2Z8WC

Structure of an ignar-ama1 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLLLRDYNYSLLFRGEKGAGTALTVKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Apical membrane antigen 1
publication title Structure of an IgNAR-AMA1 Complex: Targeting a Conserved Hydrophobic Cleft Broadens Malarial Strain Recognition
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 28
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z8wC00
2UV3A 1FNSH 4H1LH 2A83B 5HGDA 2C9AA 5EWIH 5J7CC 1P4BL 4TPRL 3GHEH 4W6YB 4LCWE 1NCWH 4Z8FL 3DXAB 1F3JA 2XWJA 5CZVH 3KYKL 4WRLA 2R2CA 2F8VA 5E4EC 2A74A 3CFJB 4RX4A 4OCLC 4MZ2A 2X4TA 2IPTH 3BT2L 4GG6A 3ZYOA 1MRDL 4ONFL 3MNVA 3QUMA 4U6VL 4Q9QL 3Q6GH 4PG9A 4HPOL 5ICZB 2GJ6A 2YSSA 3ULUL 1HKFA 1I3RB 3NPSC 2R15A 3FT3A 3CPLA 4GRLD 4YNYB 2JB5H 5EH1A 1F4WL 3NZ8A 2BC4B 3MCKA 2B20A 4DGVH 2HFTA 3KXFE 4G6FB 4WU5B 4S1SL 1MJ8H 3PDDA 1Q72L 4KH2A 1OQOA 3MJ9L 4LMQI 1BOYA 3ZE0E 3D87B 1N5YL 3GSWA 3LDBB 4XCEA 5E8NB 2ZUSA 4NNYA 2E6QA 2BHZA 4BFBD 5MEQB 3C60C 2PTUA 5T1MA 1YY9C 5CCKH 3V7MA 5DFTA 4X9HA 1CD9B 5HGHA 4JN2A 4CADA 1WFTA 2E27L 1I8KA 5B39G 3BO8B 5D6DC 3ZL4L 5DTFA 5HGDB 4LLUA 4PJ9B 2CUMA 1UYWL 1HHKA 4U3XA 1IC5L 2BY1A 4IMKA 1F3JB 2AXHA 2XWJB 5E8PB 2CK0H 3E6FA 4EDWH 2A74B 3RWDA 5T1KA 3WKNA 5DD5L 3HG1E 1RURL 4YBHA 4GG6B 3TFKD 1N2RA 1WEJL 5ACZA 2X1WL 1ADQA 3R06B 1KC5L 4X9FA 3QUMB 3KHQA 3TJEL 3D3VD 4OCYL 4Q58C 5CZXD 3QUZA 4PG9B 4FFVC 5ALBH 4ZFZA 5MHSD 4NWUH 1C5DA 1UJ3A 1BM3H 4FFYH 2FX7H 2GSIB 4HXBH 2AXGA 5GRXG 5D2NA 3NZ8B 3VFOB 4QHMA 3RWGA 2VDRL 3SDDB 2D7TH 3JWOL 5D9SA 3QXUA 4KVNH 3FFCD 1OQXA 3SGJC 1VCAA 5E00A 3TCLA 1KPRA 2BVOA 4OV6F 1D5BA 4GKNB 3WCYA 3GSWB 4XCEB 3G6AB 3MGTB 1MY5A 1IAII 4NNYB 3NABH 4P4KB 2EIEA 2UWEB 3RIFF 3VFPA 4X7EC 5B3JF 4MXWL 1K8IA 3IF1A 4JN2B 4CADB 3QNYA 4H1LG 4QT5A 5JPNA 1I1RA 1VFOA 3EZ8A 5F7FA 2NY2B 2VLRE 4H8WC 2ZPKH 1QSFD 3LSOB 2YD6A 2EEBA 1ZHKA 4P2RD 1HHJB 2IFFL 4CVUA 8FABA 1F6AA 3PXJA 5GRUH 4Y4FA 1TQCB 1LO0H 5F8RC 1S7XA 2VOTA 4U1IA 2MFNA 3VJ6A 4Y1AE 1JP5A 3NCEB 4WEBH 3L95A 2DIJA 4BFIA 4MD4A 4ODHL 1WUNT 2HJKA 3H3PH 5T1KB 1QSEE 2I5YL 3JTTB 4HCRA 5D1QD 1W0YT 5D1XA 2QR0A 2OL3A 1BJ1J 4JO2L 2ESVE 2ITDA 1N2RB 4LCYA 5ACZB 4NO0A 4NO2A 1VFBA 5IHUL 3QUZB 3MJGX 3VXUA 2W9LA 4UV7H 4N90D 2XZZA 5HYFA 3RTQA 1FNGA 3ARBC 3OB8A 4PJ5D 4R26H 5DUMH 3VXTA 1X5YA 4K3GA 3NOIA 5EFIA 1H3UA 3MV8B 5DK2B 4QHMB 5FYLL 4NJ9H 5EU5A 5D9SB 1ZHNB 1YMMD 4L3CA 5E56A 2FHCA 2KQMA 3GJFA 1OD7A 3ULSA 32C2B 1F4YL 4ZTOH 1WWCA 1U3YA 1KLGA 4YWGH 5E00B 3TCLB 2BVOB 1RZKC 1D5BB 3LKPB 3U1SH 1HHIB 4R0LA 5IVXF 3K2MC 1U6AH 2DWDA 3NIFE 3QG7H 4X5XA 1INDH 4QRPA 1UB5A 3VFPB 1M05A 5B22A 2VDLH 1AO7D 4QT5B 2EDTA 1EGJL 1JHLH 1FZKB 5GGTL 3S4SB 1F02I 1YEHL 5B3NA 1ZHKB 1MVUA 1D5ZA 4RAVB 4APQD 5GS2D 3OR6A 3PXHA 1S7XB 5CJXC 5EU6E 1MJ7H 2CQVA 1YPZA 4KZDH 1CICC 4BFIB 1W72H 5KSVA 4M1GL 4LHJB 3X3GH 1GAFH 4ETQA 5JA9A 2XN9B 1JGVL 2QR0B 4PREB 3FKUS 2J4WL 4PRHE 1WISA 4LCYB 5D7SL 5IB2B 1MIML 4NO0B 5IHLB 4NO2B 5DJAA 3VGBA 4OFIA 2SEBA 5KVFH 3V6OA 3LKOB 4X8XA 3EYUH 1XGQA 5JA8B 3VXUB 5JXEA 1AGDB 1FAIL 2VTFA 4LVHC 4WHYH 1FNGB 1IBGH 5C7XL 5K9JL 4RSVA 5SX4I 3VXTB 3LZFL 5E2WH 4YHMH 4QHKI 5EU5B 1G9NL 3ZT6A 1KTLB 1Z9OA 5CILL 3HAEA 3GJFB 4PJCA 2DMCA 4JFQA 3TIDA 4GS7C 3JTSA 4KDTA 4JB9H 1LNUB 2FBOJ 4PJEF 4S0SD 4R0LB 3LEYL 4K8RD 1JNNH 1S3KH 1WBYA 2YD1A 2F5BH 4MGXA 1UB5B 4XCNB 4YFLF 5CEZH 1M05B 2MHAA 1A6UH 2OMNA 3AY4A 4H25B 3QULA 5DUPH 3MO1B 5I1JL 5GS0D 2YHGA 3OXSA 3QUYA 5D93B 2NW3A 2XA3A 5JTWA 1IQWH 1YEDA 1MVUB 4N0CC 4CJ0A 3HUJF 1MWAL 2NY3C 4R4FL 4LQFH 2IGFH 5E9DA 1IT9H 2PYEA 2H1PL 3STLA 3WFCL 5IB5A 3O0RL 1YPZB 5KS9B 4TVSa 1U8MA 2EH8L 5KSVB 1VEMA 2YUWA 3BEVA 1SBBA 5INCA 5F1NA 2EICA 1LGVA 3RUGA 1OT1A 3BD4A 1KYOK 2FB4H 5CGYC 5DJAB 2SEBB 3WIFB 2FLBT 4HKZA 4NHUB 3HZYB 2XFXB 4P2QE 4ERSH 2R9HD 2PTTB 3SCMB 2AK4E 5E5RB 3HS0A 2YD5A 4XRCB 2Y6SC 3RY6A 2V2XA 2PO6C 2ZOLA 5GGRA 5MEOA 3HNVH 3THML 3VDAA 4F9PA 3CXDH 4YBLB 3HAEB 3W11C 4JFQB 5DJCA 3AREA 3TIDB 4K2UL 3JTSB 4AEIL 3G5YB 1BP3B 4GRWB 2EXYC 4I18C 4N0YH 5IROC 5HVFB 3CFDA 4U0RC 5DLMH 4LSQH 3RGVA 2P8LA 3IU3A 2WLYA 1ZWIA 3TYGH 3UTTE 5IFHH 5LAXA 1TZIA 2MHAB 4NQDA 1V05A 2AJUH 3CC5A 4FMKA 4X6FB 3SDCD 3QULB 2GTZA 4NFCA 4I3SH 1KTRL 4PB0H 4XPTH 3IJSA 1PLGL 3SE9L 1OB1A 1ZGLP 3QUYB 3NTCL 2NW3B 3MGOB 1HHHA 4PRIB 5BV7B 2GCYA 1X6NA 4P2OC 3DX7A 2X7LB 3U0WH 3G5ZA 3IDNA 3RX8A 3KPLB 4LCCC 2F8OA 2DBJA 5F6IC 1U8MB 1U8IB 1EFXD 2IJ0C 4FQ1H 4O2CA 2EKJA 3BEVB 3LKQA 5BS0D 2YMXL 4IS6A 3ZKQD 3TBVA 3SDAB 3RUGB 5JLZA 1EO8L 4HWBL 4HKZB 4WHYG 5FA4A 2ZG3A 4G9FA 1JNHA 2ARJA 5FO7B 3HS0B 1ACYH 1CGWA 2XTJC 4M7KL 4QYOB 2ZOLB 4G3YL 4J3XA 2VLJD 4M5ZL 1T5XB 4UT6H 5L2JA 1L0XA 3LHPL 1WAAE 4XMKH 4EZMA 1H3GA 4P0DA 3S3PA 4HKJB 1P2CB 3AREB 5DJCB 3DV4A 3O6LH 1X4YA 3V7AG 3ULUC 2VN7A 1QQDB 5DSCA 4LMQE 3SQOL 3TEUA 1GGIH 4K9EH 1U95A 3EO0A 1JI1A 4LEXL 3SE3A 1P6FA 4QRSB 3VXNA 3HB3D 3LRGA 3RGVB 1AE6L 2P8LB 3CXHJ 5T33H 5FO8A 4OF7A 5DO2C 1ZWIB 4DK6A 1CBVL 5EC2A 5GJSH 2AQ3A 2OM5A 3C08H 4LCIH 4NQDB 3MJ8A 2OK0H 2GTZB 5C0BA 2P4AB 3IJSB 1ORQA 2YXMA 1KFAL 1OB1B 4A6YL 3QFJD 1GIGH 4S1QL 1KLUB 4B50A 3OZ9L 1BWMA 1RUPL 1XIWC 2V2WA 2IBZX 3D85A 4YDKL 5C86A 2ZCLL 1CK0L 5E8EA 1T66D 2YWYA 2HG5A 2V7NA 2GAZB 4ALAH 3RNQA 3WFEL 3TBVB 5FK9B 1TETL 3DYMA 3LS5L 2APTA 2EH7L 4WWKB 5FA4B 5ENWA 5ETUA 4W6WB 1D6VL 5D7JA 1JTPA 5BRZB 4DGIH 4ZOEA 5FUOH 5C0DA 1UACH 3K8KA 3NCYP 3IDMA 5GIRA 5L2JB 1UA6L 4HK3N 2KKQA 1SYVA 4N8PA 4UINL 5ANME 4YHOH 1RAMA 4P2RE 3FAXA 2APWA 5D70L 1CS6A 1MFEH 3EO0B 4YFEA 3WJLC 5EPMA 3DBXA 4IRJA 3CH1A 4G5ZH 3JWOC 5J89A 5T1DH 2DDQL 4M4PA 1MRCL 4MMZC 4XAKD 4XPGL 5C0JA 3PJSB 5FO8B 2XZQH 5C2BL 5EC2B 3OV6A 2AQ2A 2ORBH 5E8OB 5HYJA 5JUEH 3DUHA 1F2XK 3WJJC 4I77H 5GGRY 2A6JB 1AGEA 1AGCB 3O6KH 1B3JA 2JCCE 2P5EE 1HKLL 2F8XC 3UMTA 2Q8AL 3MLVL 5EORH 4N90E 4JQVC 1T20A 3T3ME 4KTEL 1YJDC 3AS2A 4PJ5E 4C56A 5HI4D 5CBEB 4ZS6C 1HYRC 4Z7OF 3GMMB 1IARB 3OMZA 1YMME 2HG5B 5AZEH 3QPQD 1ZS8B 3RNQB 2EDFA 2D9CA 4UBDC 1AR2A 1TTGA 3BVNB 2QSCL 2BVEA 4Y5VC 3O45A 3FQWA 4JO1H 4QF1B 2KUTA 4TVPD 2UUDH 3TC9A 1I7ZA 5ENWB 3G6JB 1WJ3A 2YD9A 5F9OL 3NFPB 4OM1H 1AFVL 3RFZC 3BEWA 3BKML 4JFPB 3QUKA 5GIRB 4JRYD 2E9JA 2J1KA 3IXAA 1AO7E 5F9WC 3BDYL 2W38A 5GZND 1C12A 4RX4D 3BQUD 2NTFA 5ALCL 4DZBB 3VXMB 5JXAL 1NMAL 5D1ZC 3KVQA 5EPMB 3CH1B 5JHDA 2XKSA 5T3XH 3V0AC 2E9IA 3EYVB 2IQ9L 4HWZA 2ATKA 3QHZL 5HYJB 1TIUA 4WTWA 4Y16D 3ZTNL 2R69L 3RX5A 1D6EB 3EDKA 3VFUB 4NC1C 2HLFD 3S6CA 3I2CL 2Y1VA 3WYRA 1YEEL 2AJSH 4GQ9H 4PP1D 5E5MA 2PW1A 1T20B 3FN0H 3AGVA 4FS0A 3NIDE 2VDOH 1YEKL 1DLFH 2OXGA 3QI9C 5DQJA 2H9GA 1IKFL 5EU3B 3L3JA 4YXHL 2FJGB 4UU9A 1OTSD 4OZGA 4HKBA 4OZHB 1H8SA 3L5XL 3FQWB 3O45B 5F7KC 3HMXL 2ADGA 1OTTC 1OCWL 5I1GL 5JMOC 4XC1L 1UM4L 3FL7A 4KHTL 4URTB 4WTZG 3UXFA 3W2DH 4JY6A 1E6OL 2AABH 2VISA 2FSEB 2EZ0D 3KLHC 3T0XA 2QADD 1GH7A 4KK5D 3IXAB 1FO0H 2GK0B 5DRXA 4RRPA 1CXHA 5DFVD 3GHEL 4DUXA 4HHAA 1NCWL 4J4PA 2NY4D 3GHBL 5FYKU 1OAZH 3LQZA 1P4LA 4MWFA 2HVKB 2EDQA 1AKJB 1PEZA 3BHBA 5AUMB 1UWXH 3CFBA 5C0CD 1CD0A 3ARDB 4AENA 3FQUA 4NNXA 4I0PC 4Q9CA 3Q6GL 2J6EA 1E4XH 3H0TA 2NTSP 3UZEA 1PG7H 4ZSOB 3P40A 2NXZD 5E2TH 2XI9A 2PW1B 4ODWB 4B41A 2XNAA 5T3ZD 2JB5L 4XNZB 2EDNA 4ODVL 3OB0K 4JFEB 5F7HA 4DGVL 1YQVH 1MAMH 1EAJA 1MJ8L 4XVUD 5GHWH 4CJ1A 1HOCA 1I1CA 1PX4A 4OFVA 3HZVA 1T2JA 4OZGB 1NBZB 3WLBB 4POUB 2ADGB 1A0QH 3MOBH 1GGUA 2VWEE 5DC0A 5HJ3A 2YD4A 2OI9C 4XI5C 1MY7A 3JWNC 4JRWA 4M1CD 2F15A 3R0MA 4JY6B 4WY7H 3DMMA 2VISB 3VFNB 1Z6JT 3TZVA 1HQ4B 3PGCA 3QO1A 3KYMB 4TSBH 4FQXC 4YDVA 3F5WA 4QRRE 4I1NB 4XBPB 4F7TB 2WW8A 3TBWA 3W9DA 3RVWD 1T80A 4PJ8C 4M6AA 4H20L 3MBEA 1PZ5A 5D1XD 3VGAB 1KCRL 4NZJA 1HQRA 3QDGE 4LLVA 5DHYA 5DYOB 5F9AC 3VXSA 4J1UA 2CK0L 2JTDA 5B39A 5HYEA 4L4VA 2Z4QB 3RKDD 5IQ9A 3LB6C 4ZQKB 3RTQD 4KKLD 2E7HA 4FG6C 3ARGA 4JDTH 3I75A 3KS0H 4NNXB 4AENB 5JZ7D 4JDVA 3QEGL 3H0TB 3EYOA 2PTVA 5ALBL 4EUPH 2OTWB 4X6CE 3OAYH 1D9KD 4FFYL 3MRPA 2XNAB 4R97B 4NN5C 4KVNL 5EBGA 4JGJA 2X70B 2IPUG 3F7PC 1DEEA 1HOCB 3P9LA 1NCCH 1KOAA 5C6TL 3K81A 4R7NA 1Q0XH 2O5YL 3GRWH 2HFGL 4CW1A 5BOZG 5FUCC 5C0GA 1VADB 5HJ3B 3NABL 4JM2A 4WV1B 5C08E 1Y6MR 1ZANH 3DMMB 1A7NH 4P2YA 5C0NC 3QO1B 2Y9RT 3C8KB 2HRLA 4X6BA 4ZNEA 4YDVB 2ZPKL 3F5WB 1MI5A 1J1PH 3ABZA 1RVFH 2IAMA 3TBWB 3A6BL 2ERJC 2CXKA 3QFJE 3RBSA 1PZ5B 1B0GB 5DD1L 4WEBL 4I4WB 4LLVB 3VXSB 3TBSA 4JRXE 4H1LA 5B39B 5F3BB 3H3PL 3LN4A 1DCLA 4L4VB 1U8NA 2XPGA 5FYJH 3U6RA 3V4PH 4WFHD 2VLKB 3N85H 5L0QB 5FO9A 4ZUVA 4EN3C 1S7TA 1WTGT 3P77A 2X41A 4FQ2H 1LEKA 1WF5A 3VG9C 4AIXA 3V4UL 2O26U 4R26L 5DRWA 5DUML 3WS6C 3MRPB 3RWJA 2DQUH 1BVKA 4OI8A 4C58B 1IGCH 1RFDH 4LGPB 3MC0A 1Y6KR 3D0VB 4U1GB 1OW0A 2WNGA 1U2HA 2AEQH 1BGXH 2Z92A 4KK9D 3N1PC 3TJHD 4G8EB 5FYKD 4ZTOL 3LY6A 1PBYA 2R4RH 3P9LB 5DGQA 1IAMA 4DVBB 4R7NB 3RVVD 2FECI 4MCYB 3DYOA 2NQCA 2W59A 1Q9LA 4HFUL 3MV7D 2RHEA 5KANG 1B6UA 4UDUA 5C6WH 2VL5B 3H8NA 3QG7L 1J05A 1K6QH 3F62A 3AAZB 3VRIA 4WGWB 3PGDA 1LO5A 1NGZA 2VDLL 1ODAA 3I3EA 4WJ5B 5DJ8A 4X6BB 4R9HA 1JHLL 5E9DD 2PYED 4OFKA 3IKCA 4FQQB 3DHMA 4U6HA 3KGRA 1PYWA 4H88L 4Q6IB 3MR9A 2VKWA 1Q0YL 4O51A 3IDIB 2IANA 5F8QC 3C60A 4L5FH 1TZGL 5KN5A 4QNPE 1MJ7L 3JV6A 2EXWD 4P5TB 4KZDL 3JV4A 1W72L 4H1LB 1FFOA 4NP4H 3X3GL 3LN4B 1U8NB 2XPGB 4MD5A 4N1CA 4CU7A 4KUZH 3DVIA 5FO9B 3QDMA 4EUPG 5KVFL 1ZOXA 3VGFA 3EYUL 4L8CA 4GRMA 1PAMA 3NH7L 1F13A 3LKSA 1PGRB 1ZTXH 4G6JH 3QFDA 2IH1B 4C83A 2AJZA 4NBZB 2DTMH 1N6VA 1IBGL 2G5BA 1XCTA 2R0KL 5EZOH 5DRWB 5BMFH 1YEFL 1X5FA 2EC9T 1BVKB 2Q87A 4YHML 3CDGA 3VRJA 1JPGA 4LP4A 4O2FA 1YEGH 5C1MB 1NMBH 3WFBL 2X1QA 4EQ2A 2Z93B 2RAMA 4QRTA 4KKNA 1G6RA 2C4FT 4XP4H 5DMGD 1JYWA 1RZIB 3C5JB 3ZHLA 5L8KB 2WMPA 4GG6E 1FYHB 1RHHA 1LK2A 1Q9LB 1S3KL 3BW9B 4UDUB 1ONQA 2F5BL 3VRIB 1ITCA 3U48A 2GJ6E 1NGZB 5DUPL 4ZS7H 3QSKB 43CAA 4LHUA 2KPNA 1ORSA 4P59H 4BFEA 2FX9H 3RRQA 3IKCB 4HLZG 2WP3T 5HDQL 2CKBA 2X4NA 3FZUD 1TCMA 5EU7E 3VI3F 3LD8C 2IANB 4GKSA 3S96A 3X11A 1IT9L 5EOCJ 3JV6B 1TENA 3HR5A 2AW2A 2CDGB 3JV4B 2GEEA 4FXGB 3MLTB 1U41A 2I25N 4TNWF 1FFOB 5CS7A 2ED8A 2VZSA 4MD5B 1P5UA 5IG7A 3P4LA 5L88L 3MUHL 4G9FD 1KXVC 3BP5A 3BRGC 4NQCD 2FB4L 5TE4H 5F7UA 1PKQE 3QDMB 5D7LA 1ZEAH 3X12A 4IDJH 4MQXD 4ERSL 1MJJA 1MUJA 2BSTB 5D2LA 1M4KA 4C83B 2CIIA 3QQ4B 4KI5C 4Z95H 35C8H 2DM7A 4JPIB 5ESQB 3W82A 3ZSSA 1QFWM 1QHOA 3HNVL 3GSXA 1A6WH 5JOFA 3VRJB 4Q6YA 5IVXA 1JPGB 4O2FB 4NQEB 1I7RB 1T7WA 3BGFB 5DVLA 4MHHI 1E6JL 3MTRA 1G6RB 4E42A 4NZRH 4UT7H 3P11H 3ARBA 4N0YL 3Q5TA 4JN1H 3IAGC 4NO5A 2DJ4A 1LK2B 4LSQL 1MCFA 3LCYA 5DJZA 4OCNC 4OB5H 3IS1X 1AHWB 3TYGL 4YH6A 2XYCA 1MLBA 3CFCH 3ZE0F 3K2UH 3NZHL 4XPTL 3BZEA 4MAUL 3ZYJA 4MLIA 4U1HA 1FL5B 3CVHH 5EOTB 2V2TB 1AJ7H 1ORSB 5MENA 2RFXB 3S3SA 2D7OA 3IAPA 5D2NE 1X5GA 1UJTA 4EI5C 2X4NB 3FB5A 4PRBA 3U0WL 4GKSB 3S96B 1G7LA 3HR5B 2EEDA 5T3ZE 3FCTA 4LKXA 4N0UA 4UILH 4F8QA 3PF2A 4PR5A 4F3FA 3BAEH 4FQ1L 1LVEA 5IG7B 12E8L 5JIKA 1MCEA 4Y5XC 2V17H 5D7JD 5I1CH 3JZ7A 4LKCA 1Z3GH 4F57H 2P47B 3F7VA 1XR8A 4KXZH 5D7LB 3X12B 4GKZB 1MJJB 3MNWA 2WZPD 1LO3L 1MUJB 3RGHA 5CJXA 4HC1H 2CIIB 3P4NA 1ACYL 3IRZA 4J8RB 5D7IF 1EO7A 3IDUA 1FE8H 4AH2B 1AIFA 1CGXA 2MKLC 4JPVH 1QR1A 3PL6D 4M9PA 3R8BB 2YS4A 2VDQH 4PJEA 4ZXBC 5JOFB 4XMKL 5IVXB 3OKLB 1FGVH 2PETA 4MNHA 2GIYA 2Z8WC 4WHDA 3KPRA 2ZCKL 4NKMA 3D5OF 4E42B 1UFUA 3KPMA 3MOAL 4K9EL 4PGDA 1PKOA 2W9EH 3HCVB 3V79C 1UKTA 3SKOA 3WSQL 5IW1A 5FDYA 3X13B 1EHXA 3S36H 3C08L 2APFA 3HUJA 1EXUA 4JFFA 4U7SA 2AK1H 3VXUE 1RIHH 3VH8A 2OK0L 3WNKA 3BZEB 3B9VA 4U1HB 4ORZC 2D7MA 4XXCC 5J6GA 4OIIH 1GIGL 1P7QB 1U3HC 3HRZA 2AJ3A 1MLCB 1NCTA 4LLAA 4PRBB 4Y8AA 1W8OA 2NX5D 5C3TA 2EC8A 3GSVA 1G7LB 4N0UB 4YFDB 4HKXA 5FFLA 5I6XB 4J3TA 5CIPA 4GQPH 4F3FB 3OQ3B 4ALAL 1U93B 2R1YA 4LKCB 5K9OA 2N56A 4PBXA 4LSPH 1XR8B 4D2NA 3K8MA 3MACH 1J9CT 1CDBA 3MNWB 3VFGH 4QRPE 1W72B 3L9RA 4OCSH 3TBTA 3VXOB 3UX9B 1XZ0B 2HLAA 2ZUQC 3VA6A 4JO3L 5J4MA 4LSUH 4DGIL 3VFTA 5FUOL 1G0YR 5K59F 1UACL 1AIFB 3MV9D 1QR1B 2HH0L 1S7UA 4PJEB 3WNNA 1NQBA 2RR3A 4JR9H 4NJAH 3VE0A 4FA8A 1OSZA 1HCFX 1NLBH 2VXSH 4P23D 1W2KT 3KPRB 5BZDB 3HZMB 3RU8H 4YHYB 1VSCA 3GMOA 4M8VA 5DJ2A 2GHWB 5GS1C 2PO6A 4XP5H 4G5ZL 5IW1B 2V7HA 5T1LA 3RWCA 5LQBL 5T1DL 1QYGL 4OQTA 3B2UC 3TBYB 4MS8C 2XZQL 5E6IB 3V6OE 3HUJB 1HEZA 5JUEL 4BH8A 2YC1A 1QR4A 1DTUA 4GS7B 4OGYH 2H2PC 4WFHE 4I77L 3ZMRA 4OF5A 1QFWH 3NIFF 1C1EH 4TOYL 3MLWH 4ZFFA 1T0MB 3MRGB 1BVLA 4LLDA 5EORL 3S97C 3ARPA 4JGUA 1C5BH 1VPOL 4XH2B 3GSVB 4PJCE 5F3HA 4Y2DC 3QO0A 1SJXA 2P7TA 3U7WH 4HJ0D 5CIPB 2HMIC 1Q1JH 3GJEA 5AZEL 4WW2C 4POZC 1X5XA 2R1YB 4RGNB 1QO3B 5DDHA 4GAGH 1XF1A 2P49B 3MROB 4P2OA 3TNMA 4JO1L 1UVQA 2ZUWA 3DVNA 4MX7A 5I1KH 1FIEA 3L9RB 3QWQB 3F6IA 3BSZH 2HLAB 4ZPTA 4J3WA 4OM1L 4LCCA 4MA3A 2IADA 1A1NB 3VFTB 2BCKA 2VLME 3BP6A 3L3IB 1M7DA 2J88H 4QTHA 1O5DT 1S7UB 2ZKHH 4NCC2 5F7DA 4YXKL 4OFPA 5AD0B 2GTWA 3HE6B 1KIRA 1OSZB 1U8HA 1ZT1A 3GNML 5E9DE 2PYEE 3ZO0A 3E8UH 5CJ5A 4G42A 3FHAA 3W39A 3OL2A 1SYSB 3O3EA 4OKDA 5DJ2B 2OMBA 4X99A 4H0IA 2PO6B 2X10A 4H26A 2FL5B 2J7LA 4IOIB 4I48B 1BD2A 3QCTH 5DWUL 2HVJA 3BZ4A 3NBNA 1HEZB 2WBJB 3ILQC 2LFGA 4BH8B 3N0PB 4GO6B 1CD1A 2YC1B 3GSRA 4FTVB 3HE7C 5DJ0A 4CMHC 3MLZH 3BJLA 3TO2A 4ZFFB 4GQ9L 2AEWA 3K80A 3DETC 2VRAA 3IDXH 3BIBX 3FN0L 1B2WH 2VDOL 3BPNB 3QZWG 1DLFL 25C8H 3O6MH 3SQBA 5CEYB 1JGEA 1UGNA 1AR1D 1E28B 3MJ9A 4NN7C 4OF6A 3VFSA 1J8HB 4PD4J 1JWUA 1W8NA 1G6VK 3WMSA 2VQ1B 1NDGA 4BQCA 4I13B 5TE6H 1UEMA 2YWZA 5HHQB 1T7XA 1CE1H 3BN3B 3C87A 5EC1B 1G7IA 4NQDE 1B6DA 1CT8B 3NCMA 4XZUA 1XIWA 5LKNA 2ZSVA 4MA3B 2IADB 3W2DL 4WWID 3TIEB 1GGCH 1ED3A 3BP6B 2LVEA 3HC3L 5BCAA 2AABL 4HUVA 4NT6A 3T4AB 4QTHB 1NCDH 4RMRA 2FCBA 5F7DB 4M8QA 4CNIA 1FO0L 3MA9H 4IRSC 2GTWB 1Z2KA 3TN0C 3WIHH 1NL0H 1ZT1B 5FOBB 2IALB 1I1FB 3GBNH 3LS4H 2P24B 1NGWB 3BD3A 3O2WH 2P5WD 3VMPA 3O3EB 4JCMA 5J12C 2I24N 4X99B 1IM9B 1IM3A 3EW3B 4H26B 1K2DB 4M5YL 1BD2B 3OTTA 5KOMC 5ID1A 2HVJB 3DX9B 3UJIL 5CSZA 3FJTA 1CD1B 4G9FE 4XCCL 1CDGA 1E4XL 5DJ0B 1PG7L 3MLXH 4RWHA 3U9PH 2NY6D 3WJLA 5E2TL 3ULVL 2XTLA 4Y4HD 4PGEA 3WDIA 1N64H 1QFOA 4XNMA 1KF9B 3FRPG 5FM4A 3FTGB 1YQVL 3F7YA 1MAML 1KIQB 2Q6WA 1JGEB 4MNQB 1MHPH 3HLAA 3WJJA 5GHWL 4U33A 4F80A 2O61A 2I27N 4P99A 2BDNH 5HGAA 1JWUB 3OKKA 3C5ZB 3SGKC 4K3DH 1NDGB 4NUJB 3UTSB 2ATPA 4JQVA 4E41D 4NHCH 4Q2ZA 5B8CC 4OF0A 3UO1L 1XIWB 4XNYH 1GRWA 5C0BE 1JZ3A 2ZSVB 4PGBA 1CQKA 7CGTA 1DQDH 1U92B 2IAMD 2IMMA 4TNVF 3HMWH 1CL7I 5I15H 3QIBB 1CLOH 4FQLL 3K4AA 5F1KC 2YR3A 4Y5VA 3MV11 5CGTA 1T1XB 2R0ZL 1N59A 1UC6A 1IGFH 4TSAH 3NFNB 1NAMA 1WAAF 4GAJL 5CSGA 5TPWH 2N1KA 1JF5A 5T5NG 3O9WC 5D71H 4FQJH 4QCIB 4X9GA 3QAZC 1Y18B 4JDTL 2UY6A 5CFHA 2AQ1A 5DJXA 4Z7VF 1Q9OA 3PWPB 5I8EA 3U79A 1A6TA 2X4PA 4DKFH 3IXTA 5D1ZA 3VD5A 4OZIA 1ZLWK 4JZNB 3TWCL 4P9MH 3FT2B 2FJFA 4WUKH 1F3RB 4XNMB 3I50H 4MAYC 1DVFC 4NKIL 1B9ZA 4PJGA 2UZXB 4WU7A 2UYLB 2Q6WB 1RJLA 5KVDL 5F21B 3SE8L 3GKZA 1KLFA 3OKKB 4Z7UE 1NCCL 3DSNA 2DWEA 3V0VA 2C3VA 4IOFC 4OGAC 1Q0XL 3GRWL 4CVWA 5DK0A 1H0DB 3GO1H 5HYJE 3U0PB 3PHOA 1NFDA 3QI9A 2ICWB 4OF8A 4PGBB 1EGJA 1ZANL 1YNTA 1HIMH 2BOBA 1A7NL 5ESAB 5GGTA 2IF7A 5ID0A 4LIQL 4MMXC 3C60D 2X9XA 1IEBA 5IVNA 4HJGA 3TA3B 4OCXH 1RVFL 2YBRA 1T2QH 4C56E 1GYAA 5H94A 1N59B 2APBA 3GM0A 2JJUA 3HNSH 4H5SA 4OD1H 2DYPB 5C07A 1T4KA 3P9WB 4HDIA 3EJJX 4UQ3A 2FX8H 4IHOB 4U3HA 1G0DA 3N85L 1GZPA 3CLEH 4K9EC 2DMBA 3F8UB 1KEGH 1UH4A 2J5LB 1HXYA 5TQ2L 5I8EB 3ARFB 3SGEI 3L3KA 3NA9H 3QEQA 2F53B 3IXTB 1AGBB 2PF6A 1J5OH 3FB8A 2X4RA 4HGKC 2FJFB 3GMLA 3U9UA 3UPRB 5F96L 1EVTC 2DQUL 5ILTH 4FFVD 2QTEA 5ISZB 1MRFL 1YYMH 3MGAA 5CHNB 1IGCL 3V5KA 4FXKA 3TNNB 4WU7B 3E3QC 4K55A 3VFMB 1BGXL 1M71B 2I26N 5AG9A 1G7HA 5CSBA 1RJLB 5IB3B 3T3MF 1XGRA 2R4RL 5EN2A 5JHDE 5I8OH 4G43B 2DWEB 4I9WD 1FORL 2BVTA 1A2YA 1IAKA 3VCLA 5DK0B 2Q20A 3KPPA 5E8DH 1EH9A 4LHUD 4APQC 2OX5A 3C6LB 1K6QL 3REVA 4WUUA 3TT1H 4U1SA 1YNTB 2XWTB 3FB6A 5IGXH 2DQJL 2A6KA 2GJZA 4NUGH 3BH8B 4WFFD 1TCRA 2YBRB 3QQNA 4M03A 2WP3O 5H94B 4L5FL 1F11A 4X6EA 1E4KC 1T4KB 1PY4A 5A2IH 1JGDA 4NP4L 3VA2C 1RI8A 4PRDB 4OZGE 4UQ3B 4OZFA 4FQXA 5B21A 4KUZL 1G7JA 4L3EA 5DZNA 3KG5A 4PJ8A 4HV8A 5LGHH 1ZTXL 3QEQB 4G6JL 2VXVH 5IKCB 2DTML 4Y19D 4NN6B 5EZOL 3GMLB 2V9RA 3U9UB 1LEGB 5IMKA 2MQ0A 4K07A 2Q3AA 1TXKA 1MCHA 4UT9H 4AEHL 4MJ6A 5J9PA 2X2YA 4HIIA 1NMBL 4K8RH 5SX4H 2Z91A 1I3GH 3ZHDA 1J0ZA 1G7HB 1MCQA 5IFJA 3NIDF 5JOPE 3IDYC 3PDOB 1A2YB 3VCLB 3OJDA 2GT9A 2VSDA 4PJDF 4PP2A 1Z5LA 1OD9A 3ZT7A 3RZCC 1QSVA 4WUUB 3ZTJH 2W60A 3FB6B 1TJIL 2A6KB 5CWSB 4M3JA 1HSAA 1VACA 1X5KA 1JF1A 1UXSB 1CFSB 3OBAA 1IFHH 4KI1A 4CMMA 1CD8A 4X6EB 3U0TA 4NPYA 3O3AB 5I66A 2JIXA 1QBBA 4OZFB 3SY0A 2YPKB 1KNOB 2VDPH 4GMTH 3DUSA 2L0DA 4LBEA 4P5KA 1B88A 1CICD 4L3EB 5TE4L 4I0CC 5EIIA 1A3QA 1ZEAL 3MRCB 4IDJL 1MFCH 1A5FH 4HV8B 1YECL 3O8XB 3KPSA 3SPVA 2AV7A 4PJFF 4Z95L 5KBNC 3QIUC 3U36A 1W0WA 4LPXA 5IMKB 1A6WL 1ROWA 4OJFL 5IEHB 5J9PB 4HIIB 4EUPB 1AI1H 4DKAA 4EN3A 2OBGA 5MEPB 4C59B 4TUOA 2EE9A 4X4ZA 5IFJB 2VKXA 3B3IA 3VXSE 4F7PA 4UT7L 5KZCB 3P11L 2HRPL 2J8UE 4JFFD 4L4VE 4JN1L 4NQUA 3WS6A 2C4FU 3OJDB 2GT9B 4NKOA 1D5MA 4L4TA 4LLWA 4X8JA 4OB5L 2K3TA 1DBML 1I7TB 1Z5LB 3RQ3A 1KJMA 3CIQA 1ZLUK 3CFCL 3K2UL 3MRLA 4JPKH 3ZLQC 1AJ7L 4P4KD 1NC2B 4N9GB 4IJ3B 5I8KL 1HSAB 2C1PA 4AT6B 1JF1B 1KJ2L 3HR6A 4XNQA 2JJTC 5SWZB 3VWJB 5AAWA 5JQ6H 4PRAA 3U30B 5A1AA 4NPYB 5EBMB 5ABDE 5HY9B 4UILL 1FNFA 5J06A 3I85A 1UKSA 1JTTA 2ZUTA 3ZKXC 1HINH 4XPFL 4Z78A 1OGTA 3DUSB 2V17L 5I1CL 4P5KB 4NDMB 4WDIA 4JFZH 4F57L 1Z3GL 5EIIB 4BZ1L 5IJKC 2Y36H 3H7BB 5F1SA 1R5WB 1NGPL 3KPSB 4HC1L 3SPVB 1I85C 2BNRB 1NKRA 5CGYD 3ILPA 4OTXL 2E7MA 2I60H 2OR8A 4J6RL 5GISH 1FE8L 1OP3H 4D0DA 4POYA 4ZNEE 5CEXA 3PWVA 4JPVL 3GKWH 1MI5E 2D0FA 3E0GA 3TO4B 2VDQL 3X3FH 3HB3C 1FGVL 4M00A 4X6CF 5F6HI 4WEUD 5EZIH 3SDXA 3MV8D 3MX0A 3E2HC 3ULVC 3U7YH 2VH5H 2W9EL 2F54D 2OZ4H 1ZKAA 4RMTA 1KYOJ 4XB7A 4F37K 3UDWC 1D5MB 4B7LA 4LLWB 1BJ1H 4X8JB 4Y5YC 1OAXH 2EXYD 4R3SB 3S36L 3ZTJG 1YDPB 2HN7B 3BOVA 2AK1L 1BPVA 5CZKA 1HILA 1RIHL 4MCZB 3U4EA 4XWOD 3BPOB 1T66C 3D1MC 4V1DA 1KPVB 4XNQB 4ZFOL 4PJAF 2X40A 2P8MA 1A21A 4XCYA 4PY8J 1MAKA 2H32A 3UZQA 4PTUA 2IC2A 1CGUA 4Z78B 1X5IA 5J56B 2OLDA 3BPLB 4WHTA 3OX8A 1X9QA 4LSPL 1ACZA 4W4NA 1FLRL 2A6DA 3IVKB 4BH7A 4CU8A 1OAKH 1R3IH 4G6KH 4LSUL 4WO4C 1EHLH 4PRNA 1KGCD 5CEXB 2YXFA 3REWA 2IH3A 3IDGB 5ACLA 5JIIA 3KXFA 4OD2A 5EBLA 4N8CH 4M9OA 2IANE 1NLBL 3QWOB 5FHBH 1WV7T 3BXNB 3A67H 4JZOA 4HK3J 1CDYA 5E2VH 3RU8L 1X6LA 4K3EH 3Q1SH 5TDPA 1RY7B 3IRPX 4XP5L 3ULUD 1QLRA 2ZNXA 4FMFA 1CGSL 3QDME 1FG2B 3PQYA 2HKHL 3JWDH 4WW1A 5HI4C 4O02H 5C0FA 3QG6A 4HF5L 4LPYA 3UJJH 1C7TA 4NWTH 1CDCA 5DO2D 1YN6B 4YR6A 1IC1A 3MLWL 4LCWB 1NLDL 4FQIL 2P8MB 5GPRA 1NBYA 1C5BL 3EFDL 1P9MC 3FAWA 1FPTH 4XCYB 3S3JA 3O11A 2IMNA 4HAFA 2H32B 1I9RH 4PTUB 2CLRA 5F9JA 3VXRA 2HJLA 3KS0J 3W9EB 1F4AA 3IFPA 4MJID 5D7IA 3TH4T 2CR6A 3T0EC 3OX8B 4EI5A 1MHHA 5BW7C 4NIKB 4MQTB 5I1KL 4LLQB 5GZNC 2A6DB 3GSNA 3BQUC 2DICA 1JV5A 4FQCL 3LPGA 4ONGH 4JE4B 3VFRA 2DLIA 2Q7YA 4CVZB 2XRAL 1GVIA 4ZO6A 2IH3B 3OKNA 4HGMA 1A6PA 3SCMD 1YNLH 4KVCH 3KXFB 5IFAL 3ARQA 1NCAL 2NLJA 5EBLB 1EAPA 3QUMH 2RCSH 1JZ8A 3ZKND 4JZOB 3SGDI 3T09A 3H2WA 2YA2A 3T65B 5A3IC 2HLFC 1BF2A 4QWWC 3GSUA 3KPNA 3NGBC 5IIEB 4JREB 5TDPB 2ILLA 1OL0A 1ZT4B 3QCTL 2A6IA 3OGOE 5D7LE 5E6ZA 3PQYB 5HI5C 2W91A 1SJEB 1R5IA 4LARH 4F15B 5D2LE 3RL1B 4YHNB 5AYQA 5C0FB 3QG6B 1C5CH 4KRLB 1NANI 3OAZH 3MLZL 2NXYB 3AMLA 1ZAGA 4YR6B 5L2KD 4XNUH 4PV9A 3SKJL 3DOSA 3FN9A 5IVXE 2XXCB 4Y19E 5ITFA 3MXWH 4Y1AA 3WHXB 1I8MA 3FB7A 2AKRB 4E0RA 2XZCH 1PQZB 15C8H 25C8L 3FOLA 1J1OL 3O6ML 3CVHB 2VC2H 3EOAB 5F9JB 2XIDA 3HG1B 4P4RA 1AY1H 2IBGA 1NMCB 3WFZA 2NY7H 5AYUL 4XXCA 3IFPB 5D7IB 4ZS6D 3BGAA 2NNAB 2EE6A 2QADC 4HJJH 4ISVA 1U3HA 3DIFA 4KK5C 3M1BB 4GLRI 1CE1L 5DGRA 2NY0D 3UYPA 4YZFE 5GGVY 4KRPC 4E9LA 2MJWA 1R3KA 3SDAD 4UBDD 3L5IA 3D25A 1JV5B 1CWVA 1GHFH 2Q7YB 3QUXC 5FF6B 5MENE 2Y5TA 1NCDL 2X4QB 1ADQH 3WIHL 1EAPB 1NL0L 1IEAA 1VFAB 4AM0A 3T2OA 3GBNL 3LS4L 4HS3A 1QSZA 4XXDA 5EZJA 3MJ7A 1UWGH 4N0UE 1TJGL 2FYYA 4LVOC 3GSUB 3KPNB 3GMNA 4X9IA 3PWJA 2DD8H 4X7CC 3WNMA 4YAQA 1OARH 1U3ZA 3DVGA 5D1ZD 5DD0L 5FYLD 1R5IB 4Z76A 1WC7B 1T03H 1OM3H 5T3ZH 2VLRB 2M1KA 2HFEB 5I9QB 2VJXA 1ZVYA 3MLXL 3U9PL 3MRMB 5E7BA 3QPXH 4PJEE 4PV9B 4WNQA 4Q0XL 3H3KA 1WBXB 3ET9F 3SO5A 5H35A 1RUAH 1N64L 4Y1AB 1I8MB 2YKLL 3KPRE 4E0RB 2VO5A 4R4BB 1QBML 2Z31C 2BOCB 2EIBA 4P9HL 1MHPL 1QFPA 4M1CC 4R8WH 3O4OB 2BDNL 3UC0H 4M7LL 3D0LB 5SX5H 4KKBD 1K4DB 4QRQA 4BQBA 4K3DL 4Z5RA 1U3HB 3RPIB 2BVQB 4X5LA 4Y4KD 3T0AA 2V6HA 3U4BL 4M93C 3HUJE 4HUWB 4JFFE 4XT1C 3EOTH 3RVWC 1U58A 2GSGA 5CBAA 5GRYA 1I4FA 2D9QB 4YJZL 2E6PA 3D25B 5C0EB 1T1WA 3UBXA 4HCRH 3HMWL 4PIRF 5I15L 4WW2A 2OL3H 2H3NA 5FEBA 2B7DT 5C07D 3RKDC 4AM0B 3RWFA 4KKLC 5EZJB 3CSYA 1IGFL 4TSAL 2FYYB 5IB1B 3T2NL 3OJVC 5TPWL 2DBLH 3GMNB 5BOPA 1XFPA 5CJ8A 3QBTB 1HXMA 4F7CB 4MDIA 4FQJL 4JKPH 5F1IB 1U8JB 4GBXB 3S88L 4Z76B 3GDBA 3GJFH 2QQNH 4WGVB 3AS3A 4DKFL 3TVMB 2VE6A 5IMOA 2YN5A 5DEFA 3QJFA 2NW2B 2ZUUA 4I0PD 4UZGA 5I1IL 4WUKL 1S9YA 2IPKA 5H35B 5EU6B 2MNUA 3I50L 4LSSH 2QSQA 1X5JA 2B4CL 1XF4B 5J13C 3HE7A 4XGZA 1KBGH 5F7WC 5E6YA 4PRHB 3WV0A 4QRQB 5J6HA 4LSRH 4F37F 3B5HA 3NAAH 4JFYA 3RDTA 1IEHA 3GO1L 1ND0A 4RWYH 2NYYC 4DKEL 1T1WB 1PFCA 3VWKA 1HDMA 4BQ9A 4RBPK 1N8ZA 1QRKA 4XI5D 1PZUB 1X3DA 3CDCA 5F7YC 2LU7A 1N3NA 4OCXL 1J11A 4MA8H 4K94H 3HNSL 1MCOH 4GW4A 4NZDA 5J0BA 1PEWA 1ZHLB 4YUEH 2CRMA 4PJ8D 1YUHB 5J1SC 3OGCB 5A2KH 1HXMB 3FQNA 2G9HA 4IRSA 2QQKL 1RZJH 4N1EA 1MH5A 4U2YA 3TN0A 4Z18A 4J3UA 1JYVA 2ADFH 3CLEL 3HAEH 1N0XL 1KEGL 1J18A 2EDJA 3NA9L 1KEMH 2VE6B 1R24B 2WLZA 5M94B 2YEZA 1J5OL 5JPMB 4FG6D 3QH3A 4DTGH 3T77A 1NEUA 1R5VA 1S9YB 3RVVC 2IPKB 3CZFB 1YYML 4GXVH 3BYTA 1PG7X 4GRLA 1KGCE 3C9NA 1FG9C 5DEGA 4UDTA 4XGZB 1AXSA 1BQLL 2XTJE 3V9FA 5DA0B 5SWSD 1BZ9B 5BVJA 4P2QB 1BD2E 1S7RA 3RDTB 4JY5H 3PNWB 2PYFB 2AK4B 4RMVA 5IW6A 5E8DL 4YO0A 4HIEA 4YHZH 3VGEA 4D94A 3ULUE 1LMKA 4KJWD 3TT1L 4L4JA 3FONA 1BLNA 1A9BA 1AXIB 2EKSB 3VWKB 1N8ZB 1GZQB 4HUXB 3SGKA 3V8OA 1MQKH 3WFHA 4KV5E 5FDWB 2H26A 4XP9H 4LCUA 2W92A 5C0ND 4OKVA 1EJ6A 4JPWH 3QXVA 2R2EA 2OYPA 5J1TC 4Z7VA 5JNYA 4DK3A 3QJHA 3H9SD 2A1WH 4LLYB 3UTTB 4K71B 1DQJA 1CFBA 1MH5B 1QVOA 1AKJD 1NJ9A 2ZJSH 5DQDH 3D3VA 2VZOA 4EKXA 5DMGC 4EN3D 5IESH 1A22B 3T77B 2WIIB 3M17A 1TPXB 4GRLB 3N9GL 4EI6B 3FT4A 4K8RL 5CJQH 5DEGB 2OR9L 3L3OB 3MRFA 4UDTB 5GRZA 3FFCA 4JFED 4B5EA 3CJJA 1SEQL 1IE5A 4D8PA 2FIRT 4HUMB 3FZUC 2XQYG 1DVFA 4YO0B 1VKXA 3QXDA 5HYQA 4LPCA 5KSBF 4X7SH 1Z9LA 3FONB 4CVXB 4HUUB 3OR7B 4K7PY 4ZOAA 5F70A 3C2AH 5J1AA 2C1OB 1FSKB 3WFHB 1CDUA 3PP4H 3MRKB 3P3YA 1GPOH 1JWMA 1QSFA 3QCVL 3DURB 4RGMB 5I1DA 2NY1D 5DVOA 4JANA 5F7LB 1IFHL 3RNKB 4MQXC 3CCHA 1MCCA 3P9MA 2R23B 4Z7VB 4LOUD 5JNYB 3W5NA 4QHNA 4XB8A 4DQOH 5I19H 2VDPL 4GMTL 2BZDA 2P42B 3EO9H 3DO7A 3BMVA 3LRHA 3ROLA 5A16A 3VW3L 1I1AC 4G8FA 1QVOB 2KBGA 1NJ9B 1A5FL 3D3VB 4G80A 4Q74A 5FGSA 1KB5L 3O2DA 4QXGL 5HHOD 2H45A 2RB8A 5DD6A 3LIZH 2A9NH 1LK3H 2AERT 1NGYA 3FT4B 4LRNH 4JZJC 1A9EA 1AI1L 1SY6A 1WCBA 3L3HA 3P30L 2DL2A 3A0OA 5AAMA 3CGTA 3MRFB 2HA1A 5CKGA 1ZA6A 5I75B 2VXQH 4GT7A 4WFED 4YHPA 1MSPA 4KMTH 3DRQB 3PWUA 1ZXQA 3PABA 2Q1EA 3FOMA 5DJYA 2MQCA 4D8PB 3O6FB 3BWAA 2JK5B 3TF7C 1VKXB 1MNUL 4ZUWA 5HYQB 1DDHA 1EA9C 4KTDH 1NSNL 2WINA 2BXYA 4V1DD 2E5EA 5ERWB 1OHQA 3HI6H 4OZIE 4JPKL 1J0IA 5FYLE 1XGPB 5CINH 1AO7A 5ANMB 1KT2B 4G7YH 1D5XA 2FO4A 2Q3ZA 4P2RB 1H5BB 1YN7A 4PJGE 5JQ6L 3CCHB 4APQA 1UWEL 2ADJB 4NC1E 3G04A 5D4QA 4AYFA 3SOBH 3GEWB 2C7UA 5ADPH 1NPUA 2YD8A 1QA9A 5D1QB 3DO7B 2DQIH 4JFZL 4RMUA 4NYLA 5C09D 2ENSA 2WWKO 1NFDE 1P69B 4ZO8A 3WS3B 2Y36L 4Z7NE 1JGUH 1T21A 3O41A 3PIQA 3EO1B 4PFEA 5E70A 1FZMA 1J0KA 3KJ6L 1GGBH 2A77L 4OCMC 1GGYA 3D18B 4PJ5B 3WXVH 5IT2H 3GKWL 5SWQA 3RY4A 3RWIA 4KI5D 4NCC1 2D3VA 2WBWB 4PJDA 1A9EB 5EZIL 5C9JA 4ZUTB 1YMMB 5C07E 4MB5A 4Y2OA 3UROR 1FH5H 4RA0C 2VH5L 1TVHA 5D96B 3I6LD 4N5UA 2OZ4L 5MI0C 1FVDA 3B83A 5DJYB 2CJUH 3CAFA 4P9HC 2DI8A 4Z7UF 3WD5H 1WWWX 2WINB 3CZJA 2DM4A 3QEQE 5EBWA 2N7BA 1MCIA 2FWOB 4G6MH 1AO7B 2DN7A 4I5BB 3I9GH 1NUDA 3GBMH 1D5XB 1FCCA 1DBKL 2FO4B 1SHMA 1KJVB 4HX1B 4KROC 5IBUG 3E1F1 4RBPH 3VXRD 2Z8VC 4APQB 1F4XH 3RZCA 3MUY1 3WDHA 4EI5D 1BZ7B 5I1LA 1MCJA 3VG0H 4PJFA 2JKXA 5KVGH 3O4LD 4NRZB 3IB4A 4NYLB 1AC6A 5B4MD 2VDKL 4JJHA 1S9XB 1T21B 3ALXA 3EGSB 4WUUE 1EDQA 4P23C 1FZMB 4HMCA 5IEKB 1CTNA 1OAKL 4G6KL 1EHLL 4QRUB 2DKUA 1L7TH 1EERB 2X89A 4ONHA 4ZAKB 3RL2B 4N8CL 4PJDB 5FHBL 2C3WA 1J88A 3K3QA 4ZXBD 2EO1A 5HPMB 3TCXA 5E2VL 1F6LL 4MHHG 1TVHB 2DLGA 3I84A 1J0HA 4K3EL 3QIUA 4FP8H 1S7SA 3ALWA 2BP3A 5A2LH 1FVDB 1JPFA 1PSKH 4HD9A 1MCPH 4LVNC 3RVTD 2B4CC 4L3EE 2JJVA 1AQKH 1IGYA 1K4CA 3CK0L 4AIZA 3RHWF 5E08L 5EBWB 3OXRA 3UJJL 3SDCA 4NWTL 4QEGA 1IJ9A 4HJ0C 5KVEL 1AD9A 4DUWA 1AH1A 5A43C 4P57A 1FDLH 3WO4C 1SBSH 2KZWA 4EOWL 3OF6A 1KIPA 5DI8B 5E94B 1RULH 6FABL 2DQFA 5JDJA 3C09B 4HS6A 3RP1A 1FPTL 4ZNCD 2R2BB 1I9RL 5I1LB 3ARTA 1N5AB 5EOQL 4PJFB 3TGXA 3LV3A 5GJTH 1HHGA 5HVHB 5D7KD 2ITCA 5BS0A 2BJML 3WN5B 2JJTA 1T04A 1EV2E 4ODUB 4X6CA 4ZTPH 1Y6NR 2FO1A 4LQ1A 4NOBA 3VD3A 4ONGL 1G9ML 3D2UB 3PHQB 1CXEA 5CJBA 1INQA 5JR1H 4DZ8A 4ONHB 2VDMH 2D31A 4XMPH 2VLJA 1YNLL 4KVCL 3MREB 3QDAA 5FUCE 2P1YA 3QUML 2RCSL 1T5WA 5IJKA 3QDJA 2J12B 2J6EH 3IETA 5EG6C 5EOCH 4LPTA 5DVMA 3RWEB 2AP2A 4JO4H 3DUUB 3HFMH 4ZPVA 5IWLC 1JPFB 1EBPA 3O2VL 2IWGA 2I9TA 1KB9K 4N68A 3U82B 3V6ZB 5GSRB 1IGYB 4PJAA 4NQSA 4LARL 3CLFH 4AIZB 3UTZA 2GW5A 3KPSE 4UQ2B 3WFDH 3C8HA 3B2UD 1BOGA 3SDCB 1FRGH 1SEBB 4MS8D 4FN0A 3S36X 1F4HA 5FECA 1OWWA 1RMFH 3L3GA 3B9AA 2DLEA 4XNUL 3C5SB 4P57B 3M8OH 3UBXI 3UDWA 1CLYH 4ZUSB 4ODTH 4Y5YA 5LVEA 3MRNB 3MXWL 4RIRA 3QDGB 1JK8A 3ARVA 1JPSH 5DMKA 2XZCL 1CVSC 4L8SB 4AEEA 4JFHD 2VC2L 5F88B 1AY1L 5BO1H 3LV3B 1EFXB 2NY7L 4Y2DD 2ITCB 4HJJL 5BS0B 4L4TE 3D39D 1KCVL 5GRVK 1B4JH 2I07A 2X4UB 1T04B 5HDLA 5HVGB 1IGJB 1RZFH 4X6CB 1YNKL 1AP2B 3AS1A 4POZD 4M43H 3L6FA 4Z7WA 3DLQR 4P46D 4ZD3H 5FCUH 3GFUA 2XKNA 1EHNA 1HI6A 2AXFA 3FFDB 1MFBH 2VLJB 4JM4L 4I2XA 4CBPA 43C9A 4PB9H 4M02A 3IFLH 3OKDB 2PNDA 1T5WB 3X14A 4DKDC 3IETB 4LU5H 5GGSY 3GK8H 4S2SB 4WO4A 5HHMD 3IU4H 3BYYA 5IOPA 1H8OA 2DD8L 1L0YA 3B5TA 1FN4A 4HIJA 1OARL 2CH8A 1JPTH 1KACB 4Y4HC 5C08B 4OUUB 4PJAB 4NQSB 4XWGH 1JRHH 1OGAA 2J8UF 3UTZB 1NEZA 1T03L 2R2HA 4G8GD 5T3ZL 1NH6A 1OM3L 3KLSA 4K3JH 1GCFA 1BOGB 4HZLA 1DFBL 2OP4H 2R1XA 4OT1L 2OJZL 3L3GB 5KSAC 3QPXL 3QFJB 1Z9MA 5L6YH 4Y5YB 3HE7D 3MRBA 2D7QA 2ZG1A 4V2BA 5ICYA 1RUAL 3MUGB 3RY5A 4ELKB 5I71C 4RAHA 4RIRB 4HGWA 3SDXE 4X4XA 4BJLA 1JVKA 3GBLA 4X4MA 5E1AB 3OAUH 5FHAH 2C26A 1AXTL 4RRPG 4R8WL 1HZHH 3UC0L 4MXVE 1KULA 3UTPD 1YYLH 4NFBA 3V4VH 1BQSA 2I9LA 4MLSA 2I07B 2HT3C 4NRYA 3EOTL 1FFPB 5FAAA 1DE4A 2FDBP 1P9MA 1QLFA 3C8DA 4NSKA 3JVGC 1IC4H 4U6XA 1ZGLA 1HI6B 4HCRL 3TP4A 4JM2F 1JUFA 4V1DE 1BX2B 3G9AB 3ECBA 43C9B 4JRYA 4YQXH 5E5UB 4KDWA 4QHKJ 4YHIB 3I02A 5BW7A 1CL7H 1HH6B 4UIKH 5DRZB 1X44A 3BQUA 4IRSD 3LN5A 4JG1H 5CD5D 3TN0D 3FRUB 5H8DA 2DBLL 2VR4A 4QY8A 4KMQA 2F19L 2HFFA 1BIIA 3DRTA 2VWEC 4YDLB 4H0HB 1URLA 4U1LB 5BJTB 4JKPL 1FHGA 4G7VH 3EJYC 3KDMA 3OKEB 2Z35B 3MODH 4Y16A 4HZLB 1DBJH 4BK5A 6CGTA 4U0QB 2XG4A 4RMSA 3QIWC 4OLVH 5EA0H 5I1HH 4EVNA 1FBIL 3P4OA 1ZVSA 4X7FC 1H3WM 2BVYA 4ZG1A 5ICYB 5D72H 2P48B 1GGTA 4LSSL 4HGWB 5ACMA 1F90H 4X4XB 3DROB 4V2CB 1SQ2N 1DLHB 1L9MA 1Q94A 5F97E 4KI5E 4I8DA 4UUJB 4X4YB 5IV2A 1PKQA 2I9LB 2AVGA 3BE1H 4LSRL 5D5MF 4FFWC 1T0NA 3T8XA 3JSSA 3B8SA 3PQYE 1DBBH 1DE4B 1I1YB 3G5VB 1MFDH 4RWYL 1QLFB 2HKFL 4RGND 3VGGA 2PCPA 4U6XB 5FM5O 4KJPC 1ZGLB 4HBQA 5CP7A 1FLTX 1JUFB 2IG2H 2WANA 4MA1C 4Z77A 2VXUH 4GMSL 4JRYB 1C08A 1QRND 2DKSA 4OFYD 4OM0H 2EYRA 3I02B 4UOJA 3S37L 4MA8L 5HD8C 4K94L 4F7EA 1WLHA 1MCOL 4JKKA 4AJ0A 1PVHA 3BQUB 4LL9A 2X4TB 4FNLH 5LBSH 3VXRE 4GSDL 4PRPD 1OSPL 5D7IE 4RMQA 4DWHA 3RWHA 3MNVB 3DRTB 2Q8BL 1CGYA 1RZJL 4GH7B 5IB4A 1XGUA 5C0CA 2GJ6B 3DX6A 5IP4A 2YSSB 5IVOA 5HXMA 2ADFL 3EOBA 3O9WD 1G6RH 4Y16B 4PJIA 3FT3B 1FJ1A 3CPLB 4WI5A 1KEML 4RNRA 1ZA3A 2WBJD 4EVNB 4DTGL 3MCKB 2CMRH 5EUKA 2CR3A 4GXVL 3H9HA 1MIEL 3K7UA 1DP0A 4PUBH 4LPWA 1N6QH 1RJCA 3STZA 2W65A 4WEMB 4MAYD 1DVFD 4X7TA 4RZCA 1PKQB 5TDOA 2CKBH 5BV7L 3LEXA 2WUBH 1ZE3C 4U1MA 5T1MB 3CNKA 4UI2A 1J8HD 5HGHB 2X1PA 4Y88A 1BEYH 4YHZL 4JKWA 1I8KB 4IOFD 2Z31A 4OGAD 4YHKH 3P0VH 2FECL 2OJEA 5FKAA 5DTFB 4LLUB 5CP7B 4O5LH 4H8WH 1HHKB 2R8SH 1MQKL 1JN6A 1M1SA 3A6CH 3WXWL 1C08B 2EYRB 1M7IA 1ZHBA 2E3VA 3RI5K 2YPVL 3E6FB 3RWDB 1M7XA 4JPWL 4NQVA 2NY4B 1A7PH 2R4SH 1VEOA 1M6OA 1TFHA 5K59E 2VR9A 1RZ7H 3S9DB 3QWRD 2A1WL 1JHKL 2BNQA 4ZOCA 3LAFA 1A64A 3DX6B 3BP4A 4UB0H 4ZFZB 1WZLA 4IDLA 1IM9D 1C5DB 2EDRA 3FQTA 4M7LT 2ZJSL 1UJ3B 3MNZA 1CIDA 3F7QA 1FJ1B 5GXBB 2AXGB 3WIIL 5D2NB 1CLZH 3RWGB 4D9RD 1ZLSH 4HIXL 4EIZC 5IESL 2VXTH 2W1NA 5D2LF 2NXZB 1EEZA 1D9KA 4FOMA 2WK2A 1KUMA 3KHOA 2HWZH 1FAKT 4XCFH 1KPRB 1UQSA 3WLWC 2J3SA 1V7MH 4XPBH 2DMKA 3STZB 1KCUH 2W65B 3LDBC 1RZKH 4X7TB 1S78D 3QQ3A 2X44D 4MNQD 4U1MB 5IHZA 2CD0A 1K8IB 3IF1B 4E5XA 3QNYB 1S9WA 5JPNB 4OLUH 2G75A 4RFEA 1CXFA 4X7SL 3UTSD 2H6PA 2FR4A 4PJ9C 1KJ2A 5J3HD 8FABB 3QEUA 1F6AB 3BWUC 4Y4FB 1TTFA 4H0GA 1CFVH 4YZFF 3PP4L 4U1IB 3VJ6B 4N0RA 3O81A 3L95B 3MLPA 4MD4B 1JTOA 1G9MC 5HVWA 4XHQA 2HJKB 3DJ9A 5C8JA 4NQVB 1B0RA 1BECA 5D1XB 2OL3B 1M6OB 2ITDB 2VMFA 4UTBH 1VFBB 1YC8A 4DQOL 5I19L 1LO4L 1A4KA 3BP4B 3RTQB 2UVFA 3LH2L 3MNZB 4AEFA 1S7VA 5EFIB 4HWEL 3K1DA 5EU7C 3Q6FA 3SDDC 5M7QA 3U2SA 4RISL 4L3CB 1D9KB 1TQBB 3PWPD 4OQ1A 3ULSB 2A9NL 3H6JA 4KDVA 3I6KA 1KLGB 4FRWA 1UQSB 4LHUG 4B7IA 4PJXF 2VXQL 2XQBH 2DWDB 4KMTL 4X5XB 4P4KC 5ECJE 4QRPB 5IHZB 3EIFA 5HHME 1UENA 1KCSH 3MV7A 4ODBD 2BNUA 4CDGC 3ARUA 2G75B 2NY2C 4RFEB 3AU1A 3ZDXE 5CIPH 1FVEA 3HI6L 3QEUB 1D5ZB 5CINL 4ZFOA 1KCKA 1CFQA 2CO6B 3NCJH 3OR6B 1RZ8A 1TQCC 4G8GE 5CMAA 1EMTL 1IVLA 1CVRA 4DW2H 3H9ZA 3RZCD 5DS8A 1MCBA 4O58L 4QO1A 2ICEA 4YXLL 1DL7H 4ETQB 1OAUH 3G5XA 1T0PB 2EO9A 3J7HA 3SOBL 5A2FA 4ZDHA 5ADPL 1XGQB 3QUZC 1SMAA 2DYPD 2DQIL 1RUMH 3QHFH 1RQ5A 1VB9A 2RBLA 2X89D 4P48A 4XPAH 2C3GA 5C92A 2Z8RA 1OTUD 3CDYA 4IMLA 4BELD 4XAWL 3Q6FB 5DD3L 2X4SA 4OQTH 4PJCB 3ARFD 1L6ZA 2F53D 3FQXA 1GOGA 4BKLA 3IGAA 2CO7B 5K9KA 3QIUD 1D5IH 3UYOD 5C0AA 1NCNA 3PGFH 4HG4K 5KSBA 3BKCH 1WBYB 3B5GA 3N1FC 4DGYH 1FH5L 2QQQA 1JWSA 2GITA 4XWOC 2M2DA 3BKJH 2KZ1B 4FFZH 2Z8SA 5M95B 3MV7B 1T1ZA 3WD5L 1YA5A 1I9IL 3OXSB 4FZEH 1CU4H 2DS4A 4PS4L 4QXWA 2OCFD 5H2BA 3OF6D 1YEDB 2AJVH 1QFUL 1CFQB 4JKMA 1RZ8B 3C6LD 5JW5A 3I9GL 5FYJU 1ZLVK 5E9DB 3GBML 2PYEB 5IB5B 3STLB 1B4RA 5DS8B 4KZEH 1JHTA 1QPXA 2K7PA 2JJSC 1BBJA 2ICEB 5D8JH 1XAUA 2AV1A 3G5XB 5F1NB 5INCB 2BHYA 2DTSA 3EDFA 2ARJQ 4N8VA 4ZDHB 3CH8A 4NQCA 5FGBA 4YGVA 4QOKD 2V2XB 5GGRB 5HGBA 5MEOB 1E4XI 5IBTH 1L7TL 3QDJD 4J12A 2X4SB 2R0WH 4R2GB 4U6VH 1FZJA 2VZTA 3ZSTA 3VH8G 3DECA 2VNCA 1EZVY 2X42A 1I1AA 4BKLB 3IJYA 3S7GA 4DCQA 3WNOA 3ULUH 2QHRL 2DIBA 1H9VA 1F45A 3CFDB 4R0LC 4Z7VE 2YD2A 5KSBB 5DRNA 1F4WH 4PJ7A 1UZ8A 3IU3B 2GITB 4IBLT 4M6NH 4FP8L 5LAXB 1TZIB 1JL8A 1PSKL 3CC5B 3ULVD 3IFOA 5CD3A 1AQKL 2YZ1A 4JZJA 5F7NC 3D3VE 4QXUH 2CDFA 3MJ9H 4ODSL 1HHHB 5D93C 2GCYB 2OQJA 5MHSE 5IUSA 3DX7B 4QLRA 4OLEA 3G5ZB 3IDNB 4NBXB 5JW5B 3ULUF 1FDLL 2K1MA 1WBZA 4RGOH 4O2CB 3LKQB 2AV1B 1D3CA 4IS6B 3GMQA 3FFCE 3L7EA 4KV5F 1KELH 4UAOB 2Y72A 5JLZB 4HBCL 4BM7A 1XCQA 1A3RH 4G9FB 1JNHB 1NCBL 3SCMC 2ARJB 5IBUB 3STBA 3VXPA 4NQCB 1P84K 3GIZH 3PV6A 4XP1H 3NN8A 3V6FA 4JCLA 4ZTPL 3ZKNC 2XKUA 1EHAA 1RURH 1JZ6A 1V8HA 5JR1L 2VDML 3TJEH 4OCYH 3FO0H 4XMPL 2F9BT 1DQLH 3DV4B 1QSFE 3PL6A 5DSCB 5I74B 1F8TL 4UNTA 4KRMB 4WO4D 3IJYB 3RI5F 1U95B 4DCQB 2J6EL 3PV7A 5GZOC 4Z7UA 3VXNB 5EOCL 4WCYL 1MELA 5FKPA 4ZOBA 1UZ8B 1X4XA 3DSFH 5MP6L 4CN6A 3D48R 2VDRH 4JO4L 3HFML 1RJZA 4L29A 1OGAD 3JWOH 4LRIC 3MUJA 1TJHL 5EO0A 3BUYA 2AGJL 3MJ8B 3SGDH 4O4YL 5C0BB 4HIHA 3IFOB 4GAYA 5KW9H 2PXYD 1G7MA 1ORQB 3CLFL 2CDFB 3T04D 3WFDL 3QUYC 5DJ6A 1A1MA 2XA8L 1KENH 5BV7C 3MYJA 5DVNA 3CSPA 1OAYH 2O93L 5GGUA 4JHAL 1RJYA 1YJDH 1CLYL 3MFFA 2V2WB 4OLYH 3GSQA 1KSRA 5CP3A 3D85B 1NANH 5DA4A 4D9RE 1NC2D 5E8EB 5B38A 1JPSL 2NY0C 2V7NB 4YK4B 2NX5A 1JGLH 3B8YA 3GMQB 3SDAC 1XF5A 5GGQH 2FJHA 3HZKA 1EFQA 3UAJD 5SWZD 1XCQB 2ZSWA 4L3AA 4M61A 5ETUB 3HPJA 4MJ4A 3S98A 5D7JB 3I6GA 3NN8B 4ODHH 1RZFL 3E3QE 5C0DB 3V6FB 1NAMH 4JDZA 4NZTH 2I5YH 4RFOH 3IDMB 3T0ED 4LSDA 1S5IH 4JO2H 1EK3A 4GLRH 4LASL 4ZD3L 1SYVB 5FCUL 3UP1A 1R3JA 3D6GA 3KYNA 4M62L 3CUPA 1YMHA 3MV9A 3INUH 3AREC 3PL6B 4PB9L 4NCDA 3ES6A 4KK8D 3DBXB 4IRJB 4Z7UB 4P23A 4LU5L 4MNGA 1CZ8H 4KC3B 5F93C 5FYLH 5C0JB 1GXEA 3IU4L 1RJZB 4PJHF 5EO0B 5CKAA 3E6HA 2Y7QA 1KXQE 4DN3H 1JPTL 1AGEB 2CLZA 5A3ID 4QWWD 3EFFA 4XWGL 1JRHL 4J3VA 4C55A 1OVZA 3BFOA 4WENB 4D0CA 5DJ6B 1A1MB 2ZUVA 1BIHA 1J1XH 3MYJB 1JZ7A 5HI5D 4C56B 1UEYA 5I73B 5GGUB 4XBEL 4KKBC 4OSUL 2ZCHH 1RJYB 2VDNH 3EHBD 4OZIF 1MEXL 4Y4KC 4PJDE 3RVXC 1MHCA 1EGJH 5IMMA 2NX5B 5GGTH 1YEHH 2FJHB 3HZKB 3LRSA 1Q9WA 4XPHH 1HZHL 1YYLL 2ADIA 4PJGF 4WWKC 3V4VL 5I17A 2ZSWB 1I7ZB 4M61B 5FV1L 1LE9A 2C5DC 3HPJB 2YPLA 3I6GB 4DAGH 3BGMA 4NM4H 3BEWB 1G1YA 4JDZB 1VFMA 3QUKB 1LE5A 3J8F7 5KAQF 1FNSL 1YQ2A 1IC4L 1A14H 1EEQA 1R3JB 3KYNB 5EWIL 1NFDF 1HSBA 1NFIA 4Z7NF 4KRPD 3MV9B 1C12B 2NTFB 4YQXL 3KWWA 4LPUA 1EEUA 3QUXD 3WUZA 5CZVL 5D6CA 3WUWA 5C7XH 2CDEA 5JHDB 3HNTH 3LZFH 4MNGB 4UIKL 1U8LA 1G9NC 5GSVA 4PJFE 1CE6A 5I18H 2IPTL 2VIRA 4HWZB 3WEXA 4OZ4A 5DT1H 2ATKB 1JF6A 3HC0A 4KPHH 2Y7QB 5CILH 1BJMA 3AB0B 4G7VL 1U9KA 4LDOB 1ZSDA 2AEIT 3K4DA 3X17A 4S10A 3LEYH 5E5MB 1DZBA 1DBJL 1IKNC 4OLVL 5EA0L 3SKNA 2HT2C 2YOCA 5DQJB 5KSUA 2V5MA 2H9GB 5LGJA 5D72L 1MREH 1A6AA 1MHCB 1F90L 4L9LA 3L3JB 4LCWD 1CIUA 1WQVT 4UU9B 4YIQA 4HKBB 1FFNA 4G8IA 1Q9WB 4R4FH 3RVUD 5I17B 1FL3A 1LE9B 2Z31D 2H1PH 3WO4B 3PP3K 4S1RH 1WZ1H 5CCKL 5L7XH 1A3LH 4EJ1C 1I3UA 1F3DJ 1MFDL 5E03A 4OF3A 5DJDA 4O2EA 3P73A 1QACA 2FATH 5DRXB 2AJYH 4OZFH 1NFIB 5HHNA 2IG2L 4FQPA 4HHAB 4EQ3A 2VXUL 3LQZB 1P4LB 3KPQA 3D9AH 4MWFB 3WUWB 2PN5A 4EDWL 2BNQD 3BHBB 3CFBB 1U8LB 2J8UA 2BXZA 5IBLC 2VIRB 2P5WA 4JG0H 3WEXB 2B1AH 3FQUB 5BS0E 1FL6A 5KJRH 4K2UH 4AIOA 3RKPA 4NWUL 4GAFB 1ZT7A 2J8OA 1G6RL 1BM3L 3EAKA 4DOHE 4LDLB 2FX7L 4HXBL 5F44A 2FRGP 1T7VA 1T7ZA 4R4NC 4QOKE 3ZDZE 4QHLA 2D7TL 2VLJE 4MXQC 5KSUB 4RFNB 4OFDA 3OKOA 4Y4HA 3QDJE 1A6AB 4L9LB 2NXYD 1VFUA 1PLGH 2B5IB 2EYSA 4Q7DA 3HZVB 4YIQB 5ADOH 3LQAH 1N6QL 1FFNB 2O5XH 4KJWC 2D03H 1FL3B 2CKBL 3T0WA 2WUBL 3HG1D 1FVCA 4PGCA 4PJAE 4E41A 1BEYL 3TZVB 4OV5A 2F74A 3PGCB 4OGXH 2DAVA 3HN3A 4O2EB 4YHKL 3T0BA 3P73B 5I16A 3ULVE 4CN4A 1EO8H 4NNPH 3W9DB 4HLZH 3V5DA 4U1JA 3ZYZA 5GRUL 4DEPB 3SJVA 1NC4D 1LO0L 3MBEB 2NYYD 1RK1A 4PYGA 1BZQK 1HQRB 3MFGB 1RK0A 5DHYB 4J1UB 1JMZA 1CQYA 2J8UB 1A7PL 2R4SL 3JVGA 5IQ9B 2P5WB 3ARGB 3ARDC 3I75B 1IQDA 4JDVB 1XR9A 5CLTA 4ZUUA 3EYOB 1F6FB 4UB0L 4UV7L 4OLWH 4LEXH 5MERA 1KB5A 4Z7WE 1QBAA 1ZT7B 3S5LA 4O00A 5INDA 3RJDA 4XNZC 1H15A 4NJ9L 1VHPA 1ZLSL 2NY6B 4I2XE 2VXTL 2VLRD 5F7MC 3RIFK 2AJXH 5D5MA 3KYOA 1X5LA 1DEEB 4YWGL 4LPVA 2EYSB 1KFAH 4XCFL 2GUOA 1V7ML 3U1SL 3BJ91 4DUVA 1R3HA 2G5RA 1PW3A 1KCUL 4CW1B 1JMXA 1U6AL 2BRRH 4U05A 1RZKL 5C0GB 1DR9A 4LF3A 4JM2B 1QSED 1INDL 1FC2D 4XAKE 5JQHC 2ESVD 1OGAE 2ZCLH 3OKMA 3PWLA 2NY1C 4OV5B 4OLUL 4AL8H 3B6SA 3WFEH 4OZFG 3I3BA 1MI5B 1T83C 4Z0BH 4LLMA 2EH7H 1H3XA 4LOUC 2IAMB 4TUJA 5IK3A 3SKMA 3LVEA 4U1JB 1U2CA 2A9MH 2MTPA 2QQLH 4KUCD 3VGAC 3BP7A 3TBSB 4X4ME 1GAFL 4C54A 1MF2H 3U6RB 5D6DA 2IBBA 1UA6H 1T22A 5F9DC 1I8IA 3RBGA 3S37X 4UTBL 1BQHA 3MYZA 5JW4N 4ZUVB 1S7TB 2XZAH 4ZUUB 3Q3GA 5TGBA 3P77B 2UZIH 3BESR 3T1FA 1LEKB 4TVPE 3BIAX 1S7QA 5E4EB 4LIQE 3S5LB 4N0FA 5INDB 3L5WA 2A73A 2VZ3A 3RWJB 2EDYA 2DDQH 5E2WL 1I8LC 4X6DA 4WI6A 1MRCH 5F72S 5HBBA 4XPGH 5SV3A 3T2QA 5C2BH 2VSCA 4R97C 1U8QA 3T0EE 5C0AD 4JRYE 5C6PB 2Z92B 2E9WA 5D5MB 4MD0A 4RAUA 5JW4M 2NR6C 4PV8A 4JB9L 2GUOB 1HE7A 4WI8A 1HKLH 2Q8AH 3NPSB 3UZVB 5GGVH 1R3HB 5EU6D 1JNNL 5FV2A 4LF3B 2XQBL 3SDXF 1J05B 5IVZA 4YGAB 4WV1C 5CEZL 1E27A 3PGDB 1A6UL 1LO5B 4PRHD 3OKMB 1KCSL 4MXVF 1DN2A 3SGJA 5IQ7H 3BPCA 5DJ8B 5DQ9A 5LWYH 1WTLA 2H32H 5ICXA 4U6HB 1PYWB 2BY0A 4LLMB 1IQWL 1OLLA 3MR9B 2QSCH 1U8PA 4O51B 4YE4H 3NCJL 1HWHB 1Q9KA 2IGFL 4LQFL 3C60B 2JJWA 5KN5B 5F9OH 1DQQA 1XH3A 3CDFA 1AFVH 5CAYB 2FEEL 1WIOA 3BP7B 3BKMH 4I3GA 4S1DC 1F00I 1CXIA 1X4ZA 4MVBD 4HMEA 1BQHB 5L0QC 3BDYH 4LDEB 3WL9A 4L8CB 4GRMB 4JFDD 5TGBB 3DXAA 3LKSB 3T1FB 1RUML 4S11A 1NMAH 3QFDB 4AZ8A 2AJZB 3QHFL 2EDXA 2G5BB 1XCTB 1S7QB 5A2JH 4GFTB 3L5WB 4Z9KB 3MV01 2AEPH 3CDGB 1I1AD 3KLDA 3HA0A 4Y19A 4OQTL 3CXDL 1UM5H 4RAUB 4QRTB 3OB0H 3I2CH 2V5RA 4OCRH 4PV8B 5TF1H 3MRHA 5BVPH 1I3RA 3PGFL 2WUCH 2J2ZA 1RHHB 5DLML 3BKCL 4D0BA 4DGYL 2BC4A 4IRZH 1ONQB 3BKJL 5IFHL 2CGRH 4WU5A 2W0KA 5C0CE 2AJUL 4FFZL 4KI5F 5DEZA 1IKFH 4I3SL 4PB0L 1QFHA 43CAB 4LHUB 5ICXB 4YXHH 4PJIE 4P2QD 3RAJH 2BSRA 2CKBB 4BFGA 4Q6IC 3RX7A 5E1HB 2AK4D 1FIGH 5E8NA 2B2XH 4JFOA 1OCWH 4M1DH 3ZHKA 3X11B 5MEQA 4XC1H 4KZEL 3KYAA 3ARWA 4KHTH 4P5TC 1MPAH 3MSPA 4FHBD 1E6OH 2HTLD 1EUTA 4OAWA 5D8JL 5B4MC 1X5HA 3GSNH 5LG1A 4BA8A 4XVJH 4HXAH 3BP5B 5DURD 3W0WD 4PJ9A 4BK4A 1MVFA 4JHWH 4G9DA 3WL9B 5HYSG 3VDBA 3GHBH 2IBZY 5D2LB 2H2SC 1CICA 5E8PA 4YBQD 1O7VA 3UTTD 4FXLA 3GSXB 1J12A 4UT6L 2RGSA 5IBTL 5HSFA 1FQ9C 4Y19B 2R0WL 4HUNB 4PJXA 3R06A 5ELIA 1OW0C 2VB5A 3O6LL 1GGIL 3RVTC 3ARBB 3MRHB 2WWMC 4NO5B 2GSIA 3VFOA 5T33L 5DJZB 4D0BB 4ODVH 3SDDA 5GJSL 2BNQE 4M6NL 4W81A 4LSTH 4LCIL 1MLBB 3L5HA 2LAGB 3BKYH 1CDHA 4BQ6A 3H3BC 4QXUL 5MENB 4Z7QE 2BSRB 1N26A 4GKNA 5CJOH 3FB5B 3H42H 3G6AA 4JFOB 1F58H 3M45A 3MGTA 1GOHA 4P4KA 2UWEA 3FCTB 4LKXB 4PR5B 1BMGA 4OAWB 4RGOL 3MZGB 2FEDC 4MA7H 1WWAX 1ETZA 4JQIH 4KROD 1KELL 4LAQH 3LSOA 4X7DC 3F7VB 1HHJA 4G9DB 1A3RL 2NY5H 1VGEH 4H20H 1F5WA 1KCRH 1S8DA 4F8TA 1CICB 3GIZL 3P4NB 4XP1L 4AQ1B 4L8BA 3JTTA 2B1HH 4MNHB 4BSVA 2R56H 1LWRA 4PJXB 2YRLA 3TH3T 3FO0L 4YHOL 3QEGH 1DQLL 1WGOA 1A7BA 3BGFC 4NKMB 3KPMB 4LVHB 1MFEL 4PGDB 3MPCA 3SKOB 3QCUH 1C16A 3MV8A 3DSFL 3LMJH 5DK2A 1GJIA 3QT2A 4LAJH 1AHWC 5DF0A 1ZHNA 1EXUB 4JFFB 2ORBL 2F54A 3VH8B 2YK1H 32C2A 3O6KL 4OIBA 4I18A 5KW9L 5C6TH 3N50A 5J6GB 5IROA 3LKPA 1HHIA 3HRZB 2AJ3B 1KENL 4WHCA 1WFOA 2O5YH 3O6FD 2HFGH 1O0VA 1OAYL 3PHSA 4KKAD 1YJDL 4OLYL 1ZMYA 4HKXB 1SMOA 4PTTA 5E2UH 1JGLL 5FIEA 1ETZB 1A7QH 1FZKA 2W9DH 5DXWA 2YPLD 5FYKE 5GGQL 3S4SA 5K9OB 4P46C 1UKQA 3A6BH 2NY3B 4RAVA 4U1KA 3TBTB 1S9KC 1S8DB 4L8DA 5DD1H 3MV7E 2JJSA 3B9KD 4L8BB 3IFNH 1NAML 4NZTL 4RFOL 1VDGA 3SHSA 1FYTD 4M6OH 2XN9A 2C3HA 2AI0H 4PREA 3JUZA 1S5IL 3VE0B 3R4DA 4BZYA 5IB2A 4BSVB 1EEYA 3K1KC 3LKOA 5EO1A 3INUL 2P5ED 1DQMH 4YPJA 1AGDA 5I1AA 1E4WH 1JZ5A 3GMOB 4WW2F 4MB3A 3V4UH 2Y06H 3RWCB 3H9YA 5T1LB 2V7HB 4RCAA 1CZ8L 5T3XL 1C16B 1A1OA 3VD4A 4YDJA 4K7PH 1KTLA 2F54B 3V0WH 4J7RA 4DN3L 3EDDA 1E0OB 4I18B 2ZNWA 1LNUA 4CU6A 1F2QA 1V3LA 2AJSL 1J1XL 2Y25A 4U0RB 1BVLB 4LLDB 2W07A 1IAIM 4EBQH 3VMOA 4HFUH 2WQ8A 5F3HB 3QO0B 1P7KA 4XCNA 2K9UA 2ZCHL 2VDNL 3ZDXF 2P7TB 4H25A 3JUYA 4NQTA 4PG2C 4IOSD 5I6XC 3GJEB 3MO1A 5C0AE 4PTTB 4ELMF 5KSBE 1KTKE 4G6AC 4H88H 4KWUA 4XPHL 5DDHB 4L1HA 4P2OB 2VR5A 1Q0YH 1UVQB 3DVNB 3TNMB 5HTSA 4MX7B 4U1KB 2X05A 1TZGH 3DTXA 4ZPTB 1KB9J 4MJIA 1MHEA 4L8DB 4LCCB 2GY5A 4DAGL 5F6IB 5J8OA 4NM4L 5KS9A 2BCKB 3TESA 1M7DB 3AS0A 5FGRA 2UUDK 1SVCP 3MCG1 1A14L 5CD5C 1KIRB 4P3DA 1U8HB 1EEYB 3WIFA 4NHUA 5EO1B 3HZYA 2XFXA 4KK6C 3NH7H 4G42B 2PTTA 1OAZL 3IYLW 3SCMA 3W39B 5I1AB 2Q7NA 4YHYC 4X98A 2XTJB 2R0KH 4XRCA 2E9BA 3HNTL 1YEFH 4ZAKD 1A1OB 4TN9A 5I18L 4YDJB 3BZ4B 1LDSA 5DT1L 5E6IC 1J10A 4R96A 3WFBH 4KPHL 5EUOE 3GSRB 4M3KB 3SKUD 4NQCE 3G5YA 1UM6H 3TO2B 4M7ZC 4JFDE 2F58H 1ZVHA 1NDMA 3KJ4C 4YEFA 1Y0LA 1KPUA 4LRIA 5L2KA 1P7KB 3QXAA 1JFQH 4X6FA 1SJVA 2LTQC 1JNLH 1MREL 3VFSB 4BSJA 5KSAD 3UBXG 1U8OA 3EDJA 2WV3A 3MGOA 5HDQH 5HDBE 4PJ7E 4Q9RH 4PRIA 4RGNC 2Z9TA 3AM8C 3N1MC 2X7LA 1G7IB 1A0QL 3MOBL 4XZUB 3DTXB 4F9LC 4MJIB 2XG5A 1MHEB 2IPUK 4S1RL 5TJWK 1WZ1L 3KPLA 2F5AH 5L7XL 1HNGA 1A3LL 1ED3B 4WY7L 3WNPA 1U8IA 4LFHD 4HUVB 4NT6B 3SJVD 4YC2C 4CNIB 3R1GH 4M8QB 5L88H 4TSBL 3SDAA 3SDYH 2FATL 2HT3D 3ZT5A 2AJYL 3HE6C 4P3DB 5C2UB 1NGQH 4PJHA 3D2UD 3D9AL 5FO7A 4KJQD 2BX5A 4X98B 4GOSA 2VABA 2IQAA 4QYOA 1IM3B 1T5XA 4QHUA 1UT9A 2YN3A 2DJUA 2JE8A 1HNFA 2BY2A 4JG0L 5ID1B 2R0LH 1QKZH 3DO3A 5CSZB 2WBJC 2B1AL 4R96B 1U91A 1YEIH 4HKJA 1JPST 1P2CA 4J23A 5KJRL 1E6JH 3W0WE 1QQDA 1UWXK 4X0KA 2P46B 1ES0A 2EIZA 2X9WA 4QRSA 1NDMB 4HSQA 1OAQH 3LN9A 2EEAA 3M07A 4PGEB 3AFLA 1IILE 1Y0LB 3EJYD 2EDHA 1KPUB 3BPNC 2M26A 4PBVC 5L2KB 3QXAB 4JVWA 1II4E 3F7YB 2X1XR 3HLAB 3NZHH 2O61B 3QIWD 4QRRD 4B53A 4MAUH 5HGAB 4TUKH 1U8OB 5J11C 2DOCA 3LQAL 5ADOL 3NFSH 2ATPB 1KLUA 1EBAA 2D03L 2O5XL 2W0LA 4Q2ZB 3QDGD 1ZV5A 4LNRA 5DHVA 3QNZA 1D7FA 4Y4KA 2NY0B 1IAIH 12E8H 2GAZA 4FFWD 4OGXL 5FK9A 1J1PL 1G84A 4NNPL 4Y5VB 1QNZH 4WWKA 3HC4H 4PJHB 1KN4H 1LO3H 3BH9A 1NAMB 4KJPD 1BFSA 2E7LC 5BRZA 4OCWH 4KTYA 1RUKH 3L1OH 5F6HJ 2VABB 2IQAB 2NX5E 1CGVA 4QHUB 5FYJL 1EPFA 3O2DH 4P3WA 3V4PL 4EDXA 1QHPA 5F9WB 5HD8D 5CUSH 1U91B 5DJXB 4HT1H 5CLWA 2ZCKH 1Q9OB 4LP5A 4X0KB 3MOAH 1A6TB 1R3LA 2X4PB 4FQ2L 1ES0B 4OLWL 1DUZA 1SY6H 5D1ZB