2F0CA

Structure of the receptor binding protein (orf49, bbp) from lactophage tp901-1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
147
structure length
147
Chain Sequence
b'TINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage tp901-1 ORF49 (BPP)
publication title Modular structure of the receptor binding proteins of Lactococcus lactis phages. The RBP structure of the temperate phage TP901-1.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein
total genus 26
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f0cA02
4IOSA 3DA0A 3U6XA 2X53A 2WZPA 1ZRUA 2F0CA 3EJCA 4HEPA 4HEMA 3D8MA 2BSEA 2BSDA 3HG0A
chains in the Genus database with same CATH superfamily
4LLYB 2QZ5A 2AJVH 3NRFA 4UQ3B 3ZUNC 3RIAK 5EEVA 1P1ZA 3LXBA 4NIKB 4ZTOH 4KDWA 2R1YB 4UNUA 4GRMA 4OGXH 2EXYD 2CK2A 4QRRE 4R7DB 3QEQD 2HB0A 5HXMA 1FNEB 2COQA 1I82A 3OGCA 4S1QL 4XVTL 4XMLH 2E9IA 4M43L 4XCCL 1UENA 2LTQC 4PWGA 4FNLH 1YNKL 5FK9A 2GJ6D 1L9TA 2DM7A 1A6AA 1BIHA 2NZ9C 1F2XK 2W65A 4H40A 4ONGL 3OKLA 1KLFB 4FE9A 1F3DH 3H9HA 2N7AA 2XYBA 2ZXEB 4WI5A 1XF3B 1A22B 4DGIH 3WFEH 3Q6GH 4E5XB 4X8XA 5I1JL 1X5KA 1T0NA 4QTHA 2BP8A 2ED9A 2YIHA 1HHJA 1AGEA 5TE4H 2IDCA 4BE5A 1ZLWK 1T1ZA 3S34H 2B5IB 3IWVA 4FXTA 5GZOA 4GAYA 3APMA 3DO7B 3QZMA 3UG4A 5HP5A 1SF3A 1RCYA 3TCLB 4NPKA 4XC1L 3HNTL 4UM9A 2VLJB 3B2VH 2F19H 3DYOA 4OF7A 3D4YA 1NICA 4FG6C 4K94L 5KANG 4Q74A 2ZPKH 4ZRGA 5IT2L 1QBML 1GOFA 1KELH 3ARBC 4G7VH 5CCKL 4LASH 5L7XH 4PG9A 3TZVC 5IHLB 4U6VL 5IW1B 4I0PB 1R3IL 4CVUA 2F5AH 3CLEL 5E4IA 5B39B 4GMTH 3WU1A 3VSVA 5SX4I 1NKOA 3L1OL 1KLGA 3UJTH 2Z31B 4ZX3A 1BG1A 4MD0A 2QQLL 2BVOB 3E9UA 1RLWA 3FQ1A 3IRZA 3UYRH 4ELDA 1ZTXE 5FHBH 3DOSA 1YY9C 4WUUB 2I85A 1M3IA 5I17B 2DLGA 4PJ5E 2F54A 2EZ0D 5G5DA 5D2LE 4XAWH 1G7LA 1RUQL 1F3JB 1QFWI 1WAAF 4JFSA 3WJLC 1HQ4A 5F7WC 4OFKA 1JL8A 4NO3A 1B2YA 3GSNL 5EUOB 2EUXA 2VXUH 1JGEA 3KPNA 3LZPA 1KOAA 5H37H 3CFDA 1V7NL 1IAKB 3UTTE 5CP7B 3GSVB 1XF4B 1IKOP 5HPMB 4TRPH 1NCBL 4I1NB 1BSIA 1XAKA 1ZT7A 3DUSB 3FU0A 5DGQA 5F7UA 5SX4H 3ATAA 3T8MA 5B3SB 4IK6A 2BVEA 5FOBB 1GTNA 5F93C 3NFSL 5BVPH 4D8PB 5EO9B 3MN8A 1T04B 3U9PH 3U0WH 2FWSA 4LFHD 5CD3A 1J87A 5I1KH 4GMSH 1AANA 4J1UB 4X0KB 2VMEA 1U8KB 2A6DA 3O3EB 2DAVA 2ZAIA 1CVRA 3NJHA 1WFMA 1NAML 3L4XA 3IMVA 2ATKB 3TYFA 4DKFL 3LN4A 4JPVL 4YHMH 2A0LD 1LK2A 1NBZA 5KEZA 1O6SA 2HKHL 3CFTA 1AVAA 2P47B 4OCSL 2V3DA 1QFWH 5D7LB 4DNLA 1WEJH 3LKPA 3O6FB 1EAJA 1A1MA 1N6UA 2YC1A 3DO4A 4LPUA 3MRBA 5DR5L 4M8QA 4HLZG 1KB5B 3CMGA 4HUKB 1T4KB 3AREB 3NYKA 5HYSA 4BRJA 4LEOA 3IEAA 4PS4L 4GUPB 4W9EC 3WY4A 1OAUL 2GSGB 1HOEA 2K9UA 5HHVH 4F7CA 3W1ZA 2FSDA 1I8KA 1SLUA 1AYRA 4DGYH 1Z9SA 5DUPL 3KLLA 5IWLA 3IDJB 4WEEA 4KZEH 1H15B 4OLWH 3UOAB 3FN9A 3HPJB 1WBXB 3OZ9H 2O6DA 2RH0A 4R4FH 1CICB 1XZ0B 3SOBL 2H32A 1PGRB 1VERA 2GJPA 2RCSH 4JG0H 4OZHF 3B83A 4ZUVB 4KNSA 4GXFA 4S1RL 3VFRB 5I30L 4XVOA 4P9MH 2C9PA 3JWDH 1MJ7L 5IV2A 3KHOA 5ESQA 1B4LA 1KCUH 1YEEL 3MRKA 3QZWA 1SBSH 5CUSL 1XFPA 4G5AA 1Y0LA 1BWMA 3ARBA 4FQXD 1WG3A 5FCSH 4BJLA 3TZVA 4M7ZB 4XX5A 4YDLC 2EVFA 2ESVE 4WSJA 1A9VA 1VCAA 5JORA 5MEPA 3RB5A 1MHPL 1NCCH 4G5ZL 1DQLL 1N8OE 4WO4B 1I1YB 1KTLB 2AC0A 1ACYL 4JFTA 4JN1H 1EK3A 2ZOLB 1JD9A 4YBQD 3ECBA 4OW6A 3BUDA 2C1PA 1AJ7L 1FZMB 2NT1A 2ROYA 1FFOA 1J0KA 3O3BA 1C5CL 3L5WB 4R26L 5K9JL 4YHOH 3VXMA 4AMKL 4F2MB 3RKDC 3HC0B 1MJJB 5FB8A 5T1LA 2EINB 5EZPA 2CO6B 2X0VA 1ET7A 1R3KB 2EE6A 3QSKB 3GS4A 5D7JA 1AKJB 3I02B 3NH7H 3WJLA 1CC3A 4G8EA 4LO9A 3O6LH 2WLKA 2UZYB 3HZKB 2PMZA 5AOJA 1P4LA 5F7LB 4ZFGL 3B56A 5SWZD 3AXLA 4G8IB 2NR6C 3RP1A 3VFMB 1BPVA 4JZNA 4UMGA 5J57B 3D12B 3D39E 1NUGA 4K9EH 4H25B 4W70A 5DMKB 5KYXB 2ADFH 4E42A 2I25N 4C4BA 5BQ7B 5AD0A 4E0RB 3KBPA 4JFHD 2JCWA 1H0DB 1B0IA 2HLAA 1KPRA 1NMBH 2DI8A 2XWZA 3QRGH 4OI8A 1U6AH 3HUJB 3D18B 2IGFL 4WY7L 1Q9WB 2NSQA 5E6IC 1T7ZA 3KPLA 4P2QD 3L1FA 4OZ4A 3MV8A 1A7OH 3IU3B 3TT3H 3T0WA 3QQ3B 5DWUL 4HMDA 4MMYB 1JV5B 2R29A 1HWWA 3ARYA 4YSDA 4AKPA 1UWGH 1TCRA 2WLZA 2LLGA 3U0TB 3LV3A 3IBOA 3V8OA 4XODA 5AENA 2Q3XA 3OAZK 4YSAA 3QG6B 5IJCC 4B9ZA 2F08A 5DS8A 1QFUH 3AWEA 2EACA 2C7FA 1OPOA 4L8CB 4UBDC 2VR4A 4UT6H 4M5TA 2GW5A 2NXYB 1OSZB 3BGMB 1F11A 2NW2A 5DEFB 3OB0H 4M6ML 4MQXD 4FKEA 2UWEE 2W9EH 5LN8A 3MROA 5DA4A 4DQAA 3K72A 1C1EH 4D7PA 4ZMYA 3IFNL 1KIRB 3VXSD 1IM9A 2IIJA 3RY5A 1Q1PA 2A4ZA 3O6ML 4BK4A 5JMOC 3DHUA 2JJUA 2JJSC 3PFQA 2WB1A 3HE6C 4ANUA 2CLVB 1RY7B 4HJJH 2WXOA 2HKFL 5K1NA 3FB6A 3M17B 4DQOH 3GUTB 3MLVL 3TEZA 4D9LL 2GT9A 4W9LC 3VGHA 3VSTA 4PW3A 3IDMB 5E7BA 5H35B 1EO8H 3F64A 3AUVA 2GABA 1TEGA 2F58L 2IMMA 4N2MA 3V79C 1SYSB 2V5MA 1NGPH 3LZRA 4FZ8H 1FN4B 3MOBL 3OJDA 4OAWB 4Y1TA 1UD8A 4I4WB 4IEFA 4Z0XB 2IOIA 1ZXQA 4QHKI 4ODUA 1HQRA 4L8SC 3SCMC 4JFEE 5DVOA 4XPGL 4RNRB 5HGDB 1MCLA 3VQ1C 3SD2A 1TYRA 3V6OA 4MD5A 4W1TA 1KB9J 4E9LA 2DD8H 3QI9D 3MODH 5KYWA 1UWXH 1K3IA 3V0DA 1USQA 3AQZA 3PXJA 2YRZA 3LKOB 2MPAH 2MQCA 4GAGL 3CK0L 3FRPB 4PJ9C 4S1DC 5E6ZA 5I0VA 5E08H 1NDMB 4A04A 3RHWF 1OARL 4IHBA 2JJTC 1DE4A 3K8MA 5D1ZB 2NR6A 2VJ0A 3T4YB 4L18A 1QMUA 2EDNA 3H9SA 4DZBB 1OZTG 3TO2A 2NX5B 4FQIL 4X6EA 1SEBB 5IW3A 3DXAD 5CCGE 3AM8C 3KGSA 2YUWA 4Y9CA 4ORZC 5TQ2L 3ECQA 5E9NA 3FAWA 4PV9A 4ZX4A 4PJFE 5HGBA 1JIBA 3F05A 3WMPA 4R7XA 4TVUA 4UZUA 2VC2L 1QG3A 3LPOA 1AKPA 1Z0NA 3L9YA 1G9MH 1I53A 4EAEA 3LVEA 3O8XB 3QFDA 2JE8A 3K74B 2XCMC 3APFA 1KBBA 2QSQA 4GXUN 5MI0B 4EI0A 5HYSG 2YD3A 3QQXA 3ARDD 4K07A 1KYAA 3MREB 4UV7H 4M5YL 3RA7L 1E5AA 4YHIB 4GS7B 1QRNA 4JKPL 5DRNA 4AITA 2DRUA 4W9ZA 2NW3B 2X4NA 1IGCL 2BDNH 2QVKA 4JFPA 3WS3B 3PGDA 1EEUA 2XWEA 3T3PB 2YPKA 1CWVA 3INUH 3GBEA 2JKLA 4QNPF 3O4LA 5FUCC 3QORC 4UU9B 5A6MA 1YLBB 1PX8A 3PJSB 4N90D 1HKLL 3V52H 3SZ6A 3QZWG 4YIQA 5FO8B 1JUFA 5HJBA 4Q14A 2XZAL 3DOHA 4FTVB 3WFHB 3O9WC 3DARA 3MRFB 4I48B 1JNNH 3QIUA 4LP4A 1L7TH 3V4PB 5BPPA 3KLAB 5EU6A 2K1MA 3HE6A 4HLJA 3LZOA 3EO1B 4XNQA 1BV8A 4RISL 1QRKA 4G8GE 3U46A 1RZJC 2VSCA 5FUZH 5GGSB 3GMQA 4PLKD 4DCQB 2MEJB 4HUXB 5GRVK 2ZUTA 3JWNC 1HYRC 2VITA 3QCVL 4JGJA 3WBDA 2JKTM 4P2AA 2PUQT 1NIEA 2BVUA 2LW3A 4N2LA 2UY6B 2XV0A 3VAEA 1A0QH 1KB5H 1XR8B 2PYEA 2A2QT 3S5YA 2FJHB 3L5XL 5DD6A 2BP3A 1YEGL 3C75A 1CL7I 3PWNB 4JDEA 3TVMA 3WIIH 2Z35B 5IJVB 4UDTB 4L8SA 1DLFL 4JK0D 2V3EA 2VLKB 3IDYC 3QQ9D 5E8OA 5DHMC 3WS6C 1FL6A 2ZYRA 3SBQA 3GDCA 3OG4B 2B14A 3EJQA 2E7LA 5HGAA 1BZ9A 4XCEA 1XGQB 5EU5B 5KG9A 3ULSA 2CKBH 3SPIA 1T66D 1K5NB 2OQJB 2VDLB 4YQXH 4ZUUA 4PJ9A 1UWYA 3CQQA 1BBDH 1JDAA 1U21A 3HG1E 4YJZL 1ONQA 4K8RC 4L4VA 3LKRB 4MGXA 2OX5B 4KJYB 4HT1H 4ATTA 3ZTDC 3BUIA 3JV6B 2CHXA 4YHPA 4LCWA 1SMDA 3DUHA 1KFAH 4DGUA 4PJBE 3KPQA 3N85H 4NKMB 3S7GA 4R0LA 5ANMB 2G5BA 1SFDA 3SDXF 4BZ2H 3BN9C 1OTUC 3WXVL 1VZGA 2WNKA 4YAQA 4P4RA 2YEZA 1C8QA 2BSRA 4AYGA 1AQMA 2D4DA 4KK6C 5FOJA 1CL7H 3OR6A 5D70L 3PP3H 5EDXA 4DZ8B 4AGQA 3SPHA 4URKA 1UFUA 1II4E 5D1QA 4Y8AA 1SXZA 2WN2A 1XGRB 4NC1E 2C4FU 1V7MH 1JE6A 4GB9A 4PRPE 2AJXH 3CSYB 1W8OA 4LCIL 4PTUA 4Y16D 1TQSA 2N56A 1WA1X 3N44B 3UGXA 1WHOA 5IIEA 5KYYA 2W88A 3PY9A 4Q4IA 3S3BB 4BV1A 1OKEA 3C60A 5CN2A 1G7PA 1U91A 2WKGA 1S5IL 3PGFH 4MA1B 2RHEA 3T6XA 3BVDB 3VD7A 3A23A 3NSXA 4QY8B 1TU2B 3Q8EA 2YBGA 4UTBA 3D9AL 4RA3A 1I7ZA 1JGVL 1RPQA 3GJFA 4OM0H 3GBNL 3MXWH 4MJIB 5K9KA 2VLRD 5KSBA 2Z3FA 1LQSR 4P2OB 2B1HL 4B9IA 1Q0XL 3QORA 5E6RB 4RWYL 5HJDA 2V2WA 2OZNA 2CIKB 2VZVA 4RMVA 4C47A 4N8PA 1B4JH 1ZPLA 5AVUB 4DPRA 3WEOA 1VEOA 1OXYA 4JFDB 1HINH 4XTRC 1FI8C 3WTYA 1A6PA 3HRZB 5FX3A 4NM4H 4ZI8A 2Z92A 4S1SH 3WNKA 2PF6A 5EA0L 3LKSA 1MLBA 1GZHA 2H2SD 3VGAB 2AEPH 3NTCH 5F1OB 5B3JF 1EFXA 3MLSH 2CM6A 5FYLL 3RWIB 5ICYA 1AI1H 4BH8B 2BNQA 4M6OH 2R0ZL 1HYSD 4AYDC 1QKZL 4H4NA 2B3RA 4L8DA 3K8KA 4RGOL 3BMWA 4OD2A 4DJMA 3VRIA 2ZCLH 2WXKA 1FFPB 4X9YA 3SBWC 4AJ0A 3KNBB 2E6QA 2AXFA 3N43F 2A6IB 3EBAA 4JCWA 4PP2B 2K6YA 4QXUH 4HUMB 3GRBA 3U7AA 4RMSA 3RGHA 1NLDL 2WKOA 3VMPA 1HL8A 1YEHH 2IO5A 4F27A 2E27L 4B96A 2Y5QA 3C8KA 3LJ3A 5D1ZI 1XEDA 4BDVB 2A6KB 5CS7A 1IM3D 4LLWA 5TPWL 1MAJA 1T0PB 1RJLA 3O0RL 3TNNA 5CKGA 2FD6H 1YN7B 2BFVL 1N10A 4JMNA 3MLZL 3UAJD 3EYFA 4EN3A 5E2WL 3QW9A 3WCYA 3QUYD 5EU3B 5IQ9A 4DUWA 2WUBH 1TPXB 4IBSA 1A02N 4ZAKA 2JIXB 3EYSL 1EDYA 2D31B 1DFBL 2PW1B 2WPGA 5T5FA 3W82A 1R6VA 4TQHA 4XVUC 3GI8L 3T6QC 4IU3A 1VFUA 2CU9A 4ZQKB 3EJPA 1AMXA 1YEDA 4AKOA 1OGAA 1D9KB 1X7QB 2F1EA 3BIKA 4N85A 1T03H 3CN3A 4U7KA 3U7YL 4LHUD 4BQ6A 4GW1B 1ZLUH 3FQWA 3UJJL 2VDRB 4XBMA 5E23A 4EZKA 4MQTB 5D1XD 5ICZA 1XCTA 2XWCA 1RIUL 2C4FT 4H8VA 5CJ8A 3FB5B 3HBZA 1CJYA 4TKWA 5DSCA 2W07A 4TULL 5DURD 3P30L 1AQKH 4MDJA 1PY9A 1T3FA 3K71A 2VLJE 2QADC 1ETB1 3BKJH 4U2ZA 4BSWB 5ADPH 2HCZX 2KQNA 1RZIA 2APFA 3RNQB 2QQNH 3HE7B 4TQIA 1X4YA 4PCYA 3S6CA 4BBWA 1K8IA 3CZNA 4D3CL 4HC1L 1FCCA 3QNFA 4JRYB 4JFFB 3IMWA 3ZTNL 4DAGH 1RK0A 1EHLL 1YPZF 1QLRA 2DWTA 3FUJA 3E2HC 4Z8FL 3HEIB 2F53D 2VW7A 5EC1A 4H20H 5ID1B 5J6GA 3IM1A 3M46A 2VDOL 3BUTA 5LO7A 2B7DT 3WGVB 2VR5A 4NKDB 4WUUE 4G9FE 1S7VA 2CRIA 4P5TB 1LP9A 1JTOA 3QEGH 4NB7A 4UQDA 2JVUA 5AUMA 3VH8A 1F18A 2OJ1A 5BS0B 5JDSB 1E2ZA 3BKMH 5FO2A 3CVHA 1ACXA 1CFNA 1VADA 5H4ZA 1E40A 1OAQH 3OKNB 4QXWA 4YDVA 3ZHNA 1CU4L 1PNDA 3DJ9A 5HI5C 1MCPH 4L9LC 1JDCA 3IK2A 3NA4A 5BOPA 1KBPA 1HAUA 2FO4A 4MKTA 4Y4FD 1EZSA 2FE0A 4Y5VC 5C6PB 1D7BA 1LVEA 3JVFC 5D7KD 4YXHH 1VKXB 1KTKE 1KBVA 1ES0A 1ZT1B 3OX8B 3X12B 1MAML 2FDBP 3LVTA 3MJ7A 2O61B 3BIBX 4LKXA 5EZJB 5HHQB 2CBOA 5IP4A 3KW8A 4C56A 5MERB 2IPUK 3SBWA 2QVFB 3S35X 3VFGH 3FB8A 1JPFA 2Z34A 4UTAL 2F18A 3R1GL 3UMNA 3V4PH 3V6ZA 2CQVA 35C8H 5JW5A 4LMQE 1ZXKA 4ZS7L 4GKOA 2CDGA 2EXTA 2RMNA 4QHNB 3M1BB 1JZ7A 1WPCA 5C0FA 1JN6A 1PZBA 5A43C 4P23C 4RSYA 4YSOA 5DFVD 4KY2A 4I87A 1WZMA 4L3AA 3IAQA 4K7PL 4AM0A 1SDYA 3QBTB 3CC5B 1CFQB 1X44A 2GKIA 3ARGB 4HF5L 4M61B 4MAYC 4PJGA 4LF3A 1JRHI 3VUAA 2PO6C 1CLCA 2Z91B 2H47C 2X1XR 3V9CA 1KJ2B 4NN5C 5D7LE 3UBGA 4GXVL 5E5UB 1QVOA 1IT9H 5I1AA 4MHHI 2X6BA 5DJAB 3U48A 1KBGH 1FF5A 1JG9A 4G6MH 1CDUA 3B7UX 5JA8B 5DD1L 5AVRB 2QL1A 4MBRA 2JCCA 1F90L 2XPYA 1D3CA 3N42F 2DYPB 5ESAB 2XN9B 4PJCA 2BNRA 4HJIA 2M26A 3U79A 4H0HB 3LEVH 5ES4B 4U1SB 3ARTA 3Q1SL 4YWGH 2XVKA 1FL5A 4JQIA 4FEIA 1QSFA 3D0LA 3P0YL 2EEDA 1WFTA 1RHHA 4G7RB 4PGCA 1P5VA 1X6LA 1V3JA 4HIEA 1F6FB 3CZGA 2X4OA 3SO3C 4LAQH 2BVYA 3KS0H 1OK8A 1JRHH 4JMXA 3I6LE 4AUYA 3DA0A 2GJ6B 3RAJH 1A2YB 2VXQH 3K5SA 4JDTL 2EYSB 1MQKL 2ZUVA 1PZ2A 5KVEH 3ESVF 5C2BL 3LRLA 1TO4A 3IGAB 3APNA 3JWNG 4JZJA 1NSNL 3NCWA 3QP3A 3GSWB 3OWRA 1T7WA 1XO8A 3UTPE 1DJZA 2WTPA 1MNNA 1FFTB 2X2UA 1E27B 3GI9L 3QPXH 5EBWA 3A0OA 3OC8A 1RZ8A 3ZKMD 3EHBB 4F2ME 4YEFA 3SKMB 3ZHFA 2NXZC 5JOPD 3WDIA 2XT1B 3SN6N 3UG3A 4MX7B 5T5NF 4TYUA 4N0FA 1NOAA 3JVGA 5KBMA 2X42A 4FFZH 3SE9H 3CDGA 4B0MB 2YA0A 1W72A 1MW1A 2B9AA 5DHYB 5AVZB 2BVQB 1I1AD 4CSTA 3GZPA 4QYOB 3OAUL 4MQSB 1G4RA 3PXLA 5FHAH 5D4QA 2JQZA 4QRRA 5CGYD 3RY6C 4XRCA 5AWNH 2VUOA 3D6GA 2YEQA 4FNQA 3UZVB 2X6CA 2N4IA 1OAJA 3P40A 2Q9OA 3V6BR 4YHYB 3FZUC 1G7JA 4EIUA 2DQEL 1MCKA 1VFAB 1SHSA 3BSZH 3KLKA 3HUJE 5J3HC 5E1QA 3MZTA 4KK9C 1BP3B 1XIWB 3V6FB 5GGVY 4APQC 1BMZA 5J11C 1UM4H 3RVWD 3TH3T 5F7NC 4WHCA 2B08A 4JG9A 2LV4A 4LBEB 5LUMA 5DQDL 4MAYA 5BV7C 1O7VA 3C5JA 3TJEL 1IC4H 3HAEH 1YNTB 3C6SA 1AXSA 1XX9C 1E5UI 1T5WB 4M3HA 2LAAA 1XGPA 3QEHB 1X5GA 1FQ9C 4FMVA 3LNHA 5T5NG 5HYQA 4OGYL 2OL3H 5DLML 5INCB 1KMGA 1DVFC 1IUZA 3FRUB 1T7VA 4HX1B 5ANHA 1DUZB 3GFUA 4G6JL 1S6NA 1A47A 1J86A 4U1HB 4Y2DC 4CC0A 4HW6A 4NQDD 1WFUA 5I5JA 4ABUA 5FECA 1M4KA 2Y07L 3P02A 5G4OA 3KR3H 3SDAD 3TC9A 1CGYA 5B8CA 5IESH 4GO9A 43C9B 4DVBA 3N40P 1LDPL 1XF5A 2WYIA 2FIKA 3QYMA 1HNGA 5DJYB 4PP1C 4EVNA 3K6DA 4ONHA 3QULB 4R3SB 3ZDYF 4DP6X 3LRSA 2AJ3A 3VFVB 2WAHA 1ML0A 1MRDH 2ZG2A 1S3RA 3CFIC 4PJGF 2CGRL 3BPNB 4PJ5A 3R8BB 1DQQA 5L4MA 5GIRB 5HI3C 1RIHH 5D2LA 3FTUA 4KROC 5BO1H 2HRLA 1QEWA 3VH8G 2P5WD 5LGKA 3WN5B 3DVNB 5J1AB 2ZJSH 1JCVA 3V0EA 2YPVH 2P24B 4GKZB 4IRZA 1I85C 2YD0A 4XMXA 2JCCF 2J8UF 2VDRH 2PR4H 3HVDA 3UTTA 4LOUD 5I76A 1A6VL 4F1ZA 3P9LB 4TQEH 2DQGH 2VRAA 3SKOA 2IWFA 3HNVL 2A6JA 3X2QB 1JVOA 3GLDA 3I9GH 3FTXA 1E4WL 2E9GA 1AFVH 5DVPA 3NK4A 4XWGH 4BKSC 4JG1L 4JBSA 5F89A 1ASPA 1BQHB 1DBJL 3FTWA 2P8MB 1OAZH 2YAFA 4KWUA 1PCXA 4A63A 4XH2B 2ADGA 4X4ZA 1EZLA 1JGDA 5GGRB 3UYPA 3FO0H 2VAJA 1UCBL 4KAQH 4X7CC 5E5LA 5GS0L 3N2JA 3VXQB 2JKNA 1QTPA 2UZXA 2EYRB 2R0LL 3IJ9A 2NT0A 3RL1B 2NX5E 1LJMA 1OTTC 2VW6A 3QJQB 2PWFA 1FL3A 4NNYA 5GSVB 4GG6B 2V2TA 3ZZLA 1IBFA 1EMTL 1JCKA 2CLZA 3H0TB 1DQDH 3L7EA 3W9DB 3ZO9A 4UTCA 2EE3A 4YXKL 2IH3A 2DJUA 4WU7B 2I9TB 5GGTH 5C0BD 4JY5H 1XZWA 4HKZA 5DK3A 5KVMC 1YNLH 4F20A 3LS4H 3HMWL 4M9OA 3E8UH 4HG4K 1DQJA 3R06A 4GRLD 2R2HA 2HFEB 3FU5A 1SDDB 2OMTB 3SPGA 4F58L 1HI6B 3EG9A 2NSMA 4WI3A 4X2UA 2Q3AA 4UM9D 2H45A 5AAMC 8PAZA 3IMTA 3CFCH 1DQKA 1ZV5A 4MMZC 4PGEB 3CU1A 4RSVA 4S11A 3MLWL 2R23A 5SWZB 4CMHB 5LGJA 2XFXB 2VR6A 3T3PE 3WV0A 1UA6H 1DLHB 1E9PB 3KWVA 2ATAA 4QXTA 3RPIB 2RFXB 3HTLX 3L3OC 3GSQA 4Y2DA 2OXHA 3DI2B 5E8NB 1HHGA 1MDAA 3EOYG 4JY6B 3EYQC 5CEZE 1UGNA 1W8NA 5MEOB 2ESVA 4FTVE 1G9EA 3GSOB 2XZQL 1PBYA 2P3YA 1SXCA 2OZ4L 3GGWB 4XBPA 1IGFL 4LSDA 1ILSA 5I1HL 5CJOH 4XGZB 5DC2A 5E0FA 2FEDD 4HWBL 1D5IL 1MFBH 4JO3L 5FYLD 4KXCA 2NY4C 2YAQA 3D05A 3OBAA 3T6WA 4YDNA 1NGWB 2F54D 2ICES 5SX5H 4F57L 4Z3JA 2DH2A 1MELA 1GKEA 3BISA 4GW5A 2Q3ZA 5ENWA 2MCG1 3VA2C 1BAGA 2G75B 3SGKC 1KYDA 1WRFA 3VWJD 4WTXA 1DP0A 5IKCA 2EICA 3LXAA 1WBYB 3MYZA 5AW3B 4LSQL 1RZJL 4O51A 2C9XA 1XGZA 2P8LB 4MWFA 1NGXA 1MFAL 1VFOA 1I85A 2AP2A 1KXTA 1JYNA 1EXGA 1LD9B 3D39A 2VLKE 3MO1B 5E7FA 5E1AB 3TBYB 4XN5A 2J57A 1ZLEA 2ZOUA 1WISA 4DH2A 1OP3K 2HT2D 4H26B 2XX0A 3VXSB 3CH1B 4AJYV 3JWOL 1N7MH 1AIFA 2WQAA 1QSED 5D8JH 3VSUA 4RIRA 1OV8A 4HS8H 4FQ2H 1LGVA 4HA1A 5BVJA 4PIBA 4CRPA 4N6RB 3V4VA 5IG7A 4FCHA 1LEIA 1TEFA 1U58A 3D87B 3L3HB 1DYZA 1CE1H 3NQKA 1OEZW 3QQ4B 3RWDB 1ZVNA 3G6JF 3T0EC 3RIFF 2X4RB 5JHMA 5D2LF 3B4NA 2MHAB 2NZ9D 3IFLH 1RZQA 3PHAA 5ANME 1A7PL 4TNFA 2AKRB 4P9HH 4R90H 1SJXA 4K8RL 2CZNA 3CNKA 1I4FA 1IGJB 2ERJB 5AB2A 3OXSA 4WWPA 4FD0A 4IMKA 3DMMA 3VXNA 2EDYA 3FPYA 2UWEA 1AZZC 4NUJB 3F12B 4G9DB 3A6BL 3QI9B 1KCVL 3IGUA 1JF1A 2YAEA 5CU5A 5KN5A 2XBDA 3CVBA 1JGUL 1DQVA 1WYJA 1LEGA 2R2EB 4MZ2A 4AQ1A 1FYTB 3S88L 9CGTA 1LWJA 2EEAA 4HXAL 1B0RA 4RFNC 5C6WH 5AAMA 4S0HA 3BPOC 5AYUH 5HVWA 3A67L 2HTLD 3L4WA 5GJTL 4IMLB 2AV7B 1XH1A 2RIKA 3MYJA 2IOOA 4QHMA 4TF4A 5HVGB 3MA9H 2DMHA 5DEZA 4MJIE 5F96H 3FQNA 2HJKA 5E1IA 3ARBD 4PRAB 1Q9KB 1QZ1A 3DTUB 4IHOB 3VE0A 5BZDB 4OV5B 1JXFA 3L3OA 1OOWA 4XPHL 3IDIB 3VTAA 1KZQA 2X12A 1QHPA 3DXAB 5A6LA 2V8LA 2HVJB 3NJGA 1WT5C 4UOZA 4N24A 1M7XA 2VDKL 3CGTA 3P11H 3ZDZB 1W0WA 5KS9B 4JFDE 1HCZA 2KT6A 1HNFA 4NO2A 3W39A 1S8DA 2WBJB 3GM0A 1AD0B 1IARB 1YY9D 2LU3A 2V7NA 3QIWB 4HUWA 4JFEA 1O7DC 3UCRA 5CINH 4FG2A 4YSRA 4K5LA 1U8QA 1NMCC 3LRMA 4GSDH 5KVGL 1DQMH 2R9HC 3TX4A 2W0LA 3AROA 1EEYB 4IOIA 2EKJA 3NJXA 4R5VA 1HE7A 2FB4H 3V5HB 5C0IA 2ZP9A 2W1NA 4R4BB 1WO2A 2Q86B 2DQFB 2BOLA 3FT2A 5KJ7E 2ID5A 2W0FB 1QZNA 2Q7NA 3GDBA 3HOGA 3JWDC 2IAAC 3GHBL 4Q6KA 4YXLH 4V2BA 1TTRA 1PDKA 4R96B 1J1PL 2ZAGA 4YR6A 4BK5C 4ZW3A 1T5XB 3DX8A 4TVPL 2Q5BA 4I3SL 1K4DB 2I07B 4U1MA 2O5YH 3ZKNC 3ATBA 1QR4A 3HC2A 2R1WB 4PJFA 3BP4B 2PPAA 2OYKA 3MV8D 4NSKA 3FL7A 5FXCH 3TEWA 4XCYB 2Q7YB 3LKNB 1PZDA 1TLKA 4ZNCD 2CO2A 5I24A 1C5DA 3S4SB 1MFCL 5I0ZA 4X4YB 1BQKA 4B7IA 2DTML 1FUNA 3IGKA 3KPMA 4JR9L 1X9LA 2D8KA 3LSOA 1E2VA 4BYHA 4F7EA 3VD9A 5IMKB 4I89A 3LY6A 3ZTCC 4WTWA 4B3VA 5DEGB 1KN4L 5JPNB 2Q20A 4JVUA 3SQBA 5HYEA 5JQ6H 3QIBC 1MWOA 1AP2A 4P3CH 1E8XA 3F2LA 1XH2A 3Q3GB 1ZLWH 4UQIM 3X3GH 5H37A 2KL6A 1ZAGA 1P7QD 2VM3A 3KJ6L 1CDCA 5F7DB 3IWUA 4KQ3H 5HHNA 4K9EC 5I66B 3BKYH 1NGYA 1UG9A 1F58L 2P46B 4A68A 2HG0A 1L7IH 1VZIA 4HAGA 1RJYA 4AT6B 2CHZA 3MRRA 5IHHA 2WVSA 1B2WH 1HZHL 1A3RL 4G6AC 4HBCH 3P9MB 2Q2LA 5FYKE 4G1MA 1WWWX 3FQ4A 1MH5B 1TITA 5C8JB 2YXMA 3WNIA 3EFOB 1UB6A 3JTTB 1KEMH 3HMXH 1QFHA 3GO1H 4NM8L 4POZC 5SWQA 3L5HA 2UY7A 4G8GA 5DS1A 1CGUA 5CP3A 1NMAH 4ZW6A 4JRYE 2WXMA 2ARJA 3FXIC 1SJHA 2BSCA 4M3JA 1MHEB 3EDEA 3D33A 1S5HB 1UT2A 5BXFA 1QW8A 5AW9B 1WT5A 3RTQC 1N3NB 2P26A 4M1GH 5F1NA 2R4RH 1AOZA 1I1FA 3PP4H 4TNVK 1FIGH 3S5LA 5GSRB 2C9SA 4RFOL 5H2BB 3T2LA 4F15B 1TMQA 4XNMB 5D6CB 1A7BA 4AWJC 3CXDH 1W0YT 1D2OA 1GW6A 1S7WA 2JLPA 4NEHB 3L9EA 5F0JB 1DL7L 3VNZA 3RKDD 3FQTB 2VO5A 2YBRA 4K3EH 1SGKA 2XNAB 5BS0E 2P80A 2I7SA 3EW3B 3KLDA 1MDTA 3GZOA 2YRBA 4P5RA 3TWCH 5EV7A 2F7OA 2FHFA 3QG7H 1TJGL 2SODB 1A4KB 4GNKB 5KWYC 5HDBB 3LZQA 4R4NC 2GJRA 4APXB 4N8CH 2OW7A 4X5WB 3HG1A 4HCRL 1EH9A 4GAFB 2BNUA 2JK5A 1DUYB 1T89A 3D69A 1FHNA 2VLRB 1QLEL 3NZHL 4RCAA 3T2NH 4J8QA 1RJZA 2Z93A 1YEIL 4ZD3L 3VFUB 4X6CB 2X5PA 3FQXB 3OKOA 4PJBA 5L0QB 3D4ZA 3QJHA 4BK5A 5IFHH 3DRTA 3QUGA 3C6LB 4MDIA 3TA4D 3VFPB 4DK5A 2LHAA 1AGBB 3C6EA 1SVCP 4OT1H 1FNGB 5E6ID 4H5SA 5IB2B 3DNKA 4Z6AT 3QH3A 1F56A 4J6IA 2WLIB 2KLSA 1ZMYA 2Q76B 5BRZD 5AAWC 5IOPB 3N06B 3ZO0A 4U6YA 4EKXA 4FZEL 4PRPA 3ZHKA 3PRZA 2B5IC 4JM4L 4U1NA 1RUML 2IC2A 3QHZL 2ZCKH 1ZS2A 3QWOB 4DKDC 4CVWA 4UBDD 4TOYH 1QP1A 1U8IA 3ZE2F 5IR1B 2O6PA 4K5NA 2K8QA 2E9BA 2V5RA 1DBBL 5LXGL 2OK0L 2IBBA 4LCYA 4XCNB 4XP9H 1UCTA 3QIBA 3MAWA 3PUCA 2FR4B 1E4KC 3EFFB 1HXKA 3A21A 5CJQH 1C08B 4HG4J 2HX8A 2XN9E 5LAXB 1KN2H 4MKMA 5JXAL 4U33A 1OQOA 4BFKA 1G87A 3B37A 4XN8A 5E9DD 4I0PC 4LHQB 1HZLA 5KUKA 1NAMB 3DPBA 1IFHH 3RDTC 3GIVA 3INOA 5EU4A 1LL1A 4PJFF 1RH8A 3GTTA 3ZE0B 3EOAB 4PLOB 1E90A 2AABH 1IILE 5EU6D 4UT9H 3L7FA 4ODWB 4HULB 4AIEA 1IM3B 1UZ6E 2QKIB 2YOAA 3DX3A 4LCUB 2WVUA 5J7CC 3E0GA 1G9MC 2GTWA 3QZLA 1MHHB 1K9TA 2GJ6E 3QUYB 1J48A 4HALA 1S9VA 3MJ9A 4XNYL 3SYQA 2OSLB 4OCLC 5D7SL 1F4WL 3SYAA 1CD9B 3ERXA 4TTDD 3P4MA 2Y0SA 4O02H 4QGTA 1ADWA 1BJ8A 4MCMA 1PLBA 3TIEA 3EO9H 3LZLA 4FKHA 3NSCA 4Y5YB 1MEXL 3K0YA 3NJFA 4W4OC 4WWKC 2FLRT 3SCMD 4AYSA 1IGML 2G9KA 3HB3B 1G5AA 3CIAA 1UZGA 4P59L 5LCVL 1CZ8L 4MAZA 3ZTEA 1JK8A 4ZDHA 3KH3A 5D1XB 5HGHB 5FM5O 5T1KD 4LCVA 5GS0D 3EO0B 1PAMA 1X4ZA 1L9NA 1PEWA 4L8BA 4NJ9H 2R8SH 4YX2H 1T6WA 3RVUC 2QTVA 5I1CL 2F5BL 4GI8A 4LLYA 2G9HB 2OMUB 3TCXA 2XQYA 4S1DD 3HI5H 4MJ2A 4UQ3A 3S0PA 3MLTB 1Q90A 2VM4A 4P2YA 5CD5D 2C5DC 4TSCH 2FGZA 2R1YA 2BHYA 5HDWA 4MZ3A 1LWRA 1FNEA 3AWFA 4LCWD 3W0WD 3V2AR 3EUDA 1BFVL 3NP3A 2FX9L 4M5SA 5DO2C 5DK2B 3M8OL 7FABH 2ZCHL 1W91A 2BVPB 3NEXA 3N04A 2VN7A 4KH9A 2F53B 2E7HA 3CDFA 3O6FC 1J5HA 4DSYA 1XF3A 4KY1H 2H0FA 3HIZA 2PYFB 3KPSD 4E5XA 4AIZB 4WTZA 2C3WA 4A1RA 3ARXA 4K7PX 1Z5YD 5F9JA 2DW5A 5BZWB 3OAZH 1MI5D 4ZMTA 1MCBA 1BZ7B 1J5OH 4AUJA 4ERSL 1PZ5B 2WMPB 1QLFB 3SKUD 3DO7A 2DI7A 1U8LA 2J21A 3LS5H 5H37G 4K3JH 3T9WA 2FBOJ 2H6PB 4O58L 1CICC 4K23H 3GKWL 1WP6A 3MGTB 4BEIA 5IF0B 2LU7A 5DUMH 2VLJA 4Y4FB 3T65B 1F4YH 1GPOL 2IH1B 2YQ2A 3OF6D 3V5DB 5CLTA 2AXJA 1BAFL 4NO0B 1CF8H 4LSUH 5AOLA 4N2KA 2N7SA 3DGCR 1T2QH 4PJBF 2N0MA 2UZIH 5IBTH 2FX7L 3RPKA 4M7ZC 1SNRA 2NY5H 5IW1A 4I0PA 5B39A 3FU3A 4LGSB 3O9WD 3ZK0A 2BJMH 3O11B 5ADOL 2Z31A 1JV2A 4OCWL 2E5EA 2BVOA 4OFQA 5AEAA 5FW6A 1NUDA 1YUHB 15C8H 4WUUA 4XBGB 5AAPA 4G9FA 4MMXC 5SWSB 3S5LG 5I17A 1NC2D 4BE6A 3M7OA 2VDNL 2CBPA 1NFDF 1ERNA 1MCHA 1NBVH 2PCPB 1I3UA 1N0XH 3S35H 3U9UB 1F3JA 2APWA 4MTMA 4PWIA 2JELL 4UIKH 2AJUL 5IM7B 5AB1A 3A4EA 3LQZB 3TA3C 1IAKA 3MZGB 3RX8A 4QJ4B 5CP7A 1EJFA 1XF4A 2TRYA 2E6PA 2Z1PA 3GSVA 4YBLB 5DRXB 5FYJU 4W6YB 3O81A 5HPMA 5GS3A 4L5FH 3R0MA 4OKVB 4KBPA 2OA9A 2Y1YA 1XXDC 3DUSA 4DGVL 5HD8C 3DWTA 5E99L 1SBBA 5FOBA 5BNXD 2I24N 3WXWH 4D8PA 1DSFL 5EO9A 1T04A 2YD2A 2Y7NA 2QTEA 2BSEA 4K8RD 4J1UA 4X0KA 2EO1A 5AW6B 5FKAB 1U8KA 5TDNB 1TQUA 2DQIH 2EH8H 3PXHA 3BCDA 4NFCA 2YR3A 2VL4A 2ATKA 2FWLB 5TE6L 4J2XA 2G3ZA 4CA4A 4GG6E 2EDXA 5KVDH 3BN9D 5D7IB 4MCYB 4HUVB 3W5MA 4TUJB 1ITBB 5D7LA 1I3GL 4QRAA 3FF8A 1YQVL 4M62H 1WC7B 3O6FA 5JXED 4J3VA 1OGAD 3H4HA 3PPEA 2VXSH 2NXYC 1KB5A 1T4KA 3AREA 1UKSA 3US9A 4GUPA 2GSGA 4JFXB 2IH9A 4ESKA 2ZXDA 2A38A 1ZGLB 2XTLA 4N2HA 3IDJA 1H15A 4EDXB 2H6OA 3HPJA 1WBXA 1CICA 1XZ0A 3AW5A 1I1AB 4ZUVA 4G80B 1Q9LB 4NAMA 1AG6A 4ONFL 5SWZE 3VFRA 2WGXA 1F4AA 3MBEA 2WLLA 3NSJA 3TEYA 1SF5A 1WD8A 2CNYA 1KBWA 4OCMC 5LWYH 1SYVB 2VC2B 3GSRB 3VYOA 2IWGA 4B6ZA 3GINA 4JFHE 2EYTB 2AJVL 1C12B 3FTVA 3NESA 4YFLI 4ZTOL 3C2AH 5JZ7D 1EHKB 2NUPA 4WO4A 1I1YA 2XXMB 1KTLA 3DDFA 2ZOTA 4OGXL 4F37K 2BM3A 2ZOLA 1JZFA 1RU9H 3N55A 3T09A 1NJ9B 3AMKA 4XMLL 2WWMC 2XY1A 4NBXB 5ITBH 1FZMA 4FNLL 1R0AH 1YMHB 2W94A 3WMQA 3L5WA 3X11B 3DGGB 4F2MA 2FVNA 3HC0A 1MJJA 3ES6A 1OGPA 5F9OH 4C57C 5ABZA 2CO6A 3QARA 5TH2B 1DBMH 1R3KA 2E86A 1G6VK 4DGIL 1AKJA 3I02A 3WFEL 4XXWA 1B0WA 2J88H 4BCXA 2BW4A 1G1YA 4TVPD 3TU6A 2HSIA 2UZYA 3HZKA 5D1ZC 4G8IA 3C9NB 2XQYG 2BX5A 3VFMA 5TE4L 3H7BB 4LKCB 3H6JA 3UFIA 3HKZA 3QDGB 3VXOB 4H25A 3K2UH 3S34L 4NQDB 3BUYB 2FO1A 5DMKA 1XEUA 5KYXA 2YA2A 1NCAH 3CFBB 4E0RA 3SDAB 3VFNB 3VXSE 2ICWJ 4YNYA 2FGWH 3B2VL 4J7RA 5BRQA 5I6XB 2C9QA 4JRXD 3GEWB 1O6TA 2F19L 3HUJA 3D18A 4R9HA 5GRXG 4JPSA 1Q9WA 2UXVA 2WIIB 2A9MH 5HYJD 2ZPKL 1KGUA 4LPYA 1Q72H 3O8XC 1KELL 1MCWM 4G7VL 2V37A 3IXAB 3MJ8B 4LASL 5AKVA 4Q9QH 1EVUA 4QLRA 5EEZA 3EDDA 1JV5A 4MMYA 4TQPA 3D4GA 2F5AL 4E5XG 4GMTL 1CDHA 3OL2A 4WTZG 1UWEH 5ICXB 2X7LB 3U0TA 1QYGH 4XXCA 3QR2A 3UJTL 3QG6A 3QS3A 3LNDA 5IVXB 4KDTA 4GS7C 4GIOA 4YPGB 2NYYC 4OGAC 3UYRL 4L8CA 1KGCD 5FHBL 4KVNH 5B4MD 1GS6X 3GTVA 1OSZA 2A73B 3BGMA 4OVUA 4ZT1A 4AJVA 2YMOA 4WO0A 5DEFA 2X3AA 2F61A 3X1EA 1HVXA 5F44A 5KBPA 2VTFA 2VXTH 3T0BA 3WNPA 2P48B 5E6SB 3AGWA 5L88H 3BW9B 3V5KB 5DJ8B 3REWB 5CBAB 1DQIA 2ZT9C 2OTPA 1KIRA 4KHTH 1FYTE 4IBLT 3L9RB 2KZBA 4U1GC 3TBBA 2HUHA 1UADC 1FLRH 5B39G 2CLVA 2ZXBA 1HH9B 4PJIB 4AEEA 3M17A 3GUTA 4C59B 2EVHA 5CEYB 4PGJA 5JQIB 1R24B 4Y9FA 3MI6A 3UAEA 3CJJA 1HCVA 3VA6A 1IBYA 3VRJB 5H35A 1FIEA 4AIXA 4Z1PA 3DXAE 4JFOA 4JAMB 1G9NH 4GP4B 5BVPL 3U9PL 1ROCA 1WZ1H 2G4GA 3D3VD 3U0WL 1PZCA 4Q6IB 3ZDZE 5I1KL 1SYSA 4GMSL 1M57B 4ZMAT 1WUZA 1FN4A 3ATDA 5KS9E 5CR8A 4OAWA 4Z0XA 4F5CE 4I4WA 1ET5A 5C0BB 3CUPB 4YHML 5HGDA 4MXQC 4E9RA 3FUHA 5F7AA 4GRLB 4JFWA 4GP8B 4X7FC 5JYLA 1WEJL 5ALCH 4YS4A 2ADJB 1DBKH 2GBUA 4CMMB 5HI5D 3FRPA 1NDMA 5I0YA 2E6JA 2B39A 1F5WA 4WEBL 4L37B 1WA2X 5HHVL 5D1ZA 2KYIA 5K33A 4UIMB 3T4YA 4X7TB 3BXNB 4DZBA 5EEYA 3FN3A 1EIBA 2NX5A 4N90E 5AOMA 4KZEL 4PJXF 4OLWL 1DQTA 4YE4H 1T83A 1SEBA 3GXMA 2YD1A 3OZ9L 3QYCA 4R4FL 1NWOA 3L95B 2DY2A 3HG4A 2RCSL 5I1HH 1HEZB 2D4FA 1CR9H 2RALA 3NACH 4P9ML 3JWDL 1F42A 4P23D 3T2PA 3TJPA 4CADB 1KCUL 3QFGA 3H9YA 1SBSL 4OUOA 3CXFA 2XI9A 4FA8A 3LIZH 4IOFC 4CBPA 1N5AB 4JUSA 4MAYD 2A7BA 1JSYA 1HK6A 2PO6D 4ELMB 2G3MA 1BLIA 1NCCL 2PR9A 3B2XA 3O2VH 4MSWB 1ETJA 3MREA 4K55A 3IFNH 3VWJB 5PAZA 2IQ9H 4JN1L 3PE9A 1NKGA 4YHIA 1F86A 1PVHA 4MA1C 2DIAA 2G60H 1E9OB 1WITA 2NW3A 3U9WA 4FABL 3WS3A 5E1HB 4YHOL 4U1IB 3LQAH 3PAUA 5J4MA 1WICA 2ZUWA 4HD5A 1RZPA 5IK3B 4BQ8A 4D9LH 4UF7C 5AVVB 4UU9A 4NQCD 5I1DB 3SHSA 3HS8A 3PJSA 1R1CA 3DI3B 3JBG7 3NH7L 5FO8A 4FTVA 4NI3A 1QSEB 3WFHA 4R7VA 4ADGA 3MRFA 4I48A 3V4PA 2EIEA 1JPSH 2B59B 4Q8BA 3EO1A 2Z7WA 4K9EL 2GK0B 4CN6A 2ZSVB 2ADFL 2K45A 5AW8B 3UIYA 1KUMA 1KJMB 5GGSA 4DCQA 1NMBL 4LSRH 3QRGL 3PNRB 1U6AL 4YDJA 4OZFA 4E9SA 2R69A 2X53A 5C0RH 2AHIA 1XR8A 3SDDC 1D5XA 5E2TH 1A7OL 2FJHA 4OCXL 2BZDA 5IBUB 3PWNA 1CN4A 4BHUI 2Z35A 5IJVA 4UDTA 2ZF9A 1G94A 1UWGL 1X9UA 3ARQA 3DJTA 3QPKA 5KUMA 2VLKA 2AJSH 2NXZD 5MP6H 1ADQA 1U3NA 4J8RB 4UDUB 5E00B 4A2DA 1BZOA 1CTMA 2EIZB 2EDJA 3CFQA 1XGQA 2X9XA 1QFUL 3V9EA 5EU5A 1PCSA 5I23A 1L6PA 3QE5A 3HC4H 4UT6L 3IDGB 5HDBE 1K5NA 3AQDA 3IJHB 5J6HB 4LLAA 4JO5A 4AK2A 4TLTA 3C5SB 2W9EL 2GC4C 1N8ZB 1IC5H 4HGMA 2GIMA 3LKRA 4UI2A 2OX5A 2VLRE 3MRCB 4HJ0C 4KJYA 1I8MB 2VDOB 1C1EL 4GOSA 4P5SA 5C70A 3IYLW 4X6CE 3BFQG 4KZDH 5L4IA 2AZAA 1DTUA 3MBWB 5ANMA 4KNUA 4KQ0A 4BZ1A 3VD4A 5DRZA 1JF6A 3OJMB 1CIUA 3GBMH 1TNNA 5J3HD 2B8OT 3FSZA 4KK9D 2YAPA 4HJJL 1OB1B 4APQD 4NERA 1D9KC 4DQOL 4DZ8A 2QBWA 3IMSA 3V0VB 2R59A 1XGRA 5I5IA 4ADJA 1EO8L 3CSYA 4NDMB 4PRDA 1A3ZA 4JRWA 4LEEA 3S37X 2GSMB 1NGPL 1DSYA 1YECH 1XB3A 4FZ8L 1IRAY 3CDZB 5AVWB 2XZAH 4X9BA 1QWHA 3WAJA 1TTAA 1L6ZA 1KPVB 3HBQA 4B97A 4QY8A 1A6TB 2PWGA 1TU2A 2Y2WA 4N20A 3TBVB 1DVFD 4RLDA 3RFZB 3SOTA 3HE7C 4P04A 3NFPB 1VESA 4MJIA 2DD8L 5C9KA 3MODL 4P2OA 4AVHA 2IAMD 3C5ZC 2IVFC 2KUTA 1MCIA 3POCA 2O4EA 4CJ0A 3MRNB 2ESVD 2FUTA 2MPAL 1KTDB 2CIKA 3B2UC 4KI5F 4UNTA 4IIQB 4HK0B 3MHZA 1PG7H 4FFYA 4JFDA 4PP1D 3GNMH 4OD3H 2EDFA 1URIA 3HRZA 4G8AC 2RR3A 2V4LA 3SE8H 4JKMA 1UTDA 3CE1A 3IS1X 2YS4A 2Y6SC 3ZL2A 1DLFH 5A6IA 4P5TC 3NIFB 3QDMB 4TSBH 4D9RD 5DMYA 5HI3D 3D51A 1FAKT 4KROD 3MKGA 3CSPA 2O6EA 2O5NA 3ZZQA 2GK2A 4HXBL 4ATWA 3RWIA 4Z3TA 1KIUA 2H3KA 1G9ML 4BH8A 4HPOH 3QJFB 5JW4N 4W6XB 1Y18B 4AGOA 3D39D 3FRPG 1IGTB 3ASNB 4B95C 1P7QB 3H4FA 4N2NA 1AZUA 4P57B 5D1XE 1FFPA 3CFEB 4N25A 3T08A 4AOFA 1F02I 4UV7L 3KNBA 1WSST 3UERA 3V0IA 1NIDA 4FQJH 2A6IA 2C9RA 4PP2A 3DX0A 5F9WB 5ILTH 3IJEB 5AZEH 2BDNL 2E75C 1U8CB 3D34A 5G4MA 1TTFA 3INUL 3RTLA 4ZFFB 4BDVA 2KPNA 2A6KA 3BH9B 5E24E 4I3RH 4KGJA 5JO5B 3V52L 1YN7A 4WNSA 4IBQA 2G4EA 4PWFA 5JIQA 4YDLB 2WUCH 4MS8C 1RK1B 3G08B 3VU1A 5EU3A 4FMFA 2K4WA 2JIXA 1JNNL 1J1XH 2D31A 1CFMA 2F53E 2PW1A 4YHLH 5J8OA 4A38A 5E56A 4GUQA 2DZEA 4DPCX 4ZQKA 1IBZA 1GCYA 1D9KA 1X7QA 4CJ1A 1OSYA 2PCYA 4FOMA 5FUZL 1MCOH 4XVSH 2XV3A 3S3PA 4GW1A 1EO5A 4L1HA 5C0CB 4ZUTB 4L3CB 1ZPUA 2YGOA 1Q0XH 3OLIA 3PWPB 3FB5A 4N9GB 1MFEH 3MC0A 3CFJA 1IQWH 2QDVA 3WIIL 2CGYA 4HU2A 2XUWA 2Y7QB 2HT4D 3ESUF 1YHPA 4BSWA 1IE4A 2Y7SA 2EXYC 5D7KE 4F80A 3RNQA 2HA1A 4A2MA 1EHXA 3IKCB 4X6BB 3HE7A 4JRFA 4M8RA 4OIIH 7PAZA 2IAND 3OMIB 3V10A 4XP6H 3RILA 4M48H 2F1AA 4JRYA 2ZD0A 1TZ8A 1BYOA 2CKBL 3S8FB 3EYQD 2D03H 3NDYE 4KVPA 4YQXL 3QR1A 2WBXA 1BBDL 4EZJA 5E6IB 3KHQA 4P9HC 4X0NA 1YY8B 2WTRB 5ID1A 1F6AB 4HT1L 4HIHB 4OZFG 1EZUA 4JFED 2NY4D 3UC0H 3BDXA 1EAQA 4JFQB 4H13C 5BRZB 4E9WA 2Y06H 5C97A 1DVQA 4DFIA 2WXHA 4NKDA 1KFAL 4RGOH 5SWSE 3EHBC 3N85L 6TAAA 4IU2B 4BZ2L 4P5TA 3TNMB 1NFIB 3N1FC 4JM2C 4N8UA 3N44F 5E94B 1KPUB 5D2NB 1EAOA 1YC7A 5BS0A 3QUMH 5JDSA 3VACA 4U7MA 2P5EB 2NRDA 2YFOA 3OKNA 1BBJB 4N3TA 1JI2A 5FKPB 5E5MA 4DK6A 1CL7L 2ZWZA 3ABZA 3NRPA 2OSWA 3DROA 1RZ7H 2JB6B 2J1XA 1JMZA 1VACB 2D7TH 3DX9B 1URLA 3IAGC 1J88A 1EAPB 1V7ML 1VKXA 5CSGA 4P4KA 1R9FA 1ZT1A 3OX8A 5DZOA 3X12A 5E6YA 2O61A 5EZJA 3F3HA 3WTSA 1G7HB 4BFOA 3P4NB 5E2WH 4YHYC 2FSEB 3LYRA 3PGFL 1G7QA 3EYSH 5DHVB 3RZWA 3BRDA 4YZFE 1VEPA 4OVVA 4QHNA 5F7YC 1TQCB 3GWJA 1XIWC 4WJ5B 5I8KH 1Q94B 4OM0L 3MXWL 1D5MB 1QATA 2J2ZB 4LSTL 2GAZA 2BRRH 2BC4B 3T0ED 2EZ0C 1CFQA 3CC5A 4M61A 3ARGA 4XOCA 3RVVC 3BFWA 4MHHG 4JS7A 5DD3H 1THCA 1JXKA 2Z91A 1B4JL 5D7IE 2YXWA 4CDHA 4MCNA 1KJ2A 1HINL 4QD2E 4TULH 3ATEA 5DJAA 4NM4L 1BOYA 1DEDA 3SCMB 3FT4B 1ZV2A 4S1SL 5D6DA 5AZ2H 5HYIA 4PTTB 2N01B 1HCFX 2HWZL 1V5JA 1YJDH 2DYPA 2XN9A 5ESAA 1XVSA 5T1KB 2AEPL 3NTCL 5JOPE 3MLSL 1H5BB 4U1SA 1ED3B 1AI1L 4J4PD 3EGSB 4M6OL 3L3JB 3LXCA 1QOKA 2CRZA 2EJ1A 3TYGH 2EDKA 2GJJA 1D5RA 3WJMB 2DJ4A 2JKWA 4V1DD 1DVUA 4X4XB 4A7TA 2ZCLL 1WGOA 4QRQB 4ES9A 3BPNC 3LNIA 5L8KB 4LSVH 3BT0A 4MA3B 2GJ6A 1A2YA 5ERWB 1PD6A 2X2HA 1M42A 1YEHL 3ARPA 3QNXA 2EYSA 5EZLB 4F2EA 2XWBB 3QC6X 3WN5C 3IGAA 1U3HD 1X5JA 3KPSB 4QRFA 3CVCA 3GSWA 2BSTB 5GRUH 4E36A 1JZ2A 2JXMB 2FD6L 3S5ZA 1E27A 2H41A 1GGIH 3DV6B 3ML9A 4H0LC 1BF5A 4Y4HB 1MI5B 3ZR6A 2ARWA 2N0KA 2WUBL 4HMCA 3SKMA 1BEYH 3RHWK 4MX7A 1C5BH 2LLNA 2R9HD 2YLHA 1GJWA 1A65A 5DHEA 1T03L 3D06A 5IMOB 1X5XA 5DHYA 3BESR 4AQ8C 2BVQA 4UWQB 4ZMQA 1X3DA 3DX7B 2V8MA 1WIPA 3QDGE 4AV0A 4K7PH 4HF5H 4NQDE 4PRHB 3TBTA 4AYBA 4D8OA 4Z78B 4QOKD 2GY5A 3QZPA 3DYPA 5KTEH 5CILH 4PD4J 2OMYB 2NNXA 2WNGA 1AQKL 3O9WB 3ZKND 2F2HA 1VFAA 3BKJL 4YHKL 2QV4A 3A6OA 2BWIA 5ADPL 5M94B 4ICXA 3WLBB 3V6FA 5LDUA 1NGZB 3FTYA 5KZCB 2QQNL 2YK1H 5M95B 1ACZA 2Y9RT 3VYNA 2I26N 3TS8A 1KLUB 1EPFA 1JWSB 1UVQB 1GAFH 1NC2B 4C4UA 4XPFH 4DAGL 2YRPA 4LBEA 4NN6B 5C0GB 4PSRA 1ZK5A 3F85A 2R0WH 2O6CA 2QGBA 2L3BA 4NUGH 1SFHA 1T5WA 1O9ZA 4H20L 5IVXE 1ZCRA 3TEXA 1S7QB 2BFGA 4WI0B 4BFFA 1DZBA 2W9DH 3ETTA 3QEHA 5LN4A 4HIJB 4NZ8A 3MV11 4CMHC 2F8XC 3ZQ9A 4J12A 3ZMNA 3PV6A 5INCA 4WRLA 3SDCB 2CA4A 2DV6A 3FRUA 2R1XB 3QEGL 4HX1A 3MUJA 1DUZA 2PW2B 4YEEA 2PTTB 4LVNB 4U1HA 4BCYA 3BKML 3Q43A 2YD4A 4J3OF 1OAQL 1SLVA 1OK0A 4FG4A 5F3BB 3Q8CA 2JTYA 3OJ2C 4JW3A 1MCPL 4K7FB 43C9A 3UPRB 4P2CG 2GPZA 2ZP8A 2VN5A 2F8OA 1OHQA 4HH9B 4PJAF 5DJYA 3HC3H 1J11A 2IQAB 4R3SA 4PJIE 3QULA 1KT2B 1EVTC 4NBZB 4ENEC 4F2FA 2EO9A 1GH7A 2JI3A 4XN1A 5JPMB 4UZGA 1WV7T 3VFVA 4Q0XH 3VFGL 5ETUB 3VWKB 4RMQA 4NNXB 1BM7A 2P9RA 5GIRA 3RTQD 2EILB 4TLKA 4JCLA 4KOBA 3ZDWA 3LH2H 3WN5A 3DVNA 3BZDA 5J1AA 4CAGA 2WQSA 4KX7A 1RZGB 3KVPA 5K5YA 2P24A 3EXLA 5C0BE 2WD0A 4GKZA 4MQXC 1JZIA 5D9SB 2NY1C 2OP4H 2NMSA 3P9LA 3MU3A 3TFKC 1HNYA 1JK9B 3RKPA 4KKRA 1J9TA 1GTFA 1IT9L 2Y5TB 5IY5B 2IDTA 1KBGL 3KYNB 4G6ML 3A4DA 2F9BT 1BQHA 2EDDA 1DJGA 1FZOB 2BWDA 3N41F 1L4IA 2CIIB 2HTKD 2ZXQA 4J3OG 4XH2A 1UZ6F 5B7EA 3TL5A 2VDKB 3WGUB 1FNHA 4PJEB 5GGRA 2YEVB 3LEVL 4HKBB 4MLSA 2YQ3A 4BSJA 5KVFH 2EYRA 3UYOD 4YBHA 1HDMB 4FQXA 3HMXA 3RL1A 2RAMA 2ZNWA 3C2SA 4YWGL 4GG6A 3AG3B 5GSVA 2AV1B 2IG2H 2YSSB 2WZPD 4PRNB 1FP5A 4EDWH 2XWXA 4EO5A 5J0BA 3GXPA 3IB4A 2ERJC 4HEPA 5LDSA 3H0TA 4PS7A 3EBIA 3W9DA 1HEJC 2FJFB 3AU1B 1ZDSA 4JDZA 4WU7A 4LAQL 4LDLB 2I9TA 5FYLE 5LBSH 4NQVB 1F00I 4ECNA 4IK7A 1P6AB 3UEZA 1JRHL 3RAJL 1MF2H 4FJYA 2VXQL 4J23A 3VYPA 3QI9C 1ZD6A 3I6KB 1KCLA 1ILUA 4ELME 2HRHA 4FQ1L 5KVEL 2HFEA 1SDDA 2OMTA 2FL5B 4FLQA 5CFHA 1HI6A 3UC2A 4IJ3B 3SKNA 3X1BA 3LHPL 1N18A 4OQTH 2XWJB 2G30A 1K2DB 4H7VA 4OZGF 3U6RB 4X7EC 2V3FA 4PGEA 5KSVB 3QPXL 5SWZA 1FG9C 5K59E 3QAZB 2XFXA 1MXGA 3QWRA 1DLHA 4Z7QB 1E9PA 4OLEA 3RPIA 2RFXA 1BA9A 4DP0X 5E8NA 4FFZL 1CURA 4JY6A 2ICWI 3RDTD 3SE9L 1CT8B 1ZGLM 4F7MB 4JCMA 5JMRA 3GSOA 4JRXB 5TQ0H 1QSEE 3GGWA 2PWDA 5FHAL 1BM3H 4IKIA 3ZJAA 4YDKH 1VFMA 5E8PB 4XGZA 5HYJB 3K80A 1PLAA 4L05A 2WBJC 3GLZA 3QIWC 4X4ME 2UXFA 3E9TA 1NGWA 1TYJA 1MJ8L 2ICEB 5FFGA 3QDJD 5DC9B 3BZEB 3Q8BA 3ZE1F 3Q5OA 3BSZL 3NABH 1HXMA 1R34A 1KXVC 1EDHA 1OCOB 2G75A 2CR0A 4U49A 1F3RB 1MCNA 1M7IB 2YGNA 1WBYA 1MY7A 4DEPB 1UM4L 4PPTA 4E41D 1A25A 4OFDA 5IJKA 3EH5B 4WWKD 4NT6B 4AEIH 3KGRA 2P8LA 3T6VA 5F1SA 1KIPB 3NCYP 1W2KT 2BPBA 1LD9A 5DJDA 1IC4L 2EADA 3MO1A 3TBYA 4Z7OB 3OHMB 3PCYA 3MRMB 4H26A 3ALPA 4K71B 3VXSA 3CH1A 3FCBA 4O00A 4P46D 2OL3L 1EMTH 1WWAX 2J7LA 2W0KA 5IFJB 4FNPA 3NCCB 1CPUA 1SMAA 3PPSA 1AGCB 4ODVH 3CQPA 4N6RA 1X5YA 2YD9A 1J9QA 1SY6A 1IAOB 3L3HA 4KK5C 1EHNA 3NCEB 3OQRA 5JHAA 4PLKC 3QQ4A 4FLHA 3KR3L 1S78D 3KDMB 4QJ3B 3RWHB 2X4RA 3MLRH 4NZRH 4JDVB 1AHMA 2UYLB 2MHAA 3ARZA 1YA5A 3BD3A 2EVGA 2AKRA 1I7UB 3D3VB 2XWTB 4O5LH 5T33H 2PN5A 5JIMA 3E2HB 4FXKB 3WG7B 1IGJA 2ORBH 2CAKA 4FTDA 4Q52A 4XOAA 2D7PA 4GEJA 1MRDL 1P7KB 1KV3A 5F1IB 4W9GC 3UTOA 3CSBA 5DJZB 1RIHL 4ETQB 2C4XA 4NUJA 3F12A 4G9DA 3QI9A 2ZWYA 1QLEB 1D7FA 4C4KO 2VDQB 1G1OA 2ZJSL 2NY7H 1T66C 4EUPB 2R2EA 1FYTA 1XBDA 2XZQH 2YPVL 4L9LB 1HHHB 5IJDC 3MNVB 1BJMA 4OGZA 2VDRL 1YAZA 4Y5VB 2A77H 4QF1B 4IMLA 2AV7A 2PR4L 3KH4A 5CZKA 2C3GA 4BXVA 4C8XA 4TQEL 3KEDA 4Y19D 2DQGL 3FUFA 4Z7VF 4LFHG 3KYMB 4PRAA 1Q9KA 3IJ7A 1GC1H 4IHOA 4UNVA 3I9GL 5BZDA 4OV5A 4GG6F 3IDIA 1AFVL 2CBMA 4XWGL 5H94B 3BQUB 3DXAA 2MOQA 2HVJA 3T04D 1OAZL 1F13A 5AL0A 5TDOB 3BVNB 3NZ8B 1ESOA 2E7BA 3LAFA 3O3DA 4XN9A 1XSIA 1WFOA 4OJYA 2QR0B 1WCQA 4LSQH 5KS9A 3FO0L 4GBXB 4KAQL 5HHMB 2VR3A 4F5CA 2YO3A 1ETZB 2DYRB 2XC8A 3CHRA 4U6HB 4F15C 4YSQA 2WBJA 1MFAH 3I3EA 2XKSA 4QXVA 2AQRA 2PO6B 5I8OH 3NIFE 3QDME 3R19A 1MJUH 4GRWB 3UDWA 3AS0A 3TIDB 2X87A 3TESA 3ARDA 3GJFK 3VMNA 1DQDL 3JWOH 1JVKA 1KXVA 3ABGA 2M83A 1EEYA 1JOIA 3FONB 5HI4C 2VJ8A 1HTYA 4B9KC 5GGTL 3V5HA 2PWHA 4JY5L 1F1GA 4R4BA 2Q86A 2DQFA 1A3LH 1EGJL 3TA3D 1YNLL 3LS4L 1BQHG 2X2YA 3E8UL 4ZPTA 4D0DB 3HHSB 2W0FA 2EABA 3F83A 5EORH 1PIGA 2EE0A 4NQCB 5LQBH 5AOKA 1A8JH 4R96A 5C0JB 4WUKH 1KXQE 5HD8D 5I5RA 1T5XA 1J05B 3BEVB 3C6LC 4LARH 1EV2E 2I07A 1MCCA 3W9EB 2HN7B 3CFCL 1L6XA 2R1WA 5B1KA 3CLFH 3BP4A 4RQQB 2WWNA 4B9GA 5HVHB 3TCTA 4XCYA 3IJSB 2Q7YA 3KBHE 3LKNA 4HEPG 4N0UB 3RJOA 2P28B 3IBEA 3S4SA 2AEOA 4X4YA 4ZMWA 3UCQA 1KDIA 3WUWB 2GC7C 3LXUX 1NA8A 2DOCA 2DIJA 3NCMA 3K4AA 5CJOL 5IMKA 4JB9H 5DEGA 2CBTA 5GJTH 5JPNA 3O6KH 1GKOA 1OHZA 1PQZB 4B9PA 2WLJA 1OAYL 2WXNA 3IDXL 4EZMA 3Q3GA 2WZAA 3PWLA 3PUUA 2NXZB 2ENJA 1R5IB 2ED8A 4RMRA 5F7DA 4EZLA 5E5RB 1OT2A 3F04A 3PWPE 1A8ZA 3LKQB 4FXGB 1TETH 1WCBA 3EYVB 4AT6A 2NTSP 4BKTC 1AZNA 1K8DB 4ANVA 1JGIA 1LEKB 1MH5A 4NQEB 3E38A 5C8JA 1PEZA 3EFOA 4XE5B 3JTTA 1JHTB 2JQMA 1XH3B 3F7LA 3TO4C 1A7RH 4ZYKB 1Y1UA 1KENL 1IKFH 2WQUA 4ZFQA 3UAJC 3BLKA 3FOLB 3I2CH 3QXDB 5EBMB 3QUYC 1JZ6A 3V0JA 1N7ML 1CFVH 3TH2T 1MHEA 5KVFE 1S5HA 1UC6A 5KVGH 4HS8L 1AR1D 1C16B 1N3NA 3Q8AA 3FQRB 3NCYS 4APQB 4ISVB 4OLVH 2X41A 1T7XA 3F8UB 4M8UA 2NDGA 1CE1L 2WWMD 5HYFA 5GSRA 3HB3C 5H2BA 3ZN6A 5BRZE 4XNMA 2ARJQ 5D6CA 4LE8A 1N19A 2EDRA 4QRSB 2MQGA 3IFLL 5D1XC 1ZA3B 3BT2H 3FQTA 4Q2ZB 5JHDD 1BVNT 1GMIA 2XNAA 3II3A 1J1PH 4R90L 5D2NE 5DEJA 1EEQA 4WFED 1FNFA 5DDHB 2P5EE 2W38A 5J06A 2VXVH 2BY3A 4XNAA 1A4KA 3CFKB 5HBBA 3ZT6A 4OZIA 2GBVA 4APXA 4X5WA 1JYWA 1T0MB 3FYIB 2IPTH 2MTPA 2BK8A 2WQRA 3JTSB 4N2GA 4X9FA 5CZXC 1DUYA 2VLRA 2MNWA 2R2BB 4L1DA 2IAMB 4M7LT 4H2AA 2IWKA 3VFUA 4X6CA 3FQXA 1SLWA 1PAZA 1T0OA 3T8XB 1WH0A 1A9EB 4LRIC 3C6LA 5AYUL 3VFPA 2VDNB 2YGPA 1AGBA 2VZ3A 4K5PA 3S37H 4EEEA 1AC6A 1G9NC 4GQRA 4NQSB 1FNGA 5IB2A 3U4EB 3MA9L 3LMJH 5F96L 3IU4H 4P5KB 3O8XD 1QR1B 2WLIA 4BFIB 3OPUA 1XTMA 2Q76A 5DYOB 3X1FA 3GSNA 4FNTA 4DEUA 1S4IA 1BX2B 2PWEA 4Z7WB 5I5MA 2ADIB 5IOPA 2WXIA 4PVMA 5IQ7L 5EEXA 1JPTH 3VU2A 2G2NA 2G5UA 2MKLC 1HL9A 4KROB 2X10A 2AXGB 3P11L 4GAAA 3RX5A 4PJ7B 5I82A 1TJHH 3X1GA 3WJJA 5IZ7A 2NYYD 3QWOA 4ZXBB 1UASA 4I85A 4U6TA 5ID0B 5EF1A 4Y4FC 3N0AA 5IR1A 3DIFA 3H42L 1BVLB 2QPSA 2ALWA 5CINL 4XCNA 3FQYA 4JL1A 2FR4A 3EFFA 4OJAA 1C08A 5JHBA 1X5IA 3BMVA 5LAXA 1JPST 3FHEA 1KTRL 1WD9A 4J3XA 3KPOB 1DQML 4U3SB 4JHWL 5J9PB 4HCGA 2WSDA 1NAMA 1TZAA 2APBA 2FB4L 2MIZA 5E2VH 1OQXA 1N68A 3P3RA 3G5VB 5AFAA 1HU8A 3EOAA 1Z1WA 2H8PB 4KMTH 2C1OB 1BFTA 4ODWA 2J43A 4HUCA 1IM3A 4OSUH 3QO1B 2QKIA 1R46A 4I0CC 4MRCA 4YXLL 4QEGA 4KRMB 4LCUA 5EOQH 1GY1A 3B2PA 2XDHA 4OJEH 3T0AA 3UAJA 1BQSA 3APDA 1KB3A 1MHHA 5EF3A 3QUYA 2O5YL 3ZTJG 2ZOWA 4EN2A 3CMOL 4N9OB 3JXAA 2D9CA 3NSDA 3W81A 1J8SA 3QUXB 3VGBA 2KS0A 1AACA 3FT3B 3KPSE 4Y5YA 3CC1A 5CN1A 1AQ8A 4ODSH 5HJ3B 1JGLL 3T1FB 4N8VB 7CGTA 4ZMZA 4LHUA 4NGHH 4LNRB 1J5IA 5DRWB 4YBLC 4F8QA 3NZHH 5DC0A 1MI5E 2G2RA 2VDQH 2V2XB 4YO0A 5D1XA 1AAJA 3MGAA 5FUOH 1OY3B 3EO0A 1IFGA 1WJ3A 2PXYC 4FI8A 2G9HA 2OMUA 1MW0A 4PGZA 4MMZB 5FGSA 5JQ6L 4LLDB 4A6YL 2QGEA 4P3CL 4DUVA 1UXSB 4DUXA 4WHYH 3X3GL 3K6IA 2E59A 2IANB 3D48R 4U7SA 4MJ6B 4L2YA 1YN6B 4WEUD 3BKYL 3QCTL 4PRHE 5I18H 3U1SH 5JHLH 1L7IL 2JNZA 5IHBA 1B2WL 2EEBA 2GJZB 5DK2A 4A7QA 2BVPA 4HBCL 2F6AA 3RLSA 3PWUA 4PV1C 2F53A 3QUHA 4TUOB 1KEML 3HMXL 3GO1L 3OKDA 1RUPH 1DBBH 2VZSA 4AIZA 2BWQA 1NMAL 1W80A 2FQGA 4JJOA 2B3IA 1N4XH 2DWDB 4OD1H 5EC2B 5BZWA 3ZKMC 1PS3A 2FT8A 4JKLA 4AZUA 2EUZA 3DDGA 1BZ7A 3EOBA 3DV4B 1PZ5A 2WMPA 1QLFA 1NCHA 1PMYA 3GJEB 4Y2OB 1N6QH 2R4RL 4GT7A 3II1A 2FQDA 3PP4L 3STBA 1IGIH 1CB4A 1FIGL 2AFNA 2H6PA 2V17H 2ZP0T 3GMPB 5HDBF 4OZIF 1BEXA 3FT9A 1I1AC 3MGTA 3P77B 4IRJD 5IF0A 3ULVH 3T65A 4Y4FA 1A4JB 3CXDL 2Z8WC 2IH1A 5CN3A 4LLMB 2HP4A 5EWIH 4UINL 3U2SB 4K3EL 4OCRH 2Y25A 3TWCL 2YA1A 3AAZB 4BGDA 1UA3A 2DYSB 2DL9A 3QG7L 4Y88A 1BZQK 5GRWA 1I9JH 4F8NA 5TF0A 1FYHB 4G11A 4WQOA 4IBUA 4N8CL 3MSPA 4YK4B 3WNMA 4X5XA 5CJXA 2Q87A 3VTMA 3QA3B 3A6CH 1YUHA 2E4FA 2FBRA 3T0EB 1CZ8H 4XBGA 2QMKA 2B16A 5SWSA 2WO3B 2X05A 2VZUA 5LJYH 1CLVA 1M3JA 2XV6B 2PCPA 2NY0D 3M86A 4R7NA 4OT1L 3BZ5A 2XPZA 3FO2B 5T1MB 1E50A 4EI6B 3U9UA 2J6WA 2QLVB 3BD5A 5C09D 3SDDD 1G6RH 4JO4H 5IM7A 3L17A 4F7PB 3SYPA 3LQZA 3P3SA 3QB7C 2CDEB 5DRXA 4Y1AD 1MCJA 4OZHB 2XLLA 1BXVA 4XN7A 2ZCKL 3BZFB 4L0PB 4OKVA 5EBLB 4DEWA 3SDAC 4HETA 4Q89A 1UM6H 3BJ91 5DUBB 3OGCB 4A2EA 4BQCA 2EDTA 2ZCHH 4TOYL 4RFNB 1FZKB 3FUIA 5I6XC 4UYQA 3BPOB 1IO4C 1U36A 4I9WD 5FO9B 5BW7C 1U93B 3KYAA 4XP9L 3RIFK 4A55A 1BD2D 3DUUB 4E9VA 3EDKA 4X9IA 1BJ1J 1WBZB 3CZJA 5CJQL 1KN2L 4PJEE 4KV5E 3K6FA 3VJ6B 3OKMB 3H9HB 4HJ0D 2WQXA 5FKAA 5TDNA 3E1F1 5KYNA 4ZW7A 1C8PA 5FYKU 5SX5K 4Y4KC 5I73B 3C8DA 5JW3H 3M6DA 5D7IA 1BVNP 3VFWB 4MCYA 3WKYA 2AABL 4TUJA 1P9MC 4UT9L 1H6TA 1R4XA 1OCZB 4HK3N 1U3HB 1WC7A 1BREA 5KVGE 3CLWA 3RE0A 5A2BA 4LQ1A 3WFCH 1HHKA 4LOUC 4XMKH 4KO9A 1BAFH 3L4CA 3BUBA 3H9ZA 1B4TA 4JFXA 1NMCB 4CSSA 1ZGLA 3L4VA 1N2RB 5I16B 5TE7L 1XMWA 1QA9A 4P8QA 4O02L 3NZUA 3TFBA 3EO9L 3U6XS 3Q06A 3NIDB 4PG9B 4TVPE 1VPOH 1I1AA 3ABLB 4GJTB 4NUMA 1E4JA 3KLSA 1Q9LA 4G80A 5KANI 1V10A 1Z9OA 5EZOH 3HE7D 2BOBB 4Z7QE 1XGTB 1SYVA 3MGOB 1WE5A 5JTWA 4IS6B 3C5ZD 5CNHA 5D71H 2R8SL 4QOKB 4NJ9L 2IALB 2GG1A 4JFFD 3GMNB 4YX2L 2EYTA 1U8NA 3NJMA 3OMZA 3HI5L 2HJLB 1AQDB 1IBHA 3B2UD 5ACZB 4WGKA 4Q6IC 3WIFB 3ULUH 3GRWL 3Q2WA 4JRXE 4TSCL 3ETSA 2GSIB 4L0YA 3N1MC 1L5GB 3BKCL 3O41B 5HYJE 3V0AC 5I1EH 1NJ9A 3AQYA 4HZAA 2CK0H 3W57A 1DANU 3EXJA 2Y6SD 1YMHA 4BHUA 3B3BA 3KPNB 3X11A 3DGGA 4LRNH 3HN3A 3CFDB 4GAJH 4JE0A 3Q7JA 4BD4A 1IIKA 4LHUG 5TH2A 3T1WA 5A7EA 1I9IH 3MOQA 3H54A 4TXVB 4KY1L 4Z7UA 2J12B 1UB5B 3OHXC 1BZ8A 1KGCE 5EFIB 3BHBB 3I50H 4Y2NA 1GIGH 5B7FA 3RGVC 1RK7A 1S46A 2JFCA 1FORH 3C9NA 1NDTA 1PTZA 2ZX8A 4LKCA 3QDGA 1USZA 3ARWA 3VGFA 3VD3A 3VXOA 1J5OL 1OSPH 3FH8A 3BUYA 1GGTA 4NQDA 2ZX6A 4Z7OE 3LS5L 2ZQKA 1WGVA 3CFBA 5D4HA 4FQCH 3SDAA 3VFNA 4QUOA 3QPQD 1E2WA 1F4XH 1HJBC 5DUML 4JKNA 1ICTA 4NOBA 1F4YL 1YQVH 4OJCA 5BW7A 2ZZUT 2WIIA 1CF8L 1KNOB 3FUEA 4LSUL 1NDGB 2DLTA 1AO7D 1T2QL 3WTWA 2X6MA 3IXAA 3MJ8A 1DJXA 4FFTA 3ULUF 2PP9A 1GYVA 2NY5L 2DIBA 3BP5B 5K9QI 2XY2A 4PJ8C 1KB9K 2AJZB 5ICXA 2X7LA 1BPLB 2BJML 3D3VE 3RTQB 1MCDA 3VWJC 3BDYH 1K72A 3MRLB 5DJ6B 5IVXA 1KEGH 1GYWA 2P5WA 4YPGA 1P9MA 5EIIB 3OJVC 3A5VA 5GS1B 4PR5B 1P5UB 1YMMB 3EJUA 3OKEB 1XR9B 4ONFH 2A73A 2DYPD 5D93B 1JWMB 2BZCA 3BW9A 3MCYA 5FM5M 4RMBA 3V5KA 4LP5A 1N0XL 3EJRA 2A9DA 4NPJA 4P07A 3REWA 2FNBA 5CBAA 1PLGH 2FBJH 3BJLA 5C3TA 3VI3F 4HLEA 3EKCA 4UIKL 3L9RA 1MUJB 3IRCA 3WEXA 2XIDA 4R97C 2L7JA 4OIFA 2ZUYA 4LDCA 3N1PC 4X99B 4L3ED 4XO9A 4DF9A 4C58B 1ZT4A 3CVIH 4ODHH 4PJIA 1DN2A 1TVHB 4L5FL 4YHZH 4ELKB 5F72S 1R24A 4YGVB 3ZT7A 3LX9A 3VRJA 4TMPA 5D7IF 3D4CA 4PWJA 1KC5H 4Y7MA 1N64H 4JAMA 3WXWL 5DJXB 2MOVA 4AC2A 2H3XC 4B5ZA 1IEBB 3VXMB 1WUNT 4Q6IA 4KNQA 4HLZH 5T1LB 1OM3H 5HHME 1RHFA 1WLHA 2DQIL 2EH8L 3GS0A 5C0BA 2WY3B 2CRYA 3CUPA 2XPGB 2AXHA 3BGFC 4HGKC 2EE9A 3EHBD 3DVIA 5KVDL 2NY6C 4JM2D 4GRWE 4GRLA 2G3NA 2ZWNA 4YZWA 1NINA 1YJDC 1IAII 1XD0A 4JZNB 4M62L 2ADJA 3V7MA 3BSGA 1CXFA 4CMMA 3DX4A 3B1UA 3JZYA 4UZSA 2HTLC 4D0BA 2VXSL 3PQYD 4N0YH 3TLRA 3B2MA 2HLAB 3OXRB 2W95A 4L37A 3K6SB 1Z9NA 3DX1A 3QCUH 1K4CB 4UIMA 5DVMA 3F7YB 3BXNA 4NQCE 3NDZE 4YGAB 3Q13A 3T3MF 3RDTB 1J0JA 1GGUA 2ITDB 4CL7A 3L95A 3HLAB 4NKOA 3VFTB 1J9RA 4KX9A 1S7TB 1HEZA 3ILPA 3OG6B 4G6KH 4ZW5A 1XIWD 2Z64C 3MCKB 3B34A 2DM3A 4PJHF 4XB8A 3VD1A 3GSXB 3ZKQD 4ZQTA 2PCFB 5DLLA 3RJQB 3CU7A 5LWYL 3GXIA 3CHOA 2WANA 2H6UA 4N0UE 4LVHC 5DUJA 3PJLA 4NP9A 1N5AA 2I5YH 3WMSA 5E9AA 4BA0A 3QDJB 3RVVD 2ZKHH 1FVEB 4ELMA 2WCPA 4W9HC 1F1DA 7PCYA 1RPUA 1IAIH 4FAAB 3C2AL 4H8UA 2ILLA 4Z7UF 4YDIH 1XGYH 4X8JB 2DS4A 4MSWA 3VWJA 2WCGA 1SRDA 1BG9A 4GI9A 2XXGA 3VB9A 2LU4A 1RU9L 1T20B 4JGUA 4E41B 1E9OA 4YC2C 1UUNA 4WWKB 5ITBL 4JHAH 5GRVL 1R0AL 3ESMA 3RFZC 3KWWB 1XHHA 3FMGH 4O2FB 4U1IA 3VGEA 4OI7A 5F9OL 2FLMA 5IK3A 1O9VA 3LN9A 4HK3J 1DBML 5I1DA 2J6EH 3QJTB 1U8HB 2GUOB 2GYSA 4OJDH 2J88L 3UTZB 4IIQC 2YGQA 4NQQA 1QSEA 4P46B 3QVAA 4B9JA 2IPUG 1TYEB 1KYOK 4B53A 1QW9A 4XNBA 3MFFB 4NQEE 5DJCB 3SDXB 4JKWA 2NDFA 3UADA 2VN6A 2B59A 2VN4A 2WV3A 4X4MA 3K2UL 2GK0A 3VXRD 3KGTA 1GZPB 4LU5H 1SHWA 2ZWSA 1NCAL 1R17A 3QHTC 1SDAB 2TSAA 2J73A 1F8TH 1KJMA 1CFSB 2FGWL 2G0LA 5FM4A 2IXQB 3Q2NA 5IVXF 2FCBA 5K69A 2A9ML 3Q5YA 4PH8A 3FCGA 2VR7A 1Q72L 4AZ8B 3OC5A 4Q9QL 4WEBH 4N2DA 4X80H 5AL8A 2V9UA 1S3KL 5F88B 1UWEL 3EGXB 4JM0A 4HKJB 4JVPA 3RUGA 1QYGL 3BQVA 3PV7A 4J8RA 5E00A 4UDUA 2BHZA 2EIZA 4HMEA 5FWQA 2XZCH 1ANUA 3L3KB 43CAB 1YRKA 5F9WC 1VDGA 4HC1A 5DK0B 2J4WH 3CN2A 4WF7A 3OD3A 2PETA 3D5OF 4HJTA 2XJKA 4KVNL 1HSBB 3QK0A 2CKBB 4HUUB 3IDGA 3IJHA 4DP1X 1I7RB 4CGTA 5I0XA 3C5SA 3DVFA 4NUPA 4Y19B 2F68X 2VXTL 1N8ZA 3MLYH 4GKSB 5L88L 2L8AA 2WWOA 3MRCA 5DO8A 1I8MA 3TBSB 4XMPH 4XMTA 1OWRM 3AJ7A 3DHPA 3CZEA 2OTUB 4NAQA 3MNWB 4KHTL 3CQFA 3MBWA 3ZPDA 3G04A 3QFDB 5AG8A 3BWAB 2DJSA 1ZS8B 4U4BA 1FLRL 2AVFA 4X9HA 3BH8B 5CJBA 1OB1A 2WVTA 4ZNEE 2VM9A 2H1XA 3X13B 1KBKA 3RNKB 1WWBX 4FABH 3V0VA 5DVKA 3TN0C 1QRNB 1ZHNB 4MMXB 2NOYA 4HZLB 2XICA 4Z7WE 4LQFH 3FFDB 4D9RE 2X4NB 1G9NL 2DDQH 1GS8A 4NDMA 1WZ1L 3P4OB 3GZQA 2AF2A 3WNJA 4I1RA 4PJ7E 4R2GC 4YUEL 3CDZA 3SBPA 5ELIA 1E30A 1L9SA 4ALAH 1KPVA 4HWEH 1OM9A 1JAEA 4UTAA 3DBXB 3N43B 1JPGA 2AK4D 1A6TA 3QWRD 3TA3B 2YZ8A 3TBVA 4KI1A 2D3JA 2ENYA 2D7OA 3NFPA 4UQ2B 1AZVA 1FHGA 3QIUB 4G8FB 3MBXH 5ALCL 3MUY1 3S96B 1DBKL 3HZYB 3DHJA 3MRNA 4UANA 3F01A 2XZZA 2GI7A 3FBQA 3NVQA 2IV9A 1ZHBB 1KTDA 2JF1A 2IDUA 4IIQA 4KXDA 4HK0A 5GZNC 5J6SA 4QTIH 4MJ5B 3A3YB 2ZCZA 1JFQH 4OCXH 3QJOA 4JUTA 2VJXA 3B7RL 4ENED 2Z7ZA 1NGQL 2HFGH 4M1CD 4W68A 4YE4L 2VLME 1M53A 1HESA 4ELMF 4JDEB 5LNDA 3QDMA 2HMIC 3S3SA 5D2NC 1KGXA 2YN3A 3NACL 1CR9