2F0CA

Structure of the receptor binding protein (orf49, bbp) from lactophage tp901-1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
147
structure length
147
Chain Sequence
b'TINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage tp901-1 ORF49 (BPP)
molecule tags Viral protein
source organism Lactococcus phage tp901-1
publication title Modular structure of the receptor binding proteins of Lactococcus lactis phages. The RBP structure of the temperate phage TP901-1.
pubmed doi rcsb
total genus 26
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f0cA02
4IOSA 2F0CA 4HEMA 2WZPA 2BSDA 3DA0A 3U6XA 3EJCA 3HG0A 4HEPA 1ZRUA 3D8MA 2BSEA 2X53A
chains in the Genus database with same CATH superfamily
4WGWB 3EOAA 1YZZA 1TZGH 4JE4B 5KS9F 2VDQB 4Q0XL 1AZCA 5MENA 2J8OA 3F01A 4NXKA 4N26A 5HVHC 3ETBF 3B7RL 3Q01A 4HHAA 4DN3H 4YMPA 4XVUD 1ZA6B 3D08A 3R0MA 4FQ2H 4TULL 1FL3B 5LAPA 4JM4H 4BFFA 5E1AB 4PRIA 2ZTBA 4DOHB 5GS2H 3G6JA 3CDGA 4QAMB 1X5JA 1OANA 2FJHA 3RU8L 1EEUA 1AI1H 2CWRA 3ATAA 4TF4A 3WFBL 1OGSA 1BSIA 3P3YA 4PGCB 1LO2L 1OSPL 4GSUA 3QFGA 5C09B 4DT2A 1T21A 3WTVA 2NUPA 4LHJB 2J21A 4G6AC 4PJFB 2Y06L 2X7LA 1IM9A 3ZYOA 1S9WB 3K6OA 3DVGA 2LFGA 4FKEA 4IKNA 1DE4B 1MIML 3RY6A 1A0QL 2A9NL 2L7QA 2Y07H 5IW1B 3A22A 1FBIL 1TZIA 5L8JB 4QLRA 5E70A 2GAZA 1TTRA 5LGKA 2EXWC 4K73A 1P4BL 2ZJSL 1J11A 2YR3A 2L8AA 1U8JB 2VLKE 4EUPG 5E4EB 1QSZA 3HI1B 2GK0B 3GSVA 4TUOB 3V2AR 3HB3C 3NYKA 4N2EA 4TM9A 4WUUD 4FFWD 2ZUTA 2Y7QB 2NQDA 3RWCA 1FNEB 4X4YA 5IQ7H 1NH6A 3QUYB 1G6RB 3L4VA 3VH8A 3VWJA 1X5LA 2AERT 3KWTA 1MH5B 4OFVA 4BCZA 4DUWA 3LXCA 4L2LA 2IGFL 4P5KA 3B9DA 4WEEA 3SE8L 5JMRA 1PG7L 4WK0B 3SD2A 4KH2A 3V7AG 3MLSL 4PG2C 1NLBL 3QYMA 3Q06A 5TDPA 4WTWA 1TETH 1KB5L 3D87B 3OF6D 1Q9OB 4JPVL 4OLEA 4K3DH 3SQRA 1NSNL 3CXHJ 4GIPD 3S37X 5FGBC 4KMQA 4ZNEA 2ITDB 3W9DB 1UCTA 5HHPB 4XOBA 1QHPA 4L9DA 2X0VA 1WWWX 3LXUX 5C0BA 4D0DA 1NCAH 5I8EB 3L16A 2FRGP 3QDJE 3FH5A 1V54B 3ARUA 1J1PL 3IFNH 4I3RH 5HPOA 4N8CL 5I0WA 2KKQA 4YHKL 3F5WB 1ZGLM 2XQBH 2MFNA 4TNEA 1XEUA 3EYOA 1QA9A 4PRPA 2IPTL 1DJWA 2A99A 2Z4QA 5EUOA 3DK0A 4PJFF 4U6HB 4WHCA 1CF1A 3DXAA 4M6NH 5GSVA 3FB5A 5CS7A 1KLFB 5DRNB 1MSPA 3CUPA 2BSTA 2A9BA 3MRHA 2NY5C 4TNGA 1IB5A 3EO0B 3BFOA 5E8PA 4ZMOA 4NRZA 3SCMD 3M07A 4CNIA 3R0NA 3WFEL 3VH8B 2FATH 3EAKA 5DMJB 2B1HH 5B1BB 3WUWA 1IX2A 1YDPB 4KKCD 4YSAA 4U05A 4XP5H 3FW6A 4YE4H 4NUJA 2FX7H 1H3GA 3UG4A 1G7LA 4Y1SA 1EO7A 1BFOB 1F8TH 4FNQA 1KWGA 4TN9A 2AMGA 3SDYH 4OUUB 1I53A 1SNRA 4L3CB 2A6KB 2H1XA 2AQQA 3PUCA 3HPJB 4UF7C 5HVWA 2QADB 2V7HB 1P7HL 4ODSH 5FYKD 4X8CA 2XN2A 3RIAF 1G0DA 3PLYA 4BYHA 2HJFA 3VX0A 4JO5A 5CR8A 1TTBA 5FYLL 1DVTA 4HKJA 2DJSA 1IZKA 4FRWA 3WMSA 3O6KH 2BP5M 5C92A 4GKSB 4LLAA 4BK5C 5IREA 4MNQA 2WBJC 3DSFH 4G6JH 3FCGA 2HJKA 3MRGB 3K8MA 1DSFL 1NCGA 1FP5A 5TFSH 3F7KA 4F8NA 2J71A 2VXTH 1J8HA 5I1EL 4WHDA 5LQBH 2F7IA 4TOYL 1UM6L 1FVDB 4L8DA 4L8SA 4A04A 1E4XH 1DVUA 3HNTH 1X9UA 2ADFL 5LCVA 2CDGB 4MS6A 4FA7B 2ZSVB 4UBDC 4GQ9L 4NO0B 1EO8H 2CO2A 1ORSA 4OZGA 1MF2L 4FLRA 4QRPE 2CPUA 3DX1A 5E94B 3WIFB 5G4OA 2QV2A 2X42A 2A2QT 3I75B 4J1UA 1JIBA 4ABWA 3ZMNA 2B7DT 3ETSA 2W0PA 5AOKA 3NCJH 3SGEH 4FJ6A 5ICUA 3K5RA 2HMID 4OGXH 4LCCC 2DI8A 4M93C 2I25N 3TESA 3CGTA 5LXVA 4C4UA 2WWKT 1JGDB 3RWGA 2M8XA 2ZCHL 4OZFG 1A4KB 1BM7A 1XGYH 2XN9B 1RD6A 3IXTA 3B2XA 2OP4H 3LEVL 3BGFC 5ETUB 3C5SB 4Z7OF 3M1BB 4Y1TA 3PABB 1DN0B 3FUFA 1F86A 1IEBB 3N44B 3GNMH 5I8OH 5IJCC 5CJXC 1EZVX 1X4YA 3WJJA 4GSDH 2YPVL 3ARGD 4Z7WB 1FN4A 2XETA 4J3VA 4Q2ZB 5B38B 2BZDA 3KYOB 4AUYA 2VZSA 1EFXD 2FL5A 4GKLA 2ZUQC 3HHSB 3RRQA 4GG6B 2ZSWA 4S1QH 2YS4A 3BD3A 3ORJA 1BMZA 4P2RD 5JQ6H 3JV0A 4EF3A 1RJLB 1DVZA 3OSVA 3IKCB 5DQDL 2P28B 4D9RE 1SRDA 1ZVYA 4WUKL 3MV8E 5CFHA 5E8NB 2HVKB 3VJ6A 4FLQA 2Q9OA 5DTFA 1R9FA 3IRPX 4MNHA 1AFVH 4J8RA 5DEGB 1I8KA 1IT9L 1KTBA 3PP3H 4GT0A 3VNZA 1F56A 3KWVA 5ENWA 4L05A 5I19H 4XTRD 5ID0A 2OCFD 4CADA 1Q9WA 2K6WA 3ZGIA 4Y2DA 1BM3L 1EHKB 1XAKA 3UMNA 3G04A 5JHLL 3PP3K 3QNFA 2RIKA 4BELD 4HOWA 3I3EA 4KI5E 4XXCA 1WP6A 2E86A 3UACA 1WCBB 1G6VK 2FNWA 1ZXQA 4R2GC 3L4WA 4LQFH 2P43B 1I75A 2R29H 4X7FC 1IAIM 2Y69B 1MJ8L 1SJXA 2LW3A 2R69L 3A6CH 1MFDH 4ODHH 2DIBA 1MXDA 3KHOA 1MI5A 1N7ML 3VRIA 1OAUL 4XMPL 5E1IA 1INQA 3B2UD 2TAAA 1J0ZA 5DUBB 3SDCB 2HT3C 2P80D 3AQDA 3O6FA 4DEPC 4KROC 5AAWC 1U8NB 5C70A 3EFDH 3Q6GH 3C2SA 5FHBH 5IVXB 1FAIL 4U1SB 1GGBH 1P7QD 3FU5A 3EYUL 2BHYA 1FNAA 4J3WA 3S34L 3QNZA 1V05A 4IRJA 5IF0A 1XF3B 3L3IA 1OGAA 4GW1A 1B4JH 1C1EL 4QHKI 2CK0H 3UZVA 1HEZA 2Q7NA 3RGVA 3KDPB 3L2NA 1K85A 3SDCA 4M1DH 2X12A 2FLMA 5HI4D 2CO6A 2VDQH 2DQUL 4HDIB 4Q9RH 3CZJA 1KB5H 1F41A 1X9RA 4MVBD 4XR8C 2J8HA 1GH7A 3D7PA 5DXWA 5GZOC 3MPCA 2VLLB 2DD8H 1ORQA 1DANU 4OTXH 3BAWA 4N2OA 3MJ9L 1LD9A 2FGWH 3IGAA 5DJCA 1ML0A 5T5NF 3PHQB 2VTFA 3CFMA 4LKCA 1Q9WB 1OWWA 2Y3NA 5KSBE 4LRIA 4K3GA 4BK8A 3BO8A 3RVVC 1W15A 1P1VA 5BQDA 2JCCE 1OTUC 3MRLB 1VENA 1P7KA 4YHKH 4DSYA 4HUXA 3VI4F 4EKJA 3CZLA 1EK3A 3F7QA 3OKLB 2DQCL 4K07A 5I8KL 3PNWA 3WN5A 4HIJA 1L7IL 3B6SB 4DOHE 5HYJE 4FFYA 1A5FH 2PO6A 1NPNA 3L8QA 1CFMA 4FX5A 1JK9B 3DV6B 4P9HH 4YLBA 1S7VA 1D7CA 4UQ2B 4P3CL 4U3XA 1CBVH 4XO8A 1OP5H 5TDOA 5I8CA 1I8MA 3HB3B 1COBA 1MFAL 5IB5A 2AK1L 1UEYA 3SE3C 2R59A 3DX9A 4P4KD 3CX2A 1N64H 2XPZA 1CFNB 3ARYA 5AAMC 1AGEA 5EB9A 3OG6B 1XGUA 4JRXD 3RDTC 2GK2A 5LNDA 1OAQL 1U8LB 1Z9SA 3VVVA 3HUJB 4B60A 2F74B 4GP5B 1XMWA 4DKDC 4FKHA 3U83A 3MV11 3QZLA 2WZ6A 5HGHB 4NNPL 4PGDB 4B6ZA 3QFJD 1MLCA 2BMKA 3QUKB 4QF1A 3UZEA 4AUJA 3E6HA 1TTCA 3RDJA 3ZE2E 1UG9A 4YHOH 3O2VH 3SDAA 5IFJB 3SY6A 1JPSH 3LSOA 1CB4A 2MTAA 1EVUA 1O7VA 2P8LA 3VFVA 1O9ZA 2P1YA 3BHBA 4HUXB 4W6YB 5TE4H 5E2TH 2E7BA 1HX0A 4JPIA 5SWSD 3DSFL 4G6JL 2R0WH 5E7FA 2DWDB 2YK1H 4FNPA 3E1F1 2F19L 3HG1D 2PCFB 1X6LA 4NPYB 4RISH 3V9FA 4F7KA 4XP1L 2O6DA 4PV8A 5GXBB 4R4FL 5LQBL 4G9FB 2XWTA 3QG6B 1CR9H 3K72B 4R5VA 4Z0BL 2COQA 4NQVB 4RDBA 3IJYA 3ULUD 2X0WA 1VADB 4P2CG 4XC1L 3RTQD 5DMGC 2H32A 2OTWB 3QDJB 2K0RA 1XX9C 4WJKB 2QHRL 1E9OA 4YWGH 2FO1A 4H0GA 2ADJB 4PV9B 4JHZA 2X1QA 1N3NA 1PNCA 2CKNA 1A3RL 3NN8A 3F85A 1F58L 3FQUB 2AGJH 4PTTB 5D1ZD 4UQ3B 3F7RA 4H40A 2CKBH 4AKOA 1S5HA 1XSIA 4PR5A 4M8QB 4P59H 3VFOA 3AM8A 2APWA 3T6QC 3CMOH 1QSVA 3IT8D 4QRQA 4RGOL 4OUUA 4L9LB 5DHYA 4XCEB 2MPAL 3MACL 3LQAL 4QRTB 2B4CC 4TQ8A 1A4JB 3A47A 3D09A 3QFDA 1P53A 4IDJH 1NBZB 1INQB 4PJ5E 4FYRA 1BQRA 3KBPA 5JO5A 3V0GA 4JMXA 4GQZA 4JANA 4WGVB 5IUCA 1I7TA 3T8MA 5C9KA 2BERA 1SMAA 4GFTB 5F8QC 1YEHH 3MAWA 3IMWA 2ZP0T 5EPMA 3KWUA 7TAAA 1FO0A 2XSKA 5CD5D 2Z92B 4BSJA 3CH1A 1L5GA 5EU3A 3REWA 4EN2A 5DEZA 1T7VA 2DWYA 5IHUH 3RWFA 5IROC 1WCQA 1JHKL 3FF8A 3G04B 3T71A 3VXUB 2VUYA 3IMBA 5EWIL 2C3XA 3SQBA 2VLKD 1BBDH 2B59A 1KCUH 2HRPL 3STBA 1B88A 3SDCD 3MRDA 4K7PX 5DQDH 3S3DB 4MDJB 3EBAA 4Z3GA 3WELA 2DRUA 5CF3A 3LMJL 1PYWA 1TU2A 4NC0B 4OJAA 2AEPH 4CBPA 2MPVA 3EGXB 1EZVY 3QQ3B 4LARL 2WLLA 2WY3B 4N24A 3ARGA 5CCHE 3WKPA 2FBJL 2LABA 1NCDL 2G2RB 2WNKA 5AB1A 5FCUH 2O61A 2NR6A 4F24A 1JV5B 4P04A 3K6SB 2VXVL 1GYCA 5M94B 4YX2H 5B3NA 1YNTA 5E9NA 1CO1A 4NYLA 4AQ1C 1DL7L 4AEIH 3W9DA 1IE4A 3CNKA 4CGTA 4XNBA 3DMMC 3MR9B 1GZQA 4OVUA 3C09B 4KWUA 1JJUA 3VWKC 4K7PY 2EUZA 3PL6A 1D5XA 2IJ0C 2VISB 4FA8A 5AZEH 3L9EA 3FONB 2APSA 3WEMA 5KZCB 5DQJB 5F0MB 2I32A 3IETA 2EE3A 1K9TA 2MQ0A 1IGFL 3ARGB 3MYZA 4B3EA 5I1DB 2ATPA 3BGFB 4AH2B 1GMIA 5M95B 4B9FA 2X4OB 1G1OA 4N8VA 3W0WD 4BFKA 1EUUA 2DYPB 3LD8B 5DURD 4R7VA 3HRZC 3MRDB 4GXUM 1SBSL 1ZPLA 3IJ9A 1B2YA 3WJMA 4EN3C 3RURA 4IS6A 3ZE0F 4XPFH 4K71B 4ZX5A 2VMFA 3CFNA 1MG2C 4CSZA 1QACA 1X3DA 1Z3GL 4OQTH 3H4HA 3RDTA 1XGRA 4PLNC 3KDMA 2ZSVA 4BWWA 4NWTH 1N0XH 2A0LD 5LBSA 1A02N 4APXB 1J48A 3KPMA 3K7UA 2NPLX 4ICXA 2DD8L 5KSAD 3BUQA 1ZLSH 4L8DB 1OM3H 5A16A 4AZ8B 3C75A 4ZD3H 5F3HA 1RZJC 5EA0L 4Y4FC 4Y2LA 3VG9B 4TL4A 5INCB 2EEFA 4XCEA 3OMZA 4E0RA 3KYMB 1PKQA 2K78A 4P4KA 4L3EA 2IAND 1HHHA 1UT1A 3G9VA 3WBDA 1YEDA 4I0CC 1HNFA 4DQOL 1OT4A 2BSBA 5FYLE 3FXIC 4N8PA 5ABAA 4UOZA 1KBGL 3INUH 1T6VN 3BSZH 4G11A 2YAPA 5CIPH 2Z93B 3CQQA 5HHOE 4XPHL 1XH3B 3NZSA 4N2IA 2QQQA 1A5FL 4NC2B 1NC2B 1YSOA 5FLVA 1DUZB 1FPTH 4I0PC 1VFBB 4YFLF 2HX8A 3AG1B 3OKMA 4CVZA 2FEDD 3PP4H 3X11B 4OJFH 1ZDSA 2GSMB 3ZBMA 1QNZH 1QR1B 5D7JC 3CC5B 4NQQA 4F33A 2P52A 3FQRB 1F4AA 5C9JA 2H4EA 3HZVB 3ZTCC 5CD5C 3QEQA 1EEZA 3KJ4C 5D5MF 1T3FB 1NFDA 2PO6C 2V37A 3VM5A 4N0FA 1T1YB 3CHSA 2P5WE 3MLRL 4LASH 4A2EA 3D4CA 2UXGA 1YNKL 5IB2A 1J9TA 3LHPH 2DTML 4Y16C 4LBAA 4QNPE 1VPOH 2MHAA 3L95A 5I1JL 2EDQA 3Q2VA 5C8JB 2V8LA 5CJQH 1DUZA 4XTRC 1LO5B 1FFPB 3EUDA 2JKIS 2NXZC 3K2UH 1URIA 3QFJE 2A73B 4TQEL 5LVEA 1H5BB 5E5LA 4M7KL 1YHPA 5L9DL 2CIKA 4UU9B 2RACA 2JV6A 3J2PA 5FA4B 5CP7B 5D9SA 1U33A 1VEPA 2ADGA 2K3TA 2F6AA 1QHQA 2A5UA 5T5FA 5ESAB 3DGCR 4QXUH 3QC5X 4DGIH 4BKSC 4DK5A 4KKBC 5AZUA 1YPZB 3MCLL 1IGYA 4QXTB 4LRNL 2F9BT 4OU3A 4GLRH 4ZUVB 4XNMA 2R9HC 4DETA 2CO3A 1I3GH 4KOBA 1OT2A 4HC1H 4G8AC 1L9TA 4JFPA 2ICES 5I8CB 4B9IA 3OR7B 3I02B 4H1LA 1AIFB 2YD7A 5MEQB 4BA0A 1SBBA 1EGJL 5A16B 5CGBA 3RVXD 1HQ4A 5I5RA 2HVJB 2QHRH 1V3MA 1W72B 3QJTB 2KDYA 2RB8A 3H3BC 2D3VA 1ZVNA 2WNWA 4F2MA 2PP8A 2EE6A 2WB1A 1ODAA 4ZS7H 3T2NL 4N5UA 1J1OH 5CZVH 4AVHA 1L9RA 3GI8H 4FQXA 3GLAA 2XWJB 3LDBB 3M46A 4P59L 5FHAH 4MYPA 5C0CA 1GZPB 5C07E 2Z91B 3P69A 1WUZA 1IM3B 3MACH 4PB0H 4QXWA 1AS7A 3TEZA 3LS4H 4OZHB 4UZSA 3BWSA 3H1ZA 1WO2A 4TNFA 3C2AL 5HHVH 4JY5H 4P0DA 3RY5A 1D5MA 5LGJB 1TZIB 3TGXA 1TQSA 5KAQG 3EJJX 3PWUB 4FQIL 4G9DB 3UO1H 4FNSA 4PRDA 5IBTL 1DE4A 2CO6B 1T5XA 3O8XD 5EIIG 4F57L 2ZOOA 1OB1B 1GIGH 1C7SA 5D7HA 4WI3A 3ZK0A 5JDSB 4QEGA 2J8UF 4JZNB 1N8ZA 5JZ7C 3FAXA 1N4XL 2H3NB 3K3QA 3TN0A 2X1WL 2JIXD 4Y4KD 3MUZ1 4Z76A 1I1FA 3E3QC 3WTUA 1OP4A 1XF3A 3IDIA 3BISA 2Z8WC 4YDJB 3VACA 5C0FB 3ARWA 3HG5A 4P49A 4GH7B 3M45A 5D7EA 3PWVA 4P4RB 2ATAA 1FYTE 2V2WA 3OPUA 5H37G 3KLDA 1KN2H 2HN7B 4LKXA 5FM5O 3ZT6A 4XOCA 4BGLA 1FLRH 4B3VA 4JM2D 3NQKA 5D6DC 1MWAH 1I85A 3MRMA 3PWLA 1RLWA 4DVRL 4ZTPL 1OP3H 4XWOD 1ZTXE 3VUAA 3L3KA 4QY8B 3SZ6A 3WXVL 1G9HA 3KYAA 1JTTA 2BZ7A 2XG5A 2JFCA 2EACA 5LCVL 2XV0A 4D3CL 3QORD 3QEHB 3RL1A 2G3ZA 3PAVA 5DJXA 1I3UA 2IVFC 5EIQA 1ADQA 1D6EB 4FFZL 5D71L 3W81A 3IU4H 4ZXBA 3BLBA 1NM9A 3WEXB 2GBVA 5J06A 3L9RB 3IBEA 5JUEL 5DD5L 3OAZH 3L2MA 4ZAKC 3R18A 1WTLA 4JDVA 4RMTA 1MNNA 2Q5BA 2CU9A 3QAQA 1JPTH 5D2LA 4ZRGA 2IGTA 1U3HA 4OBRA 2VXUH 4PCTA 4XMVA 1MCFA 4XMWA 4K9JA 5KANI 3KPRB 1KTDB 3UJIH 3BH8A 4YO0A 5HHME 4P5TB 1Y0LA 5AVYB 3B9KB 4U6XB 4BGDA 2O93L 2XG4A 4P23B 3CVDA 3FT4A 3PWNA 4NIKB 5CO1A 5ABZA 4RRPA 4XPFL 4C4KT 3FQNA 1NFAA 4MJHA 2ID5A 3ASOB 1O75A 5BV7H 1I1FB 4HSQA 4TV3A 1U8CA 2EDTA 3CZSA 2VSMB 4G7SB 1S2EA 5FOJA 1I9IH 2OR7A 3EKCA 3H9HA 4LZKA 4PI2A 4APQD 3TEWA 1IEBA 2PTTB 4UCFA 2EQDA 4O9HH 3U0TA 1HQRB 1MOEA 2JCWA 4QRRD 2PKDA 1NBVH 5ETUA 3RNQA 3EJZD 4GG8B 1PD1A 2EAEA 4ZQKB 3SE6A 1EWHA 5LGYA 2OZ4L 3VXUE 3MV7B 4OD2A 3O6LL 4FF9A 2XWTB 3QG6A 4FD0A 1OO2A 3JWDH 2WQXA 5GGSY 2C4XA 4AK1A 2L4OA 1CGWA 3B1UA 2Y6TE 3KW8A 1S8DB 1F6FB 1AD9A 1Z9LA 3HA0A 2Q6WB 4BD4A 2EUWA 2B4CL 4JCMA 4H2AA 2JQMA 4X5WA 3H42H 5EBWB 5DLLA 3SBRA 1TENA 2N59A 4QOKD 4NI3A 3ES6B 5I9QC 5D1ZI 4YHNA 5HD8D 2YWYA 1G43A 1L6PA 4LGRB 1WFUA 5GHWL 2PR4H 2W95A 3O6ML 1TYRA 4PJBA 3T3PE 1T4KA 3LH9A 3PP4L 4KK9D 5MEPA 3EHBB 3RGBA 3LZRA 1EAQA 3OWRA 4UT9A 2JMRA 2EIDA 4QJ3B 2ZJSH 4I18B 2CLVB 2IV9A 5LWYL 1KBBA 4XAKE 4AVIA 5IB1A 3PL6D 1E8XA 3MOAL 4KKQA 4KTYA 4O2EB 4EI6B 4MJ5A 3AGVA 3D4ZA 3N40F 5T5FH 1L0YA 4H8WC 4GS7C 5IY5B 1CD1A 1GL4B 2FSEA 2IBBA 5E1GA 3V6BR 1NICA 4KGLA 5SWZA 1FZJA 4LLDB 4BK4A 1ILSA 1YNKH 4G6FB 1BFVL 1EAOA 4YHLL 1FFNA 3EYSL 3SKMA 1FNGA 3H9SA 1DJHA 3S4SA 4F3FB 4G3YL 1UFUA 4JFOB 1FFPA 4C56D 1NLBH 1DCEA 3FRPG 1KGXA 2C9AA 5I17B 1NSNH 1KUMA 3DGGA 3RIFK 3LTVA 4A2DA 5C0RH 4GRLD 2NTSP 3SE4A 4RAUA 5D2NC 4PG9B 4MQSB 2QLYA 3LV3B 5JIDA 2EH8H 2YMTA 1DQMH 3MN8A 3DSNA 4ZUWB 1ZT4B 4NO3A 2DYSB 1XR9A 3MLZH 3V79C 1F11A 4LRNH 1RUQH 3MDJA 3G6AA 4QCIB 3DDFA 3I2CH 3N9GH 3DGDA 3IAGC 4I5BA 3U48A 2XA8L 1MFCH 4G2AA 2DQMA 2KQNA 3CUPB 4PJBF 1G7PB 1FGNL 5DGQA 5HJBA 1OCCB 3SY0A 1H6FA 4J3OC 3QCVL 3E7JA 2BIQA 2YGNA 3BX7C 3QEHA 4TSBL 3RL1B 3TPUA 4DKTA 1P4LB 3QWRA 3TM6A 1KFAH 5I82A 1LMIA 3MLXL 4IRZL 4X0KB 1LP9F 2I07B 4GQQA 5K9QG 5DZNA 4KJPD 1KIQA 3FUKA 2V2XB 4F8LA 5IIEA 2Y4SA 1HAUA 25C8L 1MHPL 2Z1KA 3VQ2C 2NY6B 3AUVA 4I3SH 2OMWB 1UOWA 2MMXA 4HETA 1UOLA 4DTGH 4P5MA 4FHKA 1BZOA 4XC3H 4GAJH 4N2GA 1BBJB 3TJEL 3GJFK 3LS4L 3GIVB 2G5BA 2VLJA 4X4MA 4ZSOE 1MCKA 3F64A 3P2TA 5CEXA 2V7NB 3C2AH 4ZYKA 1YNLL 1PD0A 1NMBH 3DETD 4F9PA 2XFXB 5TGBA 1B4LA 3BEWB 4M6MH 4ANVA 3T77A 4PCYA 2FX7L 4E0RB 4HPOH 1NAKH 4L2YA 1JOIA 5EF2A 2RALA 2XN0A 3SDYL 1SLWA 2AJYL 2BHUA 1OB1A 1PU0A 4G8EA 3F7PC 2ICWJ 2GHWB 1JHLL 4TS6A 1MELA 3X1BA 4IBQA 1IBYA 5DZ9A 3O3EA 4LLYB 4I48B 2E3VA 3B8YA 1ZLEA 4MZIA 1LILA 4QT5A 1QHOA 4QRUA 4Q58C 4ONOA 2XUWA 3GK8H 3IJSA 1V7ML 4QYAA 5FGSA 3TNMB 5JQIB 4HHGA 4O58L 3NACH 3V6ZB 3WS6C 1NUDA 1XL4A 2E8ZA 3O4LE 4GSRA 4QHUA 3T4AC 5B39A 1KY6A 2XIDA 4ZFQA 4HIXL 3QFJB 1HOEA 4NM8L 1MCWM 2VDMH 1XB3A 3F7YA 2XXFA 3DO7A 2ZNWA 4R83A 2GIXA 1DQJA 4P46A 3MLTA 1YY9D 3QJZA 5BV7B 3N41F 5JW4Q 5TF0A 1YA5A 2C7UB 2DBLL 3RP1A 2UZPA 4A1RA 1UOKA 4UANA 3LZOA 5AYUL 3NGBB 2A9ML 4KKRA 1NAMA 2K4WA 3HI6H 3DROA 5EOCL 4IK7A 3O3AA 5JIMA 3BIAX 4GG6A 4J2XA 3FCUB 1BVZA 4XNXH 4HU8A 3HN3A 4ALAL 2B08A 4JPQA 3K8LA 2FTAA 3HCVB 4HWNA 2R51A 2A6JB 3EBIA 3RWDA 5AW4B 2J72A 3NH7L 5D4HA 1UM5H 3BZ4B 3IGUA 5CUSL 2EDWA 3OLDA 4GG6F 1X5IA 3U7WH 3F6LA 3K6SA 1YMHB 5L0QB 1C9SA 1Q38A 2DKSA 1V3JA 3FBKA 3QJHA 4FYTA 4Y4KB 1ONQA 2DB8A 4ZMYA 5KVDE 3SKJH 1A14H 3T1WA 4W93A 3WNOA 3L3JB 3IXTB 4PJ7E 3MREB 4FXKC 1AGDB 3RZCA 2NLJA 3MUHL 1VZHA 3C5JB 4NJAH 3MLWL 2H8PA 1QYGL 5F7BA 2GBUA 2GTWA 4CDHA 3JT0A 5KYYA 1TEGA 5LHDA 4J3BA 3RKPA 5TK2A 3WS3B 2MHAB 3KYNB 1KDIA 4OZHE 4LCVA 2BNUB 5DVLA 3WXWH 1EJFA 5E8EB 4P4KC 3RUGA 1KJMB 3I74A 1PEZA 1RURL 3V7MA 4D8PA 2ZUSA 3ILPA 5KSUB 2EKSA 1HNGA 1FVCB 4PJEB 5KANG 4X5PA 2F5BH 3NEEA 3IFPA 3VFWA 5K9OB 5EU5B 5IMOA 4AGPA 2BVPB 4OT1L 3UABA 3CH1B 3CBKB 5EU3B 3REWB 4WFEE 1DLFH 1KJVB 4KZDL 2ORBL 1SVZA 6CGTA 1BIHA 1U3HD 2RBLA 3WFDL 1FF5A 3L17A 3X14B 1KOAA 5L2KB 4Y4KA 4OZ4A 3QJHB 4AIOA 1BPLB 3H9YA 3NJKA 3QNXB 4G1MA 3QFDB 1D9KD 2Q8AH 4I77H 3EXJA 3QDGE 5DK2B 3ZMRA 4LCYA 4WEBH 3AJ7A 5MEOA 5AAPA 2YQ3A 3OJDB 1QR4A 3RKDC 5JQHC 1YQVL 4X50A 5EV7A 1AHKA 4GINA 4NZTH 3IPBA 1WZKA 4YNYA 4PMFA 2WW8A 4CJ0A 1F3JB 4GAFB 2YGPA 2EKJA 4MXQD 2VXQL 1AQDA 1X5YA 2UXTA 4A6YA 3W11D 1N7MH 5IGXH 3J07A 1YN7B 3FS9A 3FL7A 3REVA 2A6KA 1LVEA 2GBTA 3BKJH 1XGTB 5DUJA 1ZHNB 5CLZA 1ODUA 3OKNB 1MFEH 3T3PF 4NUJB 5I1LB 4NT6B 3D3VB 3GM0A 1XQ4A 5ISZD 4PV8B 3IDJB 1PIGA 3HG1B 1U2HA 3ZKSD 1EEYB 1QSEB 1RJYA 4MDIA 3LXBA 3D2UD 1UZ8A 5JHBA 1Z9MA 1JF1B 3BT2L 3I9PA 4NFDA 4A7GA 1SYVA 3GRWA 4N2MA 1ZOXA 4XO3A 3JVGA 5JW3L 4QWWD 4XB3A 1HZLA 4JMNA 3L4XA 3PIQA 4Y4FB 4ZOEA 5HHMB 2BSRA 5IJVB 1D5BB 1PW3A 3QIUA 3GS0A 4M1DL 4X5QA 3L1FA 3FT2B 2XDHA 2FAUA 4NEHB 4YLCA 2EP6A 2EYTA 2P8LB 3SBWC 1RJZB 5T3XD 4X7SL 3FPXA 1I4FB 3X13B 4DK6A 5HYSG 2DM7A 5GZOD 2XRAH 3LZFL 1HFUA 3KH3A 4AT6A 5L4FA 1N6QL 1D7BA 8FABB 3OV6A 4JPSA 3P0YH 1UD8A 2AJSH 2Y9RT 3D9AH 1S9VB 1S7WA 2GQHA 2YXMA 3MRRA 3L5WB 3OD3A 3GBMH 4F7PA 2WZAA 1AZVA 4O2CA 4LPVA 4OCSH 4RFNC 3A67L 4O51A 3B43A 3QUYD 3K46A 2IH3A 1W9XA 3O0RH 5I9QB 1T5WA 2IPTH 2VM9A 1IILE 2YEQA 4GIOA 3UERA 1D3CA 4IRZA 3IXAB 1KIQB 1WT5A 3MV7E 2B9BA 1Z0NA 4YK4B 4X7DC 5KVMC 3CWGA 3DX9B 2AAVA 2ENJA 4Y9EA 4YSCA 2OAAA 5KSAB 3LKQB 3FTGB 3PV7A 4UIMB 3CBJB 4GKZB 1M3IA 3D05A 1BJMA 1EAJA 1HCYA 1JDDA 3FO2A 1UD3A 3DTUB 1I1YB 4JPKL 4L4TE 1WJ3A 4P2OB 3WE6A 4A2MA 5KVEL 5CP3H 5HGAB 3U4KA 1MFAH 1P84K 4YFEA 2DTSA 2FATL 1T89A 4KMTL 2Z7YA 4OF0A 2OZ4A 4X42A 4WTQA 1SFDA 3ZTJG 3CDZA 2YPKB 2J6EL 5DC2A 1ZTXL 3GM8A 3T09A 1A25A 1MHCA 3D18A 1M7DB 1SN0A 4FG6D 4X4YB 1FNEA 3MBWA 4OCWL 3V0JA 5T3XE 3N0AA 1OGAD 3R7QA 1R3LA 4H8UA 4PQXA 3GBLA 1CLCA 5BRZE 4LKCB 1T7YA 1JAEA 4YSOA 3SDXB 2EDFA 2BVTA 3VDCA 5KYXB 5D4JA 2H6PA 1NQBA 3QPQC 3WKNA 1LD9B 1N5AA 4XZUA 3RVWC 5KJ7E 3ZR6A 5FB8B 5HYIA 5DJ2A 4AUUA 4FDWA 4NJ9H 1N2RA 3PV6A 1QG3A 2IMNA 3FMGL 3AITA 1WZAA 5ANHA 4HJJH 1EFQA 4CMHB 1WAAE 2OXHB 4H1LG 43C9A 2V0AA 2NY7H 1FZJB 2UWEA 2BNQE 2OR8A 4G9FD 1HYRC 4RNRB 1WZMA 2OYPA 4LCWB 3VFMA 4AXWA 1TO4A 4G59C 2NRDA 2QSTA 4H5SB 1UZ6F 5DWPA 2FO4B 4N0CC 4QRTA 3DUSA 5I1EH 3JYCA 1XFPA 4ZUUA 1NJ9A 2JNZA 2JLLA 1HXKA 3AU1A 4YBQD 4BFIA 1E4XL 1WIPA 1CDBA 1Y1UA 4GRLA 1UATA 1HK6A 1AHWB 1XD0A 1JUFB 3MJGX 4M29A 2FZ3B 1PIFA 2JK5B 3TFKC 3NP3A 2DYPD 5FDYA 5I1HH 3ML8A 4G8GB 4BUGA 1S78C 2VRKA 1QUPA 2VOTA 3CQFA 2CIIA 1EIBA 1MDAA 4WV1C 4YHNB 2X6MA 3N1QC 2FIKB 3HI6L 4LLVA 1SXBA 5I16B 2XLLA 4GRMA 5IR1A 2D31A 4D9LL 4DHLA 2FYVA 4JY4A 4YVUA 5FV2A 4IIQC 4UNVA 4JBSA 2IANA 3QUXD 3WY1A 2YA1A 1ZD6A 4Q14A 3NABL 1AHWA 2QPDB 3DMMB 2IQ9H 2NYKA 1OW0A 2R2HA 2KPNA 3VX1A 5JIHA 3S3SA 2GSIB 4U0RB 4MWFB 4A67A 1HL5A 1NJ9B 1NEPA 1HCZA 4OD2B 1LEIB 3EOTH 3BPCB 2X41A 3VW3H 1GW0A 3P4MB 2GEEA 5BMFH 5JDJA 2WN2A 4ZO8A 1FE8H 1W6WA 4JRLA 4ODUA 1CG9A 3CSTA 3TV8A 4OF5A 3G5YA 5J6SA 1JV2B 4PRAA 3TJHC 2XI9A 3WXWL 3BAIA 3QAZB 3VGBA 2QELA 1A1OB 1PZAA 2BX5A 3NJFA 2WVVA 3AFLA 4PJCE 2GYSA 3O41A 3S2CA 4DKFH 5AVVB 4U1IA 1UXSB 1FN4B 3HN8A 3FOMA 4BHUA 1LK2A 3GJEB 1EA9C 4KV5F 1BZEA 1E5BA 5DCCA 1DLFL 2J8UA 3MRBB 2HG0A 4K15A 5C86A 5JOPD 3BESR 2JWYA 4XBEH 3VFGL 4S1RL 4YDIH 3LZLA 5DMGD 1BAWA 3B37A 4UZGA 5I19L 4NZJA 1E3XA 2NY5H 4PJGF 5F6IC 3O4OC 4HS3B 2YEVB 4I9WD 4S1SH 1BZ7B 3HE7D 4UUJB 4M5ZL 4WI2A 2GG1A 1MCOH 4QHLB 1ACXA 1KXTB 1N6UA 2IIJA 1USZA 4JGMA 1XF1A 2CDFB 3P02A 5DHVB 3VXRD 4LQFL 4OFPA 3WDJA 1XH1A 3V6OC 2XV3A 1TVHA 3BFQG 3V4PL 4P46D 3AREB 3HC4H 2CHXA 3CIAA 3ATDA 3HZYA 1IGCH 2V6HA 3HAEA 5H2BB 2NY0D 2Z7ZA 3VXSB 1KSRA 1CXEA 1WF5A 2WO4A 4WI8A 2Z4TA 3ZXAC 1TTUA 5HJDA 3MRMB 3CHRA 4L5FH 2KLSA 2CDGA 1YN6A 2CBOA 4DJMA 1MFEL 5F88B 2JELL 4IBUA 3NCEB 2IWKA 5AW1B 3VFSB 5CXPA 5JXEC 5C0EA 4HAGA 5T1MA 2AJ3A 1M6OA 1TJXA 3QO1A 4PD4J 2OK0L 1GS7A 4PWKA 5L6YH 2X28A 2Y0SA 3NP4A 4ONGH 1KB5A 3PXJA 5J6HA 3RUGF 2X6VA 3T6XA 1O5DT 5F44A 2XYBA 2DQUH 3X3GH 3L3HA 1ACCA 3AQZA 2NW3A 4XBPB 4FXGB 4N2CA 2R1XB 3IDXL 4KRNA 3RGVB 1HEZB 2NX5E 4P2OD 5K1VA 4N0YH 5J6HB 1LEGA 1GC1C 4PGEA 4OTXL 1SY6H 3SD5A 5D2LE 3Q8BA 2KT6A 5IWLA 1HHKB 3B5HA 1ITCA 2UZXA 4JG5A 4LCIL 3RIKA 3QNZB 3MOBH 3MV9B 2WAHA 5C0EB 3MFGB 5D7LE 1X6NA 3GUFA 4ZMTA 3N50A 4GI8A 3V4VB 4BWUA 3RLSA 5E6UB 4M1GL 5IB3B 1KBVA 4WI9A 1QFWI 2X6CA 3ARPA 1T2JA 1MCNA 1NM4A 4XN1A 1IIKA 5HYFA 4NRYA 5D7IE 3VXSA 4YSUA 5HHXL 1GSMA 3WY2A 3UAEA 4G8FB 5EZLA 1MY5A 3TIEB 1R5IB 5GZOA 1XXDC 4RZKA 3RX7A 3I6KA 4LCUA 3THMH 2BNRE 5CN2A 1BHGA 1NCUA 2BZCA 3MV7D 4IMKA 5H94A 4BZYA 3IMRA 4NKOA 3CX5J 4Y4FD 1DHKA 2HJLB 3VXTA 3ZDWA 4GW5B 2BIMA 2Q8BL 3IJHA 5DQ9B 2EXYC 3ULUL 5GRYA 2OMVA 4U7SA 1JFQH 1KYUA 4AQAA 4FXLA 4G6AD 1UA3A 3MX0B 1I7RA 1ZT1B 4IIZA 4LU5L 1RJLA 5FGBA 3UBFA 4ZG1A 3NDZE 1KB9J 4NNPH 2ADGB 5IJDC 4IMKC 3OWEA 2G9HA 1FDLH 1NDGB 3CZNA 4QWWC 1LE5B 5K9OA 3UIZA 2WVVB 4YDKL 2R0ZL 1QNIA 3C60A 3E1ZA 1AGFA 2K70A 3ABMB 2X1PA 3RUGB 2VE6B 4AQ8A 4D8PB 4XX1G 2BO0A 4MJIB 1QSEE 4X6CB 1AZRA 1KCVL 4NIYE 3WHE1 3VTMA 2X4UA 4XAWL 4BEIA 2F58H 5E2TL 3HB3D 5KVDL 3VXMD 4AGLA 1TCMA 2WKGA 4A7UA 3DK2A 3WCYA 2CGYA 5T1KA 2K8QA 3ETBJ 3WKYA 3DBXA 4YDVA 3GI9L 4ANUA 1FUNA 4XPGH 4L8CB 4QXUL 4KQ4H 1O6TA 1MCDA 4OFYA 4PLKC 1PD6A 1MFVA 4YZFF 4F33B 4D94A 1TZAA 2UZIL 2OR9L 5I15H 1MVUB 1ZE3C 3MVSA 1ZHLA 4G6KH 2GSGB 2KMWA 4MD4A 1OALA 4P5TD 2ICEA 4RGNC 4XNQB 4NN5B 2FEDC 3SGKA 5IBUB 3ZYIA 4PBVC 3OAUL 3OKOA 2KBGA 5I1IH 2JSFA 1TR7A 4R6UA 2UZYA 1NC2A 4PJ6A 3VGHA 3QUZC 1RZJL 4G6MH 4NO0A 4FQLL 1E4KC 4IOIB 3D52A 4FA6A 1KGCE 2E47A 4DN4H 5CKAA 5T1JA 5CJXA 1NGPL 2O6EA 2AQRA 2YMXL 3NK3A 2FJFA 1OTSD 4L8SB 2UZYB 1QW8A 4JFQA 1IBGH 4LHQB 3QS2A 4BFBD 1NWOA 4PJ8B 4OCLC 3OR7A 1M2VB 5EUOF 4FABH 3RFZB 4MD4B 4DZBB 4N3TA 1GTNA 5EEVA 2BW4A 4L4TB 4R7NB 5GISL 1ZIBA 4JM2A 3WNMA 1G9EA 5ID1B 4FQXC 3CJJA 3FRUA 3IPEA 4IK6A 5BVJA 1BD2D 1QI3A 3Q1EA 1ZK5A 3H0TB 1CQYA 2X1XR 1KJ2L 2JIXB 2OXHA 3MBXL 1NLDL 4UINL 1I85C 1UJ3C 1PDKA 2W1NA 4M5YL 4WHYG 5I73C 2IC2A 1HE8A 1TSHA 1BQLL 2QBWA 1XGRB 3B8SA 1CLZL 2YAMA 4K71C 4CU6A 1KCUL 2HRPH 2AQ3A 1SQ2N 3D69B 4ZW8A 2NNRA 3E3QE 2WQRA 5I1GL 1G7LB 3K4DA 4Y1AD 4HQQL 4HKXA 3OKDA 1SXNA 1KJMA 1OW0C 5E8EA 7FABH 3JWOH 3WUWB 1DEEA 3QDHA 3FTXA 3VMNA 5ACZA 3NAAH 3LS5L 4RSYA 4WRLA 5JHDA 5GGQL 2H9GA 4JFZL 3O0LA 1LL1A 4ODTH 3FTVA 3DX3A 5E9DD 3BH4A 3W2DH 3IETB 1IAIL 3MZTA 3N42B 3NIGB 5C0NC 3ARXA 4Q6KA 1HKLH 1WYJA 1CLYL 1NANH 1OAJA 3FN0H 4TVSa 5ESQA 5KOVC 2NCMA 2ZONA 4NKOB 4QOKA 3FTGA 4OBSA 3OKMB 5F7AA 3BJLA 1VFBA 5FUCE 4J3OF 4FI6A 1G7MB 2ADIA 2IALA 1JZ4A 2AHIA 4U0RC 4G8GE 1FCGA 2XTJD 2O5ZL 3UJJL 4L1TA 3MGTB 5DFAA 3K2IA 3L13A 3V4UL 2ZXBA 1SJVA 3GIZL 4MLIA 3DROB 3FFCE 3AT8A 1Q0XL 5D8JH 1AZUA 3JTSA 3FB6A 4N6RB 1PBYA 1F11B 1AY1H 1WH0A 2YSTA 3BP5B 5ACZB 4JQIA 3DSNB 3F58H 4ZUWA 4PGBA 1S9VA 2ZX5A 5HHPA 1SJHB 1IGTA 4GW4B 1OLLA 5C7XH 3EH2A 1JZDC 3VG0H 5J13C 3HLAA 4FFTA 1X7SA 4Z7OB 3F7YB 4IIQA 4EMZA 1KYOK 2BRRH 1KIRB 1T04B 5DK0B 1AOZA 2OK0H 1Q9KA 5B39B 3NCMA 5KVEE 4NWUH 5TTRA 3DIVA 1P2CB 5AVUB 2PPCA 4XHJD 1JCKA 2FECL 1MWAB 1IFRA 1CXLA 3GB7A 1OF0A 4J8QA 1LEGB 1A4CA 1SYVB 4HEME 4N0YL 4QTIL 1OM3L 5DMIL 5T3XL 2NY3C 1A2YA 2ZX7A 3FRUB 3HHRB 4PJXB 3BXNA 1QSEA 1EEYA 3B2DC 2EYSA 2HRLA 4HGWB 2APTA 3NEXA 5LKNA 3OX8A 1CFSB 3U7YH 3P0VL 5D2LF 5AB2A 1WD8A 3QZWB 4PJCB 3RJDA 3BVNB 1NFDF 3T1FA 5BS0A 4NZ8A 1BEYL 4UI2A 3HLAB 1X7QA 4JFQB 2V7NA 4ZYKB 3VFOB 1AXTH 4B0MB 4IKJA 2HTKD 2IADB 1BXAA 4EIUA 4POZC 4DVBB 3RWIB 4I85A 2NY4C 2VZOA 2B4CH 1A6VL 4OFYD 4LVHC 1TXKA 2W9DH 4DPAX 2I7SA 3G6DH 5GRVK 3THML 4G72B 3HAEG 3PL6B 2LAAA 5IFAL 1QPXA 3ZYJA 3HAEB 4HCRH 3IGLA 2ZXDA 4LAQH 3ZTNH 5FK9A 5BS0E 3IJYB 3RIFF 3U1PA 4HWBH 4CKVX 4HPYL 1KLUA 4AV4A 4KK9C 4UTBA 5IJKA 2XV2A 5ECJE 4ISVA 1P0SE 5E24E 4EVNA 4BUQA 5EOTB 4DEWA 3X14A 2VLRD 3NSFA 5GRVL 3MGOB 4LO9A 2ENPA 4DGVL 5I6XB 3OQRA 2QZ5A 2XXCB 2K7PA 3HMWH 4OY9A 5JHDB 1E27A 1FDLL 2X5PA 3LHPL 2NT1A 2P8PB 1UT9A 2PW1B 4YDKH 3ARBA 1JI1A 2VDLL 3BN9D 3CFBB 5CJQL 4PG9A 3GDCA 4Q4IA 1NCIA 3LZQA 4GO6B 4XN5A 2EVIA 4C83B 3WE1A 5L4IA 4JN1H 4AQZA 1SN5A 3BUYB 4FP8L 4MASA 5EORL 4QXVA 4RA3A 1TMQA 3LRKA 5EU4B 4M43L 2Y36H 2ZOUA 3ZYZA 2D7TL 5AZEL 1A6WL 3X1EA 4PS8A 4JS7A 4WWNA 2JB5L 3ZIMA 3JYBA 2YKLL 2R0LH 3NIDE 3FFOA 3CFIC 3DUUB 3APNA 2JJTC 3L1OH 2HA1A 1RUQL 1CU4L 2FUTA 3VI4B 4QRQB 1Q72H 4H8VA 4M7LL 4E9VA 1T7ZA 5BO1L 3ZKMC 5F7FA 2QQNH 3TEXA 1M9WA 2HG5B 3VH8G 1DVYA 4O5LL 5TF1L 3JV6B 1BF5A 4I18A 1HH9A 4FQQB 5HSFA 4PJ8A 2HRHA 1NAMB 1BD2A 2Z6FA 3ABGA 4TSBH 5DC0A 5EU6D 3UAAA 1OWRM 1SZNA 2F53D 4ZMWA 5HYJD 3D6GA 1XCQB 2ZWYA 3MLXH 1T2XA 4Y1AB 5GS2D 3UTSB 4DN4L 5D7IB 4KUCF 4AWJC 4G82A 1WQVT 2WQAA 3BAEL 3B7SA 1PFOA 3ISWA 4G43B 5KBLA 1VADA 4LB8A 2YD9A 3RE0A 3WFHA 2GJJA 2DH3A 2HCZX 4MJID 1GGUA 3BPLC 5I76A 3U9UA 1S9YB 3SBQA 4QHNA 5IQ9B 3FZUD 5IESH 4MCNA 2YJQA 4TTDC 5ANMA 5DO8A 5CCKL 1M56B 2WN3A 1YG9A 4PRPE 3HNVH 5EUOE 4Q97A 5JORA 5I28A 4Z76B 1OP9A 2IV8A 4K3JH 5HDOA 2YPVA 5L0QC 4NKMB 3O3EB 2VR9A 3ECBB 3MBXH 1RZFH 1TT6A 3ARDA 3F62A 2C8NA 4NRXA 2B1AL 1DP0A 4FXGA 4KJQD 1ZRUA 2BNQD 4LPYA 5T1KB 1ITBB 1BZQK 2QMKA 4FXKB 2P8MB 3QYNA 3ARRA 5HDRA 1IEAB 1L9QA 4O00A 3T6WA 2X4UB 3NPSC 4WU5B 5FA3B 3G08A 1RVFL 4NRXB 5FYKE 4OD1L 4IOFD 3U4BL 4BZ2A 5BVPL 2X4QB 1WZ1H 1YYMH 3BRDA 1WAEA 2Q20A 2VE6A 1MLCB 2BMKB 4MA1C 5FUOL 3DYPA 4JHAL 4JLRB 4LOFA 2VN7A 2XQYK 4I4WA 3VA2C 2FUQA 4AE1A 1JZ2A 3LNDA 4AQOA 4WJ5A 1S9KC 4N28A 2P5WA 4R90H 3DURB 4ABQA 2WV3A 4LLUA 4ORGA 1QEWB 1KXQA 4YHIA 4B9JA 2X53A 2L7EA 5K59F 4D3CH 5J9PB 1T0OA 2GI7A 2X4RB 3S9DB 1XCQA 4Y1AA 1TVHB 1CLYH 3MC0A 1UQSA 2A9AA 5I71B 3OXRB 5CJOH 2C3GA 2J5LC 1G1KA 1KELL 1F4HA 1SEBA 1MW1A 3RFZC 2ZXQA 3WNNA 5LAXB 5ALCH 4R9HA 4DZ8B 2CD0A 3W3BA 3CCHA 1BREA 3OXRA 1IQWH 1GXEA 2O5ZH 3UJJH 3DVNB 2Y1YA 4JCLA 3VI4A 4PJEF 3WGUB 3EFFA 4UT6A 2IBZX 4XBMA 2AV7A 4Z7UB 2EVGA 1OE3A 1UB6A 3CH8A 4YHIB 4DGWC 1YPZA 5D5MB 3F58L 4HMEA 3VWJD 2HLAB 2B5IC 1PJWA 1HL8A 2YRPA 5EBLB 1JGLH 3BGMA 1PY9A 1BZDA 2R7EB 1S7WB 1H8OA 2AEQH 4JG0L 1IO4C 4LVEA 4J6RL 4JLRA 2OXGA 2YOAA 4XB8A 2GJ6B 2M26A 4GRWE 2XZQH 2ZWNA 5FKPB 5H35B 3IMSA 2G2PA 3S36L 3DX6A 2JH2A 4O9HL 4X4KA 5LG1A 3VQ1C 1A64A 3OPZL 3LQMA 4BKLA 1PLGH 5F7YC 5DMIH 3ZHDA 4KFMA 3EO9L 3FN3A 3L3HB 1AXIB 4LQ1A 2DWTA 2MOQA 5DVPA 2HT2D 2R0KH 3BN9C 1WSST 1P1ZA 1YPZF 2LU5A 3MHZA 1I1AB 4G5ZH 2H2PD 1G1CA 2C26A 3CU1A 4YXKH 1JZ5A 5D4IA 2NZ9D 2EADA 1ZDQA 1U8OA 4G42A 2VL4A 3SDDA 5A2JH 1U21A 3HRZA 4ISVB 2ALAA 1GYUA 1UGKA 2XPGB 3U9UB 1WITA 2DPKA 2Y24A 2ILLA 5AVQB 1IM3A 3T0ED 3VMOA 5DUBA 1NFDE 1H3PH 2O6PA 5CINL 1A6VH 3SBWA 1WFTA 3TZVD 2SEBB 5HD8C 3HIZA 3ES6A 4M3JA 4Y2DC 1C5CL 2VQ4A 4AL8H 5JLZA 3M8OL 4RWHA 1A6UH 4CN6A 5IJKC 1T7WA 1YY9C 4AM0A 2E76C 3NIGE 3RWIA 1MEXL 1DDHA 4OLYL 1KPRB 5KBNC 1U8MB 3W9EB 5C08B 1K4CA 4IGBB 5KW9H 5HDBE 2VDNH 4HT1L 3UYRH 3DO4A 4S1DC 3EF7A 2E5EA 5FAAA 2WXOA 3DJTA 1NCWL 5HHOA 5EC1A 2WKOA 4AXWB 2MTPA 3FFCB 3UTTB 1JPFB 1PZCA 3CVIH 4WW1A 1HTYA 5ICZB 1B0RA 3VCLB 1H3UA 1VLXA 5INDB 4YHLH 3GMMA 2AQ1A 1GS6X 5I71C 2FB4L 3BT2H 1P4IL 2NZIA 1IUZA 3NQIA 3Q8AA 4XO4A 3GHBH 3HN5A 1JRHH 2VW7A 3WL9B 3TF4A 4WK4B 2F1AA 4JFWA 1FVCA 1FV1A 2YD4A 3OR6A 1S7TB 1PY4A 3MRJB 3LIZL 2LGNA 4HUWA 1FWXA 3O9WC 3FH7A 4K7PH 1JTPA 2PPEA 1UXWB 1LTXA 3HC3L 5F72S 3WJMB 4AGOA 4GAAA 1R0AH 5E5RB 1BFOA 4K3DL 1DJXA 4KTEH 2LLGA 2R23A 4PJBE 2WMPA 2XVLA 3BQUC 4M5TA 2RD0A 3QQ4B 5FGCE 4N0UB 1LEKB 1R24B 4L3FA 3C5JA 4HK3N 2XA8H 2GKIA 2UX7A 1Q1JH 5B4MD 3S37H 1AE6L 2P7TB 2Z8SA 3N1MC 4PJXE 4N6RA 3K4ZA 4RGMB 2X2YA 3ISYA 4Y8DC 5GJSH 1R3HA 3OKKB 4EVNB 5DFTA 1ZGLP 3B2PA 1FORH 4EZMA 4FG0A 3HZVA 3P4NA 4IBZA 4HUUA 4OF3A 3MQIA 1BOGB 6FABH 3GSQB 1E7VA 1TEFA 4N25A 4GBXA 3VXQB 5DRNA 2Y2WA 5F7WC 1BD2E 3W11C 3DJ9A 2ZPKL 2APVA 1A7QL 1Y07A 5D70H 4IBVA 1W80A 1YYCA 2XWCA 4LSRH 4PP1D 3E2HC 5KEZA 1PJ9A 5FECB 3CXDL 4XMKH 5F7EH 1XSKA 4WEMB 3TOPA 1CICC 3D51A 2W9EL 1IC7L 4P3DB 4MZ3A 1ILUA 4EI5B 3VYPA 3F5WA 3PGFL 1JRHI 4RH4A 2MSPA 4AGNA 1G5AA 3OL2A 4XCCH 5JIKA 4CUCA 1VGKB 2VGLM 4Z18A 2BHZA 5DZLA 3ZPDA 1OLZA 2JKRM 3NK4A 1W91A 2XZCL 3IDMA 5ICYA 5ITFA 3ZGHA 2C3HA 4I7ZC 3UYPA 3T08A 5ACLA 1YEDB 4BM7A 1VA9A 4OLZL 5IESL 2JB6B 1YO4A 1HHJA 5C0FA 2Q7YA 3FUDA 1KIPB 4C8XA 1E9PA 3V0VA 4R97C 4XP5L 2OKMA 3LJ3A 1UWXK 2FYYA 1W8OA 5F9JB 2AI0L 5I75B 5A6LA 5LBSH 1Q9OA 3T9WA 3WLBB 2P5WD 4LCWA 1QRNB 3NCFB 3DWTA 4KXDA 4YGAB 5E03A 5AVRB 5JHDE 4XNAA 5DEJA 3QQDA 3R8QA 4MQTB 1FSKC 4TNWF 4YSDA 3QEGH 1I7ZA 2NY7L 4MAUH 1MQ8A 3ML9A 3JTTA 4YHZH 2ZP9A 1CE1H 2CZNA 5IVNA 4HWZB 4IBLT 3U1SL 5I1LA 1PSKH 3LVTA 4G7QB 4AIZA 5EEZA 3G5WA 1S5IH 1N19A 1QKZH 4R5TA 2LU3A 1DQQA 4HVBA 3DHPA 1J5OH 2GK0A 3GSVB 4Y2DD 3VYNA 3HOGA 5LBGA 2Q7YB 1HHJB 2WKOF 5F0PB 1KZYA 1KENH 3OZLA 4MRCA 3GZOA 1AQDB 3KNBB 3B9VA 1RIUL 5GRUL 1UM6H 2LFEA 1UKTA 4AEHH 5DLMH 5FWRA 5TQ2L 3MRCB 3T4YA 4KI1A 3TFKD 1OHZA 5HYSA 1CWVA 1RPQA 2ADJA 1U2CA 1PZSA 4XXWA 2E75C 5DS1A 1MIEL 5CP3A 3D0AA 4XCFL 1G7MA 1BZ9A 2ADIB 2VH5H 4WO4B 1HQ4B 1MF2H 3OJDA 3QHFH 4G5AA 4UTBL 3FUHA 3UC0L 1KB3A 5HJGA 1QI4A 3BPLB 4Z8FH 2F1EA 2OSLB 1G7JB 4P99A 4KY1L 1IQWL 4N0CD 5KS9B 3N06B 3MR9A 4ZMQA 4JHWL 1NINA 4N86A 4XCYB 3S5LB 3AADB 3X12A 1XGPB 3NCJL 3TEYA 1G7PA 3GSQA 1EDQA 5HYJA 4AG4H 5F93C 1SYSB 1J8SA 1NEZG 2HXAA 3UTSE 1DSWA 4HJTA 1F97A 4JFUA 2XFGB 2YSSB 2CJSA 3LCYA 5H8DA 3VW3L 1GGIH 3Q1SL 3MLYL 4JG1H 3BP6A 3L5WA 4ERSL 1FYTD 1FE8L 1LO0L 1KXVC 2X3CA 1HSBB 3KPSA 4PJGB 3VGFA 1ZANL 5HI3D 3QQ4A 3SQOH 2BXZA 2O1AA 3QIWD 5GZNA 3DTXA 1TQUA 1GCFA 2CR3A 2VSDA 4JO4L 3GNML 3RGHA 3ZE0E 4S0HA 4PLJC 5F9OL 5F1SA 4PP2B 3MNWA 4FFVC 4JG9A 1JN6A 4M6OH 3EH3B 3MRJA 4Z7IA 3TCLB 2OTUB 2YHGA 1FNGB 1D5BA 3QIUB 2BSRB 5IJVA 4JDEB 1MZYA 3EO9H 2WXLA 4PJHF 3FSWA 4P5KB 3I9GL 4S1QL 3QCUL 5JW4N 3BH9B 2JIXA 4J3OG 1NANI 3PHOA 3Q3GA 1I7RB 1ZT1A 1E8ZA 3LY6A 4I77L 2EEXA 4LPWA 1FZKA 4F27A 1RZKL 3RU8H 4CSTA 5D6DA 4RGNE 5FYKU 1PVHA 3K80A 4JKLA 1L9PA 4KPHH 2UXFA 1YEWA 3B83A 3X11A 3HE7C 1MCOL 2EDEA 2XC8A 2G60L 1EO5A 2AEOA 3VWKA 2HH0L 3ZKQD 1LP9B 1U8MA 1IL1A 5FFGA 3RY4A 1JVOA 3QRGH 2VXQH 2ZKWA 1AZBA 4FFYL 4PTTA 2WQVA 1TJGH 3VRJA 1F6LL 3FHAA 3QUXA 2X1OA 5HVFB 1F45A 3V5DA 1S46A 3BYTA 4NQCA 1KFGA 3B4NA 3QEUA 4GNKB 3ROLB 4W9LC 4CMMB 5FOBB 3FCSA 1QFUH 4PAZA 5KW9L 3GMRA 1SQMA 1UC6A 1FNFA 4FNLH 4DKEH 2WXPA 3CK0H 5ICXA 1NDMB 1ZVSB 2BNRA 5CKGA 5IQ7L 4HWZA 1RUPH 3GSOA 4LLMA 3U4EB 1EV2E 4ZUSA 1AGBA 1K2DB 1E0OB 4MA7H 3GMQB 3X1NA 2X4TA 1FL6B 2M2DA 1CTNA 2WGXA 5D5ME 3GYRA 3V6OA 1EFXA 1G0XA 3MV9D 3GMPB 3MO1A 4NN6B 5C0IA 5IKCB 3RNQB 1CLVA 4LDEB 4E41B 2P5ED 3KXFD 1KN4L 5I6KA 2H2SC 4F92B 5EU5A 5IMOB 4WFGE 1TJHH 5JYMA 3GHEL 2WJ7A 3HFMH 4S0SD 1P6FA 2GJ6E 4Q9RL 4JRWA 1FIEA 1R0AL 5IHHA 5IFJA 5E00A 3RY6C 2B0SH 3QI9B 2ZYSA 4NFCA 3E6HB 1GJUA 1R19A 2GTWB 3KCWA 2GTZB 1ZWIA 4XVOA 4C4KO 3BYYA 4K2UL 2NLJB 2WBJB 1XTMA 4G8IA 4ZS7L 1VGKA 3CZUB 1AE6H 3CFQA 3T0EC 1EBAA 1KJ2A 2ED7A 4RFEB 1IZJA 5EBMB 1BYNA 4P3WA 5DQJA 2D3LA 2I07A 4LHUA 2H26A 4UILL 6FABL 3VU2A 2VDKB 3SE9H 2W0FB 1GZQB 2Q7AA 1YEJH 2DQGH 3T0VA 4EBQL 3P9MB 4EXKA 2V2TB 1BCIA 4DGUA 1AD0B 3GJFB 1WFJA 1YNTB 3QIUC 4FYQA 3P4NB 4KMTH 4P9HL 3TO2A 1BLNB 1GAFL 1XIWA 1YYLH 3FT0A 1JK9A 5C0CE 3W39A 1CICA 4Z7VB 4Z95L 4U4BA 3FQ2A 4MAYD 3LOWA 1E4HA 5K1JA 2P24A 1J8RA 4JFYB 4MQ7A 2B2XH 2ZIDA 1XR9B 3L4CA 3PNWB 4HIJB 4WWKD 2HLEB 2ODHA 5KSBF 2QV4A 1MHHA 1H3TA 2X4RA 1Z0MA 4X4ZA 2ED8A 5L7XL 5D7JA 4ZMXA 2WHVA 4HIHB 4MQ7B 3HVNA 3GO1L 1ZS2A 5C08E 1RZ7H 3ZL1A 5JIQA 4QHUB 4NQTA 3TO2B 2H2PC 4AMKH 4BQ9A 2DYRB 3LQZA 1HWHB 2R0ZH 3FMGH 4FXTA 1TVBB 4EQ3A 4X8JA 3TWCH 4JGUA 3O9WD 2Z92A 1FO0B 4GB9A 3MV8A 2Z8VC 4Y5YB 1JPSL 1LLAA 4GRLC 4JANB 3CHOA 3DOIA 4FXKA 2DOCA 1INDL 2DLFL 2XN9A 3BKCH 4PJDA 3I6LE 5C1MB 3EUUA 3ECBA 5JHDD 2VXTL 3L3OB 1ZXKA 3PJLA 1QKZL 3RA7H 2KYIA 1SJMA 1CK0L 3LPFA 1MVYA 3IGFA 1OGAB 4JDZA 3M17B 4KI5C 4Q9QL 4C54A 1HI6B 1QO3A 1QWNA 1G4MA 2JLPA 4PRHB 3RB5A 4OZIB 1NFKA 4PJBB 1NBYA 5MP6H 4OM0L 4XH2B 3EH5B 3AC0A 2J4WL 3CZFB 3OBAA 3FQTA 5ISZE 4OI7A 3ECWA 3V6FB 3KCPB 3AAZA 3SOTA 5AL8A 3STLA 2ZYIA 3ZHNA 1RIVH 1B6UA 4F2MB 4ZMAT 1JZIA 3MZGB 2QZQA 3GSNA 1YNTF 3NABH 2ZT9C 3AREC 2DWEB 4UNIA 4HH9A 1KT2B 3V4PA 1BD2B 4GJTB 4EOWL 4MBOA 1PNDA 3GSOB 2ZCKH 4ONFH 2IANE 1JXJA 4DH2A 4DUVA 4RX4A 4XN7A 3D33A 1BVNP 2DF3A 2NYYC 3EOTL 5GGVY 2BVEA 4OLWL 3RWEA 4F8PA 4WV1A 1L0XA 2GFBB 2OZNA 4X83A 3VFPB 4OGQC 1UWFA 3MROB 3RFRA 2OP4L 3LEVH 4TUJA 2J3SA 2H47C 3QH3A 4FS0A 4PLOB 4RIRA 4DGYH 1NKOA 4D0CB 1I8KB 3U0TB 2Z0UA 4G71B 4J8RB 4MMXA 4UMSA 1B6DA 5DEGA 1WWAX 3D30A 4XNZB 3VFNB 5J1SC 3MBEA 4FERA 4W9ZA 4KV5E 4K8RH 5CP7A 5D9SB 3SQOL 1D7DA 3WAKA 1ID5I 4ZFOB 1Q0YH 2HJFB 3Q43A 5T33H 3G7TA 3TBTB 3FQ1A 3BFWA 1H5BA 2BCKA 5DZOA 3K1DA 2A73A 4OM1L 4HW6A 2ZSWB 5F9OH 1IKFL 4DO5A 1FFTB 1AKJA 2MRYA 3PWJA 3KLHD 2WQSA 4ZOAA 1MFMA 4HQQH 4M3KB 5GGUA 5D72H 1JGVH 3NJXA 1DDTA 3D39E 3HUJA 4TVUA 3ESPA 3B2UC 1AR2A 2I9TB 4OLUL 4TUKL 1HKFA 5CZXD 3AMLA 1M71B 2IH1B 3C09C 4M4RA 4KQ3H 2DIJA 3NRFA 4YR6B 2R56H 5CLYA 2H0FA 2VDMB 1U0QA 3OKYA 2AK4B 1PLCA 4TUJB 4X8GA 1KCRH 2FSDA 4FAAB 4H88L 5FUZH 2FO8A 4LARH 1A4KA 1DZBA 2N3JA 5DMKA 2F08A 1OB0A 3KPSD 2JJWA 3ESMA 2VLKB 4L1HA 4PREA 1VF5C 4G1EA 4H8PA 4Y7MA 4MD0B 2G60H 3VB8A 1HKLL 1J5CA 1RHHB 3BPNB 4KXCA 4Q9CA 4HH9B 4A68A 4PLKD 1YJDL 3DO3A 5BZWA 5IEKB 2PETA 2E7CA 2KLRA 2D8KA 4ZW7A 1K4DB 1WBXA 3ILQC 1EXUA 3B56A 3OB0K 2APBA 1L0PA 1XH3A 3PWPD 2Y5QA 3RNKA 5JW5B 1WBZA 2QHLA 3DX8B 4UT7L 1RZGB 3F12B 4NQDB 4AM0Q 2CDEA 4QTHB 1JK8A 5IT2L 5DJAA 2JK5A 1NIDA 5DJ8B 2DI9A 2H6OA 1FAIH 4LOUC 3HZKA 4HFUL 2ZOWA 4C4BA 4P4RA 2EZ0C 5BV7C 1UTDA 4TLTA 3QIUD 2TRYA 2CAKA 2A4CA 3MJWA 3M17A 3SO5A 3OLGA 1EVTC 1M2OA 1UH4A 3LIUA 1IM9D 4FULA 4TVPL 5FWQA 3QZWA 1N8ZB 4JAMA 4V33A 3VG9C 4ZQKA 1TPXC 3Q2CA 3WSQH 5HHQA 2QQKH 1R3JB 4PPTA 1HQRA 4XX5A 5GQBA 5KWYC 4GUPB 4OJCA 1CXIA 1OCOB 3QUYA 3VWJB 1N6VA 1A7PH 4WUUA 5B8CB 4PIRF 3WI9A 2EDMA 1ZLSL 5D1ZA 4QHNB 2ESVE 1CI3M 1WK0A 2FJGB 2DM3A 3EGDA 3GZKA 2EO1A 2WVTA 3PREA 1KIRA 4XPTL 2X4NA 5DHVH 1NCBH 4YN3A 1I31A 1IARB 4PS3A 2BPBA 3I3BA 1DVSA 3L7FB 3QA3A 1LDPL 3PF2A 4Z23A 5HI5C 1SJHA 3WUZA 2VN6A 2QKIA 1JNNL 1UWGL 4OJYA 5I8KH 1CPUA 4OGZA 2WZPA 2XWZA 4XI5D 5FCSH 4E9YA 2DQ6A 2VKXA 4XRCB 3IK2A 4RGNB 3L9RA 4NN5C 3BSZL 4Y9FA 4W4OC 4HJSA 1CBVL 2G4EA 3I02A 4ZXBB 4X9YA 1NMCC 2IALB 2WUBH 4NX0A 1JG9A 4BDVB 3FB5B 1CQKA 2H7WA 1GAFH 3VQLA 3ULVE 4CVXA 1E9QA 1N64L 1VFAB 5EO9B 1LDSA 2WLKA 3MUGB 1QNZL 1OAQH 4FZEH 2D0HA 3PGCB 3W1ZA 1H0DB 3FK3A 5GS0C 3M7OA 4ECNA 4ZOBA 2BS9A 3WHE0 4ABVA 2HKFH 4WIQA 3G5ZA 4IHBA 3D39D 5CLXA 3BUYA 3D12B 4UYPA 1XV8A 2R1WB 4W9IC 4PJHA 3OC8A 4LASL 1VFAA 2EUXA 2ZOLA 2VN4A 3QI9C 1T2QH 1A7RH 5IOPA 4KJYB 4XN8A 2WQWA 2MCG1 3ZHFA 4JN1L 5C0AA 1KTLA 2VR3A 4YZFE 5C07A 5JDSA 2RQEA 2CRIA 1HE7A 4XP9L 3DOSB 4R96B 3FHQA 1CD9B 1OE1A 1MW2A 1OCZB 1K3IA 2IAMD 2J6WA 4TQEH 5C6TL 4KKAD 2WAQA 3S8FB 3BKCL 5D7IF 5EEUA 2GY7B 1S7QA 3VFTB 5G2NA 5L8LB 4RQQB 3GSXA 3VGAC 1F02I 4ZUTA 2L0DA 1JXDA 3CBRA 3OM3B 2QVFB 5CFAA 2YKLH 1R5WA 3RVUC 4IM8A 1DVFC 1E5YA 5BQ7A 4JNXA 1CR9L 4B5EA 5J8OA 1XSOA 3MCLH 4JQIH 4MA1B 3MLPA 1SGKA 3HCVA 5MP6L 1Q72L 3OAUH 2C9QA 3GC3A 1TPXB 1HN1A 4DIXA 4FMFA 4FQ1L 4XXWC 3QEUB 1BVLB 4KU1A 1ZE3H 2PYED 2YARA 4E5XA 2XN9E 1EGJH 4X98A 1KPUA 2YMXH 1U8KB 4GUPA 3TIDA 2PW2A 4BSWB 2GW5A 1HS6A 1W72A 2CKBL 3DHMA 2G75A 3KL5A 3QVAA 3LQAC 5AW8B 5KVGL 4LOEA 1IC4L 3HBZA 1D6VL 3WUWG 2WIMA 3KYMA 4PJFA 5AKTA 5GISH 1TZHB 2WWMC 1KMGA 4KHTL 2CM6A 3N85H 4L4VD 3V5KB 1JZJA 4YUEL 3JV4A 4ZK8A 1UWYA 4V2CB 4GG6E 2F0CA 3NFSH 4KTDH 4F15B 4Z7VE 4OZ4B 2VQTA 1TQTA 1L0QA 4TRPH 4NENA 2NSQA 3SDXF 1A2YB 1YEFL 3HNVL 4X5LA 4B95C 3PFUA 2PPDA 3TIDB 1BQLH 5DJ8A 3LD8C 5DYOB 1P69B 3VE0A 3NTCH 2V9QA 4ZNCD 1W0YT 4YDVB 1RZFL 4G7VH 3RL2A 5GRJL 2VXSL 5EU7E 4QRSB 3N1FC 1C08B 4ZFZA 1SN2A 1P2CA 1ASOA 4IRJD 5ESVB 3MXWH 3NEOA 5A2KH 2DMBA 2J1YA 2VQ1A 3GF8A 3NESA 4RFOH 1RHFA 3OGCA 4BQ6A 4RMBA 4OV5A 2EEDA 2R2BA 3UC2A 4JZOA 5FUOH 4H20H 3M1CA 1N18A 4O4YL 4NC1E 5KJRH 4W9HC 2AEPL 1T1YA 1VJSA 2D9QB 4ODXA 3CN3A 1XT5A 2FWOB 1T3FA 4A7QA 3CZGA 2FBJH 3HE6D 2YSSA 2WTOA 4FJYA 1JZHA 5FEBA 1CL7I 4XWGH 2HTLD 1M4KA 2WO3B 2R2CA 1S78D 3MGTA 4X6FB 1A6PA 5FR3A 2UY7B 1AGEB 2EIEA 1I8IA 3FYIB 5J56B 5IVXE 1YECH 1AS8A 1OGAE 4K94L 2D0GA 3DXAB 4R5XA 4GI6A 4AIEA 1Y18B 4OZIE 4MFHA 1ZLWH 4KNSA 2FX8H 3WO4B 2G2RA 4X80H 1TVDA 5F71A 3FQWB 4PWHA 2VJ0A 2EIKB 4JO1L 4A7VA 2QR0B 3OKLA 5EZLB 3TIEA 4UDTB 3H3PL 1DFBL 5C7XL 3PGCA 9CGTA 3V6OE 1D9KC 4A66A 1TQBB 4OUOA 3WJLA 4MDJA 1U95B 1FJ1B 4Z7QB 5D96B 5E6IB 5L8KB 1L4IA 4NWUL 5EDSA 4HKXB 1HXYA 5I6XC 1PG7W 2VL5A 4Z3IA 4XP6H 2EIZB 4QRUB 3EDKA 1GHFH 4O02L 1SM3H 3GSWB 5E1HB 4ZFGH 2XZQL 3Q5TA 2DN7A 1Z3GH 5DS2A 2IAMC 2QVKA 3EDEA 4LLYA 4U49A 4ZXBD 3TCXA 3KPMB 2V5MA 3L7EA 2Z65C 3MGAA 2JCCB 4JFFE 3IB4A 1HEHC 4LSTL 4RMRA 1MCPL 4GEIA 2I69A 1CD1B 2CO7B 4P23D 5BVJB 1M6UA 5CD3A 3RX9A 1U3JA 5IMLB 3VD9A 3H7BA 4KI5F 2IXQA 4XBGA 4JM4L 2W65A 1MCRA 4JM2F 2WO2B 4YXKL 1H9DA 2OZ4H 3AW5A 3WJJC 1QO3B 2ERJC 4GPVA 2FGZA 3BQUA 4PIBA 4UQ3A 3QO0A 2UY6B 4Z7NF 3KLSA 3D39B 3IDMB 5ICYB 1JYVA 1LDPH 3RJQB 3KVPA 3X2QB 5CN1A 3QAZC 1E8WA 3EZ8A 2VDKH 1T03H 3V9CA 2EDOA 4JREB 5I1DA 1H3PL 2EDBA 3QZOA 3T2QA 4E9TA 2AK4E 4XNDA 4JKNA 2FLRT 4AGMA 3IJEA 1XWVA 2AQ2A 2XIIA 5C6PB 1IAKA 3R4DA 3L3GA 2AVGA 5LLIC 3EJPA 1URLA 1GKOA 2J73A 3I50H 4U3SA 4A55A 3TPUB 3HZYB 4OZGF 2B15A 3FFCD 3IE9A 1SUJA 1BWWA 1XR8A 1OAKL 3G5VB 3W37A 1KYFA 2AQTA 3SY0B 43CAB 4F58L 3UBHA 5DHVA 2FT6A 3HZKB 4OI8A 1Z5YD 5DVOA 2V9TA 3SGKC 2EEAA 4U1HB 1BJ8A 3HVDA 4HJGA 5LBVA 4R0LB 4UUJA 4FQCH 3ZDYE 3CIQA 3NCBB 4DCQA 2EC9U 2I5YL 1WBZB 3WNJA 3EGXA 3QZWG 3CVHB 4N2LA 1R24A 5D2NB 2HVKA 4MNQD 4LP5A 2X70B 3LSOB 2DTMH 2FB4H 4LEEA 1RUKL 4M48L 1F18A 3VWJC 4WW2B 1R3IL 5TPWH 2UWEF 4FP8H 1B2WH 2R4SL 1SVBA 4YXLL 2ARWA 3T0DA 1FZOB 1FV1B 4JPVH 4R97B 4C47A 2J44A 7PCYA 3NDYE 4HAFA 2JCCF 3RWFB 1IBZA 1YEGH 4M8RA 5DC9B 1NDGA 5DRWB 4LMQE 2YWZA 3UPRA 3CVHH 3DIFB 4NCC2 5K9JL 4KTEL 4GUOA 4P5TA 4DAGH 1E6OL 4AQAB 1L9OA 1M71A 1XCTA 4W9GC 3GRGA 5IVZB 3PABA 1A7OH 3M1BA 1CU4H 3QQ9D 1E5CA 3FAWA 3H8NA 4ODWA 4UIKH 1BPVA 4MX7B 4GBXC 3N42F 4L18A 1MI5D 5SWZD 2P47B 2NUTB 1A47A 4JK0D 2ZNXA 1AQHA 5DT1H 3QXVA 1UOVA 1NMCB 4LOUD 4UAOC 2AF2A 3UDWC 1H6EA 3ZU8A 4J3OH 1VKXA 5IHWA 5KVFE 3QI9A 1T4KB 4PB9L 3FU3A 4PRIE 3WN5B 2YZ8A 1R5IA 4PJ5B 2GHZA 2J1KA 5FO9A 4JHBA 3CXDH 1N0LA 4B41A 1JXFA 2DH2A 2QFPA 4PV9A 4ZMVA 2FIKA 4LLVB 4GRWH 4OZGB 4P5RA 4YSSA 1A1MA 2OMUA 5G55A 4YHYC 4WO4C 4X9GA 3O3UN 3V95A 1ZLWK 5I26A 3WU1A 3TT3L 1IV8A 4N1EA 4XC3L 1GY2A 5MERB 4B9PA 4AENA 2AV1B 2ICCA 4JY5L 2NTFA 1FVEA 3VD4A 1NUGA 5E9AA 4I2XA 4Y2OA 1KGJA 4PJAE 5FO8A 4Y16A 3WOVA 4M1CC 1JGEA 1MWOA 4FG4A 2JVUA 1GOGA 2QVMA 4OQTA 3GLEA 2CSPA 4NSKA 1F2XK 3GXTA 3IDNA 4HIIB 1P1ZB 5C3TA 2AI0H 2XACC 1CGTA 2FO4A 2OMYB 1NAKL 1FZMB 4JVPA 3AAZB 2EABA 3U25A 1N9PA 2D7QA 4X6CF 1RY7B 1N4XH 2UWEB 3SB3A 5FO9B 5SWZE 1M42A 3PQYE 3UZVB 2DQJL 4KHXH 3VGAB 4KVCH 3PWUA 5L88L 1SLUA 4RFOL 1IL1B 2ZKXA 5E9DA 1N2RB 3O2DA 2XU9A 4MA8L 2R2EA 4TVPE 4KRPC 3LYRA 3VXME 3L5HA 1YAZA 4JFXB 3IWVA 2OXGB 2XG4B 3DRTB 5C0AD 1EZSA 2RJMA 3BUIA 3IFLH 4K55A 4O58H 1S5IL 1CFSA 2OULB 1GZPA 4HXBL 4ZTOH 2XT1B 4PRBA 2DDQH 3TYGH 4BA8A 1WLHA 4HIXH 4ZTPH 1JCVA 1K8IB 3VXPB 4PJXA 4YIQB 4X7TB 3WTWA 4HJ0D 4JDVB 5CJOL 4PHZA 2YXFA 3QORC 4IJ3C 3EFFB 1Z6JT 2YD6A 4WKZB 4Z7UA 4WO0A 4U1GC 4MBRA 4X8JB 4EJ1C 1E4KA 5E0QA 4XCFH 3TCLA 4ALAC 3IU4L 3LNGA 1QPPA 2ADYA 2HLFC 1H19A 1IU1A 3DV6A 1WWCA 5C0BD 2C3WA 3B2VH 4J4PA 3HG0A 2YQGA 1KEGL 3IRCA 5SX5H 3ALPA 4JO2H 3LEXB 5JW4M 1OAZL 2CGRL 5CEZL 3C8DA 4QD2E 4F37K 3NH7H 5DD6A 4PJGA 5F1IB 4MVBC 4B7IA 3U7WL 3ESUF 2PPFA 4MCZB 5ESAA 4PRID 1J5DA 4FADA 1J18A 1YMMD 3SCMC 5BXFA 3FSVA 2BVQB 3IE4A 5JW4R 3ULUF 1X4XA 5IP4A 3C6EA 5FA4A 2FLBT 4E9RA 1XB8A 1ZY9A 4FGMA 2WP3O 1XD1A 4JG1L 4ADGA 3IDIB 5I8OL 1SM3L 3AACA 1G4RA 3LEYL 5T8IA 2ITCB 5J1TC 4HV8A 2VSCA 5AOMA 4L29B 3WKMH 3ZKND 1JNLL 5G4NA 1NIAA 4APQC 1IJNA 2BK8A 4NZRH 3AWGA 4HKBB 1RK0B 5EF1A 1UD5A 3FT9A 5JQ6L 2P8MA 2MCMA 5CGTA 5IG7A 1ZV9A 2BP0A 4N90D 1WEJL 4MXVE 2VIRA 4NNYB 2SODB 4PSRA 2XOTA 4RMQA 5I23A 4Z0XA 1NCOA 3FU7B 3GGWB 1YVLA 1SMDA 2GSIA 2JI1A 3GKWL 3WG7B 4J39A 2MQGA 3BQUB 3WFDH 2CCLA 2DJMA 5T1LA 1AACA 4KPHL 4KRMB 1I8UA 2V3EA 3NIGF 1YEIL 2X6UA 2ZP8A 3ZDXE 4HWEH 1T03L 2F5AH 2WLNA 2FEEL 2PXYB 5FIEA 4ZO6A 3U79A 3IN2A 3U0WL 1IC5H 4PRPD 1BP3B 4PS4L 1C5BH 4R26L 2Z93A 2PR4L 1MJ8H 3A6CL 3RL2B 5IK3B 5JA8B 4J12A 4OI9A 4AL8C 1OAUH 1D9KB 1JPEA 1DBJL 4LLMB 3H0TA 3U4EA 5GS1A 4TMPA 1FBIH 3QGVA 2EC8A 5LWYH 3DXAE 5I6MA 1AQKH 1QFUL 1NCWH 3AS0A 5D7KD 1AQMA 3EFDL 3GMRB 3QR2A 5HYQA 4CADB 3T3MB 5JNYB 5JA9A 2Q3ZA 5E6IA 1KIPA 3C5ZC 4W4OA 1G9ML 1Q90A 2IDQA 1TZHA 3O2DL 1JGIA 2HFGH 3OZKA 3ZLQC 2KZWA 2D4FA 1ET8A 2XCMC 1PZBA 2OLDA 3RTLA 3N0PB 1ZAGA 3U0PB 1SXAA 5E8NA 4NO5B 3KPNB 3NSCA 3ZQWA 4UTAA 5KJ4A 1MCCA 3ZDYF 1YPZE 3FPYA 4D0BA 5KVGE 4UM8A 3O2WL 1QVOB 4ELKA 2FH6A 3HPJA 2K3HA 3OKOB 2CUIA 4URTB 4XZUB 1S7RA 3NZ8A 1L3WA 2VDRH 4PG2A 2JTYA 1DR9A 1JWMB 3S96A 3N2JA 5TDNA 4A7SA 5C0RL 3C6LA 1MVUA 5F96H 3JWNE 3RTQC 2YPLB 4KXZI 3FYEB 3ARBB 5KTEL 5K9JH 2DLEA 2PW1A 5CMAA 4L0PB 1RZ8B 1TIUA 1KYOJ 3H54A 3P11L 2DKUA 1Z7JA 3I2CL 3D2UA 2AJSL 3D9AL 4WI6A 4Y9CA 1QTYT 4ENED 1VIWA 3HKZA 1UGNA 3L3DB 4J3OD 1HINL 5HDLA 5DT1L 3B34A 4BSVA 2ZPKH 5KSVB 5C07B 1AC0A 2VC2B 1VFMA 1D5XB 2VISA 4UILH 1KLUB 1AQ8A 1KCWA 3BDXA 4LEOA 5C97A 4OFIA 3L9YA 3EYOB 4EBQH 1MAJA 3I9AA 5A2AA 1O0VA 2YD2A 2PWFA 2XBZA 1YUHA 1JWMA 1MJUL 4DO6A 4Z7UF 2AK1H 1MHPH 2DKMA 4YGVB 2G9HB 1E28A 4ZDHB 1J05B 1PF3A 1QBAA 3TVMB 3N1PC 4RBPK 5KVEH 4PY7A 1U58B 4UM8B 4N0RA 2WLMA 2WBKA 3MX0A 4QJ5B 3HUJF 1G7IA 2MOGA 2OMVB 2J8UE 2QKIC 4LDLB 4XMUA 5KN5A 5FGRA 5BRQA 1XGPA 3D50A 5C6WH 1GA2A 3OB8A 1F90H 1B4RA 5IEHB 3V5KA 4ODVH 1E5AA 1RZ7L 2H1PL 4NKDA 1IVLA 3MRGA 4PWEA 1WE5A 2EYTB 3EH1A 2FCBA 1HNYA 1XCXA 4WWPA 3AXLA 2C9UA 1T1ZA 4YHOL 2CBPA 2IG2L 2ITFA 1YRKA 1P5VA 2OL3L 3FUJA 1F6AB 4AM0B 4ZBJA 3SPIA 5B38G 2XKUA 5D2NE 4E68A 3RDTB 5BUPA 3LN4A 5IK3A 2O30A 4MAYC 3LRSB 3ET9F 4KMLB 3KNBA 3HMXH 4HUVA 5JLZB 3F6JA 4AYBA 2HKHL 1U4FA 2R4RL 3QULA 4XMTA 1NFIA 1TYEB 1U93A 2YK1L 2H3XC 4BFNA 4CRPA 4TUOA 3D85A 5T3ZE 3T8VA 1RI8A 3P9LA 4DERA 1EDYA 1J1XH 1V7NL 3BE1L 4QTFA 4F7TA 2WWNA 3DV4B 4R4FH 3LHAA 3NCWA 5DJ6A 4N2BA 12E8L 2K8MA 1RK7A 5MHSE 1J10A 2WINB 4RQQA 2JI2A 5B1AB 3VXRA 3O8XB 4WFED 3QDME 2AANA 2EYRA 2VYRE 3CFDB 5AOIA 3K0YA 3TF7C 3JTSB 2YRZA 4ZFOL 3DOSA 3QWNA 4R96A 4MMXC 5HGGS 3MRHB 1AJ7H 3GSUB 1V5JA 1P5VB 1E9OB 1GYVA 3RZWA 4JQVC 5T1LD 4BKLB 4KY1H 1WA0X 2F7RA 4KJYA 4ZO9A 3LRMA 4OCRL 5EU6E 2WANA 2EO7A 5GSVB 4S0TD 1E9PB 1JNHB 3WNLA 1LE9B 3HG4A 3QQNA 3UXFA 3DX6B 1CFVL 3IS0X 3SO3C 4Y2OB 3QWOB 1RLBA 3UL4A 1NGWB 1EANA 5I5MA 5DHMC 1U91A 4CU7A 3LN9A 4I18C 2WZPD 3KR3H 1UT2A 2I85A 3TX4A 3KG5A 1GGTA 3H6JA 4ZT1A 3QXUA 2DIAA 2AQPA 5C0JB 4N6QA 1SOKA 2PLTA 4LLWA 3NA9L 2AV7B 4TL5A 5EO0B 4M03A 3DMMD 2LHAA 2KC0A 4PJ9A 4WO4D 5D55A 1IRAY 1JNLH 5GGSB 2J55A 2COVD 5AENA 4O02A 3BQVA 1VKXB 4NZRL 2XX0A 5TDPB 3NOIA 5I6NA 4M02A 4BSVB 1UYWL 2ROXA 2Q86A 4Y5XC 2OL3B 3SGDH 1SDDA 2YFOA 5B1KA 3T4AA 3WNKA 2OTPA 2R1YA 2W88A 3MREA 2DM4A 2F74A 2N01B 2D2OA 4X6BA 4WENB 4AYFB 4KKNA 3L45A 3PQYB 1GGCL 5DZPA 1G6RA 2WMPB 2FHCA 3D06A 1ZMY