3VFUB 2EDRA 4DK6A 1DP0A 3EO9H 2P8PA 5GGSB 1W0VA 2AJUL 4HUWB 1TIUA 5CINL 2DQCL 1P6AB 1MHHA 35C8L 1BJ1J 3TV3H 1TTUA 3T0DA 2FBJH 2FL5B 2BNUB 3HE7B 3SQOH 5I19L 3S6CA 2VZ3A 3TJEH 3CMGA 3GGWA 2YN5A 3DURB 3KHOA 4U1NA 3HLAB 4Z7OE 5HHOA 2C9AA 3P4NA 5JZ7C 1ADQH 3FQRA 3LKOA 4P23C 5ESQA 3MRQB 3U0TB 1FZJB 2VLRD 1T3FA 2YA2A 3CJJA 4X4MA 5I17B 3B9KD 3ULVC 1J9CT 1U9KA 5DVKA 4QLRA 2B2XH 1E27A 1C16B 1EGJL 1HZHL 2VJXA 1H3UA 3S5LB 1F02I 1I1AB 5EBLA 1Y0LB 3VG0L 5D72L 5KG9A 2XA8H 4DGIH 4RFOH 1XZ0B 1HHHB 1YYMH 2VDPL 3SDCB 4EBQL 4GBXB 3RHWK 1FNSL 4OM1L 3WKML 4L5FH 2X4TA 3ARGC 3E1F1 2Q20A 2IBGA 2FECI 2BSSA 2VQ1A 3L3JB 4WI2A 4TVPL 4ZUVA 5HSFA 5I1JL 1A4KA 4KTYA 1NGQL 2DQIH 5E08L 3GSNH 2WBJC 3IRZA 4OB5L 3H2WA 4LNRB 4NHUB 4JG1L 3DPBA 4MJ6B 4UU9B 5CEXA 1NGPH 2YA1A 4QRRA 1ZA6B 2YRLA 1BQLH 3TVMA 2R2HB 4ODXA 1Q8MA 4RX4A 3BRGC 4BFBD 2P5WE 5LGKA 3D18B 5HDQL 4KZEL 4W6YB 1M7DA 1J5OH 4HCRH 4YHPB 2BNQE 2NY5C 1A7QH 5E5RB 4DGYH 1AXSB 3BWAA 1CDCA 3IU3A 3FT2B 1A6ZA 4OFYD 2HKFL 5F89A 1H3GA 5J6HA 4L4TD 4JCLA 1DEDA 2NZ9D 1MOEA 1S3KL 3ECBB 1EHLL 4P2QA 4JM2B 5KS9B 1CDHA 2Q87A 3O9WC 2NY1B 5HPMA 1FV1A 3O3EA 2ADFL 5KVEH 3HI1B 4P2RD 1AY1H 4LVHB 4GRMB 3QO0B 2DIBA 4TNWK 2WINA 1FRGL 3EIFA 2BSTB 2PXYA 3PWUB 4R2GD 4NRYB 1A7RH 1KN2L 1EVUA 5IW1B 5BXFA 4UDUB 3ZSTA 2B7DT 3QAZB 1G7PB 3CVIL 4FTVD 4XBEL 3SGEH 2UZIH 1VESA 1MWAB 2JLLA 2XACC 1O5DT 4RGOH 1NFDB 5L8LB 3CFBA 4H8WC 1DE4A 2GJ6D 4HGMA 4R26H 3FTGA 1J18A 1U6AH 5LWYH 1JK8B 4KI5C 3T0EC 5L88H 4X99B 1S7RA 3ZKMD 3UX9B 3I75A 5IR1B 3V6OA 1GC1L 4D9LL 4YHKL 5J6GA 1XH3B 3QXAB 1XR8A 4DVRL 5DO2C 3QDJD 4JFFD 5FUOL 5IMMB 3VCLB 5C0BE 1VA9A 3RVTC 2DQEH 3WYRA 1UG9A 2EYTB 2ZP0T 1YDPB 1F3JB 3SGDH 4GMTL 4WDIB 1VFAB 2CDEA 3R4DA 5IMOB 3UROR 2AJUH 5F3BA 5CINH 3BD3A 1HYRC 2DQCH 4NDMB 2V2XA 35C8H 4M6ML 5T3ZL 1F5WA 3HS0B 3SDAC 2O61A 4I0PA 3H3BC 2X4OA 3DUHA 5I19H 4M7LL 4RWHA 1F3RB 4KK9C 5IHLB 1FVCA 1UM5L 1RUAL 3BGFC 3PIQA 3GI8L 2NY6C 3C6LB 2VAAB 1FH5H 1QSFE 3MRCA 4J3SA 4PJCB 4JREC 1RIUH 3L1OL 3VDAA 4QRPD 3IDUA 4P5TA 2DWEB 1KUMA 2GCYB 2V17L 1MFDL 1U95B 1P7KA 3ULSB 4QY8B 3CZJA 1EGJH 1HZHH 3FO2A 3Q48A 3BW9A 3MGTA 4W70A 4NQVA 3VG0H 5D72H 1EERB 4NZRL 1AGCB 3WFBL 4LKXA 4D9RD 2UZXB 2GHWB 3IDYC 2VDPH 1WBYA 2JJVA 4EBQH 5IFJA 3EYUL 1FNSH 4OM1H 3K0WA 3WKMH 5D9SA 3BJLA 4OSUL 4NO5A 1MLBA 2RHEA 5CIPH 3S4SA 4TVPH 1KLUA 5E2WL 1NGQH 1BZ9B 5E08H 4PJIE 4GRLA 4OB5H 3ELAT 3C6SA 3OGCA 2EIBA 3QPXL 4JG1H 5B3NA 2QSTA 1E4KC 4L3EA 1I8MA 3LD8B 3IFOB 3IGAB 4XXCA 1B2WL 3MRDA 4M1CC 2X70B 4P57B 5DSCB 3VFGL 2XWTB 2VOTA 3P9WB 5HDQH 4KZEH 1J87A 5FO7B 4MQXD 3RDTD 3PQYA 3QUMB 3AREA 1I3GL 1QTYT 1OD7A 3FT3B 2Z8WC 5IVXE 3S36X 4L3CA 1I8KB 4GO6B 4LEOA 1NKRA 4HX1A 2HKFH 5DS8B 4HULB 3GSVB 2ZPKL 5HHNA 1KELL 1S3KH 2ZNXA 1EHLH 2WUBL 4CBPA 1HHJB 4PD4K 5H37H 4NSKA 2VB5A 5SX4H 1BVZA 1AE6L 3QCTH 4GKOA 4LGSB 1KIQB 1ZOXA 3CC5B 3OX8A 2H3NA 3D3VD 1FFPB 4PJDB 4DFHA 1FRGH 4J4PC 4YHIA 3QXWA 2R39A 5GS0L 2NXYC 2XN9B 5IEKB 3BYYA 2Q6WB 1KN2H 3DWTA 1V7NH 4F15C 5CSGA 4PB9H 2UY7A 2X7LA 1SEQL 5CZVL 3CVIH 5J3HD 2NCMA 4ZSOB 4XBEH 2Y9RT 4JFEB 5E56A 3MCLL 3WN5A 3Q6FA 5JPMB 2BP3A 2EH7L 2CPCA 4XCEB 3QUZC 2QR0A 3NCFB 5ETUB 2X40A 3WS3B 1JL8A 1CD9B 1F42A 4I9WD 1BQHB 5J06A 1OAZL 1N8ZB 3DVFA 3BEVB 1GC1H 4YHKH 4NGHL 2FIKA 4DVRH 2ESVB 1U8HB 5FUOH 1ZLUK 3ARBC 3GFUA 5IM7B 5KSVA 5FECB 3LDBC 5C0FA 3RKDD 4R3SB 2G75A 1YMME 3DO7A 2A73B 4N1HB 4ZAKA 3VXRD 1MCDA 5ERWB 4LAQH 4GMTH 4PYHA 5LBSL 5E2VL 4NC1C 4K23H 2OCFD 5I1AB 1R3LB 3FN9A 3OG6B 3MREB 4I18A 1D6VL 2AXJA 4LKCA 4CVXA 1HHKA 5IP4A 4M6MH 5T3ZH 3NA4A 5HY9B 2DF3A 3CUPA 1ZT7B 1J10A 2Y23A 4M7LH 5MEOA 1FL5A 5SWSD 4JM4L 4GUPB 3UTPE 4MGXA 3I2CL 1BEYL 1GZPA 2HTLD 4UZGA 1UM5H 1FG9C 2E9JA 1IAOB 4OF8A 5EIIA 3GI8H 3BD5A 1MHEB 2X6MA 2ZKHL 4XNZC 3DXAE 1FJ1A 4FQHA 1T21A 3P0VL 5BO1H 1UEYA 3OB8A 5CJXA 3MRIA 2V6HA 1ONQB 2V17H 1MFDH 1ACZA 4N8VA 4YXLL 1FC1A 2A9MH 4V2CB 3K1DA 5JORA 3HZMB 1OTSD 4N8CL 4KHXL 5F72S 3IDIB 4HK0B 1B6DA 4KMQA 3QSKB 1NC4B 2NX5D 3FHQA 4I5BA 5ESVB 3IJHA 5C0EB 4P5KA 5DWUL 3WFBH 3WS6C 5DGQA 4JLRB 3D0LB 3EYUH 4MD5B 1Q9LA 4ZUWA 3JWDC 1MJJB 4OSUH 5HVGB 1JPGB 3BPOB 3NPSB 4ZS7L 4OJFL 2V5TA 3DGGB 3OTTA 1OSZB 5GRWA 3QUXB 5E2WH 4GAYB 1FCGA 1EFXD 4PJFF 2YBRA 2ERJB 1VERA 3LV3A 1UQSB 2CMRL 3DVGA 3DO3A 4DUWA 3PG2A 1B2WH 5FF6B 1MREL 3PL6C 4OZ4A 5JW3H 1G6VK 2PCPA 3N9GH 1FYTD 1MI5D 4HUXA 1H5BA 4L8BA 5FV1L 3SDDC 3TZVC 4U49A 2D7PA 3RWGA 3O6FA 1I3GH 3PJSA 3RVXD 3LQAC 4LCYB 4U1GC 3SDXB 3JVGA 3T1FA 4B53A 2CDGB 1W8NA 4I2XE 2ZPKH 1KELH 5GGTL 4HT1H 4L9DA 3WFHB 5HYSA 2DIAA 4Z7WA 3S98A 1AE6H 3PWVA 1UXWA 3AUVA 1JGEB 3LKQA 1S9WA 3PABB 5E6IC 3WJLC 4NQDE 1Z3GL 2XZQL 4NOFA 3C5ZA 5GS0H 1IGJB 2A9NL 1ADQA 5AYUL 1U8NA 3FQNB 2X4NB 4MQ7A 2VYRE 3SJVA 3HAEH 1RQ5A 3BP7A 1SEQH 1VHPA 4Q6YA 3NCBB 1G1CA 4R96B 3RUGE 4P3CH 5EU5A 3MCLH 1JZ6A 3AGVA 4U1JA 4J3XA 2EH7H 3DRTB 4BUGA 3B9AA 3DV4B 4U6TA 1TVHA 3NTCL 4G80B 1A9BB 4LSVH 1EJOL 3TBTB 4JRWA 1M7IB 5HI4C 5T33L 1MCLA 3ZLQC 3TGXA 4AG4L 3FKUS 4MHHG 3WHXA 4WHCA 2VQTA 1FO0L 5GISL 3K8KA 1HYSD 1U91A 3BZFA 5BRZB 4LLYB 2UWEA 5LBSH 4JQVC 5E2VH 4A6YL 4G42B 4WW1B 3GJEA 4BZ1L 1FL6B 3MBEB 1NAKL 2EDDA 3QJHB 3TNMA 1D6VH 1OTUC 1QHPA 1Z6JT 3T0VA 4MD0A 3H8NA 5JOPE 2B1AH 5EOTA 2OSLA 4HS8L 3AU1A 3M8OL 1CXIA 2BCKA 5GGUA 2VH5L 1ZSDB 3QXVA 5E8NB 1IAMA 1AGEB 4JM4H 1LNUA 3I2CH 1BEYH 1PY4A 4KK6D 3NGBC 2A74A 2IMNA 4HQQL 4HKBB 5IVZB 5C3TA 3P0VH 3VA6A 3HE6B 3VWJC 1UH4A 4O2EA 2QKIA 4CJ0A 1T1XB 4Y89A 1LMKA 2Q7YB 1GOFA 1QBBA 4AEIL 5A40E 3ARGA 3WLWC 4J7RA 2DQTL 4DUVA 1T22A 3L3OB 4PJAB 1T5XA 4X8JB 4KHXH 3QFJB 2GFBB 3ZYZA 1GGUA 5DVLA 4PG2C 5DWUH 4PRPD 5I8KL 2ATKB 4NKOB 3MRHB 1KEGL 1SYSA 3RI5K 4GQ9L 3JUZA 3WHE1 3P9LB 2DM3A 2ITCA 5T3XL 2RAMA 3LB6D 3MJ8B 4D8PA 3PHOB 3C8KA 3D0VA 4ZS7H 5J9PB 5J12C 4TSCL 4BH7A 1ZWIA 2R2CA 1QBML 5IW3A 3VXTA 1UACL 1XIWB 4Y5XB 3QUYB 3STLB 2CMRH 2R9HC 2ENSA 4RAVB 4TUJB 3G6JB 2AJZA 5KVDL 1SBSH 3PP3K 4NC0B 1KPRA 2XT1B 5FUZL 5JO5B 1MREH 1Y18B 5C9JB 1WFUA 4P2QD 5D7IF 4HEPG 3UBXG 3WDIA 1OGAA 4QRTA 2FR4B 1A6WH 1JGLL 3M1BA 3O6KL 4X4XA 5CJQH 1W8OA 1U41A 3L5HA 4HF5L 1ORQB 4H5SB 1V3JA 1GZQA 1PQZB 1XT5A 4L3AA 1SVCP 4PRIE 8CGTA 5C0GB 4OLXH 2IH1A 2M26A 5BZDA 1U93B 3MA9L 5GXBB 5B39G 3Q5TA 4NKDA 5C0CA 3GMLB 3I02B 4M7JL 2XZQH 1XF2A 4U6XA 1X5YA 5I18L 4LL9A 2A9NH 5MENE 2FHFA 5IROA 3MFGB 2VITA 3SO5A 4N0FA 1JUFA 2JCCB 5CD5D 5CWSA 4JFXB 4XAWH 2G60L 4KJPD 1IM3A 1LD9A 5JDSA 1PKQB 1FLRH 3RA7L 4C4KO 5I9QB 2DTSA 3BKJL 3MROB 4NYLA 4WWID 2LU7A 3X3GL 5ESAA 3MLVL 1KIUA 1RK0B 3FO1A 5E4IA 5H2BA 3OHXA 3EO0A 4J3TA 1NUNB 1IKFL 3NTCH 1EJOH 3V6FB 4LLUA 5T33H 4J3UA 5BVJA 5HHQA 1ED3A 2YOCA 3LZFH 2I07B 2OTPA 2VDOL 3AM8C 4AG4H 5MI0C 4HXAL 1OAUL 1BVLA 5CIPA 3DTXB 4WFGE 3SDAA 2QSCL 1KB9K 1UM6L 1FO0H 2DICA 4I0PD 1NBYA 1OT2A 1SJHB 2X4RA 5GISH 3EAKA 4Q74A 4JRXA 4PJXA 1GYAA 3MNVB 1T1YB 4C56B 3MV11 4Y19E 4A6YH 2XFXA 5ECJE 1NAKH 3GB7B 4X7TA 1IEAB 2HFEB 5DJYB 4P5TD 4DK3A 1KB5L 3TLRA 4HS8H 4DGVL 2DS4A 5ALBL 1EHAA 2BDNL 2CDFA 3M8OH 4M4RA 2VDNL 3TYGL 3HG1A 4P23B 5FM5M 2J5LC 2WLYA 2VLJE 4Y16C 5AG9A 1E28B 3OXRA 4J6RL 4BZYA 2CXKA 1X4XA 4MNGA 3O81A 4EIZC 4G8EA 3BX7C 1CFNA 1JIBA 3BZEA 2GJZA 1KT2A 4W4OC 1PY9A 1N2RA 3QQ4B 2DQTH 4EI5C 3HZVA 2PW2A 5EBWA 1U8IA 2ZCHL 1XR9B 3MRPB 5EUKA 4CVUA 3HFML 5J89A 2J8UB 3EYOB 4GRLD 4GXVL 1MAMH 4FQPA 3RTQD 1XF4A 5I8KH 4TRPL 5IOPB 3IF1A 1E4KA 1CK0H 4GQ9H 5D8JL 4L3ED 3V6ZA 4J3WA 3LKNB 5T3XH 3CVHL 4MA1C 2WBJB 1IBGL 1MF2L 1K4CB 2VZSA 1YMMD 4TSCH 2GTZB 1T20A 2C4FU 5BMFL 1QBMH 3PQYD 2BVOB 4UQ2A 3ARED 4TVPE 1UACH 2XPGA 1YEKL 3KPSA 1FNHA 4Z0XA 4YBHA 4XNXL 3QI9B 3H9ZA 3T08A 1YMHA 2WIIA 5KVDH 4NO2A 1PX3A 4HHAA 5DJ2B 1SYVA 4X6DA 3RWIB 2BVPA 1J8HA 1IT9L 5E24E 1DVFC 5D7LE 2E7LA 4KKCD 1JGLH 3AMKA 3WEXB 3EJYC 4FFVD 4TTDD 4WNQA 3LKRB 2BNRA 5I1GL 2ADGA 4WW2C 2B39A 4PJHB 3O6KH 4RA3A 4DN3L 1BD2B 3FRUA 4IOFD 4J4PA 5TDOA 3ZL4L 4PJFE 3O9WB 4HF5H 1OOAA 2PYEB 3FL7A 2EXYD 3HC4H 1PLGL 4ENEC 1CVRA 1LEGB 4YDJB 1HH9B 2PYFA 4TYUA 4TN9A 4BSVB 2O5ZL 3KPNA 3F7QA 2YC1B 3MA9H 4ZOBA 3OAZK 2YR3A 2F53E 1IZJA 4LLDA 4OZIA 2BVTA 3V0VA 4M7JH 5C3LD 4YFDB 1IM9A 3MLPA 1DBML 5DA0B 3WFZA 5DJ0A 5I18H 1A9EA 3SKMA 3ARRA 5ICYA 3GSWA 5T1KA 2NY3D 1UB6A 3K4ZA 2G60H 2FECL 1BLNB 3T0EB 3T04D 1WV7T 4R2GB 3GZKA 3UTTE 3BKJH 5IEHA 3ARBA 3OKLB 1JWSA 1RZJC 1KCSL 3PWLA 3X3GH 2O93L 2F54A 3MLVH 3QXDA 4ZAKD 4KDTC 5EC2A 1IKFH 4M02A 5FHAH 2R4SL 3QQ9D 4HAFA 4QHKJ 5T1DL 4R97C 1X5AA 4X98B 5I15H 4WEBL 1OAUH 1IGYA 2PTTB 3BDXA 1RZKC 3ROOA 5FKPB 3L3DB 1M4KA 1UM6H 3DX7B 1I7TA 3P4MA 2ZSWB 3DYMA 3MLZL 2HJFA 1R24B 3CU7A 5JIHA 3UTSD 1T03L 5DJDB 1T7WA 5CFHA 3O8XC 2E6JA 3EOAA 2RFXA 1ACYL 3W11C 3KYKL 4YBQD 4PBXA 4MSWA 3KG5A 1KB5H 3BGFB 1JPFA 5ALBH 3KWWA 2NY6B 2BDNH 4DGVH 3V4VL 2VDNH 3TYGH 4U05A 3TN0C 5T3ZE 4JREB 1S9XB 4WFFE 1CGWA 2OJEB 4JKKA 4J6RH 5I2IA 2R56L 1I1YB 2W0FA 4OKVB 1P4LB 2WV3A 2FJFA 5HHMB 4Q97A 4AIZA 5DZNA 2XKNA 1G9ML 5E94A 4HUUA 4R4BB 3AS1A 1P1ZB 4YXKL 1WWCA 1X5JA 1D5XB 4XMLL 1NGWA 4JN2B 3IDYB 4CW1A 1UWXH 2C3VB 2ZCHH 4NO0B 3IDMA 2W92A 3L7EB 5DA4A 3HFMH 1FNAA 3OWEA 3FB7A 4GXVH 4N0UB 5CLTA 2AEQL 2P46B 4D0CA 4TRPH 1CGSL 1K8IB 4ZMAT 1I4FA 1QRNA 5D8JH 4PJ7B 2L7UA 3QNZB 1YJDL 2C1OA 3HAEA 2QQNH 4Z7VB 5EH1A 4O51B 5I1DA 4C4KT 3CVHH 1ZHNA 4BH8B 2AV1A 4G9FA 1IBGH 3ZDYF 4ELMA 5AWNL 2OTUB 1MF2H 3P0GB 3SKOB 2R0WL 5LG1A 1WZKA 4MNQE 4YDKL 3PXHA 5I74C 5TF1H 5BMFH 3EOBA 3QIWA 3O6FD 3RL2A 1R6VA 5CGYC 3OB0H 4XNXH 3GMMB 3EYVA 1QLEL 5MERB 4X6FA 5CMAA 2DOCA 3W0WE 4IRJC 4V1DE 1S9VB 5IB4A 1EAPA 5C09B 5EA0L 3LEYL 1OB1A 4K9EC 2EKSA 3CX5K 2DAVA 3PV6A 3LSOB 4XXDB 5HYJE 4HBCL 5I1GH 4EIGB 3PGFL 1KIPA 4K8RD 2R1XB 3WUWA 3WJLA 3ZL4H 4LLWB 3ZZ1A 1WBXB 5GSVA 3FB5B 3A0OA 2P42B 3SCMA 2IG2L 3PHQA 5B21A 2QHRH 4JKWA 4HEME 2MFNA 3SJVD 1MHPL 2Y06L 2FEDC 4DOHB 2O5ZH 3RRQA 4LQFL 4BFGA 3MLWL 3FFCE 1X5KA 2HLFC 4Y2DA 4F15B 2DDQL 1DBMH 4RMQA 4H1LH 1D9KC 3FOLA 1JMXA 3NCYP 1RUPH 4LVOC 1CIDA 2AP2A 1A1MA 4CU8A 5KVGL 1YNTA 4XC1H 1NGYB 4PTUB 3SE4C 3QUZB 5SX5K 2BVEA 5FV2A 5JQ6L 3T0AA 2VSCA 1XGQB 1UFUA 1KCSH 2K7PA 4YQXH 12E8L 2Y6SD 3FQTA 4QHUA 5D2LA 3SOBL 4L8CB 5DHYA 3F5WA 2MQ3A 3OZ9L 1Q9WB 2IPUG 4YXHH 3FAXA 2R4SH 5T1DH 3U82B 4GOSA 4LEXL 3LDBB 3QIUC 1NGXB 4L4VE 2RR3A 2E7BA 5E9DA 2P8MA 3GMNA 3ABZA 3H9YA 4YE4L 1BF2A 5KZCB 5J13C 5DHXB 1F58L 3V4PL 1JF1B 2CRZA 4UTBL 1S7SA 5CP7B 3UJIL 3MLZH 4MJIE 3GRWA 3TYFB 2C4XA 1T03H 3V95A 5HJ3B 4NKIL 1E4JA 1CDUA 1TENA 4FG6C 3IDNB 3M17B 1AC6A 2GK0A 3KYKH 4TQEL 1RJZB 3MXVL 3O41A 4PJ8A 4EI6B 5DQ9B 4QWWC 4DTGL 1KTDB 3VXRB 4JPIA 2FHCA 3C9NB 4LPTA 4XNZB 3V4VH 3E6FA 3ZDXF 4Y2OA 4NRZA 5FYLE 3TBSA 1QLFA 4PG2A 4HKJA 3X11B 2R56H 1YQVL 5IIEA 1INDL 3DROB 2RB8A 5D1XC 4AH2A 1G9MH 2NPLX 1C12A 5SWSB 2N1KA 4YXKH 4OF0A 4XRCA 4M5YL 3INUL 2P47B 4XMLH 2ZUSA 3JTSA 3MRBB 1M7XA 4UDTA 3DI2B 2IQAA 5MEPB 2AEQH 3WFDL 4X5XB 5IG7A 1CGSH 2H2SD 4MMXC 4BSWB 2PR4L 2H45A 3HMXL 1T1ZB 5I8EA 1AR1C 1OGTB 5A2KH 1ORSA 5SWQA 4F9LC 3KLHD 4J1UA 3V5KA 3O4LA 1W0YT 4TULL 5AWNH 1RD6A 1OGAD 2R0WH 2WNGA 5I16A 1CT8A 4YDKH 1VGKB 5GJSL 2QHLA 3PL6B 4ETYA 1D6EA 3VRLF 4U7MA 3VXQA 4HJ0C 5AUMB 1QLEH 2VXQL 3SDDB 3TZVB 2AJXL 4MAYA 1N4XH 3CSGA 4KMTL 4JRYA 1ZV5A 4TSAL 2D7QA 4Y4FA 1LP9F 2A6JA 4HIEB 1FPTH 3LEYH 4KROD 4KH2A 4U1GB 4WUUE 1JGUL 4BK4A 4XWOD 4HBCH 4JDZB 3PHSA 1ZHKB 3PGFH 4YHYC 1DUZA 4P99A 5C0CD 3X17A 3P77B 3OXSB 2CIIB 5KANG 2H26A 4RNRA 3VJ6B 1FYTB 4NUJB 1KCKA 4GW4A 5L9DL 2IG2H 4NQSB 4JFHE 2BC4B 4ELKA 5ANMA 3P4OA 5J11C 5E6IB 2Y06H 4MCZB 1IEBA 1FFNB 3D9AL 4LQFH 4BKLB 2NW2A 2EEBA 3MLWH 1LK2A 5TH2A 3RWHB 1RZIA 3KLSA 5FXCH 2EDTA 5EU6E 2DDQH 4Q0XL 3EGSA 2EXWC 3BHBB 4XP5L 4JE4B 5D6CB 4E42A 4ZQKB 2MQCA 2R1WB 5H94B 5K9JL 5KVGH 3QUKA 3AM8A 4I48B 1IGCL 2HTKC 3NFPB 2G9HB 4OI9A 2UUDH 4DKFL 3SDAD 12E8H 2V9RA 3QIBC 3BQUC 1CXHA 1R5IB 4GS7C 1QFPA 4JRXD 3SOBH 1OARL 3WNKA 1RUKL 4LGRB 3RAJL 5TDNA 1DBBL 4QNPE 3V5HB 3UTQA 4LEXH 1R3HB 4IHOB 4N5ED 2AJSH 1WJ3A 1C5DB 4RFNC 4YHOL 4LIQL 5IWLC 5CHNA 4UAOC 4YE4H 5HGBA 3V4PH 2WWMC 4TNVF 5KVFH 4UTBH 2VL5A 1AKJA 3DUSA 4RZCA 4WI7A 3MJ7A 2P5WB 3MUY1 4RWYL 4R7NB 1FNLA 1S7WA 2YWZA 4NKIH 2BNQB 4LLQA 4RRPG 3RFZC 4I1NB 1IFHL 4Y5VC 3NCYS 4TQEH 5F7MC 3VXOA 2XWBB 3MXVH 3FMGL 3GHEL 1UYWL 2R0LL 3A6BL 4DTGH 4KK8D 2IALA 3NGBB 5HHPB 4S1SH 1S7XB 5AAMA 3STZB 3VWJB 3LKPA 4APQA 1IC4L 3RIFK 4ZFOL 5DFVC 1YQVH 5JW4R 2R2EB 3CSYA 4UOW0 1GPOL 1BQSA 5D5MF 2NY2D 4M5YH 3INUH 3MNZB 3RL1A 5EZJA 3V0WL 3BPLC 2AXGB 1WTGT 4M48L 1S7VA 5KG9B 1TETL 3GSXA 4NRXA 3LQZB 3WFDH 2G2RB 3FO0L 5DRXB 2PR4H 3HMXH 4Z76B 5J12B 4D9QD 1PG7L 1X5HA 1J8HD 4NZTL 2DJSA 3RIAF 3LEXB 4TULH 3RWJA 1CDGA 3N06B 1JHKL 2ADIB 5ADPL 4PRPB 1ZHBA 4WW2A 2BERA 2EIDA 3I6KB 1QEWA 2BNRD 2BXZA 3HB3D 5GJSH 3CXHJ 1YC7A 3LS4L 1SBBA 2ICCA 3GJFH 1QACA 1IQDB 2JJSC 3MV8E 1A1NB 2VXQH 1OVZA 2AJXH 3TH4T 3JWNC 1GOHA 5C0BB 2KQNA 5HI5C 4ORGA 3O3DA 1M7DB 4KMTH 5IV2A 1OTTD 1GC1C 3DX6A 4XNYL 4WFEE 43CAB 1DQJA 1JGUH 3B9DA 3VRJB 5KSBB 3IU3B 3ZDYE 2DYPD 4G3YL 1V8HA 5HGDB 1L0QA 2AV7B 2VLLB 5DZOA 3OKDA 3I50L 3UBXA 1S5HA 1G7HB 1Z5LA 3GUTA 1R5WB 1IM9D 4QXGH 1NJ9A 3DMMC 1AO7E 5L9DH 3KYMB 3ORJA 2DMCA 1FV1B 1G6RB 2H2PC 5T1KD 1A14L 3QEGL 4E41E 4G8IA 1I3RA 3D9AH 2E27L 1QSFB 3ZKXC 1BFOB 5IKCB 1I8IA 4OQTA 3PWJB 4YC2C 1DN0B 2V5SA 2F54D 4Q0XH 4WV1A 1P69B 4XP5H 4KJQD 5B39A 1RJCA 1TLKA 1Q9OB 3U0WL 5K9JH 3ULUD 3K8MA 2AJ3A 3TBYB 1MFNA 1IGCH 3FO9A 4CUCA 1XGTA 1LVEA 1N7ML 3GIVA 3UTZB 4NJ9H 3FT4A 5FB8A 5E2JA 4DKFH 1UZ8B 2QQLL 4OLWL 3U4EA 5I1LA 4UIMB 4OI7A 4X83A 4TVSa 3LN4B 5FCSH 3WCYA 1G1YA 2EDLA 2W65B 5MI0B 3O6LH 1MCIA 1OARH 2X4UA 1RUKH 4M3KB 3RAJH 5BQ7A 1MAJA 2R23A 1FGNH 4PJIB 1GGCL 4MMZC 4YHOH 2VWEE 1TZHA 1VADA 4LIQH 4DN4L 3FQXB 3DYOA 4OZHF 2XTJD 4I8DA 3FN0L 5IB2B 3RGVC 1NFIB 4HKXA 3MGOB 4LMQE 2VISB 2CDEB 3GSOB 3VD4A 4RWYH 5F3BB 2OS7A 3GNMH 1JPSL 5I71C 1IAKB 2DLTA 3H7BB 5DJ6A 1IFHH 5IVXB 2J5LB 2FEEL 4WU5A 4Y16B 3WE6A 3FMGH 3GHEH 4Q6IA 2R0LH 3A6BH 1NLDL 1A6TB 4K94H 4ONFL 4HS6B 5JNYB 5GS2H 3TCLB 4NQCE 3CXDL 2X1PA 4IIQB 4KV5E 1WBZA 3W39B 4PTTA 3TT3H 3GMQA 2J6EA 3SKUD 1KFAL 3JTTB 5DRNA 4EI5B 1QRND 1W72B 5K9OA 2BOCA 1GPOH 4RQQA 1I9EA 1B0RB 1YPZF 1CFSA 3RUGA 1EEYB 4Z7UA 3AS2A 4AJ0A 4G9FD 3V0WH 4JJ5B 4ONHA 2V7HA 3F12B 4M48H 3TO4C 1KCUL 4QOKA 3CFDA 5GGVH 1TETH 5FIEA 5JPNA 5F93C 1LE5A 1XGRB 3QIWD 4MA1B 1ZT4A 4M8QB 4ZDHB 3C5SB 5ADOL 3FO0H 3TCXA 5GS0C 5DZLA 1YY8B 1F4XH 3LHPH 4CMMA 3FN3A 4M7LT 4NZTH 1JHKH 4OCSL 5C0IA 5ADPH 3RTQB 1N64L 1E4WL 4DKAA 2R2BA 3FFDB 5JQHC 4OV5B 3LS4H 3QRFM 2J3SA 4JQIH 1E4XL 4UBDC 2F5AL 5CD3A 3MRFA 1V05A 4GXUM 2H6PB 5KSUA 2FLRT 4LGPB 4Y1AD 2F5BL 4X7CC 5GJTH 3SCMD 1YMMB 2EDKA 4XT1C 4XPFL 5C9KA 6CGTA 5FHBL 4KI1A 3AREB 3QDME 5F8RC 3ROLB 3M07A 4G3YH 1PVHA 4G5ZL 1LO4L 3ARFC 2BRRL 3I50H 4Y2DD 3C60D 4U33A 2IAMA 3WDJA 3VG9B 4OGAD 3VRLE 4PYGA 3TESA 1VGEL 5FA4A 2X9YA 2OL3L 3QH3B 4FQXA 4X7FC 4HIJB 1A14H 3QEGH 4LLMB 3D48R 2AI0L 3SE4A 3OX8B 1QFWI 1R3JA 3DXAB 4IMLB 3RPIA 1LP9E 4PJGA 2P5EE 3VFOA 4YDIL 4PRHD 4XTRC 4DW2L 3NIFF 1CTOA 1MVUA 4WU7B 2DKSA 5F71A 3FQWA 1NUDA 2P4AB 4NO3A 4JFDA 4QKXB 3RWFB 4DVBA 4AENB 2JKXA 3QIUA 5TQ2L 5I76B 3A67L 4X4ZA 1MSPA 2FGZA 4UQ3B 2X41A 3KPQB 5E9DD 2MKWA 1N7MH 1I9RL 5SWZE 4KJYA 2QQLH 4OLWH 2C26A 2DWDB 4L1HA 3VXNA 1WICA 5IB1B 3D2UD 5INCA 2VTFA 2VLKA 1WC7B 3NA9L 3IYLW 3GBNL 3VWKC 2E7HA 3VFVB 2WSKA 3VD3A 4WUUD 1GGCH 4JFPA 4M8VA 5C08D 1FNGA 4OM0L 2IPKB 4JO4L 2C1PA 3H9SA 5C8JA 4PJ8D 2CKBB 3D39E 3QO1B 1AD9B 3FN0H 3F6IA 1MHCA 5C0AA 3O8XB 1EH9A 4AT6A 5BZWA 1NCBL 2DJUA 1HDMB 5F7DA 4XC3L 4H26A 3EW3B 3UDWC 5D7JA 3RWCB 4GG6A 5F7FA 3VE0B 1JPSH 1PZUB 5I8CA 3TN0B 3T4YA 1NSNL 2VABA 4K55A 2AAVA 4PV8A 4I2XB 4GG8B 1NLDH 3WL9B 4ONFH 3Q1SH 1GZPB 2AXHA 3EO1A 1RU9L 4K3EL 4M61A 3UTSB 2VLME 4HMDA 3CXDH 3OL2A 5BS0D 3CX2A 4YHLL 1FZMB 4NJAH 1KFAH 2NTFA 5LVEA 1UCBL 2VDKL 2HLAA 2YPVH 2CUHA 1YN6A 4JKLA 5T1LB 4NQDB 4ZNEE 1DQML 3TJHC 7FABH 3QB7C 3VW3L 3O4LD 4X6CF 3T65B 3IVKA 2OMBA 2H32H 2J1KA 2Y36L 3KR3L 3EHBD 5ADOH 4HGWA 1ZVYA 5GZNC 4L8DB 3AXLB 2AXFB 4MAYD 5I74B 3QDHA 2Z31A 1YQ2A 3O2DH 1SJEA 2XQYK 4JRYD 1CDIA 1HWGB 4R4FH 4Y4FD 4OCSH 4PY7A 2YBRB 4JFOB 4HH9A 2FWOB 1N64H 5D5ME 2P24A 3MA7A 1NDGB 3U2SA 4IRJB 1JNNL 3DLQR 3DX8B 5IJVB 3WUZA 3BUTA 2F5AH 4G8GA 1PBYA 2E6PA 4HWBL 1JHLL 4P5MA 4F7PB 1H5BB 4KUCF 5JHDE 2A6IB 1I7UA 4HFWA 3GK8H 4XPFH 5FHBH 4F37F 4Z18A 1SM3H 2PUQT 5DLML 4Y4HD 4G5ZH 4OCRL 3MZGB 2WLZA 1LO4H 1UB5B 4EUPH 4ZPTB 5JOFA 1INQA 4LCUA 1N6QH 5EO1A 3BMVA 5HYSB 1VGEH 1RURL 2UVEA 3WNOA 3VH8A 3S35H 1LE9A 2QADD 2AI0H 1T0MB 1D9KB 2CH8A 5A2LH 3MLXH 1A6AB 5EOQL 3BN9C 3CH1A 4DWHA 4HIIA 4YDIH 3IDJB 2VMFA 3QIBA 4DW2H 4KPHL 1Q94A 1TZGL 1HI6B 2Q8BL 4H0HB 4M6AA 5FDYA 3UCRA 1MEXL 2KDGA 1FP5A 5TQ2H 5T3XD 3A67H 5INDB 1TFHA 1FZKA 4HIHA 1I9RH 2CIKA 1FZOA 1Q9KA 3QBTB 4XGZB 1AP2B 4PIRF 1S9YA 2DJ4A 4GFTB 5IMKB 1CLCA 1U58B 4K3JL 1AKJD 4PJ9A 2DTML 3KDMA 32C2B 4AM0B 3HRPA 3W5MA 3H6JA 4P2OC 3GBNH 2OQJA 4MA3A 3GDBA 5J13B 2ITDB 3ARXA 3F7PC 4Z78B 3V0AC 4OM0H 1JYVA 4MX7B 4YO0A 4JO4H 3GSNB 2XV6B 1NCAL 5EO0B 2APTA 1MH5B 3MLYL 2AJVL 3L9RB 3R8QA 1ZA3A 1M71B 4GRWH 5IQ9A 4Y4KC 1WAAF 1NGZB 1HHGA 4XC3H 1MCHA 4APQD 3KYNB 4M5ZL 1HILB 1RULL 2JJUA 4NM8L 4LHJB 3OAUL 1A2YB 2DQGL 3CLFL 2NW3B 5GGUB 3S5LG 1NSNH 1YA5A 3F7VA 3QR2A 4JKMA 1DBAL 5F9OL 2YEZB 3NAAL 2OZ4A 2F53A 3QT2A 1LNUB 1YEDB 2OP4H 4H1LG 1RU9H 1ND0B 4OZHE 5D1XB 4QHNB 4DCQA 3CFCH 2A74B 3EYFB 1KJ2L 2D3VA 3PGCB 2ICWB 3OV6A 4PRIB 8FABA 4JZOB 2GYSA 1P5UA 4YHLH 1KIRB 2FD6H 1IEHA 2X42A 3JV6A 1UCBH 3IKCA 5C0JB 2VDKH 3ZE0F 1KXQE 1RJLB 4M9PA 1DQMH 3QZWA 3VW3H 2XIDA 4ZPVA 5F6HI 5LJYH 3UTTA 2HN7B 3RY5A 1AQDB 2Q7NA 4PLOB 1CFQB 2B20A 3EJYD 2Y36H 2J2ZA 3GSQA 1BVKB 3BDYL 4PJEF 5HGHB 3GMOA 2JJSA 1S8DA 1ZLVH 3IS0X 4IRSB 3IFPA 4QHMA 3G04A 5D96C 5EUOA 3PE9A 1CLZL 2WZPD 3MRGB 4PJ5A 4RDQF 5FFLA 1J1OH 2LU4A 4FQQB 4QHLB 1QR1B 3RNQA 1YPZE 2VL4A 5FOBB 3E6HB 5DRWB 1HNGA 1AGBB 2NY4C 1TJHL 4NHCL 2FJHA 1SEBA 2AQ1A 2BHYA 1JNNH 1K5NA 1GAFH 4U2YA 5EIVA 1T0NA 5LGJB 1D5BB 2XZCL 3DMMA 1JI2A 4HWBH 1JHLH 3BOVA 2V5YA 5FKAB 4D0DB 1PEWA 2VWEC 3F7RA 5EDXA 4EEEA 5D70L 5EN2B 4OF7A 2DLHA 1IVLA 4X4XB 4Y19B 4FOMA 3S36L 5DLMH 4OCRH 2FO4B 4KRPC 3HUJF 3MO1B 2FGWL 3L95A 4DKEH 5KJRL 4QCIB 5ALCL 5TPWL 2IH1B 3EDDA 2LAAA 2VLJB 5E5MB 5HTSA 4ZYKB 4N68A 4U6HA 4XHJD 2DQUL 4HLZH 4DEPC 1S7QA 4C58B 1X5LA 4JB9H 2V7NA 2I9LB 1LEKA 5EOQH 3MZTA 4DFIA 1QFUL 1QP1A 1SVZA 4HLJA 5SV3A 3OGOE 5CBAB 4K2UH 2V9QA 4XCYB 3RZWA 3BPCA 4KPHH 3PNWA 4IJ3C 5GGQL 1NAMH 1BFVL 1PJ9A 3THML 1TZGH 2Q8BH 5ISZE 3BXNA 4UNUA 4LBEA 5LKNA 3V7AE 4LHQB 3MMEA 3UMTA 4EN3C 1A1OA 3BYTA 4LCWA 3BQUB 4NWUL 1XCTB 3BISA 2EDQA 3VGDA 5D6DA 3G08B 3P11H 1G7LA 2CLZA 1A8JH 1G7QA 3RGVA 2CLRA 1KBGL 1MFCL 3TC9A 1I7RB 4K3JH 4U0RC 1WFNA 2FZ3B 1CFVL 2DTMH 2FSEB 3RGHA 5K9QG 3NIFE 4UAOB 3DHMA 4R90H 4XNMA 3MUGB 3OJVC 1ERNA 3UPRA 1H8SA 5D1QD 1JE6A 4NT6B 3UJJL 3X14B 1F2XK 2X4SA 3BD4A 3LIZH 3I3EA 4HDIA 4NKMA 2X4PA 1I1FA 3MJ9A 4LPWA 3VFMA 3VXUE 3SDYL 5JW4M 3MLYH 4LIQE 1P9MC 2XOTA 2BOBB 3LMJL 4UNTA 5LQBL 3IDGB 4S1QL 4Y5VB 3F7YA 2JIXA 4ZFZB 5D7LB 2XFXB 3T2NL 2Z92A 5C0NC 4OZFH 1JI1A 4OBRA 4M5ZH 4WO4A 4LSUL 5DMKA 1RULH 1YEFL 4LRIC 3OR6A 3TNNB 2EDWA 3OAUH 2DQGH 2XI9A 3DECA 3MFFB 2KH2B 4PJFB 2IQ9L 5F9OH 3NAAH 4F7EA 5L6YL 2VDLH 3O11B 1OPGL 3FFCA 4MD4B 4P46C 3QNYA 4G6KL 1D5IL 4O9HL 4QOKD 1KJ2H 3VXSA 2HT3C 5D2NA 2NR6C 3EJZD 1AC0A 3VXMA 1RUQL 2HT4D 2V2WB 5CBEB 4PR5B 4R4NC 2WP3O 3AB0B 4K7PX 3BPLB 1G84A 1N2RB 1JWUB 1BOGA 4NN6B 1N5AA 1OSPL 1IRAY 1L9MA 4OGYH 1FL3B 3OKYA 5FYJD 1N0XH 1C5BH 3BP4B 4QF1A 3WO4C 3L6FA 3V5DB 1C8PA 3BDYH 1FVDB 2E6QA 4OAWA 4OI8A 5E03A 2EDJA 2W9DL 3H7LA 3KHQA 4JDVB 2NY2B 3TPUB 2MCG1 1UADC 2OTWA 3B2VL 4HV8B 2V5MA 4WTXA 4KKBC 1CLZH 1NCUA 4NQEA 1KPUB 2YSSB 3FZUD 5CILL 3A6CL 3N85H 1BIIA 4HXBL 1BFTA 4X6CE 3O3BA 1TJHH 3OJDB 4M62L 4NHCH 4ZO7A 1AR2A 3B6SB 3ARFA 3CFJB 4X4YA 1UGNA 4OT1L 2XZCH 2IAMD 2LU3A 2VXTL 3CLEL 3OKOA 5FYKU 5J7CC 4U0QB 1G9NL 1DFBL 1TVDA 5D70H 3KLAA 3NN8B 4JFQB 4FQXD 2ILLA 3B5TA 2VLMD 4DAGH 1QKZL 3WSQL 5B8CC 4EQ2A 5TDOB 3SBWA 3KPPA 1H15A 2FGWH 5C0DA 4JN1H 1XF3A 3FB6A 3CFKB 5ALCH 2PYFB 5C6TL 2YKLL 5TDPB 1YUHB 1TQBC 2EECA 3QHZL 4GKSB 4IEFB 4HWUA 5TPWH 4JFDD 3MLUL 2DYPB 4HJGA 4YC2B 2DQUH 4JM2C 1YY9D 2IF7A 3BE1L 1LDSA 3BIKA 5FK9B 2Y7QA 5F1IB 1IM9B 1QFUH 2P48B 2BVYA 2Z35B 3REWA 1XGPB 5ICYB 1XGYL 5H35B 3O2WL 5GGQH 1T1WA 2V5RA 4F57L 2VLKD 2Z91B 5DD6B 1ZAGA 5KW9L 4FQIL 2HG5A 3BO8A 1BOYA 3BI9X 4RGNE 1DEEB 1ZS8B 1G9MC 3QDGD 5E8DL 4JO3L 2CD0A 4NWUH 3GHBL 3H9SD 3D25A 4QWWD 3RQ3A 1HXMB 4WI9A 5CAYB 2ARJQ 5TGBA 3QQNA 2MHAA 1KBGH 1U8QA 1FNEB 1MFCH 4JZNA 4JY5H 4LCCC 5C0AD 5K93A 5KBNC 3F58L 1CFVH 3GBML 3HC0B 4MJ4A 3W9DB 5D7JD 3K8LA 4MNQB 3AVEA 2FBOJ 4KRLB 3RNKA 1EBAA 1QSEE 3G6JE 3O2DA 4Z7QF 5IMLB 3UJJH 5E8PA 1YJDC 3WDHA 1EFQA 3VRIB 1F4YL 1QD0A 3R06A 1VDGA 5DRZB 5IW6A 3W0WB 4V1DB 3ISWA 5DEFA 3LMJH 5LQBH 4X5LA 4S1QH 1DQQA 1P4BL 3BESR 4C83A 3T2NH 1W0WA 3RY6A 2ARJB 1KJMB 3TIEA 4LSUH 4CN1A 1P7HL 1YEFH 5A16A 2WUCL 5GRZA 2KPNA 1CBVL 5F8QC 3IJYB 6FABL 3WD5L 4LP5A 4C54A 1GVIA 2IADB 2IQ9H 4OGZA 3HZKB 3FQUA 5L6YH 4YGVB 3RX7A 5C7XL 1R3KB 4FZEL 4Z6AT 3ARSA 1OPGH 4I3SL 3D6GA 4F7CB 5JW5A 3MV7A 3V7AG 4G6KH 4QXTA 1D5IH 5GRVK 4O9HH 4LU5L 3W2DL 2VKWA 3RWDA 5BVPL 1IQWL 3EYSL 1WAAE 5D7IB 3RPKA 1PDKA 4D0BB 2NLJB 3TO4B 7CGTA 2PN5A 4FMKA 1AIFA 3E3QE 1T7ZA 4MDIB 5B4MC 1R0AL 3G5XB 3DV6A 2Z31D 1OSPH 1VEMA 3NFNA 4WWKD 2RIKA 3IAGC 5DJ8A 1B0GA 2JB6B