4YJZL

Human antibody h2526 in complex with influenza hemagglutinin h1 solomon islands/03/2006
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
251
structure length
234
Chain Sequence
VLTQPLSAPGTPGQRVTISCSGSSSNVGTNAVDWYQRLPGTAPKLLIYYNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCATWDNSLNDRVFGGGTKLTVLQVQLVQSGAEVRKPGSSVKVSCKASRGTFSNHAVSWVRQAPGHGLEWLGGLIPIFSTPHYAQKFQGRVTITADESTNTVHMELSSLRSEDTAVYYCAREIPGATSGPDHFFFYGMDVWGQGTTVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Viral receptor-binding site antibodies with diverse germline origins.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 50
structure length 234
sequence length 251
ec nomenclature
pdb deposition date 2015-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yjzL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yjzL02
3EOAB 3VJ6A 5LVEA 4UDUA 5JHLL 1YEHH 2W07A 1FO0L 5CEZH 5HDBF 5FYKH 2VKWA 1H3TA 5DHVB 3ULSB 1BQHB 4LIQH 4MYWB 3ZKMD 3SDCC 3GBNL 5HHPB 3WS3B 5MHSD 1G7IB 4JPVL 3L3OB 2H3NB 4MAUL 1IAKA 2AJ3A 2Y36L 4OZHB 5GRJL 4YHYB 3HPLB 3IRZA 1V7NH 4KDWA 5I8KL 5EOTA 4Z6AT 4Z0XB 3MLVH 5TE4H 4K7PH 4PJAB 4CVXB 5L7XH 2EYSA 1D5XB 4NYLA 4OCRL 2BDNL 3I6GB 1UCBH 5TPWH 3SGDI 4MAYC 2GYSA 2JJTA 5ESAB 3L3HA 1JN6B 1VACB 4LSQL 1WZ1H 5FUOH 4JO2H 2AXFA 5GGSY 3MRRA 5CEXB 8FABB 3TIDA 2DI7A 1U8KA 1LP9F 4O2EA 4EIZC 4YE4L 4HUNB 1IAOB 2MCPL 2BFVH 4PRNA 4HSQA 4QHKI 4JM2C 3M1BB 4WEUD 4KI5D 3LZFH 1BGXL 4ZPVB 4LLYB 1Y18A 1TJHL 5ETUA 4Z7VB 5KSBA 1FCCA 5ID1A 4QXGL 2Z4QB 5C2BL 4HGKC 1JZ8A 4JDTL 1AE6L 1IC7L 5TE7L 2H2PD 3VG0H 1EMTL 1LO2L 2B7DT 4HC1L 3U48A 1JMZA 1C5DB 3BQUD 4JRXE 1FG2B 4TULH 1XF1A 2MHAA 4NRYA 1FVEB 4O9HL 4KJYB 4PGEA 3CXDH 1YEJH 4WW2F 3WD5L 5JXAH 1FDLL 5ACLA 3GRWA 2EDWA 5INCB 3ROLB 4LLUA 1I7TB 2Q8BL 3VI4E 1P84J 3QIUD 1VA9A 5C08A 3WFDL 1YMHB 3C60A 1Q8MA 4LF3A 5F7UA 3MV9D 3HR5B 3HUJA 5J9PB 1FAKT 3QRGH 2IH1B 1GGUA 1L0XA 3UJIH 3S5LB 1NC4B 4APQB 1J8HA 4Z7QE 4YO0B 3QIBD 4LVEA 2J4WH 4KXZH 3S88L 4WCYH 3UAJC 3K3QA 3N1QC 1LEGB 5CSZA 1YPZF 2R0WH 5C08D 3S4SG 4YWGL 1BVKB 2J8UB 4JM2A 1XGRB 3C60B 4LF3B 1W0WB 4OM0H 2PYEB 3HN3A 5DMJB 2HRPL 3TPUA 2OMNA 4EEEA 1GC1H 3VFPA 4WV1B 4PRDA 2ZNXA 3F5WB 3FQXA 4XMLH 1PY9A 3IDXL 4YR6A 5F88B 2X42A 2PR4L 4NO3B 4KJWC 1P7QB 5JPNA 3MRJA 5CEYB 1GGCL 3MRMA 1CF8H 2ZG2A 4YDKL 4G6FB 5DQDL 1S5IL 3KNBA 1X5GA 1U8MA 5AG8A 1T1XB 3ARXA 4KAQL 1JZ7A 4CU8A 5IF0A 4QNPF 3MCKB 3DX8A 4HJJL 1RULL 5D1QD 3ORJA 4U1KB 3QZWG 1UXWB 5BW7A 4JPVH 3RUGE 5DRNA 2DDQH 5J56B 2Y36H 1QNZH 3CDGA 4X6CE 5C0RL 3DWTA 1P4IL 3UTSB 3HZMB 7FABH 3SQBA 5I8EA 2IQAB 3PQYA 3LD8C 1G84A 3TH2T 2XN9A 5FECA 1A6VL 2KH2B 3N9GL 4P3WA 4ODTH 4XNMB 1RJYB 3JTSB 5H2BA 2VN7A 8FABA 1S7VA 2QEJA 3OHXB 4JO4H 1W72H 4OZFB 4MB5A 4CVUA 3HUJE 4IRSA 3MTRA 3OKLA 2NXYD 4YFLI 1KIUA 3CC5B 4IRZL 4PGJA 4PJ7A 1Y18B 1D7FA 2BXYA 2H45A 4U0RB 4Q2ZA 2MCPH 3RY5A 3TO4A 3PP3H 4OKVB 1BFVL 2AAVA 1JWUA 3LZFL 2XN9D 5FKAB 1I8LC 1YN6B 5TDPB 4ONFL 2HTKC 3FN0H 3O6MH 5HHOA 4LEXH 1H3XA 4Y4FD 1IC7H 1QSFA 4XPBL 3EYFA 2FHBA 2NTSP 5B39A 3T4AB 2HT4D 3GSXB 1A21A 4UDUB 2BRRL 2D9QB 4MHHI 1F58L 3EOYG 3SBWA 5JXAL 1JZ6A 4RMTA 5DJ2B 3L95B 2Q8BH 4KI5E 4RGND 1A3QA 1DVFA 5GGVY 4Q9RH 4AQ1B 5F1IA 1DLFL 4FQXA 1VFOA 4FNLH 4JG0L 2HWZH 4XCNB 5GIRA 3G6JF 4UI2A 2WUBH 3ULSA 2I9LA 5F9OL 3QWOA 1ZSDA 2A6IA 1YC8A 3IFLH 4HIEA 4L3EE 2R56H 2DL2A 3MODH 3PWUB 2R23B 3BJLA 4AEEA 2QQLH 3KR3H 2AJXH 5H35A 2DM7A 3NAAH 2R0WL 3QIWD 5CSBA 4RMWA 3F65A 1N5AA 5J6GB 4J23A 1EGJH 1B2WH 5ADPH 3DVNB 3HG1A 1GC1L 3DHJA 1X5XA 2Q7NA 4NFDA 2X9WA 1B0RB 3LDBB 5EO1A 3TLRA 1CD1B 1HI6A 2Q3ZA 4XPAL 3EFFA 1N26A 3TVMC 4MD4B 5BO1L 1UA6L 1S5IH 4Q0XL 5KS9F 2XA8L 1GZPB 1QSFE 4M7KL 4LSUL 2YD8A 3SKJL 1I9RH 5DFVC 4KQ3H 5A2JH 4WFHD 2VLRB 3D69B 1MI5B 1CGYA 4X6DF 4D9LH 2D7OA 4MQTB 2CK2A 3V5DA 3JVGA 2OI9C 1ZHLB 3QJFB 4IRSB 5J4MA 3SE4A 1P6FA 1BZ9B 3KG5A 4NPYB 3GKWL 2FB4H 1HILB 1EXUA 1YZZA 1FRGL 2EDEA 5HGDB 2LAAA 3BXNA 4K23L 5DFTA 2IG2H 1BWMA 5JOEA 4HWBL 5DI8A 4KRPD 3B9AA 1KN2H 5B21A 1U3HA 3DX8B 2VABA 4ETQA 4X5WB 4P4KB 1JNHA 4Z7NF 4N90D 4NQDD 4XNUL 4D0CA 1M6OB 1J88A 1NKRA 2IADB 5T1KA 3U7YL 4WTZG 5E6ZA 1C5CH 2PKDA 5FM8A 4P5KB 1K8DB 3CCHB 4QRRB 2VZSA 3HI1A 1FAIH 5FK9A 4CNIB 3UTZB 4R7DB 4WWKA 4CAGA 2V5TA 3TPUB 5E94B 4L4TD 4CNIA 5CHNA 5DI8B 3NPSC 1W0WA 3IKCB 4U7SA 1IRAY 3IDJB 3RBSA 4U6TA 2J8UA 3C08L 4ZUTB 5JORB 5MEQA 3AXLA 4P2OA 5AG9A 1JHTB 2VLKA 4U2ZA 3BZ4A 5E03A 5E8OA 1J1PH 2HJKB 3TCLB 4D0BA 4RFNB 1RQ5A 2XYCA 2D03L 5IB3B 2G5BB 2C1OB 5ANMA 4XNXL 5ID0A 1NJ9B 3ULVL 1X5KA 1CDUA 2XTJD 4OD1H 3RTQC 1C08B 4A2MA 2EIDA 4JZNA 1DBAH 2A6KA 2O26U 1JF1A 1HHGB 4ORZC 4DN4L 3FOLA 3MODL 2X70A 4YHKH 3HS0A 2ICEB 1HEZA 2HA1A 3NAAL 1MLBB 1SY6H 1NGQH 1ZVSB 4I18C 1MLCA 5DHYA 1I3RB 4KROC 5HD8D 1QEWA 5D5MA 5DSCB 5FKPA 4MX7B 5I1AA 2FJHB 2MNUA 3EYQC 4A2LA 1V5JA 3OKNA 1MHCA 4BZ2H 5F3BB 5KZCB 1QSEA 4NQED 4YDJA 1ETZB 2AEQL 2UVEA 2P5WE 5EOCL 3OR7A 3TO4D 4G6AC 1U8OB 4E41D 2BHYA 4W68A 1A14H 2KDGA 2XA8H 3MRDA 4KQ4H 4JY4A 1LDSA 2HFEB 3Q1SH 2QQKL 3VXNA 4C56B 1UZ6F 4M48L 4N0UE 1ZLUK 1RUQL 4NP4H 1NBZB 2VLJE 1C8PA 3EFDH 1ZK9A 5E6YA 1ZS8A 2CLRB 1MJ7L 4NWUH 4YBHA 4D9LL 2X4QA 4U1NA 2VLRD 4I9WD 4PJXB 1B0RA 2VH5H 3GIZL 4EBQL 3UJJH 3OKOA 4X5LA 3R1GH 1D6VL 1CCZA 1SJHA 2ZJSL 5EU5B 3WYRA 5DS8A 2YRLA 5D2LF 1NMBH 4K07A 1MFEL 4OLEA 4PGCB 4PREA 4G6KH 2IG2L 1ADQL 4HWBH 4DGVL 2JJWA 3JTTB 1A7OL 5FA4A 2W92A 4HFUL 3BN3B 4P46A 3MC0A 4HUWA 5FO9A 1IAIM 1JZ2A 2VN4A 1VFUA 2PW1A 3IDNA 5E6IB 4L8DA 1FORH 2ZNWA 2IAMC 3NCBB 5EZIH 4XNUH 1MEXH 1MFBH 3KJ4C 1LK3L 1A9BB 5K9JH 2F54B 2CMRL 4KMQA 3SGEI 3OKEA 2EDXA 3W11D 1KFAH 3BKYH 1JGDB 4AQOA 3I02A 4Z77A 1ZLWK 4BH7B 4HEPG 1IGCL 3F58L 3GJEA 3V6OA 1K5NA 4OZIB 5K9OA 1PEWA 4H20L 3PWLA 3VXOB 3P9MB 1RHHA 4NQDE 5DD5H 1PDKA 4LCWE 3KPMB 5BZDA 1HDMA 1GXEA 4MAYB 2MTPA 4MHHG 2YD5A 2R9HD 1QQDB 5JA8B 4K3DH 3MRBA 2F58H 4XVUD 1JPFB 1TLKA 5HDQH 2NY5H 4GG6E 4NQXA 1H3PH 2YPKB 4DAGH 2XNAA 4DN4H 4YDIH 1KEGH 2NXZB 4G8FB 1C12A 3KPLB 4YHKL 5FOBB 5GQBA 4X4ME 3LMJH 5SX4I 3O41B 2FGZA 2YPVH 4N0RA 1IGFL 5E99H 5DSCA 3BSZH 1YDPB 1SY6L 2BVOA 2JTDA 3KXFB 5B8CA 1C16A 4PTTB 3H3PL 3GHEH 1JE6A 2I27N 1TIUA 4KTEL 3BH9A 1NBZA 5MP6L 3IT8D 1U91B 3L5XH 3RVXC 3P4LA 1NANH 5J8OA 4GS7B 3SDDD 2HFEA 5I8EB 3MRDB 1NCAL 4PRDB 5T3XD 1TVHA 4S2SB 3UC0H 3D2UB 1CL7H 3UYRL 2NQCA 2A6KB 3SE8L 3WKMH 4EUPB 3ES6B 5I0ZA 3MFFB 2P7TB 4UIKH 4KQ4L 5IW6B 4NRZA 2A74B 3L6FB 2V9RA 1U8MB 2QQKH 5D5MB 1NSNH 4ZS6C 4LCYB 5KW9L 2BC4B 2HG5A 4K71B 4RWHA 4XP1H 3VXUD 2J8HA 3MRJB 3DVGB 3F12A 4OZFH 5DFVD 3T1FA 4LEOB 1ZTXH 2ICWA 5FHAL 5HI3D 3HNVH 5KANG 3RZCB 4R96A 1JHTA 2ADFH 4AG4L 1RK0B 4Y4HC 1JIBA 1ZXQA 5C0BD 1S9WA 3GJFK 3KPOA 5CBEA 1G0XA 3C9NA 1OGTA 4K9EC 4MA8H 1XF3B 3SPVA 1X4YA 2D7PA 3SN6N 3ULUH 5E8PB 4M9PA 5ITBH 3O6LH 1J8HB 4TUJA 1XF5B 4NM4L 1VGKA 12E8L 3ARBC 2BVOB 4HZAA 3UPAA 2BSTA 3KPSE 2YUVA 1FZKA 1SEBA 1OSPL 5C08B 5E94A 4L4VB 1KYOK 1NC2B 4M6OH 5T3ZE 3F6IA 3CX5J 1CZ8H 1DQTA 2FX9H 1JBJA 5FEBA 2XWBA 2ARJB 5HGAB 1FL5A 2IF7A 4ZXBD 2CDFA 1C16B 4PTTA 3FFDA 1CFQA 5DJXA 3KXFE 3AS0A 3EHBC 1P5UA 3VXSB 3O41A 3TWCH 1UEYA 2Z4QA 5ESAA 5F9WC 3PWPA 1RI8A 3B9VA 5GXBB 4LQ1A 2FEDC 4G9DA 2F8VA 3T08A 3KHOA 4ACPA 3W5NA 1IARB 2CO6B 4O2EB 5HGDA 4XMKH 2YA0A 3T2NH 3MJ9L 1CDBA 2RHEA 5C70A 4YDIL 5GGSA 5F7FA 5I2IA 3QFJB 3SJVD 3AMLA 3DMMA 1CWVA 1RMFH 1TENA 3DRTB 1UB5B 3H3PH 4FQCH 1A22B 4HG4J 3VXRB 4TVSa 1RZGB 5IGXL 2J8UE 2O5ZL 2VC2H 3QBTB 3DPBA 4M93B 1J87A 4N90E 4B0MM 3T4YB 4JZOB 3STZA 4KDTA 4JPWL 4PRBB 2CJUL 3U0PB 4EUPH 4Y4KD 5EC2B 5DMIH 3EO0B 4AMKL 2Q76B 1JI1A 2DN7A 3UAJD 4UU9B 5E6IA 1NFIB 2FJGA 4XVSL 5EO1B 3TN0C 2C3HA 5KW9H 2MQCA 4XP1L 3RIAF 2CLRA 2H8PB 4HIXH 3MOAL 1OARL 4GMTH 3GHBH 4PJCB 4JHAH 3ZE1E 4Q9CA 4XPTL 3HNVL 1IFHH 5DWUH 4IRJA 4K7PX 4OIIH 2B1AL 3CLFH 4HUXA 2YRZA 1SJHB 4ZQKA 1TJIL 5ENWB 4L29B 5GGQH 3P4MB 5GHWL 3NACH 4NQTA 1FFRA 3U83A 3UTQA 2UUDK 2EO9A 4LNRB 4G80A 3IJYA 3WUZA 4WTWA 3CD4A 4UU9A 2PF6A 3QQNA 4XHQA 4F57H 3EGSA 1CLYH 1OAZH 4NCC1 2FIKA 4I13B 4OCXH 3O8XC 4IS6B 2C1PA 1A6AB 2HH0H 3BQUB 3V9FA 1JV5B 4JR9L 3E1F1 1MNUL 4Q2ZB 4V2BA 3JV4B 2ZOKA 4XP4L 5F3BA 5KVGL 4GQ9H 5E2JA 4J2XA 5ACZA 4JHZA 4DW2H 3T65B 1EEQA 1I9IL 3WN5A 5DJAA 5FUZH 4GKNA 1CFQB 3MGTB 4NJ9L 4TTDC 5AYUL 3I50H 4Y5XA 3QXAA 1R3IL 3RGVA 1OP9A 2AK4D 3IDGA 4KMTL 5A43C 4I2XE 1AGDA 2HTKD 2K7QA 4G7VH 4TN9A 3BD4A 2ZG3A 4NBXB 5BV7L 2DWEB 4FS0A 1KPRA 2AKRB 2G5BA 3VXSA 4D9RE 4FQ2L 4JJ5B 5E5MB 3O3UN 3ZE0F 2XWTA 5I66A 4QLRA 1S7VB 3T2NL 2AERT 1IKNA 3TCLA 1MIMH 2XZQL 5CIPA 3HG1E 3VFGH 5DR5H 4AZ8A 1KCUH 4OLWL 4X5WA 2H6PA 1ZA3A 2DQJH 1UADC 4HH9B 2YD4A 5GSVA 2EE3A 5L7XL 3RWDB 4I3SL 2VXVH 4R7DA 5ISZE 4Y19E 4FQCL 3FRUB 3P4OB 3RX7A 1SVZA 2O5ZH 2VC2L 5EA0H 1K8DA 1QFUL 3PJSB 5FUOL 2C3GA 2DLTA 3V52H 4HC1A 4P23C 1LEGA 3LKQB 1ZOXA 3EJZD 4TUJB 4YO0A 5EN2A 1JMXA 1BD2D 2HG5B 2GITA 4KKCD 1UM4L 1HCVA 4XVSH 1OAUL 3JV6B 3LKOB 1I8IA 1XR8B 4U1SB 4C57C 4PRHE 1HHIA 3ES6A 4I3RL 1BECA 2KBGA 4HIXL 3GSWB 2CKBB 4ODHH 5CP7B 3MOAH 2PYEA 4F8TA 1JWSB 4GG6A 1NFKA 3MMEA 5C2BH 1Z5LA 1WBXB 5HPMA 3K4ZA 3V0VB 3BX7C 4OT1H 4XPTH 4JCMA 3NIGF 1RZKL 4Y16C 3DXAA 2DJUA 3PWPD 4HC1H 1U92B 2WBJC 3T0EC 2YXFA 5FCSH 2MHAB 3QXTA 4APQA 2CDEA 4G42A 1BZQK 3VWJD 5B8CB 3B2UC 4YAQA 2P8LB 3TNNB 2GJ6E 1EHNA 3E3QC 4XBGB 4I3GA 3WD5H 5BQ7A 1U95B 2AEIT 5JQ6H 5D7LD 3FO2B 5ID1B 4PRIB 1GCFA 1I1RA 3WFDH 2D31B 1CLYL 5A3ID 1CXKA 5D1QB 4QRPD 1RUAH 1A4JB 3BIAX 4EI5D 1BREA 3AU1A 2BNQA 1UWXK 1Z6JT 5T3ZL 1JZ4A 3PWUA 1MNUH 4R26H 4PJDB 2B2XH 2Q86A 3HFML 5FF6B 4DJMA 1ADQA 4KRPC 4EXKA 3DVNA 3HG1B 1C12B 3KPLA 2ADIA 3E6HA 1OW0C 3QHTC 1FNSL 4IMLB 5IVXA 3I6GA 2HRPH 1A4KB 2X9YA 1TMCB 3S36H 5KZCD 2GSGB 3SGJA 4G6MH 5FYJE 3QULB 2VR5A 2YUWA 4P46C 3SE3C 2E8YA 2V9TA 5CAYB 5E00A 5E95B 4HWZA 3D3VD 4HCRH 1RIVL 2DKSA 5KVDL 2DWDA 3Q5TA 4HIIA 1MF2H 2R0LL 1TZIB 4U7MA 1FZOA 1JVKA 5BZDB 4P5MB 4NZDA 4P3CH 4XNZB 3W2DH 4X6DB 2XG4A 4NQEA 3OB0K 1DVFB 1X5ZA 1INEL 1MIML 2XZQH 3L95A 4J3TA 5C0RH 1D5XA 2VDML 4HUUA 5C0CB 3N06B 4OLWH 4F7PA 4X6BB 3VWJA 4FXKB 4O02L 2OP4L 3MYJB 4NFCA 1SM3L 4YGAB 4GUPA 1BAFH 2EDTA 1S3KL 3N1GC 4ZFFB 3BZEB 1QPXA 2VXVL 1WISA 1HWGB 4HK3N 4N8CL 4LLMA 4QHMB 3GMNA 3OKOB 4IDJH 1IQDB 1S7SA 3HA0A 3BH8B 4LK4A 1G9NL 4IRZH 2Z8VC 4HIHA 2VR9A 5HSFA 3GMOA 1CGSL 3SE9H 4BK5A 1HSAB 1UM4H 3PP3K 2Y5EA 1BFVH 1D9KC 1V7ML 5C2UB 1NPUA 3MOBL 5F6IB 3KWWA 25C8L 2DMBA 1X5AA 5J13C 3TV3L 4LEXL 2AABL 4OT1L 3OAZH 1RJCA 2E5EA 1K4CA 1G9ML 5DJXB 1NBVL 1QSVA 3QO0B 1XIWD 1XGTA 5H2BB 5CBAA 3G5YB 4NO3A 5MEOA 5DVMA 3O2VH 3TP4A 5T1KD 2HYMA 1ZGLP 3X11A 4KTYA 1U8OA 5IT2H 2QR0A 4O4YH 3FOLB 4Z95L 3Q48A 5CKAA 3UBXG 2ESVD 1MHCB 4L3ED 3MROB 2OJEA 3LEXA 2LAGB 1DQQB 4FMKA 5D7LA 2O61A 1LMKA 2UZIH 2CGRL 1I3RA 3H0TA 3OG6B 4R26L 1DUZB 3RGVD 5L9DH 1TNMA 4M7ZC 4OGXL 4KTDH 5E8OB 4DUXA 2B1HH 4PLOB 4A6YH 4RGNE 1ED3B 4JANA 4LOUD 5IG7B 3BD5A 3V7MA 4X8JB 4GLRI 3PDDA 5EZLB 3T0DA 4JO3H 5IESH 5BV7C 1FNSH 3X3GL 1MCCA 1DCLA 3NTCL 1PZUB 5ADPL 4TUOB 3ARWA 1AJ7H 4HK0A 4G6ML 4ZTOL 4ZOCA 4QRRA 4NZTL 1VEMA 5JHLH 4P99A 5SWSD 2YR3A 3A67H 4ODXB 4D0CB 3I6KB 1P1ZB 2FYYA 4W70A 3DOSA 5I66B 1CGTA 3VXPA 1VKXB 2NX5A 3KPRB 3G08A 3GBNH 4O2CB 5EBWB 5MEQB 5DZNA 2A77H 3FB8A 3PE9A 3IDJA 4GRWB 4KQ3L 4LVNC 1BEYL 2PXYC 3DMMD 3HRZB 3PWNB 1FIEA 1I7TA 1K8IB 4NN5C 2YBRA 1TJGH 3NABH 4OF5A 1OB1A 2MWCA 5CZXD 5HHMB 4JFEE 5D2LB 3CXHK 3MRIB 1LD9B 4TRPL 3VGAB 1BAFL 4K7PL 5D1ZC 3KYNB 3FHQA 1LK2B 5C0NC 2AJYH 1YUHA 1LE5A 5J89A 3GKWH 2FB4L 1CTNA 1UCBL 3D0VA 5TPWL 4JFPB 1WZKA 4XC3H 5CGYD 4GXUN 2OR7A 5D6DC 1TPXB 1HHKA 3WO4B 5I73C 1HOCB 3U0TB 1G9NH 2EXWD 3KPNA 4PJFF 1KN2L 2COQA 2GSIA 4HS8L 4HBQA 2YD9A 1IGMH 4KK6D 5E56A 3VFRA 4FZEH 2DLHA 1CDHA 1NUGA 2R1XB 1QQDA 4UAOB 1EO5A 2FIKB 3B9EA 1KT2B 3TPKA 4J3OC 5DJAB 4QXGH 3RVXD 4OLZL 2NY7L 2CSPA 3K46A 5GZOD 3VXTA 4JRWA 5TE7H 5JHDD 3WNMA 5L2KE 2VLKD 1T20A 1NBVH 2XQBL 4FFYL 4U49A 1KIPA 1WFOA 3MJ7A 4URTB 2P8PB 5FYKE 3JUZA 3O2VL 1EFQA 5IV2B 1FDLH 3QIUB 5KG9B 1N2RA 2VUYA 2XXMB 5IT2L 1A0QH 3THMH 5D6CA 2ICWI 3H3BC 5FYJD 5HI3C 4LU5L 5I1JH 2XI9A 3O2WH 4XNXH 4YDLB 5LG1A 4OCYH 5HI5C 2PW1B 3MJ9A 4NQSA 3X13B 1AY1L 1XGYH 3QXDB 3EJYD 4GSDL 4PV8B 5C0BA 4OUOA 1BJ1H 2L7UA 2UZIL 1UZ8A 3EBAA 1DBAL 1JFQH 2Q7YA 4PJHA 2OZ4A 5IB4B 5IMMB 4Z7UE 3EOAA 3F7RA 3VJ6B 1EGJA 3HE6B 4JZOA 1JI2A 4FFWC 3NIDF 1RUPH 4AENA 4QHLB 1Z9SA 4DZ8A 4QWWC 3RY6C 3CGTA 3X3GH 3CPLB 4R4BB 4WFED 3I75B 1HH9A 4XWOC 4HT1L 3VDCA 1OSZA 1OT2A 1CLOL 5EIQA 1KTDB 2A6DA 1WAAE 4M5ZH 3A67L 5J1SC 1FPTL 2JB6A 5EOCH 5FCUL 3VXNB 4C56A 4JREB 5C0EB 4KAQH 5IVZB 4JFFE 1XF2B 3UP1A 3UTPD 3PWPE 2HVJA 5KSUB 1BEYH 1V05A 4YHZL 5FGBC 3LN4A 3SJVE 5EBGA 2AXJA 1MJ7H 2E9IA 4N0FA 4MQ7B 4MX7A 4YC2C 5T33L 4JM2F 3UJJL 1A6VH 1M7DB 1K4DA 4TSAL 1QRND 1ZT7A 5CP3H 2ZSWB 5EO0B 2AJYL 2PTVA 3O9WC 1BX2B 1QSZA 1J10A 3OAUH 2BNUB 4KU1A 5DJDB 3OR6A 4YHPB 1HYSC 3MREB 5HGHA 4ELME 3GI8L 4GW4B 3VXRE 4J8RA 4QRSB 4JVUA 1MHPL 4NCC2 5JZ7D 2APWA 4JDZA 3DURB 3PWPB 3MRFA 2QQNH 3S3JA 5EU3B 1FN4B 4I0PC 4KZEL 1NGYB 5CP3A 3HE7C 2XACC 3JBG7 1MEXL 2Y5TB 5EU6B 2FD6H 4XMPL 1LK3H 3BDBA 4FMFA 2QKIA 2PXYB 2XN9B 5FECB 1OTTD 4PJCE 1M7IB 1PYWA 5L2KA 3CDGB 4WHCA 1IGCH 3F58H 1KULA 2FL5A 1S9WB 5DK3A 3KDMB 5C0AB 5FK9B 1A7PL 3CNKA 2BRRH 3VFWB 2CUIA 3TN0D 5J1AB 1X3DA 1GPOH 1K2DB 1KC5L 1SY6A 1A5FL 1J0HA 2HVKB 2DJ4A 3RZCA 2HTLD 3FB6A 3W9DA 4NN7C 1CICD 5I1EL 3G6JE 2BSSB 5DK0B 1DN2A 1OY3B 2HWZL 4U6YA 4OCYL 2YMXL 3RVWD 2WUBL 4LLAA 2P7TA 3B9KC 4OKDA 3H9HA 3OB8A 4JM4L 1YMHA 2YKLH 3P9LB 1H3PL 5GS3A 4MVBD 4DAGL 1IT9H 3O4LE 2OL3B 2JIXD 3M17B 2NY3C 3E2HB 5C0IB 5I1LB 2QQLL 3LMJL 5INCA 3ROLA 3RGVC 4WI9A 1JPTH 3D6GA 3DVFA 2ICWB 1E27A 3CDYA 4PGEB 3QH3A 5BV7B 5KSAC 1VFBA 4QXUL 4XZUB 1U41A 1NC4A 2VZ1A 2ADGB 5D7IF 3P11H 3V5DB 4G8GB 4NRZB 1KB9K 3BAEH 5IVXF 5HVHC 3V6ZB 3UC0L 2ZCLH 2NY6D 2ENSA 1CXLA 3H9SB 4EUPA 2Z93B 4M5ZL 2FGWL 4R97B 5F1NB 4CVZB 1FPTH 3NFSL 1HZHH 4ETYA 3QO1A 1ZHNB 4YBQD 5D2NC 3B2VL 5J6HA 5CCKL 1BQLL 4WTXA 1S7RA 1IGTA 4RFOH 1NSNL 1GIGH 2HKFH 4Y1AD 1MUJB 2HN7B 4J4PC 3BH9B 4JFYA 3KJ6H 2GTWB 1T03L 5FDYA 2VDRL 4WFGE 4IOFD 2WWMD 4K8RC 1SVCP 1YDPA 5T33H 5F6IC 5ECJE 1YEDA 4Z76A 2BSRA 1UQSA 4JFXB 3VGGA 4U1JB 4GKZA 5HYQB 3LQAC 3KWWB 4MA8L 3S6CA 4GQPH 5CZVH 5EPMB 3O4LD 2O5XH 4PRNB 3SDCA 2Z31C 5F8RC 1S7QA 4QOKD 5IMKB 1ZWIB 2BZDA 4WGWB 2LU4A 3AS2A 5HHNA 1WSST 3E8UL 4LPXA 1F4XL 5AWNH 2MMXA 1MH5B 3VFVB 3BZFA 3C5ZA 4Z7NE 1RHHB 4OLYL 3IF1A 2WIIB 3JZ7A 2AV7B 1OSPH 5GJSL 4JZJC 2IALB 3KLAA 1B9ZA 4OCSH 4KZEH 5IB5A 2WBWB 4UV4H 3HHRB 3ALXA 2Q8AH 1EDQA 4R7NB 2FD6L 4XMPH 4Z77B 4FTVA 1ORQB 3EO1B 4LPYA 1S9VB 5DXWA 1FZJA 2WV3A 3MYJA 3OJDA 3QI9A 3S4SA 4IOSD 1IILE 3U30B 1FL6B 4XHJC 1T6WA 1A9EA 2DBLL 4ODUA 3UDWC 3GMRA 1CFNA 1KNOA 4CADA 1ZHBB 4WW1B 3DX6A 2V9QA 3HAEB 1R3LA 2ESVE 1KC5H 1JNLL 5E2VH 2BRQA 3O6FC 1OLLA 4UUJB 2DI9A 3ZDZF 4GAGL 4YH6A 2ITCB 2YMXH 4ZYKB 2DMCA 3FQTB 3PL6C 4J6RL 3P30H 3LRGA 4P2QE 1R3HB 3ARZA 5I71B 3VD3A 3NMEA 1JJUA 1NDGB 3VG9B 5E8EA 4YHNA 3BPCA 4A6YA 5D5MF 3UTTA 1T5WA 4X4ZA 5DGQA 2KZ1B 2VLJD 2Q1EA 1RMFL 2F19L 3NCYP 4FFWD 1UGNA 1EHAA 2BOBB 1ZT4B 3JTSA 4LHQB 1FQ9C 5C86A 4X6CF 5DVNA 4X7FC 5DO2D 4U1GB 2WMPA 1FNGB 1F4YH 4R2GB 4ONGH 4UTBH 3VU2A 1ERNA 4NQEE 4PJ5D 1EV2E 4YDJB 2AEQH 4AMKH 1HZHL 4JZNB 2GFBB 3ULUF 4QRQB 3LQZB 1S7TB 5EBLB 5FV1L 1T1XA 2X1OA 1CBVL 1NCBH 1TZGL 4M48H 2P8LA 3TNNA 1HHJA 3DX9A 3S3SA 4Y16B 2VLKE 4G42B 4NP4L 4G5ZH 4HPOH 4JFZL 4G9FE 4JHAL 4P46D 4WI2A 1D5IL 4U1GC 1NMCB 1MFDH 4EBQH 4NO2A 4OIIL 1DBKH 5FA3A 3PL6B 3H9YA 2FO4A 3MLTB 2D4DA 1C7SA 1TJIH 3V7AE 3ZHLA 5I9QB 4NKDB 4LLVB 2XTJE 5DD6A 4NRXB 4H26B 1DUYB 4WFGD 1PX4A 3B4NA 3MBEC 2IANA 3KS0J 4Y1AE 1CYGA 1U2CA 2NW3B 4P2QA 4IOIA 4X5XA 4U6XB 4O00A 2WK2A 4UUJA 3X3FH 3MJ6A 1BJ1J 1GOFA 3BZ4B 1RJLA 4OLYH 3GSVB 3KPPA 3DIFA 1WCBA 3CFCH 4WFHE 3Q5OA 1FNAA 1MCBA 4PP1C 5K93A 2J3SA 3DNKA 4RFNC 5GJSH 1N59A 4E5XA 1JF6A 1SEQH 4FQQB 1INQA 1I1YB 2B8OT 1WITA 1YNKL 4HMCA 3NCCB 4I0PD 1XH3A 3TBSA 2DQCH 5EU4B 5DJ0B 1QD0A 4FTVD 3QXUA 2ILLA 1QP1A 4BZ1L 1NCCL 3FQUB 1ZA3B 4KUCD 4OZGB 4FQPA 1CFSA 1CFTB 5T1KB 1A6UL 2Y9RT 1FFQA 3AVEA 3BDYL 1A1OA 3FAXA 1U8QB 1ZGLB 2DF3A 4PJ8C 5IHBA 2AKRA 3IF1B 3ZYZA 5HVWA 4KMTH 4RISL 5E2VL 1MPAL 2HTLC 3VA6A 1IAII 3WE6A 1QA9B 3HI5H 4K3DL 4TOYL 4XNZC 3TO2B 4FXGB 4B41A 1GGIH 2ZUVA 4LCUB 2NY5L 1AGFB 5HYEA 2G75A 1KGCD 5EOQH 4WUKL 2PUQT 1BZ9A 2NR6D 1R5IA 1FE8L 1HH6A 3F7VB 1H0DA 2HFGL 3IXAB 4FQ1H 1UENA 1DL7H 2YPVL 3RDTD 1EH9A 2DQJL 3BSZL 1OP5K 4LSTL 2NZ9C 5JR1H 2WZPD 2YD6A 3PXHA 3HC4L 4KTEH 3U79A 3HC3H 1U8PB 2OI9B 1QRNB 3QUMB 1NFDF 5IMLA 2ADJB 1YYMH 3DI3B 1GZPA 3RGHA 1FGNL 1QLFB 4RA3A 5I76B 3PWJA 1LO5B 4HUKB 3SE8H 3U36B 1N4XL 2FLBT 1R5VA 4WJ5A 5KSAB 1Y6KR 4G80B 1U3YA 3MV7B 5MENA 1NCBL 1LNUB 5EU7C 4X7TA 5CIPH 1NL0H 1W72B 3TVMB 4PJBA 1XMWA 5IEKA 2IEPA 4HPOL 4JFZH 3VE0A 3MLZL 2RR3A 5HVHB 1D5IH 1FVCA 1RZKH 3W0WE 2JIXA 3B9KB 3VH8A 4BSWA 1F2XK 3PIQA 2ATPA 5DVOA 1NLBH 2BY3A 5B39B 3U82B 1PKOA 2OZ4H 3BHBB 5DJCB 5HYJB 2NY3B 3E2HC 1OF2B 4HKZB 3QIUC 3SCMB 2X2YA 3RWJA 4GLRH 3U7AA 4LCIH 3X3FL 4BKLA 5CZXC 4FQXD 3DARA 3F7PC 1RUAL 1S7XB 5BZWA 3IETB 1JWUB 2NY4B 1RK1B 2R29H 1JYNA 3A6CH 5HD8C 3FT4B 3CFCL 3TBYB 4PJHF 1NC2D 3QUXC 2NMSA 4HKBB 4UV7H 4Z7UB 1SEQL 3VXSE 2YHGA 5F72S 1LP9E 5KTEH 1ORSA 4M6OL 4OFYD 4XVTL 1AGBA 4PLKD 2DQCL 4ZNEE 4WFEE 3QG6B 2VQ1B 3IKKA 2X05A 2XY1A 4XCYA 4I0PB 1WV7T 2OXHA 1BFOB 1L0QA 4BFBD 1T2QL 1IM9A 4JM2D 2YXMA 4MA1C 1Z3GH 5FYJL 4NKQB 1LEKA 4J3UA 2RBLA 3WFEL 4J1UB 5KVDH 2XZZA 5T5NF 4L8CB 5I6XB 3Q3GB 1TCRA 4KV5E 5ERWB 5KBNC 4HMDA 5AUMA 1K85A 3IDMA 4ISVB 1J7VR 5D7SL 2OQJA 2OTPA 3L3GB 2OR9L 3W2DL 3TA3A 4GW4A 1I7ZB 3FFCE 2IPUG 1CE6A 1D9KA 5ANME 2B5IB 4RCAA 4BQ8A 2FSEA 4OCWH 2EDHA 3BE1L 3O4LA 3EYSH 4F2MA 2DS4A 2CRIA 1I7UB 3AC0A 1RJYA 5E2WH 4N1HB 5JPNB 2CK0L 3MXWH 2VDKL 4S11A 2E8ZA 4POZC 4YZFE 2YOCA 2VXQH 1F6AB 1X5YA 4LSTH 3VFPB 2SEBB 1F42A 3MRCB 2XWJA 5DD3L 3ZYJA 1N6UA 1NMAH 4GAYA 3HC3L 3TNMA 4BK4A 1FFOB 4Z7UA 1KJVB 1V3JA 2DIJA 4IDJL 3SCMC 1S9YA 3B8YA 1CI5A 2BVYA 5EUOA 1E4WL 5C1MB 2E7LA 2ZP0T 4WDIB 4QRUA 4Y4FA 5H8DA 3MRHA 4QYOB 1OAKL 1QSEE 3SE9L 3MJ8B 4JQXC 1JGLL 5E8PA 4OB5L 4MNGE 4NO0A 4NUJA 4OCNC 1OF2A 4ZUSA 3SO3C 5J9PA 3V95A 2L0DA 3BHBA 1PLGL 3DSFL 4YGVA 3KPOB 4HH8A 4E42A 4UQ2B 4PJ5E 3FFCD 3V6OE 3MRPA 3TV3H 1MCKA 3DRQB 5F6HJ 2DYPA 4K71C 4CJ0A 4ONOA 2B1AH 4RA0C 2DOCA 3BP7B 3DUSA 2NY5C 4JG1L 4M1DL 4YDLC 2J8OA 5GPRA 1B88A 2DQTL 4HF5L 1RSFA 4Y4HB 3Q0HA 1CFBA 5GHWH 1A6TB 2LV4A 2OZ4L 3HZVB 4WI6A 2AQ1A 5MENB 5JW5A 4OTXL 2PO6D 1T4KA 4KK9C 1FZMB 4OFKA 1MFCH 1YA5A 1DANU 1F3DJ 2DQIH 3IFNL 3WFCH 5LWYH 3QXVA 5AZ2L 2VL5A 4L5FH 3W9EA 4PJEB 4CMMB 4RWYL 3P0GB 1X4XA 3AFLA 3UTSD 2E27L 1JZ5A 5L88L 5D7LE 4XP4H 5CLTA 4XVTH 1X7QA 3GNML 4D8PA 2AXFB 3VCLB 2JJUA 3LKPA 4M1CD 4A6YL 1UH3A 5EO9B 3GM8A 3RQ3A 1T83A 3MRNB 2XOTA 2AJSL 1IGJA 5F1OB 5FUZL 5IQ9B 4GT7A 3ULVC 4P3DB 4LSSH 1Z3GL 5FYJH 1TZHA 3B5TA 3FO9B 1J0JA 3S7GA 2IPTL 1R3IH 4GG8B 2NXZC 2ORBL 1TPXC 3TYFA 1WFUA 3A0OA 3HPLA 3QEHA 3U2SB 3HE6D 2UWEA 4G7VL 2ZOLA 5GRWA 1U8IA 32C2B 5GRYA 5IQ9A 3SGJC 2O93L 5HYIA 1UZ6E 3FRPG 3VGAC 4P59H 2HT4C 4WU5A 4OCWL 3HZYA 1G7QA 1LE9A 4YIQA 6CGTA 4HS3A 1VPOL 1TJGL 2CDGA 2VLLA 3NABL 4NN5B 5DR5L 4WVRA 1AXSB 3VFSA 1JGDA 4M7JL 4GBXC 3SHSA 2OK0H 5L0QC 1JZ3A 3GMPA 2GW5A 2B39A 1GHFL 2DIBA 3W9EB 2DKMA 4PJ5A 3B3IB 5DD3H 5KVEL 4P4RA 4FQQA 1NEZA 4X9HA 4PJFA 5DHXB 1PG7H 1W8OA 4XXCC 1ACYL 2YEZA 2IFFL 2AJVH 5SWSA 5CJ5A 4Y2DD 4P46B 3I6KA 4PJAE 3AREC 3RUGA 1XEDA 3QIWC 4ODXA 5IVOA 1XGQB 2EXYC 1HCFX 4FHBD 1IGML 4IOIB 2NW3A 4XCEB 5I9QC 3NH7H 4UT9L 1VEOA 2BP3A 1G6RA 3QEGL 3CJJA 3QUMH 1K9TA 2R1WA 2C3VA 3T8XB 4MNQD 3S34L 1JL8A 3RDTA 4I3RH 5I17A 4M7ZB 1EEYB 2VAAA 4GKOA 3CX2A 1N59B 1KLGB 1FYTA 2X89D 4U3XA 1H15A 4O5LH 3WXVH 5IG7A 4LGSB 1J0KA 2HLAB 3EDKA 4DUWA 4ZUWA 1BBJB 2IJ0C 1ZA6B 1G1CA 1IM3B 5C6WH 2DJSA 4N0UB 1V3KA 4OSUL 2FLRT 3NIFF 1KXVC 4XAKE 1D3CA 4UNTA 5DEFB 5I8CA 1I3VA 3D25A 5MEND 4LLVA 3QHZH 3FTGB 4Y19A 2VZUA 2B4CL 3OKNB 4X98A 2C7UA 5D96C 4KY1H 5B4MD 4AL8L 1AY1H 1XGYL 4GSDH 1GOGA 1VGEL 3BP4B 4PY7A 1YJDH 5T3ZH 5TQ2L 3IDYC 5TDNB 3V6BR 4POUB 1U8LB 5F8QC 1JFQL 4I8DA 4X4YB 1YNTB 5KS9B 3VG9C 3GNMH 1J05B 4GS7C 4OV6F 4AIOA 1DSFH 3UTTB 4KROB 5D7IB 4JFEA 5T5NG 3AMKA 4FG6C 5IIEB 2MCG1 1I9EA 4S1SL 1S5HA 1CDYA 5JUEH 4LSSL 4R4FH 5ESQA 3Q3GA 5DJ6B 2X1WL 3OX8A 4JB9H 1UM5H 4KKLC 4IIQC 4PY8I 3T2QA 1LGVA 4G6AD 1IC5H 1X6NA 1Y0LA 1NFDA 1ZHKA 2OXGA 3KYMB 3BUTA 3WIFA 4ZFGH 4N0CD 4TVPH 3RWCA 4DTGL 1I8MA 4PGBA 3QAZB 1G7LA 4P59L 4P49A 1CLZH 1Z9MA 4YHZH 4PS4H 3FO1B 1D5ZA 5FGBA 1WFNA 2VDMH 4UDTA 1DVFC 3D39A 8CGTA 3N1PC 2X4NB 1MQ8A 4YUEH 4NNXB 1KTLB 2NY1B 4TSAH 3MLVL 5JLZA 4PTUB 1P4LB 1WIOA 3FL7A 1BZ7A 3ESVF 4WWKC 5KAQF 1M6OA 1NCUA 3RUGB 4GO6B 4N8CH 1R5WA 1HQRB 3CFJB 1PAMA 4LBEA 3R8BB 2IALA 3KLAB 3VD4A 2BNRD 1T7WA 1PBYA 1SBSL 4UOW0 4POYA 1VB9A 2P5WD 4OF8A 4XCCH 4G3YL 3V6FA 2AJVL 3KJ4B 1MH5A 4HWBA 4QT5A 3CFDB 3CH1A 2HRLA 5HYJD 4Y2DB 1CGSH 4WUUE 5JIHA 3QI9B 3CDFA 4RAUA 3NH7L 2BFVL 4HWZB 1ES0B 1OL0A 5C0BE 2MJWA 2X4OA 3QPQD 1V7MH 1OCWL 2ICCA 5JA9A 1FFPB 3MOBH 4JPKL 4NM8H 4P3DA 25C8H 1KIRB 5BOPA 3T0EE 1H3VA 3FB7B 4CVWA 4JFXA 3QEQB 1FYTD 2BK8A 3MRNA 4WHTB 4JLRA 5DK2A 5IR1B 5BJTB 3ARGC 2YC1A 4LPTA 4BSVA 3FB5B 5JIKA 3NZHL 3NA4A 2A0LD 5C0GB 1ZWIA 1SYSB 3PP4L 3OAYH 4F9PC 5K9QI 1A5FH 1TZHB 1VFAB 2DQFB 4O4YL 3AUVA 5B8CC 5SX4H 4Z95H 3QHZL 2C4FU 4R0LA 5BS0E 3MRKB 3Q6GL 3H9SA 4MNGA 1HI6B 3FO2A 3VMPA 2Y6SC 1U95A 4M62H 3CSPA 1VGEH 5D1QC 4R3SA 2ZSVA 3OJVC 1NAMB 5B22A 2HLFC 2ED9A 2CKNA 1CIDA 1S9XB 2PCPB 2ARWA 1ONQA 2ZPKL 3MBED 4OGXH 1DQLL 2J7LA 4KKCC 3DROA 3BKJH 4M1CC 2NLJA 4ELKB 5KAQG 2JJSA 4OM0L 3UTTD 3QWRA 2BCKB 2Z93A 1EFXA 4PV9A 5FYJU 1FZMA 2R2EB 1BIHA 3ZTNH 3J8F7 1J8KA 5B38A 3I85A 2I9LB 4NN7B 1M05B 4ZTOH 4Z9KB 3WHE1 3ULVD 3PNWB 3JWNC 1ZANH 2P24A 1UM5L 2WUCH 3IDXH 4P23B 3RVUD 1WTLA 3RIFK 2DM4A 4Z5RA 4Y5VA 4GAJL 1U0QA 4O58L 2NXZD 5DK0A 3VXQA 3NFSH 2XICA 1JTTA 2E9WA 4TVPL 3RWHA 3B2VH 4DTGH 4DKEL 4JFQA 1FO0B 4P5TA 1CLZL 3M17A 1AC6A 1BVLB 3ZDYF 4PS4L 4YGVB 4PJ8D 4NKIH 1T89A 5A3IC 1Z2KA 3K8KA 2F9BT 2NY0B 1QSFB 4ODSH 3VMOA 3N9GH 1JNNL 5EBMB 3QCVL 2CXKA 4F33B 2A9NH 5J11C 4X6CB 5DMGC 4X80H 3BFOA 1LDPL 3D9AH 4XC3L 4OIBA 1W72L 2C4FT 3GZKA 4OD2B 2BNQE 4HFWB 3RKDC 2F74B 1IKFL 5ALCL 3LEYL 4MXQD 3V0AC 2Y7QB 1I7RA 4IIQA 4CDGC 4E0RB 1G7PB 3BYYA 2JLLA 5AWNL 1LILA 3VFNA 4RBPH 1T1YB 4U0RC 2F54D 3MX0A 3OR6B 4YHPA 1IMHC 1OCWH 3LN5B 4OBSA 4GXVL 3B6SA 3MLPA 1CGUA 1RU9L 5KS9A 5HYSA 4OLZH 2NY7H 4PR5A 1A6WL 1I7ZA 2AI0H 3VFNB 1S7UA 4DVRL 4MQ7A 3P2TA 1KN4H 2NZIA 3MV11 2VKXA 1RD6A 1AO7D 4BH8B 4HWUA 4EDWL 3REVA 1QACA 4XT1C 1DTUA 1FNLA 1DLFH 3RVVD 4JCLA 3Q6GH 1MFNA 3O2WL 1E6JH 3IJYB 3BPLB 1OSZB 4JKPL 1T5WB 3P30L 1M05A 3L3IA 3P0YH 4NZJA 3IS1X 3O45A 1F90L 2FHFA 2HFTA 2R56L 2D7TH 1QTYT 4EIGB 4MZ3A 1DN0B 3O3AB 4WW2A 2D0GA 2IPKA 4JQIH 1MOEA 4NT6A 2VIRA 5BZWB 3BGAA 3U0WL 4DEPC 1Q72L 1EGJL 2Z0BA 4PRPE 5EORH 3S5LA 4ZDHA 4RNRB 3SCMA 4PGDB 3WLBB 3WXWL 1W72A 5IJKA 4MA7H 2VXUL 1JRHI 3MSPA 3QUXD 2J5LB 5DGRA 1KJMB 1MRDL 2X4RB 4GFTB 3MRKA 4MNGB 3GRWL 5F7DA 4MJID 4PG9A 3SKOA 1UA6H 4Q0XH 3T8XA 4DKEH 3QIUA 3S4SB 3QEUB 1ZT1B 3QI9C 3SKJH 1OP3H 1I9JL 3UDWA 3P9WB 1KV3A 1F3JA 1ZKAA 1AP2A 4BSVB 4M93C 4NKMA 4PJ7F 2FEDD 3CVHA 4XAKD 5JDSB 4I77L 4QNPE 4YNYB 3OAUL 4X80L 2NY1C 4KVNH 5FM4A 3GI8H 2IANE 4YHIB 5GJTL 4HHAA 4DGIH 4U3HA 1U8NA 4XBPA 4P57A 5T1DL 3DTXB 3TGXA 3QUKB 1L7IL 1Q9WB 5IEHA 2M26A 5AYQA 3IFPA 4G43B 4OUUB 1WWWX 1H0DB 1HH6B 4K94L 4JFPA 4GXVH 1DJSA 1YY9D 3QPQC 3D39E 4U1MA 4YHYC 3Q6FA 4JFYB 4CGTA 2HN7A 1C5CL 1AXIB 4XH2B 5KVMC 3RX5A 5EOTB 1W0YT 4C83B 4DVRH 4UT7L 3G04B 2VUOA 5TGBA 1A6UH 2PTUA 2PXYD 3L3OA 3F7YB 5EOCJ 3LV3B 4DN3H 3C08H 4EDWH 5HHPA 1H5BC 4U0QB 3UJTL 4RISH 5C0AD 1J1PL 2VJXA 4I0KA 2GJZB 1JUFA 4TOYH 2QJDA 4OD1L 4LCWD 3D39B 5DD1H 3QUZD 1XH3B 2DICA 1HSBA 3TBSB 5CBEB 4NOFA 1IT9L 2OL3A 4GRLC 1G6RH 2LU7A 2D7TL 3IDIA 4M00A 1Y6NR 4FQ1L 3MNWB 1JPTL 4JQIL 5IK3B 1K3ZA 3QIBB 5EU7E 3U0WH 5DFWH 3GMQA 3D85B 1D5BA 2AJUL 2BSSA 1OOAA 4IHOA 4LCYA 4NGHH 1I85A 1YYML 3RZCC 3P11L 3K74B 5ESQB 3O3AA 4WW2B 3DRQA 1FGNH 3FZUC 2ZCLL 3JVGC 5DD6B 3MRPB 3I3BA 4ESKA 4G8EA 2H26A 5CJXC 3WUWA 3EZJB 1CD8A 4UIMA 5D1XD 4GRWF 4N68A 5CCKH 4TTDD 2IAMD 1KPUA 3VWKA 5FIEA 2EDYA 5GGRY 4N0UA 1HE7A 5FYLL 3TBVB 5D7KD 3SKMB 1ZT4A 3DX9B 3PDOB 2QSQA 3C8KA 1FJ1B 2XKNB 1CE6B 1D9KB 3D0LB 1S7TA 4UQ3B 5EBLA 2Y4SA 4JHWL 1NLBL 1LEIB 4I77H 4RGMC 3VW3L 3H2WA 1HQ4B 1LO3H 1R3HA 1CGWA 2EYRB 3HZKA 4KVNL 4RDQG 1MFEH 5HPOA 5C09D 2O5XL 4GJTB 4G6KL 4Y5XC 3ZSTA 3X12B 3G5YA 4OLXL 3DBXA 4LCIL 4MAYA 2R9HC 3TC9A 1D6EA 3KPMA 3CU1A 4ODVL 1ZT7B 4XWOD 2X9XA 4F80A 5IMOB 1FORL 5FM5O 5H94A 1GGTA 1PKQA 1CN4A 3JV5A 4EN3A 4UV4L 5KTEL 5I1DA 5SWZB 3GJEB 2GK2A 1MFBL 3UZVB 5K9JL 3WFHB 3C5SB 3GKZA 4JFQB 3ARED 5C0CA 1XGQA 1F2QA 3VWKC 3OKYA 4R7NA 3K4DA 4MXVF 2VDQL 2UZYB 4X9BA 5SWSB 1DBBL 4L8DB 2DD8H 2VZTA 4HKZA 4F7EB 2DB8A 1B4RA 3QNYB 1JGEB 4XXDA 4ODUB 1ODAA 1BOYA 2EC8A 2AVGA 4PJIF 2WLYA 3HPJB 2BCKA 1W2KT 2A9ML 4PJ9C 4DWHA 5BMFH 3SDCB 4PGCA 5CWSB 4C4KO 1HYSD 5EIIA 1WWCA 1ZAGA 4F7PB 4KRPB 3FONA 4GW5B 4RMQA 4BFEA 3RWHB 1WBZA 4TNVF 3RAJL 1JPSL 1EX0A 1MHHA 1G6RL 4NQEB 3D3VB 5DTFA 2WIIA 2V5MA 1IGFH 5E99L 4Y4HD 5B3NA 2QSVA 1CIUA 2E6PA 2F19H 4DOHB 1PZ5B 4U1IB 5HHNB 4RQQB 1CXIA 1NMAL 2IBZY 3VI3F 3ARFC 2VLJB 2C4XA 4QRPA 1F4YL 4PJGA 3EOBB 4AK1A 3QQ9D 1NCAH 2APBA 4N9OB 4YNYA 4NKOA 5ACMA 3RFZC 5C9JA 5IVXB 3O6KH 4JGJA 4MB3A 3SDDB 5HJ3A 1PZ5A 4U1IA 2EDJA 4WNQB 3V79C 1ZLUH 1DE4A 1K3IA 3V0WL 4CW1B 3FB5A 5J3HD 3WDHA 1CBVH 2FDBP 4S1DC 3IXAA 1F3JB 2CDEB 5KOMC 4R0LB 5EB9A 5JTWA 1R3KB 1RZ7H 4TSCL 4WY7L 4NKOB 3MA7A 4LIQE 1FIGH 5INDB 1MFDL 1XIWC 2E7BA 3IGAA 5KSVA 1YMMD 2VRAA 3NCJH 5HHXH 1ZHNA 1X44A 4JHWH 4JQVA 2YD2A 1HINH 2ATKA 3MMEB 1C7TA 3VW3H 43C9B 3GSWA 3L7EB 2Z35A 1C08A 4GRWH 3V6ZA 3SGDH 4GRWE 3LS5H 4U1LA 2I07B 2VE6B 4OTXH 2KQNA 4EI5B 3ULUL 4RNRA 1MCWM 5C0CE 5HHME 3D87B 5IB3A 3MJ8A 3WFCL 5LWYL 2PYEE 4NM4H 1A1OB 4JFED 2QHLA 5T5FL 1P4LA 5JORA 5CWSA 5I1LA 4PRPD 2LU3A 4LPWA 1BF8A 4PG2C 2APFA 1YY9C 3C8HA 3NCMA 1NDMA 4TNWK 1QRKA 2P5EB 1ZLVK 4P5KA 4S1QL 2PXYA 1G7LB 2EC9T 4MA1B 3FQRB 1KCSH 3D5OF 3VD5A 4TTGA 1IBGH 2DI8A 3BDYH 3QJHA 3W9DB 3V8CA 5EUOB 3SDAD 4YQXH 4JJ5A 4FABH 1ZGLM 2WANA 1JPGA 3GJFA 3BIBX 3AREA 4HMEA 4JVPA 4LVOB 1MPAH 5T1LA 3LQAH 1G7MA 3MGOA 4PJ9A 3UO1H 5L2KB 3QUXB 1O7VA 4L8CA 4HH9A 2NY4C 1WCBB 2XPGA 3DIFB 3KPPB 4WGVB 3ZYIA 4IRSC 4CL7A 1R6VA 3ULVF 4I2XB 3ALPA 2GTZA 3RL1B 4NPYA 5EOQL 4WUKH 1IM9B 3HKFA 2FSEB 4M7JH 3O11B 2HFGH 5E2UH 4O51B 2NNAB 1IVLA 3QG6A 4EVNA 3ZT6A 3FO0L 5LGKA 2FNBA 4MXWH 5D2NE 5KVEH 3QDGB 3FTGA 5IGXH 3WFZA 3OF6D 2B4CC 4KI1A 5HGHB 1T1ZB 2AXGA 1A6AA 2XN9E 5D7KE 4IS6A 4OGYL 5ISZD 3RZCD 1WZLA 3BEWA 4KI5C 5DMIL 2DTSA 1LO0L 3EGSB 3FZUD 1PW3A 1N4XH 2W9EL 4Y16A 4UT9H 4BFIB 4LFHG 3QEGH 4M8VA 5C0CD 4N0FB 5DLMH 2ZUWA 1I8KA 2GFBA 3JV4A 3QNZB 3SKUD 3SEPA 1OARH 3MLZH 4GMTL 4B53A 3D25B 4PD4J 5DMKA 3V4UL 1HSBB 3VFTB 3L1OL 3W39B 1IFHL 5DWUL 4QCIA 3CLFL 5IW1B 5FO8B 5DZOA 1P53A 2R2HB 1T22A 3NN8B 1HN1A 4OSUH 1ZLSL 3R06A 1U8JA 2F8OA 2P43B 4P9MH 3CUPB 4KV5F 4LLQA 1R3LB 2VAJA 4MWFB 4XCNA 1P9MC 1AGEA 2UWEE 4QHMA 4DZBB 1NEZB 1QLRA 4DGYL 1WC7B 1OAZL 2C3VB 4OCXL 3STLB 4XI5C 5E08L 1YJDL 3OJDB 1AFVH 3WKNA 3VFSB 1Q9KB 2H8PA 2VLLB 1T2XA 5KVGH 3WSQH 2GJZA 3QUYB 2F53A 5HHOD 1P6AB 5CEZE 4KK6C 3MNVA 4D9QE 6FABL 3T3PE 2FH8A 3LKSA 4EUPG 1ULVA 1YC7A 2WAHA 5DQ9A 3DUUA 2PO6A 4PJDE 1A9EB 2DQFA 2P5WB 3MRGA 5JUEL 3BP5B 5TGBB 3U2SA 3I50L 3STZB 1D5MB 2JK5A 4R4FL 5JIPA 2FBJL 1HXMA 4H5SB 4NQDA 4S10A 3EIFA 4GXUM 2H2SC 3U6RA 1FZJB 2FJFA 1U8PA 1IC1A 4MDJA 3VXRA 3EJZC 5FM5M 4ZFGL 1I3GH 1NFDE 4FN0A 5D7SH 4F7CB 4XTRD 2OR9H 3E6HB 3QAZC 1EA9C 4WHTA 3SE3A 1OTSD 3GSQA 2AK4A 4JE4B 1CK0H 3LKPB 3U1SH 3DTXA 1HKLL 4M61A 4KDTC 1LE5B 1QLEH 5SV4A 4RIRA 4YUEL 3VMNA 2VDKH 4X6DE 1QA9A 2VXQL 3AU1B 2BMKA 2EH7H 3DGCR 4ODBD 3FN9A 4LHJB 4U6VH 4QT5B 3NOIA 2Z92A 4TUKH 1IGJB 5EA0L 5I18H 3TM6A 4Z76B 4P0DA 1SBSH 4O2CA 1TTFA 4XCCL 5C0JA 3V52L 4OGYH 2A73B 2DM3A 1MAMH 1UVQA 1YYLH 3SQOL 2DKUA 3SGKA 5ISZB 1LO0H 3NVQA 4U6XA 1J9CT 2CDFB 1Q9KA 1ITCA 2ICES 3NFNA 3ILPB 4LAJH 4MA3A 1EBPA 4Z7QF 4N9GB 2Z8WC 3GSOA 3HE7D 1DEDA 2X7LA 3C2AH 4JPKH 1I1YA 4ODHL 4PFEA 4NKDA 1AHWC 3DO3A 4DZBA 2WBJA 3T0EA 2OLDA 3H9HB 5KN5A 3L1OH 3MRLB 3HR6A 2BSTB 4OLUL 4W6YB 3CUPA 3ZDYE 4HWEH 4U6YB 3ZKQD 4PJEE 1NBYA 3NZHH 4M1DH 4PRHB 3C60C 2HT2C 4JN1H 3PP4H 4K55A 4H1LA 5D7LB 1QFWI 2GK0A 5GGTL 5DMYA 3DYOA 2B0SH 1DUYA 3W39A 2QLVB 1DN0A 2Q87A 5JQ6L 4OFPA 3BO8B 1MCHA 3FAWA 4ZO6A 1GL4B 2DQIL 1BJ8A 2NZ9D 3IFNH 3V5KA 3QNZA 3HNTL 2Y07H 2PW2B 4M1GL 1MCEA 5DUPL 5EWIH 3FCTA 3WO3B 1OP3K 4WHYG 4L5FL 4GAFB 2PTTA 4R96B 1JK8A 3K0WA 5E08H 4OFYA 2E27H 1QFPA 4JRYD 4Y88A 3F12B 5B39G 5GS1A 5GGUA 3C2SA 3GBLA 2VISA 1F13A 2DM2A 1NCDL 4Z7WF 4OI7A 4RBPK 3P77A 4X98B 5E7BA 4OZFG 3ZKXB 4BH8A 6FABH 3IVKA 5DRXA 1NDGA 3G9AB 2CLZA 2W65A 2CQVA 2KKQA 3MJGX 1RZKC 1FNGA 4PJXE 3HB3D 3K8MA 1PSKH 3SDAC 1QR4A 3OL2A 5F70A 2ORBH 4OD2A 3SY0B 2W91A 4HX1A 3TF7C 5EZJA 5C7XL 1MF2L 1BX2A 4LDLB 5M95B 3B5GA 3QO0A 3CU7A 4P3CL 1T0PB 1M7DA 5C0AE 3FQWB 4YHLH 1YEEH 1K5NB 3ZZ1A 4IRSD 1HKLH 3IDUA 4FTVE 1VPOH 4E0RA 2HT3D 1TCRB 2BNQD 4NKIL 5KJRH 5ICYB 2FZ3A 5A2IH 4J1UA 4O02H 4KH2A 4OGZA 4Q97A 4CMHC 1B0GA 2OK0L 1L4IA 3VXUA 2DQHH 2HFFB 2C1PB 3QCVH 1GHFH 2IFGA 3IETA 5I8OH 4RX4D 4U6VL 4NO0D 3GK8L 2OSLB 4TUKL 1VFMA 1W0VA 4P2RD 3ALWA 4PLKC 4NZUL 5I18L 3ZDZE 1JP5A 1ACYH 3ARDD 4JFFA 1IKFH 5ALCH 4UBDC 2HJFA 1AIFA 3IJHB 4P5MA 4OF7A 4L4VE 3QNXA 4H0HB 1TZIA 1I4FB 5JDJA 4H8WH 4I48B 4Y7MA 3BISA 4JN2A 3VI3E 1FO0A 1T3FA 1ORQA 4FTVB 3B9KA 4FFVD 4ZNCD 2H9GB 3NPZB 3RJDA 5IFHL 4Z7VF 4HXAH 4P48A 3GB7B 4LP5A 4IRJC 4NUGH 5HYJA 4U1NB 3MV7A 4HWEL 2R4SH 1KN4L 4TYUA 2ED7A 4JAMB 4JN1L 1MELA 1TITA 2IWGA 1S7QB 1CICB 4WUUD 2NY6B 3G6AA 1KPVA 5CJ8A 5GGTH 2XRAL 4IOFC 1IGYB 4GW1A 2V7NB 2Q6WB 3BVNB 1A1NA 4Z7VE 1Q38A 3KPRD 3FOMA 3RBGA 4M1GH 5DUPH 5EWIL 4C4KT 4KY1L 5SWZD 1CDIA 1CQYA 4I1NB 4PJXA 3O2DL 4D2NA 2ADGA 5TQ2H 2M2DA 4YAQB 1WWAX 2CGRH 3DMMC 2CRMA 1VADA 3RNKA 1F90H 4XZUA 2EE6A 2Z31D 4OZHE 4BQCA 3ZE1F 2D4FA 4PD4K 4TNWF 1IEBA 3L5WB 2VDLL 1MLBA 1IGTB 4G9FA 1S7RB 4PJGB 3KGRA 1A4JA 1KJ2A 1YN7B 3V0VA 1RIUH 4S1SH 1QKZL 1CGVA 3I84A 4UTAL 1AJ7L 4U6HB 5GGRA 3RWFA 5GRXG 2VXUH 1CDJA 4GBXB 4G8GA 3BGFB 4NZTH 5DK2B 1DBML 1MRDH 4U3CA 5C7XH 4MD5A 4D0BB 1CQKA 2IH3A 1YUHB 2JKXA 4XHJD 4NHCH 5ADOL 4K2UL 2ICEA 2D7QA 5HYJE 2A77L 1LD9A 2J6EA 5C0AA 1OTSC 5HHMD 4KK9D 4UQ2A 3CH1B 3G6JA 3U4AA 3FO1A 5LQBL 3S5LG 5KJRL 5IKCA 3QDJA 4L8SC 3HI1B 2MFNA 4JKMA 5F7KC 1Q9OB 5T3XH 2KQMA 4P4KC 3O9WB 1IQWL 1I75A 5EC1B 4AEHH 3GMMA 5J7CC 1UB6B 5HXMA 2L7JA 1P1ZA 2FYYB 5CIPB 3ET9F 3RWIB 3K2UL 3LSOB 4JRXB 4F3FB 3RPIB 2HVKA 5EC1A 5EU3A 3ARGA 2V2TA 4P2QB 4OM1L 1KTLA 1YEKL 1QSED 4G3YH 5KOVC 1OD9A 2YBRB 1MCFA 1KG0B 1KTKE 1L7IH 3UTZA 1INQB 3WNLA 4H8WL 5HI5D 3SDXA 1BIIB 3VRLF 1U8HB 2IQ9L 3QXAB 5D7IA 2AGJL 1I7UA 4NCDA 4NM8L 1NH6A 3E6FB 4GKNB 5CMAA 1DUZA 1AKJA 4J3XA 2EH8H 3PWVA 1QR1A 2APVA 5ILTL 1RPQA 2VXSL 3LVEA 1KPRB 4TNVK 3C5JA 4GBXA 5IW6A 5CD5D 2R4SL 2XQBH 4FFYH 2YS4A 4LHUG 2D2OA 3BEVA 3MV7E 4TUOA 4PYGA 2VLRA 3S35L 1AD0B 1MAKA 4Y4FC 5EU6E 2JB5L 1UJ3C 1CGXA 3O3BA 4DN3L 4AEIL 3QDMB 1I1FA 2X6MA 2XRAH 2XKNA 2FH6A 2NY2D 2ZKHH 3C8KB 4G9FB 3SDYH 3UJTH 2Z9TA 1A0QL 4NQVA 3THML 1CT8A 2IPUK 2R2CA 1VADB 1KENH 2R0KH 5I74C 3RNKB 1IM3A 4LU5H 1XGTB 5GS0D 5I1JL 3WHXA 4OV5A 1FSKB 2Y06H 4PRID 4JEGB 2I26N 5F89B 1NAKH 2VITA 1MHEB 3LN4B 2NTFA 2XNAB 1A1NB 3RDTC 5DEFA 1KLUA 5I8CB 1UXSB 2EXYD 2ZPKH 4TVPE 1N8ZA 3TBYA 3RI5K 4BQ9A 1RUPL 3FQTA 3BKJL 2YPLA 1QKZH 5E0QA 1ZSDB 3D2UD 5C3TA 4ZFOA 3RWGB 2GJ6D 2BJML 4LPCA 1U3HD 4GRMA 5FYKU 3V2AR 1CLOH 1QFOA 2BHUA 1ZHBA 2A38A 4XP9L 5D6CB 1N5AB 5TH2B 1F4WL 3RDTB 1MFAH 4KRLB 5ADOH 3AM8A 4K7FA 5DURB 5H35B 5BRZA 1T3FB 1G6RB 1FVCB 5F3HB 1FSKC 4L3AA 1BWWA 2P45B 3T4AA 1JUFB 2VWEE 4MGXA 2OTUB 5FYLH 4YZFF 1QSFD 1T20B 5IB5B 2Z91A 1BD2E 3X13A 3ARTA 3RY6A 4GH7B 3OZ9H 1F8TH 5T3XL 4X7CC 4V2CB 3ZKNC 3LV3A 5IQ7L 1P7KB 5EC2A 1UJ3B 2A9NL 1DQDL 4PUBL 1LDPH 3UMTA 1J0YA 2V5RA 2X4PA 5LGJB 2WM0A 3GI9L 1DEEA 3DHMA 4FXKA 2H32A 4ONHB 1GSMA 1MHPH 2WLZA 3TBWB 4ZUUB 2VLRE 4I9WE 5K33A 1U93B 1SHMA 5EFIB 2X1XR 4KRMB 3SBWC 2D9CA 4FP8L 5C92A 3ZL4H 3I9GH 1MRCH 5HHOB 1QRNE 4WO4C 4G6FD 4D8PB 2G75B 3GEWB 4MQXC 5I75B 4MSWB 1X7QB 1TVBA 4XNMA 1U8NB 2EH8L 4LPUA 3NFPA 5ILTH 4ZUVA 4OKVA 3WNNA 1JRHH 2YN3A 3BYTA 3AB0B 3DETD 1UEMA 2RAMA 5D1QA 1AO7B 2NYYC 2VDQH 4RSVA 2YZ8A 3KPNB 5ICXB 3JWOC 1I8LA 1DVFD 1GPOL 2GKIA 2VYRE 2VZ3A 4YDVA 5IOPB 4DUVA 4WV1C 1OAYH 2XIDA 1VGKB 5E2TH 1XF5A 3MRMB 1MLCB 2GTWA 5DHYB 1F6FB 3MXVL 5IJKC 3BJ91 4YBQC 1ZLWH 3ILQD 2LTQB 2NXYB 1E6JL 5BMFL 1FNEA 1U92A 3RNQA 4DCQB 4NZRH 3VD9A 2Y06L 3EDEA 3F5WA 5E1AB 3QDHA 5J6HB 3PGDB 1JPSH 4CN1A 4XGZB 1UXWA 2WQ8A 5HI4C 2XTJC 2EKSB 2PYFA 3G5VA 1SEBB 4PY8J 3KPRA 4FQXC 2QTEA 3DJ9A 4BUHA 1V3MA 4Z78A 5D8JL 4LEOA 2FX8H 3TZVD 1FVDA 2DLFL 4LHUA 3CZFB 3CSYA 4PJCF 5TF1L 1Q72H 4AYFA 2E3VA 4Y4KC 1QBML 3H0TB 5EORL 3SCMD 4UT6L 4L4TE 3GSUA 2F53E 4MA7L 1KBGH 1K2DA 1WWBX 3BAEL 1X5HA 1OGTB 1WBXA 2EKSA 5HPMB 3JSSA 3MYZA 4M6AA 5T1MA 5AD0A 5EZLA 4C59B 2OMBA 4U1HA 1JCKA 1IC4H 2RGSA 3H9SD 5CJOL 4RFOL 4PJEF 1GIGL 2HKFL 3CFKB 4J7RA 1I9JH 2QKIB 1FBIH 4MZ2A 3KJ6L 1T03H 2VDRH 3ARDB 2BC4A 1RZ7L 4QRUB 1JTPA 1SMOA 4YDVB 5IOPA 2OJEB 3BPNC 3LEXB 3NCFB 1RZ8B 5CD3A 3PJSA 1F8TL 1MIEL 3HUJF 2D0FA 1KJVA 4X0KB 1EUUA 5I1IH 5JOPE 1AO7A 3WEXA 4RRPA 3WNOA 5F9JB 3NCEB 1P2CB 4QXWA 4YK4B 2OX5A 4PJBE 4RIRB 3CFBA 4POZD 5HY9A 1EXUB 3E8UH 4P9HC 1F4XH 2AS5M 3QB7C 1IL1A 4OF0A 3NA9H 4HBCL 5IB2B 4LDOB 4RGNB 3PWLB 1HKFA 1T66C 4K94H 4N8PA 4RMVA 3ZL4L 1IEHA 1E4XI 1MRCL 4OCSL 3MRFB 3H42H 3S97C 4LKXB 2YZ1A 3IDMB 1T0MA 5AUMB 2Q8AL 5A1AA 2YUZA 2X1QA 4IIQB 4HW6A 2FJFB 2P48B 1EVUA 2ITCA 4NJAL 2VL4A 5IVZA 4PJ7E 4UT7H 1MVUA 4KK8C 3MLWH 1IBGL 5C6TL 2DBLH 1OP5H 4YQXL 1KTDA 3S37H 2UUDH 5ACZB 4I0PA 3L3HB 2X1PA 3QZWA 1NUNB 5ESVB 1JNLH 2F53B 5AAWA 1ZEAH 1A2YA 4PJAA 2I60L 5BRZD 5J6GA 2HVJB 5KSUA 1WCQA 3BQUA 4BELD 4NZRL 4J6RH 5DD1L 2UY7A 3IXTA 4PLJD 4R97C 2X44D 4DQOH 1WAAA 2JB6B 4GBXD 3WUWG 4IMLA 4QF1A 3QWOB 3GMLA 5C0BB 1JGUL 3D1MC 1AKJD 2L4OA 2WNGA 2K1MA 3K80A 3SDAB 2FJGB 3DECA 3FO0H 4HULB 3GMLB 4FQJH 1R5VB 5EUKB 4HIIB 3CPLA 4R4BA 2AJUH 1VESA 3UPRA 1ZVHA 5EPMA 3PIQB 4AENB 4L4TA 1A02N 4ONGL 5IV2A 3BRFA 3MR9B 5D1XB 4GKZB 1A3RH 1IEAA 1NLDH 3MV9A 1MWAL 3MBEA 4FQHB 2EIZB 1XZ0B 4PJBB 4K3HA 1IC4L 3HC0A 4W6XB 4FQLL 4NQSB 2CIKB 1TZGH 3P0VL 4Y19D 2W0KA 1WVZA 4RZCB 5DLML 1DR9A 2AW2A 3OGCA 3AY4A 4G6JL 3BRGC 4G5ZL 4F37F 5LCVL 1CXEA 3V4UH 1EEZA 2HMID 4OCLC 2I9TA 3DXAB 4LMQE 1P7HL 1DBKL 3OXRA 2WQRA 3O3BB 3OKDA 5HHQB 4ZPTA 5LAXB 2P4AB 4QRRD 1J1XL 3L7FB 1T0MB 3U0TA 4F9LA 3T0AA 3BIKB 4KMLB 5ID0B 3H6JA 5EN2B 3LQMA 3QEQA 1A3LL 4OLXH 3ARYA 5D7JA 4NQVB 4XX1G 3SDXE 1E27B 4U2YA 1UWXH 3FRPA 1OAXL 2ARJA 2X4UA 4L4JA 3C6SA 4KKBD 1R3JB 3HLAA 4H25B 5D2LA 4GG6B 4Y2DA 2MPAL 4YXKL 1DDHA 4EQ2A 2CIIB 4G9FD 4BZ1H 2OM5A 2QBWA 1NCCH 3CMGA 4JJHA 5EDXA 4E9LA 2C1OA 4WUUB 2KZWA 4EXPX 4AIZA 3QFDA 3TEUA 4I5BA 5BVJA 5HDOA 5E4IA 1J8HE 2EDQA 1LP9B 3FFDB 4LNVA 3ARQA 1KCKA 3EDFA 1GZQB 5JNYB 1BZ7B 3FQRA 1P7QA 3QDJD 4RDQF 5J1AA 2Y72A 3IKCA 5C6PB 3U9PL 1E4KA 3D3VE 1U3HB 4CBPA 4NRXA 4PRPA 2F53D 2I60H 1TNNA 1R3JA 3BQUC 3HLAB 4DOHE 3CCHA 5BS0D 4HS6B 1I8MB 3C6LD 4F3FA 3GSUB 4NC2B 4M4RA 5FO7A 1QLEL 3LEVH 2XWTB 1H8OA 1FE8H 4P4KA 2NX5E 1DL7L 1DP0A 4Z78B 1JGUH 1L9MA 5FDWB 3WJLC 2DWEA 4P2QD 2UYLA 5I16A 4XWGH 1DQML 5JR1L 2EH7L 3MBXL 4ZPTB 3CIQA 1E4JA 3UZEA 2ATKB 4QRPE 3C6SB 5FA3B 4ELMF 1MI5D 2Q3AA 2AQ2A 3BP6B 3ZT5A 3RNQB 4GRLA 5F97E 4K8RH 3INUL 3T1FB 1A3RL 5BS0A 4XP5L 4ORGB 3B9DA 5LGHL 3O6KL 5HYSG 4TPRH 1FG2A 1PVHA 2W59A 1CD1A 1GGYA 3V0WH 4L9DA 1Q9LB 3DYPA 3WIHH 3BWUC 3RWFB 3HNSH 2X4TA 3D69A 4Y19B 5ENWA 3ARGD 5F9DC 3BVNA 3MUY1 1OT1A 1S7WB 1N6QH 3OBAA 4S2SA 2V7NA 1U9KA 3AAZB 3REWB 4OLUH 4PRHD 5D72H 1IE5A 4JFHE 1P4BL 4YPGB 1HINL 3G5ZB 1NCTA 4S0SD 3UTPE 5CBAB 5CFHA 3QDAA 2MOVA 4W4OC 5JW4M 4ZO8A 2K7PA 1S7SB 2B0SL 4W4NA 3P9MA 2JELH 4YBLC 5DQJA 1KACB 4FQXB 4J12A 1U58B 1JN6A 4L29A 2BSED 4NWTH 3HE7B 4LLMB 3VA2C 2B5IC 3TBWA 4QRTB 1XGPB 5T5FH 2R29L 3IXTB 5I1GH 2O5YH 1XCTB 2R8SH 1DBJH 4MNQA 3MRBB 1CICA 3OKEB 2R0ZH 2CO7B 1M71B 2R1YA 3ECBA 3GMOB 3KVQA 2LTQC 2NXYC 4MD0B 5I6XC 3L9RA 3QNYA 4YHOL 3BGMA 4Z7UF 3SGEH 2AV7A 4S1QH 3DVIA 4JFFB 4X83A 3ZDXF 4X6DA 5GGSB 4CUCA 1T2QH 2H9GA 2P5ED 4BH7A 1BLNB 1NQBA 5GS0L 3T4YA 4FABL 3GMPB 4ZG1A 3CFEA 4LVHB 2EE9A 2P8PA 3HMXH 1S9VA 4X6BA 3P73B 1A2YB 4V1DE 3LQAL 3QNXB 3SE4C 3UO1L 4PYHA 4U1JA 1AI1L 3IJHA 3RKPA 4WU5B 4ALAH 1MCPH 2A0LC 2ADIB 3FQWA 4HJ0D 3VFMB 4OZFA 4LPVA 4KKAC 1TXKA 1AR1D 1J8HD 5CGTA 3Q5YA 4YXHH 2V7HB 5IHZA 2P44B 1MVUB 5E2WL 1CFVL 3CFBB 3MXWL 1T5XA 5IJVB 4QXTA 1VERA 3VXUB 2M8XA 3QR2A 3LPWA 3MCLH 4L9LB 4X9FA 3CZJA 3DGGA 1T7YA 3FFCB 1MCOL 1EK3A 1XGPA 1FNHA 5DS8B 3QP3A 5DRNB 3MBXH 5IROA 1H8NA 3HE7A 3NIGE 1HXYA 1MHEA 4C58B 4JO1H 5F89A 2FJHA 1UKQA 4XBGA 1L9NA 5BQ7B 1Q9LA 2C9AA 1FJ1A 2MSPA 1NUDA 4L3CA 5FV2A 2IAMA 4XP5H 3VWKD 3ZE2F 3S37X 2OJZL 3G5ZA 5DJ8A 1ZVSA 4MB4A 1VCAA 4OB5H 4K3EH 5D71H 1F3DH 5A2FA 1FG9C 1GH7A 4QRRE 3REWA 3WIHL 3AAZA 4KUCF 3UTSA 2H32H 3QO1B 3X17A 2D31A 5T1MB 3RVUC 1JWSA 3FQNB 5IFHH 4HXAL 4P2RA 1QSEB 1XGRA 3CVIL 3P77B 4HGMA 3L3DB 1HNGA 2IMNA 2D0HA 2V5SA 1J86A 2XQYG 4NUGL 4U1SA 4JG1H 1P4BH 3BGFC 1R0AL 3RTQA 3G5XB 5C8JB 3X14B 3KPQA 4ZMAT 1ZLSH 3U4EB 4Z18A 5JW4R 4M02A 2WBJD 3T0ED 3L5HA 1XF3A 2CRZA 1BIIA 3RVVC 3EJYC 3QCTH 1MFCL 1J1OH 5CP7A 1EVTC 1KG0A 1VSCA 5BXFB 4N1CA 5HHVL 1RK0A 3SO5A 2O5YL 3EYUL 4ZUSB 1VENA 4I0CC 3DLQR 3OJMB 3QQ9C 1KLFA 1AFVL 4V1DD 5L88H 3OWEA 3DVGA 3TJEL 3CSYB 5FO7B 3RWIA 2O61B 2LVCA 4XNYL 1RUKH 3RA7L 2EEBA 2VDLH 3QFDB 4YHOH 4C56D 5E5MA 1C5BH 1GOHA 4TSBH 3LOWA 1RIUL 3W5MA 2VABB 1NANI 5IWLC 4XGZA 4OI9A 2VDPL 2PN5A 4UTAH 3DSNA 5JHDA 5GS0H 1I1AC 2FBJH 4C83A 3DGGB 3H7LA 4RX4A 5I1KH 2PETA 3QCUL 1DBMH 4WO4D 2YWZA 3JV0A 1G0YR 2IAMB 5FOJA 4M6MH 4ZOBA 1I3GL 3KXFD 2V7HA 1MAJA 4HWNA 3TIEB 1DLHB 3RPKA 1L0YA 3ISWA 3MLRH 4K2UH 5HTSA 3T65A 3SKNA 3RWEA 2RIKA 5K9OB 2OQJB 4YXHL 5D70H 4F7CA 4EJ1C 1CLCA 2VR4A 4ZPVA 2ARJQ 1RJZB 1XR9B 3I02B 4H25A 3O9WD 2H32B 5E6ID 2YUXA 1JYVA 1MCOH 5GRUL 2X4SB 3O3EA 2BX5A 4AEHL 2I9TB 4HIJA 3TIDB 5CUSH 4UB0L 3QFJD 1EJ6A 4PJHE 5FXCH 1A64A 2DQDL 2FIRT 3HI6H 4IBLT 2JF1A 5E8NA 1PG7L 1KIQB 3KPRE 1YEKH 1X4ZA 4M03A 2JCCF 4HUWB 1MAML 1YYLL 5FO9B 1RIHL 3SQOH 3I75A 1E4XH 5CEZD 5FYLD 2ZOKB 4R90L 4KKNA 5FYKD 3JTTA 2EC9U 3WIIH 1XF2A 3MO1A 2ESVB 3QUML 4QRTA 3C2AL 3S34H 3T2PA 4ERSH 2AJ3B 4OZHA 2H3NA 4X8XA 2PO6B 5TH2A 5F7DB 1BP3B 2EIBA 1MI5E 2XFXA 4F9PA 3CVIH 2CIKA 3UTQB 1CS6A 4X6FB 3S9DB 2FECL 3VXMD 1U8JB 1FZOB 3GB7A 2RB8A 3U46B 5E8DL 2OTUA 3PV6A 4LAQL 4ZQKB 4ZNEA 4AEIH 3VH8B 4BSWB 5CGMA 4KGLA 2ZKHL 2YN5A 3SDYL 3UPRB 1RZGA 1ETZA 4Q74A 4N0CC 3MUZ1 2ZCKL 1UZ8B 1MRFL 3U46A 1KIPB 2B4CH 2X10A 5DQJB 3ZO0A 3SDAA 3DMMB 1NGZB 3EYUH 4AY0A 1IAIH 2XFXB 5CJXA 5E8NB 3O6FB 1IKNC 3U36A 2Q76A 3WLWD 1M1SA 1LO5A 5BS0B 1KT2A 5FO8A 1RUKL 5IBUG 4XP6L 1GRWA 2MKLC 3TO4B 4HQQL 1B0GB 3PV7A 2NY6C 1EPFA 1NUFA 3TH4T 2X4TB 4JGMA 3MNZA 4PJ7B 2YD3A 3T09A 3C5JB 3UTTE 1T7XA 3O11A 1IC5L 3PWVB 1QR1B 4N8VG 3D0VB 1EAJA 1T89C 2GTZB 3RL1A 3TIEA 4I2XA 1H9VA 4JZJB 1OW0A 1UYWH 4GRLB 5FKAA 4PG2A 5JW3L 4XPFL 3GM0A 2X09A 3AXLB 4P2OB 4JPIB 5DDHB 3W0WB 2XPGB 4HKJA 4YHLL 3BOVA 1MY7A 4LSPL 4NSKB 1QBBA 5CHNB 1AD0A 4L1HA 4KKAD 2KUTA 3CSBA 4OZIF 5TQ0H 1JTOA 5D9SB 4NO5B 1NBQA 2GITB 4P2CG 5EBWA 2YPLD 4MMXC 1H5BB 4Z7WE 5IM7B 1U8QA 1T7VA 5I8OL 2IADA 3ABZA 4L8BB 3KNBB 3UEZA 2CPCA 1LP9A 4UB0H 3LKQA 4AT6A 1G7HB 1JNHB 3LHPH 1B0WA 4YR6B 3GI9H 2XZAL 3SDXB 4LLWB 3PABB 2EDBA 3S3PA 1F02I 2BXZA 1UT9A 2N7AA 2J88L 5AD0B 3KYOA 1BQSA 1B4JH 3H8NA 3WIIL 4U31A 3I9GL 5F21B 2V2TB 4AT6B 2BVQA 1WJ3A 1MJUL 3VXQB 3T0XA 5C07E 4KVCL 4XTRC 1G1YA 1JRHL 4X9GA 4WI8A 4YK4C 5IKCB 2QADB 2XTLA 5DT1H 3UROR 1CDGA 1AGDB 3V4PH 4LAQH 3F6LA 1EJOL 4X8JA 4LLUB 4S0TD 3RGVB 3IGAB 5KSVB 4Q58C 1T0NA 1AGCA 1KGCE 5JO5B 1EEZB 1OAYL 4BFGA 5E2TL 3QUZB 4NDMB 2PCPA 2W9DH 3CZFA 3KLDA 1RURH 4RZCA 4ZD3H 4EI5A 3K1KC 4M62L 4NQCA 5ABDE 3DV6A 3MACL 4MQSB 3S35X 3VGDA 4HKXA 3RP1A 4RFEA 2NY0D 3FOMB 3I3DA 1IEAB 5ETUB 2AEPH 1DQLH 4ZAKC 4F7MA 2FR4A 3B43A 4YPJA 2B20A 1Q0YH 4QRPB 4ZS7L 2FX8L 4KJYA 1N3NB 1IAOA 1SYSA 4HIEB 2NX5D 2IBZX 3O6FA 3WDJA 3OGCB 3ZTNL 3OF6A 4HIHB 5IHZB 4YXLH 1EHLL 2F15A 1NGZA 1ZANL 2WUCL 4QWWD 5L8KB 2KPNA 4EOWL 2EIZA 4WNQA 5EH1A 4GAJH 4O58H 1FP5A 4LCWB 5F1IB 4GMSL 4C55A 3OPZH 3BKMH 3MV8D 3V5HB 5JW3H 1JPFA 2V17L 4LSRL 2X4OB 4X9IA 2UVFA 3K8LA 3EJJX 5EU6D 3CXHJ 3QG7H 4MJ5B 1HSAA 3VWJB 1SBBA 5D7JC 2F54A 3PV6B 1TVBB 2K3TA 2P5WA 5LQBH 4EN3C 4HGWB 1P7KA 1YPZE 4ZFOL 2BVEA 3QPXL 5GIRB 5TQ0L 1ZE3C 4YX2L 3BI9X 4ODSL 5MENE 5DTFB 1PG7X 5JIIA 4KFZC 1JNNH 4OZIA 2Z91B 5JHDE 4OBRA 2FEEI 2CR3A 3VI4F 3L9RB 3LKNA 1RVFL 1PGRB 4HXBL 3D9AL 1QPPA 3LHPL 2ESVA 4OM1H 3D18B 3CFEB 3ZSSA 1N0LA 3LEYH 3EO1A 5BRZB 4PP1D 5ICYA 1G9MC 1PX3A 2GSGA 2AK1L 1IAKB 5SWZA 2J88H 3DRTA 3DXAD 5F7EL 3CC5A 1AH1A 3RVTC 5I75C 1B4JL 4QO1A 1MCDA 2K9UA 4JREC 2ENYA 2IQ9H 5FHBL 5TJWK 5DJYA 3KLHD 4PGBB 3BZFB 3H42L 1KB5H 1CDCA 2X4QB 5F71A 3BPOB 3NCYS 1GVIA 3R06B 4ZSOE 1RU9H 2Q86B 5SWQB 1XCQB 1NFDB 4X7DC 5FA4B 1FHGA 4RRPG 5IMKA 4KVCH 1JHKH 1HWHB 1A6WH 1UWGH 2AI0L 1U2HA 2VXSH 3C09C 4OF3A 4QHNA 4JY4B 1INDH 1RJZA 4X4XB 3V5HA 5DT1L 2FX7L 5C71A 5C6TH 1OM3H 4PJDF 5C09E 5EU5A 2CLZB 2DBJA 2W65B 5E4EC 3S35H 4LCWA 2JB5H 1EJOH 4RFEB 1YJDC