2Q20A

Structure of the germline vk1 o18/o8 light chain variable domain homodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
b'TDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPYTFGQGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vk1 O18/O8 germline light chain variable domain
publication title Altered dimer interface decreases stability in an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q20A00
1RZIB 1BX2A 1CGSH 1UA6H 1ZOXA 3O2WH 5C0EA 2EXYD 4G8IA 4IJ3B 3OKYA 5C0RH 4OF0A 1L7IH 1QVOB 3RZCA 3U4EA 3GK8H 3RL2B 4DUVA 5MEPB 2XKUA 4OZIF 4AM0A 3NACH 1OLZA 5C0AA 2JKXA 3VXPA 1HI6B 3LV3A 5LGHH 3B9VA 5ISZB 5E4EC 3MRLB 3IDNB 5EPMB 4XPFL 1Q94B 3VXRA 2DJSA 4XH2A 4D0CB 3MR9B 4JVPA 1A21A 2J8UB 3T0EC 1FC2D 3BIAX 4N0CC 3SGJC 3E2HB 4GRWF 5C0IA 2GK0A 2XA8L 4KVCL 1F3JA 3QDAA 1RJLA 2WW8A 1LO5B 4P23D 3TC9A 4XTRC 3AREB 4U1LB 1NCCH 1JZ5A 1DSFL 1OD9A 3VWKC 5C0RL 1L7IL 3GHEL 4NPYA 1P9MC 4OJFL 1U8LA 3GK8L 1AHWB 3V4VH 5DJCB 4G9DB 3EAKA 4PGEB 3V8CA 1FFNA 3NACL 4EKXA 2BY3A 2GJ6A 5K59E 3RZCC 4QRSB 5EIVA 1K2DB 3S35L 4Y0GA 4CMMA 2YXMA 1RIVH 2R2BA 1R5VA 1DL7H 4ONGH 4NQUA 1ZLSH 2OZ4A 4BQ9A 5HVFB 5ACLA 2WIIA 3ZDZE 3MZGB 4XNZC 5E8DL 1FH5L 3IFOA 4K7PX 1AKJB 4QRPA 1OSZB 4DFIA 1MIML 5MEQA 4BZ2L 3GSNL 5L7XH 1V3LA 2DBLH 3MXWL 3FONB 2DM4A 4WHTB 3MCKB 3FO2A 4F7PB 3FQWA 4FQCH 4LLDA 4X7FC 2X4TA 4KK9D 1MCPL 4IRSD 1YEKL 1F02I 3EYVA 1AD9B 3VDCA 1EAJA 1OAZH 3G5XB 4O02L 3D39D 3HC4L 5C9KA 3E6HA 4RAHA 4NZUH 3V4VL 3HHRB 3DX6B 4CN6A 2YD3A 2X05A 2ZSWA 5GIRB 4W6WB 3S3PA 5IB3A 2CGRL 1OGAE 2XKSA 5DUMH 1KIQA 1MFAH 2D31B 4PJFA 5DHVH 3WNOA 5DFWH 3FN3A 4R4FL 4XI5C 1MVFA 3P2TA 5D4QA 3TNMA 2XNAA 5DI8B 3SCMD 4PRBA 1JYXA 2PF6A 2A77L 5L7XL 1RZIA 1ADQA 5FYLD 2LVCA 1KOAA 4L4TD 2YD5A 3O6KH 1HOCB 1QVOA 1GOGA 1MCNA 1HKFA 3RL2A 5MEPA 4JLRB 3O3UN 3T0VA 3WFEH 3W0WB 5FEBA 4FQ1H 1LP9E 4JFDB 5SWZA 4RGMC 1HI6A 5ISZA 2BFVH 1QFHA 3MRLA 3IDNA 4UMGA 5EPMA 1Q94A 5DUPL 3NCYS 3BESR 4HK3J 5DMGD 2I9LB 1MFAL 2FZ3B 2J8UA 1N4XH 1HSBA 4ZOBA 2L4OA 1CDUA 4MA3B 4PRIE 5J13B 1QR4A 3BQUB 3QXDA 4HUMB 3U82B 3D25B 4PP2B 5CGMA 4PJXE 3BP5B 4UIMB 2Q1EA 3LRSB 2VSCA 4U1LA 3MGTB 2HFGL 1NGPL 4N8PA 2RIKA 4HBCH 3OJMB 2C1PB 1HN1A 4KMTL 2WINB 1AHWA 1WIOA 3DRTA 5DJCA 3R8QA 4G9DA 3WFEL 1FNEB 1H15B 2A6KB 4XCCH 1QO3B 4NQCA 4F57H 4IJ3C 15C8H 5DJXB 4EIGB 3N9GH 3QUML 1WITA 4QRSA 4YDIH 1TZGL 3CMGA 4JN2A 2BFVL 1NCDL 3CFJB 4KUZL 4N9GB 1UG9A 2ZCLL 4M1GL 1TNMA 1BOGB 4TSAH 1CFBA 3GSWB 1T6VN 5B21A 3ULVE 2DYPD 2X89D 5IJVB 3VMNA 1OSZA 1OTUD 2NY6D 4GW4B 4HKXB 1IGJB 4G6AC 1OCWH 1G9NL 5TDPB 4WHTA 5T3XH 3MCKA 1FP5A 3VI4F 4F7PA 1EFXA 1D3CA 3E2HC 1T1XB 2CIIB 5I8EB 1J0ZA 1FNFA 1T4KA 4MJID 4WI3A 3G5XA 4HBCL 3TA3D 3UC0L 4XBGB 3RWGA 1HE7A 3BKYL 2P46B 3DX6A 1XGQA 4XCCL 2Q6WB 4F57L 5D93B 15C8L 1GRWA 4TNVF 4YDIL 3V4UL 5HI5C 1AHWC 1MLCB 4JCMA 3VFOB 5IIEB 5F9WB 5FYLE 2UY7A 1ZLVK 1QSZA 1P7HL 4TSAL 5FAAA 2J6EH 2CSPA 4AQ1B 4CVZB 4X6CB 5DR5L 1B4RA 4K9EL 1IC5L 3SGDH 3LPGA 5DEZA 2R0WH 2NXZB 4FFWD 1HOCA 1Z2KA 4MJ6B 4WUUB 3NFPB 4QYOB 4GKSA 5D5MB 1P4BH 1FO0L 4WW2B 2COQA 4D2NA 4F7TA 3W0WA 1QYGH 4PGDA 4HF5L 5C08D 2NY1B 1B4JH 4JFDA 4GAGH 4GRLB 2JELH 1MCBA 3QDGD 5IM7B 1YJDC 3VGEA 3ALWA 3VD3A 3T0WA 4FA8A 2GK2A 1OY3B 4M9OA 3L7EB 2UWEF 4AY0A 3O8XB 3FT2B 2I9LA 1ZLVH 3EYQD 3OGOE 3BPNC 4ZS7L 3D6GA 2IH1B 1DE4B 3D25A 4PP2A 1WLHA 3AS2A 3BP5A 4UIMA 3ZTNH 1JJUA 4NP4L 5MHSD 3MGTA 3O2DL 3FN0L 2C1PA 4PD4K 4OCRL 3JWDH 3FQXB 1FORH 5D5MF 2PW1A 3HAEG 2NX5B 1X5IA 2WINA 2FBJL 2J8HA 1P4BL 2GYSA 1M7IB 1QO3A 1MCLA 4GAGL 5E95B 4IS6B 2VDMH 1UXSA 4P5TB 1CZ8H 5DWUH 2E5EA 2JELL 4HCRA 1GSMA 5E5RB 4Z0BH 3MRJA 3CFJA 4EXKA 1OWWA 4N9GA 2MCPL 3P4NA 3IF1B 4A6YH 5JXAL 1BOGA 3NIDF 3BYTA 5HI3D 5IMLB 2UZIL 4S1RL 3VFSB 4AEIL 5IJVA 1CQYA 3L95B 2IALB 1DQLL 3VFVB 3LZFH 4GW4A 1IGJA 4JKMA 4JHWL 5TDPA 2XPGB 4S0TD 5CFHA 3INUH 1OAUL 4LIQL 5C0CB 1T1XA 2CIIA 5I8EA 3LAFA 4JY6B 5J13C 3BQUC 4Q9RH 4Z7WE 4HZAA 4AH2A 1FORL 1J5OL 3P73B 1A3RH 1MFCL 4TSBL 3ARTA 4XNUH 2QHRH 5ILTH 2YRLA 2VZTA 1B2WL 5B38G 2MHAB 3QFDB 1CZ8L 3ESUF 4NKQB 2WUCH 4WFFE 3VFOA 2YUWA 4G7YH 5C0GB 2NY7L 1MCIA 3FZUD 5SWSB 5KS9E 1QLEL 4X6CA 1FYHB 4XX1E 3RWFA 3O6LH 1VDGA 2ZWLT 5C08E 2CD0A 4WGWB 1CD0A 1A7QL 1AR1D 3QP3A 1TTFA 4L5FL 3EYOB 4DCQB 3T4AB 4MJ6A 4WUUA 2XIDA 4Q2ZB 1Q9OA 2AJYH 3NFPA 4QYOA 5GZND 4OLEA 4PJHF 3NA4A 4WW2A 1JFQH 3O3DB 4BZ1L 4JO1H 4EOWL 2BRRH 1QR1B 2R0KH 4FP8L 1TPXB 4U7MA 4XNUL 3RBSA 4GRLA 3RDTB 4QTIL 4PBXA 1OPGH 3PP4H 5HHMD 4OFIA 5HYSA 5IM7A 3C5SA 3QIWB 1D5MA 3G5ZB 2WUCL 3FT2A 3O8XA 3BRGC 2DQGH 3OXRB 4GKZB 3WIHA 3WSQH 4G7YL 5D93C 3G6AB 1VB9A 1INQA 3BWUC 4EVNB 1FZJB 2Z31D 3O6LL 4LU5H 1CE6B 3QUKB 4HQQL 4KQ4L 5F9WC 3CSGA 3TCXA 4XPGL 4PRNB 2VLJB 3S36H 1WFNA 4I3SH 3MRHA 1KPVB 5DQ9B 4B7LA 3U48A 3IFLH 2FB4H 3FQXA 4IDLA 5JDSB 1JV5B 4HZLB 2NX5A 5IG7B 3D85D 4NGHH 3EOAB 2HVKB 4XWOC 2VLME 1KCRL 3FT3A 2NXZC 2G2RB 1WZKA 4KHXL 4IS6A 4W4NA 4YDKH 3TO2B 1S7SB 3QCUL 4P5TA 2ZUWA 3GJEA 4FOMA 3IDGB 2V5SA 3QXTA 4WW2C 4JFHD 2ENYA 5JQ6H 5IBLC 2XI9A 4WTWA 2EYRB 3P0VL 4WENB 2NY1C 4GRLC 5IMLA 3VFSA 1EK3A 4OGYH 4RFNB 5LBSL 3TO4B 4PIRF 4U1SA 3RKDD 1L0XA 3OKKB 2AEIT 2AK1H 3UTTB 3OF6A 5MP6H 1ORQB 3VFVA 4MLIA 4UT7L 1AR2A 3O8XC 1N5YH 1H9VA 3IETA 2XPGA 4OFDA 4ZO9A 4PRHE 3X12B 2EH8H 4OLYH 2MFNA 1SEBB 3FT4B 4OCYL 2XG5A 5FYJE 4KJWC 5BMFH 3P73A 2AJUH 3KPSE 5B8CB 4PJIB 2QSQA 1FE8L 1GC1H 2BDNL 2HFFB 3CAFA 4YDKL 3QFDA 5DVNA 4UT6L 1GGUA 1B0GA 3L5XH 1X5XA 2HWZL 1S5IH 2KDGA 4YBQC 4C4KO 2F74A 4Y4KA 2DQTH 2QADD 5SWSA 2WQ8A 1FJ1B 1FLTX 4P5TC 4POZD 3IVKB 4GG6A 4NZRL 1F6AB 2H6PB 5D1QB 5MP6L 3RWIA 2DQEH 3LN5B 3FQRB 3QDME 5HHME 2JF1A 1OQOA 2YPKB 2AJSL 5H35B 4Q2ZA 1YMME 3PHQB 3SE9H 5KW9H 4NOBA 2ZJSL 4XPBL 3O3DA 1T83A 2YD7A 3GJFH 1YY9D 2HT4C 4TNWK 4TVPD 5DMIH 3RDTA 3MNVB 5KAQF 2ICWI 4GT7A 5KSBB 2YR3A 4JG1H 3VXUD 4XPAH 2IADA 1SVCP 2R0ZL 3QIWA 2XWJA 2ESVA 3OXRA 3HFMH 4GKZA 3P4OB 4LSUH 4J2XA 3CDCA 3PXJA 1OAXH 5AZ2L 4ZMAT 1K9TA 2XZZA 1FZJA 3L3GB 4MCZB 4LCYB 1CE6A 4UV4L 3QUKA 3RX7A 4KAQH 1YMHA 1IM3A 4PRNA 3HE6D 3EYUL 2VLJA 4FN0A 2DQEL 1CGXA 1MFBL 1JK8B 4H5SB 4U2ZA 4XCFH 3HG1B 1KPVA 1M1SA 5JDSA 4JFHE 1JV5A 4UZGA 2A9NH 4HZLA 1NPUA 1N7ML 4NO3B 5IG7A 3SE9L 2BNQB 3EOAA 3WV0A 3MOAH 2HVKA 4PJCB 2XWTB 1NEZA 2G2RA 3LN4B 4MB3A 5GZOD 5KSBF 1P4LB 5DMIL 2P5ED 3VGAB 1S7SA 5FOJA 4GBXD 4ZTPL 3PJSB 1EO5A 1FCCA 4HPYL 1VA9A 1T83C 2CLZB 2EYRA 4PS4H 4RMSA 4YFDB 3FFCB 1TPXC 2PETA 1KIPB 1JWSA 3RDTC 3QDJD 4Q9QH 4RA0C 3TO4A 4M6ML 1OAXL 4DWHA 2FGWL 3UTTA 4XMPH 2GHWB 1ORQA 3QIWC 2A2QT 1Z5LB 3SKUD 1S7UB 1YPZE 4NJ9H 3AS0A 1CXIA 1S7QB 3U36B 1BF8A 4UDUB 3PWPD 1MAML 4U1NB 3X12A 4OZHB 5CUSL 4N1HB 5KOVC 3B9DA 1SEBA 3FT4A 2O5YL 2A9NL 1ZHKB 1RD6A 1AGDB 4PJIA 2VERN 4Z0XA 3ULUH 1MCSA 3CMOL 5KTEL 2AK4D 2HFFA 5FOBB 2Q8AL 1HINH 2VWEC 5T1LD 3RVUC 1MHEB 4LVHB 4QLRA 3BRFA 2OQJB 1VENA 5DD5H 3U7AA 4EBQH 3QUYD 1N6VA 4DK6A 1ZLWH 5IVNA 1IGML 1UZ6F 4DAGL 3W39B 3QEHB 1F6AA 4XMPL 2H6PA 3EGSB 3LN5A 3WLBB 2WSKA 4H8WH 1QFWI 3TO4C 4NJ9L 4HS6B 3EOYG 1DQMH 1WQVT 4XT1C 4OZHF 2YPKA 2R23B 5H35A 3PHQA 4NRXB 3ZHDA 4F58H 5J4MA 3U7YL 1ZANH 1R3JB 3OKDB 2BCKB 2Z9TA 3JWOC 4PP1C 5DJZB 5JHDE 3U83A 3QIBA 4JVUA 5JW3L 4KPHL 3AAZB 2ICEB 3WDIA 1CGWA 5GS0C 2VZOA 4OCLC 1KIUA 4GLRH 4OIIL 3FO1B 3P4OA 4L29B 1T66C 1IKFH 4RISH 3EDFA 3QWQB 5I0ZA 4YH6A 4LCYA 1YUHB 2Y06L 4U05A 2GI7A 4LEOB 1W72B 2F53D 4OV6F 2P43B 5IVXE 2JCCB 4ETYA 3QULA 1JK8A 2X40A 4H8WL 5DK0B 1PKQB 4PV9B 2VXVH 1C12B 4Z7UB 1U8JB 3RVXC 3OJ2C 1PYWB 3QFJD 4JKWA 4EUPB 4NO3A 4Z77B 2BNQA 4DW2H 4PJCA 2XWTA 1V05A 3LN4A 4UDTA 5D1ZD 4P5KA 1J8HD 3ZMRA 2IC2A 4YHNA 4KTEH 4OD1L 4X6FB 3CVHL 5C3TA 4XP4L 3FFCA 4PJDF 1F3RB 12E8H 2D4DA 1F4XH 1RI8A 1KIPA 4BSWB 4RISL 1NCAL 4P2QE 5DFVC 3WD5H 5KN5B 1YN6B 1LK3H 3GNMH 4AG4H 1S7UA 1UM4H 4Y2DB 4Y4HB 4UDUA 2AK4E 1B90A 5D96B 4U1NA 2RR3A 5GGSY 2VXVL 4PUBH 2B8OT 3LKOB 4U3XA 1UJ3B 5DRNA 4XNYL 4JM2A 2G9HB 1ZHKA 4YHZH 1AGDA 1GGYA 4PGCB 1JRHI 4DW2L 3QWOB 4WO4D 3M8OH 2ZOKB 3NAAH 2AV7B 5FOBA 1QHOA 4QY8B 4ZFGL 1OSPH 4ZS6D 1HYSC 1PD6A 2DIBA 1MHEA 4OCWH 3L3JB 4MWFB 5L2KD 1U8KA 2VYRE 1IGTB 4NZTH 2R39A 3IXTB 3NFSL 3BHBB 4FQHB 4PJBA 3W39A 3QEHA 3WUWG 2IBGA 4J3WA 3EGSA 1TCRA 5SV4A 3UZQA 4GH7B 4YPJA 3WLBA 2E8YA 3F7YB 5IMMB 4HS6A 4P2RD 4PR5A 4J7RA 4QHUB 3RVVD 2XN9B 1FC1A 1KNOB 2V2WB 1SMAA 5FKPB 3THML 3HR6A 2BCKA 4WEBH 3VXQA 1DFBH 5DJZA 5EOCH 2XZQL 4RZCB 2WBJB 3AAZA 2ICEA 2IBZY 3SDXE 4OFYA 3QWRD 3Q3GB 1ROWA 3LOWA 4EN3B 2B1HL 4J4PD 1FIEA 5DHXB 1J1PL 3FO1A 4L29A 4G5ZH 2H32B 4NQDA 3GSOA 4LVEA 4KK5C 3BRDA 3QFJE 5F1NB 3RPIB 1RIUH 1I8MB 4LVHC 4RMWA 2C4FU 2VXSH 4Y7MA 4LEOA 3SE8H 4MJ2A 5FUOH 1ZGLM 1T7WA 2JCCA 3MCLH 4E5XB 3WJJA 3BOVA 1PKQA 4PV9A 5DD6B 4Z7UA 1J8HE 1U8JA 2W1NA 3TYFA 4QOKD 1WIPA 4X7SL 1PYWA 3LN9A 4EUPA 5E00A 3U1SH 4LLMB 2DLFL 4Z77A 3QCVH 2H2PC 4X98A 2OR7A 4PD4J 1MJJA 5J89A 1ZMYA 4S1DC 1QFOA 2FEDD 2YD9A 2XOTA 1R3HB 3LQAH 4NQEE 3NCFB 3RRQA 3VXSD 2NZIA 4X6FA 3RIAF 3WE6A 3MV9A 2H9GB 2V5RA 4P23B 2YD2A 3HPJB 4X7CC 2VXUL 1JNLH 5I2IB 4BSWA 2ORBL 5E99H 2DI7A 5KN5A 3UTPD 3TH2T 1YN6A 3MRPA 4H0HB 2UUDK 2VLKE 1UGNA 4HIJB 3LHPL 4LEXH 5FK9A 2YD4A 1HKLL 2OI9B 1IBGH 4ODTL 4U3CA 5JTWA 2ZNWA 2VDNL 1CR9H 3HUJE 3MCLL 5MI0B 1KG0B 3WNPA 2V9TA 4G80A 1K6QH 3BW9B 4L4VD 1KULA 4WEUD 2EZ0D 1UJ3A 4P48A 3JXAA 2PYED 1BFTA 2Q3ZA 3WJJC 2O93L 4PGCA 5C07B 3QWOA 4XVUC 1AI1H 4FZEL 2AV7A 4QY8A 4KRPB 5T5NF 3U7WL 4N5ED 3L3JA 5JPMB 1JWUA 4MWFA 5K9OB 1IGTA 5TFSL 1EBAA 3IXTA 4ISVB 4WV1A 2OL3H 3NCEB 4IRSB 4WHCA 2OR8A 1UCBL 4UIKL 3BHBA 4FQHA 4F7EB 2DIJA 3BP7B 2UUDH 2F54B 3D39B 3BT2H 5FGCB 1Y6MR 1BFOB 2E7HA 4LEXL 2A1WH 3BGMA 3F7YA 5IMMA 3KR3H 1RZJL 3PGDB 2EDBA 3QPXH 2V2WA 1KNOA 2JTDA 3MGOB 4K7PH 5FKPA 4LAQH 3B83A 3L1OH 4QWWC 3TFKC 5CEZL 1LE9B 3P30H 4M61B 2FO4A 3HR5B 3CFIC 5D96C 4M6AA 1I3GL 4RZCA 2QQKL 2WBJA 4FTVE 4YGVA 4CW1A 2NQCA 3VCLB 2D9QB 1AI1L 4XC3H 3Q3GA 4EN3A 4PJ5B 1UJ3C 1QSVA 2LE9A 4J3XA 3CDFA 5AAMA 4ZFFB 5TF1L 3OG4B 3V7AE 4ZOAA 5T3XD 2XRAL 4PJAF 4AEEA 2H32A 4L4TB 2OL3L 4J1UB 5F1NA 2E6QA 3RPIA 1I8MA 4IHOB 4V1DE 2GEEA 2YBRB 3LPWA 3PE9A 5GRUL 1VADB 2HTKC 3GUTB 2QHLA 5DD6A 2EXWC 3VXSE 1U3HD 2L0DA 2R0LL 3WS3B 5F7FA 1H3UA 3GKZA 2P48B 1G6RB 3CSPA 2EYTA 5EUOB 4LLMA 5J3HC 1GJIA 3I02B 4HJ0C 3OR6A 1MRFH 1FYTE 3PHOB 2XY1A 2Z91B 3GKWL 4XVJL 5IHBA 3P30L 1DBKH 2X1OA 3T1WA 5DO2D 1V3MA 3T2QA 4OCSL 2CR6A 4M9PA 3KJ4B 3B2VH 4F7CA 3QQ9D 4P23A 3HPJA 2YHGA 2WBJC 5DFTA 5I8CB 4JB9H 4YDJA 4EN3C 2Y07H 4JANA 2OXGA 1I7ZA 3PGCB 1QKZH 1UYWH 2PYEE 5KOMC 5IEKA 1KCKA 4OSUH 2VC2H 2EXYC 3PWNB 3DV6B 2APVA 1LK2B 2BP3A 4R8WL 1KG0A 5CJ5A 1XGUB 3IFPA 3BW9A 3QXWA 4YNYB 2YUVA 4R3SB 1FDLL 1A9BB 4RDQF 2AEPL 4OZGE 4M48H 5C07A 3MRMB 2CO7B 1KTDA 2DYPB 4U0RB 1A6ZA 3S5LB 2NY6B 2NYYD 2E7MA 3ES6B 5JPMA 4H1LG 1JGDB 1S78D 2PO6D 4ZD3L 5K9OA 2C3VB 2P49B 1ZVHA 4ZOCA 3SDDD 4IRSA 4MJIB 4G8GE 4JB9L 3TA3B 4XBPB 4YEEA 1TJHH 1JPST 1MWAA 3D39A 3V5DB 4AL8H 4P23C 5I18H 4LCIL 1BFOA 3DBXB 1UENA 4OV5B 3T3ME 1XGPB 1X5KA 2VC2L 3PGDA 3FN9A 4LNVA 5GGVH 1X4XA 1UH4A 5D1XD 3HAEB 1MHHA 4L3CB 3MGOA 1CIDA 3BPCA 2YUXA 3KPMB 4I8DA 3SO3C 2OI9C 3VG9B 1YEGL 1MCQA 3DO7B 1LE9A 3RIFF 4M61A 1MSPA 2FATH 5MI0C 3DX8B 3IAQA 1RIHH 4M48L 2VDLH 5J11B 3VCLA 5DZLA 3WXWH 4N9OB 1HNFA 4ZFFA 3ISWA 3SCMA 2QR0B 1FZMB 3AM8A 1TNNA 3QUXD 2GW5A 4M7KL 1XGTB 3DPBA 4L4TA 4Y8AA 4YZFE 1I9JH 4J1UA 4HV8A 1X6LA 3V6OA 1E0OB 2VABA 1TJHL 2YBRA 4X6DE 4OIBA 4DOHB 1REIA 5I18L 1I7RB 2YPVL 3MRFB 3GUTA 4KK9C 4IRSC 2NW3B 5IFHH 4PREB 5KVEH 1L0QA 2XTJB 1MHCB 1G7MB 3KAAA 2ERJB 1G6RA 4H25A 5EUOA 5T1MB 3I02A 3A0OA 2Z91A 2MWCA 3TBSB 2X1QA 4FABL 5DLMH 5CKAA 2W38A 4KI5E 5D7KD 3FTGB 2VDLL 2EIDA 1WF5A 4U1MB 5KSAD 2OZ4L 1R3IH 3ZKND 5DVMA 4QRRB 5F96L 3VXNB 3H0TB 3JZ7A 5I8CA 4GRWH 4EDWH 1JWMB 4NUGL 1I9JL 5IOPB 5ANMB 5LJYH 2F5BH 4ONFH 3SCMC 3UP1A 3AM8C 2W9DH 3DSFL 3UEZA 2Y5EA 1B88A 4KKCD 5D2NB 1EHXA 3PWNA 3PQYB 3DV6A 4NC1E 4U6XA 2MCG1 3V6OC 4R7NA 3W2DL 5KVEL 4YNYA 1KB5B 3QO0B 3UROR 2GUOB 3UPCA 1A9BA 5FYKU 5DSCB 1SHMA 1BQHG 1KELL 4LIQE 4PV8A 5DVLA 1ZS8B 1PDKA 2DYPA 2X89A 4ODUB 4X8JA 1I3VA 3W11D 4XHJD 4YR6B 3OAUL 1NCUA 5DMGC 4FS0A 2X44D 5FKAB 2C3VA 3NABL 2AEWA 1NC4D 4X9FA 4ODHH 5CJXA 3R8BB 5A40E 4E0RB 3C8HA 1Q1JH 1HCVA 4MJIA 2HRPH 4HKJA 1NQBA 2D9CA 3TA3A 4XBPA 3KJ4C 4EDWL 4PRPE 4HBQA 3OBAA 3MJ9H 3V5DA 1V7ML 3D0VA 4OV5A 1ADQL 3K4ZA 2EECA 1WCBB 4I2XB 4JZNB 3TIEB 3HAEA 3VD9A 5FV1L 4L3CA 1NUNB 3KPMA 1F8TH 1QSFB 3RBGA 2DLHA 1CGTA 3HC3L 3KPTA 4APQD 2FIKB 4NYLA 4R97B 2HLAA 1CL7L 4NBZB 3X14B 1CXKA 1EERB 4FFZH 4U6VH 2JB6B 4DN3H 3KPRD 3LQMA 4WI6A 1QFUL 3QYCA 3ZYOA 3RU8H 4U0RC 3I2CH 1ZV5A 1OTUC 1P2CB 2NY6C 2NLJA 1A6VH 4Z7VE 3MLSL 2Q8BL 2WP3T 1ES0B 1I7RA 3MRFA 5CJXC 1YQ2A 3WHE0 4J8RB 4S1QH 2NW3A 4NO5B 4HFUL 4PREA 5DC9B 3MODH 3TA3C 4DTGH 2RFXB 4EI5B 4HGWB 3QDGA 3EDDA 2HJLB 3MV7B 5T1MA 1KLGA 1H8NA 2R9HC 4M3KB 3NBNA 4FQXD 3LRHA 3TBSA 1C1EH 3W9EB 2P8MB 1P69B 3FTGA 3TBVB 4LLVB 5DMYA 1SEQH 4AMKL 3WBDA 4U1MA 5LQBH 3VG9C 1NAMB 3U46B 1YN7B 3VXNA 3H0TA 5J11C 4XVSL 3GRWA 2EDRA 1J0KA 3RU8L 4IRZH 1JWMA 1XF2B 3QISA 4YGAB 4QGTA 1A6VL 1DBAH 2J1KA 3D85B 1NCBL 3LEYH 5EA0H 3I9GH 3QEGH 3NFNB 3MOBL 4WY7L 1KB5A 1YJDL 2VDOL 3QO0A 2GUOA 1ZT1A 4A2MA 5MENE 5DVOA 3UJJL 5DSCA 3QT2A 3O6FD 5DJ0B 1C1EL 2I25N 3MV11 2OMBA 1ZS8A 4ODUA 2ERJC 4BFEA 1SEQL 3HMWH 1A47A 2ADJB 4LFHD 4YR6A 3TYGH 3VFNB 3F58L 3MJ7B 3EYQC 3DIFB 3V52H 1JGLH 2AEQH 3BKMH 4E0RA 5T1DL 5D2LF 5JQHC 2VRAA 3QHZL 5L6YH 3CH1B 4ERSL 4N0YH 4DEPB 1CU4L 3WHE1 3O9WB 5EA0L 2X7LB 4Y1AE 3U2SA 1WCBA 1TLKA 4I2XA 4JZNA 2UZXB 3TIEA 5E2UL 5BCAA 2E7LA 2PW2B 5D2NC 4JRYD 1AGCB 1T1WA 2P5WD 1E6OL 1KBGL 2QEJA 4KRMB 1QG3A 2FIKA 2VLLA 1A1OB 4AIZB 1GIGH 5GSRB 4HCRH 4KJYA 1R6VA 2GSIB 5F7MC 5DA4A 2JB6A 1XH3B 4U33A 4U1GB 3TYGL 1NAKH 32C2A 5L0QB 3AC0A 3V52L 5E8OA 5DD3L 5DRWB 1JGLL 4Y4FD 2X4SA 3AVEA 3BKML 4MNQD 2QKIA 5FM5O 4JN1L 2FHBA 1P2CA 5DMJB 4GRMB 2CLRB 1ES0A 3E8UH 3W81A 5AYQA 3TCLA 4R0LA 3S98A 4J8RA 2O5XH 3X3GH 3ULUD 4NO5A 2DIAA 2H2SD 1TJIL 4EI5A 4HGWA 3FCTB 1LEKB 3VXUB 1FV1B 3MLXH 3MV7A 3STBA 5C8JB 3OXSB 4R6UA 5D9SB 1A7RL 2Y1VA 3D18B 4LFHG 2E27L 4R26H 3W9EA 3N1PC 5J06A 3OQ3B 2VH5L 4HX1A 3TBVA 5DRZB 3MBXH 4E41D 1NLDL 2Z31A 1MF2L 2FD6H 4PGBB 4HCRL 2VZUA 3MRGB 1NAMA 2D03H 4YPGA 1EX0A 3I50H 3QZWG 1YN7A 5IEHB 2A83B 1O7SA 1LQSR 4R97C 3LY6A 1JGUH 3FZUC 3SO5A 5CEXB 1T3FB 1J88A 3NVQA 4BELD 4M5ZL 5INCB 3TWCH 4O4YL 1XF2A 3C2AH 4X6EB 3JTSB 4KKLD 4PJGA 3D85A 4FQIL 5BRZB 5CBEA 3E8UL 3CGTA 1A3LH 1I8IA 1O0VA 4XP9L 1RK0A 2D0FA 2P5EB 2YC1B 3NFNA 3V0AC 5GZNC 5DD0L 4NCDA 3MLXL 1UC6A 5HHVH 1JP5A 4GKOA 1RJZB 1MQ8A 5D7IE 4Y19D 4MNGB 5LKNA 1EVUA 1IC4H 4EI5C 1RMFL 4IIQB 1S7VB 1CDYA 3FQNB 5SX4I 3MUY1 2NY2B 3TJHD 4KY1L 3VFNA 1FVEB 4LKXB 3DIFA 3A6OA 5GJTL 2ZUSA 1N5AA 2Z31C 2BVQB 1P7QD 3TWCL 4ZFOA 4BQBA 2IFFH 1WC7A 1MCKA 4F7MB 2DQHL 2V2XB 4ZPTB 4K7FA 3O9WA 2VDRH 2X7LA 3UYOD 1A3LL 3ZDXF 5CLTA 1DBJL 2XZCL 3OV6A 7CGTA 5FUCC 5C0BE 5T1LB 5TQ0L 1MI5E 1RVFL 3EDEA 3G6DH 4KKAD 4UINH 2PW2A 2CKBA 4YQXH 4M1DL 4Q6IB 2IG2L 3FAWA 1WEJL 4DJMA 1A1OA 4D9QD 1I1AD 4FRWA 1K4DA 5GSRA 3T0BA 3C08L 5FV2A 1QRNB 1XH3A 3ZDYF 1QBLL 3QG7H 2WQRA 4NKMB 2ZCHH 3WIHL 2BHYA 5DRWA 5EO0B 1K5NA 4X4MA 4G6KH 5FYKL 3RKDC 5L8JB 2ZPKL 4GMSL 1ED3B 5F88B 2I9TB 1VFAB 4FMKA 4NOFA 2NPLX 4KWUA 2CLRA 3BMWA 4Y5VA 2IFFL 3P77A 1AXIB 4LRNL 3EO0B 1SYSB 5KVMC 3S4SB 2DM2A 4AEFA 3FCTA 4ODVH 4PRDB 1LEKA 3VXUA 1FV1A 1DR9A 5BV7B 5C8JA 4DEPC 3OXSA 1QNZL 5D9SA 3D18A 3EFFB 5F7EL 3O9WC 3JTTB 4GXVH 4UINL 4BH7A 4V2BA 4ELME 4YQXL 3TV3L 5C6TH 4G9FE 1BD2D 1FAIH 3LSOB 1LD9A 5DRZA 4NWUL 1NGYB 4XNMA 3UJIH 4CJ0A 3MRGA 3PV7A 3OR7B 3QG7L 2F53B 1CFVL 2A83A 5IEHA 1AP2B 5CEXA 1T3FA 5ALBH 1LE5B 3QCTL 5INCA 4G6KL 2BK8A 1TVHB 4U1GC 4X6EA 3JTSA 2JJWA 5GGQL 1QFPA 4DKFL 4XZUA 4YHKH 5L0QC 1UQSB 5DJDB 5K93A 3ZT5A 4ODSL 1PW3A 3ALXA 4M03A 5D7LD 2LU7A 5IBTL 3BKCH 2P5EA 2YC1A 3AGVA 4GBXA 3UPAA 1RZGB 2WUBL 3L9RB 1IILE 4M7LH 4ODVL 4Y5VC 5FHAH 4XMLH 1RJYA 2YN3A 4XNXH 3O11B 4MNGA 3QDJA 4J3UA 3G08B 1BVKB 2V9RA 1ZE3C 1S7VA 3VA6A 3EO9H 3FQNA 4NZJA 3JBG7 3UJIL 2H26A 1OL0A 4HS3A 1ACZA 1K4CA 4FXKB 2ZCKH 4JFOB 1CK0L 3T4YB 2BSED 2W0LA 3PWPA 4YHMH 5F89B 2BVQA 3DMMB 3OKMB 1W0VB 5EIIB 4F7MA 4ZPTA 5E2VL 1J7VR 1VKXB 1XZ0B 4LGRB 2JB5L 2BERA 3T2PA 4WNQB 3ARVA 4RIRB 1UB6B 4LCCA 4FZ8H 1GPOH 5JW4R 5T1LA 4HPOH 2BJML 4JAMB 4P9HC 5FHAL 4XMLL 3SEPA 2ZG1A 5L2KB 4K3EH 3RUGE 3QUYA 4OZ4B 3VFRB 4Q6IA 3NPSB 4OD3H 4UQ3B 3V0VB 4PJ8D 5GS1B 3EO9L 3UYRL 5DK3A 1JYWA 4YHLL 4NKMA 4X6BB 1Y6NR 4P3CL 1BZ7B 5EO0A 3F5WA 4P2RB 4J3TA 1QTYT 4IIQC 1ED3A 5BXFB 2I9TA 1VFAA 3H9SB 1LO2L 3C6SA 5CJBA 1P1ZB 3B9EA 3TJEL 3RKPA 3VFGL 3O45B 2MOVA 4CNIA 4ZFZA 5JOFA 3UJTH 5DQDH 2VN4A 3DSNA 1CLZL 4PRDA 5DZNA 4FZ8L 1GPOL 3ZE1F 4LL9A 5HGDB 3NZHL 1TZIB 2P47B 1JZ7A 3EFFA 2Y36L 2EEAA 3JTTA 5EO1A 4KJQD 4MYWB 4OD3L 4QRQB 4XWGL 4RQQB 5IQ7H 3QA3A 4MAUH 2HH0L 3BGFB 4G42A 2GQHA 1IAII 3OR7A 4S11A 2F53A 1AP2A 1PSKH 3QUYC 3WNMA 4Q6IC 4HGKC 1KLUB 4WU7B 5DRXB 5F97E 5D7LE 1LE5A 1KCLA 1CGUA 4JRXD 4QOKB 1X44A 5HHQB 1CN4A 4MA1B 2L7UA 4CKVX 1KF9B 1AO7E 1JTTA 1DLHB 3F7QA 5DJDA 5DHVB 3JWOL 3QB7C 2EEBA 5D1ZA 4UNVA 5I19H 4LPWA 4HSQA 3GO1L 5EDXA 4NBXB 5GS0L 2Q3AA 1EHLH 1RZGA 3L9RA 3PIQB 4GW1A 4LLUB 3DUHA 4JGJA 3S34H 4P46D 2PR4L 5B39B 4KHTL 3O11A 3G08A 1BVKA 2ZNXA 5BV7C 2OSLB 1JZ6A 3G5YB 4ALAH 1LDSA 4OI7A 2X41A 2EDHA 1HIMH 3RAJH 1PG7X 1PSKL 4FXKA 4JFOA 5B3JF 3T4YA 3U0TB 5J6GB 1NUFA 4NT6B 1K8DA 1RPQA 2DI9A 4L4VB 3DMMA 5GJSL 1DUZB 4FQLH 2CXGA 5FCSH 3OKMA 1W0VA 5CINL 2DLGA 5EIIA 1F58H 3GI8H 3DXAE 1UWEL 3PV6B 1XZ0A 1J0YA 3V4PL 2OMNA 4RMQA 4WO4A 1NUDA 4WNQA 4RIRA 1MCWM 4N0CD 4FMFA 2FR4B 3AXLA 4RBPH 4DGIL 1NFDF 1IMHC 3DYPA 3KLAB 5ETUB 3X3FH 2B4CC 5L2KA 5TDNA 5FM5M 3ZE2F 4MXVE 4OZ4A 5D1ZC 4XTRD 4UQ3A 1A8JH 5CSZA 4YEFA 4M8QB 5E2JA 3M1BB 1L0YA 5F71A 5CEZE 2AI0H 3FO9B 1BBDH 1PZUB 2FSEB 1CBVH 5E4IA 1BZ7A 4P2RA 1XF3A 4Z5RB 5BXFA 3C6LD 1P1ZA 43C9B 4O2EB 4JHBA 2ICCA 4S10A 3GI8L 1AGBB 4UTAL 3O0RH 3VDAA 5C0ND 1KXVC 2HG5B 3DMMC 3QWRA 3WXVL 3VXRD 4J4PA 5HGDA 3P11L 2NY4D 1IRAY 4ZUUB 3X3FL 3U0WH 5TE4L 3I3BA 4WO4C 3C8KA 2X70B 4XXDB 4LHUD 4QRQA 4RQQA 1RUAL 4ZS6C 1RU9H 4NUJA 5ECJE 2D7TH 3MA7A 1ZHBB 2BHUA 3BKJL 3GIZH 1Y18A 3QEUA 1FFOB 2IFGA 4MS8D 5BO1H 3NPSC 4WU7A 5DRXA 2CLVB 5GS1C 5A2LH 4M6OH 3OG6B 1U3HB 4QOKA 3ZKXB 5HHQA 3O41B 2J7LA 3BZ4B 1FBIH 3Q1SL 3UTZA 3B6SB 5CZVH 5IQ9B 1OARL 2R1XB 1PAMA 1Q9LA 4XMKL 1XFPA 3KLDA 4PY8I 5DHVA 2GJ6D 3MV8B 4QXGH 4A2LA 3VWJB 3VXSA 5F7WC 2B39A 4QGYA 3UTSB 4LLUA 4ZNEE 1F4YH 2CO6B 5B39A 1N2RB 1UZ8B 2KQMA 3ARZA 3D3VD 5GRVK 5I0DA 1MEXH 4RAVB 5ALCH 4QRPD 1SVZA 3QO1B 5FGBA 3G5YA 5LAXB 4J4PC 4Z76B 5ITBL 2AABH 3LIZH 3MPCA 1JF5A 4JM4L 5BO1L 3T0EE 5EOQH 4ZODA 1WAAE 5J6GA 5D71H 1LO4H 4NT6A 1MRDH 4BFIB 4L4VA 3WKMH 1AIFA 3BJ91 1W72H 4UV7H 4GQPH 3UBXB 1PBYA 1Y0LB 1U92B 3PV6A 4K2UL 4WU5B 5CJOL 5CZVL 1N59B 5FCUH 4GAYA 4X99B 4YXKL 2OP4L 2FR4A 4MA1C 1T2QH 1CICD 4LHUG 1AC6A 5HGBB 1D9KB 3BFOA 5D7SH 3SE3A 2X6MA 3KLAA 5ETUA 5L8LB 2DLTA 3MLUH 4NCC2 2FEDC 5GISL 2BVTA 4X7DC 1NBQA 5GSVB 1VFBB 3CZFB 3M1BA 1ZVSB 3E0GA 5SX5K 5K59F 4NNPH 4JHAL 3FO9A 3UZEA 2AABL 5C0AE 2FSEA 1OAKH 1YNLH 5JORB 4XC1L 5C70A 2FX9H 5EU6D 4Z5RA 3H42L 1JPSL 5FGBC 1LO4L 3ZDZF 4IOIB 1MRDL 4DZ8B 3VXRE 43C9A 4O2EA 3E1F1 4UV7L 3PDOB 3MRKB 1XGYL 3TH4T 5AYUH 1AGBA 3A6BH 4YUEL 4A6YB 5IBUB 3OAYK 5FCUL 3KDMB 2Z8WC 5IWLA 2EZ0C 1T2QL 1BM3H 1TETL 1HWHB 2R15A 3IDJB 2AV1A 4KZEH 3QUXB 4LSSL 2X70A 4XXDA 4KZDL 5GRVL 5C0FB 1Q9WB 3SE3C 1LP9B 2EDKA 4N5EC 3SDAD 2B5IB 5FIEA 1HWGB 1FFOA 2R69H 3VGHA 2GJ6E 3ARED 2BOBB 1YNLL 3FRUB 2CLVA 1GHFH 5C92A 2XQBL 1CCZA 1U3HA 3BZ4A 3K1DA 3AROA 3B6SA 5IQ9A 1YEFL 1KCSL 3MRNB 4LVOB 2FECI 3OAYH 1RURH 1GVIA 5AYUL 3V5KB 2HN7A 4QRPE 4U49A 2J6EA 3VWJA 2I60L 2P42B 4DKEH 3MNZB 4OM1H 1N2RA 1UZ8A 3RVTC 1OM3H 2DTML 1AKJD 3BEVB 5ID1B 3FO0L 4QRUB 3QO1A 5IWLC 2KL6A 5LAXA 1GAFH 1LP9F 1RZKL 2J8OA 4Z76A 4HWBH 1E28B 4OZFB 1FFPA 4PG2A 4JKKA 3KJ6L 5F7DB 3ROLB 1X9QA 4OLUH 2NY3B 2R29L 4PJFE 4B0MM 3ARDB 1Y0LA 4Y2OA 3V6BR 1U92A 2DDQH 4WU5A 3EO1B 1N59A 4NWTL 1MJUH 4X99A 1EGJH 2R56H 1U3HC 1S3KH 1VPOH 3N85L 5HGBA 1T1ZA 4QHNB 1GGIH 1MFDH 1L7TH 1RV6X 1YC7A 3C5ZB 2FJGA 1ZA6B 3SDDA 3VWJC 1OF2B 2F8VA 4W70A 3RVWC 4JY4A 5C0DB 2DM7A 4Q6YA 5GSVA 1VFBA 3MROB 1ZVSA 2YOCA 1NANI 4YXLH 3QAZB 3GMQA 1FGVH 4K3HA 5SWZE 1YQVL 1A7NL 5HPMB 6CGTA 3VFUA 5ISZE 3WIIH 1C5BL 1Q72L 5E2WH 1V3JA 4IOIA 4PJ7A 3HLAB 1KTLB 3PNWB 3BMVA 1M05B 5EZIH 4H20H 3IS1X 3PDOA 4OLUL 2ADFH 5F1KC 3ULVF 2J8UE 1CFSA 4PG2C 4A6YA 4APQB 4KJPD 2QQQA 1UACL 2Y5TB 1PJ9A 3KDMA 3I6KB 3D5OF 1MFEL 1I75A 4AQOA 2R2CA 2R2HA 4RGND 3DWTA 2VXTH 1S3KL 3MMEB 1JBJA 3IDJA 4PB0L 1CS6A 3QUXA 2PTTA 5E8PB 5C0FA 1BVLA 4Q97A 2WWMD 2SEBB 3CFEB 3CZJA 3BQUD 2F15A 1ZSDB 3HKFA 5IF0B 4CU8A 1S78C 1I8KB 2XWBA 4X4YB 2BOBA 3EJYD 3HI6H 1UM5H 3SDDC 3FRUA 3T8XB 1CI5A 3MJ6A 4QXUL 5GRJL 3H3BC 4HEME 4Y16B 4D0BB 1CGYA 4D8PB 5DTFB 4FQXB 2X9XA 4WFEE 4TPRH 1P4IL 2F5AL 3MRNA 4HKZA 1E6JH 4MZ2A 1AQDB 3V5KA 5J56B 3N1QC 4K3JL 4HIHB 4RGOH 3GMPB 3UYPA 4LKCA 2EKJA 5KSAA 3VD5A 1ZK9A 5IJKA 5E1HB 5DS8B 2DD8L 4TULL 4Y88A 1ZHNA 2I07B 3BEVA 5ID1A 1BFVH 1EJ6A 4PLOB 3MUHL 4TTGA 3K0WA 1E28A 2XACC 3QUXC 2CRYA 1KLFA 4ZUSB 2DQDL 2GAZB 3GJFB 2J88H 4B7IA 3MRDA 5F7DA 3LEVL 3ROLA 4F2MB 3MLYL 5FA3A 2B5IC 1MWAL 4LPYA 3ARDA 4OLZH 4ZSOA 2HMIC 3C5JA 3EO1A 5DYOA 3L6FB 2N7AA 4O58H 3RY5A 4WEMB 3VRJB 4JO4H 3ET9F 4JR9L 4LPUA 4NM4H 3RIFK 3NCJH 2G5BB 3CCHA 1ITBB 4LVOC 3HA0A 2G60H 4YHIA 3C5ZA 3L3IA 3TT3L 5AUMA 1NC4A 4NHUB 4Z7WB 1ZA6A 5KBNC 2CRIA 1WT5A 1JNJA 1OF2A 3HC0A 1SBSH 3MROA 4HJGB 5IJKC 4PLNC 5KZCD 3W0WE 1EEZB 4U7KA 4NJAH 4JFDE 4LDOB 5D8JH 3ZKQD 4XWOD 5HPMA 2NXZD 4JKLA 3MYZA 2AQ1A 2J88L 2HLFD 2Z93B 3BVNB 5BVPL 3HLAA 1KTLA 5EBLB 4OLWH 5HI4D 2VZ3A 1I8LC 3DUSB 2VR5A 5T33H 3MXVH 4JPKL 2GY5A 1BECA 4NHCH 2P5WB 2NY1D 4APQA 2ZP0T 4GRLD 3FQTB 1DN0A 5I71B 1DP0A 1G6RL 2NY3C 3ARDC 3MMEA 2YSSB 3KPRA 3ZL4H 3CX2A 4WWKD 5FHBH 3BP4B 5FGRA 4UILL 2G60L 4Z7WF 6FABL 1EUTA 4MNQB 1F4WH 3W11C 3K80A 2YKLH 3CFEA 4XHJC 4KVNH 4O9HH 2XA3A 3IFNH 5IF0A 1PEWA 1T03L 3BO8B 4S1SH 1I8KA 3C5ZC 3BH9B 2ZG2A 4X4YA 4NJAL 5D8JL 1QD0A 4OI8A 1WT5C 2IGFL 3GMRB 3T8XA 1EO7A 2Q7NA 5KJRL 5JOEA 3LKPB 4XP6L 3QAZC 1R5IB 4D0BA 4D8PA 4FQXA 5TJWK 2XFXB 5KS9F 2Y6SD 4YBQD 4HXBL 1AQDA 1I3RA 3M17B 4RFEB 4E41B 3GMPA 3LB6D 2DN7A 4L9LA 5HHNA 1H3PL 4N0FA 5EUKA 4I18B 4I9WD 5DS8A 4APQC 1V8HA 5GHWL 3ABZA 2AGJH 2ARJB 3QQ3A 43CAA 1IGFH 2UYLB 3UO1H 3F7RA 4TOYL 4H0IA 5CCKL 4JFPB 1L9NA 5D72H 4NM8L 3GJFA 5C0CD 2D7NA 4CDGC 4KTYA 4F2MA 1QBMH 3JVGA 5CSGA 2DQIH 3KXFD 3BN3B 3MLVH 3MLWL 3BZFB 5I1HL 1W0WA 4NN7B 3L6FA 5HYQB 4GKNB 4Y19B 1WFUA 4X6CE 4OF6A 1INDH 1GC1C 2VL5B 3KPLB 3VRJA 1RK1B 2K7QA 3EOTL 1IEAA 4FQXC 1N0LA 2G5BA 4WGVB 3ZT6A 1U6AL 4NQXB 3NTCL 2GY7B 4FXLA 4HUKB 5EB9A 3H2WA 4S2SB 4NHUA 5SWSD 1T2XA 5E03A 4WUUE 5C7XL 1B0RA 1TJGH 3IKCB 1EEYB 3KPSB 3KLHD 1S9YB 1YEEH 3GSQB 3ILQC 4CU7A 3T2NL 2MNUA 1I1FB 1YEJL 2K3TA 2W0KA 1KN4L 2MTPA 3IYLW 1AJ7L 1QQDB 5LCVL 5JR1H 2Z93A 3BVNA 2Z35B 3D0LB 3DUSA 3MUGB 2NXYD 3RWHA 3SOBL 4M4PA 1EHNA 4JRYA 1CF8H 2P5WA 3KPOB 4X80H 3HN3A 4Y5YB 1SJHB 2JJSA 5FYKE 3FQTA 3JVGC 5JHLL 3V6ZB 2YSSA 1IGYA 2YK1H 2DICA 2VITB 3V0WL 3K2UL 5EU7E 4Y4FA 3ZKMD 2OJEA 4MD0B 4MNQA 1RZ7H 3VDBA 2RB8A 2NX5E 4NRZB 1T0PB 3B2UD 5I30H 2ADGB 3RI5K 4GO6B 3GRWL 3GMRA 4JFQA 3MLZL 1A1MB 5JR1L 3WEXB 5I8KH 1IAIL 4U6HB 3WFBH 1TIUA 4MD5A 2XFXA 1AGEA 4TTDD 3ARXA 3M17A 4RFEA 5F3BB 3BD4A 4E41A 4G6JH 3T09A 5ADPH 1KB5L 4JHZA 2GFBA 5AG8A 3CH8A 3CJJA 4MDIA 4TRPL 3DETD 3P9MA 4M02A 4ZUVB 2JJSC 4XCEB 4KV5F 1JHKH 3TO4D 5I71C 4M62H 3VFWB 2AKRA 4WI2A 1HK6A 4OCNC 4K94H 5ADOH 2DLEA 3UTTD 2ARJA 3QNYB 4OIAA 4Z8FH 1FZKB 4PLJC 4DFHA 2UYLA 1MAJA 5EBMB 4JFPA 5I30L 3NCYP 5JZ7D 1IE5A 4PP1D 1FFRA 1KEGH 4G7VL 1KEMH 3HI1A 2DRUA 2EIBA 2K7PA 4FG6C 2P4AB 4C54A 3ZYJA 2V6HA 3FAXA 1W0YT 5KSUB 3IU4H 3E6FB 4LSDA 5IGXL 3B9AA 5SWSE 4GKNA 4Y19A 2YMXL 2GIYA 2E9BA 2QL1A 4ONHB 3ARYA 2H2SC 1UH3A 4GG6E 4P49A 2VDQH 1WJ3A 1LO0H 1RK1A 1LNUB 3VXMD 3IU3B 3VI3E 4ZUTA 4GMTH 4NQXA 4OBRA 4R4ND 4S2SA 4EI6B 1Q38A 4OCXL 2A38A 1EEYA 2XZAH 1P7QA 3MNWA 2F19H 2P24B 3ZSTA 5D1QD 3GSQA 3H7LA 4I18C 4K23L 3V6FA 2WK2A 1I9IH 1QQDA 3VU2A 1KEGL 1EMTH 4YXHH 1T21B 4CVWA 1NMAH 4WI8A 4KKLC 3D0LA 1WZ1L 3QHTC 4XGZB 3MUGA 2ESVE 1HXYA 1JYNA 2F9BT 3KPOA 5L88H 1J1XL 3UTQB 2AERT 5EU4B 4Y5YA 1SJHA 1OP3H 1EDQA 4P2YA 4PJ8B 4NRYB 3ZHKA 4M4RA 4OM0H 1YPZF 2VDQL 5HXMA 3V6ZA 2VUOA 1UKTA 5IMKA 4NN7C 2VLJE 3UPRB 4GMTL 4I77L 4QXTB 5T5FL 3TPUA 1JTPA 2Y23A 1HNGA 3TM6A 2VWEE 4NRZA 4AT6B 1NAML 2XZAL 1ZA3B 4FXGB 2ADGA 4I13B 1QOKA 4HS8H 3HG1D 3VH8B 5DA0B 4QCIB 1DBBL 1JRHH 3I75B 2FO1A 2BHZA 1A1MA 5JPNA 5AEAA 3WEXA 3NPZB 2X1XR 3GSXB 3TT1L 2BNQD 2M26A 1VEOA 1JF6A 3QEQB 1BD2A 5E6ZA 3JV4B 3D9AH 1QP1A 5F3BA 1VFUA 3UTTE 2RAMA 5D70H 4OGAC 4KKAC 2BSTB 2N4IA 5ID0B 2FCBA 3FFCD 2WV3A 5IFJA 4OB5L 4ZUVA 4Y5YC 3SQBA 1F45A 4HUWB 4XCEA 1KJ3L 2QQNL 4GOSA 3VFWA 3MFFB 4MXQD 1AQKL 1S7WB 5CJQL 1IAKA 3AU1B 4OQ1A 4PJIE 5EBMA 1KFAH 4MAYB 1C7SA 1MPAH 4PTUB 2CQVA 4ZFOL 1F6LL 2VB5A 5IK3B 4P2QB 3E6FA 1U36A 3MOQA 4ZNCD 4ZO7A 2I24N 1X5FA 3IJSB 2R1YA 1WBYB 5IVXF 1DJSA 3FFDB 1BQLH 3OKOB 3LS5L 3IU3A 4JPVL 1JF1B 4UB0H 2CKBL 3LDBB 1A0QH 4JO2H 3CLFL 4DUXA 4EI6A 3DGGB 1Z3GL 4H88L 2EIZB 1N6QH 3SKJL 2P24A 4MX7A 2HKFH 1MELA 5E08L 4PJEB 4WTZA 5GS3A 1UM6H 2H2PD 3CFDA 3WN5B 1KFAL 2IQAB 2R1WA 5I76B 4S1DD 2VLRD 4KUCF 4C83B 2BC4B 3HNTL 4GAJH 4KK8D 2HRLA 4B41A 3BXNB 3UTQA 2FL5B 1RUKH 5EU4A 2J3SA 4TVPL 4ODWA 1A6WL 2B2XL 3RWJB 4LPVA 1IEHA 2O5ZL 3T0AA 4PJ8A 4Z7QF 4NRYA 1PG7H 4OQTH 5HYIA 4XPHH 1BQLL 1YEHH 4QXTA 4D0DB 1BAFH 2EE3A 1X4ZA 1T1YB 3C6LB 2NTFB 4MMZC 3PWJA 4AT6A 5CP3H 2BNQE 5FDYA 4PJEF 4OLXL 5EZOL 1F2XK 4PJCE 3SDXB 4FXGA 5C2BL 5HYEA 3DYOA 1YNKH 1M7XA 4BSVB 3VH8A 1DANU 4QCIA 4XVUD 3STZA 5B3NA 2N7BA 1IGCL 2KBGA 2ID5A 3FB5A 3GSXA 2OJZH 3FFCE 5TE7H 4P9HL 2NY4B 3E3QC 1MCRA 4YK4B 3L7FA 1I9EA 1IFHH 1DBMH 1INEL 2PTVA 4JY5L 5DQJA 3VJ6B 3QEQA 1PY4A 4U4BA 1UB5B 3JV4A 4U2YA 4U1KA 3LQAC 3LKRA 4WI4A 3KPNB 1RUQH 5ID0A 3ECBB 3LKQA 3GB7B 3T04D 4UT9H 4HUWA 4WCYL 1I9RH 3X11B 5L8KB 4OAWB 4OZHE 4PJ8C 2DOCA 3MFFA 5EORL 4JRXA 2FHFA 1S7WA 1RFDL 3AU1A 4M6NH 2A74B 5IESH 4ETQB 3BE1L 3V5HB 3SDXF 3PGFH 4NQEB 4QWWD 3ULSB 4Y2DD 4MAYA 4Y4HD 1EV2E 5F70A 1DVFB 4E9LA 5IK3A 5HY9A 1VFMA 1TDQA 2FX7L 4KMLB 1IKNC 4P46A 4W4OA 2RCSL 1FVDB 4LSPH 1AXTH 1IFHL 1DBML 1CG9B 2VLKB 3D3VB 4HWEL 1I4FB 4PJBE 3IJSA 5BV7H 2K9UA 1WBYA 4U1JA 3FFDA 3OKOA 3RY4A 5JNYB 5DJ6B 1RUQL 2DQUL 4UT9L 2HTKD 3GSNB 3DGGA 4Z95H 2GJJA 2W60A 1CXFA 1Q0YH 5TH2B 3SKOB 4M6NL 3EJZC 4HJ0D 4OZIB 3I6GB 2ZUVA 1RUML 4JG0L 3WN5A 2IQAA 5I76A 4N8CH 3QNZB 4NC0B 3SGJA 2XN9D 3I85A 1BZ9B 3Q0HA 4G3YH 2BC4A 2WWKT 4LLYB 3TESA 1T5XA 2CRMA 1C5CH 1VCAA 4MAYC 1DQTA 2EEDA 4ORGB 3BXNA 2FL5A 2GT9B 5HVGB 3R1GH 4NQDE 4OD2A 5M95B 2HVJB 4YDVB 5BV7L 3LH2L 2HTLD 3RHWF 3HUJF 4P46C 1N0XL 2JCCE 3GSVB 2Z4QB 1UT9A 3UZVB 5IR1B 1PKQE 4D0DA 2VOTA 4Z7UE 5EU6B 4JO3H 4JKPH 5I73C 3BAEH 1T1YA 1IT9H 4Z95L 3C6LA 2NTFA 5I15H 4M00A 3DURA 4R90H 5FUZL 2D7MA 3LDBC 2B1AL 2BY0A 3EKCA 3IS0X 5E2TH 4BSVA 4JDTL 3GBMH 3MBEB 4KXZH 5FDWB 3PDDA 5SWQB 5C6PB 3MV9E 5JIPA 2IANB 3WN5C 2C7UB 4UTBL 4R2GD 2B4CL 3QRGH 2GITA 1UB5A 1CLYH 3R1GL 3T1FB 4LHUA 4HFWB 4KKNA 1NBVL 1TCMA 4ORZC 4KTDH 3SDAB 3KPNA 3T0DA 3ECBA 2JJTA 1CGSL 1UA6L 3O2WL 3X11A 4OAWA 4JKPL 1FYTB 4M5YH 3FHAA 4P59H 5FO8B 1HSAB 2A74A 4ETQA 2OXHA 2V5MA 3V5HA 3ULSA 2BRQA 4P4KB 5E2TL 1DVFA 3GBML 3MRBB 4L3AA 3AMLA 3C6LC 1A9EA 5LGHL 2CH8A 1G7IA 1XCTA 1G7PB 2VDPH 2ZKHH 2Z0BA 1FVDA 4HIXH 4Z9KB 4L1HA 5C07D 1CG9A 3LQZB 2J2ZA 4X7EC 5C0NC 3D3VA 2A73A 4DUWA 4HG4K 4OI9A 1I4FA 1CLYL 4G8FB 3VXOA 4KRPD 2CXKA 1UADC 4QTHB 2NY4C 5JNYA 4YK4C 5DJ6A 4NQTA 4MHHG 2O61B 3BZEB 1NCCL 4DKAA 4YX2H 2GCYB 4MQXD 4TUOB 4OGXH 3RX8A 4OZGB 5B4MC 1ZT7A 2F54D 3CIQA 2OR9H 5TH2A 3SKOA 2JJTC 4MS8C 4OZIA 1U93B 5F9AC 5ABDE 3V7MA 3O2VH 4QHKJ 3TLRA 3QNZA 4NCC1 4TQEH 3BX7C 2IPTH 1BZ9A 3HZMB 1CICA 5GRYA 3C60D 3DI2B 3BISA 1RIVL 1DL7L 4ONGL 4TYUA 1ZLSL 2E6PA 4G8GB 2VDPL 1AFVH 1MOEA 2GT9A 1DVFC 1XF5B 2IQ9H 3G04B 2P7TA 2JK5B 2YWYA 2HVJA 4YDVA 4PJ5D 5IFAH 5ESAB 4O00A 1YECH 3JV6A 1BGXH 5I17B 2DBLL 1JVKA 2FRGP 5EU6A 4FQCL 5F7KC 2ENSA 4DVBB 4HXAH 4OZGF 1OAZL 2CK0H 3CC5B 2UY6A 5T3ZH 4K3DH 1YYLH 2VZ1A 4NZUL 1VSCA 2I5YH 3O2VL 1FO0B 4TQEL 1CGVA 5SWQA 2IPTL 4RGNB 2IANA 5F9JB 1RJCA 5DUML 2VQUA 4D0CA 4LLAA 2C7UA 2BXZA 1YYMH 3MR9A 5IHUH 2VXQH 4Q0XH 2D0HA 3T1FA 4R7DB 5EC2B 1CICC 2Z8RA 1U8PB 3O4LB 5EBGA 1WWBX 2DTSA 2E8ZA 4WJ5B 1LO5A 3SDAA 1E4JA 3MJ9A 4UBDC 3MRIB 3GBNH 1BGXL 3AREA 3OPZH 2YPLB 2VUYA 4IMLB 3O6KL 1HSAA 4U7SA 1VESA 3VXTB 4NQVB 5DF0A 3U30B 3S6CA 3JSSA 1Q8MA 5C07E 1GOHA 4XCYB 4PGEA 1EIBA 4FQ1L 1NBYB 2BVEA 4P4KA 1CE1H 3DOSA 2I5YL 3MRBA 1WBXB 2DKMA 1TQCB 1K2DA 5HSFA 4GJTB 2DI8A 2EDEA 4C58B 1G7PA 1JNHB 2FEEI 4YZFF 1RHHB 1YYML 1HQRB 1WUNT 3LQZA 2EICA 2VXQL 4ZXBB 1AKJA 1N4XL 2OS7A 2OTUB 5A1AA 4X6DF 4JGUA 5E8NB 4F9LC 3D39E 2FYYB 4JQIH 5FGCE 3FONA 4O51B 1U8QB 4X4ZA 1P53A 1X5GA 2V2TB 3CUPB 2O61A 3BZEA 5CS7A 3TNNB 4RNRB 3S35X 1AD9A 1C16B 2GCYA 4TUOA 4G8EB 3GMNB 3SDAC 4HLJA 2UVEA 1OWRM 4EIZC 2R9HD 4KI5F 1WVZA 3AREC 4K8RH 1ZLUH 2DAVA 3EHBC 5CMAB 3N9GL 2HFEB 1MJ7H 5GIRA 2KQNA 3HZMA 1FNGB 4LSVH 2UWEB 2D31A 1G7HB 1FAKT 2CDGB 2BSSB 3EBAA 4M43H 4MVBD 1EBPA 4P4KC 2B0SH 4L4TE 1XF5A 3G04A 4OTXH 3V6OE 1JIBA 2NY5H 2JK5A 5ESAA 2ATKB 3MFGB 5DI8A 4JQIL 3NCCB 5KZCB 2GKIA 1OCWL 5F1SA 35C8H 5T3XL 5F6HJ 1OT2A 4DVBA 5EUOE 4MCYB 3JUYA 2P8PB 4JLRA 2NNAB 3AFLA 2NMSA 4HH8A 2XTJD 5AAWA 1D5ZB 4F8QA 1UJTA 3S5LG 3FHQA 2KUTA 2PXYD 4JE4B 5F9JA 5AG9A 4WWKB 4LP4A 1O5DT 2FZ3A 2AXFB 4LSRH 3PABB 1ZXQA 2B0SL 4R7DA 4MA3A 5EC2A 1A6UH 2J6EL 1U8PA 3O4LA 3DROB 3BQUA 4WJ5A 4JGMA 1QA9B 1ACYH 4QRRD 3LRSA 5LGKA 3MRIA 2EE2A 4GQ9H 2R0WL 2YPLA 1IGIH 4KKBC 1K85A 5E6YA 2HKHH 3VXTA 2YRPA 5DHYB 1TMCB 3L3HB 2FIRT 3T65B 2PCPB 1FIGH 4R9HA 1FNEA 1H15A 2A6KA 4C56B 5CZXD 1QYGL 1NBYA 5DJXA 3PQYD 1B4JL 2ITDB 2R8SH 1WBXA 5TPWH 2C4FT 2BVUA 5DEGB 1BOYA 4F9PC 4PJ9B 3BUYB 5BW7A 3KS0H 4KJPC 5E7BA 2X4RB 1AE6H 3GSWA 4FQJH 4MJIE 4Z7VF 3LS4H 2OTUA 1B9ZA 4JFFD 2AXGB 4B5EA 4RGNC 5E8NA 1A6UL 9CGTA 1CWVA 4HKXA 4UNUA 1TZHB 4UI2A 1U8MB 1ACYL 1A4JB 1U8QA 4O51A 4V2CB 3ZTNL 1GH7A 2V2TA 1XIWD 1FRGH 2WBKA 4RNRA 2WWMC 1OGTB 1C16A 5MENB 4G8EA 1A1NB 3GMNA 1T0MB 3A6CH 3KYMB 3JWDL 3LKNB 4PJHB 4XBGA 3KXFB 4EXPX 2EH7H 2DL9A 3EJYC 1M6OB 4HC1H 5DEFB 2Q6WA 3SJVD 4QHMB 5CMAA 4J3VA 5TPWL 2VDML 1ZTXH 5FA4B 4KDWA 5DWUL 3U30C 5A16B 1QSFD 1MLCA 4Z0BL 2IPUK 1EVTC 2UWEA 3G9VA 1G7HA 5IIEA 2CDGA 4A6YL 3WNLA 1BF2A 3NH7H 4CVZA 1AE6L 3S88H 1TQCC 3CLEH 2ATKA 2DQCH 1RULH 5BW7C 5LXGH 4Y1AB 2BNRB 3LZFL 4DOHE 5HGAB 4TSCH 4ZXBC 1II4E 3INUL 3WFCH 4N90D 3QDGE 3HE7D 1CDCA 5D5MA 4Q9RL 1CFQB 2P8PA 3IDXH 4OZFH 2NXYB 2VMFA 1EJOH 1FNSH 2EC8A 3BN9D 2EH7L 1A3RL 4UAOB 3OB8A 3MX0A 1NGQH 2QHRL 1H3GA 5ILTL 4LK4A 4EI5D 3DUUB 2APWA 3MA9H 3CFCH 3BI9X 1D5ZA 3MV7D 5GGSB 3ULVH 2XYCA 5SX4H 3L7EA 3ARFD 2H41A 2EO9A 4WWKA 3TN0D 3HZKB 2QLVB 5MHSE 1BJMA 2AXFA 1SY6H 2CJUH 3PABA 4YIQB 3DROA 4KMQA 2IH1A 5ANME 1DE4A 3CDGB 3BWAB 1T80A 4U1IB 1MRCH 5KVDH 4XCNB 2W92A 3D69B 4HULB 2DQJH 3MRQB 4XB7A 4I5BB 1FG2B 2AJYL 5DHYA 5HHOB 4RMVA 3L3HA 3LCYA 3T65A 1JL8A 2PCPA 1JFQL 1M7IA 4C56A 4JO1L 2CUHA 2BRRL 1NCTA 2ITDA 2R0KL 2HLFC 5FYLH 5C0JB 5JW5B 1OPGL 3PP4L 5HI4C 5AWNH 1KT2B 4WFHD 1A7OH 3CFCL 2EDXA 5LVEA 3UX9B 3IF1A 5FO9B 1U42A 2X4RA 2DQGL 3WSQL 1QLRB 1FNAA 2A9MH 2AXGA 3L95A 2KKQA 2IALA 1MQKH 1YNTB 4LU5L 1TZHA 4WWKC 5I1DB 3OWEA 5ITFB 1U8MA 2D7QA 1A4JA 3F12B 3N0PB 4I2XE 3S36L 5C0CA 4LASH 4JY6A 4I3SL 1EO8H 1OGTA 1A1NA 3MRRB 1B3JA 1T0MA 3IFLL 3KYMA 1QSFE 2X09A 2FB4L 3LKNA 2W0FB 4PJHA 3KXFA 1A14H 3CD4A 3F8UB 4NGHL 1KUMA 1CXHA 1RZ8B 1M6OA 3GJFK 5JOPD 3O9WD 3G6JB 4QHMA 5CILH 1R24B 1SQ2N 4GUPB 5DDHB 3T2OA 4EZMA 1MCOH 2IMMA 2MHAA 3P0GB 5FA4A 1GXEA 5A16A 5JQ6L 2ZUYA 4BFBD 3VXMB 3WNNA 2Y6SC 4JZJB 5C0GA 2VQ1B 4CMHB 1H5BB 4ZYKB 5CGTA 5F8RC 4OGYL 3LB6C 4X9HA 5I1KH 4MA7H 2Y7QB 2AK1L 3RWEB 4ZAKD 4XNQB 2QSTA 2BNRA 2APXA 5HGAA 4XP1H 1N5YL 4NNXB 1ZWIB 5C0BB 3MRCB 1CL7I 2VIRB 1FPTH 1MI5B 3EYOA 3ZTJH 4DCQA 4KH2A 4QNPE 3T4AA 2OK0H 4IMKA 4DQOH 2Y4SA 2J5LB 3MV7E 2EH8L 3BD5A 1H3TA 4OLYL 1CFQA 5D7IF 2L7JA 5DK2B 1XMWA 5BMFL 1N8ZB 3T3PE 2AJUL 1LGVA 1A7BA 1QR1A 3MACH 3G6JF 1KPRB 2UV3A 1GC1L 1P7KB 2WBWB 4IDJH 3L5XL 3G5ZA 4LQ1A 4HH9B 1S5IL 3ARWA 2DQTL 3G6AA 4YIQA 3ELAT 4EVNA 4P9MH 1Q9KB 4PJGE 5I1KL 5FUCE 5GGRY 3BWAA 5KVGH 2X4PB 4BA8A 1U91B 3D69A 4N5UA 3HNSH 1MCJA 3PL6D 1DQDH 5DQ9A 4C55A 3MRQA 4JFXB 4F3FB 1FPTL 3KLHC 2OK0L 4WFHE 4I5BA 1FG2A 3F6LA 4G9FB 4O5LH 5HHOA 5KW9L 3RJDA 5CZKA 5BRZD 1P84K 3BDXA 4GSDH 4CVXB 5IKCB 1RZFH 1UEYA 3MACL 4ODXB 4KQ3H 4NIKB 4IMKC 3UMTA 3TO2A 2EDNA 3GIVB 5JW5A 1J12A 1I1YB 3IDGA 1KT2A 4JG1L 2NXYC 1A7PH 4XPAL 4EQ3A 3IDYB 2FX8H 4UAOC 5L9DH 5FO9A 1CDIA 3HFML 5DMKB 4LSUL 2XV6B 1ZLWK 1QLRA 4DGVH 3OKKA 4OUUB 3HMXH 2NY2D 1CD9B 1AY1H 4MQTB 3FMGH 5I1DA 5ITFA 4HG4J 4KAQL 5JOPE 1UKQA 3GSRB 1F3DH 4L8CB 3MYJB 3ZKMC 4XCFL 3PXHA 1R3KB 4PTTB 3REVB 1MREH 1BLNB 4CVUA 4ELMF 3B2UC 1RQ5A 2YWZA 2EDFA 3QG6B 1V5JA 1X5LA 1HHKB 5B8CA 1RZ8A 1HH6B 3MOAL 5ELIA 1VGKB 3G6JA 3RA7H 3WYRA 5HHXH 1RZFL 4OF7A 5BS0B 1BZQK 2ZOLB 4LF3B 3VXMA 1CLCA 4JZJA 4PS4L 4TTDC 5F6IB 4X4ME 5DJAB 2FH8A 4Q9QL 1FJ1A 1KJ2H 3IVKA 1S9XB 4DGVL 1QRND 1CIUA 1HXMB 2Y7QA 3MCG1 3RWEA 5E8EB 4XNQA 5D1QA 3CK0H 1A3QA 2HT3D 3DETC 4WW1B 2FJFB 4NNXA 3FQRA 4TVPE 4RFNC 5FGSA 2ZSVB 4MQSB 2XKNB 4BSJA 1BQSA 2VLRB 3L3KB 3VXUE 1LDPH 5I1AB 2NTSP 1ZGLB 1JHLH 5DK2A 1N8ZA 5JZ7C 2ITCB 3QXAB 4AEHH 3BJLA 2VN7A 3ULUL 1KPRA 3LD8B 1R3LB 2AJVH 3MNVA 4RRPA 3F6IA 5EWIH 4LARH 1J10A 5GGTA 5KSBA 2M1KA 1P7KA 5IB5B 1HINL 2H1PH 2KZ1B 3F62A 5ESQB 5B8CC 3QXVA 5A43C 4PJDB 4LSQH 2G5RA 8CGTA 5DD5L 4EBQL 3N1FC 3AB0B 1NKRA 4HT1H 4HLZH 1UXWB 3L3GA 4MCZA 3EIFA 1WIUA 5EG6C 4L3EB 4JZJC 4HGMA 4R4NC 5F8QC 5FYJH 1NJ9B 1PKOA 4BUGA 1H5BC 1NLBH 1U91A 4H5SA 3SQOH 1NGXB 3HG1A 3TIDB 2P5EE 4LOUC 1CD8A 1E4KA 1OAQH 1DQML 3UXFA 3VW3H 5D1QC 2C3WA 3RUGF 2CIKB 4F58L 1ZANL 4ZTOH 5FECB 4MNGE 3QDJE 4CVXA 5IKCA 4CADB 4ODBD 4YHPB 4ODXA 1P4LA 3GIVA 2J5LC 5EWIL 1TXKA 5DUBB 3PJSA 1YA5A 3CNKA 2CLZA 4JFEB 4U6YB 1TTGA 2H1PL 5IP4A 3KYNB 2BX5A 3ILPB 4NKDB 3PWPE 1IKFL 4G43B 2AQ3A 3QXUA 5EZLB 1FNLA 4OUUA 2PN5A 3EOBB 3VFPB 2CK2A 1GGTA 1Z5LA 4MD4B 2OTPA 3O3BB 3HS0B 4L8CA 3MYJA 1S7QA 3U36A 2VAAB 1MH5B 1R3KA 4QT5B 4PTTA 5FO7B 4I0PB 4OZHA 3Q48A 3REVA 1HYRC 3DMMD 5C09D 1U95B 3QG6A 3S4SG 1U3JA 1HHKA 2IBZX 4M7LT 8FABB 1HH6A 1MUJB 1VGKA 3PHSA 1E4KC 2R4SH 5BS0A 1L6ZA 1QRNE 3ARGB 1P5UA 1F42A 4KTEL 1DUYB 3DVGB 3ESVF 2OQJA 1MY5A 12E8L 1AXSB 1PX4A 1F4XL 5DJAA 4JRWA 3VGAC 4W6YB 3QSKB 4WVRA 1S9XA 3BSZH 1G6VK 4PYGA 2EDYA 3DXAB 1BBJB 1HXMA 3WD5L 2V17H 3IDYC 1LK3L 4LDEB 1Z6JT 4WW1A 2LU3A 2QJDA 3GNML 4AG4L 4RX4D 4BKLB 2H3NB 4XPTH 1B0WA 1UM4L 4MXQC 2XKNA 2VLRA 3L3KA 5IW1B 3H9SD 2R23A 4NRXA 1R0AH 1ZGLA 1R3JA 3OKDA 4PUBL 1ND0B 3K8KA 4XP5H 1I3UA 2ITCA 3QXAA 5M94B 4YHZL 2A0LC 1QEWB 3NCBB 4X5WB 1R3LA 3M8OL 5IV2B 2R4SL 4TUKH 3NAAL 5IB5A 5F72S 1OSPL 2F53E 1BEYH 4PJDA 3QHFH 4OCWL 4YDLB 1X3DA 4NZTL 5IT2H 3FOLB 3FB6B 1YZZA 1XEDA 4FHBD 3TVMB 4AYFA 1MIEH 1UVQB 3BSZL 1YUHA 2PUQT 1FN4B 1JPFB 1W72A 3MUJA 5F6IC 1J05B 5JIKA 1NJ9A 4I1NB 5DK0A 1NGXA 1PZ5B 3DX9B 5D7JD 3TIDA 4XPTL 1LEIB 5EO9B 1C12A 1WWAX 2H8PB 5DXWA 1LHZA 1NSNH 2CIKA 4MXVF 5CIPB 1TFHA 2VJXA 3WS6A 7FABH 4R2GB 4WEBL 5C86A 4N0UB 1DFBL 4CADA 1P6AB 3VFMB 5GXBB 1D5IH 5EOCL 3OKEB 4AIOA 5DUBA 4TUKL 5I75B 3QRFM 4JFEA 4U6YA 4KK8C 3EZJB 3VMOA 3LD8C 4NKDA 2LAAA 4G5ZL 4Q9CA 1H0DB 1OTTD 5SV3A 5EZLA 3EOBA 2D0GA 3VFPA 4OLVH 1RIUL 1VEMA 2FEEL 2XQYK 2VXSL 3O3BA 3SE8L 5T3ZD 5FUOL 4Y2DA 3AB0C 4Y4HA 2VAAA 4QT5A 5FO7A 1MNUH 3LKOA 1U95A 1VEPA 4LCWD 3U1SL 2G9HA 3EDJA 4B50A 5L2KE 3QCVL 8FABA 2CMRH 2ZOKA 5CBAB 1HHHB 5IHZB 5ICZB 5JDJA 1IQDB 1YEDB 3LQAL 1U2CA 3WS6C 3W9DB 3DVGA 2Q87A 3SDYH 4P2RE 4PJAB 1JNLL 3DX7B 5E99L 3ZYZA 3SHSA 3V79C 2HA1A 1CVSC 2NR6C 4PRAB 5HYJD 2XT1B 3GI9H 4D9LH 2JIXB 4BKLA 1HZHH 1IBGL 3QUZD 3U4BH 1CR9L 2PTUA 2WAHA 4QHUA 2XN9A 4L8BB 5IW1A 1MJ8H 1G0YR 1K6QL 3C60B 4G8IB 1ZT4B 1MLBB 4Y2DC 4Y4HC 3U4EB 3QI9D 3RVTD 3HTLX 3P40A 4I0PC 5B39G 5CP7B 2CMRL 3A67H 4J6RH 4LPTA 2P44B 3PWVB 3VXPB 3LV3B 1WAAF 5JUEH 2RQ8A 4HWBA 1QSEB 2AJZB 3SDYL 3BDYH 3FOLA 3FB6A 4QOKE 2JJUA 3ARGC 5DJ8B 1UVQA 5EH1A 2X1PA 1N6UA 4RMTA 2Q86B 1N64H 3BT2L 2IEPA 4E5XA 4L1DA 2A1WL 4K8RD 3RP1A 1V7NH 3KR3L 2F58H 1EGJA 2H8PA 2VKWA 1GL4B 3QPXL 4K7PL 4QEGA 4LAQL 3L1OL 4NPYB 1JPTH 4Z6AT 4N0UA 3MV8D 1U8LB 4JREB 3OKEA 3ARBB 3UTPE 1R3HA 3IGAB 3VWJD 3RVWD 4XC3L 3UTSD 4E42B 2H9GA 4HMDA 1NANH 5I2IA 5F44A 1H0DA 2WIIB 5KG9B 4L4VE 2HTLC 2AAVA 3IFOB 4HIJA 1CYGA 3NA9H 1N64L 1E27B 1VGEH 2J4WH 1FFQA 3VD4A 3TVMC 3Q5YA 1MRFL 3QIUD 5BZWB 1X5HA 4X7TB 1DBKL 5CBAA 5ICZA 1HHJB 1IQDA 1YEDA 4B53A 2N1KA 3K7UA 1D9KD 1KJVB 3B5GA 3W9DA 1WISA 3B2VL 4R2GC 3WUZA 5C9JB 4XPFH 4PJAA 4ISVA 4HDIB 4L9DA 1F5WA 3DX7A 4F7EA 5I75C 1IEBB 3BP7A 2HAZA 3O4OB 3RHWK 2F54A 3LRGA 2Y07L 1PX3A 2XA8H 3HZVB 4KVCH 1T7ZA 1QKZL 1UYWL 2JIXA 2XNAB 5AD0B 4OSUL 4PRBB 1U8IB 3KYAA 4L8BA 1UH2A 4WI5A 3C60A 2ZUUA 4ONOA 1DSFH 2HT2C 1ZT4A 1MLBA 3K3QA 5HHPB 3GHEH 4OJFH 5T3XE 3HR5A 3DHMA 5JIHA 1M4KA 5CP7A 4C4KT 4PJ5A 2HP4A 5SWZB 3PWVA 5D6DA 3S35H 1QSEA 3N1GC 1PGRB 2AJZA 4YHYB 4POUB 4PJFF 1FH5H 5E8DH 4KRPC 5DJ8A 1HSBB 4IHOA 2A6DB 2ICWB 2Q86A 2DKUA 4AL8L 1MIMH 4BZ2H 4Z7OE 2HMID 3MV8E 3QXDB 3UBXG 3GSNH 1VADA 3MXWH 5F9DC 4RWHA 4MQXC 3WS3A 5GGVL 3ARUA 1MCPH 1F3DJ 1YEKH 4N8VG 3UTSE 1EEQA 3OAZK 3EUUA 2PXYB 5DVKA 3PHOA 2WM0A 4O02H 3IJYB 2W07A 4PRID 3HC4H 2CKNA 1XF4B 1A6TB 2FATL 3OZ9H 2CUMA 3DRTB 1RIHL 3ARBA 3O3AB 3IGAA 3C60C 4NQCB 4P99A 1P84J 2CR3A 3WXWL 4E42A 1G0DA 2CGRH 3K4AA 3DNKA 3KHOA 1U3ZA 3F7VB 4JN2B 2XTLA 3UCRA 2RJMA 5KG9A 4OCMC 1KIRB 2J8UF 5D6DC 4R4FH 3PGCA 2IWGA 4MLSA 1E27A 1W8NA 2A77H 1LK2A 4KFZC 1XGUA 5IBUG 5IFHL 4PB9H 1EFXB 4TN9A 2VZSA 3DVIA 4R3SA 2NY3D 1T4KB 3OAZH 3ARDD 3ULVD 1T7YA 5BZWA 3MRMA 5DLML 4X7TA 3RWGB 4JFFB 5F7NC 3OZ9L 3S5LA 1HHJA 3ROOB 1XGQB 3OB0K 3NMEA 3P3YA 3BPNB 1KJVA 1R3IL 3ES6A 3QPQD 4Z7NE 1JGDA 3EYFB 5C9JA 3D48R 5DUPH 4UUJB 3C5ZD 4JREC 1CXEA 1XIWB 3HB3C 3ARBC 3M45A 4EQ2A 4HDIA 4PJ7E 1AD0B 1IEBA 4YO0B 2YZ8A 5ACMA 2F5BL 3HZVA 3IKKA 4ONFL 3DBXA 2W9DL 4K7PY 4LGSB 4ZDHB 1XGPA 3UAJD 5AD0A 4KRLB 4J23A 3SJVB 1JI2A 1U8IA 1NEUA 2HFGH 1HCFX 1NGPH 3CSYB 4PB9L 3TGXA 3SN6N 5HHPA 3DO7A 2XXCB 1JMXA 4GKSB 4KMTH 3DX8A 3SPVB 4F7TB 1WFTA 1S7RB 4PGDB 3FQUB 3OB0H 3QUMH 1TZGH 2QR0A 1FZMA 3S7GA 2LFGA 1NCDH 4KUZH 4MJ5B 1XGTA 4OZFG 2ZCLH 4M1GH 3WMSA 4ODHL 1Q1JL 2LAGB 3HE7B 2HRPL 4X8XA 2A6DA 2ICWA 2Y25A 3MJ9L 5D7KE 4JPIB 1CQKA 1G9NH 2IPUG 3O4OC 1MHCA 1G7MA 4Y16D 1F8TL 2PXYA 3ARFB 3IJYA 4NBYB 3UC0H 3TN0B 1M71B 2PW1B 1XF4A 1A6TA 1Q0XH 3BKYH 3O3AA 2YA0A 4FFZL 3PWLB 1A6PA 4U6VL 2YA1A 3L3OB 4QRRA 3V4UH 3ILQD 4DN3L 1UXSB 3F7VA 4MVBC 4N68A 3MRJB 1A6AB 5D2LB 3P4NB 3HNVH 1KIRA 4YWGH 3I2CL 4W68A 1I1CA 5IOPA 5ANMA 5F7UA 4ZSOE 4YHYC 4KGJA 5DR5H 4K9EH 5D2NA 1D6EB 1GZQB 3PQYA 1IC5H 3RWDB 4XB8A 4S1QL 1PY9A 1JZ3A 5TF0A 3MODL 4DTGL 2DLIA 2FH6A 2IAMD 3D2UD 4H1LH 4PY8J 2E7CA 4PY7B 4AH2B 1FO0H 2F8XC 3DGCR 3ORJA 1XT5A 1Q0XL 2XTJC 4HF5H 4JFFA 4TNVK 5GRZA 5I9QB 3ROOA 3NIFE 2KPNA 5LQBL 2PXYC 3W5NA 5EOCJ 3EYFA 5FKAA 4UUJA 1XIWA 1T0NB 2YN5A 1A5FH 1AD0A 3HNVL 4IRZL 4YWGL 4ZS7H 4YO0A 5GGVY 2R4RH 2P1YA 3H9YA 3RWFB 1DBAL 1C08B 4LBEB 4LHQB 3GBLA 4UU9B 4ZDHA 3LEYL 3SJVA 4NP4H 4CN1A 4WFFD 3I9GL 3QEGL 3O2DH 2WIMA 3FN0H 2EDDA 3CSYA 1T2JA 1QSFA 3KPRE 4RMUA 1E4WH 4OCRH 5CZXC 3SKMB 1Q9OB 5HPOA 4UQ2B 2FBJH 1D6VH 3X14A 3SPVA 1S7RA 3DV4B 3FQUA 3RQ3A 5HVHB 3HMWL 4ZAKB 3ZSSA 2X4QB 4IOSD 2I26N 2WMPA 4U0QB 3ZTJG 4MHHI 5HYSB 4PLJD 3C5SB 3PG2A 4MJ5A 2MCPH 1Y6KR 4M1CD 2AEQL 2ZUXA 1D5MB 5JXAH 1A5FL 5CWSB 2UZIH 3B43A 3HE7A 4NO2B 4S1RH 5L6YL 1I7TB 4AEIH 3RGVB 1INQB 4FG6D 4CU6A 4X6CF 2R4RL 3FB7B 4N0YL 1DQLH 1XIWC 1S7XB 5K9QG 4JPIA 4JHWH 5IVOA 5L2JB 1OAUH 2RFXA 5EULV 4LIQH 2HJLA 3BZDA 4IRJD 5ESVB 3MRHB 4KDVA 1NGZB 1QFWM 1E4WL 3ARFA 3TN0A 1M71A 1J5OH 2P8MA 2MKLC 4HUNB 1RHFA 4WW2F 1MFCH 3ARQA 1JPGB 1D6VL 4LLVA 4TSBH 3KYKH 1L4IA 3PWLA 1GIGL 3FT3B 3ZKSD 1B2WH 3L3OA 2W59A 4MSWB 3U46A 1NAKL 3GJEB 1A6AA 5D2LA 3PL6B 4Z18A 4K94C 2NY7H 2VLMD 1QLEH 5DD1H 4U1SB 4KK6D 3BH8B 4URTB 2E3VA 1D6EA 1GZQA 2HJKB 4G6FB 4XX1G 3RWDA 2O5XL 3HE7C 3CU1A 3IETB 3X3GL 1A7QH 4L5FH 3JV5A 5E9DB 4GW5B 3BN9C 4LPCA 3QJHB 4PY7A 4UOJA 1XGRB 5DJ0A 4R26L 2C5DC 4BZ1H 5BQ7B 4EOWH 3KPQB 4FP8H 3KYKL 3MBXL 2ADJA 4QTIH 2FD6L 3ARFC 3MJ7A 2D03L 4LPXA 3TN0C 3I50L 4PRHD 3CXDH 3IXAB 4KGLA 4U31A 1T0NA 3P4LA 1B0GB 5GGUB 5FYJD 5IVZB 1JGUL 1T5WB 4F37F 2F74B 4Y4KB 3KPSD 3N50A 3CH1A 3C2AL 5K9KB 3BIKB 4JRYE 4GG6B 2P5WE 4NNYB 5DD1L 4F33B 1C08A 4LBEA 4UU9A 4HQQH 4KQ4H 4XPGH 3RWIB 2DQFB 3WDHA 5HD8C 4OGAD 3RZWA 3SKMA 1AGCA 5HHVL 3FRPG 4IOFC 4DKDC 4UQ2A 1HHGB 1IM9B 4MNQE 1IC4L 1KCRH 1T22B 4AIZA 3DV4A 2GSIA 4KHXH 1BQUA 3QDMD 3HPLB 4ZAKA 2EDQA 2X4QA 3L5JA 3QCUH 1ITCA 3H3KA 2ICES 1YMMD 2IADB 3ULUE 3CXDL 3P0VH 4JDZB 5A3IC 5I9QC 2GTZB 2XWJB 2ESVB 5F7HA