2F0CA

Structure of the receptor binding protein (orf49, bbp) from lactophage tp901-1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
147
structure length
147
Chain Sequence
TINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Phage tp901-1 ORF49 (BPP)
publication title Modular structure of the receptor binding proteins of Lactococcus lactis phages. The RBP structure of the temperate phage TP901-1.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
total genus 26
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f0cA02
4HEMA 3U6XA 2F0CA 4HEPA 2WZPA 3EJCA 3D8MA 1ZRUA 3HG0A 2BSDA 3DA0A 2BSEA 4IOSA 2X53A
chains in the Genus database with same CATH superfamily
1QUPA 2LT9A 5BUPA 2VDQL 1CTOA 2Y5EA 4G6AD 1RFDH 1S7RB 1QTSA 3FO0L 4LNVA 3GSWA 2XPGB 3O8XB 1S8DA 4AQEB 1UJ3A 2EJ1A 1OM3L 4K8RD 2E8ZA 4GO8A 4EZLA 4PLKD 2OR9L 1MWOA 3RUGB 2GJ6A 4P59L 1KPUB 4OSUH 5DD6B 5DGQA 3VFNA 1OE1A 1DBJH 2CH8A 4WI0A 3N85H 4XP1H 2DM3A 3KYOB 4GQZA 2G9KA 1FLRH 1OB1B 1A8JH 4NEHB 5FKPA 5C08E 2W0FB 2ZX8A 5L8KB 1L9TA 4XOAA 2ZNWA 1XTLA 2QFRA 3OXSB 4I9WE 3SPVB 3QDJD 4X6FB 2LVCA 3IEAA 1ORSA 1W2KT 2FNWA 3X14B 1VPOL 5KSUB 3G5XB 2HTLC 5IBUG 2CGYA 3UZQB 4PS3A 2PPAA 4LP8A 4JDZA 4JPIB 1W0WA 2EIBA 2P1YA 3GJFB 1HYSD 4ZW7A 4OVVA 5MEQA 5AD0B 3T0WA 3DX1A 4QRUB 5JHLL 1MVUA 3V9EA 2YZ8A 3Q3GB 3PQYA 3C60C 1CD0A 3RVTD 2XWTB 5FV2A 3VJ6A 3S97C 4MNGE 5MI0B 5KYYB 2HVBA 4IBQA 5KWYC 1FDLH 3A21A 5IK3A 4G70B 2JKJA 2BP0B 1PZ5B 3SPCA 4I18B 4KKLC 1T1ZB 3PDGA 4S1RH 5EC1B 2VITA 5EU3B 4A7QA 1ITCA 1XL4A 1ZT7B 4U7MA 2Q0ZX 1TSHA 3FHAA 4WO4D 1DSWA 5T1LD 5A3ID 1FIEA 1TQWA 2IXQB 2IH3B 5BO0D 5LHDA 3BAIA 4F57L 4UM9A 2VLJB 3LN4A 4ZPVB 3QUXC 4RIRB 3D4CA 1OP4A 3NZHL 3EUUA 2C9QA 3AY4C 2P8PB 4F80A 4ODSL 3FNKA 1FBIH 1FORL 15C8L 2A83A 3WL9A 1OCWL 4NPYB 4QHNA 3HTLX 1A7OL 2FTAA 2FWLB 5D7LD 3UBFA 5CBAB 3O4LB 2W59A 3Q43A 4GRMA 3QFJB 4LFHD 4GXFA 3FFDA 5D2LA 1D7DA 3N91A 1WAEA 4LLUB 1CD9B 3WY3A 4I18C 1MRCH 3CX2A 1HNFA 5JHDA 1XCTB 2BSTB 4KK5D 1CFTB 4MNQB 4UUJB 5EA0L 3ARFC 3R7RA 2ZD0A 1MWAA 5B8CA 5BCAA 5J1AB 1T5KA 3UZVB 2AITA 2EYRA 2F18A 4TNFA 5D7IE 4XMUA 5BXFB 2O5ZL 5KYXB 3KPMB 1RUQH 4LPCA 1Q0EA 1CL7I 1CIDA 3KEHA 2P24A 5GRVK 4PPTA 2EYTB 4TNEA 4FYQA 2DI9A 3AZUA 4E41D 1T1XA 4QRAA 3F12B 4H5SA 3TVMB 5EF0A 3SJVA 4YLBA 5A2FA 5ABDE 3DBXB 5D1XB 3SDXE 3QDJA 3RWEB 2VLRA 1MJ7H 1BD2D 4FG6C 1K4CB 3T0ED 1XH1A 4QRPE 3U6XA 1JCKA 2R0WL 1TYJA 4LVNC 2C3WA 1EXGA 1U8CB 3S3CB 2B1HH 1F8TL 2FT6A 2FWOB 1UKTA 4NP4H 4BA0A 2WCPA 3PP4H 3M1CA 3B9AA 4LLDB 4NO3A 4WY7H 1FC1A 1FL3B 3CLFL 1LM8V 3FCSA 4NQVA 3FQTB 4YIQB 5DD1L 5DS8A 5EU4B 2AGJH 4XMLL 3NZ8A 1MFEL 4GLRH 5DSCA 3PP3K 3KR3H 4EI6A 4LL1A 1I53A 3TEXA 4D9QE 2A9ML 3Q8EA 1BF2A 2BXZA 5KAQF 3KYKH 4JCLA 4WHYG 1XF5A 3BAEH 4Y5VA 1T20A 4QXGH 1FZKB 2KQMA 3ISRA 4P9MH 4ONFL 4MRCA 3RUGF 1GKEA 2QKIB 2VDPH 5I66B 1C5CH 2D3JA 2OXGA 3H2QA 1KGXA 4WO4A 5T1LA 1OAZL 5BZWB 5LQBL 1U3YA 2VM4A 4P57A 5JHBA 5ICUA 1AI1H 1CS6A 2CLVB 5AVUB 4FFZL 2VW4A 3CZLA 3IMRA 4NXSA 5TDPA 3WNKA 3LH2L 1RZ7H 5HI3C 2J88H 3RG1C 3K1KC 4JPKL 2NY5C 2Z8SA 2E4TA 3KPRA 1I85C 4Z0XA 1KV3A 3JTTB 4IRJD 1KB9K 4GAJH 1E28B 5E6IC 5C08A 5D7LA 2BP8A 3M45A 5I8CA 2CO1A 3ZR5A 2AI0L 4JGUA 3G5YA 2EVGA 3L3KA 4Y2NA 4MCMA 1Z7JA 4RGNC 1ITBB 1WFTA 4HP5A 4HUUB 4TYUA 3UTTE 1Y6KR 1UD2A 1X5IA 5KZCD 4JDVB 2IJ0C 4TM9A 4NAJA 4X6CA 4JO1H 4NWTL 4XPFH 1SYVB 3IETA 1KIRA 1U92A 4R4FL 4Z7QF 2E7BA 2EE3A 4RGMC 4NQDB 3X11A 4EDXB 2J4WH 2R2EA 5HHVH 3C5ZA 3CX5K 1S7TA 4H0HB 4G9FD 5J89A 1S9YB 1PCXA 4OKVB 1GW6A 1NCDH 3WKML 4DO5A 4CBZA 1OE2A 2EKSB 2COQA 3X1BA 1I7UA 4NPKA 2K6WA 5F9OH 4AJ0A 4LB8A 4E41A 1PNCA 4FG4A 2P5EB 3LTVA 3KG5A 3Q2CA 2ATKB 4HFWB 1K5NA 4JFEE 3FKUS 2QL1A 3AXLB 2ICCA 4AGPA 5KVEL 3EH2A 5DEFB 3KJ4B 4JZJA 5CIPA 3DK2A 1DQQA 4BK8A 1HI6B 4DTGL 5T5FL 1BD2A 1BZOA 3CHOA 5FYKD 3SQOH 1U36A 3ZL4H 1P6AB 1HL9A 3VRIA 4E9QA 2QADC 3DPBA 5F9WB 1YQVH 4N2DA 4NRYB 4OFYD 4MNHA 3T4AB 3CIQA 5F6IB 2H8PB 1CFVH 2EUVA 3EOBA 3CHXA 1GGCL 2Z34A 1YNTB 1GY1A 2AV1A 1EPFA 3HUJB 4U1MA 1PZSA 5IB5B 1MCWW 2XQBH 3V52L 4IDLA 5DC9B 3X3FH 3FHQA 3T6QC 1WWAX 4WWKC 1W16A 5IMKA 1ND0A 3HG5A 3IVKB 4QRSB 1PNDA 5AKSA 1M7XA 2JJSC 4LEOB 3EIFA 3KPPB 1RZQA 4A7GF 2OQJB 5DFTA 3T9WA 3DO7B 3K2IA 3T1FA 4ESKA 1AD9A 2WXJA 2EDMA 1WAAA 3BH8A 3MLVH 3AG2B 5C07D 2WBJD 3KJ4C 4XMXA 1YN6B 2IDUA 3ZKMD 4QTFA 2L7QA 3GRWA 4XBGB 3VXPA 5TDNB 1NCAH 3NTCL 4WEBH 5BVJB 5C09D 2A4EA 1E8YA 4Z7OB 1RLBA 2CJUH 3DV4A 3HS8A 3FT3A 3EH1A 1I8IA 1O5PA 5D7IA 4TSCH 4MX7B 1DHKA 1NDTA 4DEPB 2R29H 3P4MA 1CU4H 4LP4A 2Y06L 2YXVA 4E9XA 2FZ3B 4YX2H 2YBGA 3RHWK 1Z5LB 1UT9A 5IQOA 4K5MA 1YJDH 3QB7C 4YHML 2H6PB 2GAZA 3UROR 3I02A 3CSGA 3SDXA 4LF3B 4BFNA 2DMGA 1NAML 4DQAA 2YUZA 3DROA 3QQ3B 4EUPA 4QRPA 1ADQH 4HJIA 5GGVY 1KGIA 2X7LA 3E3QC 3OKMA 4BQ6A 3L1EA 1T21A 1XCWA 1YEDA 4GRLB 2V8MA 4YH6A 4XP4H 4GG6E 3T0AA 1R3KB 1MZZA 3PJLA 3FO2A 2AEWA 3S5ZA 1IT9L 1HHGB 1CWVA 5IR1B 1P5UA 4X4XB 5GGSB 2DWEB 3LKRB 3VQ1C 4XBMA 2F1AA 1U6AL 4JRXD 1QP1A 1PGRB 3RZCB 1QFUH 3NJMA 4P4KA 1QBMH 1ORQA 3B5HA 4X5XA 4AVKA 2R0ZL 2HKFH 5E2JA 3NCFB 3P9MA 3GMNB 2FBJH 3OJDA 4J8RA 2QR0B 3M7FB 2MCMA 4ZW8A 1RH8A 1FFNB 4JQVC 1YEGL 4QXUL 3W1ZA 4YHYC 2QQQA 4FQPA 4BCZA 4MSWB 3LKOA 3MLTA 4ZMXA 2WXOA 3VFGL 5JR1L 4ZRGA 2KBGA 2FX7L 3CFBB 4KU1A 5FW6A 1IX2A 3ZX1A 5CD5C 1LK2A 1LEKA 1CCZA 1BCIA 1F5WA 2APWA 2DL2A 4JMXA 4AL8L 2BCKB 3VGGA 5IJCC 2ZOUA 1GYAA 1QA9B 2YGNA 3NJLA 1C7SA 4P5KB 5IHZB 2YC1A 3P3RA 4HFUL 1VB9A 5C9JA 4DPRA 3TONA 3PV7A 3K72B 2BSSB 3C5SA 1IKNC 1Z0NA 4H20H 2JVUA 3MFFA 4ZX5A 3L5IA 2HRPH 2DD8L 2GG1A 1NFIB 3HS0C 1M71B 2KERA 4I0KA 1A6UL 3WUWB 2H4EA 2YRPA 1ZLUK 1MG2C 3FXIC 5IVOA 5CHNB 5C07A 4HKZA 1C1EH 3PABB 3QI9B 1BQHA 1T6BX 3UTTA 1KB5B 2GBVA 3L7EB 2QVTA 4XPTL 5B7EA 4B97A 4EOWH 1TETL 2DBLH 3EYFA 2CO2A 5ICYB 1UOLA 1H6UA 3HE7D 1OCZB 3WXVL 3RTQB 3IDYC 1IGTA 4TVPH 1WWWX 4RWYL 4JFDD 1V7NH 5IHLB 3ULVH 1MWAL 5HDQH 3KLDA 3D6GA 5E8PA 1F4YL 3BN9D 1HDMB 4P2OB 4KO7A 1K6QH 1OZUA 3FU0A 4GW4A 3ZKXC 5CJXA 3VFRA 1X6NA 2ROXA 1YEJL 2HH0L 4LHJB 3K8MA 4FJYA 1U8MB 2CRMA 5F0JB 1YNTF 3TCLA 3GMPA 2FSEA 3QORB 3VWJC 1BFVH 2CBOA 1A6AB 1CFSA 4Z3EA 4RRPM 1MF2H 1FYTB 2H0FA 3QEQD 3E8VA 5C7XH 1FAKT 1B0RB 1UGNA 4A2MA 1OTSC 4C83A 3RNQA 4F7KA 4NCDA 3THMH 2NY2B 4NQEB 1GJWA 3MX0B 3SYQA 5JIIA 2P7TA 1H3PL 4WJ5A 5F7LB 4BQ8A 4PJDE 5ANHA 1DQML 2VR7A 3PWJA 3VG9B 1OAXL 4DFIA 3WENA 3RX5A 5E95B 1R3HA 4MQ7B 4G7RB 1GL4B 2Y6TE 4P2AA 2XIBA 3RPIB 4X5WA 1MXDA 4TOYL 3CHPA 5EOCJ 4K23H 1GTFA 3U36A 1H5BC 2FX8L 1NKGA 1ZTMA 2GY7B 4IDJH 2FATH 5TDOA 2K78A 3VWKC 5MENE 3MLPA 1G4RA 5IT2L 2VC2B 3BISA 4N9OB 2G3NA 2OMYA 2PYEA 5DK3A 1DVXA 1ROWA 3ARED 3OHXA 2RAMA 2V33A 3SSGA 2ZF9A 1SVZA 1Q0XH 2WWNA 5EV7A 2VN6A 4J3UA 4JANB 3RUGE 3U79A 1R33A 4B60A 5FYJE 3WNLA 3LZPA 4HSQA 1DYZA 4AQAA 4HOMA 2RR3A 3HFML 2GT9A 3QNYA 5EMYA 2NY2C 2GB2A 2Q86A 1LJMA 5F71A 1HSBA 2YD5A 3O2VL 3VRJA 3S2AA 3IMUA 2KMWA 3EFOB 5DMJB 4UQIM 1ML0A 3VXNB 3H3KA 2VO5A 3OKNA 3OMAB 4KHTL 3KL0A 2DQJH 5IB3B 5FYLD 1YYMH 3IDIA 4NGHL 3S3PA 4JFFB 4FQXB 4ZFFB 1L7IH 1X5YA 4WUKL 4CGUB 3MGAA 3QXDB 4XMTA 2FHBA 1Q1PA 1ACCA 3Q2LA 1NCUA 3QPXL 1GZPB 4GG6A 4NERA 1IKOP 4LOFA 4N9GA 4Y7MA 1NMAL 2ZCLL 3QO0B 3PYCA 1UM6L 1WITA 4Z7QE 1H9VA 4BSJA 1BQRA 3O4OB 3NJGA 3QZLA 2JCCB 4N0RA 2HVKB 3E6HA 2KZKA 5BZXA 2DQGL 5ANMB 5I0DA 3R7QA 1QVOA 2WVVA 1JPSH 4HZAA 4YHOH 1AQMA 5IB2A 1A6ZB 3TF7C 5I9QB 3X1FA 2GSGA 2FD6H 1MLCA 1AGBB 1RJYB 2VLJE 4DK3A 1DN0A 3X17A 1IGCH 3UZEC 3QARA 2XUWA 3GJEA 3I6KA 5I1JH 3T09A 4FQXC 1E3XA 1P7KB 2CJTA 3C60D 1QHQA 3QHFH 1MUJA 5AUMB 2JELH 5CO1A 2XWBB 5FF6A 3B37A 1MCOL 1A9VA 4KKLD 5KEZA 5GIRA 4MHHG 2OK0H 2WXIA 3O4LE 4JPWL 2FVNA 3TP4A 4A2GA 3QFJE 4LARL 1EAQA 3U4BL 1XVSA 3Q0HA 3QIBD 4UOQA 5GRJL 4MNQE 2Z3FA 1MQ8A 1UATA 4PI0A 3DTXB 3EOYG 5GZND 2ENQA 4NCC2 3QUXD 5EBMA 3UCQA 1XGRA 4ABUA 4KMLB 3IAGC 1M2VA 5F7EH 3CH8A 3ARPA 1PBYA 3CVHH 3MRDA 1EQWA 4FZ8H 2CUAA 1BQKA 4FHJA 3N0AA 1I8MB 2CPCA 1LO2L 2I27N 3BKYL 3Q6GL 4FQQA 1T5WA 2OZ4H 3DI3B 4Y8DC 3B2PA 4KOBA 1YEHH 4N24A 4PSRA 4HDIA 2X09A 3DKHA 1SY6A 2VMCA 4GKNB 2DH3A 1MDTA 3GRWL 4N2NA 5IBUB 5HYSG 2W80C 5D1XE 5F0PB 2V3FA 5I8OL 3ARFD 4PW9A 5H37G 1HNGA 1TCRB 1KB5H 4HAGA 4ZFGL 1I8UA 2NY0D 3KYAA 5TPWL 4GI6A 2GEQA 3F58L 4Z3HA 1A6VL 4MRBA 2HLAB 1GPOL 2Y0SA 3JV0A 2G9HB 1YUHB 2X0UA 4HAKA 3DUUA 4DN4H 3GK8L 3ZQXA 4TUJA 3MBWB 2X6UA 5PCYA 3BIKA 1MNUH 3F5WA 1XB8A 3BVDB 3FULA 2WZ6A 2ZIDA 4PY7B 3ZUNC 1AHWB 4G82A 2NUPA 4JM2B 3GZKA 1FNEB 3LZFL 1IAOB 4PJDA 5I17A 2WCSA 1PY9A 2DQFA 4M3KB 2XY2A 4UQCA 2BY0A 5DJCA 1X4YA 1UFUA 2V2XA 1XZ0A 4EDWL 4OBSA 4I77H 4XN2A 2YD2A 3MRPA 3CZGA 3FZUC 3S98A 4QYOB 4HMDA 1S7RA 4M7KH 1KBKA 5ILTL 4H0LC 4UQEA 4F7PA 3O8XA 5BV7L 4AQEA 3SGJC 3TT1L 3O2WH 5EEVA 2CDFB 5G55A 4AJYV 4JFXB 4PEEA 1KCVL 1X5KA 4OTXL 3QUMH 5I82A 5AVSB 1M05B 3L7FB 2P43B 1R1CA 1RSYA 1L0QA 3KYOA 3LSOB 1OB1A 2QSCH 4ISVB 1F90H 2W0FA 5LXGL 2EDRA 1NLBL 1TZHB 3ARDD 1MVFA 5IESH 2VDLH 3SPVA 2EVHA 5IQNA 1ES0B 4N5EC 4X6FA 5JW3H 2NUTB 4N1HB 2X6CA 4NQCD 5KSUA 3ELQA 2CRYA 4M6OH 3UZQA 4DK5A 3G5WA 3QUXA 1RERA 1FN4B 1NOLA 4LHUG 5AOJA 4ETQB 5IFAH 1HOCB 2BK8A 3AY4A 4NQDE 1J9CT 1OGSA 3GJFA 5AD0A 3GHEL 3QQ9C 4X4ME 2JCCF 3L4ZA 4LSQH 3CZNA 3MLXL 3BX7C 4BYHA 4F37F 4ODVH 4HIXL 4AYDC 3EOAA 2XWTA 2A9NL 4I3GA 5E6ID 3UYPA 3MREA 3SPJA 1MFBH 2E9WA 2J43A 2P5EE 4I18A 4NBXB 1T1ZA 4RGND 4JCMA 3D85B 5EU3A 3VUAA 3WKNA 3ARFA 2KL6A 2A3TA 4NM4L 1EXHA 3LXUX 4IGBC 2X1QA 4UTCA 2Y3NA 5JIMA 1WZ1L 5E8DL 3INUL 2CGZA 3HN8A 1LEGA 1CUOA 2IH3A 5GS2D 4IKNA 2AJSL 2E46A 2G2NA 4XVJH 4CVUA 1E4KC 1OO2A 1IU1A 5T3ZH 4RIRA 5D9SB 4WGVB 3T77B 2XDHA 4TVUA 1KC5L 4LRIC 5JPNB 5MEOB 3HUJE 2XZAL 5I2IB 3ARBB 4RFOH 2B2XL 4G43A 5J12B 5D1QC 1NL0H 2XRAH 3E9TA 3Q6FB 4UMGA 4YE4L 1KLUB 3WSQH 2VSKB 2MPVA 1LO0H 4NPYA 3LPGA 3O4LA 2IWGA 3TC9A 1R17A 2PTVA 5HJ3B 4KZEL 3IS1X 2V0AA 2CK2A 3C9NA 1EDYA 4J23A 4LLUA 3T65A 1UACL 4XAWH 2C4FU 5F1SA 3VH8G 2EIKB 2BSTA 5J56B 1CFTA 1QAWA 2QADD 4L1BA 5TQ2H 2PPFA 2ZOTA 3TO4B 1PAZA 4GBXB 3C2AH 1J5IA 2XTJD 3IPFA 4YO0B 1V7MH 3LVTA 4Z7OE 4ODHH 5HDOA 2AJYL 1ZAGA 2XA8L 4G7YH 5DFAA 5B7MA 5CF3A 3KPMA 4WWKD 1XCQA 1JPFB 4M1GH 3QULB 1N4XH 4AIZB 2CRZA 5DRNA 4DPAX 1Q4NX 1DQTA 1WF5A 2EO9A 2EYTA 2QT6A 2V7NB 4MA1B 4RAHA 3BZ4B 4WSGA 3A6BL 3F00A 3T4YA 3F12A 1UKSA 3ULAB 4W9KC 1JGVH 1BMGA 3DBXA 1LNUA 3TYFB 2QSQA 4Z18A 1JFQL 1FV1B 3P77B 2C9VA 3G6JB 5DK2B 1UUNA 5ITBL 2N01B 5FHAH 1K4CA 3E2HB 4KK9D 4YHLL 4LO9A 5ACLA 2NXYD 4LSTH 4JM2F 1D7BA 3TO4C 1VADA 1WS8A 3WYRA 4GBXC 4E5XA 3MNDA 3Q8CA 1U8CA 4BEIA 1IMHC 4DKFH 1FFQA 2FWOA 3QWOA 4RNRA 5LGJA 4U1LB 4Y5XC 4LLDA 1TQSA 3DUSB 1I85A 4PWKA 5AENA 3WV0A 1FL5B 1NLDL 1K8IA 4S1RL 3HE6C 1T2QL 1S7XB 3EBGA 5DMGD 5E6IA 3RJOA 2DWYA 2NR6C 2MNUA 2WINB 1NM9A 5FB8B 5E03A 3MMEB 2AKRB 5IF0B 5I0VA 1N0XH 4ZJ9A 2ZYRA 1I7RB 1BJMA 3SO3C 3V4PA 3TF4A 1IM3B 5JO5A 1FZKA 1XH2A 4Y2LA 2UXFA 1GGYA 1SXNA 3U1QA 3TPKA 5JQ6H 3N1GC 5E5LA 1R75A 2IFGA 3NUKA 4FXKC 1IGMH 2CLVA 4LGSB 4ZT1A 4BRVA 1UKQA 1I1AB 2WLKA 2OAAA 4PH8A 1I8KB 3PIQA 1MW3A 2Y22A 3QDGB 2MNWA 4LU5H 2Y7MA 5KBMA 1VAHA 1ZS8A 1RIVH 1M3JA 4JDTH 3ZU8A 5DYOB 3JTTA 1PF3A 4PJGB 2HT3C 2FAUA 2D9QB 2DEXX 3X1NA 1NKRA 3KVDD 3JUZA 3IRZA 1P7HL 1UT1A 1YY8A 2QQLL 2UZXB 3QWRA 3SN6N 3WU1A 5GJSL 4HUUA 5DA0B 4CN6A 4QGYA 5IHBA 4JDVA 4HZLB 1B9ZA 2CNZA 3PY9A 4N28A 5KS9B 5CD5D 5DZLA 1INDL 2WQXA 3ES6A 4PUBL 1OAQH 2ARWA 2BIHA 4EDXA 4YLQT 1S3KH 4X4MA 1I1FB 4WWKA 1MW2A 5F96L 4OKVA 4Q6IB 2WXRA 2BNUB 4X7DC 1JERA 1OK8A 2DN7A 3MUGA 3PL6C 4Y89A 2ADGB 4KMTH 5CM1A 3I74A 2EDLA 2JJSA 1E6JH 2WNWA 2P5EA 3ALPA 12E8L 3V6ZB 2NNAA 1ECYA 1F58H 2YAFA 2ZYSA 3A47A 5DEFA 2MEJB 3UJIH 1LQSR 4BELD 1VFAB 4OGYL 4UANA 1HI6A 3I50H 2B1HL 2LFEA 1C08B 1SY6L 4M6ML 4WY7L 2VUOA 3V0JA 1UD4A 5AYUH 4ENEC 1A47A 2Q8BL 3B56A 4KZDL 4OCSH 1VZGA 3KR3L 3B9VA 4JRYB 4NQEE 3HUJA 4QHPA 5LAXB 5IB5A 4P2YA 4HZ1A 4BIKA 4ZUVB 5GS0L 2L3BA 3IJEB 4TUOB 4K8RH 5FUOL 2WQVA 4BFRA 2AAAA 4Q6IC 2YKLL 1CDBA 4U1NB 1FHGA 4G9DB 5HXMA 1IBGL 1BFTA 4LEOA 5DC2A 2VLMD 4YDNA 2X4SA 2GTZB 3VWJD 1V3MA 5BRPA 3U6RB 2A6JB 3ZO9A 4BXSV 2X4QB 2ZWNA 1WE5A 2OQJA 4N6RA 5ECJE 4ANWA 1RZIB 1F4WH 2KZWA 3UDWC 1NFAA 1EZVX 3ZKND 1QLEH 1WZKA 4Z3JA 1NFKA 2ZX9A 3K6FA 1OTSD 1NC4D 3S37H 4WHYH 3SGEH 5BVJA 1XAUA 2F19H 3ZO0A 1ACZA 1BG9A 1NIDA 2H1PH 3V9FA 2M1KA 2X6BA 3HB3B 2RHEA 2W60A 4G8GB 1O7VA 5B39B 1VFOA 2AXHA 5KVFH 3RI5K 3G6JF 4QHMA 4WFHE 3TEWA 2F6AA 1ED3B 3RPBA 5EU7C 2YZ1A 5AZ2H 4V1DB 3QUYB 1Z5LA 3WE6B 4XP9L 2FQEA 2A77L 4RAVB 5HJBA 3VWKD 3NDZE 5I1CH 1UVQB 2IGTA 5B38G 4JQVA 1HHIB 2NY1D 2W65B 2XXCB 5FDYA 3QS3A 4LF3A 5FYJL 1KCWA 2WZ0A 1QD0A 4JFFE 1T66C 5F1OB 3C87A 1TPXB 2JXMB 2BDNL 3FN3A 3M17A 3QQ3A 4PI2A 4BCYA 1IBDA 1ETJA 1NKOA 4DETA 4JY5H 4YGVB 1R3KA 1DL7L 5D72L 5CGYC 4KVNL 1HHGA 1QRNB 5A2IH 5IR1A 2QV4A 5GGSY 4X4XA 3QK0A 2DWEA 5GGSA 4EQ3A 1ZHKA 1LO5A 1IKNA 3CMOH 4M1DL 3UPAA 1YNKL 4LXFA 3U7YH 3RFZC 3N5AA 2EDTA 2JCCE 4ADIA 3Q2WA 2D7OA 4M9OA 3MLUL 3BPCB 3PUCA 5ANME 4HALA 1EUTA 2X88A 3LRMA 1U3JA 1J9SA 2QR0A 4YDIH 4XN9A 3AMLA 5EBGA 3V6OC 4EO5A 5C6WH 1DBBL 3P11H 1NBCA 5F3BA 1UGKA 1N0LA 2F8XC 5EO1A 4BE5A 1RK1B 3RAJH 4JFTA 3OKDB 3KM2A 1ID2A 1OHQA 3GSQB 1TPXC 1BDYA 2VXUH 4WNSA 1BGXL 5A16A 1A2YB 3BVXA 35C8L 4JQIH 4O2CB 2HVJB 4FTVD 4KJPD 2WW8A 2BCKA 4U6HB 4ZS7H 1A14H 4AQ1C 4PRPB 4KXCA 4HD9A 4P5KA 3L1FA 1YO4A 3L5WB 3EBIA 3K72A 1DSFH 4S2SA 5KS9F 5DI8A 3BPNB 4FKKA 1VENA 1XL6A 4NKIH 3ARGB 1UQSA 1NFIA 3ETTA 2K7PA 1MAJA 2WQRA 1M71A 2ZUQB 3VWJA 5I71C 1GAFL 1N3NB 2WTPA 2Z31B 1CL7L 3CSYB 3HI6L 4XZUB 3WUWA 3LKNB 4PWJA 4M93B 4WW1B 5DJ0B 1RVFL 1DE4B 4ADGA 4X9GA 5CS7A 3L7EA 1E40A 2CR3A 3HC4H 1G0XA 3W9EB 1AGEA 2WBXA 3KLLA 4F1ZA 1M7DB 3VFMB 2QFPA 3DMMB 4HLEA 4PBVC 3UTOA 1DEEB 4WKZB 1LLAA 3QIUB 1PX8A 1BHGA 5I1KL 5TQ0H 3AACA 2VZSA 4MA3B 3WN5B 4Q52A 1O9ZA 2AZUA 3RKPA 3TU6A 4IQHA 4X7TB 1HDMA 2IFFL 3LKQA 3TBYA 2OL3A 4KPHH 1ZTXH 2P8MB 3S35L 2Z91B 1H5BA 2K7QA 4LOUC 3RL2B 1EHKB 3WO3B 4C56B 4DWHA 4LE8A 3ARGC 3VWKA 4G72B 4J7RA 4J27A 3RIAF 2VMDA 5L2KB 1AZCA 4J28A 1KCUH 1N7MH 4XP4L 1AZUA 1FYTA 1AXTH 1NC2B 3GBML 1HINL 3V2AR 4YXKL 8CGTA 3L13A 5IMOB 3CFCH 4PY8I 4A38A 4O02A 1GH7A 3ZW3A 3V6FB 1J0KA 5M7QA 4PQXA 3DMMC 3MX0A 3UIZA 1ZT1B 4L3AA 3S3JA 3IDJA 3T6VA 4RQQB 2NNXA 3QIUC 1TJXA 3D09A 1AQKL 3NCXA 2ZYHA 5AW2B 3WN5C 4ELMB 1ZEAL 2Q6WB 4FRWA 5E51A 2DW5A 4M8QA 3H2WA 3V0VB 3MV7B 4OJEH 1PG7X 4NOFA 3BKJH 1B2YA 2F0CA 5C6PB 2MSPA 5IJBC 4RESB 1KGYE 3AQXA 4JPSA 2BSRA 2YGPA 3E80A 3NA9L 4PJXB 1W0YT 2X10A 3B2UC 4IKLA 4JQXC 4Y88A 4WI3A 4EUPH 3GRGA 2ADIB 1HCFX 4FTVA 3RY5A 2YA0A 4ZUTA 1QTYT 1T1WB 1DVZA 2CG9X 4WI6A 2R0KH 4XPBL 1WJ3A 1RZJC 4YFDB 4XVTL 5EZLB 2K6ZA 5FLUA 5D2NB 3O9WB 4NJAL 1RUML 4K9JA 5E5UB 2YJQA 3VMNA 1PEZA 3A23A 4ONGL 4JFQB 3C6LD 3WY1A 4ACPA 5J6HB 2HWZL 4HXAL 5ICZB 1X7QB 1YDPA 4KUZH 3VXNA 1NGYB 3FZUD 3WCYA 3V79C 1T6WA 2MQ3A 3K4AA 5EOTB 4AVHA 2JNZA 5HDBB 3UZEA 4O5LH 5T3XE 4W4OC 3LKSB 4FQXA 4ZFFA 1H3GA 4MGXA 1YEEL 5ISZB 1GGUA 3CJJA 5CD3B 3UOAB 3RX9A 3FQUA 1PLAA 3QXDA 2X4OA 4MHHI 3O0RL 1IEBB 4KTYA 3OKEB 4LSSH 5FYKH 4AEFA 4CAGA 4QTHB 4DP8X 5CR1A 5HYSB 2EIDA 5LUMA 5E99H 2ZSVA 4PGZA 5E2VH 3GO1H 5TTRA 1CIUA 5T1KB 2Z8RA 2YUVA 3SIKA 1AGDB 4EI5D 2BSDA 3MJ9A 3TNMB 5I1IH 2O5YL 4L1TA 4N5ED 3GSNA 2HVKA 3PHQA 5E8NA 2D7TH 2WAQA 4WW2B 2B0SH 2XG5A 3RL1A 4R7VA 4FP8L 2Y1AA 4Z95H 4PTUA 4NLAA 3KPTA 4L4JA 2XVLA 4FJ6A 1E6OL 1KZQA 4PGJA 1AGBA 1FIGH 3FQ4A 3K6NA 4N22A 3GZPA 4QEGA 3U46B 1XBRA 5I6NA 4NKDB 5IVNA 1P7KA 1I7TA 3AT9A 3SDAC 1RZKH 5J1SC 3JV6A 3LV3B 2LHAA 5AUMA 5I1AA 2JB6B 3HPJB 2IADA 1MJUH 3BI9X 1OAUH 3K6SA 3SKNA 3OZLA 2YD8A 3WTXA 2A6IA 2R4RH 2O93L 1CLZL 1SXCA 1OL0A 1HOEA 4ZOBA 2ADYA 1ASOA 4IGBD 3TPUA 1TITA 5JUEH 5EORL 3BSGA 4YZFE 5HD8C 2YEVB 4HS8H 3UJJH 4IRZA 4FFTA 4OD1L 3WHE0 5DR5L 3U9UA 2UYLB 4X5PA 5HGGS 2ATPB 1AACA 2X41A 2FJGB 5E9NA 5EZIH 5I76A 5A6LA 1NAKL 5D1QD 1NA8A 2FRGP 2R2HA 3R1GL 43CAB 4KXZH 5CGTA 4K5OA 1MIEL 4NPJA 1SDYA 3BPOC 2UVFA 3NEEA 3MXVH 3V8OA 5BMFL 4Z3IA 1GZHC 1NJ9A 1PLGH 1X5MA 1EH9A 4JKMA 3G5VB 4GKNA 5DZVA 3AXIA 4Q7DA 4FA6A 2VJXA 4OD2B 1UA6L 2B77A 1MCHA 1REIA 4PU2A 1BVLB 4LHUB 4EZKA 3GZQA 1KBGH 2HFEB 2DDQL 1B9KA 5LGHH 3G6JE 1IFGA 1JNNL 4WJG3 4Z7UB 3EGDA 2VR3A 2VLLB 5DUPH 3SGJA 1IQWH 3CFEB 1VFBB 1R24B 1R3LB 2HLAA 2G9HA 4OCXL 1LP9B 4ELMF 5IJVA 1DBKH 4DO6A 5AB1A 2IPTH 3UBXA 1IILE 4KDTC 4URKA 3HI5L 4DEWA 4I85A 3II3A 4PRBB 4WQOA 4PS4H 3GNML 1NMBH 3IKCA 3TTYA 1FNEA 3W9DB 3EG9B 3OC5A 2RALA 4MJJA 1U8KB 1SBBA 5INCA 2OMXA 2F54B 4FZEH 5HHNA 2DRUA 5FM5M 5C0JA 2BVPB 2ZUSA 3OVUB 3ESNA 4WJKB 1OALA 3AUWB 2ZF8A 2ZYIA 4CVXA 3VNZA 2WLZA 2G5BB 2R69H 1NOAA 4OJAA 4JKKA 4BKTC 1O9VA 4R7NB 3TJEL 4QRTA 5CCGE 2CDFA 4JO3H 4ZMOA 1LDPH 4LCWB 2QSVA 5SWZD 5IQ7L 2HJFB 2PO6C 4MA8L 3QDGE 4A7TA 3HE6D 4OGXL 3Q2NA 4ZK8A 3QA3A 5F7FA 2NR6D 4DKEL 4A6YH 3L7FA 3VH8B 2ICEB 1HAUA 3STLB 3S34H 1DDHB 4L8CB 5IW3A 2DQ6A 4LEXH 4MD4A 4PGBA 1DFBL 1J1PH 2AJUL 3FT9A 2E6PA 4TQEH 2AP2A 4IGBA 5SWSD 1OP5K 1ILUA 4MB3A 3PGDA 1ES0A 1ZTXE 1BVKA 4NO5B 1XGUB 1U58B 2NUTA 4F15B 3JV4B 3LNIA 1HN1A 5D7HA 1E4KA 5KS9E 1WD9A 5IW6B 1DJXA 1TTBA 1FN4A 4N8CL 4XH2B 1JPEA 3CWGA 4LRIA 1HOCA 4FFWD 3VGAC 3ZMEA 5DO2C 4ETQA 2CA3A 3EXLA 1A4AA 2ODHA 4JW3A 5D1QA 4NDMA 1VCAA 4AEIL 5FOBB 4WW2F 2F5BL 1M42A 3H9ZA 5D7JB 4RMTA 3VSVA 4ZW5A 4JM4H 3IFLH 2HT3D 1A4CA 3ARRA 3FS9A 2ICEC 4RISH 1MRFL 5T1MB 3VQMA 1TVBB 4FE9A 1BF8A 2DMBA 1CFMA 3PXHA 2CWRA 4A55A 2Z92B 4KI5E 1CBVL 3CU7A 5E5MB 1UWYA 2N0KA 3FOMB 4Q9CA 4F15C 2IO5A 2K3HA 3D5OF 3DOSB 2ITFA 4W6YB 2OL3L 4WV1B 5H37H 4CJ1A 3M07A 5D9SA 5MEOA 2ADFH 5G4OA 4F2MB 4YXLH 5I2IA 3PL6D 3VI3B 3BMVA 3W3BA 2ZCHL 5JHAA 1QLRA 4XNXL 4FA7B 4AE0A 2CHZA 5EU7E 4XCNB 4ZXBB 5I1LA 1OOWA 2VQ1A 2UY6A 1Z5HA 4JE0A 5D7JC 2UZIL 2X70B 4NUMA 4QLRA 3U0PB 1XR8A 3HBGA 3OMNB 3SEPA 3V95A 5I6XB 2G60H 1FSKC 5HJ3A 4E42A 1SJHA 3B9EA 3GT6A 4PWHA 1CPUA 2VR8A 1RURL 4KFMA 4Y4KD 2H9GB 2IANA 4G9FE 1P4LB 2MOVA 3ARQA 3TO4A 2I07A 3QSKB 4DP7X 4GBXA 1TZIB 4ENED 1Q9LB 1QR1B 5I1GH 3R4DA 2NMSA 4YO0A 3N1PC 3GBNL 4PWEA 4Y5XA 5FYLH 5L9DL 3BLBA 1TZGH 5D96B 2V2TB 2WCGA 4H0IA 4NN6C 4G8GE 5SWZA 2QGEA 4AC2A 4F92B 1LMKA 3HE6A 4JE4B 1JPFA 4YSEA 5I15L 3QULA 2P45B 2ZWKA 3MV9D 2NR6A 3L3OC 3P40A 4GW5A 4ZFQA 2V7NA 2VC2L 4Z7UF 4Z7VA 3C5JB 1A7QL 1UEYA 4V1DE 4UTAA 4QXTB 5JW3L 1AOHA 2Q5BA 2EUZA 3D0VA 3I6SA 3CVBA 5K33A 3V6OE 1JZIA 5SWSA 5CCKH 1LP9F 3HPLB 4HIEB 1BQSA 1ZVHA 4YVUA 1SZNA 1L9NA 5KANG 3P77A 2Y36H 3HNTH 4KWUA 5IV2B 5DK2A 4D8PB 5DVKA 4AXWB 4XMVA 4FXKA 4TSAL 4H4NA 1FFOB 4N0YL 1IM9D 3QDHA 4PS8A 1AAJA 4CVWA 1AMXA 5C70A 5IGXH 5AW0B 3AY2A 2AK1L 4EPSA 4CW1B 3BT2L 5A7BA 3GXPA 2F7PA 4QIRA 1BQUA 1PZCA 1OEZW 2OI9C 1F13A 1KY7A 1QRNE 2GTWB 5D96C 2HFGH 2B3RA 2CJSA 4ANVA 1MJJA 2W81C 4N5UA 4EXKA 3QDMB 2NTFA 3FOLB 4KC3B 4CN4A 5HPMB 4MQSB 3ZT7A 5FB8A 5C09E 4HF5H 1IIIA 2J8UB 2AKRA 1UT2A 3O6KL 3RWDB 5IF0A 3RVWC 3ML8A 4JVPA 1FF5A 1I7RA 1YMMB 1IM3A 3L16A 4OZIA 3MLRL 1WUZA 1T66D 3O3AA 4HXBL 2VJ0A 1QYGH 1UH3A 5IMMB 4LL4A 3IKKA 3OWEA 4YUEH 3HZKB 1VZIA 3MRHB 5DJ2B 4ZUUB 4P46B 3FUNA 2V5YA 3VFSB 4J6RH 3WGUB 4LQFL 2JH2A 2B8OT 3L9RA 4MD0B 5CGYD 4LNRA 5KBNC 5KVDH 3N42B 1JMZA 4HV8B 1D3CA 4L5FE 1CFQB 1I8KA 3QDGA 3RYMA 3PL6A 4PRPE 1L0XA 3VXSB 1YEIH 1JF1B 3X13A 3BSZA 4LLAA 4PJGA 3X1EA 4UQ3B 4I0CC 5ITFB 5KJRH 1XH3B 2YPLB 3IGUA 1AO7D 3NCEB 3C2AL 1THCA 1N5YH 2A4ZA 2LR4A 2XBZA 2MFNA 2VXVH 2J1XA 2VZOA 3IDGB 4LGRB 1H9DA 1RUAH 4IJ3B 5TH2B 4HZLA 4JRXE 1EEQA 1JGUH 1NBZB 5E9DB 5L4FA 1U41A 4PJIF 1SJMA 5ECGA 4MAYC 1AS6A 2FQDA 2BY3A 5C0AB 1H8NA 3QXTA 4NQSA 1E27B 4PJ8B 3QUKB 5HGHA 5EEXA 4OZHB 1ADWA 1F4HA 2IDTA 2D7MA 4Q6IA 1U8IA 2BNUA 3MV9A 4IRZL 2WKLA 4RSYA 5B38B 3LEVH 1GC1C 4MAUL 3H7BA 7CGTA 1JZ2A 2AV7B 4HUXA 1G1CA 2TRYA 2MMXA 3I9GL 3KBPA 4JG0L 4GAAA 4HUCA 1U91B 1SQMA 3I3BA 5EIIG 3MJ8B 3BP7A 4FA8A 2LFGA 1FNFA 2SODB 4C56E 1A0QH 4DFHA 1JV5A 4O58L 4NZUL 3OWRA 2OLDA 3UDWA 5ABZA 1DLHA 1QRKA 4UT6A 5L2KE 1QKZH 5K9JL 1NDMB 1C08A 4FEMA 3UMTA 1IM9A 4XC1L 1I1YB 5JMOC 5FS5A 2BRQA 4N0CC 3QUZC 3UTSB 4UOW0 3TIDA 5IIEA 3RKDD 1HZLA 3BHBA 2CJ3A 3JXAA 4JRYA 3FQRB 3PREA 3ZXAC 2B1AH 3FO9B 1KJVB 3QPKA 2F74B 4XPGL 1ZMYA 2ZP9A 3UP6A 3ZOAA 4BZ1A 1QATA 1J0YA 4XCFH 2APSA 3VA2C 4ELME 2MHAA 4ODXB 4LOUD 4U1NA 4NZRH 4ZO6A 1TZOA 4Q9RL 1CE6B 3GSUB 1HL5A 3CFKA 4G8FB 3MV7E 2A6JA 4NHUB 1AFVL 4I3SL 4JFDE 4UILL 3GWJA 1MELA 3FTUA 4JRFA 4W4NA 1M6UA 3WFEL 2YAPA 2ERJB 3MODH 1BM3L 1C16A 3FQ1A 4KZ0A 4PJXE 3JT0A 2FL5B 1ZANL 4I48B 2XV6B 4JDTL 3FJTA 1RPQA 3AB0B 2QPDB 1O6SB 5B39A 4YHKH 4DVBB 5JA9A 5AOKA 3ZE2B 1G0YR 4HJSA 1BMZA 4LSVH 5GRWA 5AW1B 3K8KA 3RFZA 3BVNA 4WI8A 2JKRM 3QEQE 4C8XA 5D2NE 1LXMA 2NY5H 4V1DA 3ZYJA 1BJ1H 4JLRA 3FMGL 5FGBA 5I1HH 4N3TA 4Q0XH 1Z0MA 4ZFZA 3V6OA 2HRGA 4NZJA 4BBWA 5IW1A 1AO7A 3QZOA 3MLWL 5K1JA 4N2CA 3U0TB 4ES9A 2W65A 1JK9A 3OTTA 5DZOA 5HDBE 1UZ6F 4R8WL 3CK0H 4X9BA 1CICB 4FQ1H 3V4PH 4A2DA 1Q9WB 4YNYB 3B2UD 2JXMA 5ISZE 5DURB 5B1CA 2KI6A 4LDCA 1PDKB 3AQZA 4AQ1A 4F20A 2WSDA 3VCLB 4IW4C 3GGWA 5E08L 4EBQL 3F7VA 3MVSA 4HKBB 4ODTL 1ZLWK 1F4AA 3QCTH 4RMSA 4QGTA 4OCYL 5T3XL 5C0RH 1DTUA 1JXFA 1AY1L 2VQTA 4JKNA 1WUNT 3X12B 1DVFB 1PJ9A 5JHMA 2LGNA 2ZOOA 3K2UH 3N42F 3V0AC 2AJ3B 5F89A 4EKXA 1ACYL 3X2QB 4JFYA 3SE8L 4LLWB 3NIGB 1H3WM 4OF5A 4AT6B 1UWXK 5JPMB 4RCAA 3OLEA 3H42L 4L8DB 3NJJA 3KPNA 1DJYA 4OY9A 1U8HB 2FDBP 3PS6A 4XPHH 3N1FC 4J3OD 4ODBD 3OQ3B 4FQJH 4O2CA 1PLBA 2HVJA 3U2SA 2Y25A 3ALWA 3VXRD 1TFHA 3QXWA 4OLZL 4PRPA 1J0IA 3CFNA 3BRFA 3LXBA 1USZA 3K5RA 4KXDA 2VDOH 2DLHA 1M7UA 2BOCB 1GMIA 2VUKA 3ARGA 3J07A 4XVSL 5H35B 3VI4A 4F7MA 4IBTA 4IOFC 1N3NA 4ERSH 4PG9B 4PRHD 4M3HA 3MGOA 3LKNA 3K4DA 2BNRD 2X1OA 4OZHF 5DJ0A 1DE4A 4CUCA 2JWYA 2IH1A 1J88A 2VRAA 3MLZH 4PR5B 2VXQA 4IKIA 1EEZB 2BVQB 5K39A 3SDAD 3S36H 4Y2OA 5J9PA 4YHPB 5JPMC 2E7HA 1IGJB 3AU0A 3DMMA 4YBLB 1NGQL 4AV5A 2YA2A 1DEEA 4QTIH 4WKZA 4C4KT 3QIUA 2VDKH 1T03L 3H3PH 1KJ3L 3WN5A 1MLBB 4XXDA 4X7TA 4FKEA 4I0PB 1BZDA 5DLMH 4X6DB 1WLHA 2H32B 2P8MA 2KYIA 1MJ8L 5FYJU 2Z91A 2QTEA 4P9HL 3RL2A 3NEOA 4KY2A 5HHQB 2A9AA 3EH5B 1ASQA 4FLOA 4Z7UE 1UCBL 5L2KA 1FRGL 2EICA 4XWGL 4EI0A 3ETSA 4DAGL 1NC2A 1FZMA 4JQXA 4UTAL 5IMOA 1LP9E 1L7TH 2OJEB 2I25N 4P5MB 4U6VL 1AZVA 4FKHA 3V6FA 3JQOB 4RFEA 4PIRF 4U1KA 5ERWB 1H6TA 3CIAA 2NW3B 3ELAT 3MBEB 1WRFA 3LQZA 2F54E 3WTSA 1YPZB 1R3IL 2C34A 2NYZA 1XO8A 2CD0A 3JWOL 4R83A 2O61A 4OFQA 1MPAL 1DP0A 1J7VR 2HXAA 4M61A 3VD7A 3EO1A 3NPSC 4JHWL 3JV5A 3CVIH 4U1JA 5FO9B 4P49A 1AIZA 2C4FT 4TVSa 4W4OA 1CC3A 2Z4TA 3ZE2F 5FFLA 1KFAL 4FG0A 3I9IA 1HHJB 3DRTB 3ILDA 1KN2H 1SBSH 2R27A 1D5XB 1YY9D 1IGIH 5DEGB 1JHKH 4LCWE 4GKZB 5J0BA 4XNQB 3MLYL 4CGTA 4YAQA 1X5XA 3DSFL 2ED6A 1S9WB 4XPAH 3FB6B 3QJUB 2XICA 3ZRFC 3ALXA 3W56A 3OM3B 1T1WA 2P4AB 5D1ZI 1FP5A 1WD8A 5LNGA 2ZAIA 5D1ZC 5EZLA 4YPGB 1VFUA 1XAKA 2BJML 2WXLA 4ZAKD 5DLLA 5J6HA 3GBDA 4JFQA 2Y7QA 3UO1H 1NEPA 2HJLB 3HG1B 4M43H 3WS3B 4IHBA 1TEGA 2E27H 3NCCB 3NJKA 2FT8A 4YDVB 2IALA 2OR8A 2XQYG 5IMLB 3PWPD 5DD0L 4TNGA 4HUKB 3OLIA 4ALAH 2DF3A 3SDAA 3T2QA 3NCYP 1T2XA 1QACA 2PO6D 2ZSWA 3BSZL 3UFIA 3VSQA 2XV2A 4AZUA 5CD3A 2DLEA 4X0NA 4XBEH 4J3OG 1KFGA 5B1BB 1LO4L 1PIFA 2BSED 3OKEA 1AYRA 4QTHA 2WLMA 4XMPH 4ZQKB 1F6AB 5DUBA 3ZRCC 1IAMA 3FYIB 3MGTB 4FQCH 2E76C 4N8VB 3CLWA 2XZQH 3BEWA 1K85A 1W9XA 1AGDA 4PJIE 5E2TH 4OD3L 2HLEB 5DJYA 1QFOA 3TNMA 3V4UL 5LGYA 2LABA 2ZUYA 3C09B 2BH0A 3KMDA 5HYJD 1AKJB 1WK0A 1E9OA 2AEQH 2BS8A 5D93C 3MRCB 1ZLVK 3P4OA 1IGFL 5IZ7A 4H8HA 3K46A 4NIYE 1DQDH 1DJZA 1GS8A 4KDVA 5DO2D 4KI1A 3WMSA 2WOYA 4M5ZH 4AM0Q 1PS3A 2WVTA 2EXWD 1OY3B 3CUPA 1Y18B 3ZKQD 3FQXB 3RY6C 4F2ME 4MJ6B 3AW5A 3W39B 1TG8A 1JAEA 3QG6B 2X5PA 1AP2B 5E2UL 4WFEE 3VI3E 4N0UB 2EVIA 1GZHA 2AQRA 3EYUL 4UT6L 4LCUB 3KWXA 4GSDL 3HPJA 4U1IA 5EWIH 1X5HA 3VD4A 5MP6H 1XTMA 1L3NA 2B4CL 2AJZB 3NFPA 1JNHA 2PTTA 1EXUA 5DZPA 5A2AA 1NCWH 1RP8A 3CXHJ 2P5WD 1AGFA 1ZDSA 2VT0A 4D7BA 1U8JB 2Q3XA 4BZ1L 4O51A 3PFUA 4RAUB 2XN0A 5H4YA 3PGFH 3EFFB 1P6FA 1Z32X 2UYLA 4ZSOA 1HEZB 3US0A 2E4FA 4CJ0A 4X6DF 4KNTA 4KDTA 4YZWA 43CAA 1Z9SB 3L3GB 5HJDA 1E8ZA 4DSYA 1JZ3A 2KZ1B 1CXEA 3HR5A 5J11B 1XH0A 4O02H 1G4MA 9CGTA 2CNYA 3H54A 2AEPL 2QQNL 3RB7A 3AS3A 1E8WA 4B3VA 1UWEL 3PHOA 3SO5A 1NBQA 3NOIA 5HGDA 1PMYA 1DZ0A 4LBEB 4XAKD 2BM3A 2E9IA 5CBEB 2E9BA 3D4GA 3FQWB 2VLLA 4HSCX 3QQDB 5F8RC 3ZHNA 5C3LD 2BX5A 2RH0A 4U3CA 5I0WA 1VFBA 1R24A 2O4EA 4UB0H 3EADA 1RK0B 4L4VD 3UC0H 1Z9LA 3EOTL 3STZB 1YPZF 5A43C 5F6HI 3OKOA 4IEFB 4UNTA 4R96B 1UZ6E 5I75B 2DKSA 3EJSA 1GIGL 3PF2A 5DJZB 2BHZA 4F7TA 4F8OA 3FU7A 4A2FA 3QDME 2R1XB 1JYVA 4JZNB 2CK0H 2Z4QA 2XYBA 1RHHA 3W9DA 5EO9A 4Z95L 2J8UE 1U8KA 5D70H 5KVMC 2F54A 5ID1B 4JFHD 2BVPA 1F0LA 1YMME 3L08A 3SE4C 2DM2A 3UPCA 2V5SA 3GI9H 2Y3AA 1I8LA 3PWLB 3KEDA 2G5BA 2C1PA 2W94A 4R7NA 5TK2A 4GINA 1A6TA 1BZ9B 1MJUL 4H8WL 4ACTA 5ADPH 1EO8H 3QFDA 1IFHL 2MJWA 2HJFA 4LLYA 2CE6A 4WUUB 5GRXG 4OLVL 2Z35A 1TU2B 5FKAA 4LAJH 2I60H 3VXSE 2W0PA 2EEAA 3FQNB 3G9VA 5DS2A 5ICXB 3B4NA 1KXTB 2ICEA 25C8L 1WEJL 2D2OA 3VB9A 5JTWA 2DJ4A 4L8CA 4KX8A 1CLYH 4PJCB 3PWNB 4ZDHA 3RVWD 4G6JH 1E3ZA 3BGAA 3WOVA 4G8EA 2VN4A 2KH2B 2YPLE 3BZFB 2IEPA 3PP3H 4DEUA 4U1HA 4HW6A 1HH6B 3FH5A 2P5WA 3W0WB 4L5FL 5INDA 1XGUA 3BUYB 3MJ9H 1J9RA 1P4BL 2LU5A 3MRJA 3QZWA 3FTVA 5EBWB 3BW9B 3KWTA 4BFGA 3GSNH 3NEXA 5A6MA 5E9DE 3SE6A 1OT4A 2OMTB 2ITDB 1A3LH 3ULSB 1EGJL 5MEPB 4M7JL 5L7XL 4OZHE 4X6BA 3DX6A 5D7JA 5I1EH 2EDHA 4KRNA 4G3YH 4PB0H 2V17H 2VXQL 4MWFB 3ECUA 2KKQA 2J71A 3DVGB 3VFVA 2AVFA 3U6XS 3KS0H 5T1MA 3ROOB 4ZNEE 1JDAA 3KWWB 4AJVA 2C9RA 3OQRA 3F62A 4QO1B 1JV2B 1E4XI 5KSAD 3K0WA 1S7UB 4L4TB 2PWHA 3V0HA 4MAYD 4F7CB 2GW5A 1C5DB 3NK3A 1IC1A 5EEUA 2AXGB 3UTSE 4RRPA 4POZC 3KXFB 3N9GL 3G5ZB 3G6AB 5IG7A 3CMGA 5JXAL 2GJZB 4RGOL 3Q13A 1HZHL 1X5AA 2JQAA 4XCNA 4ZXBA 3MU3A 3N55A 4OF8A 2X70A 3GKWL 5KANI 3U0PA 4HKXA 4CC0A 3TN0C 5DWUL 5F1IB 4ZTPL 4BINA 2Y2TA 4TRPL 3VG0H 1EAOA 5IQMA 2MCAA 2H9GA 3K8LA 4G7SB 4IJTA 4POYA 1WSST 4UV7H 4ZMVA 4N0CD 3QUZD 1BEYH 1TQBB 1TZIA 4OM1L 1Q9LA 1LK3H 4Q9QL 5FLVA 1PW3A 4FFVC 4LPYA 4OLYL 1BG1A 5I74C 3QS2A 4KTDL 3BCDA 4OFDA 4DERA 2V2TA 4KO5A 2X1XR 4AE1A 2YMOA 4FTDA 3AMKA 1PU0A 3ZE2E 2MPAL 3MRQA 4M00A 4POUB 3IMSA 3ESVF 4F7EA 1F41A 4Y8AA 2BHFA 2BIIA 4HEMA 1MFVA 2Y6SD 3O6MH 5FDWB 4WWID 3TCTA 5ENWB 3TIEB 1N64H 5CP3H 1J8HD 3RHWF 4HIIB 2A9CA 4TKWA 1FZOB 3MNMA 3GXFA 3HPLA 4HIEA 2E7MA 1LDSA 5JDSA 4AJWA 3VDAA 1OLZA 2D7PA 3LD8B 4ZFOA 5IV2A 4AXWA 3MBXL 5CSZB 2IAAC 3KBHE 5HGAA 3RJDA 1HHHB 2UZYB 4XO5A 3D4ZA 3SPIA 3TNNB 4Y4FB 4Z76B 2CDGA 3HMWL 2CGRL 3SKUD 3TFBA 4X0KB 1PZAA 3CDYA 3L1OH 4LVHB 2OTUB 4NC1C 2GTWA 3A5VA 5E8EA 2IBBA 1MQKH 5JIDA 1IZKA 4YWGL 5C97A 4GMTH 5K9KB 3WUZA 1YYLH 2VERN 1G6VK 1XX9C 3F84A 3QDMA 3W11C 4ABVA 4RMVA 2J8UA 3KH4A 3FT2A 5BS0D 1YMMA 1CR9L 2GFBB 3F7PC 2H3NB 4DUVA 2VDMB 3BDYH 5CZVH 5IMMA 5C6TL 1PLCA 3HZKA 5DJ2A 3RY4A 3LD8C 1U3HB 2CBMA 4MAYA 5F7UA 5IEKA 3SZKC 3VDBA 1DQKA 2MKLC 1JVLA 3ZLQC 1CTMA 1C7TA 3DX8B 1NWPA 2ZXWB 4BK5A 5IFJA 3QPQD 1G9NL 3IBEA 5GSVB 1TEFA 3VVWA 4LVHC 3VXSA 1C9SA 2IVFC 3LIZA 2Y1ZA 4MMZB 1CXLA 4Q74A 1O6TA 4PRNB 3MOAH 1FC2D 1FFPA 2I26N 3MCLL 4R7XA 1XEUA 5H2BA 1XH3A 2YPLA 5EH1A 3ML9A 2P3YA 2FJUB 2JIXB 3KLAB 3QXAB 2CM6A 4KUCF 1JSYA 3IDGA 1BZ7B 2V6HA 4Y19D 1FNSH 5BO1H 5DJAB 1KB3A 4PJ7A 3QUZA 4Z78B 2RCSH 2R2BB 2X4NB 5E9DA 4P99A 1DEDA 2E7DA 3CFDB 1PPIA 1I3RB 5C0BB 1RZPA 1SLWA 1D6EA 1KTDA 5C0AA 1SEQH 3UERA 3QUKA 2FEJA 3H2PA 2AC0A 5C0CB 3NQIA 4B3EA 1JGDA 4PJ5D 2AV7A 3HHSB 1E9PB 5TE4L 4X6DE 3ZQ9A 4OJFH 4Y5YB 2X87A 4OB5H 4XVUC 4MMZC 1U21A 3RDTC 4ZNEA 5HSFA 3WJMA 2VSCA 5GS1C 1OSZB 2YK1H 3HMXL 3IDMA 5DQJB 4F33A 3QJFB 4FNRA 3ZYOA 1NDMA 2XZCL 3HN3A 2V5RA 5E2WH 1RIUL 5FW7A 3U4EA 1HCVA 4D3CL 4L3ED 1FH2A 4YPJA 1G7JB 3FO9A 4XCEB 1P4UA 4XI5C 3C75A 4LL9A 2F74A 3WLBB 2P80D 3L5JA 4M8VA 5FX3A 1WA2X 5EN2B 2VRKA 3I9AA 2NZIA 1SRDA 1JGEB 5HGBA 4GAYA 3RA7L 3S5LG 1YPZE 1MREL 2YEZB 4NOBA 5JW5B 3CC5A 4HWEL 3GSUA 2Z64C 4Y5YC 5BS0A 3BIBX 4NHUA 3I84A 4WIQA 2XNAA 4K7FB 4TF4A 4R7LA 1WGVA 2UXTA 1UWGL 4AZ8B 3ZL1A 4PP2B 2FL5A 4LIQL 4EIZC 3LRLA 4I48A 2V3DA 4I1RA 4QHLA 4OIIH 2VXTL 2D03L 4G6ML 1I9RH 1U2HA 4DVBA 5DVPA 1DDTA 1QX1A 4L2YA 4MJ5A 4LKXA 5GGQH 5F93C 1WDAA 2APFA 4XGZB 3A4AA 4YBQC 4JAMB 3MRNB 5CEYB 1J05B 3BWAA 4HLZG 4AG4H 1EA9C 2WXHA 3R8BB 3Q9QA 2I7SA 1EK3A 3HG1E 3NJVA 1MOEA 2YIHA 3F6LA 1YMHB 4KTEL 3E8UL 3TBWB 5I6KA 3ASNB 3KAAA 2NW2B 1VLXA 1ONQA 4FAAB 1YEFL 2Y5QA 1A6WH 4DN3L 4YNYA 2JQZA 3ESMA 4HCRH 1GZQB 4PB9H 5K9QI 4HWZA 2G2RA 3D3VB 3LEVL 1I9JL 1PDKA 1W72A 5FUZH 3H4HA 3TH4T 3ZDZF 3DOIA 1VESA 5D1ZD 4PJ5A 2V5TA 5EC2A 5C2BL 1TO5A 3MJGX 1Y1DA 3EUDA 2J73A 1XCXA 5ETUB 5AW6B 1DVFA 2FO4B 3X12A 5CKGA 3IFOB 4D8OA 1S5IL 4KQ4L 3L95A 1QSFD 4MS8D 1M3IA 4M02A 3BDXA 2AJ3A 5FECB 2Z93A 3ATEA 1CDIA 4M4RA 3GQFA 4AMKL 5DMYA 2BOBA 2N7BA 2VN7A 1SEBB 3GMOA 2NQ3A 5JPMA 5GJTL 2NX5D 4A04A 2F53D 1CG9B 5AAWC 1U8HA 3CHSA 1T0MB 3WEXB 9PCYA 4N0UE 5JZ7C 4L3EA 4CC4C 2YWZA 4HIJA 2AEOA 4MLSA 5CINL 4AYMC 1C12B 1K4DB 2P80A 2VKWA 1YLBB 4R5TA 1KYDA 1BAGA 3EO9L 2E0PA 4F58H 1KELL 4QD2E 5DT1L 4G5ZH 2VDMH 1QSVA 5AAPA 5CEZE 1G9ML 5H35A 3IM1A 5KTEL 2R56H 4XC3L 1USQA 5LG6A 1MCKA 3P9WB 4MMXB 4Y2DB 5I19H 1HAWA 5GRUL 3U4KA 5ESVA 4LRNL 2PW2B 3A6CL 3FRUB 2BVQA 3L4CA 4AENB 4K94L 1HXMB 1PZ3A 2AJVL 4WU5B 3B7RL 4HJTA 4PGCB 4YHPA 3TL5A 1IGJA 5I6MA 5T33L 2BZDA 1O7DE 4A39A 4UIKL 5BOZG 1ZV5A 3AS1A 5IM7A 5I6PA 3LEYH 4GXVH 4ADJA 1MHCB 1MLBA 4Z7NF 5L88H 1U8OA 2H32A 1N6UA 3QO1B 4GAFB 1UM5L 3L48A 1KENL 4EZMA 4PTTB 4MJID 5HHQA 3GD1C 1NEZA 5HHPB 4UNVA 1SOXA 3OAUL 1NPJA 4DPCX 3ZHKA 4Y2DC 2BO0A 4MMXC 4U6YB 4ELKA 2ITCB 3ISWA 1JNLH 1K2DB 3QAZC 2XTSA 4FQ2H 1JZ8A 2YQ3A 4NFCA 4OLWL 1ZHNB 4UDUB 5ADOL 3TWCL 4MCNA 1GSMA 4NBYB 4A2EA 2VMEA 2OJEA 4EXPX 3MR9B 4H26B 1B2WL 2VABB 4CU7A 2JJVA 4DZ8B 4QKXB 4APQD 1RL1A 3VD5A 5KBPA 1KXQA 3ESUF 5T1DH 3SOBH 4OW6A 5ERWA 1PG7H 3TA3B 5D1ZA 4YLCA 3ILEA 1UUSA 3MCG1 1YRKA 2Z7WA 1Q94B 2QHLA 5DC0A 3CZUB 1D5IH 3VYNA 4UTBA 1XF4A 4Y9EA 3MKKA 1QSFA 3IWUA 5FO9A 3QAQA 1T3FA 4RMBA 3GF8A 1JJUA 2G30A 4HJJH 1NSNH 5ESAB 4KITB 3DRTA 1CVRA 3H9HA 3FN0H 4PGDB 1NGPH 1UB5A 2X38A 3VTTA 1MFAH 2NX5A 3SDDD 2C3VB 3IXTB 4XNQA 3DV6B 4WUUE 3KW8A 3MCKA 3O6FC 4R26H 5I1DB 4WEMB 3FB6A 3DX3A 1KCSL 2NDGA 3BEVB 4R4BA 1YEKL 3KM1A 4FQHB 4KNSA 4PJCE 1ZVSB 4NKMB 43C9A 1J1OH 5LN4A 3PNWA 2CUHA 2B59A 4WWPA 4CMMA 4KROB 5DJDB 6TAAA 4QRRB 3HG1A 3W0WE 3VI4F 4HQQH 1FNLA 2FH8A 3E7JA 2DQTL 2X2HA 4NZ8A 4BUGA 4KNQA 2H1XA 3P0YH 1KT2A 5IMLA 1LMIA 4LVEA 3BXNB 3LIZL 4OFIA 2BY1A 3RY6A 5LDUA 1EBPA 3PHSA 4M6NH 3NFSH 4ENZA 5BZZA 5IB1A 5CN2A 3S88L 4L1DA 1LWJA 4WCYH 2AXFB 5KW9L 1F6AA 4PLJC 1JHTB 5J8OA 4PV9A 1KTKE 4N8VA 3RVUC 3WDHA 3ME0A 4KKCD 3TLRA 3C08L 2XN1A 1GOFA 1I4FB 3GSXB 1BJ1J 2ZKYA 4JO4H 3AM8C 4EE2A 1AKJA 4PJEA 3PHAA 2W9DL 4KROC 4OCLC 4FQLH 1UH4A 3MRCA 3NRQA 1AH1A 1JZ5A 2CKBA 2E6QA 2XN9D 3PWUB 4L4TE 3VFWB 1SDAB 2LTQB 2P47B 3JWNC 1FL6A 1UOVA 5SX5K 4JKLA 1NCBH 5AFAA 2DY2A 5BVPL 2Q7AA 3U48A 4AEHH 4OLXL 1UYWL 3KXFE 1Y18A 4S1SL 3HG3A 3FQXA 1ZT4A 4MA7H 4O9HL 3W39A 2NY6B 3QG6A 3RURA 1OPOA 4DHLA 1ZPLA 3D50A 5L6YL 3TH2T 3WIIL 1B0GA 3FFOA 3QJZA 1HWGB 2F7RA 5FPIA 1LGVA 5I30H 1LTXA 4I1PA 2Z8WC 3D39D 4IBYA 4CMHB 4ZG1A 1MFCL 2XTLA 3NZSA 2OW6A 2AJZA 4A7UA 4NYLA 4EJ1C 3SE9L 2EVFA 2TRHA 2BS71 4AQ8C 4NRXB 3U0WL 1DBAH 3SCMB 1U8JA 4DPBX 1IAIH 1MAML 3L3JB 3RBGA 4M6AA 1P4IH 3QQ4B 1L9SA 4FMKA 4UOJA 2OJ1A 1Z9PA 2HKHL 2LLNA 4BH7A 2NZ9C 1KPVA 1ZV9A 3H0TB 1SXSA 3TV3L 2MCG1 4F1SA 4LKCB 3MRBB 5D4JA 3L3GA 5DJ8A 2X53A 2EH7L 4G11A 4J3OF 4PRAB 1AJ7H 1IC7L 4TSBH 3ZYIA 4PD4K 3TN0D 1GGBH 2VZ1A 1KJ2A 3TJPA 2WQSA 1T4WA 2OYLA 2WZAA 3SE4A 1RZJH 2DZEA 2WMPB 1Z3RA 1SOKA 4Y0GA 1QLFB 4ZD3H 3WLWC 4OZ4B 2J21A 1F11A 2BMKB 1BFSA 1P84K 2WNGA 2VDRB 4U49A 1FAIL 4W9GC 5ALCL 4JX0A 3ZUCA 2ZUTA 4LBEA 2RJMA 4FFVD 2LAAA 2OA9A 1FNHA 4HWBH 4YEFA 1XMEB 3OJVC 1H15B 1RK0A 3LQMA 4FLQA 4OV5A 3STZA 4UQBA 4QMEA 1D9KB 1DJHA 3IJSB 1F97A 5E2TL 2JI1A 3GSVA 3LB6C 3AGVA 2EEBA 2I7OA 4HT1L 5DJZA 5FWRA 2BNQB 3ZTNL 1TUPA 1A1MB 3QQNA 4JZNA 4Y4HB 2G0LA 4J3OH 1F1AA 1NBVH 2DWTA 4JFZL 4CSPA 1CGSH 4TQ8A 3BGFC 2WXFA 1K72A 1KTRL 4UU9A 3LHPL 1X4ZA 5DFVC 4ATWA 5ID1A 2IV9A 1RHFA 2XVGA 3MNWB 3S4SG 1W72L 3ZZ1A 2XN9A 3A22A 2Z9TA 4KY1H 2Q8AH 1D2OA 3W2DL 1J11A 1NGXB 1M57B 2ICWI 4J39A 1MCIA 2KUTA 2UUDK 3N2JA 3WNIA 3H9SD 4HMCA 4DGYL 1JYWA 4K15A 3DHJA 4WHDA 4RZCB 2V9QA 5E0FA 3IDXL 1E4HA 5DMIL 3MOBL 1BZ9A 1E4WH 3WIHL 1IC5H 1QR4A 3EFDH 3LH8A 4OFKA 1G7MA 4C4UA 1D6VH 4LBAA 1ZXQA 3RU8H 3MLSH 4YVNA 1EJOL 3P1VA 2LQRA 4PP1D 5ICXA 1KXTA 3W11D 4NP9A 3P4NA 5HHMD 3TZVC 2J44A 3MRKB 2X4PB 3D39A 4PJCA 5CWSB 2CKNA 4JHZA 3D9AL 3M8OL 3BZFA 5L4MA 1EBAA 1MI5D 3FT4A 5D6DC 3R0NA 1HH6A 1OAYH 2OMVA 4MXWH 3BUYA 3K5SA 3CVDA 4NZTL 5E00B 1E5YA 3VD3A 2EH8L 5TFSL 1CK0L 1GGIL 1JS4A 2PCXA 5E6RB 2QHRL 2ZWSA 3CXDH 5C0BE 1BBJA 1G7PA 2ITDA 4XNUL 4OZFA 3D69B 3ULSA 2G75B 3X3GL 2E8YA 1RAMA 5C0CE 1RU9H 4HWNA 1F4XL 3TBSA 1YHPA 3TT3H 5DRWB 4CILA 2ESVD 3M7OA 3JWDC 4LVOC 3ROLA 4JN1H 3DVGA 4UV4H 3DLQR 3GXMA 2VLKB 4H25B 5B1JC 2AJXL 5CN3A 3NSDA 1MCDA 4AGQA 5D7SL 4LCCB 3SDCC 4E0RA 3ZIYA 4L4TA 1YECH 4OCRL 2I24N 3DETC 4KMQA 1P7QB 3FB7B 5E1AB 5FIEA 5B1AB 1C5DA 4HG4K 3EHBC 1XXFC 3VW3H 2WGXA 1DVYA 3SGDH 1JL8A 1B3JA 1Q1JL 2R0LL 3G5ZA 3IJ9A 1JRHI 5G5DB 4XMKH 4RBPK 1HH9B 3DX9B 3GB7B 2BVOB 5EU6D 3DO4A 1MH5B 4L1LA 1FO0B 4NN7C 1CYXA 3FONB 4MZ2A 3R06B 4NENA 3DGCR 3RDTD 2WP3T 3WTYA 4DVRL 1PSKH 1DQVA 4HCFA 4NM8L 5GRZA 4I89A 1FZJB 3O2DH 3KPQA 4G6KH 4X5QA 2C7UB 2H2SC 3KHQA 1WTLA 1X3DA 5D4QA 4Q8BA 4XTRD 3DGDA 3VD2A 3G08B 1AG0A 5F3HA 3UPRB 3TXAA 2J57A 4RFNC 2OTWB 2WUBH 4U6XB 1I1CA 3UGXA 3H9SA 5A40E 2ALWA 4KHXL 5KVGL 5AKRA 4XI5D 1J8SA 4GUPB 2VNCA 4OF3A 3ZHLA 1ZXKA 3QNXA 4XO3A 3PJSB 2AK4D 4XODA 3NESA 1KYFA 5D7KD 3D7PA 3IDUA 1XGQB 2Y07H 4K07A 3RI5F 3BD4A 2R9HC 2ITEA 5I8KH 1A3ZA 2PXYC 3GBLA 4M7LL 3ULUF 1QFPA 4PJHB 3SY0B 4JUSA 2BP5M 3QNZB 4X80L 2H1LM 4U1SB 3O3EB 1D5MA 4AVIA 1QO3B 3KJ6L 4PWGA 4FYTA 5HHOD 2Y2YA 3NSJA 2O72A 4HBCH 3HC2A 2GC7C 4Z76A 1JPGB 4Y9GA 3C8KA 2XIDA 3D3VE 2OYPA 3LDBC 4LCYB 4FI7A 3L4VA 3L6FB 1A7RL 1R6VA 4ZMWA 2OTUA 1QSEB 3MRGB 1U3NA 5K69A 3EYVB 4M5YL 5K9KA 1G7QB 1NDGB 1SUHA 1FNGB 2MH4A 5AWNH 4IKKA 4ZZKA 3F85A 4OCNC 1TKWB 3A3YB 2IOMA 3DWTA 4ZNCD 2QKSA 5FCUL 3P30H 4JL1A 2NY7L 5HHXH 1U95B 2HPOA 5J6GB 3KYMB 5E94B 2GFBA 3ULUH 2H3NA 4OGQC 2LU4A 3G7TA 4GT7A 1QI3A 2C5DC 1BVOA 3FUEA 3QUGA 4OIAA 4U33A 2ZUVA 1VGEH 5E24E 4DH2A 2FGWL 5CEXA 4P2RD 3UAAA 1DQLL 3DX8A 1UXWB 5ACZA 3S5LB 1LD9B 4X8JA 3GUTA 4W9JC 2A0LC 5D5MF 1DLFL 1DQJA 5EU6A 1AGCB 1U3ZA 1W91A 1GTNA 5FK9B 4K71B 5C8JB 4GAGL 4BCXA 1O0VA 3EGSA 2VWEC 4MMZA 1AC6A 5LNEA 5IROC 3RDTA 1E5ZA 5GS1A 1SHWA 3L2NA 4FLSA 4DCQB 3K0YA 4K3DL 4RX4D 2HPTA 2H47C 2FR4A 3CVCA 3KVPA 5DJAA 3QRGL 1EDQA 3HCVB 3SDYH 1PD0A 1RJLB 5JZ7D 2R2BA 5JYMA 3S37X 4Y16C 3T1WA 2KLTA 4Y1AB 4XBPB 1CFNB 3EO0B 1G87A 3OAWA 4O2FB 4A7SA 5CEZL 4QUOA 3PUUA 2AK4A 5C0CA 4LAQL 1A7PL 3WNPA 3ZDWA 4P23D 2WUCL 2QPFA 2YSSA 3HHSA 2A73B 2JB5H 4BQ9A 1JPTH 1HT6A 5GZOC 4ES8A 4O4YH 5SX4H 4Y5YA 1S9XA 4YHZL 4JZOA 2DWDB 3LS4L 2XWXA 5EZJA 3GJFK 1W8NA 3O3DA 3MNZB 4YQXL 3KPSB 5DQJA 5HHOA 1G7HA 3QJFA 1XGPB 1HIMH 1KJ2L 1ZK9A 1G6RB 2YUWA 3PDOA 3NACL 3MPCA 3VE0B 3CLEL 1TDQA 1YAZA 3GSRA 4DZBB 4JG1H 3FFCB 5BJTA 4KJYB 1G7JA 3I3EA 1QZ1A 1V3KA 3OR6B 4X4ZA 4XCEA 5E5RB 1CF8H 1JK8A 3L5XL 5C0FA 2HT4D 2ARJA 2CLRB 3U30C 5EN2A 3LS5H 4RA0C 3I3DA 4YN3A 3D08A 1N6QH 3BJLA 5D71L 2YEZA 2IIJA 5JW5A 2KHAA 3KS0J 4JN2B 2V7HA 1CZ8L 3LQAL 5DCCA 3QZPA 4LSUL 2EXTA 1KB9J 4JPQA 4WNQA 1KWGA 1FJ1B 4YDKL 5JOPD 4OCMC 1T7XA 5AW5B 2YGVA 4JJ5A 3KCWA 3QYCA 2PR4H 4HPOL 4QPEA 3JSSA 3RFRA 1MHEA 2J5LB 2NNFA 3WFCL 3AU1A 2JKXA 5AVXB 1FO0H 4P2RA 1K8DA 5IFHL 1MFDH 4PJHF 3IE4A 3MACH 4DQOL 3QG7L 4X99A 5DD5L 4R5XA 4FYSA 1V3JA 2XX1A 1NCIA 3POHA 4HOXA 1MCPL 4NJ9H 3EYOA 3GMRA 1C5BH 3CX5J 2ZP0T 1X44A 2WWKT 5BQ7B 2MOQA 3VNYA 1IO4C 4QRRE 4XN5A 1YZZA 2BINA 5IREA 3D2UD 2FE0A 2EIEA 1WG3A 5E8OA 2FO1A 4XMZA 3TBWA 4XNAA 1JWSA 4YSSA 4RX4A 3U9PL 4XNMB 3VMOA 4K7PY 3FUJA 3L3HB 3KHOA 4W6XB 4K2UL 3RNKB 4GQRA 2OCCB 1G7LA 1AYOA 5AAWA 1D5BB 2VAAA 5CUSH 3O6FD 4AIOA 3GXIA 3IGAA 4CC4A 4XWOC 3OX8B 4Q6YA 2WK2A 3BH4A 2OMBA 5LWYH 3KNBB 4CDGC 4JFEB 1S9KC 1E4XL 4U1GB 2PKDA 4FC3E 3QJRB 3PPSA 4FXTA 2R2CA 2P28B 1NFDB 5HJGA 2FO4A 1ZLEA 4UT9H 2MTAA 5JLZB 5KYWA 3IFOA 3NCJL 1H0DB 2D31B 4ODUA 4J3WA 4DUXA 1O7SA 2A74C 1CE1L 2X2YA 2FIRT 1KEMH 2A6DB 3CN4A 4A2LA 5FHBL 4WFFD 3WBDA 1GCFA 1JHLH 1SDDA 1SEBA 2D8KA 1QEWB 3MO1A 4JM0A 2XXFA 3DOHA 3UTPE 4GO6B 4PJBA 3FTWA 4U2YA 4K5PA 1L0YA 1CG9A 4QYAA 4PLJD 2OFQA 4XCCH 2DTMH 1DO5A 1T5XA 2EDKA 3RVUD 5J06A 5I18H 4FCHA 5DD3L 5DHVB 1MHHB 2C9AA 1W80A 3DX4A 5CLXA 3V0IA 2FJHB 3MC0A 4U1GC 3ZT6A 2WANA 3HC3H 5DZAA 4MYWB 3V9CA 4I7ZC 4ANKA 1UZGA 4GO9A 4Y2DA 3B2DC 4MMXA 2DKMA 3QT2A 4OLUH 5EDXA 1LEIB 2MRYA 4X7SL 2PETA 1LVEA 1RMFH 4HGWA 5IBTH 1HKLH 3MYJA 5I8EB 3S96B 4M3JA 4N2KA 2ED7A 4H44C 2EE6A 1AXSB 3WHXB 4WU5A 4TPRH 1JWUA 5B3JF 5GGTH 4WTQA 4BGLA 1UZ8B 3GDCA 1Q9KA 3CQFA 4WF7A 1QHPA 4LPXA 1Q0YL 4XRCB 2YOCA 1U8LB 1M7IA 5EB9A 1Y07A 4LHQB 2UWEB 1INEH 2BS9A 4JY6A 4L18A 4QY8B 2VW6A 3F64A 1KLGA 3D2UA 4FABL 3D05A 4HS3B 3B2XA 5F44A 1TYEB 1HKFA 5HHPA 2IOIA 3V0WH 2JKIS 5AVYB 1S7VB 3PV6B 4NNPH 2XBTA 2ZOLA 3BLKA 3C6SB 2ITCA 2GITB 2NZ9D 4HLZH 4U6YA 2OYMA 1UENA 5ES4B 3ULUE 3CE1A 1W0VB 4UDUA 3IMVA 4WGKA 1EHLH 3O6FA 3QJHB 1UURA 3RGVB 2GK0B 4LOVA 4P06A 2VXSH 2PMZA 4KRLB 4UAHA 3T6XA 4FFZA 1J0HA 2A6KA 4TQHA 4DZ8A 5JOFA 1HSAA 5DUML 2EVJA 1ICTA 2BP3A 2ARJQ 3FRPA 4X9IA 3VXOB 3CFMA 3U7WL 1A4KB 4NHCH 1VCBC 1Y0LB 3VXTB 3DA0A 4Z8FL 4LLMA 3WFDL 1RZGA 1T7YA 1G6RH 1IC4H 5DJXA 1T6VN 2ADJB 2GJ6D 3E9UA 4PJFF 4XCYB 3KGRA 3VXUB 1UM4L 1JUFA 2V9TA 5ESAA 3GIZL 1Q72L 1G7IB 4M29A 5IKCB 4XP6H 1Z3GH 2XJLA 1E5AA 4Q97A 1SXZA 3BP4A 2KLSA 2DLFH 3JT2A 3SD2A 3V5HB 5I1DA 3BAKA 3OSKA 3C5XA 3GI8L 4D9LH 4W9CC 1H8LA 3MV8B 3V4LA 4KRPB 5DFVD 4NKMA 4I5BB 3AM8A 2QBWA 2NY4C 4L4VE 5LG1A 4OZGA 3BOVA 5IP4A 3REWA 3IWVA 1A3QA 4H1LG 4GMSL 3D07A 3QJTB 4JHAL 4FNLL 3PQYD 4ABWA 1BXUA 4FXGB 1HFUA 3BVVA 3JYBA 1T4KB 4JFHE 4DP9X 1OT2A 4D9RE 1KJMB 2X2JA 3QCVH 4R0LB 3AQDA 3IN2A 5DHMC 3TZVD 5I16A 3ILPA 1KN4L 3G6DH 5BRZD 1NIAA 1AE6H 4GW1A 3Q8FA 5DHDA 4EZJA 4OM0H 2VLKE 4UIMA 5FGCE 2F7IA 3TYGL 4UM9D 4AQ8A 1I4FA 4BDVB 2YSTA 4S1QH 2QVIA 1CT8B 5EF1A 2YFOA 3GEFA 4HJGA 5KYUB 1VDGA 1LE5B 3L1GA 1Z2KA 2B3IA 3VGEA 3OXRA 3PWUA 4RDQG 1OP5H 4R5VA 2X6AA 4L9LC 3B9KB 3BO8B 1Z6JT 4FS0A 5AOIA 1FGNL 4ZMLA 3CU1A 4GKSB 4W9EC 2CO6A 2RFXA 1INQB 1D2PA 2FX9H 2B5IB 4R3SB 5JW4N 4B53A 4X9FA 5DK0B 6PAZA 2R83A 3S4SB 2I5YH 3U2IA 1J10A 4GLRI 3FF8A 4MVBC 4R0LC 2XLLA 5LCVA 4UYQA 2WNKA 3AAZB 5TE7H 3RWFB 4JO2H 3T2NL 4HH9B 5MENB 4XO4A 3V6BR 4X2UA 2X4UB 3SDCD 5GS0C 3BKCL 2NSXA 3BQUB 2VDNB 4HJUA 3DETD 2GCYB 2UX7A 1MFMA 3SCMA 1QBAA 3EHBD 3L3JA 1BEXA 4KRMB 2IGFH 3QQ4A 5J4MA 4E9TA 1NAMA 4Y7OC 4WDIB 2UWEF 5DHVH 1SVCP 2ZXCA 1PYWA 4OFVA 4LKCA 3BP5B 3SJVD 2ZP8A 2NY3B 1RULL 2B5IC 4PRAA 2XFXB 4YXHL 1I7ZB 1WGOA 2E5EA 2YJLA 2VLRD 1YNLL 1OT1A 1B6DA 2VISB 4PJHE 2F7OA 3NG5A 4G6FB 3QEUB 4S0SD 2FNBA 3B5TA 1QLFA 3L4WA 1KLFA 4UZSA 1UOWA 3P0YL 5JNYA 4YE0A 3RQ3A 3BQUC 2QJDA 3O8XC 1J8RA 3PE9A 2DQCH 3QIWB 4UTBH 2ICWA 5C3IA 2FLMA 4HU2A 5FA3B 3HC0B 4GIOA 1MCSA 4HPYL 3I75B 3M46A 1EV2E 2VSMB 5GISH 4EIBA 4Z7QB 1BQLL 5AVQB 3VXMD 1D9KA 1WYJA 3CV5A 3IJSA 1QSEE 1RJZB 1M2OA 2R9HD 3TZVA 2VZ3A 2VWEE 1NZRA 2CHWA 1SYSB 2PXYD 2BNQA 2NY3C 4K7PL 5AW3B 5IBLC 4ZYKA 5KG9B 5BRZA 3SKMB 3UG5A 1A1MA 4K9EL 2EDXA 1CGXA 4FQIH 1BAFH 5D6DA 1NCCL 1PJWA 1MEXH 1GJUA 3CBRA 2EYSB 3BKML 3MNWA 1BFOB 4OJCA 2FB4L 4CVZB 5DQ9B 2TAAA 4HUWA 1BP3B 4PJAA 3ABLB 4IRSB 1R4XA 1ZDQA 1RLWA 2ZPKH 1NGXA 5IQ9B 4G8AC 1B4LA 2WWMD 1SM3L 3NSFA 2FCBA 3KPRD 3V4VH 1J8HE 4JJHA 1TJHL 1JTPA 3DXAB 2P52A 1QBBA 1ZVNA 5C08D 4IOIB 4PV8B 5MI0C 1XT5A 1WWBX 3IU4L 1CDYA 3L4XA 3ORJA 1COBA 4N1EA 2Y2WA 4I9WD 1AQDB 3IAPA 3WXWH 5I0YA 2J2ZB 3MRKA 2X4PA 5CWSA 1V05A 5B1JA 1JGLL 1N18A 2Y1YA 3ILQC 2WVUA 4URTB 3SQBB 3QWNA 1II4E 2B16A 4IS6B 3B34A 3SDCA 4I4WA 2ZJSH 4IMLB 3VFPA 5JIPA 2OX5A 5TE6L 3MNVB 2P48B 8FABA 5CILL 2WNXA 3C5ZD 3QCUH 4KVCL 5F7WC 2CAKA 1N5AB 3HNSH 1ZGLB 4UNIA 2CPUA 2ZCKH 3KBEA 1QFWH 2A0LD 4Y1AE 5EU5A 2CKBH 4FADA 4G7VH 1PQZA 3LPFA 3BGMA 3D69A 1P1ZB 5AZEL 2QQKH 3FT0A 3RWJB 4GT0A 1TNNA 4X4YA 3BE1H 4FLRA 3UYRL 1KULA 4JB9L 5DRWA 4HC1A 5IROD 1NGZB 1OGTB 3IJHB 3BFWA 1QOKA 2E7CA 3T8VA 4AKQA 2DPKA 5B3JE 1MRDH 2MCPL 2UY7B 1J12A 5EBLA 1MNNA 3OPZL 3I6GA 1YJDC 4H25A 1MVYA 1EEYB 4KGLA 4NUGH 1Z9OA 2H2PC 5DZJA 3KPSE 3H1ZA 4UQAA 5E6YA 1HILA 4UQDA 3O6LH 3CFJB 4L37B 1CD8A 2BRRL 4Y16D 3W38A 3FB7A 2B08A 2OXHB 1UFGA 3IB4A 4OQTA 4NWUH 4B7IA 2EZ0C 5GHWL 3WTTA 5CJQL 3FFCE 1J5OH 5G5DA 3FSZA 3JUYA 4P2QB 4BH8A 3KLHD 3VXMA 1PFOA 5CZRA 2BVOA 3TVMC 5GZOD 3MKGA 4Y19E 2PXYA 3UJTH 4F37K 4YHNB 3R06A 5D1XC 1BBDH 3GC3A 1CTNA 3IFNL 3A67L 3FQYA 3B6SB 5J5EA 2CO7A 4XNYH 3EJTA 2AABL 2R1WA 3HZYB 1ZLSH 2IWKA 3CCHA 3DRQB 2C7UA 1UXLA 2RIKA 4Q2ZB 2XIIA 4OT1H 1ILSA 4G8IA 4YSAA 1M9SA 3UPRA 2QMJA 3F65A 1DBML 3GHBH 3SYOA 4UT7L 2F5AL 4P3CL 1OIOA 4KVPA 1CO1A 5A2KH 2O5XL 3HHMA 4AX3A 3QXUA 4J8QA 3M6DA 2VL5B 2QDWA 4UAOB 5FM8A 2ZKHH 5F8QC 3DTDA 4DGVH 1R5VA 3PJSA 3FBKA 2X0WA 2NSMA 3MA7A 4AK2A 2BSBA 2VH5L 2HN7B 4FFYA 1TTCA 2ISDA 2VDNH 3OB0H 1HZKA 1AR1B 3NAAL 2QKIC 2PWFA 3N44F 4JFUA 2BIQA 3IJ8A 4QRPD 4