1C1EL

Crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKFLIYKVSNRFSGVPDRFGGSGSGTDFILKISRVEAEDLGVYFCFQSTHFFPTFGGGTKLEIKSADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CATALYTIC ANTIBODY 1E9 (LIGHT CHAIN)
publication title Evolution of shape complementarity and catalytic efficiency from a primordial antibody template.
pubmed doi rcsb
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1999-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c1eL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c1eL01
2HAZA 3GJEA 3NAAL 4H20L 1NANH 2PYEB 1S3KL 1GSMA 3MBEC 4M00A 5IW6A 3RVTD 1DE4A 3WUWA 3WXVL 4HWEH 5IJKC 4M6OL 1V7ML 5ERWA 5I74B 5FCSH 3WHE1 1NGZB 2ZPKL 4HAGA 4B5EA 2PF6A 5I1IH 2GSGB 4NQVA 1D6VL 4XVTL 4XAKD 1HWHB 4LHJB 1UXSB 5TF0A 3BH8B 1XGQB 4ZUSA 2Z9TA 1NMBH 3GMQA 5H37G 1J1XL 4M93B 3RU8H 2F5AH 1DJSA 1CK0L 4BELD 2CLVB 2YUVA 4BUHA 3QIBB 2Z93B 1T5XB 2JJSA 4L4VA 2B1AL 4PJ8D 5DQ9A 1OAYH 3VG9B 5FUOL 2HJLB 1IRAY 3DVNA 1K4DA 3MRRA 4QF1B 2VDOH 1JNLH 1UEMA 3CXHK 3KHQA 4YFDB 5GS2H 1KLUA 5EBMB 3QDJB 1FNGA 1CICA 1JHKL 2DQTL 3BPCB 2FSEB 3I6LD 4M62H 1TZGH 4Y0GA 4X7SH 3ZT5A 4Z7VA 4ALAH 4RFOH 1J88A 1S5HB 3R1GH 4YQXL 5FUZH 1OAUH 2VITA 1RIUL 3LKPA 3O4OC 2A73B 3GMNA 1K8DA 3QP3A 4JVWA 5E1AA 5JMOC 4JRXB 4ELMA 1QSFA 4ZTOL 5CFHA 5BS0D 1MCLA 5I2IB 4N8VA 1EH9A 1YNKH 4U1HA 1UH4A 4LK4A 4OZHE 3EYFB 4ZSOA 4KKBD 3ZDXF 3SPVA 4Y5VC 3QWOA 4NN5B 1S5IH 3A6OA 3HPJA 1TJIL 1RJLA 4NO2B 4XNXH 2X4PB 5TE6H 3KS0J 3HS0A 3QQ9C 4PLOB 4WHYH 4M3JA 2NY3D 4DGYH 2WP3O 4PY8I 4WI2A 1EO7A 1MRDL 2ERJB 1QKZH 4HK3N 4JFDA 1DEDA 1ZLVH 3VRJA 5C07B 1OSPL 4I4WB 3QEHA 4HGWB 3CXDH 3CSPA 2ILLA 2YBRB 3RRQA 2DYPB 3I6GB 1P7HL 5FAAA 5GZOD 1LD9A 3L6FB 2DI9A 4FTVE 5GSVB 2DTSA 1S7QB 3W2DH 1X5FA 2BOCA 1NDGA 2O5XH 3ARDC 1FZOA 4PGZA 3IDIB 3ULUH 4OD2B 2V2WA 2FJHB 4HWBH 1S9XA 3VXME 3QG7H 1WBYB 3A6BH 4JY4B 3ULUC 4PR5B 5C09B 1S9VB 1RI8A 4NSKA 1EA9C 5C9KA 4FQLL 5LAXB 5JIHA 1VESA 1QLFB 1GGBH 2CIIB 1TQBB 3TBVA 2KBGA 1II4E 1O7VA 3MA7B 5E7BA 2R2HA 3LN4B 5JOFA 1SYVB 3LVEA 5AZ2L 5C0AA 3V4UH 4BQ6A 2PTUA 5BMFL 4LFHD 4HXBL 3WIHA 3D2UB 4HS6A 2DQEL 4X6DA 5SWZB 2E9BA 3O6KH 3S3JA 1I8KB 4Z5RA 1CZ8L 1EHLH 4HLZG 3WO3B 4GUPA 4M6AA 4TN9A 4KI5E 3WXWL 4M48L 1BF2A 4CMHC 5HVHC 1J9CT 3G5VB 1G6RL 1N3NB 4UINH 2BNQA 2H3NB 4U6TA 4UV7H 5CSZA 5F9WB 4BZ2H 1HEZA 2C1OA 1A6VL 4J4PA 4WW1A 2DTML 4FNLH 5GGUA 5ITFA 2EDWA 3G04B 1KN2H 3CFCL 3X3GH 4LSUH 4UT9H 4FQJL 1G7LB 2MTPA 1L0YA 5F8RC 4PG2C 1NCUA 1AJ7H 5E1HB 4H8WC 3RX7A 1YEKH 2X4OA 4DKDC 1ZANH 3OAYK 2IH1B 1OAQL 1WWWX 4CN1A 1NEUA 4RMVA 1CFQA 2NTFB 25C8H 2G60H 2UUDH 4JHWH 2Q7YA 4QHMA 5EU7E 3MV9B 2CGRH 4NRYB 1FORL 2V2XB 4G7YH 2YA1A 4XC3L 2JJTA 3JWOL 3CVHB 1P2CA 2BJMH 2A6DB 1RUPH 1QP1A 3QUKA 4PJAA 5J1SC 1MCEA 4P9ML 4FXKA 1CU4L 3MLTA 5FGCB 3GO1H 5H94B 2NY2B 3INUH 4K8RD 4O5LL 3DX6B 3QQ4B 2VZSA 3RI5F 1NCTA 1BX2B 1QZ1A 1ZOXA 2C9AA 2ICCA 1JL8A 2ZOLA 4ACPA 4MVBC 3MRDB 4PREA 5E70A 3HPLB 1CGTA 4LLQB 3EYQD 4UTBH 2VQ1B 4L5FL 3V2AR 2NY0D 5KZCD 2B4CL 2JJSC 1XGRB 1W0WB 4JG1L 3N1MC 2FX7H 1MUJB 4JZNA 3QUYD 3PL6D 1F4HA 3FB7A 2FD6L 2B2XL 1M6OA 3MCLL 1IAII 4LVHC 3VW3L 2X9YA 5FDWA 1CICC 3K8MA 2GJ6A 3WFEL 2DQUL 2EH7L 3G5ZA 2XYCA 4CMMB 5HGDB 1N6QL 4FS0A 5DO2D 2X89D 2PETA 3QIWD 5DUPH 3ECBA 1V5JA 4AENA 3VXQB 4OB5L 3BT2H 2YPLD 2YSSB 4NQED 1SJVA 3RPIB 1R5VB 3BGFC 4KRPC 2Z8WC 4RWHA 4P2RB 1Q0XL 2XQYG 1TQCC 1R3JA 3QYCA 4C56D 4OF5A 3TWCH 3O41B 1A1NB 1X5ZA 3O2DA 4KY1L 5DQJA 3VFMB 1QUNA 4K94L 4GRLC 4G9DA 3SGKA 4LCWE 4F57L 1F97A 1I8LA 5CZXC 1DQJB 3B2VH 5HHNA 3TZVD 2HVKB 3PDOB 2A1WL 3MLSH 1HN1A 4XC1L 1I1RA 2DBLL 4LIQH 4Z7QE 4XXDB 3LKOB 2AERT 1X5HA 5CILL 5GHWL 2VDMH 3S35H 1NGZA 1CXIA 3OJDB 2GSGA 3UPAA 1HE7A 1JCKA 3QUZD 2B1HL 3E2HC 3P0YH 4PJDB 5HDLA 1UXSA 3GNMH 3BH8A 1CVSC 1XGQA 2DI8A 4PFEA 4UOW0 4CRPA 4LSDA 5DFVC 4RGNC 3CJJA 3ESUF 4GMSL 5GRYA 1TENA 2CLVA 3QIBA 2Z93A 5MENB 1T5XA 2H32B 5FOJA 3B9AA 4PJ9D 2F54E 4I2XE 4D0BB 5F1OB 1IAOB 5EZIL 4L29A 2HRLA 3KPLB 4QF1A 4CVUA 1Y18B 3P3YA 3IDJB 5EBMA 3QDJA 4PJHE 3WIHH 3BPCA 2FSEA 1OPGL 1R3HB 1G7JB 4ETYA 1S5HA 1U8KB 3P73B 3EDJA 4NKDB 5EULV 2A73A 3BUTA 3R06B 2HVJB 4JRXA 4IEFB 5F88B 4H88H 3O2WL 1U3YA 4PRDB 4FG6C 4GQ9H 2V9TA 1HKLH 5I2IA 2DDQH 2ITDB 3CD4A 4ZD3H 3JTTB 1KENL 1V3JA 2QHRL 1G6VK 3GK8H 4MLSA 4NO2A 2X4PA 3NTCH 1EUTA 4UIKL 4Y4KC 2RGSA 4HPYH 2VLKA 2DQHH 2HRPH 3C60D 2Y5TB 9CGTA 4HK3J 3SCMB 5C07A 4I4WA 4HF5H 4HGWA 1MJ7L 4RGOL 4HPOL 3CFEB 1I3GH 3CFKA 5L8JB 2DYPA 3I6GA 6FABL 4TVPE 3L6FA 4ODXB 4PBWD 2OZ4A 4L9LB 3L3IB 3WL9B 4PJFE 5GSVA 1S7QA 3F8UB 3RNQB 5B3NA 1U92B 3T04D 1BEYH 4PG9B 5JOPE 3IDIA 2DM7A 4OD2A 1CDGA 1PEWA 3ARUA 2JJTC 4UILH 4NO0B 2FJHA 4R0LB 1WBYA 1J7VR 2CRMA 4F7TB 4JY4A 2P8LB 3MA9H 5F96L 4PR5A 5C09A 4L4TB 1S9VA 5SWQB 3GI9L 5BV7B 5LAXA 1QLFA 2CIIA 5ALCH 5CZVL 4K8RL 2A74B 3FTGB 5E56A 1MSPA 2IQ9L 3MA7A 15C8H 3DSFL 3LN4A 2NY1D 5GRVL 3PNWB 1SYVA 4FA8A 2B0SH 3FN3A 2AJSH 3OPZH 4LOUC 3D2UA 4YFEA 4EDWH 1HQRB 4HG4J 3GSNA 2CKBL 3NCFB 5SWZA 2BVQB 3MLXH 1I8KA 4JDTH 2DRUA 1ZXQA 4K3DL 1UACL 3I9GH 3IDXL 1AGDB 1JN6B 1DL7L 4MD5B 2ZCLL 4X7DC 3W39B 3G5VA 2ZUXA 3AU1B 4NOBA 3O45B 1N3NA 1PKQB 3UC0H 3MNWB 2VZTA 2H3NA 4ZO8A 4PJCE 2ESVB 3OKLB 4QYOB 4B41A 2AEQH 3BPNB 5E6IC 3V6OC 3ZKNC 3G04A 5IBTH 2AS5M 3O2DH 1WVZA 3VWKC 5C0BB 1G7LA 4P3CH 1IGCH 5K9JL 2VYRE 5C08E 1LVEA 2IH1A 1A7OL 1KJ3H 2XN9E 3SGKC 5DJ0B 2NTFA 4F37K 2J7LA 1TVHB 1VFAB 2X1QA 1DBJL 4LRNL 4M5ZL 2OJEB 1JGUH 1KXTB 4LHUB 4YJZL 3MV9A 4NRYA 4XT1C 3V52L 2V2XA 1S9KC 4AEEA 3FFCA 2J8UF 3CVHA 4PJIF 3ZKMC 1FGVH 2A6DA 3FOLB 1EUUA 2HJFB 1IM9B 1D5IL 4NNPH 1WSST 4CNIB 3SDDD 1ZHLB 5H94A 4MDIB 3C08L 3DX6A 3QQ4A 4G80B 2FLBT 4HV8B 1AY1L 1T6VN 2VDRL 1E6OH 1BX2A 3KPSD 4U6VH 3MRDA 4XHJD 3HPLA 1MJ8H 3EYVB 4LLQA 2I60H 5EU6E 1LK2B 2VQ1A 3QIBC 3LPGA 1XGRA 1W0WA 1KEML 1DUZB 4WUUB 5D2LB 2CR3A 3VG9C 1MUJA 4PP1C 4JJ5B 4YE4H 4E42B 1JPFB 4P59H 1QRNE 3ZL4L 4MQSB 1IVLA 1MWAB 4CMMA 5HGDA 1JHLL 3ZHDA 1H0DB 3T0WA 5D7JC 5SWSE 1IC7L 2UWEB 4AEHH 4LFHG 3VXQA 1QNZL 3MODL 2KUTA 1WCBB 2YSSA 3QXDB 5DYOB 5IVXF 3RPIA 1R5VA 5GS0D 4P2RA 4YWGL 1MCRA 4R4FH 3O41A 3O3DA 5B4MC 4MA1B 1YN7B 2W65B 3VFMA 3BQUB 4NN5C 5BJTB 3K4ZA 5IP4A 4Z95H 4KK8D 1DQJA 1INEL 1U8HB 3H8NA 5T1DH 2EDKA 2HVKA 3PDOA 1LP9B 2DQGL 5FKPB 4M7KH 2ERJC 2OTWB 1ZEAH 5ADOH 1FYTE 2OZ4H 1EZVX 3E3QE 5EZLB 3SOBH 3P4LA 1CN4A 2EEBA 4XXDA 5K59E 3WV0A 3DV6B 3MV11 3CIQA 3MTRA 4GMTH 5HHOD 1KBGH 5J11B 2DLFL 4KFZC 3W9DB 1MRCH 1QLEH 4RCAA 4PJDA 1H3GA 4YUEL 2RBLA 4WI5A 2XQBH 1JBJA 4RISL 1HSBB 5MENA 2H32A 4TRPL 3OB0K 3OHXB 3ULSB 1IAOA 4OFKA 5HXMA 5DEZA 3SDYH 3KPLA 1Y18A 1CD8A 3IDJA 4JGJA 4OD1L 4AQ1B 1OP5H 3Q5YA 1R3HA 2VXQL 1G7JA 1YEGH 2GY7B 1U8KA 1Y6NR 3P73A 5IGXH 1BFSA 4NKDA 5FFLA 1ZLWH 3ARFD 1MNUL 1UH3A 4Z7NE 4I0PC 2HVJA 3H9SB 2Q1EA 3QULA 3ARED 4HUNB 4IMKA 5F88A 2OR9H 2PW1B 4PRDA 2X05A 1CG9B 2ITDA 1T3FB 3SKJH 2IAMB 3C6LC 3JTTA 3THML 2MPAH 1D3CA 3HMXA 2CO7B 1YEIH 1DBAH 4HBCL 2FGWH 3B5HA 3QEQB 2Y5TA 4J8RB 2A2QT 5KSBB 4HJGB 3SCMA 3WFDL 4NKOB 1MCQA 4UDUB 3IU3B 5FHAH 5AWNH 1E4XL 3CFEA 1RJCA 5DD3H 2E9WA 5HD8D 1JZ2A 5DT1H 4ODXA 4UDTB 4L9LA 3L3IA 3WL9A 1CXFA 3V0WL 3QXVA 1WAAA 3RNQA 1CXHA 1UWEH 4PG9A 3BKMH 2DQJL 2DIJA 4NO0A 2HT3D 3I2CH 1IM3B 4I13B 4R0LA 1OARL 1XT5A 3LEYL 3QO0B 4F7TA 5TE4H 2P8LA 4U6HB 1XEDA 1BD2B 2OX5A 4L4TA 5DA4A 5C1MB 1ZLUK 3UTQB 5SWQA 2NY2C 4LRIA 4ZFOB 1RZJC 2A74A 3FTGA 3H42H 1OWRM 5D2NB 4NWTL 3MLYL 4GOSA 3PNWA 2VDLH 1KB9K 5JW3L 3RKDD 1KC5L 2YUXA 4WO4D 5IUSA 1HQRA 4FQPA 3UTSD 3QDGB 3P30L 4MSWB 5MEOB 5IFAL 2JB5H 2BVQA 2XZQL 3CSGA 4NIKB 4YGVB 3T8XB 3EO1B 3V4VH 5HYQB 1A6PA 1AGDA 1JN6A 1IE5A 3ELAT 4KDTC 4MD5A 4KJQC 2HFEB 1P4IH 4Z7WF 3W39A 1UEYA 3AU1A 3BDYH 3O45A 1PKQA 1JWSB 3PGFH 3MNWA 1A4KB 2CPCA 4JVUA 3VD3A 1CGXA 1U2CA 3RTQC 3SDAD 2ESVA 3OKLA 4QYOA 2QADB 3O6ML 3BIAX 5E0QA 2UY6A 2F53D 3ZYIA 3VWJC 5JUEH 3LRGA 3GSQB 3X14B 2GYSA 5C0BA 5C86A 5E9DD 5GS0L 1QFPA 1TJHL 2QQQA 1OW0A 4L3EE 1MFDH 4Q2ZB 4MJIB 4YAQB 3VXUD 3SE8H 1I8MB 1F90L 5DJ0A 3FQNB 1TVHA 1VFAA 3BO8B 3F65A 1FNSH 5I15H 3WD5H 3GSWB 4LHUA 3DX9B 3C2SA 3IFNL 2VH5H 3FFDB 1JPSH 4V1DE 1X6NA 2X4RA 4NO3B 1PKOA 3WHXB 4JM4H 3MV7D 4GAFB 3WJLA 3FOLA 3VI4E 1J0JA 3O3EB 2HJFA 1IM9A 1BZ7A 1BQHB 1IQWH 4CNIA 3DOSA 3UYPA 1ZHLA 4JFYB 5FUCC 2XRAH 4MDIA 1MI5D 4XPTL 1PZUB 4HV8A 1T7ZA 4KZDL 2YZ1A 2H32H 2NY7L 4WTZA 3WNNA 3EYVA 3W5NA 4H26A 5E08H 1GH7A 1LK2A 3ZKXB 5IMLB 1DUZA 4WUUA 5D2LA 4F9LC 3VXNB 2ORBL 4OIBA 1MPAL 4JJ5A 1FLRH 4KZEH 3RAJL 1IC4L 2Q76B 3UZVB 2UZYB 4E42A 5CZKA 1JPFA 3MBXL 2FB4H 4R97C 4R6UA 4MLIA 1MWAA 4WUKL 5BVJB 1YQVH 2BHZA 1H0DA 1OB1A 1UH2A 2UWEA 1DLHB 4FQ2H 3RPKA 2XI9A 4MAYC 1WCBA 4NFDA 1CR9H 3QXDA 5DYOA 1BFVH 3BJ91 3MROB 4K3GA 1A8JH 3M1BB 4IMKC 2YD6A 2DLEA 2GEEA 2IBGA 3RVUD 1ND0B 1QFUH 3LQAL 1JPTL 1XR9B 1YY9C 3S8WA 1B4RA 3ZDZF 4Y2DA 3HNSL 3HMXH 1YN7A 2W65A 1CFVL 3QISA 5HTSA 3BQUA 5BJTA 4O2CB 3LKSB 1ZHKB 4WWKB 4FXGB 4XNZB 1BBJB 1U8HA 3VA2C 5CCKH 1WWCA 1T1WB 2AEIT 2XY1A 4K9EL 1YJDH 4HJ0C 1LP9A 5FKPA 4KROC 1LO0H 2OTWA 4S1QL 5EZLA 2OXHA 4M9OA 5J56B 2AABL 3RUGF 5J6GB 4WHYG 2JJUA 3DV6A 4L9LC 2DMCA 3VMNA 4GG6B 3QHZL 3W9DA 4JN1H 5DK0B 4KAQL 2ID5A 3IRPX 1ZLSL 4DTGH 5D7KE 1EO8L 5BV7H 3W81A 4JKPH 4R0LC 2BVPB 3IVKB 1H3PH 2VDQH 5KG9B 1HSBA 1XF2B 4HIEA 1FDLH 5BV7C 5D6CB 3EO9H 1P7QD 4LRIC 2L0DA 3OHXA 3ULSA 4XP6H 2PNDA 2ZSWB 4OZIF 1R0AL 2BXZA 1AGBA 2FX8H 2NYYD 2K7PA 4OZHB 3U7WH 4JO2H 1YPZE 4LLWB 2QR0B 3HR6A 3DO3A 4DZBB 4TYUA 4ZUTB 1FPTH 3H9SA 1BJ1J 2R2EB 3OR7A 3BMWA 4WFHD 1JF1B 2PW1A 3OL2A 3BKCL 1CG9A 2KDGA 1KV3A 1T3FA 1I9JL 2IAMA 1BVZA 3FJTA 4LSSH 4GAJL 4ZTPH 2DQCH 3U6RB 1A3LH 2V5MA 3BPNC 2WK2A 3QNZB 4FTVB 1QYGL 2NW2B 3CDCA 3VI3E 3QEQA 1EVUA 1QBBA 4J8RA 4F9PA 3GIZL 4HJGA 4HS3B 5KSBA 4NKOA 1BJ1H 4UDUA 3AMKA 3IU3A 2XKNA 4EJ1C 2IFGA 2D0GA 3C87A 3MOQA 2IH3B 3GIVB 5I8EB 4DN4L 3QR2A 2QSQA 1N2RB 1R24B 1L9NA 1YMME 1PBYA 1GAFH 4YDKL 5TE7L 5F7HA 4JCMA 3WJLC 1IM3A 2C3VB 4FZEL 4YBLB 1FG9C 4LSVH 1DLFH 4U6HA 5DVMA 1OD7A 1KCVH 5HPMB 3UTQA 4YHMH 4G6AD 5E4EB 3WUWG 4ZFOA 4KTDH 2YD5A 3TYGH 4IRJD 5LCVL 1CL7H 1UQSB 4NWUL 5ESVB 5D2NA 4OLXH 4AMKL 2IFFL 1KPUB 3K2MC 4X6CF 2WV3A 2V17L 3DNKA 4GAYA 3MUY1 4BZ1L 2BMKB 2EC8A 2HKFH 4W68A 2VL5B 2QQLH 3QDGA 1BFOB 4MSWA 1AD9B 4DW2L 4OTXH 1FAIH 4P2QE 5DD1H 1MWAH 2PXYB 3HKFA 4C4KO 1PVHA 1I9RH 3T8XA 3EO1A 5JW4R 2AK1H 5I76B 4BQ9A 2VZ1A 5JLZB 2P49B 1T1ZB 5GGVH 5F7FA 2HFEA 2HT2D 3EBAA 1A4KA 4GBXB 5JHDD 2BP3A 4ONFL 2VRAA 5HDOA 2ZSVB 3X12B 4MQTB 3SDCD 5IWLA 1KF9B 3GSQA 2CD0A 2SEBA 4KH2A 3TA3D 1VHPA 5JOEA 3WJJC 1C5BL 1BVKB 4HD9A 5J4MA 4G43B 3ARGD 3K7UA 5D1XD 3NCEB 4XAKE 3BIKA 4Y2DC 3K1KC 4Q2ZA 4YAQA 4N8VG 1VADB 3BQUC 3MJ6A 1I8MA 3FQRB 3LIZH 2F5BL 3FQNA 1U3HD 5ACZB 4F58H 4DGIH 2P47B 1EZVY 3BO8A 3T1WA 1YYMH 5D7IF 3DX9A 1SBSL 4K3JL 3FFDA 4HEPG 4NO3A 3WHXA 5JW4M 3I02B 3EJYC 1NSNL 3O3EA 1XGYH 3I6LE 3CPLB 5DUML 3EFDH 1BQHA 4K23H 2AV7B 1GC1L 4JFYA 3U0PB 2V7HB 4KUCD 4A6YL 4M3KB 3X17A 1HZHH 3VCLB 3RBSA 3P11L 4NQCD 4RNRA 3NABL 1V7NL 5DTFB 2H26B 3RWEA 4IOFC 4PJ7B 3C5ZC 5BS0E 1RULL 2EO9A 4OLWH 5IMLA 4XAWH 3ME0A 1UA6L 1KEGH 4KVNH 3VXNA 3WO4C 5AEAA 4EOWH 1CIUA 2Q76A 2V7NB 3NH7H 1O0VA 4PRAB 5TDNB 1FYHB 3VFRA 2YMXH 4ZUUB 5BVJA 1RZIB 1U8JB 4RFNC 2NR6C 1DLHA 3I50L 3K2UH 4NJ9L 5KJRH 2IG2L 2BERA 5K9KB 4LCWB 5ETUB 2W9DH 3M1BA 4NN7B 4H0HB 1ND0A 1NFIB 1XR9A 3QDHA 5C0RL 5CGYC 3WDIA 2VLLB 3RJQB 3L1OL 3QDME 3V5DB 4AQOA 1KLGB 3LKSA 4O2CA 1ZHKA 4WWKA 4YXKH 4FXGA 2B8OT 1BBJA 4JZJB 3MRGB 3UJIH 1T1WA 1E6JH 4QRPB 5FV2A 1D5ZB 2EIDA 3IDYB 4Y7MA 1RIHH 1PG7L 4F9PC 2HN7B 5EIQA 4HGMA 3DUSB 5KSAD 3EOTH 1A6AB 1MJUH 5LGHH 5J6GA 2AJUH 4J3WA 4XXCA 2RB8A 2BVEA 2BC4B 4GG6A 3RNKB 3HI5H 4FXLA 4I2XB 5DK0A 3CLFL 4NKQB 4XPBH 1CYGA 2P45B 3FO0L 4PJHB 2BVPA 4XTRD 1VGEL 3IVKA 4M61B 5KG9A 12E8H 4WW2F 1WBXB 1XF2A 1YEFH 5D6CA 3F7YB 2WBWB 5IESH 1SY6A 35C8L 3IYLW 1B4JH 2P5ED 3IF1B 4YXLL 1BIHA 2ZSWA 1LO3H 2YKLH 1MVFA 2JELL 1PY4A 1ACZA 2HLAA 3K8LA 3PF2A 1BJ8A 3CU7A 2LVEA 2Q8BL 5D93B 2OP4H 1B90A 2W38A 1LK3L 2AVGA 4OZHA 1GGTA 4U0QB 2P1YA 5LQBL 1DVFC 2H6PB 4WRLA 4LLWA 4DZBA 2QR0A 3WUZA 1NGQL 4JFEE 1UJTA 4ZUTA 5FB8B 3BKJL 3WN5C 2XZCH 4YHKL 3JWDH 3MRCB 1JF1A 5CINH 4YLQT 1BAFH 3SE9L 3HFMH 1FC1A 1ZGLM 3QI9D 3ZDYF 1BP3B 3QCTL 5L2JB 3K4DA 2Z92B 3U6RA 4PTTB 2VXSL 4MA8L 5IWLC 1GPOH 2D4FA 4FTVA 1G0XA 1MCIA 4PJFB 1IFHH 3D5OF 4LPTA 3IXTB 4F7EB 4TOYH 4HS3A 5HHMD 1TDQA 5F7YC 1JGVH 1IEBB 4ZS6D 3TH2T 5DD5L 5L2KD 3O9WB 5B8CB 2IH3A 3GIVA 1AP2B 1G84A 1M71B 3MLUH 5EBWA 5J9PB 2BNRD 1R24A 4U7MA 5EA0H 2GK2A 5JDSB 2JKXA 4PRPE 4GT7A 4IDLA 1G1CA 1P69B 4FFYL 3MPCA 2APFA 1C16B 2C3VA 1IT9H 1X4YA 5JXAL 3KJ6H 2GTZB 4JPIB 1VKXB 5HPMA 3N1FC 5GGQL 1T66C 2K1MA 3WIIL 5JO5B 4PJXF 2ZNWA 1UQSA 2VSCA 5I1HH 3M8OL 2Z8RA 5E24E 3HZMB 2CLZB 1KPUA 3BAEL 1OY3B 2XY2A 4C56E 4QHKJ 5A2LH 4H1LB 2BMKA 3NIGE 2VL5A 1G9EA 3N1GC 1L7IH 1QSZA 2EDHA 1BFOA 1J1OL 4PJCB 4PRIB 5GZND 5B21A 1DQMH 2PXYA 1CTOA 1NCBH 1UXWB 1FN4B 5I76A 5DD0L 3UYRL 5JLZA 4TPRL 1T1ZA 1VFMA 5SV3A 3WFCH 2LTQB 3GKWH 4XNQB 4GBXA 3X12A 5BO1H 2ZSVA 3BVNB 3FMGL 2AI0L 1LEIB 4Q0XH 5I8OL 1VFUA 2CLRB 5ALBH 1BVKA 5HGGS 4G43A 4RA3A 3IETB 2VR4A 3PP4H 4M1CD 1I1AB 3VGAC 2HMID 1VADA 4G42B 4ZUWB 3LZFH 1EFXB 2YK1H 5ACZA 4WWKC 5EO1B 1F4AA 4AEIL 3MLPA 5TFSL 3SBWC 1EMTL 4L8SC 3D18B 5GS3A 5E2UL 2XV6B 5KBNC 2R2CA 1J87A 4EIGB 4LGPB 1K2DB 2K3TA 2YN3A 4U33A 5DDHB 1RZKC 2IPUK 4FMFA 3CPLA 5EU6B 1VPOH 3LPWA 4XXCC 2AV7A 5GRVK 3V9FA 3U0PA 2V7HA 3TFKD 2YD1A 5DWUL 3VCLA 5D1ZD 5C0IB 4MB4A 4UT6H 5DTFA 4QRQB 1KFAL 2F58L 2H26A 3SEPA 1QRNB 4WCYH 4PJ7A 2Z0BA 2OI9B 1SY6H 4PB9H 5I8CB 3WYRA 5HI4D 2DMBA 3PWPE 1CGVA 5SWSB 5LXGH 4PJIE 4YDJB 3OAYH 5DMGD 5JQ6L 4GKZB 1U6AL 5L6YL 2V7NA 3C8KB 4PRAA 2Y72A 5TDNA 4RQQB 1XCQB 1NC2D 4ZUUA 1R3LB 1FL6B 1RZIA 1A7NL 3EOBB 1U8JA 1T89C 3U9PH 3MUGB 3RGVC 1NBZB 1OGAB 1W72L 3FRPG 5K9KA 4LCWA 1AFVL 2CMRH 4CU7A 1FFOB 3ZKQD 5ETUA 1AHWC 2FBOJ 5BQ7B 4JO4L 1UWXH 3WDJA 4MZ3A 4TSBH 2VLLA 2UVFA 4U1NB 4LCIH 1MY5A 3V5DA 3E8UL 1KLGA 2H2PC 1D5BB 4LEOB 5L88H 1PLGL 5FDYA 4JZJA 3MRGA 4QRPA 1D5ZA 1H5BC 2OK0L 4LARL 3AXLB 2HN7A 3DUSA 5IQ7L 1A6AA 5CD5C 5T1LD 1PG7W 5DMIH 5HVFB 3S3SA 1HSAB 4LMQE 2BC4A 1B0GA 1IBGH 3HA0A 5I8KL 3RNKA 4JM2F 5MI0B 4XP5L 4I2XA 3MBED 3NFSH 3VGFA 1KB5L 4XVUD 3FT2B 1KN4L 4GSDL 5FYKU 4PJHA 4JGMA 2YA0A 5ADPL 1WGOA 3Q0HA 4M61A 1WBXA 5EU5B 3O6FB 3F7YA 4N0FB 2BRRH 3IF1A 2FBJH 5CP7B 2HKHH 3DVGB 3EKCA 4NCC2 3MFGB 4QWWC 4OM0H 4PV9B 1FVDB 2WW8A 3L5JA 1A14L 2JLLA 4QRTB 2IANB 2H6PA 2VJXA 1HILB 3MRKB 1CDUA 5FB8A 2VXTH 2PXYC 2YEZB 5F1SA 3MRCA 3BZFB 3OKEB 5T5FL 1N64H 1TPXB 1NGPL 3OZ9L 2Z92A 4PTTA 4DFHA 4KHXL 3MNZB 4OI8A 4PJFA 5LKNA 1IEAB 1YQ2A 4NZRH 3DPBA 3IXTA 3BHBB 5DFWH 4F7EA 3KPSE 4WEMB 4XMPH 3KG5A 3ULVF 4NZJA 5F7LB 2FH6A 3SGEH 1IEBA 1JYWA 1NQBA 3QQ9D 1RUMH 5B8CA 1KPRB 1AP2A 1M71A 4EI5C 1Z9MA 5KVDL 2O26U 1KT2B 1BGXH 2E6QA 5J9PA 3S88H 1T7YA 3ARBA 4XP1L 2XA8L 5JDSA 4YDVB 1WTLA 1XIWB 5A3IC 1SEQL 3TT3L 3MLRH 5JXEA 1C16A 4M1GL 2CRIA 1CFNB 4QXTA 2VXVH 4DQOL 4JPIA 1VKXA 1V05A 5E2WH 1B2WL 4TUKH 1F4WH 3ARDD 3S96B 4RMWA 5JO5A 5I75B 4MDJB 1OM3L 4OIAA 1OVZA 4KK9C 1OAKH 1MFAL 3HZMA 2CLZA 1F6AA 4KQ4H 1J0YA 2XZZA 2J5LB 5LWYL 4DK6A 4X7FC 5HPOA 1KULA 4P5MB 4N5UA 1G1YA 4D3CH 4PJCA 5CGTA 1YEDA 3RP1A 4PRIA 5EU4B 2CRZA 4KK6C 1UXWA 1FN4A 1PAMA 3ZMRA 4RX4D 2XTJE 2HH0H 1JYVA 4OCSH 4LQ1A 1D5XA 2I07B 5HVGB 4XNQA 4L3EB 2O93L 2FECI 3K3QA 3BVNA 4Z7OF 4E41D 1T83C 1LEIA 1I9IH 1IGIL 4J3SA 1INDL 1CFSB 2CLRA 4RGMB 3G6DH 5LG1A 1WBZB 3ZHKA 5CKAA 3RWDB 2VB5A 1F4YL 3IETA 5HHOE 3ARWA 3HMWL 4YHLH 4NJAH 3VG0H 4V1DB 1OAXL 4XPFH 1I1AA 4XI5C 3WNPA 5EFIB 1H3VA 3MOAH 4NM4H 4LAQH 2D7PA 5C6PB 4LSPL 4G42A 1P9MC 2X41A 4ZUWA 3U30B 1EFXA 5BRZD 4QXUH 5IT2H 4Z7WE 5M94B 5EO1A 2VUOA 3O6LH 1B0RA 1EGJA 3VFGH 4OQTA 5FGBC 3D18A 3EYUH 1GGCH 1MEXL 5D7LB 5GJSL 5JR1H 5E94B 4OIIL 1F2XK 3S36L 1SBBA 5DDHA 5EU6A 1F8TH 4J6RL 4OLVL 3TBSB 1RZ7L 3NCJL 3UBXB 3VE0B 5C0IA 3QEGH 3AY4A 4YDIL 4EZMA 3IFPB 1QHOA 1NJ9B 4QRQA 1QRNA 4JFZH 4O58H 3QBTB 4NP4H 4UV4H 5DXWA 3OJ2C 4Z7UE 5I8CA 3S37H 5MEQB 2YWYA 4OZFG 5IB1B 2PO6C 5SWSA 2ARJQ 4YDJA 3NIDF 5I30L 3SJVD 1MREH 1I1YB 4HWEL 3D9AL 1F02I 5LBSH 4GKZA 3UO1H 3C8KA 1KYOJ 4RQQA 1N26A 1XCQA 1R3LA 1FL6A 3OF6D 3CK0L 4FQCL 3BRGC 4NGHL 5TDPB 4XCCH 1RPQA 4FZ8L 3U2SB 3MUGA 1NBZA 1OGAA 1FBIL 3MMEB 1KSRA 2A6JB 1NFDF 1WITA 1D9KB 1JGDB 1FFOA 2WQ8A 3ULUF 5EO0B 3FKUS 5BQ7A 3MV8E 2KPNA 2W9EL 1M4KA 4TVPH 4P23B 4FFZL 1P84J 5A2FA 4U1NA 1U36A 3Q2CA 4P2OB 4NKIL 4PRHA 1MFEL 1NL0L 1D5BA 4KRPD 2C4FT 4LEOA 1QSFD 3LHPL 1I7RA 4KGJA 5AAWA 4Y8AA 1WZ1H 3OKDB 1OF2B 3UTTD 4AIZB 3AXLA 5C0EB 2RAMA 4GRLD 3TCLB 4M43H 3V7MA 1FP5A 1HSAA 1MIEL 5B8CC 3BN3B 3STLB 4BFBD 3ZDZE 1RURL 3CZFB 4MJ6B 5FHBH 3UTSE 1VFBB 3ARBC 3S97C 2ICWI 5KANI 3FT2A 3N1PC 2YRZA 3FOMB 4XB8A 2MCPL 5TH2B 4TVSa 2O5YL 4R2GB 4XNUL 4Y19D 5EU5A 3LMJH 3O6FA 4TUJA 2AJ3B 4D9RD 1RQ5A 1RSFA 4KVCL 1IKFL 3RWJB 2X4TB 1DN2A 2E6PA 4N0FA 1ACYH 1LDPH 5FYLH 3TESA 1YPZB 3RUGE 5C6TH 3B9DA 5CP7A 2F53E 4O51B 3DVGA 2RJMA 3QIUD 4S0SD 3U46B 5DFVD 2X4NB 4GXVL 4H1LH 2RCSL 3I75B 1IILE 1G9MH 4PV9A 1FVDA 5E9DE 5KVEL 1ZHNB 1YY8B 2EDTA 4QRTA 2IANA 5F7EL 5C0FB 3KDMB 1HILA 4JQIH 1T22A 3NA9H 3MRKA 3VXUE 4MNGE 2D3VA 1A5FH 2YEZA 3FB6B 4HIHB 5HGAB 3BZFA 3OKEA 4PJ5B 3BYTA 2NXYB 4JAMB 1QFWM 1HNFA 2Q87A 2LTQC 4X8JB 5JTWA 3KLSA 5AUMB 5I1CH 3MV7E 1HOCB 1DANT 4OAWB 1T04B 4APQD 4I8DA 3TV3H 2HFFB 1KTKE 3MNZA 1DBBH 4FG6D 4U49A 5DVNA 4PD4J 1IEAA 1MI5E 1IKNC 3AM8A 3O6KL 4K55A 4NHUB 1YMMB 3BHBA 4XMLH 5F6HJ 5GRXG 4WFFE 2MQ0A 3QHFL 3T2NH 1FIEA 1EGJH 3ALWA 2VR9A 5J57B 1G6RB 3KR3H 4UOW1 4Y4KD 2I24N 2QSCH 1KPRA 1UM5L 3OWEA 2YN5A 4Z7VF 1DR9A 2NY4B 3GMMB 1KT2A 4P46B 1RMFH 4JO1H 1UADC 4OFYA 3ALPA 4H8WL 4YDVA 1XIWA 4ORGB 3KLDA 1KXVC 4YC2C 5EZOH 1CFNA 1DBKL 1T1YA 4ELMF 1NMAH 5DJDB 1ITBB 4BFEA 5ITBH 5HYEA 1MIML 2R56L 3CAFA 3S6CA 5IBLD 3S96A 3HE7D 5FOBB 3VH8B 2VQTA 4KHTL 2GT9B 5DRWB 5FYJH 1FH5H 3MZGB 3P0VH 3AY4C 1U8IB 1T2XA 2EC9T 1EAPB 3BE1L 2OI9C 2WBJB 3SQOH 5T1KD 3GKZA 4WI3A 4P5MA 4RMUA 4BYHA 1OAZL 5EU4A 3H3PL 5I1GH 1WQVT 4LOUD 5D7SH 3SKUD 4ENEC 2I07A 4L3EA 5DMKB 1C8PA 32C2B 4OSUL 4X6CE 4XPHH 5I1LA 5DK3A 1CFSA 1WBZA 5D96B 1ZLUH 3RWDA 2BFVH 4PJ8B 4JKLA 4NM8H 2P46B 5I1KL 2OQJB 3C2AH 5E6ID 2IJ0C 3CH1B 3ZKND 3VWKD 1Z9LA 4UTAH 3M07A 3C09B 2DD8L 5ID0B 4IIQC 4N0YL 5GIRB 4XNYH 3BT2L 1X9QA 1N4XH 5D7LA 5E94A 2NY6C 3RVWC 5T3ZH 3RIFK 4N5ED 1I3UA 3BRDA 1YYLL 4CVWA 5BS0B 4WEBH 3VDAA 5C2BH 2VN7A 2PN5A 3DBXB 2G75A 1G7QB 1IZKA 3TBSA 1TIUA 4OCYH 3TIDB 5MI0C 3UBXA 3VE0A 1RVFH 3IAQA 3ZKMD 5DHVB 3IFPA 4N0CC 1NJ9A 3TO4C 1J0ZA 5A16A 4K3HA 2NY3B 3RDTD 2X9XA 5MEQA 3N9GH 5EOCH 5IB1A 1AKJB 3HG1D 3O6FC 1Q72L 4NDMB 2Y07L 2WUCL 1I1YA 3S36X 3L5XH 3KGRA 1ULVA 3NIFF 4J7RA 3STBA 3GSVB 4FABH 3QIBD 4CADB 3T4AB 5ACLA 1JYXA 5TDPA 1FRGH 1J0IA 3MYZA 4NZTH 3U2SA 4OM1H 7FABL 4O4YL 3MMEA 5KOMC 3MUZ1 2A6JA 4M6ML 5IFHL 1JGDA 2X42A 4N8CL 4PJAF 2ATPB 3SE3C 3UJTL 1CBVL 5EO0A 5DJ8B 4OUUB 1XCTB 2NY5H 5D7JD 1FL5B 3NOIA 4P23A 4YBQD 4NYLB 1QPXA 4BFGA 4K71C 2V5YA 4P2OA 1QBML 1SJHB 1K4CB 4I0CC 3O2VH 3BISA 5GGSB 5F44A 3VJ6B 2A6KA 3ARVA 3HNVL 1ODAA 3OKDA 1OF2A 4AIZA 4RBPK 5B4MD 5C0EA 1KCRL 1BOYA 4KXZI 3TCLA 4X9GA 5F72S 3QZWG 4QTIH 4K7PL 4ZXBC 3GGWB 4XBEL 1HKLL 2VLKD 3FB5B 2ZOKB 4IS6B 3STLA 3MX0A 4CDHA 2DIAA 4LVNB 3IU4L 1DFBH 3GK8L 4OFIA 1A6ZB 1VFBA 4AG4H 1JGLH 2EDLA 2F54D 5E2TH 1AE6L 3DUHA 4AL8H 1YEHH 3FOMA 3QH3B 2Y9RT 5TH2A 4I3GA 4TQEL 1MAML 5KSVB 1T6WA 3BWUC 3RWJA 2E7MA 2X4TA 5T5NG 2H2SC 5I75C 1BQHG 4NBZB 5CEYB 1YPZA 4O51A 5EUOF 5ELIA 4Y5YB 5DUBB 3U46A 2X4NA 3TJEH 4GXUM 3I75A 3HC4H 3O3AB 5BZWB 1ZHNA 5GPRA 1YY8A 2J5LC 1QQDB 3MZTA 4ODSL 5C0FA 4U0RC 4EKXA 3PUCA 2R39A 4Z6AT 1Z3GL 4Y5XC 5MP6H 3FB6A 4Q74A 4HIHA 4MXVE 5HGAA 4UBDC 4PJ5A 2OS7A 5ALCL 4JAMA 1T0MB 4WTXA 4X8JA 5F89B 1HOCA 3QRGH 4I0PD 4BA8A 2VWEC 4OAWA 1OQXA 1T04A 5JZ7C 4O2FB 2R0WH 4LCUB 2HFFA 5KW9L 3CSBA 1DTUA 2YXMA 5C0NC 1JNJA 2NY0B 4RGMC 2G5BB 2CKBB 5DS8B 4EDWL 5KZCB 3QUXC 1WZMA 3C6LD 3V5HB 4NHUA 1YMMA 3QUYB 3PL6B 3BW9B 3MLXL 4JDTL 1NH6A 1VSCA 3V6ZA 3STZB 4TTDC 4QLRA 1BBDL 1G6RA 2HTKC 3IKKA 5HGHB 4Q9QH 4LNVA 4LPVA 3MQIA 3ZDYE 1G9NH 3QIWB 3D25B 4P46A 2EDXA 3HN3A 3JZ7A 5TQ2L 1UB5B 3V4PL 2ADGB 1K8IA 2YPLB 1H8NA 1G9NC 4NQEB 3T0EE 3IJYB 2VC2H 4ORGA 2Q6WB 1W8OA 1SYSB 2DICA 2R0KH 4O2EB 5DJDA 4C56B 4YFLF 1HCVA 4JG0H 5BVPL 1CGYA 3BOVA 4G6JH 1MFBH 5FOBA 5CEZE 3FFCD 3VH8A 4EVNB 5KTEH 2GT9A 5DRWA 3NAAH 5M95B 4LLDB 2RQ8A 4YGAB 5F3BB 1U8IA 1S3KH 4BQBA 4B53A 2IBZX 4NQSB 4J3VA 2LAGB 3GI8L 1EAPA 3TZVB 3WXVH 5ID1B 4M6OH 2WBJA 4KK5D 1DUYB 1V7MH 5J1AB 2ZPKH 3B6SB 1RJYB 1FGVL 3CCHB 1D6VH 5CIPH 1FZMB 1VGKB 3VGBA 3GMOB 2XPGB 4JPVL 4DVRL 4S1SH 4C59B 3QUZB 3FQUB 4KJWC 1PW3A 3ZTNL 3O11B 1ZV5A 1PYWB 5FUOH 5DMKA 4HFUL 1NBVL 32C2A 2XN9D 2ED7A 3LN5B 4TNVK 1JHKH 2DQTH 2DMKA 3KJ4C 4KJQD 4OGZA 4PJ9B 4PJ8A 2DBJA 4P59L 3RTQD 4YQXH 3KYNB 2NX5D 3QXAB 1RIUH 3CH1A 3VWJD 1AQDB 4M03A 5F7DB 4MJ2A 4OCXL 2D7QA 4DJMA 3FQXB 5KANG 5IVZB 5F7KC 4OF6A 4ZTOH 4AEHL 5ID0A 5GIRA 2C3GA 2FDBP 4IM8A 4ODUB 3ABZA 1OLZA 2EDYA 1R3KB 4LGSB 4K3EH 1TJIH 3OQ3B 2R0ZL 5BS0A 4BJLA 5C71A 3DBXA 1ORQB 1G7QA 2BVTA 1L0XA 1OT1A 3TIDA 1EEZB 4PJIB 4XP9L 1MRDH 4I9WD 4DEPB 2AGJL 3WNOA 3IGAB 3QUML 5DHVA 1JZ5A 4PGEB 4QRUB 2K7QA 5CJQL 4PUBL 4PGCB 1A21A 4M7KL 4R2GC 1Y6MR 3C60B 4H0GA 1AKJA 4NDMA 2HJKB 1WFUA 3IRZA 3MFFB 5CUSH 3S5LG 1J0HA 1XH3B 4KQ3L 1MRCL 4CADA 5CHNB 3T4AA 5HHME 4JPWL 4FQLH 1QVOB 4PY7B 4NN6B 2Y25A 3MRHB 2XQBL 4Q9CA 1GCFA 3NGBB 4JY6B 1J11A 4Q97A 2ATPA 3K0WA 2VKWA 5DJ8A 1UJ3B 2I9LB 3MYJB 1CDJA 5AZ2H 1XCTA 1I7UB 4Y8DC 3D85D 3LH2L 4HXBH 1FL5A 4NC1C 3VU2A 4MZ2A 1F6LL 2DQEH 4NYLA 4MAYD 3AS3A 1FYTD 4I5BB 3OG6B 3SGJA 4EI6B 1SJHA 2NY1B 3GSNL 1FIGL 1K4CA 3RVXD 3WLWC 4L8BB 4NQDE 1YEGL 4MS8C 1CZ8H 3RZCA 5GGSA 3VJ6A 3MREB 1ITCA 3WXWH 5IGXL 4M48H 1YY9D 3B9KC 4FP8L 3JV4B 3FN9A 1G6RH 5E8NB 2P7TB 5EU3B 3CX5K 2FIRT 5DGQA 1A6VH 2DTMH 3IAGC 1DQTA 4LEXH 1A9BB 3CFCH 1QSED 4IS6A 2ZOKA 4HJ0D 4KROD 2VZUA 4FQJH 4P46C 1A6ZA 4PJEB 4AZ8A 4J3XA 2OJZL 1OAQH 8CGTA 1A7RL 1DBAL 3B5GA 2FGWL 3QH3A 1BQLH 4WW2C 5KSVA 2LFGA 1FORH 1T20B 5CEYA 4XC3H 3LDBB 3MUHL 4LU5L 3JWOH 4Y5YA 5DUBA 4Y16B 3ARPA 5I73B 2ADJA 3CVHL 4P2CG 2A6IB 1BZ9B 4M8QB 3O3AA 4KWUA 5BZWA 2FEDC 4Y4FD 1CU4H 2APBA 1HYRC 1QQDA 4O5LH 3RWCB 3RVTC 4G8EB 1IGML 1RZJL 2JF1A 3Q6FA 1K85A 4CU6A 2E9IA 1XGUB 2AK4E 3MLWL 4GW1B 5I66B 4HT1L 1UM6H 1UZ6F 4L5FH 1T0MA 4JKKA 3MXVL 3KPSB 3L5WB 5F89A 4JG1H 4PJDF 3DETC 3PQYD 4FQXD 5LJYH 2B2XH 4O2FA 3MCLH 1FG2B 4LCUA 3VW3H 4OJFL 1MCKA 2G5BA 2CKBA 5D96C 5DS8A 3VD4A 3WFEH 2DQUH 2EH7H 3V5HA 4NKMB 3VDBA 3QUYA 2JB5L 3MLVL 2YZ8A 3BW9A 3PL6A 3OAUL 2EDRA 2KL6A 4QOKD 3IJSB 3STZA 2UZIL 5T1MB 1Z6JT 3UTOA 4OB5H 5HGHA 4A2LA 2FNBA 2X89A 5KN5B 3C09C 3D25A 3QIWA 1Q0XH 5GGVY 2C4FU 4WDIB 2IPTL 1UB5A 2W9LA 5JNYB 3HI6L 4IJ3B 1WJ3A 2YPLA 4KY1H 4NQEA 3IJYA 1ZHBB 3O8XD 4K94H 2Q6WA 3KLHD 4MX7B 1CDHA 1SYSA 4F57H 4O2EA 4L3CB 4RDQG 4C56A 3G6JB 3TVMC 1AXTL 5DHVH 3ULVE 4KKBC 3EFFB 4EVNA 2A1WH 1HI6B 4NZUL 3U9UB 4LLDA 1JE6A 2DQFB 5F3BA 2BXYA 5D5MB 4NQSA 3PV6B 4XC1H 5I15L 1SQ2N 2DBLH 1LHZA 4ZAKC 3TZVA 3BN9C 2NY3C 5ID1A 2VH5L 1MCPL 5CILH 5GHWH 1DUYA 5J1AA 4JM4L 4M4PA 2R29L 3B6SA 1RJYA 2CR6A 4YPJA 2FGZA 2H8PB 3CCHA 4NFBA 2QEJA 4QRRE 1FZMA 1VGKA 2IC2A 3GSUB 3GMOA 2XPGA 1ED3B 5HY9B 1JHTA 1B88A 4PY8J 2D7TL 4GMSH 5HHOB 3QUZA 3FQUA 1WAAF 3O11A 1PQZB 3PV7A 1OCWH 1PYWA 4ZPTB 3SQBA 3AMLA 5E08L 3UBXI 5EZIH 1CLZL 3LN5A 5I19H 1OPGH 4PJ9A 1A02N 3Q6GL 1ZGLB 2CO6B 1MHPL 2R4RL 5JW4N 2D0FA 4Z0BL 3KYNA 4G8GD 3QXAA 1KGCD 1FV1B 3HI1B 2NQCA 1FFNB 4L1HA 4NBXB 1AQDA 4R8WL 3SGJC 5F7DA 5ANMB 3FQXA 1DBML 5IVZA 3RZCC 1J8HA 1H15B 2L7UA 4JCLA 2KZ1B 3DXAE 4AIOA 4FQ2L 1AR1C 1J5OL 2X44D 4Z7OE 2ZWLT 4ODUA 4Y2DD 2YD3A 3ARFB 1KENH 1BM3L 1MCHA 1R3KA 3AREB 4MGXA 1TXKA 4NUGL 2AW2A 4Z7UB 4UIKH 4ZO9A 1R5IB 1ORQA 3NPSB 1XFPA 1EEZA 1YECL 4PJIA 5DF0A 4XVJL 3GHBL 4HBQA 3EJYD 5J12B 3IGAA 4PGEA 5CCKL 1MJ7H 4QRUA 4RGOH 3ISWA 4HPOH 3ZTJH 4PGCA 8FABB 4KJPC 3BD5A 2O61B 1KTDB 2LV4A 3C60A 2DM3A 4N1HB 2HJKA 3AUVA 3MFFA 3R8BB 2Z91B 4PJGB 2GW5A 5ILTH 4IOFD 5T3XD 1XH3A 4LVOB 3C5ZD 2DQDL 5ICXB 4YEFA 4MNHB 2A83B 1P5UA 4JN1L 4PGDB 1A7BA 4M7LT 1RIVL 1KLFA 1QVOA 3E6HB 3I85A 4PY7A 2X40A 2BSSB 4NNXB 2CJUL 3MRHA 2VUYA 5CZVH 4K8RH 4H1LG 1H3PL 2J6EL 4JY6A 2IQ9H 3RVVD 4DKEH 1FDLL 4N1EA 1UJ3A 3EO9L 3L3HB 2I9LA 3MYJA 4IRSD 5J13B 1HHKB 3NIDE 1I7UA 3F12A 2NR6D 1JI2A 3IB4A 1MCDA 4I5BA 3O3BB 2EO1A 2CKBH 4EI6A 2XXCB 3S37X 3UJJL 2BHYA 4HCRL 3U1SH 3VFOB 4L8BA 2L4OA 4LGRB 2IALB 2NY0C 4K3DH 3MREA 1UACH 1SMAA 3IDXH 2OTPA 4WO4B 1DL7H 3JV4A 3UTSB 2ZCLH 4P5TD 3QUYC 3PL6C 5D2LF 2WSKA 4R4NC 5FGRA 3FT3B 1WLHA 4Z9KB 5E8NA 1NFDE 5ECJE 2P7TA 5EU3A 1FFRA 4BH7B 3ULUE 4J3UA 4Z78B 5I1EL 5IMOB 4N0UB 4OLUL 5D7KD 4OBSA 1CLYL 4ZOCA 3QIWC 3A67L 3H3KA 5SX5K 4HKJB 5C3LD 4GKOA 3SDAB 4PJEA 5K9JH 5IROA 3RUGB 4JANB 1VACB 2BCKB 2EXYC 3W0WD 4DAGL 2F53B 5I9QC 2GITB 1A7OH 1NCNA 1BZQK 1M05B 4CDGC 3MR9B 4S2SB 5CJOH 1NGWB 5E9DB 1EBPA 2IBZY 1DBJH 1YNLL 3ARQA 4LRNH 4M5ZH 5A2KH 2C7UB 4G9FE 1A0QH 4TNWF 4E41E 3V52H 1T20A 1TJGL 3PWJB 3VXUB 4MNGB 2EDEA 3DI2B 4Y16A 2A6IA 4D0DB 3TZVC 4M8QA 4WTWA 1D5IH 4KV5F 1JTPA 4OV5B 5INDB 3AS0A 4ISVB 4X4YB 1LP9F 3C08H 2OCFD 3TBWB 4YH6A 3MV7B 1AY1H 2VDRH 3DUUB 4G8EA 3E1F1 2E7LA 5BRZE 2P8PB 2XWJB 3MXWL 1KCVL 2P5WB 1MQ8A 4L8DB 4GW1A 1MI5B 4LCCB 4OT1L 1BREA 1GVIA 3KPSA 1ES0B 3L5WA 1NCWL 1DVFD 1KEMH 4S1DC 2FEEL 4LDOB 4WHCA 4MAUL 2X09A 1X5XA 4XPAL 4YHIB 1CS6A 1WZLA 3ZL4H 4ONGH 4WU7B 4GQPH 5MEPB 4NKMA 1FAIL 1JHLH 1IC7H 5F9DC 2FWOB 3IJSA 3FCTB 4QTHB 2AJYH 5T1MA 4U7SA 2AP2A 4HHAB 1QNZH 3QAZB 5EIIB 3CDYA 5KN5A 1NUNB 4YWGH 4DCQB 4WDIA 4DKFL 1HCFX 3SJVE 4GRMB 5IMKA 5JNYA 5JW5B 4ESKA 1T7VA 3QHTC 1ZHBA 4MX7A 2GUOB 2DWDB 1EFQA 1IGTB 4ZNEA 2EKSB 3LB6C 1INEH 1XF3B 3G6JA 4Z18A 3GBML 4RSVA 2DJSA 3EFFA 3SDXE 2DQGH 3U9UA 5C0CA 5I16A 2DQFA 4DEPC 1J18A 4LPXA 4DGIL 4JHBA 2C3HA 1SM3L 4P2QD 5D5MA 3PV6A 1E4JA 5KS9E 4N9GB 4W4OA 2ICEB 1P4BH 4MNQD 1T66D 2NTSP 5FO9B 3RL2B 4KPHL 1GYAA 2DLFH 2H8PA 2FL5B 1VERA 5IKCB 4ONHB 1XGYL 3EYSL 3GSUA 1NAMB 2E7CA 5EOTB 4YUEH 4ELME 4A6YB 1QSFE 1ED3A 5HY9A 2OM5A 5T3XL 1I1FB 5HHOA 4YIQB 3UTTE 1IMHC 3P4NB 3OKNB 1PQZA 4EN3A 4TRPH 4YHYB 2BVOB 1TZHB 3DARA 4ZPTA 1KCLA 1A1MB 3CFDB 3NGBC 5SX4I 3V6FB 4XAWL 4OD1H 1MCNA 1S78D 2VXQH 4JFDE 1P7QB 1ZGLA 2PCPB 5HDBF 4OGYL 3NH7L 3PWVB 2JIXD 5GSRB 1FV1A 3HI1A 4DGVL 1FFNA 3OKKB 3EOAB 1MCJA 1WC7B 2NY1C 1MNUH 4HWZB 5ANMA 5M7QA 1GHFH 5GGTL 4Y19E 3L3KB 1H15A 4X4ME 2FYYB 3P4OB 1PFCA 2X6MA 3RJDA 4D9RE 4OCNC 3D39A 2IEPA 3ARFA 3CH8A 4RGNE 3AREA 2DWEB 4XCYB 1RUKL 4H5SB 4ZS7L 2NLJB 2UUDK 3EIFA 4OLZL 4Z7UA 1HDMB 2JCCF 3V7AE 4BSWB 1R5IA 3QWRD 4HBCH 4H25A 4G5ZL 2ED8A 2P44B 5E5MB 5I1JL 4JQXA 3WFDH 5IROC 5CP3A 1U93B 5F3HB 1ADQL 1E6JL 4J12A 1E4XH 5T33L 2R1XB 8FABA 3SGDI 2CIKB 1A2YB 2O61A 1KTDA 3VFUB 3V0WH 2YXFA 4TSAL 1IC1A 1KCSL 5DURD 2Q7NA 2Z91A 4PJGA 4HIXL 4X6FB 2DQJH 3DHMA 3L3DB 1JF6A 4Y16C 5I73C 5ICXA 4MNHA 4HEME 2XG4A 5ESQA 4PGDA 4F8QA 1J12A 2BNQE 4QXGL 3E6HA 2BSSA 4JFQB 3TN0D 4NNXA 1KIQB 2ADFL 2Y36H 5MERB 2R23B 3JBG7 1CLOH 3QDMD 4LKXB 1YEFL 4LBEB 3MLYH 2LU3A 1AO7D 1NCDL 2YUZA 3J7HA 3G9AB 1HHKA 3V5KB 4IRJB 5JW3H 1KC5H 3SO3B 3RGVD 1KUMA 1X5AA 3O3BA 3NIFE 3P30H 3SE4C 4R4BB 3EJZD 1MH5B 3OTTA 3VFOA 4BZYA 5DK2B 5IFAH 2XZQH 2OP4L 1S7RB 2B5IB 3PDGA 2IALA 5DVLA 4NZDA 1TLKA 3GBNL 1VA9A 4WO4A 2XACC 3AAZB 3UTSA 1EEQA 4RMRA 3FT3A 1AQKL 3V0VB 4MXQD 4BH7A 4PJAE 2GIYA 3QO1B 4KKNA 2H2PD 4R3SA 3O6MH 5IMOA 4N0UA 2A9NH 5B39B 1FGNL 1RK0B 5D71L 2W91A 2NZ9C 3X11B 2HFGL 4HKJA 5JHDB 4B0MM 5FO7B 3SDAA 5GS0H 1TJHH 2BY3A 3HTLX 1RHHA 3RUGA 4AYFA 1VACA 2D2OA 3SDCB 3LEVL 2F53A 2GITA 5ISZD 2VERN 2GCYB 4V2BA 3TA3B 1M05A 1CGSL 3ZE2F 1F90H 4S2SA 2HWZL 2H41A 3ARGB 5D1XB 5E9DA 4D2NA 2BDNH 1N0XL 2C7UA 2PYFB 4J3TA 3IFNH 3PWJA 3VXUA 4YX2L 1U3HB 4JFED 3UBXG 4D0DA 2V6HA 3G9VA 1N6VA 4G7VL 4OV5A 5INDA 1NCAL 4ISVA 4X4YA 4XPTH 3TBWA 4R7DB 3MV7A 1Z5LB 3V6OE 3KJ6L 2VDNL 4X7TB 2P8PA 2XWJA 5EWIL 2WAHA 3R0MA 4EIZC 2P5WA 3VDCA 2EH8L 4L8DA 4UOJA 2VDPL 1MI5A 4LCCA 3V6BR 1NUGA 4GG6F 4EN3C 1ES0A 4NQCB 1RU9L 1YMHB 4U1GB 4KJYA 5EUOE 4LSQL 2R9HD 4F7MB 1MPAH 4ZO6A 3RAJH 1IC4H 2JJWA 4HKXB 4MA7L 4LPWA 3MBXH 4YHIA 5C0JA 4WU7A 2M26A 4WFEE 2ZCHL 5MEPA 5KVGL 5FIEA 1XF1A 4WUKH 3LKNB 1DQML 5HYJD 1ZTXL 1Y0LB 1NCBL 3FCTA 4PRPD 3B2UC 3OMZA 4QTHA 4HHAA 5EIIA 1U8LA 1BIIB 2YA2A 3HG1E 4DCQA 1C7TA 4GRMA 3LQAH 1JPTH 5JW5A 3TH3T 3HNSH 1QBLL 4G6ML 1CFVH 2J8OA 2GUOA 3AREC 2NW3B 4KMLB 2DWDA 4X4XB 1IGTA 4EI5D 2EKSA 3GJFK 1XF3A 5CP3H 3S35L 5EN2B 3NPSC 3P9MB 4K9EH 4HIIB 4M7ZB 4FMKA 1Z9OA 2YK1L 2J8HA 4JQXC 4S1QH 5AZEL 5J12C 1JGEB 1NPUA 5EORH 2GQHA 2AABH 4N90D 4N9GA 1RZKL 1M1SA 4ODBD 2ICEA 3OKYA 1WFNA 3A6CL 2BHUA 4S10A 5FO9A 3RL2A 4JRYD 3DSNA 2PYEA 5KSAB 2FL5A 5IKCA 1FNEB 1P7KB 4KAQH 4ONHA 4KK9D 1NAMA 4JRXE 5EOTA 4A6YA 1ZLSH 1EO8H 1TITA 2QL1A 1I1FA 1INQB 1U8NB 4YIQA 3T1FB 1TCRB 3VFWB 3P4NA 3OKNA 3PGDB 5I6XB 1MHEB 2BVOA 1TZHA 1A1MA 3CFDA 3DYOA 4F15C 3FO2B 4KK6D 4DWHA 2DAVA 3V6FA 1R0AH 2VLKE 2FHFA 3QCVL 1RZGB 5GRUL 4DZ8B 4MJ4A 3WFZA 1P7QA 2IF7A 2P5EB 2HJLA 3LD8B 2CK0L 2VSDA 3PWVA 5GSRA 4JZOB 1GOHA 3OKKA 3EOAA 4JREB 1WC7A 4HWZA 3BYYA 5I1DB 3VD5A 4HG4K 4WEUD 1BHGA 3L3KA 2FYYA 3P4OA 43CAB 3DYPA 1I85A 1W72B 1ONQB 3BKCH 4XI5D 2K9UA 1I3RB 1V3MA 4C57C 4E5XB 4EUPB 4GAJH 3ZSTA 2DWEA 4NRZB 4H5SA 3N50A 4XCYA 5GJTH 2NLJA 2GFBB 2Z8SA 5C09E 2UV3A 1HDMA 4BSWA 2N7AA 1QYGH 2LQRA 3PWPD 3QI9B 5J89A 3OV6A 3EYFA 4YK4B 4BQCA 3GIZH 5E5MA 4M02A 5F3HA 4J4PC 4Z77B 3BZEB 2ZUVA 3BJLA 4K7FB 5GS1B 3BP6B 2R1XA 3UPCA 3W5MA 2RIKA 2CIKA 2BY2A 1A2YA 1JI1A 1UKTA 4G6FD 3VFUA 1NCCL 4LMQI 5HHMB 5EC2B 2XICA 4LASL 3C5SB 3VGGA 2O5ZL 1EHNA 2LAAA 2QQKL 1KCUL 3ARRA 4X6FA 5DMIL 1A7PH 4YDKH 1TETL 4PS4L 2XKUA 2YBRA 5TE7H 3L3DA 5L2KB 5GXBB 3VH8G 3EHBD 1VEMA 4FZEH 3KPTA 1IGFL 1REIA 1KB5B 2F15A 3MOBL 2BNRB 1QLRB 2FO4B 5J3HC 2PO6D 1BQUA 5BOPA 3KPOB 4JFQA 5K9OB 1KIQA 3KXFD 3CSYB 1U8PB 4OZFB 5LCVH 5MERA 2WINB 2R23A 4NWUH 4LKXA 1FE8L 4LBEA 3QDAA 1F00I 4AMKH 2IFFH 3RGHA 1BFTA 2HYMA 2V17H 4GRWF 4IRJA 3V5KA 1E4XI 4N1CA 2FZ3B 4BZ1H 2CQVA 5TJWK 1T5WB 2RHEA 4R4BA 4DW2H 1MH5A 5DK2A 1OP3K 3JSSA 3OGOE 4PJ7F 1S7RA 1X5YA 2AJVL 3MJ9A 5E2JA 5TF1L 1L6ZA 3FRPA 3FFCE 3AAZA 1A22B 4QO1A 1DQQB 2V9RA 3RHWK 5IG7B 3V0VA 4BKLB 4ONFH 1YC7A 2EIZB 3QO1A 1NFKA 2W0KA 3UTPE 5B39A 1RK0A 1T4KB 3X11A 1C5BH 2Z31D 1IC5L 5JHDA 3OJMB 5FO7A 1QEWB 1NEZB 4XP4L 1UKSA 3SDCA 5BOZG 2GCYA 3TA3A 3RZWA 3SO5A 1HH6B 2F5BH 3ARGA 5D1XA 5KVFL 4Y4HD 1U3ZA 2LABA 2X1XR 3ARBD 2BZDA 1SBSH 4K3JH 5ENWB 2N7BA 1U3HA 3QPQD 4Z7QF 1AGEB 2J1KA 3QFJD 2WWKT 4XCNB 2AQ3A 1NSNH 1I8LC 1UCBL 5DUMH 3REWB 4R90L 4IRZL 4RBPH 4DOHE 1GC1H 1NAMH 2CKNA 1M7IB 1AD0B 3BH9B 4A6YH 4U1IB 4R7DA 1JFQL 2NX5E 4JB9L 4P3DB 3GZKA 2VXVL 3HZYB 3P11H 4X7TA 1AGFB 2M8XA 3NABH 1V7NH 4ODHL 3Q5OA 2YUWA 4GS7B 4P2RE 1F4WL 4TUKL 5L0QB 5I74C 4XZUB 2LVCA 3T3PF 1RULH 3L7EB 5D1ZB 4YHYC 4NQCA 1YMHA 1L0QA 3BGMB 1UA6H 4PLKC 4F7MA 1KPVB 4HKXA 4M93C 2ITCB 2AQ1A 5F9JB 5FCUL 1N5YL 3LKNA 4I9WE 4KU1A 1Y0LA 3SY0B 3ZYZA 2IG2H 1NC4D 4K2UL 1T2JA 5FUCE 5FEBA 1NC2B 1UZ6E 4I77L 3MRIB 2HTLD 4PBXA 5C7XL 1I85C 4F37F 5GQBA 1YA5A 5C0DB 2AAVA 4XMKL 1F3JB 5C0RH 4JFPB 2EXWC 1JZ3A 1E28B 3L1OH 5D1QD 2NW3A 4U3HA 5CJXA 4X4XA 5HI5C 4NM4L 5EN2A 4LAQL 3P9MA 1A1NA 4JRWA 4HIIA 1PG7H 5IT2L 2XIDA 4X6BB 4BUGA 3O6LL 1JGEA 3HAEB 3BPOB 1FO0L 4EDXB 4PJFF 2XTJD 1XGPB 3I3EA 3UX9B 5KSAA 1EBAA 3PGCB 3RKPA 5C6WH 1FNEA 3CLFH 5T1LB 1B9ZA 3ZTJG 3LKOA 3LS5L 3FO0H 1ZT1B 1VCAA 2ZUTA 1VGEH 1A6TB 1INQA 1U8NA 3OJDA 3T1FA 1PY9A 1TCRA 3VFWA 2BVUA 3P9WB 2E3VA 1UM4L 3MBEB 3PGDA 1MHEA 5F9OL 1QO3B 3RWHB 3X3FL 35C8H 1NLBL 4UV4L 3FO2A 4YXLH 5JA9A 5HYIA 1WIUA 1CE1L 5IW1B 1XZ0B 1KTRL 3TT1L 1QSEE 3AS2A 4P9HH 1RZGA 1MREL 4DZ8A 3RY4A 2P5EA 2Q8BH 3VFVB 4D0BA 5LBSL 1LK3H 1TQBC 3GMPB 4P9HC 1NDMB 5LQBH 4JZOA 3VFSB 2IPUG 1VFOA 3MJ9H 4FQIL 2YD2A 2C1PB 4P5KB 1NGQH 3Q1SL 2APXA 3BKJH 4YHKH 1X7QB 4E0RB 3NACL 4HS8L 5FYJU 43CAA 1W72A 1ONQA 3SE9H 4HSQA 1SMOA 1D6EB 2BSTB 4KDVA 3BX7C 3RBGA 5MHSE 5DZLA 1I3RA 4OLYL 4PJCF 4E5XA 4EUPA 3QCTH 3R06A 3GDBA 4PRHD 4NRZA 1Q1JL 2VXSH 2GFBA 3BUYB 3H7BB 4L4TE 3NCMA 4MA8H 3U0WL 4QHUB 1G7PB 5L8LB 3QI9A 1ZS8B 3D3VD 2I5YL 3O4OB 4WGVB 1HQ4B 1QR1B 2NY6D 2W0LA 3RVWD 3B3IB 4KRLB 3VMOA 5F9WC 4Z77A 3BZEA 3RFZC 4K7FA 3T0XA 5GS1A 3BP6A 4GFTB 3KYAA 4Q7DA 2F8VA 4D8PB 4TTGA 3PWLB 5DD5H 2UZXB 1JNNL 3E6FB 5EC2A 3WIFB 4Y5VB 3QWQB 1RUAL 1AR2A 2JTDA 3C5SA 1JTTA 3O4LD 3PQYE 4MCZB 2AXFB 4N0CD 5C2UB 3TO4D 1PSKL 1LMKA 1WF5A 4M7LL 5L2KA 4FFYH 4HGKC 1DEEB 4WHTB 1HH9B 1KB5A 4WU5B 2BNRA 1QLRA 2FO4A 3MV8D 1PKQE 1U92A 5H2BB 1GL4B 1U8MB 2EYSB 4QOKE 5GGQH 3KPOA 3WIIH 3RY6A 5K9OA 1F11B 3CSYA 4R96B 3PIQB 1U8PA 4OZFA 2WINA 3U4AA 3BESR 3EDKA 3M8OH 3BAEH 3BWAB 3KNBB 1JZ4A 4O9HL 3ARDB 4W70A 1E4WH 2FZ3A 4WGWB 1NFDB 3CVIL 2W60B 1J1OH 1T5WA 1B6UA 5E2VH 4JFFD 3UYRH 5DJ6B 3T0DA 5F97E 4TPRH 1FQ9C 2EE2A 1DQQA 1YDPB 4RMQA 1U0QA 4ODTL 1OOAA 5IG7A 1MQKL 4BKLA 2EIZA 3D48R 2FRGP 3CLEL 3FMGH 4HQQL 3FB8B 2AI0H 4P57B 5I8OH 1PD6A 1T4KA 4G6KL 5CJBA 2ENSA 4QCIB 4OZGB 1SVZA 1EIBA 1QEWA 3DX7B 3ARSA 1VEOA 4ZXBD 4GXUN 1WFOA 3VD7A 4CMHB 5HVHB 4XMLL 1HH6A 1AXSB 1Q9WB 1MY7A 4OGAC 3QZWB 4WUUE 5D2LE 4AEIH 5TFSH 4ZOEA 1EMTH 4M7ZC 4OQTL 5ENWA 5E2UH 5BRZB 3S7GA 1XGTB 1AGEA 4L3AA 4XCNA 5ACMA 5K59F 3JTSB 2OJEA 2ZKHL 3REWA 2X4UB 3VRIB 4GAGL 1M7IA 1AD0A 1LO2L 2H2SD 3BH9A 5HDQL 4U1IA 4DUWA 1UWGH 4X7CC 1JTOA 4HC1L 3UAJC 1SVCP 5DWUH 5KSAC 4G8GE 4P3DA 1KGCE 3RIAF 3HZYA 1AGFA 1KFAH 2F58H 4HFWB 4WENB 1NAKL 3I84A 2E6JA 4LQFL 4XZUA 3L7EA 1QFHA 4G80A 4WFFD 3F6IA 3BGMA 1FJ1B 5DD6B 1A6UL 1R3IL 1KPVA 5E8DH 3IFLL 4HX1B 2EZ0C 5JQ6H 2V9QA 1U6AH 4LLVB 3WSQL 5L6YH 1FNLA 4UBDD 3JV6B 2ITCA 5F9JA 3WS3B 3BP4B 5DZNA 1BOGB 4JJHA 1KJMB 1KG0B 1S7UB 3SJVB 1A7NH 4ZG1A 3ZE1E 4RMTA 5JZ7D 1WEJL 3B8YA 1W72H 4Z7NF 4JREC 5C0ND 2HA1A 3CGTA 1AFVH 4OF0A 4LCYB 2WUBH 1NC2A 4F2MB 3QUXD 3MRIA 4F33B 3H9HB 4EUPH 5IVOA 3SDXB 4JO4H 4XNMB 3MRRB 5C0DA 1F3JA 4TTDD 4JFPA 1FNGB 5T3XE 1E28A 3G5YB 3Q3GB 5KS9B 1R6VA 3E8UH 3E0GA 5HJ3B 3QI9C 2R69L 2OK0H 4MXWL 4YK4C 4LARH 1GOFA 4NC0B 4X6BA 1LO4L 1LDSA 7CGTA 3T2PA 4KRPB 5IQ7H 3HAEA 3ILQD 1Q0YL 5FGSA 3HC3H 1WT5A 3S3PA 1YEEL 4EDXA 3UTTB 4RIRB 1XGPA 4GJTB 5T3ZL 4NHCH 3CUPB 3SCMC 4GRLB 5H35B 4XP5H 2GJJA 2XT1B 5T1LA 3H9SE 1KB5H 5I17B 5C2BL 1EV2E 1YJDC 3RA7H 4I3SL 4A2MA 1KN4H 4GSDH 4KKCD 1ZT1A 3F58L 5IBUG 1NUFA 5ADPH 1A6TA 1FZKB 5IV2B 1FNHA 4OZFH 3VRJB 5H8DA 3MBEA 4JFHD 3QEHB 5HHVH 1QO3A 3RWHA 3RY6C 5IJKA 3LV3B 3LEXB 5D72L 5IW1A 1XZ0A 1U41A 2A77L 4Y19B 3ROLB 2Q86B 2M2DA 1S8DB 1KOAA 2MHAB 3E2HB 4HMCA 3HUJF 3VFVA 1A14H 2VZ3A 3W0WE 3GMPA 3QIUB 1NDMA 4FABL 3VFSA 2OYPA 1CF8L 3OKMB 3NBNA 1N7ML 2C1PA 2I27N 4P5KA 4OI9A 1X7QA 1JMZA 4FQ1L 4U1KB 2EDJA 2YD9A 5DRZB 5T5FH 1D6EA 2BSTA 1CD0A 5IHUL 3KYKL 3UROR 3EW3B 1NGPH 3OZ9H 3MRBB 3BUYA 4X5LA 4OZ4B 3DMMD 1Q94B 3MACL 4KHXH 4QHUA 1G7PA 5HDBE 4CW1B 2ICWB 1ZS8A 2BOBB 1HQ4A 4B7LA 1QR1A 4RAVB 5AYUL 4U4BA 4APQB 1NLDL 5JPMB 1KELL 3KVQA 4R26L 5E5RB 4D8PA 1UZ8B 3PWLA 3E6FA 4M1CC 5DVKA 4YXHL 5KVDH 3WIFA 3QDGE 4Y5VA 4QTIL 1OW0C 4XP1H 4MCZA 2AXFA 2XA8H 4PRNB 3MRJB 3IS1X 4O02L 1F42A 3VXMB 4Y4KB 1SEQH 3TT3H 2JCCE 4PTUB 1A3QA 1KTLB 2F74B 3NN8B 4M1GH 4UDTA 1DEEA 1DFBL 4GO6B 4WHTA 1X4XA 4WU5A 4DQOH 2EICA 3ZDXE 2YPVL 1S7TB 1B2WH 4LAJH 1IAKB 1U8MA 2EYSA 1MJJB 2HG5B 1YEHL 1F11A 3LS4L 4R96A 3PIQA 4PIRF 1OM3H 4AEFA 1Q9KB 2VAAB 3QO0A 1MFAH 4FFWC 3AC0A 1BD2A 3BWAA 3KNBA 4M6NL 3ARDA 3QPXL 3S5LB 3HE7B 2Q8AL 1L7TL 1CIDA 4HJJL 1WWBX 2HP4A 5LWYH 3GJFB 5GISL 2Y23A 3PWUB 1NFDA 2W60A 1OD9A 4UAOB 4OCWL 1KCKA 1TNNA 5HI4C 4PJ5D 3F5WB 5DJ6A 1MCOL 5T1KB 1I7ZB 1O7SA 2VL4A 1C1EL 1YDPA 4NC2B 1AIFB 5MEOA 4Y1AD 3WLWD 4QGYA 4YGVA 2AEPL 3FB8A 4P57A 3TPKA 5HYQA 4OV6F 4RX4A 4M5YL 1IGIH 2VLRD 1INDH 4MD0B 4MNQE 3B9KD 4QCIA 4OZGA 1JWSA 5KSUB 2ZUQB 3HMWH 1OAXH 2F19L 1EAJA 3BDXA 4LSPH 1DQLL 4IDJL 1MHHB 1AXSA 1Q9WA 3AS1A 3X14A 3GRWL 3QZWA 1CLCA 1YEJL 4Y89A 2BY0A 3VGDA 3HAEH 2FJFB 4DN3L 4MA1C 5E6IB 1MF2L 4HW6A 1MEXH 4MJIA 4P48A 5GJSH 5BRZA 5TDOB 1P6FA 4Q9QL 1XGTA 4OIIH 3VWKB 1G9NL 3S36H 3BPOC 1OTUC 2ICES 3JTSA 4KTEL 4PG2A 3GSWA 2X4UA 4J6RH 2XNAB 3VRIA 2GI7A 4OLVH 2VC2L 4URTB 5EUOB 1RZ7H 3NCJH 3UYOD 5CBAB 3ZE2E 4PGBB 4YDIH 4TUOB 5HHNB 5AYQA 4QNPF 4HFWA 3U7AA 5F21B 2MNUA 4KKAC 2Y7QB 5SX5H 2DLTA 2E27H 5J11C 4XVUC 3JUYA 3OAZH 1FJ1A 5DD6A 1FLTX 4PJBF 5I30H 2DI7A 4CN4A 3A0OA 4HX1A 3D9AH 3RDTB 4LLVA 2CRYA 1KJ2B 3JV6A 3WS3A 3HG1B 3BP4A 1BOGA 1KJMA 1HXYB 1KG0A 1S7UA 3SJVA 1DZBA 3CK0H 4FQCH 4NCC1 3DETD 4NGHH 3ROOB 2R8SL 4S1SL 4WIQA 1F4XL 5F9AC 1YPZF 4FZ8H 3WLBB 3T0ED 1TNMA 3WFBL 1FBIH 3DO7B 4LSRL 5DC0A 2UY7A 3IS0X 4LCYA 4F2MA 4GG6E 1T1XB 3OF6A 4F33A 3H9HA 4X80L 5IFJB 3SDXA 4L29B 4XNMA 5CEZD 2W9EH 4KMTL 4R9HA 4FFZH 4I3RL 4J23A 2D9CA 3G5YA 3UDWA 2ZP0T 3Q3GA 4NKIH 3MROA 5KS9A 1MFEH 1NL0H 4UQ2B 5AD0B 4OCRL 3LHPH 4U2ZA 1MCSA 5D7JB 5HJ3A 3VI3F 2IAMC 1QFWI 5GGSY 4NOFA 4DVBB 5TQ0L 1AO7E 1KACB 3MRMB 3TVMD 1BECA 5B22A 1MIEH 3UTTA 4RIRA 2NZIA 3FONB 4MHHI 5E99L 2JE8A 2WIMA 3CC5B 4YO0B 1RURH 3CUPA 4K3EL 4GRLA 5H35A 3TGXA 5KOVC 5I17A 3GSOB 3KLAB 4ZAKD 3BN9D 5DR5L 3VFPB 2VLKB 2MCPH 1FZKA 2O5YH 1AKJD 4XNUH 3QUMB 2WLYA 5IV2A 4X0KB 4YHPB 2F54B 1JP5A 3O0RH 4KVCH 1IKFH 5IJVB 3CFKB 3VXRD 4NUJB 3LV3A 1XF5B 3LEXA 4HUMB 4ZNCD 3JVGA 4Y19A 4GXVH 2RCSH 3ROLA 1J1PL 4X4MA 2Q86A 1S8DA 2X9WA 2MHAA 4ZFZB 5CUSL 5KVEH 1C08B 3KS0H 3ZLQC 4XX1E 5I18L 4JR9L 1WCQA 5F7EH 3QIUA 5ISZE 3VRLF 2N56A 1UYWL 4ZOBA 3OKMA 1OTSD 2IMMA 5D2NC 1PEZA 2OL3L 2FX9L 4PB0L 3WMSA 1FCGA 1NKRA 4CVZB 4U1KA 5DRZA 1CXKA 3C8HA 5IOPB 4BQ8A 3MUJA 4RWYL 4P0DA 2M1KA 1GIGL 3MRBA 2R2EA 4OZ4A 3RZCD 3CXHJ 3FAXA 4JO3L 1Q94A 1T2QL 1AR1D 5IVNA 4P4KD 4NNYB 4CW1A 2ICWA 3GSNB 2BOBA 1WISA 3RWGB 3JWDC 4RAVA 4I0PB 2Y6SD 4APQA 4YHOL 2QADC 3V0AC 1U9KA 3QHFH 3RI5K 5JPMA 4HMDA 4OKVB 4FQQB 1HIML 1UZ8A 3QNZA 3L3OB 3I6KB 4G3YL 2NW2A 3C6LB 3KPQB 1UM5H 2VDKL 1JRHI 1YUHB 2MKWA 3WKML 4PRNA 1EVTC 3ETBF 2X70B 2ZCKL 2C4XA 3MRJA 4LEXL 5L7XH 4H8WH 1EJOL 1S7VB 3VXMA 4Y4KA 2QQNL 5D70H 4PTUA 2Z35B 1KTLA 2F74A 2XWTB 3NN8A 4KJPD 3VD9A 5I8EA 1DBKH 1N2RA 1KIPB 5HYJE 1MIMH 1S7TA 2R56H 3R0NA 3KYOB 2ZJSL 2PR4H 5D8JL 1IAKA 3TC9A 1MJJA 2HG5A 3BMVA 1BQLL 4KHTH 5F71A 2WBKA 3S34L 1X5KA 1Q9KA 2VAAA 3IJHB 5L9DL 4MWFB 4NQDD 5LGKA 3BE1H 5FKAB 3S5LA 3HE7A 3FFCB 1V8HA 1I3VA 3SKOB 1JWUB 3GJFA 3PWUA 1HINL 2FATH 5ESVA 1KXQE 5IM7B 2D0HA 2J3SA 1OAZH 3HNTL 3H3PH 1MRFL 3F5WA 1UWXK 3IDGB 2A9ML 5T1KA 1I7ZA 3ZKXC 1OSZB 5DZOA 1LGVA 2F8OA 2VIRB 2ATKB 1AD9A 4JY5L 3BI9X 1AIFA 4TSCL 3TH4T 1MCCA 4K07A 1UM6L 2NXZD 4OSUH 4CL7A 4N90E 2ARJB 4MD0A 2YC1B 1B3JA 4GRWE 4JRYE 1JZ6A 2QV2A 4R4ND 5KSUA 3TJHD 4M9PA 5C08B 3F7VB 4FFVD 5EBLB 5I1KH 3K1DA 2XN9B 4PJ7E 5CEZL 4OI7A 3ZZ1A 1MHHA 3UDWC 4Q6IB 4MB5A 4JM2D 4DOHB 5J06A 3QFDB 3RTQB 4JHAL 2DD8H 5IB2B 4N0YH 2FJFA 2NX5B 5E6IA 2EXYD 3RX8A 3V6OA 3VWJB 5TDOA 3FQRA 3VWKA 3FO1B 3EZ8A 4KTYA 4XNZC 1YYLH 3BKYL 3CMOL 3G6AB 2AK4D 2IQAB 3O3DB 4XPGL 2XNAA 3HE6D 4HK0B 5EUOA 1ORSB 5JDJA 2AJXL 3I02A 2W1NA 1OHQA 5CBAA 4WVRA 4PGBA 4TUOA 2D7NA 2DF3A 5DLML 2QBWA 2HLFC 1FAKT 4KUZH 5HYSB 2Y7QA 5C70A 1D5MB 1MHCB 1Q72H 2Y07H 2WUCH 4F3FB 1CE6B 4Q58C 2LE9A 3QNXB 2I26N 4P4RB 4OD3L 3RDTA 4U1JB 4QRPE 3JVGC 1RFDL 1KJ2A 3HG1A 1W0YT 2D03L 2ICWJ 3FN0L 4WV1B 2J8UE 1HXYA 4S1DD 3ROOA 1CXEA 1WWAX 3QIUC 4JE4B 1QFWL 4W6WB 3WLBA 7FABH 4O4YH 3DO7A 4M6MH 5IFHH 4XCFL 3T3PE 2XG5A 4N8CH 1T1XA 1OCWL 1OP9A 3UJTH 1CBVH 5IFJA 2KH2B 1U58B 3S4SB 3ULVD 4F7PB 4HIJB 4R97B 2D31B 5I19L 3O3UN 3AFLA 1NANI 1QBMH 5ABDE 5K93A 3GBLA 1J8HD 1MVUB 4UQ2A 5AD0A 3KPRD 5D7JA 3D85B 1JIBA 2YS4A 1NFIA 3HNVH 4MAYB 2CXGA 1FYTB 3KXFE 5FYKD 5B39G 3OXRB 3JV5A 1KCRH 4QRRD 4CJ1A 3QULB 4APQC 4XWGH 4DVBA 2MCG1 4M7JL 4K7PH 4XBEH 1MELA 3BSZL 3LB6D 3MRMA 4ERSL 4HKZB 4Z0XB 1GGIL 3LRSB 3FONA 4LL9A 2DQIL 3CC5A 1A9EB 3DTXB 4YO0A 3T4YB 3IU4H 3GFUA 1T03L 3JV0A 1G0YR 2BVYA 1BLNB 1TFHA 3GSOA 1AE6H 5IVXE 3KLAA 5TGBB 3UZEA 3GB7B 1JMXA 2Y06L 3VFPA 3SHSA 1QSEB 1MFCL 4KROB 3QUMA 1MAMH 4TQEH 3S98A 4X0KA 1Q9OB 3TM6A 4YHPA 4X6EB 2DLGA 1BVLB 2F54A 4RAUB 5IJVA 3CDGB 4KRMB 3VXSD 2YD4A 4NUJA 1I7TB 1XF5A 2J4WL 4PGJA 4YBLC 1FHGA 3B9VA 3GJFH 3TP4A 2OR7A 4OFVA 1PG7X 5IBLC 4MMXC 3DXAD 4PYGA 3HE7C 5E4EC 4ZFZA 3BDBA 4X9FA 1C08A 3NIGF 5DJAB 3EDFA 5ILTL 2CK2A 4LNRB 4ODSH 2OXGA 4AIXA 2YWZA 5DQDL 4UAOC 1HWGB 1NUDA 3B9EA 1ERNA 3IT8D 1A7QH 1Z3GH 4KI5C 4IOIB 4Y4FB 1DSFL 4HUWB 4U1SB 4CVZA 3HB3C 1QFOA 5E00B 5HI3C 1FL3B 5IOPA 1P5VA 5DMYA 2IGFH 4DKEL 5BCAA 1JRHL 3DVIA 5EOQL 1C5DB 3QFJE 4EBQL 5KW9H 5GS2D 4R7NB 4HUUB 4NNYA 1RUQH 2ZUQC 3PQYB 3RWGA 3U1SL 2AJZB 4FQXB 4GBXC 4I0PA 5L2JA 5JHLH 4Q6YA 5FYLE 4OKVA 2R4SH 4FQQA 2BNUB 4Z8FL 1BBDH 3PABB 3L3OA 3I6KA 3KPQA 3C6LA 5EU7C 2WNGA 1E4KA 2B39A 3ZKSD 4QOKB 4PRIE 1BMGA 1YUHA 5TQ2H 3V4PH 4RFEB 2X70A 3FZUC 1HYSC 1S7VA 2YR3A 4RZCB 6CGTA 2VLJD 2Z35A 1DQDL 3O9WA 2XWTA 1QTYT 1H3UA 3C6SB 1G0DA 1TVDA 2APWA 3OB8A 4M1DL 1KIPA 5BVPH 3KYOA 1K6QL 4N5EC 3O8XB 4ODVL 5EZJB 4D9LL 1F58L 5CJOL 4Y16D 3IJHA 1ZT4B 3GHEH 1IARB 4MWFA 3GI8H 2GTZA 2VXUH 4HXAL 5FKAA 3HHRB 2J88L 1A0QL 5TPWL 2X4RB 3QXTA 3IFOB 3SKOA 2AKRB 1JWUA 1A6WL 4Q9RL 1F5WA 1UENA 4JPKL 5GRJL 1KJ2H