4YJZL

Human antibody h2526 in complex with influenza hemagglutinin h1 solomon islands/03/2006
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
251
structure length
234
Chain Sequence
VLTQPLSAPGTPGQRVTISCSGSSSNVGTNAVDWYQRLPGTAPKLLIYYNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCATWDNSLNDRVFGGGTKLTVLQVQLVQSGAEVRKPGSSVKVSCKASRGTFSNHAVSWVRQAPGHGLEWLGGLIPIFSTPHYAQKFQGRVTITADESTNTVHMELSSLRSEDTAVYYCAREIPGATSGPDHFFFYGMDVWGQGTTVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
publication title Viral receptor-binding site antibodies with diverse germline origins.
pubmed doi rcsb
source organism Influenza a virus
total genus 50
structure length 234
sequence length 251
ec nomenclature
pdb deposition date 2015-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yjzL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yjzL02
4FQXA 4DGVL 1E0OB 5KVFL 5I18H 1FHGA 3MJ9A 5L6YH 1U8QB 4ORGA 1JPSH 5AYQA 1DQLL 4QWWC 2Y06H 1X9QA 2H9GA 1WBXA 3EHBD 4KZEH 3I02B 3E6HA 4X6CB 2EDQA 3RHWK 1H5BC 4D9LH 1GPOH 2R2EA 4K8RD 1P84K 3D85B 2ZUSA 2V2TB 4Y5XB 4LSDA 4M6NH 5DZOA 1BLNB 4FFVC 5C0DB 5FO7A 5D6DA 2PTVA 4P46B 5F6HI 1VFMA 2ZOKA 3B5HA 2NNAB 4GXVH 5B38A 1MFAH 4X9FA 3V6BR 3PWJA 3WFHB 3CZFA 4JHBA 4MD4B 1KG0B 1F8TH 1FNSH 4KQ3H 3EYOA 5E0QA 3TZVA 5D5MA 2DMBA 2EIEA 4CJ1A 3ULVF 2GK2A 2HLFC 3QDJE 1K8IB 4GAJL 4MQ7A 1V7NH 2PXYA 1D5IH 1IBGH 1KV3A 4PJ8B 1F11A 3W2DH 1A7NH 5FB8B 2BVUA 3RWCA 1BIHA 1JWMA 1MUJB 5HHOD 4UAOC 5C3TA 1BM3L 4ESKA 3FONB 2GTZB 1MCEA 1FZOA 3OBAA 3HA0A 5DEFA 1LO3L 3ROOA 2EICA 2OMNA 5E56A 2QQQA 3CVHH 4KI5C 1BZ9A 3QDMD 4WNQA 1CLYH 3CU7A 4YBQC 4XB7A 1VERA 1YEDA 4UIMA 4ODUB 1E4XI 4X6CE 3BE1L 4I2XB 2MFNA 4XP4L 5IQ9A 1FFNB 1AKJD 1ZWIB 1T4KB 1G7HB 3UTZB 4X8XA 1EUTA 1KCVH 5C70A 2R4RL 2F19L 1TJHH 1ZLWK 3EIFA 1WZLA 2NY3B 4Y1AD 1T7VA 1YEEL 2AXFA 4DFHA 4LVEA 2R15A 3EDFA 5HGAA 3BP4B 4X6BB 3HR5A 4ZXBD 1F2QA 5I0ZA 3S97C 3P0VL 1NGXB 3U7AA 2Q6WA 3GBMH 1RMFL 5HYJD 3FO0H 4NKMA 1JGLL 3KR3H 2F5AL 4FA8A 2DS4A 2PTTB 5EZJB 4YXKL 4GBXC 5I74B 5T1DL 3NN8B 3FN3A 1N7MH 2YK1H 4I18A 2K7PA 5DK3A 1TZHB 4DAGL 4LDEB 3TYFB 5E8PA 3OQ3B 5DO2C 4K3JH 3UYRH 4LCYB 1XR9B 2PTUA 1HCVA 4MCZA 4MXVF 1MI5D 3T04D 4LHUB 5D70H 3WJLC 4I2XE 1I8IB 3V0AC 1T89A 1XIWB 3E6FB 4IIQA 1MCNA 3ARED 3HI6H 5FYKH 4ODSL 3U4BL 3MFGB 2DTML 5DJYB 5IFJB 3MUZ1 1Y6NR 1YDPB 3VGHA 3UXFA 4NM8L 4J6RL 5T1KD 1WBYB 4XBPA 3R1GL 4UIKL 4U1HB 2J6EH 3W9DA 4G6MH 2GUOB 4EN3B 3L6FB 3IS0X 3MO1A 2OP4H 3MRMA 4X6CF 5DYOB 2CRZA 4EVNA 3SY0A 4OQTL 5I2IA 5EZOL 5I1CL 3MQIA 4NJAH 3VMNA 5TFSH 4LPWA 3V5DA 2AJXH 3TN0A 2X7LB 4N1CA 1BQLL 4LCUA 3HE6A 3RP1A 4KRNA 1HZHL 2YSSA 4NNXA 5DJXB 3BKJH 4PY7A 5D1QC 3IU3A 1I1AC 4GH7B 4NGHL 2NXYB 4JO2H 1LK2A 1TMCB 4JPKL 2W9EL 3PWPA 2VDQL 1SEBB 3I9GL 1A0QH 3FTGA 3LZFH 1GGCH 1CVSC 1S7RB 2FO4B 2R0LL 1CZ8L 2I24N 1R3HA 1INDH 1QHPA 4WW1B 5MHSD 2MJWA 4XVTH 3H9YA 4YE4H 3VFTB 1ZT4B 3DMMD 1CICC 1PG7W 4O2FA 3REVB 5C0JB 1KOAA 4OGAD 5KSBB 1KYOK 3BAEL 2X6MA 1BQHG 5T1LD 3UO1H 3P4NA 1VPOL 2X40A 3GMRA 5CEYB 3FJTA 5CHNA 3W5MA 2I9TB 1NFIA 32C2B 5DT1H 3O41A 3MLVL 4OZIB 1T6WA 2AS5M 4B5EA 5IB1A 3K81A 5EBMB 4WUUD 5KSAD 5DURD 2DQUH 1OT2A 3FQTA 3RL1A 4X0KB 4G42B 4QRQB 4RISH 3EYVB 4MSWB 4U31A 3JWNC 5DDHA 3OKOB 4U1KA 3LKPB 3JSSA 4MDJB 4LOUC 1P84J 4IHOB 3QUZA 5I15L 2Z8RA 3ULUL 5ICXB 3SOBH 5IV2A 1VGEH 4FQ2H 2X42A 4ONFH 5CD5C 2P45B 5T33L 3L5XH 4PRIA 4QHKJ 4CN4A 4V1DA 4FQ1L 4K71B 3MRIB 3FB6A 4RA3A 3QUXD 3RWFA 2HFFA 3WFBL 3P73B 5EBLA 2QLVB 3Q6GL 2KKQA 4JO3L 4XXCC 5EIIB 5INCA 5T3ZE 4KUZL 5E2JA 5F7NC 4RFEA 1JZ3A 5BVPL 3IF1B 4Q2ZB 4MHHG 3HAEA 3S37H 4H1LB 4HGKC 3MLYL 1MIMH 1N8ZA 5KSBE 4R7NB 5KVEH 2FD6L 3EFFA 1L7TL 4NFCA 3FQWA 3GHBH 5JR1L 5KS9B 3SPVB 4WEMB 2HFGH 1C1EL 5BRZB 3AAZB 3OX8B 1NCCH 3FHQA 4UV7L 2C1PB 1RZ7H 5B3NA 4OZIE 4UU9A 5EBWA 1JBJA 1UWEH 1LK3H 3TBVA 3H3PL 5I1KL 4D2NA 4JREB 4HWBH 5BV7C 5D8JL 1UM5H 1ACYL 1XF4B 3VG0H 1ZLSH 1LQSR 3HRZA 2YHGA 1PLGH 1HH9A 4PLKC 3B6SB 5A1AA 2Y07L 5JW4R 4QF1A 35C8L 4RA0C 3SKNB 1MF2H 1I4FB 5LQBH 3D0LA 3QXUA 1BVLB 2HLAA 5MEQB 3N1MC 2DN7A 2YUZA 4UOJA 4GSDL 4KJYB 3O45B 5F9OL 2E9BA 4OT1H 1XF5A 3MRDA 1T0MA 2CGRL 1N64L 3RZCB 3EGSA 3VFMB 4LVNC 2VXSL 4PV9A 4MB3A 4LBEB 1Q9WB 3P4OA 4RAVB 3T8XB 1SYSA 2BCKB 3VXQB 5EFIB 2QSQA 3S88H 3GSXA 5D72H 4M5YH 1EIBA 4PP1C 3MV01 1Z5LA 4OLUH 2XQBH 4DTGL 5IWLC 1FYHB 4XRCB 3KPQA 1A6VL 1KB9K 5KS9E 1H3PL 5E2VH 5BRZE 5D2LF 2DYPA 5IBLC 3RKDD 1QO3B 3V2AR 1TZGL 2BY0A 5FUZH 4G8EA 4NQVA 4NWTL 1E27A 4LCWD 1WWAX 2WBJC 4M7ZB 4QHMA 5DRNB 2WLZA 1FGNH 2COQA 3P11H 4Q7DA 3RIAF 4XZUB 3JV6A 4P4KB 5L2KD 3C60C 4EQ3A 4MAUL 3CVHA 4TUJB 1U8NA 1UFUA 3QIBB 1PSKH 3NABL 4WGWB 1NMAL 2IPKB 2P8PA 2J8UB 1E4WH 4DW2L 4WFED 2C1OB 3PNWB 1YMMB 4OZIF 4NQSA 4UBDC 3MRLB 4LLMA 3RA7H 2VITB 4Y4HB 2GJ6B 3GFUA 4Z7WB 5DMGD 4OV5A 2AXGB 2GHWB 4FP8H 2CLRA 3KLSA 3QIWA 3VG9C 3GNML 2OBGA 1X5ZA 5IB3B 2NYYD 1LD9A 4AM0B 2Y6SD 4MAYB 4FTVB 3QDAA 3TA3A 3ARVA 4ZPTA 1CFTA 2DM4A 3PGDB 1U8MA 1PZUB 4UT7L 1ZANL 2AV7A 4X6DB 4AL8L 4XHJD 4D9QE 4JAMA 1KPRA 1UG9A 2EDJA 3HMXH 5I71B 3STLB 1UYWH 5FGRA 3VWKC 2B8OT 1U3HC 1FAIL 1U8LA 4RGMB 5JDJA 5GS2H 4LKXA 3Q6FB 1RUAL 4XMLH 1KPUA 3MRPB 3GSNB 1KYOJ 3L3GA 5JZ7C 3VGAB 1HXYB 2CR3A 4K7PX 5ECJE 1N2RA 1MCCA 1WWCA 4ZUSA 4XMKH 5LGHL 5I9QB 1U8HA 5KS9F 4P23A 4LLDB 4KY1H 2PO6C 4OF5A 2NZ9C 3F7PC 4OD3L 5EO1A 5JW3L 1I7RA 2V5MA 3ME0A 4TOYH 4W4OC 1YMME 5C0CD 4ZO8A 1BOYA 5FYJE 1JPTL 2GJ6E 4NNYA 4PJ9A 3L9RB 2LE9A 4U3HA 4Z7WE 4HT1H 4UI2A 2O5ZL 5T3XH 1DN0B 2NY1C 1G7QB 1J0JA 3L7EA 5J8OA 3KPNA 1AP2A 1K3ZA 3QWRD 1YEJL 3QDGA 5H37H 4PJBA 2E7BA 1F3DJ 4JFEA 4FTVE 2J6EA 4NQED 4W81A 1NGQH 5D71L 2RHEA 3T0EB 5EOTB 2PN5A 3SE3A 2ATPA 1L9NA 3MRRA 3PHOB 4I3SH 2AJVL 2VLKB 4FQXB 4XPGH 1UZ8A 4YDLB 1KJ3L 4ORGB 5CSBA 4LPVA 5JIIA 1RIHL 4WEUD 1AXTL 4OD1H 5HHMD 5C0IA 2H9GB 1WBXB 1U36A 5F97E 4KAQH 5HGBA 4YQXH 3E6HB 2NY2D 1UXSA 1T7XA 1YY9D 2R2EB 2ZJSH 3QUKA 1DBJL 1MVUA 3S36L 4OCYH 4JY6A 2CDFA 4FQJH 1MLCA 2NY0D 5FO7B 2HH0L 4OJFH 2DI9A 4ZTPL 2ZOKB 1MJUL 3BD5A 5B38B 1I1YA 2VN7A 4XCEA 3PWJB 3CZFB 5F88A 3ZE1F 5I8CA 3QHTC 2GCYA 2XWJA 1OTSD 1FBIH 1PX3A 2CK0H 3EYOB 4KFZC 4ZO6A 5GJTH 3TZVB 5D5MB 4KKAC 4GG6F 5J7CC 5TQ2L 4ZS7L 3TNMA 1PKOA 4MQ7B 5J0BA 1BD2D 2PXYB 1EO7A 5HD8C 1F11B 1R3IH 3TESA 3T0EE 4QXWA 5CINL 3RWCB 1L6ZA 3LKNA 4PBVC 1JWMB 1T83C 2VLJD 3BGFB 1ES0A 3U9PL 3O3EB 2VLKE 3MRHA 4M5ZL 2OTWA 4RMUA 1QLEH 1X5FA 2HRLA 3SE4A 2XN9D 3NGBC 1FZOB 4XAKE 5DEFB 2OCFD 3ROOB 3GSRA 2IADA 3RU8H 2AGJL 1BZ9B 4WNQB 5HHVH 1BWWA 5HHME 1YEDB 5TE6H 4UIMB 4PGZA 3PDGA 5F71A 3SE9H 3IFPA 3CFBA 4NZUL 4J3WA 5GJSL 5IQ9B 3BDYH 1KB9J 2C7UA 4U1IA 1JJUA 4TPRH 4CMHC 4W6XB 3U9UA 4YGVA 4XHQA 4HF5L 4WEBL 3RBSA 1P4BL 2IJ0C 2R0WH 1U42A 2LVCA 5DRWA 2E27H 4XVUC 4XPHH 2AXFB 1IQWH 3V9FA 1ZA6A 3BKMH 1BEYH 3CC5A 1K9TA 5D5ME 1HNGA 4DVRH 1CL7L 3LIZH 3IB4A 5CD3A 4V2CB 3F58H 1YN6A 4K3EH 1IMHC 1OT1A 4UT6L 2Q6WB 4A6YL 2X10A 4HWBA 4HK3J 1G1CA 2P5WA 4MJ4A 3RAJL 4NFBA 4NKMB 2VLJE 3KLHD 3HC3L 3ZKMC 5JOEA 1YEHH 1KEML 2J1KA 4U0QB 4JRYA 3SBWC 2HT4C 1BFOA 4QY8A 2F58H 4I18B 3OB8A 1PD6A 5EIVA 5LBSL 4O2CA 5K9JH 5E8PB 1ND0A 1IL1A 4Z7OF 4KWUA 3CLEL 3EZJB 3ESUF 2DJSA 3D2UA 4F37F 5IG7A 1SEQH 4HPYL 4ZFGL 2YUXA 4IIQB 1QBBA 3OKLA 3UBXA 5FXCH 2BSSA 4G5ZH 3MRQA 4RCAA 4XBPB 5I1HH 3T77A 5C2UB 3I85A 3OHXA 1V05A 3W9DB 1OW0A 2PCPA 1FSKC 1XF2A 1B9ZA 3V4UL 3MO1B 5F7MC 3DETD 12E8H 1OSPH 4JKPH 3MRMB 4EVNB 3SY0B 1CLOH 5I2IB 5IB2A 3FO9A 3L3JA 2XYCA 5CEZD 3V5DB 1BFVL 1MJ8L 3F8UB 3TN0B 4LCUB 3HE6B 4NQXA 3IVKA 1ZOXA 2FCBA 2YSSB 4NNXB 3UBXI 1D6EA 4PY7B 3IU3B 4R4FH 5J11B 1LK2B 1ZT7A 3PWPB 4WO4C 4ZOEA 3FTGB 2CPCA 5ERWA 1R3HB 3HZMA 3QPXL 2ATKA 4KROC 4NP4H 4PUBH 3LPWA 1DBBL 1UT9A 4O2FB 1EPFA 3VA2C 1DBMH 1TJGL 1WEJH 2C5DC 5EORL 3UTQA 5J13B 5I6XC 1AGCA 2Z8WC 1FPTH 4XBGA 1WICA 2ED8A 4MNGA 1DBAH 1IRAY 3CSPA 3P4NB 4ODWA 1D5ZA 3GMRB 4P4RA 3NACH 5ICZA 5CHNB 3OSKA 1NFIB 2NY7H 2D7TL 5DTFA 1U8OA 3VDCA 1FDLH 3QXDA 3O41B 3NIDE 1S9VA 1A6AA 4LLYA 4PRNA 5IB1B 3RDTA 3CFCL 3FQTB 2LTQB 3EYSL 2MKLC 3RL1B 5B21A 5DJ8A 3X11A 5TF1L 5DDHB 4LHUG 4U1KB 3QWQB 5LJYH 2ICWA 4QNPE 4DUWA 4Y5VC 4KH2A 5FGCB 4BFIA 3ALPA 1HSAA 2IFGA 3HMXA 3QUZB 3MRBA 4LEOA 15C8L 4MA3A 5F7YC 5ACZA 5T1MA 1BF2A 4JM4H 1UH3A 3EAKA 2AK1L 3PQYA 5IHUL 3LY6A 1G1YA 4PRIB 4GRWF 2XT1B 4V1DB 4XC3L 3VE0A 2QQLL 4CN6A 1H8NA 4RFNB 3FB6B 3X13A 1V3LA 3RVTD 5IW3A 2HFFB 4J12A 1QFWL 1WLHA 3PWPE 5DVMA 4B0MM 5MERA 4JKWA 4HWUA 4WV1C 5EBLB 1GZQA 2A6IA 3RWDA 4KU1A 5INCB 4TSAL 3DUSA 2LFGA 5F7EL 4R90L 3E0GA 3HAEB 1N8ZB 3TN0C 2B4CL 3QUYC 3EFFB 4MX7A 3VH8A 3FQWB 1HHKA 3TH4T 1KN2H 1IAIL 3O3AA 3MNWA 1F42A 4F9LC 2WUBH 2Q86A 3VWJD 2R0KH 2EDXA 3L95A 4WW2C 3VFNA 3VRIA 1HKLH 3GRWL 3O0RL 4Z78A 2WUCL 4UU9B 3VFSA 1IGJA 2WIIA 5EBWB 4FMKA 3TBVB 3BUYA 2R69L 4J3XA 4YFDB 2X44D 4JM2D 1A7OL 5F3BA 3HRZB 4JPWH 1HH9B 2YD5A 3QO0B 2F8OA 4NQDA 4PB9L 3SE8H 1CDGA 4QF1B 5DR5L 5FGCE 1FZJA 3U6RA 1SBSH 3D0LB 2C3VA 5CZKA 2Q8BH 3SCMD 4YH6A 2HLAB 5B22A 1F6AB 4PRIE 1OAQL 2BVEA 3RHWF 2ZSVA 5BOZG 3CSGA 1AY1L 1XF5B 3MRDB 1T0MB 3NIDF 2VERN 4HGWA 3EGSB 2AERT 4PV9B 1C5CH 5F93C 4MGXA 3IU4L 2E5EA 2B1AH 3P4OB 4QGYA 1D6VH 3MOQA 1SYSB 4I77L 1QRND 3GSXB 4O58L 2MCPL 4QNPF 5F1NA 3X3GH 4LASL 1A5FH 3Q5OA 4IRJA 1AC0A 3QNZA 1Z5LB 5EC1A 4DVBA 5JOPD 3CZJA 1BZQK 4OIBA 4WFHE 4I1NB 4MD5A 3LVEA 3T1FA 4YHYB 4OSUH 2DYPB 2OX5A 3QRGH 5EULV 1U0QA 1PZ5A 5ALCH 5HTSA 1A4JA 4G8EB 4JGJA 4NQVB 1E27B 3TT1H 4UDUA 4JFFD 4QHMB 4UDTA 2VYRE 4HKBA 4HUNB 3MJ9L 1EHLL 3JV6B 4TTDD 4H1LG 4PS4H 3CVHB 3K8MA 4DGYL 5JXAL 1U8NB 3MA9H 2QSTA 3H9HA 2J12B 2P8PB 1UXWA 2APTA 3UTPD 2GTWA 2H2SC 5KANG 1RVFL 1PG7L 2R2BA 1ZA3B 2BVTA 4NQSB 3FN0L 4LLMB 4HPOL 1J8HD 4KKLC 1M71A 1CWVA 3I75A 4DN4L 4OV5B 2HT3C 2CLRB 3TO2A 4B41A 3QIWB 4YC2B 2IAMD 5GRUL 3RKPA 1LD9B 2OL3H 2XZCH 2NR6C 3BX7C 3HN3A 4MA8L 4U6VL 3WIIL 4X5WA 2FB4H 3TA3B 1E4XL 4LFHG 4WCYL 5C0RH 4ZPTB 1CFTB 2GYSA 3ULUD 1IZKA 1U8MB 5CSZA 2AV7B 1CF8H 1CG9B 3EDDA 2Y9RT 3LEXA 2OR8A 4JAMB 1KPRB 2FH6A 4ZUWA 5F7UA 3D18A 4Y89A 1HCFX 4LSVL 1TTGA 2XQYG 4U1GB 2JLLA 1LP9F 1MJ7L 4HS8L 2HMID 2GJZA 4UV4H 4LKXB 3FZUD 2GW5A 4JRWA 5GS0L 5HDBE 3NVQA 2V5TA 1KPUB 5EU6A 1HK6A 3L3GB 4LLAA 2IPTL 2AJUL 5INDA 3I50L 3GHEL 1N2RB 4OM0H 1RZJC 4ZUSB 3PJSA 4QWWD 3IKKA 5E8NA 1U8HB 5I75C 4P23B 3V6OA 4Y2DC 1DR9A 4RMSA 4MQSB 1T2QH 1YPZF 5EO1B 4R26L 4FFYH 1I7RB 2P5ED 3UTPE 1NUGA 3QUMH 5ELIA 4Z5RA 4ZFFA 4HIHA 4NNYB 4PJ9B 5D7KE 1WJ3A 2WK2A 3O6FA 4HV8A 1N6QH 2DLFL 3HLAA 3CDCA 2BVPA 3L7EB 4FFVD 4MZ3A 3N0PB 3KPNB 1AP2B 5KJRH 3Q1SH 2IAND 3QDGB 4PJBB 4JFEB 3SDCA 2F54D 1AD0A 1HNFA 4GFTB 3QCVH 1P5UA 3O3DA 4H88L 5JPNA 2ATPB 3MRRB 2JJTA 4OCRL 1UZ8B 2BNUA 3MLXH 2HLFD 5DK0A 4NN5B 3OTTA 1IEBA 4DOHB 3MV9D 4EDWH 1P4IH 1YYML 5C0IB 2AJSL 3TIDA 3W82A 3UJJH 2WWKO 2DQFA 3K2UL 1XGQA 2WIMA 4UTBL 5HGBB 1W72L 3U1SL 1UXSB 3AS2A 1NC4A 4RBPK 4M62L 4ZOAA 4OLXH 3TA3C 1EK3A 3QUKB 4YWGL 4BJLA 1MVUB 3SDAA 4KI5D 4Y16B 1YC7A 1RV6X 4RFOH 2B1HH 2CDFB 4JY6B 1MLCB 4LF3A 4YBQD 1X6LA 1MQKH 4KGLA 2RJMA 5M95B 4HJ0C 4QGTA 1I1YB 4XCEB 4YEEA 1T20A 5JHDA 2CMRH 5F88B 2L4OA 3MBXL 5I8CB 1N0LA 1MCWW 2XWJB 1ZLVK 3ZL4L 5HVHB 5CFHA 4ZPVA 1PBYA 5CUSL 1OB1A 5HDBF 4Y8DC 3TNMB 4KMLB 3QDGE 4PJBE 4WI2A 4JFEE 4NT6A 3N50A 4O4YH 4TULL 3BZ4A 3LKNB 4QO1A 2EDHA 4FNLH 3CFJA 1ES0B 3MRHB 4OFYD 2M2DA 2OTWB 3OKYA 1CS6A 1MCQA 1JF5A 4OM1L 1OP5K 4DGIH 3GSRB 5LKNA 2IADB 3FFCD 1FZMA 2IGFL 2MTPA 2CO6B 4PR5A 4DOHE 4PRHD 4LCCC 5I73C 4XPAH 1A14L 1H3UA 1MCSA 3IFPB 4BFEA 2E6QA 3CFBB 4GBXD 2MOVA 3RX7A 3S6CA 43CAA 3ZT6A 4YHKL 2C7UB 2ZUQC 1UWGH 2H8PA 4U1IB 4Z0BH 5ALBL 4K3DL 5DO2D 3U9UB 4YGVB 2EXWC 4Y19D 3ULUF 1FE8L 1P7QD 3LEYH 1G0DA 1HEZA 1EEYA 3RGVC 1EHNA 1N4XL 2GQHA 3AS1A 5DRWB 3GIVA 1ZA6B 3IAGC 2RR3A 3CC5B 2VN4A 3ORJA 5CILH 4BQCA 4E41D 4DKEL 5CCKH 3FQNA 2YRPA 4O5LH 2HTKC 1ZHBA 2N56A 3HC4H 5CD3B 5GGUA 3C09B 1YN6B 5TDNA 4DQOL 2EYTA 3MJGX 1F4YL 3DGGA 4B7IA 5EA0H 3AM8A 5F6HJ 2Y36H 2YOCA 3IDYB 4EUPG 1TXKA 2R29H 2EO9A 1JHTA 1MRDH 4YHML 3GIZL 4P3CL 4JRYB 1BFOB 4QY8B 1QSFA 2NY4C 3FFCE 4O2CB 1ND0B 1IL1B 3MACH 5HVHC 5D1QD 1I1AD 3BT2H 3ULSB 2OR7A 2ICEA 2YUWA 3D2UB 2ZCKL 4L9LA 5IG7B 5EH1A 5H35A 2BDNL 2I5YH 2ZPKL 1MREH 2A1WH 4ACPA 3OKLB 4IMKC 2AJ3A 3WFEL 1MIEL 3CPLA 3UBXB 2W9DL 2BSSB 4DKFL 3MRQB 4M3KB 3NMEA 1GH7A 4UB0H 1CICD 3SEPA 4OIIL 1RURH 4HH8A 3T77B 3UJIH 1IFHH 2V9TA 3UJTL 3OHXB 1HOCA 1FYTA 1F4WH 1IGFH 4Y5YA 1UKQA 4TUKH 2PCPB 1XF2B 2D2OA 1GGYA 4JGMA 2K9UA 1EZVX 1ULVA 1MOEA 3O2VH 4TN9A 2FX8H 2NQCA 3FQUA 2RCSH 3TLRA 5IB2B 1CBVL 3FO9B 5F7WC 3L3JB 1D5BA 4OFKA 4YFLI 2R8SH 1S3KH 4WI8A 1S3KL 4NQXB 3IVKB 4KI5F 4ODVH 5I18L 1D6EB 2YMXL 5L6YL 3P30H 3OR7A 5C7XH 1JPSL 5HHQA 2VO5A 1NC2A 4LSQH 2C4XA 2BC4B 1ZT7B 1MFEH 4LOUD 2DJUA 2Y06L 4JRYE 4S1SH 4P2YA 3DECA 5ERWB 2QTEA 2YS4A 1SY6H 2ZUYA 4I3RH 5F89B 3HZMB 4Z7QE 5HXMA 2ATKB 5CD5D 2DL2A 1KPVA 2Y7QA 4D9LL 2F5BL 5F8RC 4I5BA 1IT9H 4CGTA 4TTGA 1GPOL 3VGFA 5FOJA 2I60H 3UTQB 4NN6C 4M6NL 1AGCB 1I7ZA 1PKQA 4XBGB 4MNGB 5C86A 5MEPA 3UZQA 4ODWB 1D5ZB 3IJSA 4RQQA 4BH8A 4GXVL 4P4RB 5E70A 3AXLA 1MFAL 3QAZB 4D0CA 1U8OB 3B5TA 3QXDB 2OL3A 1F8TL 1JWSA 1A6AB 1S9VB 4LLYB 1FNSL 4KQ3L 4PRNB 3RDTB 1JNJA 4R97C 4WHYG 3KHOA 4HHAA 3FT2A 5DJ8B 3X11B 3SDYH 4U3XA 1V7NL 2ICWB 1Q38A 4G9FE 1IBGL 1WWWX 3W2DL 1S7UA 1A7NL 1Y0LA 4BFIB 5IMOA 1AI1H 2KZWA 4NO2A 2QHRH 3MRBB 4LRIC 4LEOB 4MA3B 5ACZB 5E8OB 5T1MB 3OB0H 5E6ZA 2C26A 3I6LE 3WDHA 2CLVA 3GO1H 3PQYB 3ZT7A 4OCSH 4WU5A 5EOCH 3VE0B 4AIOA 4PLKD 3X13B 3WD5L 4BZ2H 3VXUA 3GJEA 5MERB 1CLYL 5I16A 4PG9A 1GZQB 2A6IB 3RWDB 3WS3A 1OW0C 4L8SA 1CYGA 4JJHA 1FLTX 2BP3A 5AWNH 3DUSB 1QBAA 1TTFA 2N7AA 4WDIA 1CTNA 3QUMA 3TBYA 2P4AB 3DNKA 4JHWH 4NC0B 3ZE2F 2NPLX 3WN5C 4MX7B 3P3YA 3VH8B 3WEXA 1HHKB 4LGPB 2DLGA 4Y4KA 3PABA 1UEYA 1XCQA 1TJHL 4P5TC 3O3AB 3MNWB 4PP1D 2DBLH 2Q86B 3L95B 3RTQC 3VFNB 3VRIB 4Z78B 4IRZH 3VFSB 1IGJB 3P9MA 2WIIB 3O2WH 4E5XA 4XMPH 2CUMA 3BUYB 4XC1H 5C0EA 5HYSA 1B4JH 1NMCB 5F3BB 4YO0A 5FHAH 1DL7H 4H0HB 5IBLD 5DJAA 3T0WA 4NQDB 3GBML 1FZJB 3GMPA 3U6RB 4WFGD 3FO0L 4K9EH 4MNHA 2C3VB 1M1SA 2WBJD 3KR3L 3MODH 1E28A 3PQYE 4M8QA 4NO0A 2ZSVB 4BELD 4P48A 1LEGA 1N7ML 2HYMA 5E2WH 3VD4A 1RJLA 3C60D 2JB6A 1ZLUH 1YNTA 5EOQL 4HGWB 4K3JL 3EO0A 4ZOBA 3IDGA 2QQKH 2W0LA 2MHAA 4ELMA 3BESR 1F3JA 4OZHA 1OD7A 2MPAH 1KFAL 1KACB 2DQIH 5F1NB 3HI6L 5CKAA 2V9RA 5FYKL 1B88A 4IRJB 1KCRL 4TNWK 5E24E 3QNZB 3LDBC 5EC1B 4UBDD 1HSBA 5KAQG 5DVNA 4DVBB 3MLUL 3WIHH 5T3XE 3OKNA 4G7YH 4C83B 4HFWA 3KPPA 4X6EA 4MD5B 3O2DL 3T1FB 1OAYH 3NCYS 4KJPC 1CDIA 2J6EL 3O4OC 1PZ5B 4WGVB 4HK3N 4PGEA 4G6ML 3RJDA 1A4JB 1ZT1A 5DC9B 4UDUB 4LDOB 2Z4QA 4UDTB 4HKBB 3FQXA 3ECBA 1V7ML 4NJAL 5TFSL 3HAEG 2AJXL 4NQDE 4WWKA 2APVA 4PJXF 4KRPB 2WM0A 3VWKD 2KBGA 1U3HD 3IFLH 4ERSH 1C5DA 1I1RA 3H9HB 4JO2L 4XX1E 3PWUA 2VDMH 1UXWB 3RPKA 2GTWB 1EO5A 1A0QL 1MRFH 1DEDA 2R2BB 3O9WA 2LU7A 1INDL 5JZ7D 2X4UA 3PDDA 3SJVA 3MOBH 2VXQH 4XVTL 1M71B 5C6TH 4YE4L 1A7QH 5HYEA 3CDGA 3EOYG 3I75B 3MGTA 5AZEH 3BPNB 4ZAKC 3CJJA 4PLOB 3TO2B 4KDVA 4L29B 3DI2B 1CXHA 3GDBA 2PO6D 2NZ9D 3CK0L 5BW7A 5EU5A 4HMDA 3UO1L 4X5WB 5CP3A 1TJIH 5KW9H 4GMSL 1MCKA 2DTSA 2GK0A 1KJMB 4IRSA 1I3RA 3DVGA 5CSZB 2NY1D 5H2BA 5DT1L 3LEXB 1QYGH 2DQUL 3ZTNH 4PJEA 4ZUWB 4PPTA 4ZD3H 3D18B 1A6ZA 1OAKL 2BFVH 2YD9A 3O6KH 5BXFA 1CXIA 2GJZB 3TM6A 1RIUH 1QNZH 3FO2A 5EU6B 3SOBL 3BQUA 1VGEL 1IM9D 4EDXA 5ITBH 4FQ2L 2VDOH 4ONFL 5INDB 4E42A 4GRMA 5D7LA 3PJSB 4F8TA 5E8NB 5E4EB 3BH9A 4OGYH 4HMCA 1N26A 5D1XC 1FVEA 4Z5RB 2EE2A 3U48A 1B0RA 4ZFFB 4MB5A 2X5PA 4HIHB 4XWGH 4GKSA 3O6FB 4HV8B 2Q1EA 3HLAB 2BVPB 4JANA 5BO1H 2VIRA 2EH8H 5EIQA 1MIML 4YDVA 5KVEL 4UINH 3JTTA 3NZ8A 3OZ9H 2UV3A 4KRPC 3SDCB 3ARFA 1GIGH 2DB8A 1AD0B 4YBLC 1RHFA 1VACA 1NCCL 1JYXA 3O3DB 5JPNB 1RZ7L 3H9SA 2FSEA 4KKAD 1WCQA 4JZNA 3WHE1 3K1DA 2BNUB 1FP5A 1NCAH 1P1ZA 1UWEL 5DK0B 3KXFA 4HWBL 2ZNWA 1IEBB 1UM5L 2BVQA 3VG0L 5HD8D 1ZLSL 1A6WH 1PLGL 3UTOA 3TIDB 5ETUA 3QFJA 5DQJA 2DQFB 4AEHH 1XGQB 2UWEF 3UTSD 3ET9F 5EU6E 3JWOH 1MF2L 3H9ZA 1NC4B 3P4MA 4I0PC 2NX5A 4TVPH 3SDAB 3ZO0A 3PP3K 4LQ1A 1UB6A 1KCLA 1SY6A 3V6OE 1J11A 4LF3B 2NY6C 4OT1L 3VFPA 3T0DA 4LSRL 2X1XR 4YJZL 1T20B 5JHDB 1OM3H 2F53A 4HCRH 4AT6A 2OTPA 3S88L 1WFOA 2QR0A 5D72L 4M5YL 5E8DH 1OL0A 2VXUL 4FMFA 4H25A 1VGKA 4ZPVB 1FC2D 1OB1B 4OLUL 5KOMC 3PL6A 2XQBL 3VRLE 4BQ6A 4NT6B 1LEKA 4XVUD 5E2VL 3ZDYF 4YIQA 2GFBA 4ZFOA 5FUCC 3BZ4B 4MMZC 4YX2H 4OFVA 1X4XA 3CFJB 4XTRC 3NFSH 5JO5A 2ARWA 5FUZL 3RFZC 1ONQA 1WFNA 4PJHA 3BI9X 2BNRD 2EH7H 1EJOH 4WHDA 1FGNL 1FZMB 5ESAA 4PR5B 3P11L 1EVTC 4QOKA 2WANA 4L8CA 3QIUC 3TO4C 2CO7B 4S0TD 1Q9LA 3ZKMD 43CAB 3LRHA 5FGBA 1PSKL 3SGJC 4KZDL 1R24A 2HT4D 1F13A 3PV6A 3BRGC 1E4WL 2H8PB 4GW5A 4I9WD 4KQ4H 3HS0A 4PJ5D 4IBLT 4DZBA 4GRLC 5HGDA 1HEZB 1EEYB 3MV7A 5JHDE 1YYLH 3WJJC 1D5MA 5C2BH 4FP8L 2AJYH 3GIVB 2D3VA 1GHFH 2CXGA 3BD3A 1QLRA 1OWRM 1U91A 2W0KA 3FQNB 2FZ3A 3REWA 1ZHBB 5GGUB 5TDNB 2EYTB 4XI5C 2XRAH 2F15A 3DGGB 5D7IE 5HDLA 4HIIA 3UDWA 4MA1B 3HMXL 1F45A 1UYWL 1EXUA 2XG4A 2FIRT 4QRPD 1JHTB 2BOCB 2JJUA 3VDAA 1RJYA 4JCMA 2IPUK 1QSFB 1J18A 4G6KH 4XMLL 3K74B 3MBEA 2IMMA 3AB0C 2FX7H 2ICEB 4L9LB 1KBGH 5H35B 1HILA 4WO4D 3EDEA 2AJ3B 4KY1L 4DN3H 3CPLB 1X7QA 2XOTA 4TOYL 4KROD 3DGCR 4BYHA 3BP5A 2KDGA 3QQNA 2AQ1A 5DQ9A 1T6VN 1HOCB 1FYTB 4HT1L 5T3XL 2YBRA 4Y5YB 1VFUA 4JY5L 3G5ZA 5F72S 2D0HA 2JJVA 3RVWC 1TPXC 5K9KA 1CE1H 1TIUA 1NGQL 3CSYA 1D5BB 1ZAGA 2JELH 4HQQH 2AK4D 4XPGL 3SKJH 3T0AA 1FNFA 4M48H 5FUOH 1XGPA 1G6VK 3OR7B 4EBQH 4P9MH 5HHQB 1G0YR 1NC2B 3MROA 3UROR 2J2ZA 4OD1L 1YNLL 1QSFE 4P3DA 4YQXL 5CMAA 2C3WA 1KPVB 2Y7QB 2NXZB 4P2OA 4I5BB 1JUFA 2ZJSL 3ESVF 3H6JA 4KK9C 2P1YA 5DUMH 3LKOA 4OCYL 4FQJL 1I7ZB 1PKQB 2BERA 5D7IF 5AZ2L 4OD2A 1N3NA 5MEPB 1RZKH 4OJFL 1X44A 3IJSB 4RQQB 4BH8B 4YAQA 3AXLB 4D0CB 1IGML 5A16A 2OL3B 1FYTE 2GY5A 1FBIL 1JWSB 2V5RA 5DSCA 2CK0L 3ULVH 5GJTL 4HHAB 3QUYD 3FT2B 5EU4A 4M00A 4AQ1B 1W0WA 1OY3B 4R0LC 1R3IL 2I26N 1S7UB 1Y0LB 2E7LA 5HGHA 2J7LA 5CBAA 5IMOB 4LSTH 2APFA 3ARBC 4NO2B 4OGXH 5KOVC 1HDMA 1XMWA 4PGCA 1NLBL 3UBXG 3T08A 1QLEL 2CLVB 2X89D 4FG6C 4WU5B 3JVGC 5C07A 3LN5A 2LV4A 3EOTL 3RU8L 4WI4A 3B43A 4MLIA 2NCMA 3VXUB 3GJEB 5HHVL 3C5ZD 4Y5YC 2HN7A 4PG9B 2Z9TA 3WS3B 5TE6L 3SE9L 4L8SB 4PLJC 3KPSD 3KVQA 5MEND 4XPBL 5J1AA 3DRQA 4OLVH 1IGTA 5GS1A 1R3JA 3BDYL 4WDIB 1T3FA 2CKNA 3QUMB 3TBYB 4C56D 1NGWA 4O02H 3KYKH 4TPRL 4QRTA 5SWSA 4PD4K 1PKQE 4HKJA 4U7MA 1OP3K 3U36A 3OR6A 3UMTA 3WEXB 4Y4KB 3PABB 5F1IA 1XCQB 2HJKA 2ADGA 1G0XA 2WAHA 1G7MA 4XPHL 1F00I 3BKML 3MPCA 4RNRB 2UUDK 1BEYL 3P9MB 4E5XB 4LDLB 5E08L 4DVRL 5I1JH 2RBLA 5C0EB 5HYSB 3NIFE 4JFDD 3VXRD 4YO0B 5F9WC 3DUUA 3F58L 3K3QA 4K3EL 3HCVA 5DJAB 1GGIH 5FYLL 3T2NH 3L5WA 4NQCA 3GMPB 4C58B 3L5HA 4MNHB 3MCLH 1MQ8A 1E28B 4Z7UF 1J86A 4M8QB 3TVMA 3LRSA 3DVIA 3HNTH 4NO0B 4RMTA 1LEGB 2F58L 5CJXC 1IKFH 4JHAH 1RJLB 4YR6A 4J4PC 2JB6B 4LVHB 1YNTB 3VXUE 5K9JL 3EO0B 1Q0XL 4NC2B 3IDGB 2AJZA 1MFBH 2MHAB 2X70A 4ELMB 1F3JB 4OZHB 1QFUH 1SEQL 4F7MA 2H2SD 5IGXH 2L7UA 5SWZA 3RVXC 4XNUL 1HHGA 4G5ZL 2GEEA 1GGBH 4KKLD 3ZMRA 1YA5A 2QBWA 4RSVA 5I1HL 3OKNB 4HFWB 3KPPB 4X6EB 2HT3D 1Q1JH 3MR9A 3N1FC 2XI9A 3GKZA 5DUBA 4PGEB 5JUEH 3BMVA 2NR6D 4L3EA 1ZT1B 12E8L 4OLZL 2Z4QB 1Y18A 1CLOL 2AEQL 1NMBH 2YA1A 3FQXB 3ECBB 5JNYA 4HZAA 4K8RH 2IQAA 4XNMA 4MJID 5ENWA 1AHWC 3BZFA 1JK8A 4WWKB 5CJOH 3MCKA 5IVZA 4R4FL 3ZKXB 3OF6D 1C5DB 3VH8G 4AEFA 1OTUC 3PWUB 5I30H 3FT4A 5C0BA 4MCYA 4OKDA 5FFLA 1K4CA 4HXAL 3O9WB 5H37G 5LWYH 2X4UB 3SJVB 2CXKA 4NP4L 4G6FD 1H3WM 4PUBL 4LU5H 2FEDC 3CDGB 3MGTB 4IDLA 3DVFA 4ELME 1DBML 4QHLA 4Y2DD 4OZHE 3QG7H 5D6CA 1RFDL 5EU5B 1FPTL 4JG1L 3TBSA 1DBAL 1TENA 4KHTH 2DBJA 4NNPH 4RAUA 3NACL 2E7CA 2NY7L 5DD5H 1UM4L 2GK0B 4XX1G 1FDLL 1I3RB 3DVGB 1JGEA 4IRSB 5H2BB 5E9DA 3Q48A 3O6MH 4ZTOH 4PJEB 2B39A 3ZKSD 1A6ZB 1CGTA 1FL5A 3QB7C 5E6IB 2FATH 5BXFB 1SBBA 3FO2B 5D7JA 3BPLC 3BQUB 3HE7C 3FFDA 3HZKA 4RGOH 4EDXB 4JM4L 1FIGL 1HHHA 1IAKA 3NAAH 4HBCH 5DK2B 4GRMB 5D7LB 3C5SA 5C0FA 1OCWH 3BH9B 5H94A 3GSQA 4PB0H 3QEHA 1FVEB 1Q0YL 2FHFA 5JXEA 3SJVE 4D9RE 3TA3D 3BKCL 2BVOA 4GKSB 1Z9MA 5I1GL 3CCHA 1Q94A 5GRVL 4ENEC 4JANB 2VIRB 2X4PB 1QBLH 4HJ0D 1HQ4A 4YDVB 3JTTB 4L5FH 2JF1A 3NZ8B 3EYQC 4DKDC 3ARDA 3ARFB 2IWGA 5D1ZC 4XNXH 2XZAL 1VACB 4GKOA 1WIOA 1S9KC 2WUBL 3ARGC 2R0KL 3H9SB 3FRUA 2FSEB 1HKLL 5DF0A 4JZNB 2OK0H 1CGVA 4JR9H 1P1ZB 4PJEE 4XBEH 3KXFB 2IALA 1A3RH 2BVQB 2R23A 4JPWL 1FFOA 4A2MA 5JA9A 3I3BA 5LVEA 4ZO7A 4FQLL 5ETUB 3QFJB 3K7UA 5DQJB 4MB4A 4OZHF 1ERNA 3SE8L 1BPVA 5E94A 2RB8A 1TFHA 2Q8BL 3O4LA 4PD4J 5IROA 3P4MB 4JFZH 2NX5B 3QDHA 1URLA 3IDXH 4MNQD 5FYKD 1DN2A 1UB6B 4BKLA 5IJVA 4OCXL 3VFPB 3K4AA 1FZKA 5GRJL 1SQ2N 1C5CL 2JJSA 2F53B 4N0YH 2B1AL 3W81A 3IJHA 4CVUA 1D6VL 4AT6B 1NGYA 5L9DL 3IDJA 3G9VA 1PEWA 2QR0B 1FORL 5F96H 4WFFE 2H3NB 3DJ9A 3X3GL 4R2GB 4K94H 2EXWD 1A5FL 1VGKB 4H25B 3S35H 3CFDA 3PL6B 4WJ5A 3MRNA 3RGVD 1DVFC 1LEKB 1CXEA 5JTWA 1RHHB 4YIQB 2GFBB 4OSUL 4ZFOB 1UM6H 3QRGL 3MXVH 5KVDH 1U3ZA 3BEWA 3LS5H 2BZDA 3H9SE 4FZEH 5ALCL 1JPFA 4OBRA 1NBYA 4W6YB 3H3BC 5JO5B 4BUGA 1QR1A 2ZCHH 1ONQB 2HTKD 1EHXA 3TT1L 4PJHB 3KXFE 3JUYA 5T3ZH 3G08A 1YEKH 2BY2A 5ESAB 1T5WA 3N1GC 2ZSWA 5F44A 3G04A 3TCLA 2CUIA 3UZEA 1HIMH 3QNXA 4QOKB 3S3PA 2J88L 3QFJE 4L8CB 4Z7VA 1C12A 4MQTB 1Q9LB 3BFOA 3MA9L 1R24B 2NX5E 4GQ9H 4WTWA 1UA6H 3PV6B 2NY4D 1IEHA 4GW5B 4MNQE 3HS0B 4DZBB 5HGDB 4XCCL 1DUZA 3B4NA 3MV7B 4BZYA 1D5MB 2F53E 1D9KC 4LPYA 4OLWH 2ZUUA 1ZE3C 1OGAA 3BPOC 1CDUA 5F9DC 3VD3A 3K2MC 4JDZA 1RJZA 2UZIH 5CZXC 3BN3B 2XZCL 3RQ3A 1QLRB 1U91B 3F12A 2FB4L 1VA9A 2FZ3B 3REWB 5DFWH 5B3JE 2ERJC 5C0RL 2NTSP 3H7BA 1S9WA 3RZWA 4EI5A 4HIIB 2VQ1A 1CF8L 1JV5A 1RZFH 4KRMB 1KNOA 1Z0NA 4M1GH 3OJMB 3HB3C 1JMZA 2FRGP 4AG4H 2D7OA 4PJHE 1YQVH 4F57H 2EC9U 1A7RL 2BJMH 2C4FU 2YWZA 1RJYB 3QI9A 1BX2A 5E2TH 2Z31A 5IJKA 4QOKE 4H1LH 5J12C 1KJ2H 1A7BA 3MBEB 4OM0L 1N5YH 2WP3T 1NANH 4OCLC 4X80L 5GGTH 1R3LA 5I1IH 4J8RA 1HILB 2IEPA 3IDUA 1T2QL 2W59A 1F58H 1X7QB 5T5FH 4FFYL 1GRWA 5FHBL 3QUML 3JV4A 3BP5B 3EJZD 3I6GA 3BEVA 5IUSA 4TNWF 5DQ9B 4OAWB 3OJ2C 3TYGH 3MV7E 2KPNA 1WIUA 2YBRB 1OVZA 3G5ZB 4HDIA 5KJRL 2P5WD 1FRGH 2DMKA 4KDWA 5C8JA 5K9KB 1JI1A 1HINH 2H6PA 1CGWA 3S4SA 3CSYB 1K5NA 3QCVL 2YUVA 2DM7A 4X6CA 2A77H 5IIEA 1XGPB 3UX9B 3MLXL 1KIQA 4U49A 1U6AL 1Z9SA 1LO0H 4Q6IC 2VJXA 3VGBA 1UJ3C 4OFIA 1P4IL 4EDWL 2J8HA 4P3DB 2NNAA 3STBA 4X9BA 5CMAB 1NLDL 1G9NC 2FWOA 4P2OB 2J4WH 4XNYH 2HT2C 1JUFB 4OUOA 3FMGH 4OLXL 3E8UH 3LKOB 5DEGA 1MAMH 1IC7H 2QADC 4NBZB 4RFOL 2XZZA 2B1HL 1MQKL 4OD2B 1MNUH 1N3NB 1ZGLA 4U6YA 1WFUA 4JQIH 2VE6A 5GSVA 4YAQB 1QVOA 2YD4A 4IOFC 2CMRL 1IM3A 5A16B 4LAQH 2BRRH 2CKBH 3BH8A 1JTOA 1GZPA 2ZUWA 2FL5A 3GK8H 3MJ8A 5DSCB 4K9EC 3EJJX 2X4SA 4XVSL 2XWTA 5EU4B 2J3SA 3VFRA 1W0WB 3BGMA 4QCIA 1Q72L 4P5TD 1MCPH 5GRYA 4HJJH 3SDDC 3QDMA 4O4YL 5HGHB 3RTQD 5CBAB 3GMNA 4L4TD 1HDMB 4PGCB 4P0DA 2Q7YA 3F6IA 3EUUA 1QSVA 1BZ7A 4H8WH 2VKXA 3NCEB 4IJ3B 5C07B 1J1XL 3LN5B 4DGIL 5C9JA 2HJLA 1AKJA 4XPAL 2HWZH 1ZTXH 2HN7B 3GUTA 3ZLQC 4OKVA 5J1AB 3O6LH 3DRQB 3LSOA 1IGTB 4QXGH 4RAHA 5GS1B 4Y1AA 4RX4D 1T3FB 5JHLH 4WRLA 1NGWB 4Z0BL 1JFQH 2DDQH 4KJQC 3GMQA 4QRTB 5SWSB 4HKJB 4NC1C 3U36B 5L7XH 1DSFH 2FLBT 5FIEA 4ZXBA 3OR6B 5F1KC 3LEYL 1LO4H 5F1IB 2HJKB 4U05A 2ADGB 1WWBX 1YEGH 1G7MB 4M1CC 4NKIL 3V4VH 1MCFA 5HYJA 4IOSD 1INEH 5CILL 3F7YA 2R9HC 3HG1E 3GSNH 2ESVD 4O5LL 3HC4L 3KAAA 5GS2D 2D7MA 3DUUB 4CVWA 3HCVB 4KJPD 1BF8A 2PKDA 4KTEL 3FQRB 2WNGA 3L5WB 5IMKA 2L0DA 4NQCB 5IEKA 1P9MC 2ADFH 5EA0L 3T2PA 1MI5A 4L4TE 3BXNA 1KLUB 3TVMB 2R29L 2J5LC 3LRSB 1MRDL 4U0RC 1IGCH 4JKKA 4JB9H 4PJGF 3AREA 1JRHH 4Y4FC 4YR6B 4F9PA 3MACL 3ZDXF 2AJZB 5T1KA 3MRGA 3VFGH 2X70B 2PR4H 4MDIA 1YUHA 2I5YL 4F7MB 2A1WL 2GUOA 1MHCA 3UC0H 1BQSA 2VXTH 4EIGB 5SWZB 1HHGB 1EEZA 5SWSE 5TE7H 2QL1A 1MCLA 4ZAKD 1F4WL 3MR9B 5F70A 5GGVY 1IGFL 5EWIH 5J89A 4TUKL 1GVIA 5DUBB 5BOPA 4L3EB 3ARZA 3SO3C 1RUMH 3L3HA 5LCVL 4HUWA 5D2LA 3GGWA 3AMLA 3O2VL 4K55A 1Y18B 2RCSL 3QZWG 5C0AD 3N1QC 5KSVA 4RGNC 2ESVE 5J06A 2ZOLA 5JNYB 2R8SL 4GAYA 5EZIH 2IQAB 4XNMB 5ENWB 1U93A 3BZFB 1JK8B 4NCC1 3OAYH 4NQCE 1ZXQA 4ODVL 1MHPL 3MCKB 3QH3A 4EUPH 3P30L 3DMMA 5IVZB 5C7XL 4XP5H 1OF2B 1IE5A 2VWEC 3WXWH 4LSQL 3AC0A 3FT4B 5D2NC 1MFEL 5C0BB 4MCYB 3VFOA 1NGZA 4LRNH 1K4CB 4S1SL 5GGSA 5T1LA 1NDGA 1SY6L 2X41A 4I3RL 4YHOH 4YGAB 3WNKA 1KXVC 4TVPE 4OF6A 1IT9L 1X5AA 4XNQA 3SGKA 5HYSG 4QHLB 1QZ1A 2I60L 1FQ9C 1RI8A 5D6CB 4WUUA 5D1XD 3VD9A 3WKMH 5KSAA 5JLZA 3TBSB 2ORBH 5CBEA 4MJ6A 4RAUB 2DQGH 1X5HA 4Z9KB 3SKOA 3WNNA 3UYOD 3QHZH 1I8LC 5E9DB 4APQC 3JWOC 3F62A 4YK4B 3ZYIA 4L3EE 2BNQD 3B9KC 4G8FA 3SDYL 4K07A 4CADB 3MNVA 3QUXA 3BHBA 2FGWH 3LV3A 1A9BA 3QEGL 1JHLH 5D7JB 1SJXA 1OGTA 2QHRL 3HZKB 4KUCF 3MLSH 1IAKB 1HHHB 4GRWH 4ONGH 3GO1L 4OCSL 4NCC2 4Q2ZA 5EOCL 3C5SB 5C0FB 5IVNA 1KJ2A 2A6KA 5H94B 5C0BE 2VR9A 4BZ2L 3GSQB 2YZ1A 3QEHB 4X7CC 1M7DA 4I0PD 2BVOB 1TLKA 5AWNL 5LAXA 4TNVK 3CCHB 4PRDA 1Q94B 1NBZA 1AFVH 2NY6D 5GZNC 1ORSA 4JHWL 4BSVA 1HQ4B 1RPQA 3ZKNC 2QEJA 3ARDB 3O11A 4X5XA 1I85C 5FYLD 4KVNH 3V5HA 4F15C 5CJQH 3GM8A 2DBLL 1CIUA 2C9AA 5E9DE 4LGSB 3FRUB 3T3ME 4IRZL 4P9HH 3O2WL 2DLHA 2IALB 1R5VA 1NANI 5KN5A 2R23B 4XC1L 1B4JL 5FHAL 1DL7L 1FFOB 4HS6A 3WXVH 4LIQH 5E94B 1HHIA 4XTRD 1NAMH 3W5NA 4PY8J 4WI7A 4K9EL 1EVUA 3W11C 3O4LB 4NZRH 5GHWH 1IC5H 3LS4H 5I1LA 4R4BA 4BKLB 5IJVB 5E2WL 3QIUD 3TO4D 1FZKB 2ITDA 1NCDH 1S5HA 5KVFH 4M1DH 2QQKL 3DX8A 1S5IL 3IJHB 1DQLH 1NGYB 3IDJB 4JFYA 4JPIA 2MPAL 1NFDF 2DQIL 5FCUH 3CFDB 5CEZH 4WJ5B 1YJDH 4GRLD 4LCWA 2CKBA 4CDHA 3MRNB 4OI7A 1DANT 3LAFA 1BJ1J 3WIHL 2H2PC 4G7YL 3OJDA 4GG6A 1FGVH 1OAYL 6CGTA 3K80A 1X3DA 1GC1H 5L2KA 3BEWB 5HDQH 1JPFB 1Z2KA 1NBYB 1XGTA 3QCUH 1QR1B 1NC4D 4F8QA 2IPKA 1HN1A 3FB7A 2H32H 3G08B 1T5WB 2LQRA 1U8PA 2OMBA 2ZSWB 2G75A 3G04B 3TCLB 4IOIA 3WNMA 3QNXB 4LP5A 1T21A 2EECA 4JQVC 4Z7VB 1C12B 4M93C 1A1OA 1EJ6A 2FLRT 2EIZA 5MI0B 5BZWA 4N9OB 3IFLL 2YD2A 5FM4A 4ERSL 5DI8A 2VB5A 1A6UH 1RD6A 5DD3L 4OLYH 4J3UA 2VDML 3H3KA 5CZVH 4GS7B 3OJVC 5IMMA 1MRFL 3CVIL 3ZE0E 3EYFA 5AG9A 1SYVA 4N5UA 4Q58C 3MOBL 2VXQL 1JL8A 5C6TL 1A7QL 5AZEL 3P9LA 1PG7X 1OGAB 1ZHNA 1ZLWH 3QXTA 3ARXA 4JDZB 1RJZB 3QPQC 4M7LH 3BE1H 3F12B 1TJIL 5KW9L 3PGFH 5IROC 5ISZD 1C7SA 1W8NA 4HMEA 1PEZA 3H7BB 1S9WB 2JIXD 3ULVE 4EI5B 2ZP0T 2VQ1B 1JV5B 3GSNA 1XH3B 3KPRD 1ZHLA 3RVWD 3ZTNL 3TP4A 1LDSA 1KNOB 1QHOA 3GSWA 4ZD3L 2R4RH 3LD8C 2F19H 4DEPB 1ED3A 3O6KL 5SX5K 4JZJC 1C7TA 1ZSDA 3QI9B 1BX2B 1EHAA 2VLRB 1YEEH 1RIUL 2XG5A 1RZKC 2Z31B 3HAEH 1FFQA 3VCLA 1MAJA 3WO4B 3CXHK 4Z7VE 5C0CA 1AXIB 2VDOL 5CGTA 3RGHA 3EO1B 3SKMA 2H1PL 1R3LB 4J8RB 3B8SA 5H8DA 1YN7A 4OGYL 2RIKA 2XTJB 3RVVC 3QWRA 4FABH 4QRRD 1JGLH 4NN7B 3JV4B 1L0XA 3I6GB 5DZNA 2AAVA 3BEVB 4NQEA 3IAQA 2XIDA 4XWGL 4KK9D 1C16A 4U3CA 1EBPA 1X5YA 2VLKA 1OGAE 4DAGH 3KGRA 5BO1L 4HDIB 1Y6MR 2EH8L 4P2QD 1UWXK 4UINL 7CGTA 5C8JB 2XKNA 1DQMH 2IBGA 3OZ9L 3C6LC 4PJDA 2H6PB 3S4SB 1GIGL 1JRHI 1I1FA 2BVYA 1K5NB 3EO9H 3ZHDA 1J0YA 2E8YA 1NBQA 5IIEB 1NCAL 3A6CH 4KRLB 3ZE0F 1KIQB 2NTFA 3GJFA 1A6WL 1FIEA 3ARBD 2VLRE 3ISWA 4AEHL 4EUPA 1QP1A 4GKZA 3JWOL 5HYIA 4JO1H 2DKSA 2FWOB 4FG6D 1U41A 1BBDH 4TVPL 1Q9OA 3FAWA 4TSCH 5DEGB 5EZOH 3TPUA 2V6HA 5EU3A 4MXVE 1RJCA 2XTJE 1EMTH 3CGTA 5IP4A 1ZGLB 4U6YB 2VE6B 5GSVB 1HZHH 1IVLA 1QVOB 3MUY1 3E2HB 4PLJD 4J3TA 1OM3L 4QRRE 3D9AH 1IM3B 1BD2A 2O5YL 4JQXC 4JPKH 4HCRL 4N8PA 5GIRA 2MCG1 3L3DA 3QP3A 3BH8B 3MJ8B 1GZPB 4U1MA 2FL5B 5E8DL 3O3EA 3TF7C 5HHOB 2VLJA 2R0LH 4H26A 1B90A 5DJZA 2X4SB 2XWTB 3VFRB 2XN9A 4Z7VF 3BGMB 4QCIB 5DUPH 3WS6A 4PIRF 3W9EA 3QDMB 4M02A 2A83A 3GMNB 3DV4A 2B20A 2Q7YB 2DLEA 4FHBD 3NFSL 1BZ7B 5EZLA 1V8HA 1F3DH 4LAJH 3IRPX 2GAZA 2EH7L 5C9JB 1EJOL 1JNHA 4MS8C 1UH4A 2HJLB 1AKJB 5EG6C 1AO7D 4HC1H 4QRSA 4S1QH 3GUTB 5JMRA 4NO3A 2VLLA 3V7AG 4OKVB 3WHE0 2KZ1B 3LSOB 5FEBA 5FM8A 2O26U 3R0NA 3CX5K 3NIGF 1S7TA 4Y1AB 1S7XA 1YZZA 3QEQD 4J4PD 3GMQB 3ULUH 3L7FA 4KQ4L 3PE9A 3RY6A 3E3QE 4ZXBB 1W0VA 5D4QA 1CDCA 4FQ1H 4KTYA 1YYLL 4GW1A 1XF3A 4KKCC 5C2BL 4JFOA 4Y5XC 2AJYL 2PYFA 3WFBH 5HYJB 4UNUA 5IB5A 3RVXD 4P46C 5HHOE 3F7YB 4XH2A 3Q6GH 2FHBA 1E4KC 5FF6A 4LLWA 1A7PH 2AEPL 1IKNC 2PW2A 2XRAL 3D1MC 4GAGH 2D9CA 2VZUA 3QDME 3TPKA 4NYLA 5IMKB 5IEKB 4M4PA 3MLYH 4YHPA 5KTEH 3VD7A 4XXDA 2AABH 1MI5B 3BXNB 4HKZA 1L7TH 1MVFA 5L0QB 5JR1H 1MCBA 4C4KO 5JW4N 4PJ8C 4L3CA 1KELH 1NAMA 3AREB 1QPPA 5IW6A 3N9GL 4K7PY 1QA9A 4WU7A 4G6KL 5MEOA 5T1KB 5BJTA 1CE6A 3MRGB 1OTUD 3QXAA 5GISH 4POYA 1V5JA 1KBGL 4LHQB 3WE6A 4MDIB 1YUHB 3RX8A 1I7TA 3IETA 4Y1AE 1MHCB 2Y07H 2VMFA 4DN3L 1EEZB 4QLRA 4JRXD 1OD9A 1AIFA 4LMQE 1LO2H 2FEDD 1W0YT 3C8KA 3AY4A 5GGQH 1MSPA 5HVWA 4X7SL 2D7QA 3MV8D 1K3IA 5EN2A 3BIKA 1I8MA 4MLSA 5HYJE 1L0QA 2YRZA 1H9VA 3L3HB 4HUWB 4QYOA 5D2LB 3GGWB 2YPVH 3CXHJ 2EE6A 4JFXA 1CE1L 5KSVB 2AQ2A 3AVEA 2NY3C 4RDQF 1EH9A 2ZOLB 5IBTH 4GAYB 5J6GA 2JELL 1U93B 4HQQL 2V17H 2H32A 3DHJA 2IPUG 4M48L 5FUOL 4ELKA 3QH3B 1MI5E 3TFKC 3DMMB 4EBQL 4P9ML 4HJGA 1H3PH 5CJ5A 1NUDA 3VFOB 1NGZB 5GGSB 3DX7A 2R4SL 5DJCB 3HE7D 2XNAA 3EOBA 5T1LB 1NDGB 2H41A 2V7HA 1SJHA 2JE8A 4NWTH 4U33A 5I74C 4XNQB 1KN4H 3DXAD 3DSFH 5FGSA 3JXAA 5DUML 4ODTL 2G9HA 1AQKH 2W0PA 4WUUB 5KSAB 3OAUL 5DURB 5JLZB 1CDBA 1RZKL 5CBEB 2ZUXA 4MJ6B 2WLYA 1M6OA 3C5JA 3SKOB 3LHPH 2A74A 2WV3A 3DX9A 2VZVA 2EDBA 1XIWC 1X5LA 4ENED 3IFNH 3BISA 1KCSH 3NZHL 5EBGA 3T3PF 3ULVL 4EI6A 1A21A 5JOFA 3EYQD 4G8FB 5D2LE 2OXHA 5D1ZD 3MNVB 4QHNA 5L8KB 3STZA 3QUXB 1YECL 3BHBB 3ARGD 3LV3B 2FECL 1A9BB 1AH1A 3OV6A 1FAKT 1OGTB 4TQEH 4YDKH 4LGRB 2UZXB 4EN3C 3BJ91 1LP9A 2Q8AH 3B3IA 3KLDA 4JN2A 3S96A 5MHSE 4X5LA 3N06B 1BOGA 2XA3A 2VLMD 1KJ2B 2A6KB 5HJ3A 4PRBA 4UT7H 5F9JA 1EAPA 2JKXA 4N90D 5JORA 1ZVHA 2OI9B 3F7QA 3DVNA 3JWDC 1M7DB 2OS7A 3OL2A 3S3SA 5F6IB 1YPZA 2NXYC 1SJVA 3S3JA 1JZ5A 5LAXB 4PRDB 3LQMA 3VWJA 2OJEA 4ZOCA 5I1AA 3DXAE 1NBZB 1ORSB 4O02L 3KYKL 4WUUE 3WNPA 4F3FA 4BSVB 1NCWH 4JM2A 1MHEA 3O11B 4X5XB 5LGHH 3QO0A 3V5HB 4X6FA 1QFPA 1FO0B 4LKCA 1CGSH 1WFTA 3SCMA 1F6AA 5DWUH 1R5VB 5I1JL 5KN5B 1DVFD 4WENB 1JPTH 4P57A 4PJFF 1OAXH 2Z8SA 4HS6B 3MJ6A 5E95B 1GGIL 3I84A 3CX5J 3T2NL 1HHIB 2P42B 1KIUA 1CXKA 1KENH 4KMTH 2DQDL 5I1LB 1IC4H 4R4BB 1QRNA 5D71H 1XGYH 3BZEB 1U9KA 3R06A 1OQXA 4LARH 3SHSA 4JHAL 3IJYA 2ITDB 4P5MA 1S5HB 3DX8B 4ZUUA 5JQ6H 2PYED 4K71C 1MCHA 5I8OH 1RIHH 4JFYB 4JPIB 1QFUL 1AXTH 4BQ9A 4KDTA 5IGXL 1KUMA 2KH2B 4LCWB 3RWIB 2CKBB 4JFFA 4H20H 5BS0D 1WAAA 3R4DA 4FXGA 5B8CA 1D9KD 3OJDB 5SV4A 1HXMA 4GG6B 2ZKHH 4LPUA 1Q1JL 5KZCD 5IK3A 3OXRA 4XPTH 5CZXD 1AD9A 5L2KB 1CXLA 2HH0H 1XGTB 3M45A 3WO3B 4MYWB 1A8JH 2OR9L 4QRUA 3TJHC 3FB7B 5J6HA 4ZSOA 1NMBL 1U8PB 2G75B 1J1OH 2MQ3A 4IOIB 4OFPA 1ZA3A 1T21B 4K8RL 4XAWH 3WLBA 1A1OB 4JREC 4Q0XL 3HB3D 5CJOL 1J8HA 2EIZB 1I3UA 1CVRA 5BZWB 1E6OH 4ZFZA 1CLZH 3RNQA 5DI8B 3V8CA 2W9LA 5GRWA 4HC1A 5I30L 1O5DT 4NHCH 1B6UA 3VXMD 2IAMA 3P0GB 1GGTA 5CINH 2ZZUT 5IMMB 2X9XA 4HIXL 5ADPH 3EYFB 1SYVB 2HAZA 3LQAH 4LU5L 4O00A 4W4NA 3P9LB 2DMCA 1CG9A 2PYEE 1ZHNB 5I17A 3QG7L 2H45A 4JVWA 3RZCC 2R1WA 4DK3A 4KHTL 3ZE1E 4NNPL 3HPJA 4DZ8A 4LCWE 3D3VD 2DI7A 5BV7H 2P43B 5DD5L 1FVCA 5AYUL 4GG6E 3VMPA 4BZ1H 2CJUH 4G3YH 1ZHLB 3O6ML 4ZTOL 3W39A 5L2KE 3HNSH 4PGJA 3GSWB 1JZ7A 1NSNH 4WEBH 3UTTD 2CD0A 3L1OH 1CR9H 1ED3B 3QXVA 2FATL 1ZSDB 2VABA 4RWYH 3NTCH 3VCLB 4WFEE 4XP9L 5F7HA 1H5BA 5C0CB 5IM7A 3KPMA 4RGOL 2IBBA 4M7ZC 3NAAL 4HBCL 5DHVA 3SKMB 1LGVA 1T0PB 3TBTA 1F4AA 4UT6H 4CRPA 1YN7B 1OCWL 4L4JA 1RULH 4P4KC 1RIVH 2EZ0C 5F7FA 2R0ZH 3RAJH 4LVOB 2IANA 4PB0L 1AJ7H 5JDSA 2HT2D 5F7LB 2Z91A 4K7FA 4NQEB 3QIBC 2F54A 1C16B 2NLJA 1EFXD 1S7QA 2QADD 1FC1A 4ONHA 5I1DA 3BUTA 4PJIA 5IQ7H 4NUJA 3RVUC 2AQ3A 2YD7A 4H8WC 1QBLL 1T66C 4Y4HC 3T09A 2XKNB 2JB5L 4IOFD 4L5FL 3CLEH 4PJDB 3QEUA 3S37X 4XNXL 4OTXL 4U1NA 1JCKA 1I1FB 3MV9A 5HHMB 4ZFGH 2B4CC 4HUXA 1RZ8A 4KTDH 5C09D 2DLTA 2DF3A 4MAYC 2NY2B 4BSJA 5CLWA 4JR9L 4M6OL 1JF1A 2D0FA 4XBEL 2NTFB 4P59H 4ODHL 5FECA 2EDYA 4Y16A 1A3RL 2B5IB 2VZSA 3IAPA 3GJFB 3SDDD 1EAJA 2VC2H 4HW6A 3WFDL 4F2MA 2Z35A 3PP4L 4EUPB 3IRZA 4GKZB 5I71C 2FIKA 5C0CE 3LQZA 1Z9LA 2X9WA 4JFZL 4RGMC 1KTDB 1Q9OB 3IDXL 4Z7OE 3TPUB 4K23H 5EU3B 1WF5A 3GKWL 1G6RH 5AAWA 4OIAA 1DLFH 2P24A 1FLRH 2VDLL 3VGAC 3BDXA 4NKDA 3VMOA 1I9RH 3X14A 4N0YL 1BD2B 4NQEE 5I9QC 2XXCB 5GIRB 3L3DB 2WQRA 4U1MB 5F96L 4KJQD 2VLJB 4K94L 3B9VA 4H26B 5DJZB 4OFYA 3S35L 3QPXH 4RMQA 2XN9B 4KVCH 3JWDL 2DWEA 1KIRA 4M6MH 3FFCA 2AI0H 4PJDE 3W9EB 2JCCF 5D96B 4M1CD 2VSDA 4PRHA 2A83B 1UM6L 3DV4B 4RIRA 3MLRL 1VFAA 5KVDL 4DKAA 3LS5L 4FZEL 2R9HD 4JFPA 5EZLB 2ZCHL 1MCWM 4GBXA 5T3ZL 2D7TH 2GAZB 3T0EC 1YEKL 5TGBA 1JNHB 5HVFB 4CUCA 4LCIH 3MFFA 4GRWB 4FQXC 4QRSB 2RQ8A 4NO3B 4Y19A 3PG2A 4YDLC 5HYFA 3EYSH 1P7QA 3NFPA 2VLLB 3WJLA 2V5YA 1S7TB 4Y4FD 3S4SG 2IFFH 1S7XB 1UA6L 1MH5A 5EUKA 2DL9A 2DQHH 4E41A 3L7FB 4K3HA 3IXTA 4TNVF 4JEGB 2E8ZA 1W0VB 2WBWB 4L4VD 4XC3H 1IJ9A 4GW1B 1BD2E 1XF3B 4JFOB 4ORZC 3DYPA 4N5EC 4OLWL 2PYFB 3QQ3A 1OTTC 5JW5A 1TITA 5IB5B 5D6DC 2UZIL 5D93B 5T5NF 4GG8A 4XH2B 4M6AA 3EZ8A 1FNGA 1FCGA 2EEBA 2XN9E 5FF6B 4LLWB 3T0BA 4TSAH 2O61A 4RDQG 5F7EH 2PW2B 2HRPH 4NYLB 1PX4A 1RZFL 3TZVC 4YHPB 3ULSA 4XXDB 1CFVH 5D1QA 4F33A 1I1AA 4HKZB 4M1GL 5L88H 4AG4L 3DO7A 2PXYC 5GS3A 1YQVL 4PP2A 4RGND 1IAIH 2CSPA 4L3CB 2EE9A 4F57L 1X5IA 1NAMB 2BJML 2HKHH 3F6LA 5IW6B 1RK1A 1QA9B 4WU7B 3BGFC 4OCWL 5E2TL 3O0RH 4GRWE 5MEOB 1MFDH 1KJ2L 3OAZK 4U6HB 5BJTB 1CICA 1NCUA 1CE6B 4W6WB 3V6ZA 3U4EA 5GS0C 1N5YL 3QXAB 5GGTL 4OQ1A 5I1IL 3WE6B 3TBWA 4PJDF 1I7TB 1RUPH 3IETB 4PB9H 4WHTA 1I7UA 1J10A 1F58L 5T5FL 2VTFA 1AIFB 4G9FA 3D39D 4UOW1 1F4XH 1UACH 3C8KB 2OYPA 1OAQH 5DC0A 4J23A 3TYGL 1CCZA 2P48B 1HWHB 5JW4M 1YNKH 5EN2B 3BIKB 2XPGA 4G8GD 1I8MB 1QBMH 4HEME 1FRGL 4QYOB 4GW4A 2APWA 5TF0A 4TYUA 2IF7A 4HWEH 2BC4A 4JFXB 2ED9A 1HINL 1J87A 4O58H 1F4HA 5J6GB 4APQD 2HJFA 5F89A 2GKIA 2A77L 2H32B 3B9KD 4YXHH 4ELKB 3LN9A 5CIPH 1TCMA 3K0WA 3EYUH 1XGRA 4HJGB 1LO0L 4P99A 1ZGLP 4PJXA 4LIQE 3CUPA 3A0OA 3VDBA 2NZIA 3DX7B 2XNAB 3EOBB 1JGUH 3HMWH 2V7HB 1SJHB 3L3IB 4XXCA 1MPAH 4EQ2A 2J4WL 4XNYL 1BVZA 3FMGL 4PJCA 3SDXF 4I18C 1IC7L 2G9HB 2QJDA 4OUUA 4P9HC 3UZVB 1MNUL 3A67H 4JN1L 2XQYK 4JQIL 4J7RA 4Z77A 1M6OB 4HLZG 3C5JB 4YHZH 2IBZY 2AXJA 2A74B 3DX9B 1T89C 2CKBL 4IIQC 3MOAH 4PRPD 4U4BA 5GZND 1A22B 5E8OA 3GK8L 5CEZE 3CH1A 2VR4A 3IFOA 4GMTL 1U8KA 4EI6B 1NBVH 3ZKND 5ID1A 2XACC 5JOFB 1G9MH 2Q76A 5MP6H 4QHNB 4DN4H 3W0WD 3STZB 3GSUA 1DE4A 2IQ9L 4P2CG 3U0WL 1LP9B 1F6FB 3B3IB 4FQCH 3S7GA 4MA8H 4U2ZA 4PBWD 2FYYA 4JN2B 4ETQA 3S96B 4X99A 4N0CC 2OLDA 4H8WL 1BOGB 5FYJL 1MLBA 1QSED 3NBNA 2ICWI 1V3JA 4XB8A 5HJ3B 4PRBB 5F9JB 1EAPB 2YPLD 5JORB 1XEDA 3HE6C 2HWZL 1ZTXL 3DVNB 4YUEH 3W11D 1FNEA 4ALAH 3MRCA 5J11C 1YPZB 1TQBB 3O6LL 4LSVH 4F58H 2RFXA 4A6YA 5IFHL 4S2SA 2VR5A 1MJ7H 3S98A 3U0PA 4QXGL 3VWJB 2OJEB 3V0VA 1CI5A 3TC9A 2YD1A 5I1AB 5BVJA 4XWOC 3DIFA 1JFQL 2DDQL 4HX1A 4C55A 5IWLA 4F3FB 1A3QA 4D8PA 2ADJA 1V3KA 5L7XL 1DSFL 2VH5H 4MD0A 3GHEH 4JM2B 5GGVH 1LO4L 1MHEB 2YKLH 3B2UC 4NM4H 5DFTA 3DURA 4MXWL 1KGCD 4TRPL 4X6FB 5J13C 1YEGL 4XPFH 4LKCB 1L9MA 1INEL 2WBJA 3KJ4B 3SCMB 4UT9H 3WMSA 3GSNL 4QTIH 3U7WH 2H2PD 3MLZH 4CMMA 4P57B 1BAFH 3PHSA 3MLPA 2A38A 1JWUA 3C60A 1K2DA 5I66A 2LTQC 1U58A 2ADFL 1KSRA 1A02N 1LP9E 1A9EA 3DPBA 2UWEA 4O2EA 1QRNB 2DKMA 4RBPH 1IGCL 1JHKH 4JB9L 3R06B 3QUZC 2ARJA 4DCQA 5I8EA 3G6AA 3IJYB 3PV7A 4P5MB 3PWLA 3DSNA 4C83A 3MMEA 4ZUUB 2A9MH 3V52H 1YPZE 2DWDA 3VFGL 1G6RA 1VFBA 4RFNC 3NCJH 3P9WB 2PR4L 1PQZA 3PXHA 3UC0L 2IH3A 2VXTL 1XF1A 4HXBL 1ZLVH 3RBGA 5TE7L 3VXOA 3F7VA 4JFFB 1K6QL 1QACA 4FXGB 5B8CB 1HXMB 2KL6A 4YWGH 5JPMA 3KYOA 5IK3B 3OXRB 4HBQA 5EWIL 1AD9B 3QPQD 4L8BA 4M7LT 4NOBA 3C9NA 1RUML 3VWKA 4QRUB 1U3HA 43C9A 1PY4A 5J6HB 4ZSOB 3MBXH 4XNZB 4G8IA 2DI8A 1OP5H 4G6JH 5EZIL 3ZL4H 5JIPA 3VXSD 3WLBB 4L1DA 1VHPA 1J8HB 1BWMA 4UMGA 3ELAT 4L29A 4XP5L 4ZFZB 3RNQB 1E6JH 4KK8C 1TQCB 4TSBH 3WXWL 4ZUVA 2A6JA 1QRNE 1WCBA 4NCDA 2PO6A 2IAMB 4L1HA 1F5WA 4LRNL 4A2LA 4W4OA 3ALWA 1AC6A 4JDTH 1V3MA 4YHOL 3V6FA 4Z6AT 1T0NA 2VAAA 2G5BA 5JOPE 3HKFA 1KJMA 2FBOJ 5DD1H 1MFNA 4NRZA 2VZ1A 3RWJA 4P49A 2DRUA 5I17B 1Z3GL 3RVVD 3BN9C 3WKML 1A14H 1G9EA 2EIDA 4LSPL 2ORBL 2R1WB 4WI5A 2FR4A 3MNZA 4YZFF 3HPJB 4DZ8B 3L5JA 1AGBA 2DQGL 4JFFE 2EDWA 1WAAE 1FVCB 4YHKH 3QHZL 4GXUM 4DK6A 1D5XA 4FXLA 5ALBH 4K3DH 5TPWH 4P2RD 1JPST 1I9JH 3W39B 1IM9A 3LRGA 4JFHD 3AU1A 1EEQA 5GGSY 3C6LD 1HE7A 3ROLA 4YHYC 4ZSOE 2VABB 3D48R 3H42H 3ZYOA 2FGWL 1DLHA 1RAMA 1GAFH 1JHLL 3B8YA 5IVXF 5C08D 4HWNA 3NA9H 1H5BB 5IM7B 2YPKA 3KPMB 3MLSL 5M94B 3S5LA 3V95A 2ITCA 2LVEA 4ONGL 4Q9BA 2AEIT 5DHVB 1J8HE 1LDPH 3U2SA 1JNLH 3TBTB 3GRWA 4JM2F 4PTUA 3V0WL 1F4YH 4FFWC 1CK0L 3S34H 2IANB 3BRFA 5A2JH 4NBYB 1ODAA 3QISA 5JDSB 2Z91B 4K7FB 2F54B 1EBAA 4YHMH 4ZQKA 3GIZH 4POZC 2NLJB 3HUJA 2ENYA 3QHFH 1S7QB 3ULUE 1ZEAL 4ONHB 1GJIA 5I1DB 5F8QC 2HTLC 1AFVL 4PJIB 4NUJB 1CFSA 1QLFA 5DRZA 1XR8A 5TDOA 3FB5A 1IAII 3C08L 3QEUB 4R6UA 3VI3E 2OQJA 2ZCKH 4U1NB 3QIWC 4YC2C 4U7SA 3MV9B 3U83A 4HUXB 5CJQL 1RZ8B 1T83A 3RJQB 4UAOB 3UTSA 3LH2H 1QPXA 2ZCLH 2QKIA 4OBSA 5E00A 2D31A 4P9HL 1JF1B 2CRMA 4I8DA 1EFQA 3CD4A 4POUB 5FECB 3GMMA 4NWUL 5IESH 4LSUL 1CLCA 4OZGF 3HTLX 4FQPA 1NFKA 3WXVL 1WTGT 6FABH 4OI8A 2YD8A 4LIQL 2Z35B 2K3TA 4XVJL 3R8BB 5CIPA 4F2MB 3CX2A 3QDJD 1NAML 2P5EE 1XCTA 4M7JL 4ZYKA 5ILTH 3F65A 2FIKB 3I3DA 1BMGA 3LQZB 2Z0BA 4NZRL 1YMHA 4U1GC 5GHWL 4BSWA 3LS4L 4AMKH 4MS8D 1WAAF 2XICA 5DGRA 3TCXA 1J7VR 5FDWA 2OXGA 2P24B 5ADOH 2IANE 1NCDL 2YMXH 1R5WA 4NKDB 4M1DL 1M05A 3X14B 5D7IA 4G80A 2F54E 1S9XA 2VDKL 4P23C 3Q5TA 3TV3L 3CXDL 2CRIA 2D9QB 5FCUL 5T5NG 5SWQA 4PJIE 5CEZL 5IT2H 1YJDL 2DWEB 2F5BH 1J05A 3HR6A 1KIRB 4PJ9C 2BHZA 2WBKA 3D85D 2BNRA 3FFCB 1FH5H 4KKCD 4NSKA 1FGVL 4PRHB 3MV9E 4RIRB 1PGRB 1GC1L 4P46D 1VFAB 4MJ2A 5HDQL 4JFPB 1I3VA 1UB5A 1SM3H 3QCUL 4OCMC 1CU4L 4GBXB 5HHNA 4HZLA 3SBWA 5TGBB 4AENA 1RZJH 2VQTA 4KI5E 3SE3C 3MFFB 3G6JF 2MKWA 1N5AA 4PJ5A 4Y19B 1F90H 1P7QB 3NFPB 5FOBA 4YDIH 3DYMA 4NN5C 2D4DA 5CP3H 3OKEA 4PJ8D 1A6UL 3VI3F 4U1SA 4OLYL 3LKQA 5CZVL 1MH5B 3G6DH 5EUKB 4OZFH 1W2KT 5GRZA 4E41B 3KWWA 3CMOH 4PJ7F 3IXTB 3L3OB 1J5OH 4Y16C 2FH8A 3WD5H 2EDEA 1YY8A 3QQ3B 3QFDA 5JW5B 3GSOA 4GG8B 3OG6B 4M7LL 1FNGB 4KI1A 2NW3A 2BOCA 4QRPA 2AW2A 3PGFL 2O61B 1AGFA 1AR1C 1MFCL 3EOAA 4PRHE 4QKXB 5DA0B 4NZDA 4R4NC 4F33B 5D1QB 1I1AB 2E9WA 4U2YA 1J12A 3BSZH 3IDNA 4IMLA 3DO7B 4PP2B 2NY3D 4WO4A 3NCCB 2Y5TA 1FL3A 1RK1B 4Z7UA 2X4RA 3SE4C 4Y19E 4M3JA 5FYKU 1JN6A 4PJIF 3QBTB 3TFKD 1CICB 3V6ZB 3U4EB 3TBWB 4WHTB 3VA6A 1I7UB 1UVQA 2FHCA 4E41E 3ALXA 4FABL 4G9FB 3DBXA 2DAVA 5TDPA 4Q9RH 1W72A 3ZE2E 2AV1A 3EFDH 2XPGB 5IHZA 3EJYC 2AK4A 5EOQH 4LHUD 4GW4B 3GBNH 1NJ9A 2VISA 1TCRA 1DQML 1IAOB 1XIWD 4M9OA 1KFAH 4Y5VA 3EO9L 4JJ5A 4KZEL 2HJFB 5F3HA 4PYHA 1KCRH 3A6CL 3M17A 4UNTA 1P53A 1FV1A 1UQSA 2GIYA 3C09C 3MLUH 1XGRB 1MY7A 3O2DH 3VXTA 4PJXB 4NZTH 3CUPB 3KS0J 5KG9A 2P7TA 4AH2A 1BECA 3BYYA 4WV1A 4EN3D 1IAMA 1TDQA 2CUHA 2KUTA 5CJBA 5DLMH 1H0DA 4JO1L 3J7HA 3IDYC 3PF2A 3QCTH 3N85H 5DHXB 4PJCB 1BBDL 4XCFH 4TSCL 2W38A 1V7MH 1UEMA 5C9KA 4OUUB 1EMTL 3QUYA 4G6AC 3JV5A 4CVZA 4Z77B 5EO0A 2OZ4H 3LPFA 1L7IH 2NXYD 1D5IL 2IG2H 3D9AL 4F9LA 3GZKA 4MJ5A 2HG5A 4IEFB 4WW2A 2FBJH 3AUVA 3NA4A 5AUMA 3CH1B 1WT5A 5LXGH 3IFOB 1U8KB 3RNKA 2EXYC 4ZG1A 5BV7B 5T3ZD 2EKSA 5ID1B 2X89A 2X1PA 1SMAA 1BQUA 2Q76B 3CVHL 5DUPL 3GSUB 3LKSA 1DE4B 2E9IA 1K85A 3CK0H 2VXVH 3C5ZA 1RY7B 2QSCH 1KTLA 4AY0A 5DD0H 3QZWA 2FYYB 1JZ6A 3KPSA 4ETQB 5MENA 4X99B 5IR1A 4GMSH 4K7PH 1MLBB 5KVMC 4O9HH 2VDPH 3T0XA 4HAFA 3HNVH 5HSFA 2BMKA 2E9JA 4PJXE 4C56A 1RSFA 4HC1L 1KCVL 4S1QL 4LVNB 1FNEB 3MRCB 1PAMA 4W70A 1OAKH 2RFXB 4A6YB 4S2SB 4GKNA 1NGPH 2DOCA 4W68A 2XTLA 3U0PB 3V0VB 1UCTA 4PJCE 4RNRA 3SKUD 5BVJB 1WBZA 3DIFB 1IZJA 4HX1B 3GM0A 3KYNA 2ADJB 4D8PB 1BGXH 2EDNA 1LO5A 1G7LA 2PNDA 4MD0B 4JFDA 3VXRA 2QV2A 5E6YA 4WI6A 3DURB 2CR6A 5C92A 3I3EA 1DQJA 2R2CA 2WP3O 4WY7H 1RZGA 2WBJB 1CFBA 1CN4A 3QAZC 3TWCH 4CMMB 2YK1L 1A7PL 1JWUB 4GAGL 3UYRL 3BO8A 3RDTC 3C60B 5BZDA 4L9DA 1K2DB 5I66B 1U58B 5KBNC 5I19H 1MCOH 3WYRA 5KTEL 2AABL 3LQAC 4KHXH 5D70L 1A9EB 3TJHD 3GSVA 4JO4H 5BRZD 2UWEB 3X3FH 2N4IA 4O2EB 1M7IA 2ZG1A 2DICA 1KELL 1OSZA 1WGOA 1NCNA 2ARJB 4DCQB 5I8EB 3G6AB 4Z95H 3PP3H 1DQTA 4NOFA 3PWLB 5TE4H 4FZ8H 3MMEB 3RIFK 2BSRA 3BVNA 1VCAA 2DWDB 1G6RB 1VFBB 3FOMA 3VG9B 5GISL 1OPGH 3VU2A 1PQZB 1P69B 2IH3B 2K7QA 1JIBA 3ZZ1A 4LFHD 2OP4L 3VXOB 1P2CA 3F7VB 1LO2L 3IKCA 1A2YA 1S7WA 5GGQL 5JPMB 4I3GA 3KYOB 4LNVA 2YD6A 1G7JA 4MJIA 4L8BB 3RZCD 4LSRH 4X7FC 3BKJL 1RUKH 4WFGE 3C9NB 4WTZA 3VWKB 3LPGA 1U3HB 2MQ0A 2YPVL 43C9B 3OF6A 4G8IB 3INUH 3LZFL 1GGCL 2VXUH 5IBTL 4N1EA 4PJCF 1LMKA 3GBLA 4HK0A 3ZHKA 2V17L 3P40A 4NBXB 4WHCA 1NMCC 4HG4K 1FNAA 2UWEE 5ANMA 3U7YH 4Y2DA 4ZUVB 2A6JB 1WCBB 2PO6B 3MUJA 4D9QD 3V4PH 3SO5A 3G5YB 3GMOA 3CSBA 5HI3C 1H3VA 2C3XA 1UENA 3V6FB 1T0NB 2VAAB 2G5BB 5CS7A 3WUZA 4WIQA 4ETYA 1KN4L 4MVBC 4OZFA 4FN0A 4NRZB 3DSFL 2NY1B 3DYOA 2F9BT 3RWJB 2X09A 4P4KD 1AQKL 2EZ0D 4C59B 4X9IA 2BHUA 4RISL 2FR4B 1XGUA 3MNZB 5KSBF 1PVHA 1AGBB 5E6IA 3UPAA 3QIBD 3LHPL 3SQOH 1G7IA 4KZDH 3UEZA 5J4MA 3IFNL 1D5XB 1YMMD 4IRJC 1G84A 1KCSL 4KK6C 3RVUD 1T2XA 1NUFA 1IM9B 1AGDA 1T66D 5DK2A 3L5XL 3HPLA 4Y4HD 2GJ6D 5FYJD 3AU1B 3ZDYE 2Z92A 3OXSA 3CMGA 2N1KA 3AS3A 3ROLB 4DUXA 1DLHB 3D69A 1FG9C 3T2OA 4GO6B 3K4ZA 4MAYD 4TQEL 3V5KA 1L6XA 1PW3A 4YDKL 4FTVD 2YPKB 2Q8AL 5HGGS 3S5LB 2ITCB 4Z0XA 4LEXH 2LAAA 3U2SB 2CDEA 3ARQA 3QT2A 5IW1A 4U6XA 5C6PB 3S37L 4PTUB 5E03A 1T7YA 2X4PA 3H0TA 5DVOA 4HSQA 5DJ2A 5LGJA 2BY1A 2X1OA 1SVZA 3GHBL 1QKZH 1NEZA 5A2IH 2HFGL 2VDRH 4U1LA 4ZQKB 2ILLA 3HUJB 4XGZA 4XP1H 1UADC 3G5XA 3KPOA