2Q20A

Structure of the germline vk1 o18/o8 light chain variable domain homodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
TDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPYTFGQGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vk1 O18/O8 germline light chain variable domain
publication title Altered dimer interface decreases stability in an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 29
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q20A00
2ARJQ 1MRDH 4LEXH 1JGVH 1DBBH 3UPCA 3EYVA 5IBUB 4LDEB 3L7EB 3FFDA 2BFVL 4X7DC 2VZVA 1I9IL 1FZKA 2WQ8A 3Q6GH 1DBJL 2CKBA 5BVJB 1FNFA 1P2CB 4MNGA 4QF1B 2NW3A 1LILA 2V17L 5B3JE 4RAUA 1CT8B 4FMKA 3P0VH 5FO8A 1J1PH 4OZ4A 2PW2A 5E0QA 3TPUA 5JTWA 5E94A 1BF8A 1F4XH 2HT2C 4OZIB 4JHAL 5DD1H 9CGTA 1MCBA 4WJ5B 5DQJB 4DUXA 1HH6B 2OI9C 2YN3A 1I7ZB 5F7KC 1IARB 5J6HA 4XZUB 4M7LH 3TBWA 4JQVA 5F6HI 2X1PA 1SJEB 5TQ0H 4F7CB 3EYSL 4M5ZH 3FO2A 3OR6A 1FZJB 1T1XB 1ZT7A 5I8EB 5I1DA 1FYHB 1YUHA 2PTTA 3ROLB 5HHOE 4WI7A 4R90H 2X5PA 5HDBE 3BP7B 4PJGF 2PETA 3NA9L 3PABB 5C0IA 4L8CA 3PJSA 2R29H 2VRAA 4WWKC 5C0DB 4MD5A 5E99L 4JFXA 3WXWL 4KVCL 5HHQB 3VXUB 5M95B 3S36H 3DVNB 4N0CC 1K2DB 2GI7A 5D7JB 3D18A 3GRWL 3ARXA 4AM0A 1T7ZA 1CDYA 5C2BL 4R4NC 5DMIH 1R24A 4GG8B 3R06B 3TA3B 5EBWB 2EIBA 2ITCA 2APWA 5SWSA 3EOBA 4LSDA 2UWEB 5I8KL 1T1WB 1JVKA 4TULL 4BFGA 3RHWK 4X6DB 1UC6A 1AHWB 5EOCH 5BS0A 4P2YA 3B2VH 1MIML 5HXMA 4YHMH 1OP3K 3RWIB 4N90E 3LEXB 4TVPD 2YC1B 4GQPH 2W60A 2B1HL 1I8IB 3MRNA 3QYCA 4Y2OA 2HRPH 3K4ZA 5IG7A 3RIFK 4F7TA 5I1KL 5E2WH 1KG0B 5D7JD 4JRXB 3QB7C 1QR1A 3U4EA 3UDWC 3CJJA 5IMKB 4JN2A 1R3KB 3U7WH 1KN2L 1D5IL 4G9FD 4Z6AT 2AS5M 4QT5B 3RVWC 5T1MA 3TA3D 1JYNA 2HLFC 4J3VA 4LLYB 4RNRB 1KV3A 3S96B 3Q2CA 1BM3L 5ESAA 4F8TA 1OGTA 3ZKND 1F3DH 3BPCA 4V1DA 5DRXA 3W0WE 4G6JL 3Q0HA 1JPTH 3TP4A 1AKJA 3T0AA 1IC7L 1AR1D 4UUJA 3MLXL 4LU5H 4KROB 4O4YL 4L3EB 3SJVE 1EXUB 1ORSB 4LFHG 2BVOA 5BRZD 2IQ9L 4GMTH 4NKOB 2ZPKH 4ODVH 2WZPD 5I2IB 5I8CA 4XNYL 3NH7H 2RB8A 1LQSR 2CR3A 1KSRA 2QV2A 4YDJB 1YQVL 4EVNB 1CGUA 4GMSH 1IC4L 2VLLB 5FV1L 3L3GB 4AL8H 5IP4A 1WF5A 1GGTA 4XCFH 1E6JH 1OAQH 3UTQA 5MEOA 3CDGA 1ZGLB 4EZMA 5EULV 3BEVA 5FHBL 4P5TD 3VWJA 5F3BB 3G04B 3MYZA 4BH7B 1EGJL 3H9SB 1QLEH 4OFYD 1GPOL 2JJSC 4HWUA 5I75C 5FOBA 2OTWA 2DKUA 2BNRB 3RDTA 1T04B 3MJ8B 3NGBC 5DS8A 2DDQL 3QUXA 3MA7B 3HUJB 3DHMA 4NQVB 1IFHH 1MCIA 4X5WB 5ENWB 5GRYA 3L7FA 4WGWB 5F9AC 2FBJH 1P6AB 3EJZD 4GJTB 5C09D 3RWGA 4L3ED 1ZHNA 3FB5B 3MV9A 1U8OB 5E9DD 1GIGL 3INUH 1M7XA 2EYSA 5D93C 1JPFB 5D1ZC 5DQDH 4WU7B 3LZFL 4Z7VF 3QJHB 1S7SA 4YFLI 1CGSH 2VDLL 3PWUA 1FZMA 1QSZA 3C6SB 2MKWA 1G7JB 5HYQB 4UAOC 1CR9H 3WFCL 1W0YT 5EZLB 4DQOL 4GAYA 4IRSD 5CLWA 3V4VH 1T6WA 2BNRD 4GRMB 3BN3B 5DFVD 1AH1A 3H6JA 2AJXL 4BM7A 2L7UA 3GSRB 3K8LA 2CKBH 3BPLC 5ANMA 4D3CH 2XA8L 4PP1D 1RHFA 5IR1A 3GHBH 4HV8A 2NR6D 3OKEA 4KHTL 1CXEA 5GSVA 1FJ1A 3T0DA 4OZFA 1YC8A 2ESVE 3EDDA 5F7NC 2VXVH 2H8PA 5J6GB 1U92B 3DMMA 3OSKA 2R0WH 4MWFB 4P46A 2AQ1A 3NCCB 3ARSA 3B4NA 4U1NA 5F7DA 1GGBH 3QPXH 1L7TH 2APFA 1TZHA 1A6TA 5JR1H 4FQPA 5IB1B 2CLZB 3TJHC 4B41A 1CDIA 2E9JA 1F2QA 2A83B 5INCB 1RD6A 2W38A 4PJEA 3L95B 4NN6B 3JV4B 4UOW1 1KGCE 3T77A 2ZNXA 4JKLA 4LCYB 1B88A 2Z93B 4M1CD 4YBLC 3ZKXC 5L9DH 1T66D 1QA9A 4KRMB 1OM3L 2EH7L 1GSMA 3AY4C 4LAJH 1GVIA 3LVEA 2WWKT 2ADIB 2LU3A 4LLWA 4NM8H 5AD0B 1T03H 2ZWLT 1NFDE 5DQ9A 4PJ7E 3O3DB 4PP2A 5E6IC 3MXWL 3FT3A 1RJZB 1IKFL 1NUFA 3TNMA 3U0TB 4JVWA 2MCG1 4AY0A 3U83A 1YDPB 5C9KA 3QWQB 4OZGF 4D2NA 1U93B 3IYLW 2DD8H 4YHIB 3X11A 3HZYA 3KYAA 4QHNA 2NX5B 4DKFH 3UAJC 1F3JA 4QGTA 3FT2A 2HTKD 4Y5VB 3IXAA 4IIQA 4U31A 4YXLH 4JY4B 4NO2B 4CVWA 1T7XA 2QJDA 1R5VB 4HAFA 2VL4A 3T3MF 3QZWB 3QIBA 1E4XI 4HK3J 1MNUL 4JAMA 1BFVH 4LRIA 1P7QA 3HTLX 1NANH 2G9HB 1F6AA 3SE8H 2FHBA 3F58H 5TE4H 4AJ0A 4APQC 4F15B 4D9QE 1IGCL 2EZ0D 2VLJE 3ROOA 3G6JA 1E6OL 2NY4C 5DJZB 3PGFL 3CDYA 5DF0A 2IADB 1CF8H 2P42B 4R0LC 4DKEL 1DVFB 2IAMA 1OAZL 1V8HA 4L3CB 1XZ0A 3IDXH 5DC9B 4ZUVB 1RFDH 1R3IH 5CINL 3FCTA 1EDQA 1Y6KR 3QIUC 2NX5D 4J12A 5CD3A 2FEDD 2BMKA 4F7PA 3JV0A 4L9LB 5ICXA 1A14L 3WFDL 1U2HA 3A6BL 4KTDL 1NBYB 3FMGL 5JUEH 1PZUB 4Z7UA 2NZ9D 3HAEH 1XGRB 5C0FB 2BNUA 4BQBA 2VH5L 3MNZB 1N5YL 3T09A 4IOIA 1FPTH 2Z8WC 3MO1A 5HGAA 2NLJA 5AG8A 2VZSA 2IPKA 1BJ1J 5I1GH 5D7IF 1B6DA 1FC1A 4LL9A 5H94B 2NY1D 3WFEL 2BERA 3MGTB 3EGSB 1FE8H 4CJ0A 2GCYA 2FYYA 5I1IH 4ONFH 1KLGB 5I1HL 1FDLH 4RWYL 2X4RA 3DVGB 1JCKA 2FGWL 1NMAH 1L9MA 5D7SH 3UP1A 4WUKH 4F80A 5HHPB 2EDBA 1I7UA 4IMLA 3F7QA 3VW3H 3Q48A 3HNTH 4YJZL 2Y07H 35C8L 4H20L 4IJ3C 4JANB 4RIRA 5D71L 4NQEA 2QR0B 2V5YA 1IM9D 2HN7B 2X4TB 4DEPC 3MV7B 3MFFA 4WEBH 1DQDH 1QSEE 2C5DC 3L3DA 4L1DA 4R2GC 12E8H 4OLUH 4LGSB 3TCLB 4LNRB 4E5XA 1P7KA 3G9VA 1S5IL 1PJ9A 3DYOA 5J1AA 2QQKH 1ACYH 2YRLA 4ENEC 1SMAA 4XTRC 2Z91A 2W9EL 4QRPB 2BY2A 5IEHB 5JHDB 4HQQL 4AIXA 3FN3A 1HOCA 4QRSA 2W0PA 1ZVHA 3B8YA 5T5FL 1GC1H 1MAML 4MB3A 5IB3A 2CK0L 1T4KB 5I16A 1LE5A 1JPSH 1BP3B 4PJCA 1MCJA 4OZFH 3ARQA 1U9KA 3VI3E 1A6UH 2QHLA 3MCKB 5ABDE 2DLEA 3BAEH 4ZSOE 3KR3H 1X4YA 5E4EC 4AIZB 1KB5H 3CXDL 3DROB 2KZ1B 2WBJA 2ZSVB 3WBDA 4J3XA 4PJXF 5DJCB 1U8HB 3KXFA 2AEQH 2OR8A 3LPFA 4J3OC 5FYKD 4QRPD 3KVQA 4PJIE 2EXWC 3SDXE 5JHDD 1CIUA 2E6PA 1Q0XL 4P57B 4JM2F 3QA3B 4MJ2A 1MCOH 3U82B 3CX5J 1MJJB 4S1QH 1W0VB 2EYTB 4N8PA 2XZQL 2YD2A 1QNZL 3HFML 3AM8A 4LSQH 1CGWA 3VRLE 2DS4A 4YH6A 5EOCJ 4DUVA 4YHNA 4LCUA 5IEKA 4OZHA 1DBKL 3H9HA 2WP3O 2DI7A 1T2QH 1MHPL 2AK1L 3MMEB 1A6AB 1AIFB 1BX2B 1NCCH 3IF1A 1EMTH 4C55A 3UJJL 4POZD 4JY5H 4NUGH 1PYWA 2VDNL 5AAMA 4DN4L 1LEIA 5A16B 4WO4B 5AZ2L 1A5FL 1AJ7H 3W2DL 1QLFB 2MMXA 1LEGA 1XT5A 4R4BA 1BIIB 2UZYB 4OCXH 1CDJA 4LASL 1Z3GL 4PTUB 2CDEB 4L4VA 4JPIB 2XKSA 5LQBH 1BECA 2DWDA 4KQ3L 1BZ7B 1VKXA 4ONGH 2APTA 4NP4L 5JXEA 2ADJA 1UB5A 5CEXA 4MDIB 4MXQC 3DXAD 5I76A 4PRIE 4RSVA 1KCUH 4OLXL 5GGRB 5IVZB 3BE1L 3NZ8B 4ODTL 1IT9L 1NEZA 5E8EB 3OR7B 3BJLA 1F97A 5IBUG 3WXVL 2DI9A 3SOBL 5EU5B 2IANE 4YZFF 3OXSA 1C12B 3TO2A 5IMLB 3BQUA 5C9JB 4I48B 1RJYA 2W65B 4M7KH 2IBZX 5DTFB 5JQ6L 4HDIA 1J5OH 1FL5B 3D85B 3CU7A 3KPLB 1AP2A 4TNWF 4MAUL 4U6YA 4YGVB 1DQLH 1QBMH 3P3YA 2F53B 3SDDA 5FF6A 4FNLL 5F9OL 3LB6D 5GZND 3F5WB 3P0YL 5C0AD 5AEAA 2MFNA 1ITBB 2XNAA 7FABH 2HAZA 5DJYA 4YAQB 1CTNA 5F9WB 1BVKA 5B38B 1CG9B 3QCTL 2FO4B 4C56A 2AK4E 1HYSC 4GH7B 4QHLA 5L2KA 4OM1L 2PO6B 4S0TD 5L0QC 1F90H 3E6HA 4OLWH 4GAJL 4D9RD 5JHLH 5J06A 4I2XA 4JRYB 1T5XB 5LAXA 3UTTD 2NY6C 4HMEA 2VDMH 3EO0B 4XCEA 2XZZA 2DRUA 1FLRL 3GKWH 5J8OA 2QSQA 2F53D 1IGFH 2YSSA 4QRRE 3ETBF 4HKZB 4Z7WA 1BJ8A 1MRCH 4KHXH 4UILH 3CUPB 5JA8B 2X1XR 3PWNA 2FHCA 3RL1B 4JPKH 5E6YA 2FL5A 4Y16B 3HPLB 3MUY1 4PG9B 4RFOH 4AEFA 3RGVA 3TZVD 3FZUC 3GMQA 4OLYH 2M8XA 3QUZC 2NY3D 2LFGA 1Q9WA 2PO6D 4OCSH 4S0SD 2VWEE 2DQDL 2CIKB 4M6ML 4EUPH 1MWAL 2X4QB 3TNNB 2BCKB 4JY6B 1I4FA 3KLAA 5D2NB 4Q0XH 2KPNA 1DP0A 4PJAF 3O2DA 3K1DA 4QXTA 1WWBX 3OG4B 3IDJB 4D8PA 1OT1A 3SE3A 3HNVH 3GO1H 1N7ML 3QWRD 4NZUL 4ZFOA 4PRPE 4PJ8B 4ZO7A 1RK0A 5KSVB 3TH3T 2VLKB 4CW1B 4OGXL 4Y16D 2HH0H 4OCRH 5EO1A 4OF0A 1O7VA 5F96H 3IS0X 3CFDA 1QFPA 2MQ3A 2Q87A 1MCFA 3CSYA 2DYPA 1VDGA 4QKXB 1U95B 1DE4B 4TQEL 4OUOA 4P4KA 4PJHB 4HCRA 3MQIA 3W39A 3D39A 2GQHA 4MA8L 2I60H 3ZKMD 4ELME 1TQBB 2DBJA 3R8QA 3DBXB 2FJGA 2ZJSH 4ERSH 1T0MB 2V7NA 1XGYH 1LP9A 4U6VH 4OJFH 1OAYH 1KPVA 1RAMA 1H3VA 1TZIA 2A74B 3L3OB 2YPKA 3GUTB 4YBHA 4PJ8D 1MLCB 5D5MB 5HYJA 5DZLA 2HKFL 2MPAL 4JB9L 4F33A 2DJ4A 3VXPA 1JUFB 1A2YB 2DTMH 3MUJA 3EZ8A 5BO1L 3U4BH 4PB0H 4DOHE 3QJFA 5DJDA 4Z7QE 2R2BB 2VXUH 1NCWL 4I9WE 2FCBA 5D7LE 5BMFH 1OTSD 3VGAC 3IU3A 3KPNA 3S5LA 3SE9L 4X6CA 3EFFA 4G80B 4RGNB 3WHXB 4NO5A 5FYLH 2B4CL 4XXDB 4PJ9A 4RGOL 3BYTA 4FQJL 1N64L 2EDDA 1S7RA 3FFDB 1FSKC 1QG3A 1FP5A 1GHFL 2HFGH 5EORH 1QO3A 3QQ4A 5JDSA 4KI5D 4UV4H 3DUSA 1EHAA 4S1SL 4X0KB 1NJ9A 1IBGL 4OSUH 5EU6A 4MMXC 2A6IB 2CKBB 4BZYA 4KVNL 1S7UA 4MNGB 2VO5A 1FGNH 2EE3A 4NO3B 5EUOA 3EOYG 5F7MC 3ARYA 4M4RA 1TPXC 5A2KH 4N1HB 5DMKB 3CVIH 3BN9D 1P9MC 3ARGD 4OZ4B 4ZS7L 5E2TH 3TPUB 5E8PA 4NQUA 3UTSE 2HKHH 5CP3A 1OL0A 3LEYL 1DFBH 4OGAD 2ADGA 4CAGA 3ARRA 1IQWL 3E6FB 4DUWA 4GG6A 3RVXD 5DRNA 3QDJB 5JOPE 5E8OB 4FN0A 2CH8A 3TBWB 3KJ4C 2COQA 4FQIL 1JZ6A 1FNAA 3N1QC 5FUZH 3BMWA 4JPWH 4MQ7A 3DIFA 1ZT7B 6FABH 4M03A 4OF8A 1YUHB 4CVUA 3ALXA 2PTTB 1QRNA 3BH9A 3A6CL 1A64A 3GI8H 1KCRL 1ERNA 5CS7A 4YX2H 2Q3AA 4KKCD 2P45B 2R1WB 4FOMA 4F58H 5C0IB 5B4MD 3PJSB 1XCTA 1A7RH 3E0GA 5ALCH 5I1EL 4YHOL 4ZPVA 5DK3A 4MD5B 3NIFF 1KLUB 4XHJD 2B5IB 4H8WC 5GGTA 5ILTH 2HJKA 4WI8A 3RZCC 4NKIL 1TJHL 3N0PB 3VG0L 4OCYL 1H8SA 5A1AA 4PGCA 3JVGA 1J0ZA 4WHTA 4S1DD 3AREC 2O5YL 3PP4L 4LCCA 2IPUG 1Q9LA 2NTFA 1E4KA 2ITCB 3QH3B 1RZJC 1NCTA 1GGIH 5FGRA 3EOBB 5IOPB 3V6OA 3NCYP 4Y4FC 1EEUA 3EYQD 3C6LA 1OAKH 3EFDL 3MXVL 2AV1B 5BS0B 1U8JA 1YNLL 2ENSA 5I1LA 1A1MA 5ITFA 4KRPC 2HJFB 5C0BE 4HS8L 4L3AA 3GB7A 1EHLL 4WWKB 2GEEA 2W60B 4V2BA 1N6QL 1YNKL 5KW9L 3MRNB 2G75A 3VFGH 2YK1H 1DUYA 4FTVE 4M00A 3T2NH 2BK8A 3MRJA 2CXGA 4DKAA 3NCJH 5A43C 3DVFA 5D9SB 1QR1B 3MLVL 3HE7C 2FJHA 4ZAKC 3U4EB 4W4OA 2VITB 4JN2B 2AABH 4MLSA 1D9KC 3SGJC 3Q1SL 3IVKB 4R26H 4Q9QL 3UYPA 2ICWI 3G5XB 5TF1L 3NIDE 5ESAB 5SWSD 4PJ5E 2VAJA 4JO3H 2CRYA 3VXSA 3BPCB 3P2TA 5DRXB 5JPNB 3QZWG 5SWZE 5IWLA 1AKJB 5BS0D 4UUJB 3BYYA 4KXZI 3C60C 2I26N 2BC4A 5DVMA 2YD3A 4LLUA 1OQXA 4OCMC 3EDKA 4H8WL 3FHAA 1V3LA 3HI6L 5FYJU 3PDOB 3L3IA 4YE4L 5BCAA 3BKCH 3WIHL 3IAPA 4MNQE 1EBPA 1KYOK 1RZ8B 2Q86B 5MENE 4O02H 5D1XB 3TFKD 5JLZB 1UJ3C 1H8NA 4XP6H 4OAWA 3PL6D 3QQ3A 1AGFB 2P5EA 4XNMB 3UTQB 2EDQA 5MEOB 1RZJL 3BEVB 2X1OA 3PV6A 4MX7A 4HCRH 3DURA 1LMKA 1AGDB 3L1OL 5T5NG 4AEIH 4G6AD 3QG6A 4M7JH 1R3LB 5FOBB 5DJAA 4OF5A 4LPVA 5DS8B 1D7FA 1I1AC 3QUXB 4V1DD 1SBSH 5ISZA 5MP6H 3F8UB 4J4PA 1AKJD 3AFLA 3L7FB 3TYFA 3ULSB 2R4RH 3QG7H 1CFVH 3MV9B 4OCWH 1ADQL 3DRTA 3BP4A 1A3RH 1U91A 4XVJL 2E7CA 4ZFZB 4QCIA 1S7SB 5JO5A 5C0CE 4HF5L 3KPMB 1P5VA 1OD9A 1NCDL 3RVVD 4NQDE 5EZOL 1E0OB 3RU8L 4A2MA 3VWJD 4X7TA 1EJ6A 5DR5L 3AB0B 4D9LH 4O9HL 4HFUL 4PY7B 1G9NC 4W6XB 3I3DA 4KUCF 2Z4QB 5E5UB 4G8GE 1NGQL 3BJ91 3MGOB 3RDTD 4JCLA 1JK8A 3QUXD 1IZJA 2FNBA 3MRLA 3UMTA 5GJTH 5ANMB 3I02A 3CGTA 5KVGH 1N5AA 5IR1B 1FAIL 4HV8B 1UGNA 1R5WB 1XGPA 1CK0L 4R7DA 5HBBA 1DN0A 3DGGB 3DOSA 4P2OD 3IAQA 4OZFB 5D1ZB 4LQFL 3GIZH 5HSFA 1IKNC 3DMMB 5CP3H 4OM0H 2DIAA 4Z0XA 3N1MC 3QQ9C 5JOEA 5DUPL 1KBGL 5ESVA 5T3ZL 5F7DB 1IEAA 4UAOB 1RUQH 1TZHB 5T3ZE 2AXGA 1HSAB 1A6TB 4KMTH 1QFWH 4WNQA 4PLJC 2V9TA 5JORA 5HGGS 1E4XL 5DHVA 1T22A 4YBQD 3QUKA 2VSDA 1AGEA 1GZPA 2Y6SD 3T77B 4DCQA 4OKVA 1F58L 4X9IA 5AUMA 3HMWH 2DQGH 1YPZA 4X6EA 1IGYA 2ZCLH 4HUUA 4XC1L 4R4FH 3ULUF 1KULA 2LU7A 5DQ9B 4PP2B 4PLNC 4I1NB 4M6AA 1DBMH 3DMMD 4P46D 5MEPA 4XCCH 1FIGL 4UNVA 4B0MM 3SO3C 1QFHA 1OW0A 4HXBH 4JQXA 2XZAL 5GGTH 2VDKL 1QD0A 3RWHA 4Q97A 1S9KC 1G9NL 2I24N 1AE6L 4QHKI 2EDOA 3HZYB 1JWSA 3WLBB 3WDHA 5LXGL 1M71A 4NOBA 3IXAB 2YPLE 4OCNC 4O2FB 1OVZA 3BP5A 2N7BA 4I77H 1KENH 1FN4A 1QR4A 3HMXA 4JAMB 2JJTA 1P7QB 5DJ0A 1F6AB 3O2WH 4NWUH 4UZGA 3O6ML 4QHMB 1A1NA 2XTJB 3AU1A 5E6IB 1FFOA 4AQ1B 1A3LL 1IGJA 1KPUA 3G6JB 3VD5A 2FATL 1N8ZA 2J88L 3STBA 4NWTL 5J12B 2EIDA 4JHWH 2IAMB 4JO4L 5IROC 2J6EL 4D0DA 1XZ0B 1I1FA 1U8QA 1ZT4A 2HVJA 1MI5A 5EU7C 5CD3B 4PIRF 3U9PL 2BMKB 3IDIB 4LLDA 1RHHA 4Z18A 4BZ2H 3LRHA 4M48L 1FVEA 5ICXB 3WJLC 4UTBL 1FL6A 5EH1A 4L4TE 4AH2A 4QWWC 1MELA 3QIBD 1I3VA 5GZOC 3EHBC 1B0GA 1P7QD 3X14A 2I9LA 4XP9L 3BKYH 4XPBH 3NTCL 1KLFA 2VNCA 3C5ZA 2CGRH 2GJZA 3PV7A 4F2MB 2XTJD 3WCYA 4APQB 1BGXL 2BNUB 3QFJE 2YMXH 1YEJL 3IRZA 4L5FH 5HGAB 1QFOA 1QUNA 2NLJB 4HJGA 5I1CH 4M6OH 3MLZL 5EDXA 1A9EA 1M05A 2IPKB 2IAMD 4PS4L 4LVHC 5IW3A 4CNIA 4UIMA 3M8OH 4MD4B 1J8HD 2ORBH 1MFDH 1CE6A 1WV7T 2BDNH 1JNLL 3QIUB 4UT6H 3MACL 3OKMA 3R0MA 4DTGL 3GMLA 1G7PA 4OV6F 3UX9B 1I8LC 1XR8A 1BJMA 1I85A 1CLOL 2AGJH 2E27H 3ZHKA 4JFZH 1YA5A 3SGDI 2NYYC 5I19L 1BD2A 2NXZC 3RAJH 5FO7A 3L5IA 2X05A 4IMLB 4CGTA 5B38G 3QNYA 1PX3A 1EH9A 1X5XA 4XPAH 1MREL 3PHOA 4FMFA 1AI1L 2YWZA 5TE7H 4RIRB 3FOMA 4HK0A 4NQEB 1OTTD 5C0RH 1KCLA 1QBBA 3L3DB 2APVA 5KN5B 1CDBA 4ZG1A 1KFAH 1LK3H 2PR4L 2GJ6B 2BVPA 5TQ2L 3SDAC 1AD0A 4PTTB 4XI5C 2EC8A 4QXUH 5GS3A 1U8MB 1FNLA 4K3HA 4K23H 1A7NH 2AI0H 4FS0A 4LGRB 4G6MH 4ZXBC 4K3DH 3MOQA 1HOCB 4QRSB 5ECJE 3ZE0F 4XVSL 4QTHB 1D5BA 5IB3B 5I16B 3WMSA 4OFIA 4U0RB 4FP8H 4RQQA 5IB4B 3BGMA 2WUBL 4NQED 3K1KC 3D3VE 1IGIL 5L8KB 1OTUD 1XF4A 2EO1A 2QSCH 4DEPB 1G6RB 4LBEA 2CJUL 1FORH 2DQUH 1AO7E 3N9GH 5E1HB 1MRFH 2ERJC 3BEWB 2DM4A 2WBJB 5D1QA 2OTPA 3QUML 3OZ9H 3LEVH 1MFBL 1YEKH 3KXFB 2A77L 5DHVH 1KIQA 1EO5A 3HI5L 5DHYA 1NCNA 5KSBF 1JZ4A 2BFVH 1ZANH 4RRPG 3CZJA 3G6AA 4Y88A 2OR9L 4U4BA 5KANG 5I0DA 4XP5L 3SQOH 1S7VB 1X5ZA 4Z7VE 4EI5C 3QCVL 2V17H 2F74B 5D8JL 1CQYA 1T83A 2J8OA 4XAKD 2EDNA 2ESVA 1TJIL 4FQHA 4OQ1A 1DCLA 5BVPL 1MFCL 5IEKB 1OSPH 4WW1B 4N9GB 2OYPA 3E1F1 2IALA 2ZG3A 3IF1B 4G43A 3I2CL 1SYSA 4QOKE 2QBWA 3RWJB 3PP3K 5DJ6A 4OI8A 1LEIB 1MCCA 3VWKC 4FXGA 2X9YA 5T1DL 1EHNA 3KXFD 2HVKB 5DI8A 3CXHK 2RFXA 3EW3B 4P2CG 4P9MH 2DJSA 1KTDB 2NY5C 4Q9RH 1LEGB 3EYSH 1NAKL 4PLKD 4X6FA 5FDYA 4R4BB 4QNPE 5DJ2A 2OCFD 4KKAD 3PWLA 1Z5LA 4BFIB 1VADB 2DWDB 3HMXH 2KQNA 3D25A 3FFCD 3F12A 4TYUA 1NFDA 2ADJB 3QXAA 1UB5B 4Y89A 3WFBL 4PJ7A 3NA9H 2BVYA 4KGLA 2Y36H 5D70L 2DKMA 5FYLD 2AK4B 4YDIL 1NEZB 1UVQA 2K9UA 2FJFB 4U1JA 4KVCH 3TIDB 3HLAA 1HZHL 5C0ND 3NFSL 1JHKL 1YY8B 3OXSB 3V95A 3O3AA 3TO2B 3BQUB 2I07A 1RJYB 4PRHE 3VMNA 5C2BH 4I18A 3UYRL 3QCUL 1S9YB 1AP2B 3QRGL 4U6YB 2VUYA 4U6XA 5LGKA 3SDDB 1MFAH 5FF6B 3JTTB 2NCMA 4L4VD 2J8UB 5I8KH 4A6YL 3QDGE 1UZ8A 1KT2A 1H3PH 2H26B 5DC0A 8FABA 2EC9T 3O3BA 5JXED 2XNAB 4X4ME 5DJYB 3K2UL 1DBAL 2W1NA 1MIMH 3VU2A 3MODL 4GKOA 2XWJA 4OZGE 2VLJA 4C56B 3RVTC 4QHLB 3Q5OA 3VFOB 4FA8A 5L2KB 3K46A 1EIBA 1NFIA 1TTFA 5K9QG 3U0WH 1J10A 1JWMA 2NY5L 4QYOA 1MH5A 4HS3B 3BQUD 5DYOA 3G5ZA 1HHIA 3FQTB 5IESL 1D5IH 5CMAA 3T3ME 1S3KL 4NT6B 3SDDD 4UQ2B 1BM3H 2YSSB 3R1GH 4K7PY 1DQJA 3O0RL 3UPAA 3PWNB 4XP1H 3GSNL 4G6JH 2FL5B 4NN7B 5I8OL 4RMTA 1IC7H 3HC4L 4U1HA 2QHRH 3RGVB 3VD3A 2EDHA 2ZZUT 1JZ2A 4C56D 2QADB 1WBYB 3U48A 2Q7YA 4IOFD 5L2KD 2AJSL 1Q9WB 2CO6B 3JUYA 1DJSA 1W0WA 1K8DA 4XNYH 5AWNL 1CDHA 5TDPA 5L0QB 4OCLC 5E2VH 3RL2A 3ZTNL 1EAPB 3UTZA 2NY7L 1I4FB 3BDXA 3ECBA 3WLWC 5KSAA 3AUVA 4JFFE 3GFUA 5FHBH 5IJVA 5DGRA 1T89C 4ZUTA 4U1KB 4XWGH 2A6JB 4D8PB 1EGJH 3DNKA 1G9ML 1ZKAA 4WFHE 5ITBH 4TTDC 1GPOH 4E9LA 5B8CA 1KXTB 3MLPA 3HR5B 1RK0B 2PXYA 2NPLX 4ZODA 5CJXA 3MRCA 2AEWA 4ZNEE 1R3JB 3D6GA 3RGVD 1JZ3A 3CFDB 2PYEB 1WFNA 3BZFA 5I30L 1A6ZB 4M3KB 1GIGH 2XTLA 4ETQA 2AXJA 5D7IE 1AGCA 2DYPB 1P84J 4H1LB 1WLHA 3W9DA 4P4KB 3T4YA 3K80A 2VDLH 4LPUA 4XNXL 3D39B 3RUGF 1YEDB 3PWVB 3DSFL 2HLAB 2C1PA 2D7NA 2V7NB 2WWMC 3WFCH 1LP9B 1MIEL 5HGHA 1KTRL 5SX4H 2YPKB 1LGVA 5C3LD 4NRYB 4S2SB 1JGLH 5HYJB 4F33B 4KJPD 1RZIA 5HI3D 5FYJH 2XA8H 3IU4H 4RCAA 4UBDD 3GIVA 4KHTH 2I25N 3QJFB 1FFNA 5DSCA 3IDYC 3HI1A 1N0XH 2DYPD 4EDWL 3KPNB 1MCDA 3FB6A 5IV2A 3EFFB 3WO4C 4K71C 4GS7C 3UPRA 4P4KD 3LIZL 3RVUD 1XH3A 4ZSOA 4PJ9B 5CILL 1CLZL 3D39D 1IILE 3QIWC 3MOAL 1S7RB 4PJFF 5CZVL 3HNSH 4HJJL 4X4YA 1MPAH 1QO3B 3QQ4B 4HKBA 5JDSB 3ZL4H 4Z77B 2ZSWA 3U30C 3WN5C 3I75A 4G8EB 1P1ZA 1YNTA 5D96C 3UBXG 4PJIA 1RUKH 1F4YH 2FX9L 5HYJD 5JOFB 5JW3L 4JKPH 3H3PH 4FQXC 4BQ8A 4HC1L 4RMSA 3KLSA 2JCCF 5E8PB 2EH7H 3CD4A 5KG9A 1A0QH 4DFIA 1UCBL 5LWYL 3HC0A 3ZDYE 3VFUA 3VGAB 5F1OB 1CGXA 3MXWH 1SHMA 4UT9L 4XPTL 1Q1JH 4Z76A 1O7SA 4GG6B 1N2RA 4PJXE 3QNZB 5DRNB 4PJ9D 5GS1C 5E70A 2LABA 3KG5A 3PHQA 5BQ7B 5M7QA 4NQCA 4MQ7B 1G1YA 1ZVSB 4L1HA 4YDVB 1BBDL 3PF2A 2PCPA 4JKWA 1SM3L 5EU6D 3LS5L 5E2JA 3LAFA 2BP3A 2ZUVA 3T1FA 1AC0A 3BH9B 3NACH 4JG1H 5KSUB 2IFGA 1W8NA 1MCWW 1BQHA 1NL0L 5CEZD 2VERN 4HPYH 4JFDE 1EUTA 4OZFG 1ZWIA 2B2XL 5IJKA 2EDWA 1FFRA 1MNUH 1RJLA 1BQLL 3LKRB 4YUEL 1T6VN 3P73A 1JPST 4PRIA 2HJKB 1IGCH 4K8RC 5FKAA 1RZFL 4CU7A 3RA7L 1UJTA 3D5OF 1E6OH 1ZTXH 2FX8L 4Z78A 1YC7A 5EZJA 4WHTB 2VSCA 1A7OH 4X7CC 3RX5A 5IBLD 4DKEH 1I8KA 1OAZH 1Q9LB 4OIBA 2SEBA 4CU8A 2YN5A 3H7BA 3RX7A 2D0GA 3ZTJG 5EIQA 4F7EB 4UU9A 1QRND 4Y8DC 1A14H 4HT1H 5ALBH 5IFJA 2OL3L 5J3HC 1U8JB 1MQKL 3ESVF 5D2LE 5I1LB 3BOVA 1A1MB 5ITFB 5SWZB 2EH8H 3QULA 4S1RL 2JK5A 4LOUC 1I3RA 3GB7B 1MHHA 5CP7A 4JFOA 1WGOA 2MQ0A 3FMGH 2G75B 1DUYB 3V52H 1JNHA 3MRJB 3BDYL 3LCYA 4MNQB 1N0LA 3NZHH 2VH5H 1BWMA 1EUUA 3K8KA 1N5YH 3THML 1UKSA 4HHAA 3O41A 5EIIB 2FJHB 3HCVB 3T65A 3DX8A 2OM5A 5HYEA 3OKLA 1DQQB 5D5MF 2HT4C 5TFSL 1CICD 3VXSB 4OD3L 1A02N 3PHSA 4XBPA 3C6LD 5DRWA 1XGTB 4CU6A 3K8MA 1YEHH 2BC4B 4Y19E 4XNZC 3GNMH 4KRPB 2NY0B 3BUYB 4LVEA 1B4JH 4EXPX 3ESUF 4K8RL 5IVXA 1NGWA 3ET9F 4Z95L 3FRPG 1NDGB 2VOTA 3FB8B 4HK3N 1P7HL 3FQUA 3LH2H 3QHFL 2A0LC 3WD5L 5JNYA 1MUJA 4WEUD 35C8H 3QQ3B 5FA3A 1KJ2L 2P5EB 5F7LB 2XA3A 3ZYZA 3HE7B 1UM6H 3BPNC 4PY8J 1MWAA 2R2EB 1T0NB 4MX7B 1D9KB 4NQDB 5JIHA 1F4WL 3DURB 1TJGL 3GSWB 4CRPA 1J1XH 5F70A 3VXSD 5F7HA 4XVUC 4O2CB 2HMIC 2MNUA 1TTGA 3CFEB 3NFNA 1CL7L 1HQ4A 5HDBF 3RKDD 4YHLL 2W9EH 3C60B 1HHGB 4MAYC 4NYLA 2R0LH 3B9KA 4YO0B 2ZUUA 4HQQH 3CFCH 1QFUH 1U91B 1G7HA 4WW2F 2AJVH 4X5XB 4FQ2L 1MAMH 4KRLB 4NDMA 3PIQA 1YMHB 4LCWA 2P5ED 4OI9A 4PJAE 1RZGB 1S7TA 4YFDB 4X7TB 4XBEL 3RTQC 2DOCA 3C08L 3CXDH 4ELMA 4KDTC 5EBLA 3TWCL 1JK8B 1SJHB 4HPOL 5ISZD 2H45A 3MRLB 4J4PD 4G5ZL 4KJQC 3CZFA 3SGKC 2MKLC 3I02B 1U3HA 3SCMA 1JHLH 1XGPB 4KJWD 3FO1B 4R7DB 4X6BB 5E5MA 3VE0B 1Q0XH 1DN0B 2QQQA 2V2XA 2C3WA 3QUZA 3QO1A 3CMGA 4HLJA 1NGYA 4U2ZA 4CMHC 1UB6A 4Z0XB 3VXOA 1QNZH 1BHGA 3V8OA 1H5BC 1OSZB 3A6OA 4DZ8A 1L6XA 1A7PL 4YFEA 1MQ8A 3KPPA 1IEAB 4IRJC 2AXGB 5FO9B 5FKPB 4Y5YA 4LARL 2AK1H 5FDWA 5DHVB 1FLTX 3MV8E 3U2SA 3UJJH 3VXME 1Y18B 4X8XA 4WFGD 2YA1A 4WCYH 4DN4H 1VACA 4OKVB 4JCMA 1A5FH 2XI9A 4X6EB 1YPZB 4BELD 1IGYB 4HUUB 2CRIA 2PN5A 4F9LC 4LASH 3AXLA 4MVBC 3HE6C 5C07D 5FGCB 2X4PB 1OQOA 5E6ZA 4KTEH 4U1GC 3U36A 1S78C 3L6FB 4CL7A 1PSKL 4O5LL 3RWHB 3QUYA 1I1CA 1X5FA 2VXSH 2GTZA 4M6NL 4BZ1H 4ODTH 1Q38A 1IT9H 1JWSB 1A7BA 2VXTH 3LMJH 1M71B 3SHSA 4P59L 4JFQB 1HEZB 3UTPD 4PJDA 3VDCA 4MQXC 3OKYA 4LLAA 3BP5B 4K2UH 5IHUH 1NH6A 1WITA 2Y5TA 3EJYD 1M7IA 3MBEA 5DJ0B 3WYRA 4R96A 1WZLA 1A1NB 1IGJB 4ZOEA 1N8ZB 3SO3B 1FH5H 3RIAK 5DD6A 4D0DB 4XCYB 4XMPL 4R8WL 1I1FB 4GXVH 1SEBB 1CU4L 1U8QB 2HVJB 1MI5B 2IMMA 1INQA 2HRLA 3SGEI 3HC3L 4LLDB 1RHHB 4GAJH 4HGMA 1AXIB 5I6XC 4X83A 5HHME 2HFEA 2AJUL 1MFEH 4XGZA 4YNYB 5H35B 3EUUA 1CD8A 4P3WA 4AH2B 1I9JH 4PGZA 1FLRH 2EDTA 1B0GB 3CNKA 3DUUA 3X14B 2I9LB 4AEEA 2IWGA 2Q1EA 4ZS6D 1D3CA 4LPXA 1CTOA 2ZUTA 2R2HB 3BWUC 5E56A 2EXYD 4LSRH 4FQCH 4ZD3L 1N4XH 2JJWA 1NEZG 3C9NA 2I5YH 3RWEB 1A9EB 1M05B 2QEJA 2WBKA 5SX5K 1Z9OA 4CNIB 5B3NA 4UIMB 2A73B 1CFNB 5JW5A 4HIJB 2FB4L 2WM0A 4M1DL 2P8MA 3N85L 2MHAA 1MI5D 1F4HA 1IEBB 4MA7H 1MWAH 4KMLB 1I7TA 1ZHKA 4EI6A 3OKMB 3GEWB 1CFSB 4P2RE 1NPUA 4J3SA 4PG2C 3P4MA 4PJ5A 3TJEH 1LNUA 4I0PA 1XR8B 3CLEH 3OJDB 4HBCL 1BD2B 1YMME 1TXKA 2DQTL 1N7MH 4NGHH 3C5ZD 4NZUH 3FAWA 4N90D 4ODWA 3QNYB 4IDJL 3RY4A 2J4WL 4LVOB 4U49A 4OGXH 2DQCH 3PHOB 4Y1AA 3FOMB 4CN6A 3WIHA 4NSKA 5MHSD 2WWKO 4LVHB 3O6KL 2JIXB 1TCRA 2L4OA 1JV5A 3UCRA 2W0KA 4PRNA 4TQEH 1YJDC 4UIKH 5KOVC 3GI9L 3MRPA 4FXKA 3QAZC 3WE6A 3W0WD 5KANI 2BVQB 4Y4HA 1S5HB 3TVMA 5D6CA 3VXTA 1CFTA 2Q7NA 1BD2D 2NXZB 1X5IA 3I50L 2P5WA 4MNHA 3RY5A 5D7JC 1HILA 3S98A 2B0SH 4RQQB 3S36X 1FG2A 5GHWL 3BGMB 4XAWH 1H0DA 2QQLH 4RISL 4ZO6A 1YEGH 4DVRH 2Q8BL 3TA3C 4W4NA 5C0CA 2UYLA 4LBEB 1ZAGA 3NAAL 1NC2A 4XWOD 4LIQL 3HZMA 3ZKNC 1ZGLM 4LIQE 3SE9H 1MCKA 4RMRA 4DZBB 1IGMH 3GSUA 5D1QB 4MD0A 3O9WA 4Z0BL 4X7SH 1AHWC 1AR1C 2B4CH 5B39G 3SDAB 3GJFB 2ATKA 2D31A 2FX7L 1KIQB 4X80L 1OWRM 3MUHL 4DKDC 2GW5A 1GHFH 2E7BA 4OZIE 4NOFA 4HWEL 3G6AB 4DN3L 2VDQL 4S1SH 1UM5L 3KGRA 4PR5A 4N8VA 1IBGH 2VC2H 1T80A 2R9HD 3ARPA 1V3MA 3G6JF 4ZXBB 4KDVA 1PZ5A 4N1EA 1S7XA 4XPHH 5FUOL 2Q8AL 1WISA 3P4OA 1F42A 3S88L 4P5TC 3X3FL 3O8XA 4FQHB 5I66A 1FO0A 4OT1H 4H1LG 4ZMAT 3QSKB 1X6LA 4GRWE 3O4OB 2IALB 3QO0B 3RVWD 4G43B 1YJDL 4MXWH 4E42A 2VQ1A 3HHRB 2ERJB 5D1QD 5DJ6B 1IAOA 4OD2B 5DEZA 4RMWA 4TVPL 4KROC 4FXGB 5KVMC 2GFBB 4ZOCA 3V4PL 4TVPE 5BV7B 5BRZA 3KPSB 1W8OA 5AAWA 1Y6NR 3MRKA 1YYML 5IM7A 3VXUE 5DJ2B 2EDJA 3IJHA 3PWLB 1MJ7L 4L8BB 3KLHC 4PD4J 5FYJD 4WI2A 4EI5B 4HG4J 4N0FA 4J6RL 4X5LA 3D25B 2Y25A 1KCRH 5J1SC 2B1AL 3QXAB 3GGWB 3DV4A 2VDRL 4YPGA 2ESVD 1KEGL 5JIKA 3PDDA 2ARWA 2XZCH 4HD9A 3TN0A 2UWEE 4IRSC 5K9QI 3LN5A 4U1LB 1KTLA 5I18L 4QHUA 5DFVC 4X6DE 5CIPA 4U1JB 4POYA 3HLAB 5DEFB 4EN3A 1TJHH 5DFWH 4KJYA 3WHE0 1FGVH 4OCYH 5C09A 2I07B 3OB0H 4PP1C 2PNDA 1T5WA 2O5YH 3F7RA 4NBYB 5KJRL 4WV1A 2YPLA 1K8IA 2J8HA 4U6XB 5HYIA 3IXTA 5IB5B 5CWSB 5DJ8B 1NAMA 1UM4H 1INDH 2JB6B 3LOWA 2EIEA 4YGAB 4JRXE 2WQRA 1DEEB 2EYRA 1DDHB 3BH8B 2XRAL 1UZ8B 1KT2B 5A2LH 8FABB 3EFDH 4TSBH 4UDUA 4YIQA 3V79C 3V7MA 1H3TA 5JIIA 1JJUA 1I1YA 2XWJB 4YHZL 3GHEL 4P3CL 1HKLL 1IAII 1EHLH 3CXHJ 5AG9A 2UZIH 3WNKA 2X4OA 3QEUA 4WI6A 2NY2D 3F7VB 2J6EA 4L3EE 1YZZA 3RWDB 1MLBB 4M1CC 4QYOB 1JF5A 1LO2L 1T66C 2XWBA 5DYOB 4I0KA 3G5ZB 3PGDA 2D7PA 4FZEH 2BXZA 3LHPL 5C1MB 3SDXF 1QSFB 3P30L 4KZEL 4ZPTA 1NANI 4KAQL 1NCBL 4HUWA 2VL5A 4PJGA 4X9HA 4MZ2A 5TF1H 4WFFD 2P43B 3C8KA 1CGTA 1DQJB 3HG1A 2YEZA 1I7RA 4U1HB 5AYQA 2DTSA 2IH1A 3VRLF 3H9SE 2VDPH 3OG6B 2VLJD 2YD5A 4XNUH 3W9EA 4H8WH 2BNRE 1W0WB 4ZOAA 5I1AA 1S9XA 4YE4H 3HUJE 2HTKC 3WIHH 4QGYA 3SEPA 4NN6C 3O11A 1FRGH 4UINH 2R56L 4DAGL 3ARBA 4MMZC 3ECBB 1WSST 1A9BA 1FBIL 2XN9A 4M5YL 5GISL 3N1GC 3ZE2E 5KSAB 4LDOB 3ZDZF 3EO1B 5IQ7L 1I9RH 5M94B 4GBXA 5DUBA 1LO0L 4ZUTB 1HH9B 5HVHB 5T33L 4G3YH 3ARDA 2EZ0C 2KZWA 3MROA 2PXYB 3V0WH 4LKCB 3ZYOA 4P3DB 1NLBL 5KZCB 3MRCB 3RWFA 2N4IA 4MCYA 4Z8FL 3P11H 1B2WL 3G08A 3VFVA 3MRQA 1X4ZA 1QBAA 4ETQB 3ZE1F 4XVJH 3CVHL 2FEDC 1AGCB 4Y5VC 4GKNA 5FM8A 3TV3H 3HRZA 2DJUA 2O61A 2ZKHL 3B9AA 4LLMA 1WEJL 5T1LA 4NIKB 3WKMH 1NCDH 4FXLA 5DHXB 5KSAD 3RU8H 4QXWA 3WJLA 2C1PB 1MVUB 1G7IA 3D69A 1DUZB 5HGHB 1CBVH 5E95B 2O5XL 3UBXI 2NZ9C 1PG7L 4LDLB 1G84A 2KL6A 1KIPA 2ADFH 3SKNA 2PXYD 4QTIH 1GAFL 4ODHL 2F5BL 1MJ8L 1RZIB 2XOTA 1S9VB 4OUUA 1PW3A 1A21A 3CMOL 4I3RL 5SWQA 1FAIH 3GIVB 4Z7OE 1HWHB 2ICEA 2FECI 4OBRA 1L9NA 1WIUA 1VHPA 1FVDA 3O6FA 5DSCB 1N59B 4LQFH 1FO0H 4NZTH 5IV2B 3O45A 1C5CL 1QACA 4L9LC 2K3TA 3UPRB 1ONQA 2X10A 3FHQA 3MCG1 1KBGH 3TBYB 3D0VA 1WFUA 4BKLA 3BD4A 1YYLL 4TUJB 1FYTA 3OAYH 2J8UF 5EU4B 3QUMA 4HKBB 2ID5A 2ZSWB 3FN9A 1E4XH 1F45A 3AMKA 4H25A 5I73C 1F3RB 3ZE0E 3JUZA 5INDA 4BFBD 4NHUA 4NPYA 2YD4A 3MOBL 1C1EL 5GS0C 2FHFA 5IHBA 2F5AL 1J87A 2BJMH 2V6HA 4N1CA 5EO9A 1CI5A 2NX5E 5IGXL 4D0CA 5MEQA 1U8NB 4XC1H 3HC0B 3V6FB 1U2CA 4LCIH 2L7JA 2A9NL 5E8DL 4LHUA 2V7HA 3OB8A 3MZTA 1IEHA 4Z76B 3WO4B 4PLOB 1N2RB 2H41A 1FIGH 1KIUA 4ORGA 3MCLL 4LAQL 2FIKA 2XZAH 5DWUL 5CIPH 3IS1X 1HSBA 2GT9A 3EYUL 3PHQB 2E8YA 4NQCB 3TBSB 5IKCB 1AE6H 2EKSA 3SBWA 5E2UL 3T3PE 2FD6H 5SX5H 2PCPB 1SBBA 4LSTL 1XIWA 3VXQA 5LXGH 3WSQH 4FZ8L 2NQCA 5KBNC 5E4IA 4YK4C 1AXSA 3T0VA 4BUGA 3VGHA 1BQHB 1NAMH 2IG2H 4ELKA 1FC2D 1LWRA 1RU9H 4FQXB 1IM9A 5FK9A 3ARUA 4NQTA 1ZWIB 4NM4H 4KK8D 4FABL 1BWWA 1ZA3A 4QXGH 3D2UA 1B6UA 3BKJL 1I3GL 3P73B 3O6MH 4R2GD 2ED9A 1A3LH 5TDNA 3OMZA 4Z78B 1ZS8B 2J88H 2WLYA 4UTAL 3MBXL 1JRHI 4MB5A 4NQCD 2J6EH 4CMMA 4EBQL 4ENED 1M7DA 4JZJA 3H7BB 4HLZH 2EC9U 4PRHA 2LQRA 3MRFA 3IFOA 5GS0L 5HYSA 3V2AR 3VFNA 4PGDA 5A40E 2YUVA 5JIPA 5IFJB 4ZO8A 3A67L 2DMBA 2EKJA 1T2JA 4HKXA 3T0BA 3I3EA 3QULB 4R97B 4QY8B 3CX5K 1UQSA 4MA3B 4XC3H 4ZDHB 1I3RB 1R0AL 1MHHB 1HN1A 4JFOB 4Y19B 4XP9H 1NLDH 5BW7C 3NTCH 4POZC 4TOYL 4OZGA 4PRID 2P47B 4YHPB 4P5KB 5JA9A 4MGXA 3KPOA 1YEJH 4HHAB 4TPRH 3LQAH 1Y0LA 5T1KA 3QDMA 3IKCA 3VCLA 2JB5L 3T65B 1ZHBB 4CKVX 2XWTA 1TFHA 2VLRB 4I5BA 3U9UB 4N5ED 5F6HJ 3EYOA 2XQBL 1L0XA 2OZ4L 1GGUA 1U8IA 3FO9A 4HEME 2GYSA 3EOTH 3MACH 1R3HA 2A6KA 3LN4A 2YZ8A 4YQXL 4N0RA 4ZTOL 1QBLL 2MTPA 1C5BH 1JF6A 1HHHA 5IVNA 2FIRT 1CLOH 2DQHL 3G5VB 3GSNA 5I19H 5IVXB 1NGWB 3FQUB 5JDJA 5LCVL 1DTUA 1WCQA 4CN4A 1LEKA 4P49A 4WO4C 4X9GA 4QRPE 5FA3B 2A9ML 1IM3A 5JHDE 4X7FC 1NSNL 3C2SA 2DM3A 4XX1G 3UC0H 3LB6C 4R3SA 5GZNC 4XXCC 4JFFA 1P4BL 5D4QA 5IHZA 4HH9A 43CAA 3BFOA 5FV2A 5TQ2H 3BWAA 3NFNB 2ED8A 5DJXB 4QRRD 3OKKB 3DXAA 4M3JA 1KNOB 3B9KB 4B53A 4E41B 2QQNH 4Z5RA 1YY9C 4ZNEA 1G7HB 3GBML 1JZ8A 1JE6A 5CGYD 3ILPB 4NZRL 3M1BB 2N7AA 2WUCL 5D7IA 3CSPA 4M7ZC 1ETZA 4LCWB 2WUBH 5IW6B 1SVCP 1HI6B 1IGIH 1WZMA 3MLUL 2WNGA 4TNWK 3I6LE 4AIOA 4NNPH 1D5MA 1XR9A 1UXWA 1HE7A 2CJUH 4GLRH 2IFFH 2BNQA 1FV1A 1CE1H 3QUMH 3OKNA 2CLVA 2X1QA 1AQDA 3MJ9L 3TZVC 5F9WC 1Z9LA 1JPGA 4LEXL 2BOBB 1P6FA 2NY3C 1U3HB 2PO6C 3SCMB 2CSPA 3B9KD 4MAYB 4AEHH 4JZNB 2OR9H 3WIFB 2V2XB 1QTYT 3JV6A 4HGWA 3VXNA 1NDMB 3SKOB 3OAUH 3Q6GL 3VG9C 1IC5H 1NGYB 2X4UB 5DEGB 3VXOB 5E08H 3P9MA 3K7UA 5I71B 4LCWD 1HYRC 3P0VL 4LK4A 5BVPH 1X44A 3B9VA 4NZJA 4X8JB 3HZVA 4Y5YB 3SN6N 3MRRB 3BT2H 1I1RA 3NIDF 1KJ3L 5F6IC 1UADC 5HD8D 4Y16C 2G60L 4JR9H 5IF0A 4PRBA 5T1DH 2APBA 1JZ5A 4M7LL 4OB5L 5LKNA 1FL3B 2IEPA 4G9DB 5GGSA 2FSEB 1U3HD 3SCMD 5A3ID 1NAKH 1ZHLA 5TQ0L 1DSFL 1LD9B 4G6KL 4M5ZL 2K7PA 3VGDA 1EEYA 2UUDK 5GJSL 3QUZD 2A6DA 1M4KA 3MLSL 4FFVD 4I9WD 5D2NC 4NKDB 3TBTA 2VDOH 3ZKMC 1H5BB 3U36B 3E2HB 3STZB 2D7QA 3QUYB 4HIHA 2F53E 1P5UA 1WFOA 3DYPA 2R29L 4LLQA 4X98A 4YDIH 1MY5A 3QWRA 3VJ6A 4PJ8C 5JXAH 3GSVB 2C26A 4QRQA 1HZHH 4TRPH 3F6IA 5L7XL 4JM2A 4G42B 4PJDB 4HXAH 5KVDH 3BRDA 2CD0A 3UYRH 3QCUH 2Y5TB 4ORZC 5GGUA 3NN8B 4MJIB 3RJDA 1OTSC 3QRGH 1M7IB 4JQIH 3MBEB 3NMEA 4LSPH 4JFDA 4Z9KB 4JRYE 5F3HA 4A6YH 1F6FB 3HE6B 3QHTC 2XACC 1RUMH 2C9AA 2V5TA 2OJEA 3KPQA 1TQBC 4H26B 4PGBA 3MODH 3QUYD 4JN1L 2VN7A 2Z92A 4KI5C 5DD6B 5FM4A 3QIWA 5FGBA 3CH8A 5JOPD 1S9WB 2CIIA 5CSZA 2VB5A 4HIIA 1G7LA 5EWIH 1INQB 2X44D 3DX6B 2HRPL 5TE6L 3JWOL 2IJ0C 3O6LH 3SY0A 3QRFM 2NY5H 3BN9C 3ARGC 1BVLB 2HFEB 1NMCB 2AXFA 4KTYA 4XGZB 1XF5B 4GXUN 4Y2DA 5IESH 3EBAA 3DARA 1S3KH 4UDTA 3B3IA 1WBZB 4OGAC 3MBED 4PBXA 1AY1L 5EPMB 4O00A 4X7EC 2RAMA 2IF7A 1VFMA 4K9EC 1TCMA 5D2NE 3RVXC 4H5SA 3GSNH 1D5ZB 2VE6A 4F37F 4ODUA 1BZQK 5I8OH 2FZ3A 3HC4H 3Q3GA 1FVCA 3C9NB 1H15B 4LU5L 1J1OL 1JF1A 1AD9A 3WHE1 2QL1A 5AWNH 3LKNA 4GMTL 3VD9A 2VLKE 2P8MB 2MHAB 5D6DA 1I7TB 1FNHA 4MZ3A 4F3FA 1X5AA 5I6XB 2YPVL 1OP5K 3T0EA 3BZEB 5B4MC 3P4MB 1LNUB 4I0PB 1OAQL 2Z8VC 1LDSA 4XHJC 1G9MH 2R15A 1IGTA 4PJHE 1QLEL 5IHLB 4XPGL 1ROWA 4JQVC 4Y1AB 2AJYL 2YXFA 1U8PA 4I13B 4S1DC 5IQ9B 1IFHL 4KI5E 1OF2A 3O81A 3RP1A 5BZWB 1XGUB 2FBJL 3P4NB 1L6ZA 1TCRB 5D5ME 3INUL 4ZQKB 1JV5B 3FQXA 4KK6D 1KJ2A 4JM4L 4MS8D 4W81A 4PRNB 3EYQC 2QSTA 2W0LA 3HZKA 2ZUQB 5ICYB 2WK2A 2WINB 4PJ5D 1A1OB 3WE6B 1X5KA 4I0PD 3H3BC 5MI0B 3VXTB 3NCBB 1CR9L 4MJ5A 3MRIA 1MIEH 5KS9B 1CFTB 4K9EL 1N3NA 4RGNE 2B5IC 1ES0B 3OKOB 4HWBL 1ZLUK 5C2UB 2DM7A 3PQYA 1J86A 1FG2B 4Y1AD 1H0DB 5GRVK 4PV8B 4NKMA 2CKBL 5CKGA 5J9PB 4D3CL 2UYLB 2Q76B 1PGRB 3GHBL 4MNGE 3MZGB 5E5RB 3OAZK 3IGAA 4HJ0C 3HZMB 4EDWH 3MFGB 3KPRA 4PJAA 4GRWB 1JYWA 3OHXA 3WS3A 3GSUB 3MV01 4ZUSA 4PGEA 2VZ3A 3O9WB 3QP3A 3LIZH 4L9DA 3OPZH 1HQRA 2R0WL 2ATKB 2BVEA 1LHZA 4Y4FD 3L5WA 2Y7QB 3QAZB 4MYWB 1JYVA 4J3TA 4Y4HD 1TZGH 3T4AB 3TVMD 2WAHA 3QPXL 3X12A 1G0XA 1L7TL 4PR5B 5JR1L 3QDJE 1Q9KA 3TFKC 1PZ5B 4ZO9A 2P5WD 5JW3H 4KUZL 1N6UA 3P4OB 4LSVL 3ARVA 5I66B 4G9FB 1FO0B 3B5HA 4XCNA 4R7NB 5GRJH 5C0CD 5L9DL 5TPWL 4G6AC 2IQAA 4POUB 1NC2D 1E4WL 4P5MA 1NKOA 3Q6FA 4NM8L 2I27N 1T03L 1WZKA 4E42B 2VQ1B 4UT9H 4XPTH 3O9WD 4ZYKA 1UT9A 3U6RB 1CDCA 4U2YA 1YN6B 2D7TH 5DURD 3MV8A 3ALPA 5CCKH 2GUOB 1MOEA 5BRZB 5F8QC 4GAFB 5KOMC 1ULVA 3MRKB 4EJ1C 5IM7B 3IJHB 1IAIL 5D1XC 3VA6A 3VFMA 2C4FU 4DKFL 3CU1A 5E00A 5F21B 3O4LA 4AG4H 4N0FB 3PL6A 3RVVC 1IL1B 2BXYA 5ACLA 3DV4B 1QKZH 3AC0A 4YPGB 4YXLL 3S35H 3O8XD 4P5TB 1ZSDA 2B2XH 2CQVA 3TN0B 5EOTA 2OXHA 2EE9A 1BQLH 3LN5B 4YUEH 4N5UA 1BFVL 4QHUB 5IB2A 3QUXC 1BFTA 5BS0E 3VRIA 4EN3B 3LKOA 4KJYB 5TE4L 3QI9A 4U3XA 1DZBA 4KDTA 3VFTA 1KPRA 3L5JA 4JDVA 4YEFA 5C09B 1I1AD 4GFTB 1T5WB 4WU5B 1CZ8H 2GITA 5E9DB 2AAVA 1CF8L 3HAEA 4KXZH 4WV1B 2BHZA 4F57H 1K8IB 4NCDA 4I3SH 2HWZL 3IXTB 5EO0A 1RFDL 1NAMB 1EO8H 3NCFB 1CIDA 4NO0A 1WCBA 1B9ZA 1H3GA 5F1IA 1CXHA 4UT7L 4UDUB 3MRHB 5HDQH 2AEPH 2OL3H 1FNGA 4PB9L 1LK2B 1MHEA 1I1YB 4S1RH 4LKXA 3AB0C 4KC3B 5ETUA 3TN0D 4AT6B 4IRSB 4HZLB 4KK9D 4YBQC 2X4OB 2Y6SC 5JUEL 1KJVA 3HS0B 4EN3D 2DQJH 2P24A 1FQ9C 1U8KB 3FKUS 5ADOL 3MR9A 4PBWD 5GXBB 3TESA 4P23A 2XWBB 4ONHB 1A6VH 1U58A 1YEEL 5K9OA 1C08A 2G5BA 5C8JA 2F58H 2YPLD 2GY7B 3BZDA 5C70A 4ZPTB 1C7TA 5I1GL 4P2OA 4PJGB 1FZOA 3C8KB 1BQHG 1ZA6B 3HG1B 3DMMC 2Y06H 1NGXA 4OIAA 2V2TA 3RZWA 3ZMRA 5F93C 1I7RB 1AXTH 2FRGP 2IH1B 5I1IL 1T7VA 3U4AA 4ONFL 3D0LA 5DZOA 3BW9A 1FDLL 3W9EB 2H3NA 5I1AB 1NMAL 5DA4A 4Z95H 4XVTH 5D7SL 3O11B 4WUKL 3QHFH 4MA1C 3DV6A 3ARBB 4WUUA 3CVHB 3MLRH 3MV9E 3HNTL 1KJ2H 2XN9B 1DN2A 4CDHA 1NQBA 4GBXB 1CGVA 1I8MA 1IAKA 3OJVC 4QNPF 1UWXK 2ZOKA 1VGEL 3M17B 2GIYA 4UMGA 3Q5YA 2FECL 3C2AL 12E8L 1T0PB 4OLUL 3ARDB 4KDWA 1CD1B 3MROB 3HG1D 4Y7MA 3I9GL 4WY7L 1YMMA 3ULVF 2QQKL 3CC5A 1A4JB 4MCYB 1KB5A 4YHLH 3G08B 3T2QA 4EKXA 3VFVB 2JJUA 4OKDA 2M2DA 3LSOB 5EN2A 1DQTA 4GQ9L 1A47A 3ARFA 4GKNB 4IIQC 3QPQD 2UUDH 1RMFL 1GL4B 5ANME 3TC9A 3HRZB 2O61B 3ARBD 4O58L 5T1LB 4DW2H 2XN9D 1JPSL 3BIAX 2NMSA 2NNAA 2ZCHH 3QIBC 1LO4H 4GBXD 4LRIC 4OLVH 4XBEH 2E9IA 3D69B 3JWDH 4DK3A 3G9AB 3RNQA 4HUVA 1WAAF 2DQEL 3RNKA 1A6UL 4FQQB 1DLHA 1U3YA 2XTJC 1JGDA 3ARDD 5I1JH 1J0YA 3KR3L 3TWCH 3SKNB 2OLDA 5F7EH 3RPIA 1XCQB 3VFSA 4CVXA 4W6YB 5J12C 2IAMC 4G8FA 1GZQB 2AEQL 4RZCA 5SWQB 3L7EA 4Y5XA 3BGFC 2FLBT 1X3DA 3O6FB 3DRQB 4PJEE 1CD9B 3HN3A 3BIBX 4OFKA 1CVRA 3TO4A 3O45B 3EOAB 5DT1H 4CDGC 1P2CA 4S1QL 1NUGA 3G5YB 5T1LD 5ID0A 2G2RB 1CT8A 3QFDA 3VD7A 4K3GA 1VCAA 4LSQL 1JNNL 4BKLB 5F7YC 3MSPA 1U8LB 1SJVA 1GGCL 3N1FC 1LVEA 4H25B 3CH1A 1T2QL 1OHQA 5INDB 2CXKA 2CLRB 1NCCL 4NHUB 5I9QB 1EMTL 3LV3B 2A2QT 5DQJA 1EZVX 1HH6A 1OTTC 1U0QA 1HWGB 1I7ZA 1VPOH 3MRDA 4XZUA 4OGYH 4GW4A 1AJ7L 4JFEA 4TN9A 5HHVH 1A6WL 1JRHL 2IBZY 1SJEA 1J8HA 2XY2A 4D0CB 4F7CA 5JW4M 1NBZA 3BIKA 4K3JL 3B2UD 3O6FD 3GMPA 1T1XA 2NY1B 2ZCKH 5I8EA 1RIVH 2JELH 5I15H 2AJZB 2O93L 1B4RA 3BPOC 1F4AA 4RX4A 2X4NA 3ROLA 2FIKB 5C7XL 1ODAA 1AGBB 3FRUA 2GT9B 4O5LH 4P4RB 1NC4D 3UROR 2Y4SA 3QEQA 1FYTD 1AQKH 3DUHA 4HULB 1R5IB 1KCUL 1S7QB 2XTJE 4PJBB 5C0DA 3G6JE 3T08A 5I73B 4WHCA 2FEEI 3VFRA 5D72H 3VXUA 4L8SA 3DVNA 1OTUC 4EDXB 4ELKB 2IPUK 5DK0A 1IM9B 5FK9B 1OP5H 1KF9B 4M7KL 1ZA3B 3D2UB 3MUGA 4GG8A 4QRUA 3D1MC 1R6VA 1DQLL 4LHUD 1ZLWK 1T1WA 3KAAA 1JWUB 3UO1L 2P49B 5TDNB 1JTOA 4U3CA 1UH2A 3V5KA 2VKXA 2D0FA 4CMMB 1M7DB 4JZJB 3UJIL 4TSCL 1VSCA 4IMKA 3LEXA 3B9EA 3V7AG 1XIWD 2YC1A 3IDMA 3MRFB 4HFWA 1BVZA 1XF3B 1X7QB 3HC3H 4U0RC 3IB4A 3VFNB 1LO3H 1MVFA 4YK4B 2Z35A 3CFKB 1KG0A 4EUPA 1JL8A 4JRXA 4HKXB 5HVGB 3FQNB 3H0TA 5FM5O 1UQSB 5K9KA 1REIA 5IMKA 1KCVL 4YHYC 4E0RA 1X5YA 1R3KA 2W59A 3GSQA 3D2UD 4QT5A 1SEQH 3GKWL 1BZ9B 2XYCA 2WBJC 4KWUA 1IGFL 1ZLUH 1MRCL 3AS2A 4KHXL 4UILL 4ZD3H 3KPOB 4RAHA 1V05A 4JPKL 2WV3A 4C4KO 1Y0LB 3VCLB 3QDMB 3IKCB 4ISVA 3SDCA 1UYWH 3ZKSD 1YQ2A 3W11D 2MOVA 4M1DH 4NKOA 3EYOB 3MLTB 4PRHD 4OCSL 1ACZA 4NQSA 3DPBA 3FO9B 3OAZH 5CJQL 1A4KB 2XG4A 4NQEE 2A6KB 2VABB 5ICZA 3AM8C 3LN4B 1FAKT 5JPMA 2Z31A 5KTEL 4M62H 3MNVA 4QO1A 1IC1A 4HGKC 3HKFA 5F3BA 2GJ6E 2LAAA 3G04A 4BH7A 5DLMH 3ZDYF 4XH2A 3H9SA 3CLFL 3IRPX 2ITDA 3GO1L 3HNVL 4LVNB 2J4WH 4WHDA 1PKOA 3MA7A 4H0IA 1IM3B 4NQVA 4P2QA 2HH0L 5T1KD 3QDMD 1WWCA 1TNMA 1KCSH 1PBYA 5F96L 1H8OA 3ISWA 2E8ZA 1W72B 4DGIH 2GHWB 1U8OA 2HTLC 2BZDA 2FDBP 1DQML 1WT5A 3BO8A 2EDRA 1JPFA 3ZYIA 1ZV5A 4XAKE 5IHZB 43CAB 2UV3A 5JXEC 3FFCA 3BWAB 1G6RL 3GI9H 1T3FB 4PRAB 4LHJB 3JWNC 3DXAB 4X9FA 1JIBA 3IFLL 4YDKL 3C6SA 1J0KA 1G7JA 5HYQA 2XFXA 2I60L 2ZJSL 5EC1A 4Z5RB 5CZXD 2ZUSA 1RULL 4GT7A 5EZLA 4OJFL 1OAYL 1MCWM 1NUNB 4NJAL 3KXFE 2BRRH 4GUPA 5TH2A 3BQUC 5I74C 5GHWH 1ETZB 3WUWB 3GSRA 1FG9C 1OARL 3CSBA 2Q8BH 3ZDZE 4Q7DA 4PB0L 1D5MB 2BSRB 3SDDC 1UXWB 3SE4A 2VXUL 4ZFFA 4JFFD 5BMFL 5F89A 1W2KT 5C0AB 3RY6A 1FV1B 5F8RC 5FCSH 3OKNB 1BAFL 5J6GA 2ICWJ 4WFHD 1AQDB 1U92A 1JPGB 2YUXA 5F88B 1NFKA 5IT2H 4X80H 5D2LF 2X4SA 3BZ4B 3S34L 5ADPH 4IOFC 3PWPA 4KY1H 2BY0A 2HFGL 3ZE1E 1UM5H 5EORL 3KJ6H 2OP4L 5B22A 5IB1A 4UV4L 3RVTD 1SMOA 4HGWB 3MC0A 5DD3L 3VXNB 2DWEA 1ZEAL 2A83A 2Q8AH 2V2WB 5INCA 4MB4A 4KZDH 2DMCA 2UY7A 3L95A 3P9MB 4RFNB 3MYJB 4M7ZB 3S88H 3UTTB 3X3FH 4F9PA 4HMDA 3SKMA 3GBLA 2Z93A 3GKZA 1KN4H 2XKNB 5E2TL 4KPHL 2HKHL 1OB1B 1CFBA 3AAZA 1DFBL 5LGJA 5T3XH 3WJJA 1K6QL 2BNQD 3VI4E 4NN7C 1OLLA 3RGVC 4TVPH 4PRBB 4RMVA 3TZVB 15C8H 2QADC 2APXA 4HW6A 3AS0A 2NY3B 1NMBH 5FHAH 1U93A 1EEYB 5L8LB 2V5RA 3WO3B 6FABL 4N0UB 5IK3A 1E28B 1KACB 2W9DH 4WGVB 3VG9B 4FQLH 4J6RH 5DRZB 3TYGH 3VFPA 3GI8L 1KEGH 1TDQA 4GSDH 1P84K 4YX2L 2OK0H 1R5VA 3SE3C 3ZZ1A 5JZ7D 1MJUL 1RUPH 2J8UE 2EE2A 3DO7A 1A7RL 4X98B 4NNYA 1GXEA 3VJ6B 2HG5A 5A2JH 25C8L 5KSBA 5ESQA 4KJPC 5F6IB 5ILTL 1U36A 5HI3C 4C56E 4XRCB 4JHBA 4JVUA 5GPRA 5L2KE 4UBDC 3RRQA 5DJZA 1ORQA 3S4SA 2IADA 3BHBB 3MGAA 1VGKA 2OTUA 5F1NA 3ULUH 1TVDA 1DVFA 1JGUH 2XQYG 4GKSA 3CCHA 1FHGA 1UWXH 1GGIL 4P4KC 3P77A 3RVUC 3QWOB 2XRAH 4Q9CA 4BSVA 3NA4A 1QEWB 4U6HA 4Y4KA 2OJEB 3KPQB 4PGBB 2J1KA 4M61B 1LE9A 1YECH 2C1OB 2Z92B 2ZUXA 4YHZH 5HGDA 4FQ1L 1HKLH 2X7LB 4X99A 1QFWM 4OF6A 1UA6H 3U1SH 4HIIB 4K3EL 2XICA 1NBYA 2E9WA 5GGSY 3VFGL 4C57C 4LFHD 4JM2D 5C0FA 1F02I 5FB8A 3X13B 1KC5H 1WFTA 1LO2H 2AXFB 4IRZH 3B3IB 5CGTA 5EUKB 3TT3H 4KZEH 4NNXB 1KELL 1BFOA 1NCBH 3LPGA 3BDBA 4JFDD 1VEPA 4H5SB 3LS4L 3O2DL 2CRMA 4PJ9C 2VE6B 1HHKA 5GSRA 3CFJA 5CD5D 4ODUB 3EGSA 3G6DH 3Q3GB 4N0YL 4YXHH 5C0GB 3FJTA 1CLYH 3QIWD 1EERB 3LKQB 1JF1B 1RSFA 1V5JA 4JGJA 3LKNB 4RFEB 3FO0H 3BKCL 3REVA 4QHKJ 5HHPA 1F6LL 2PYEE 4DAGH 1OY3B 3KYOB 1DLFL 3T0EB 4IDLA 4JANA 1MFNA 3ARGB 5IQ7H 4Y2DD 2QR0A 5LBSL 2X4TA 2E7LA 3EYFB 3MV7A 1T20B 4HCRL 3J7HA 1NGZB 2PUQT 1WJ3A 4PBVC 2AP2A 4AEIL 4KI1A 3D39E 4LNRA 1ZMYA 1WZ1H 3FT4A 1NLBH 2DLFL 1SBSL 3EYVB 3UZEA 1LP9E 3B9DA 5IBLC 4Z8FH 1B2WH 1WIPA 2R4RL 4JGUA 3V6ZA 2F54A 1CFVL 4OCWL 1FZKB 4TTGA 5HYJE 2WMPA 1A3RL 2R0ZL 3LRGA 2NW3B 1JNJA 4JO1L 1E27A 4RAUB 3F6LA 5E1AA 4BH8A 3T0ED 1T4KA 4KK5C 3BD3A 5CJOH 5FO8B 1JMXA 4JZOA 1WUNT 3MPCA 2PW2B 1OGAA 5E94B 4MJ5B 3MRIB 1N3NB 4M43L 1PG7H 4K7PH 4N8CL 4D9LL 4ODSL 4WWID 3DROA 2PF6A 3PQYB 2R39A 1GAFH 4ODHH 3JVGC 4WTZG 5EB9A 5J6HB 2ZSVA 1MJ8H 5DJCA 4X9BA 4LCCC 1U8HA 3CMOH 4NRXA 3P9LA 5EU6E 1CDGA 1E4KC 3FO2B 3OR6B 1JFQL 3MREA 2Y23A 5KVEH 3V6OC 4P57A 5EUOE 3KPRB 5DD0H 5CEZL 5I1DB 4DGYL 3OHXB 3AMLA 1OAUH 3WS3B 3C6LC 5CEZE 4ZUSB 4NFDA 2A1WL 1MJJA 1C16A 1HQRB 2EYTA 4XB7A 1ZLWH 5L88L 4JFYA 4L8CB 1VEOA 3L5WB 4N9OB 3IDNA 3DTXA 2DLIA 5J3HD 1RIUH 1RUQL 3X12B 3B43A 4KMTL 4JFXB 1CN4A 4GG6E 1Q9KB 5C08A 1A6AA 1BX2A 3PQYD 1G0DA 3WS6A 3MOBH 3D18B 1C1EH 4W4OC 4AM0B 1OCWH 4WO4A 4XCNB 4TUOA 1R24B 3HMWL 1QLFA 4RBPK 2IQAB 1PDKA 2NXYB 4P5MB 2ZCLL 5SWSB 3RUGA 1CICA 5E8DH 3JSSA 1BIIA 3KPRD 5B21A 4PTUA 2CDEA 5K9JL 3KLDA 5IWLC 3DETC 4GRLA 3RKDC 4LAQH 1BZ7A 1VFOA 2YWYA 4HXBL 1WWAX 3EYUH 2NY0C 5DZNA 3RWCA 1RY7B 4JDTH 1NBQA 1PKQA 2MCPL 5E8EA 5IG7B 3OR7A 3VFMB 4F7TB 5E00B 3O4LB 3PL6B 4M1GH 3S37H 2IH3A 2H2PD 1C12A 2R0KL 1ZSDB 1Z9SA 3KNBA 2W65A 5T1MB 5EOTB 1KENL 3V6OE 1RURH 1FL5A 2NXYD 3BKJH 3D85A 2J2ZA 5IB2B 4PJFA 1OGTB 4OTXH 4V1DB 1TETL 2IGFH 1YEIH 2DIBA 3QHZL 3MV11 4UB0L 5EFIA 3LKOB 3VRIB 4J4PC 3QI9B 3F5WA 1UACL 1KPRB 4JDVB 1CS6A 2P46B 2RQ8A 2HMID 3MV8D 2D03H 2BVOB 4KJWC 3HAEB 4EBQH 2BRQA 4KQ4L 5I8CB 3HB3D 5EO0B 3MLWL 2PKDA 43C9A 5GS0H 1T1ZA 2JCCA 1QPXA 3EAKA 3O4LD 5F1IB 4DGVH 4U33A 4BZ2L 2RR3A 3KYKL 3A67H 3CDGB 4BSJA 4OD1L 4JRYA 3WFHA 1MHEB 3VWJB 2E5EA 5C6TH 5ETUB 3MUZ1 3VXSE 3WDIA 3ZSTA 2OTWB 2VISA 3RDTB 3BKYL 2E9BA 1KJVB 2CGRL 5E8NA 4HKZA 3ZHLA 3W82A 3QI9D 4JG0L 2BOCA 3HPLA 4P23B 3RWGB 1KEMH 2YMXL 1EJOL 5KS9F 2HP4A 1ZHNB 2JB5H 4PG9A 3VGEA 4L5FL 1U58B 4OZIF 5HDOA 2G5BB 5I1CL 1UENA 2EYSB 4M6OL 4P2OB 2KBGA 1FZOB 2ORBL 1J0HA 4JKKA 4NO0D 1MFDL 2P5EE 3DVIA 4JFPA 2HFFA 1A7QH 4UT6L 2V2TB 5DGQA 3PWUB 1FZMB 2DLTA 3TNNA 3WV0A 2ENYA 1QBLH 5GRZA 1DL7L 3D0LB 3BW9B 5HPMA 2DQHH 1KIRA 5FA4A 4CBPA 4GRWF 1LDPL 2XY1A 4GAYB 2AGJL 3RAJL 5AZEL 1L7IL 1WK0A 1UKQA 5LCVH 4WUUB 2OSLA 4NQXA 3MLYH 2VLKA 2A9MH 4XPAL 4QEGA 4RMQA 4P23D 5TE7L 4ONOA 5K33A 5C0RL 3OKEB 3EJYC 1IAKB 3CK0H 2AVGA 5CEYA 5CUSH 1RUAL 5GSVB 2ZOKB 1Z2KA 1FJ1B 4TNVF 2C4XA 1P4BH 2H8PB 1CL7I 3O2VH 4P46B 1MCEA 5C07A 3VXRA 4M8QA 1OW0C 4JQXC 1NCUA 1U95A 1DE4A 2D2OA 3ORJA 5F9JA 4ACPA 1KB5B 5GRUL 4U1NB 1U6AH 2R8SH 4YC2C 2UWEF 5EN2B 4K23L 3GBMH 5CZKA 1A7NL 4FG6D 4X6DF 4BJLA 1HNGA 3ARFB 4G6ML 3GUTA 2A74A 3AS3A 4PJEB 4MA1B 4WUUD 5D5MA 4FP8L 2NNAB 3MLUH 3KHQA 1QA9B 3FQRA 2JJTC 5E7BA 2FH8A 4WRLA 4GAGH 4JVPA 3C8HA 4LLWB 3DYMA 3EKCA 4ZS6C 3RNQB 4HUVB 4YEEA 3RNKB 3I6GA 5BJTA 2R2BA 1DLHB 1JGDB 2EXYC 1NBVH 1UZ6E 1FORL 3FT3B 3RPIB 1MRFL 3VFSB 4CVXB 4G80A 1YMMD 3MJ9H 3TNMB 3WHXA 3OZ9L 1QYGL 5E24E 1CFQA 3LEVL 4WVRA 4XXDA 1YEKL 4G8FB 4WFEE 1H3XA 4HWBA 4RZCB 1A22B 4Y5XB 1ZANL 3X11B 1P4IH 3NVQA 4QHNB 2E6QA 4PUBL 3TIEA 3UTPE 5KVFL 1F3JB 4X0KA 3ARFD 3LQZA 3TO4B 3FT2B 4MLIA 3U7YH 3SQOL 2A6IA 4IIQB 1JGEA 4ALAL 2FEEL 1YPZE 3BSZL 5ID0B 5GGQL 1OLZA 4NO3A 3QFDB 4TSAH 3O3EA 4Q6IA 3VDBA 2KUTA 3NCEB 3QIBB 5DMKA 5DUML 3FB7A 1JI1A 5HHOA 2N1KA 3C5ZC 1D6VH 1OSPL 3GBNH 4UI2A 3CH1B 1KJ3H 3BX7C 5FGCE 5IUSA 3ROOB 4NHCL 4R6UA 1XEDA 3OF6A 2D0HA 2G60H 3E6FA 4WW2A 3MTRA 4NJ9H 3NABH 2LVEA 3QDJA 3MRDB 5E8OA 4OB5H 4GW4B 4JFEB 2R1XA 1J8HB 1K4DA 4P9ML 4KV5E 1DSFH 3BGFB 4Q9RL 1NCAL 4G6KH 5DA0B 1NBZB 3FCTB 3BIKB 3HUJF 5GJSH 3GMPB 3ZT7A 3GRWA 3TO4D 3WUWG 4F7PB 1RZ7H 3MLSH 4BQ9A 3HMXL 2X4NB 3SGEH 4YXKL 4JGMA 3ZE2F 1EVTC 1TITA 1I85C 3FRUB 2IPTH 2R1WA 3QEQB 3GSOA 2Y36L 2IC2A 4Z7UB 1UH3A 1OWWA 3FN0L 5EOQL 1KLUA 4LVOC 4J8RA 3E8UH 5L7XH 3GDBA 3VGBA 1MCHA 3VFRB 2R4SH 4IOIB 4M93C 3MO1B 1HKFA 4L8SB 5EC2A 5DK0B 2D3VA 4JFED 4UV7L 4ZTPL 2CKNA 4XWOC 5IIEA 1MI5E 1MCSA 1BEYL 3MUGB 4QRUB 4XX1E 3QH3A 1BOGA 1MFAL 5HI4D 5IOPA 2GCYB 2FYYB 2XXCB 4RX4D 4NRZA 5C0EA 3BPOB 1H3PL 4KUCD 3V5KB 3D9AL 2X4RB 2AV1A 3W0WA 4JN1H 1C7SA 5T3XD 2YD1A 3QEQD 2HJFA 2R9HC 4IHOA 3SJVA 2WIIA 4WWKA 3PUCA 3IDMB 2DLHA 1I7UB 4HFWB 3WIIL 4NN5B 4ZOBA 5TE6H 3JWOH 3V5DA 2C7UA 3U0WL 3ME0A 3VXUD 2Z35B 4DK6A 5MHSE 1MCLA 4EUPB 1JHTA 5D9SA 4OLZL 5CBEA 1F11A 3H0TB 1EK3A 5K9KB 4Z7OF 3MFFB 1Z9MA 2VITA 3FL7A 4E0RB 1RQ5A 2JTDA 1KB9J 5EU7E 3GSQB 1RJCA 3MRBA 3IVKA 4E5XB 3QEGL 3DHJA 1AY1H 1P7KB 5D1QC 3NPSB 3G5XA 3R1GL 5J1AB 1HINH 2MSPA 1GOGA 1EFXA 1EGJA 3OJMB 4XP1L 5JPNA 2Z91B 1BD2E 2Y1VA 2QHRL 4ISVB 2D7OA 3SDCB 1J1OH 1IZKA 2VZUA 1KUMA 2H1PL 4NQSB 2OJZH 3PDOA 2DI8A 5E2VL 1MCPL 1T83C 1RZ8A 5ICZB 2Q86A 1LE5B 4PJCB 3ULUD 5D1XA 4KGJA 5JPMB 2YPVH 2Z31B 5JLZA 4XHQA 3MNVB 4P9HH 5IBTL 4JRXD 1AGFA 3ULVC 4XNMA 4PD4K 3UDWA 1X5HA 4YHYB 2HFTA 3O4OC 1ZLSH 4HG4K 2O5ZL 4XWGL 3ZDXE 4XH2B 5EZIH 3PGCA 1AGDA 5ITBL 2ITDB 4OIIH 1R3LA 4XPGH 2AJYH 4MQTB 5BV7C 2FGZA 4FFYL 4P2QB 4LSSL 3ULSA 1IJ9A 3UBXA 3OWEA 5D7KD 4KROD 4XT1C 1I9IH 3SDCD 3T3PF 4J3UA 1H9VA 3IT8D 2X40A 4RBPH 1DBJH 4JM4H 1KXVC 3BO8B 2V9QA 3H42L 2G5RA 4ZFZA 3FFCB 2H2SD 2ARJA 3KLHD 2Z31D 3DLQR 5K93A 1D6EA 3KPMA 4YHNB 4LCUB 4OZHB 3H9HB 2DIJA 2XFXB 2X09A 3CPLA 2Z8SA 3EDEA 5EC1B 4K9EH 4J1UA 5T5NF 1T21A 3H9SD 4WDIA 4HX1A 2NY2C 4JHAH 5GS2H 4PY7A 4HWBH 4XBGA 2JJSA 3FONA 2Z4QA 1PYWB 4GOSA 2R2CA 1Y6MR 3MGOA 4GUPB 5TH2B 1JGLL 2WBWB 4J23A 4P2QD 1PY4A 4I18C 3CSGA 4PJBF 3T8XA 3H7LA 5FYJL 3IU4L 1TIUA 5FYJE 1R5WA 4L4VB 2O26U 4ZFFB 1K5NA 3DGGA 5E7FA 5F89B 4NC1C 1N0XL 5GGVL 5D1ZA 1VKXB 3IAGC 3ULVL 3CFIC 3ULVE 4RWHA 5CEXB 5CJ8A 2X4SB 1CYGA 5I76B 2DF3A 3PWPB 3S3PA 3HNSL 5CGMA 5E99H 1MPAL 4EEEA 1HSAA 3OJ2C 4FFWD 3WXWH 2AEIT 3ZL4L 2DWEB 5BV7L 4KUZH 1RUKL 1F4YL 4HEPG 3M45A 3KPSE 2Q20A 2LU4A 4JKPL 3GRWH 5I74B 4LSVH 1AFVL 3H3PL 4B5EA 3QDHA 4TUKL 1KCKA 3SKMB 4HDIB 3BXNA 3V4UL 5TPWH 1E4WH 4U7KA 1WAAE 1A0QL 3AAZB 5LGJB 4TULH 5HTSA 1G9EA 2WW8A 1Q1JL 3RI5K 3RFZC 1BVKB 4BYHA 1MCRA 3PWPD 4K55A 3MRGA 2B1HH 5JQHC 5IFAL 1IAIH 3E6HB 3WLBA 3SDYL 5IK3B 4CADA 5I1KH 4M8VA 4I2XB 3K74B 3VFPB 5KSAC 2VZOA 3NACL 4JG1L 5LAXB 4O2FA 2ZUYA 3KDMA 1KN2H 3VRJA 2I9TA 4XCEB 4HPYL 4WFFE 5J11B 5H8DA 5HVHC 5DMYA 3DO7B 5B8CC 2W91A 4NNYB 2LAGB 4NC1E 3IJYA 2HG5B 3AY4A 4Z7WB 2PXYC 5KSBB 2X89A 5ESQB 5J1TC 3FQWA 5CJXC 1JMZA 4QHMA 3CFBA 4RAVA 5E6IA 3MLXH 4O4YH 1ZTXL 2ED7A 3FRPA 3GMQB 1ORQB 3OXRA 3S4SB 3EJJX 5ID1A 4LMQI 1VGKB 2IQ9H 2OTUB 5F1NB 1A7OL 2HT3D 2HWZH 1K85A 4GKSB 3CCHB 1YQVH 3REWA 3ARWA 1IC4H 2PW1A 3ILQD 3P77B 5CFHA 4BSVB 4UT7H 3IDIA 2KQMA 3KLAB 4U6HB 4Y4KB 1QSFE 4PB9H 4QXTB 4HT1L 1LE9B 5ALBL 3L3KA 5HGDB 2CRZA 2EH8L 4X99B 3GK8L 2CMRL 4H0HB 1WIOA 4ZFOB 1TQCB 2DDQH 2KKQA 3OKDA 4F2MA 3V52L 1FNEA 2VAAA 5EO1B 5ADOH 4APQA 5FB8B 3NZHL 4CVZA 1YEEH 3CSYB 4R0LA 3M07A 1DVFD 1BFOB 4MD4A 3LZFH 1FIEA 2E3VA 1QVOA 1QSEA 3QIUA 5DO2D 3NIGE 3W39B 1HHKB 5GSRB 2JF1A 3CFJB 4Y4KD 3MNWA 3VDAA 3JBG7 1IMHC 2FJGB 2MQCA 3C5JA 1YEHL 4P48A 3PDGA 1KPVB 3GNML 4DQOH 4JREB 1TZIB 1B4JL 3REVB 2AJXH 3VXPB 4B7IA 1PG7W 3HAEG 3LH2L 2F9BT 4HS6A 2J5LC 4KK8C 5FUCC 3WNLA 3LDBC 5J0BA 5GS0D 3ZLQC 5DJDB 1UM6L 5H37H 4AQOA