4YJZL

Human antibody h2526 in complex with influenza hemagglutinin h1 solomon islands/03/2006
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
251
structure length
234
Chain Sequence
b'VLTQPLSAPGTPGQRVTISCSGSSSNVGTNAVDWYQRLPGTAPKLLIYYNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCATWDNSLNDRVFGGGTKLTVLQVQLVQSGAEVRKPGSSVKVSCKASRGTFSNHAVSWVRQAPGHGLEWLGGLIPIFSTPHYAQKFQGRVTITADESTNTVHMELSSLRSEDTAVYYCAREIPGATSGPDHFFFYGMDVWGQGTTVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Viral receptor-binding site antibodies with diverse germline origins.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 50
structure length 234
sequence length 251
ec nomenclature
pdb deposition date 2015-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yjzL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yjzL02
5I15L 1T7ZA 4DW2L 4XVUD 4JAMB 1LD9A 4K23H 5DGRA 5DRWB 2A6KB 3E6FA 5FHAH 1HSBA 2FWOB 4TUKH 3RKDC 5HBBA 5D1QD 3UXFA 5F7EH 4J3SA 5TGBA 1JN6B 3BAEH 4J3WA 2UWEF 3IT8D 5F9WC 3BD4A 3T2PA 2BNQA 3MRJA 4G7YH 4DKDC 4OSUL 1FHGA 4JFHD 1QSFE 5F7NC 5ADPL 4GS7C 1EFXA 4PLNC 3MMEB 4R6UA 1EK3A 2MCG1 3RPIA 4KHTL 5K59E 4KVNH 4X7CC 2W9LA 2R56L 2X5PA 3VXTB 3BX7C 2K1MA 3TIEB 1BBDL 4I2XE 1TENA 4PJEB 1IAKB 3QG7H 5HYIA 3QNZA 1A7NL 1ND0A 4RNRB 4MNQB 5GZOD 3OKEB 3ORJA 5AD0B 4XCEB 2MHAA 4ONGL 2CUHA 2PXYB 2VXUL 3IDXH 3PHOA 4YFDB 5D2LE 1NEZG 5HHPA 3BJ91 3EYQD 4AZ8A 2GK0B 4XXDA 2EYRA 5I19L 5CMAA 2BZDA 1CFBA 1MIMH 1ODAA 1ZLWK 3UEZA 2X7LA 2C1PB 4U33A 1EA9C 1G9EA 1I4FA 4GRWF 4MNGB 5ESVA 5J12C 3EHBD 4I0PB 4WW1A 2LVCA 1PQZB 1BIIB 4MA3A 3RTQD 4ERSH 4GLRI 5CINH 3NIGF 3ARUA 3OJDA 1WBZA 4R8WH 1UJ3C 5JLZB 3QJFA 4KC3B 3PP4L 1IGJA 2A38A 2YXMA 1KBGL 1FBIH 2AEPL 5KW9L 5HYQB 1KSRA 3K8MA 3LS5H 4PRPA 4BSWA 1E6JH 3DROA 1ZXQA 4HWEH 1P2CA 1YQVL 4XXCC 4C56D 5CS7A 1YNLH 2FX7L 3OGOE 1H9VA 1AD9B 3NCBB 4JRYB 1BLNA 4L5FL 3H9YA 3KYNB 1B0WA 3L3IB 1ZANH 3ME0A 1N64H 2M8XA 2EDWA 4LLVB 4I0PC 1JCKA 5D7LE 4X6CF 2C3VB 4DGVH 1SQ2N 4UINL 2X4UB 1KJMA 2LVEA 4RZCA 4X5WB 3W11D 1EEUA 1MLBA 2ERJC 3IU3A 1CICA 2A6IA 1MIEH 2ZWLT 3ARGA 3QIWC 3DO3A 4HUWA 1ZHLB 3LKNB 1OD9A 2DQHH 1MSPA 3SDCA 5JPMA 1J0IA 5HI5C 3QQ4B 1OQXA 4KKAC 4LLWA 3AXLB 3RU8H 5KBNC 2IQ9L 2D7MA 2HT3C 43C9A 1BQLH 4JHAL 5D1XB 3V6OC 4ZUVB 1A64A 5TDPA 5DUPH 2V2WB 5IT2L 3MUJA 1XF5B 1H5BC 2UVFA 1LNUB 1KB5L 1ZT7A 3H3KA 4XAWH 2XY2A 2YKLH 1OGAE 5LG1A 3SO3C 2W60A 3UTSA 2KKQA 2UWEA 5DJXA 4YDVA 1KLGB 2P47B 5FKAB 1A47A 1P7QB 1X5FA 2WBWB 3O41B 3QAZB 1X5AA 5CZXD 1IGFH 4YHLH 3CFDB 3IGAB 4PJ5A 4CDHA 2BJML 4QHNB 2F53B 4QXTA 4Y4KC 1NBZB 3QZWG 5ESQA 4RBPK 4DKEH 1LWRA 2OM5A 1EERB 3LKQB 1MHPH 4YPGA 4Z9KB 1H3XA 3MACH 4NZJA 1DUYA 4YEEA 3JZ7A 3QA3A 3QEUA 1OL0A 4LIQL 5TH2B 1NSNL 1U2HA 4OZIE 4LCYB 5T1MA 4FZEH 5H37H 1Z0NA 5BZDB 1OVZA 4IRZH 3OHXB 5EUOA 1TJGH 3SE3C 2DI7A 1A1MA 4HPYH 4K8RL 4MNQD 2R2HA 3ZYJA 1S7TA 5JDJA 5BZWA 2DQUL 3N85H 3QQ3A 1CDGA 2PXYD 2OJZH 4KK9D 2VXQH 4WWKB 3MCKA 4ODTL 1AR2A 3DWTA 4C83B 4BSVA 1R24A 1N6UA 4I5BB 4JZOB 2Q3AA 3X13B 2A6DA 3QWOB 4K2UL 5KS9F 4MSWB 2C3GA 1MCOL 4Y4FB 1N0XH 1YECH 3KR3H 1CCZA 3WFDL 3EOBA 3FB7A 3T08A 4L3EA 4PJ9A 3FQWA 3TN0A 1ONQA 3QEQB 1LVEA 3U0TB 3MBXH 5DJZB 2FR4A 5E00A 2N56A 5EZIL 3MRHB 3NACH 2OTWB 1JZ3A 4I0PD 3MV7A 1S7RA 5GS0H 3M1BB 4R97C 1HH6A 4JO3L 4TTDC 5HHQB 5A3ID 4NWTH 1DFBH 3HN3A 5T3ZL 5I1KH 2YD1A 3IKCB 2C4FU 3TJHD 5IVXA 3EJZD 1JMZA 2E9IA 2ZUSA 4NGHH 1K9TA 1N8ZB 4YNYB 3N1PC 3BP6B 4X7SH 3X12B 2AJSH 4JRXB 4G3YH 3LEYL 2FX9H 3DVNB 3S34H 1AO7D 2J6EL 3RNQA 2P48B 4RCAA 1CQYA 4XBEH 4JRYD 5CUSL 2ZUVA 1XR9A 5LWYH 3DNKA 4M8QA 1BQHA 1ZA6B 2H8PB 2H9GB 1RULH 5KVDL 4X6CA 3P77B 4YHNA 4YDKL 1HZHL 3MODH 3T0EB 4RMWA 3I3DA 2NMSA 5IR1B 3RVXC 1FNEB 1CFNB 3HMXL 1LO5B 4MA7L 4P2OC 4PUBL 1Z9SA 4HKJB 4KK6D 3LVEA 5FO7A 1TZIA 1MJJA 3E3QC 4U1NB 4L9LA 4PRHE 1T21B 1CF8L 5BVJA 2V9RA 4QOKE 5HPMA 4XCYB 1C5BL 4WTWA 1X5XA 2HA1A 1REIA 4LFHG 4O2EA 2BNQE 2BDNH 5D1XD 4NO0B 4Y2OA 4WTXA 5EO0A 4AH2B 2ZG2A 2D7TL 3AS1A 2ADFL 1YEEH 3BZEA 5BMFH 1ROWA 2Q6WB 2NNAB 1DSFL 3P3YA 5J0BA 3O3AB 3SPVB 5FA3A 3ES6B 4MDIA 1IEBB 4NDMB 1AGFB 4G9FE 1EBAA 4LMQI 4Z7UB 1X7QA 1VFBA 1KEGL 1EUTA 5FGCE 1BECA 5KG9A 4X9HA 1B4JH 3VRLE 5DQJA 1P7QD 3U79A 3VJ6B 4OFVA 1KCSL 5J13C 1UG9A 4MGXA 3MV9B 1KF9B 5D8JH 2Z93A 1S7UA 2F53D 3F6LA 4GAGH 4H26B 4RGNE 1AHWA 4YGVA 4GG8A 4XP9H 3Q6FB 5DSCA 5JORA 5GS2H 1E27B 3KYMA 4LCWE 3DX6A 1NGQL 1WF5A 2DQEL 4LHJB 3VFRA 1FCCA 4AG4H 1DDHA 1HHGB 4JKLA 3WIHH 1U36A 4GXUM 1XFPA 5CBEB 3QUXA 12E8L 3W5NA 2YSSA 1P84J 2NX5B 3TBYB 3BKML 2DI8A 3D2UB 4XVJH 5DMJB 3MRQA 4ZUUA 1A6VL 3OJ2C 4PJ7E 4Q0XH 4JGMA 3CPLB 4TTDD 5FYJE 5FYLH 4RAVA 1OAXH 1AY1H 1OAYH 5EH1A 5MEPB 4WWKD 1H0DA 1CBVH 5C6TH 3MRPB 4JFDB 3MNVA 1GAFL 3OPZL 4N8VB 5INDA 2YRLA 4WFHE 4Y4FD 1BF2A 5C2BH 1CGUA 4PYGA 3QR2A 1JF1A 2NY0C 5D71L 3PWNB 5MERA 1HK6A 1I7TA 1OAKL 5D7JA 4HMEA 1DL7H 2EEDA 3RWJB 3CD4A 4F7MB 3CFKB 3KWWA 2R0WH 4R7DB 3CXDH 5I1IH 3RVXD 2QBWA 3F12B 4JPVH 2EKJA 1IEAA 3VH8G 2XZZA 4EN3C 1I7RB 4PV8A 4M02A 1RUKL 4UU9A 1QR1B 3D39E 2E5EA 4NFCA 3EO0B 1NGXA 1QRNE 1SBSH 3BWUC 2JIXA 4YFLI 3MA7B 1MWAL 2O5YH 2VKWA 2Y5TB 1ED3B 3H7BA 1FPTL 3P40A 4J4PC 3PWJB 4OLYH 1F58L 3RY4A 4PRAA 4YDLC 2VLKA 4JRXD 3RX5A 3QXAA 3O4LA 2ZCLL 5ACMA 5BQ7A 3IFOA 2QKIB 1ADQH 1MCRA 1QNZL 4L3AA 5IFAL 3EYSH 2L4OA 1HHJA 5T1KB 2R2EA 3W2DH 4AQ1B 5ITBH 3T0ED 2ED8A 3MACL 3WV0A 4CU7A 2EDKA 2ZOKB 1RHHB 1ZHNA 2EICA 1FCGA 1KIRB 1UM6L 5D7SL 2EO1A 2H1PH 2NXYB 4XHQA 5JXAL 4N9GB 3SKJH 2NY1B 4JY6A 3ZT5A 2XTLA 2HTKC 3ULVH 1NEZB 1R3KA 4K3GA 3LH2L 1TZHB 1JRHL 1N6QL 4PGCA 5EIIA 5IJKC 2FZ3A 2F8XC 3CLFH 2AGJH 1KXTB 3I6KB 3Q3GA 4NHCL 4NO0D 3UDWC 2VAAB 5HVFB 4PRNA 1ZVYA 1G7IA 2BCKB 3FHQA 1Y6NR 1PG7L 1NMCB 1UXWB 2HLAB 2NY2C 3EO9H 1U8OA 4OV5B 4PJFA 5DMIH 2DLIA 3I6LD 3V6FA 3MLPA 4EUPH 5DUML 3U0PA 3NIFF 4XHJD 4JPWH 5EUOE 3UPRB 3BPOB 3ARQA 3OKLA 3MV9D 2NXYC 5SX4H 2IH1B 4F8QA 1CQKA 4LVNC 4KKLD 4F33A 4EJ1C 1VGEL 4WI5A 5EULV 3SBWA 1A6ZA 5C0JB 5KSAB 4F58L 4W6YB 3KLAB 3IAPA 5LBSH 1QSVA 2YN5A 5EG6C 3V2AR 1U8IA 4JHWH 4NWUL 4NSKA 3B5HA 2YBRA 4AJ0A 4M5YL 2CR6A 5T5FL 1NLDH 3TYGH 2G75B 3BO8A 1I1FA 3SKMB 1X5YA 4PTUB 3B9VA 4DQOL 2JKXA 4WNQB 3TH4T 1A7RL 2NX5D 2ZUQC 4M5ZL 3H3PL 1L4IA 5KSBB 3D2UD 1YPZF 1NMCC 3DXAE 2CIKA 4IMKC 5T33H 1CG9B 4JFQB 5E1HB 1LK3L 3HI1B 3SDAB 3MV7E 3EOTL 2BNUA 2VXVH 4N5UA 4XT1C 6FABH 5J89A 1YMMA 1EEZA 4JFDD 4W70A 3RDTC 2Z92A 4OCSH 2BK8A 5K9JL 2IBZX 3CFJA 4GW1A 5I76B 4TNVK 3WMSA 3U7AA 4BH7B 2Z4QA 1SMOA 3HC4L 3DURA 3BH8A 5E6IB 3BXNA 5CZVH 3DTXB 2QQLH 1VCAA 2J8HA 5C70A 1MRDH 3M17B 5SWSE 1OTTC 5EPMA 4AIZA 1ZWIA 3WL9B 1RI8A 1NCWH 1UZ6F 5ECJE 1WZ1H 1BPVA 1CXHA 1GZQB 3RWGA 5AZ2L 4HCRH 3V5HB 5JOFB 3DGGB 2Y9RT 2B2XL 2ZPKH 3EYUH 2IH3A 1IM9B 2UYLB 3TBWB 3H9ZA 1DQDH 4G6MH 3MXWH 2CLRB 3QHFL 2H3NB 1VEMA 4A6YA 1P1ZA 3HE6C 4OI9A 4J8RB 1CLZL 5EZLA 1HSAB 3QZWB 2IGFL 1II4E 1QFHA 4KDTA 4M43H 4Z7WF 3O3BB 4KI5C 5D6CB 1X44A 5T1KD 4DK6A 3VI3F 3QULB 2ADIB 1QEWB 1QKZH 3IDNA 4JM2C 4HT1L 2GJZB 3IVKB 1DBMH 4QRUB 4NRZB 1WEJL 1MOEA 4DOHB 5IBLC 2J88L 4YO0B 5E03A 2NXYD 3HI6L 4YFLF 5DVOA 3JUYA 3QCUH 5H35A 2RCSL 1D5BA 2NY1D 3FO1A 4UUJB 1BFVH 4Z7VB 3L7FA 1UJ3A 2OR7A 3N06B 5I16A 2AI0L 2NLJB 1A7QL 1Q94A 2B0SH 5FDYA 3UPCA 2BVQA 4NZDA 4F37K 2GK0A 4P23C 1V7NL 1I8IB 3Q5YA 4XP1H 4ZTPH 5GIRB 4TQEL 3QIBB 2DM7A 1WSST 4XXCA 4CNIA 4O02L 2DQIL 1KGCD 2COQA 3ROLB 3RIAF 4UQ3A 3MGOA 4X7DC 4K55A 4PY8I 3O6KL 3VGAB 3VD4A 5DURB 1TTGA 2NY5C 2NPLX 1RD6A 4H88L 1EXUB 4DEPB 5KSAD 4X4YB 1FO0B 3QIWA 4WUKH 5JLZA 1C16B 1KTLA 3QSKB 3A6BH 3OKMB 1RZ7L 2NW3B 4DCQB 4QXWA 5SWZE 4XNUL 3V6OA 1GC1H 2A73B 2HYMA 2A9NH 3GM8A 3MJ9A 3OB8A 5KVEH 4ZXBB 2FJGB 5DJ2A 1H5BA 2D31B 3MNZB 5EZOL 1D5IH 2AABL 3PQYA 1T3FA 3KPQA 3I02A 2JB5L 2IEPA 3SDAD 1VDGA 3SE9H 2EE9A 3IDIB 3F7QA 2ZP0T 3MRIA 4UILH 2CKBL 2VDPL 4S1SL 3VGFA 1ZA3B 4YAQA 1UKSA 1JZ2A 1RPQA 4P9ML 2YC1B 1AQDB 3D85A 3CUPA 1UACL 2YPKB 4O00A 1M7DA 4Y4KA 4U2YA 1N4XL 4L29B 2Z9TA 4CMMA 5CD5C 4WWID 1TLKA 4JFEA 5H37G 1HQ4B 4NPYA 3FQNA 5E6ID 2VO5A 3IU4L 5EWIL 3L5XH 4C59B 4XNXH 4ZUVA 3VRIA 4J23A 5DJ0A 3TP4A 2OR9H 4AM0B 4ZXBC 3PL6B 4FQ2L 4JEGB 4BQ6A 3QH3B 5CKAA 3SE3A 1MQ8A 3CX5K 2EDDA 4MCZA 2EIZB 1RK0B 3BGMB 3BPCB 5FUOH 1ZK9A 2BC4A 2DI9A 4D9QD 5ABDE 1AGCB 1IM9D 3QFDA 5DMYA 1Y18A 2RGSA 1OM3H 2R8SH 3TC9A 3SQBA 5D2NE 1RFDL 4XPHH 4TNWK 2R2BA 3MA9H 5E4IA 4KJQD 3TA3B 3HR5B 1OTUD 5EOTA 4PLJD 1TQCB 1EEYB 4LPCA 1N26A 3BKYH 5E99H 3V5DB 1JV5A 2X4PB 3SE8L 5L2JB 2XQBL 3PWLA 4OJFH 4PJFE 3O2DA 4HGKC 1H3WM 3BUYA 3HLAB 4LNVA 2H32B 3L3DA 3RL1B 3VI4E 5ELIA 4YE4H 4OI7A 2P8PA 3LSOB 3ZDYE 2FEEI 4HUNB 4XNQA 1IGMH 1K2DA 2Z8WC 1EFQA 1SM3H 4YUEH 2H45A 3P9WB 4LF3B 2I60H 2R9HC 3DV4A 3SCMB 2Y36L 3QIBD 3DOSA 4NIKB 5A16A 5I17B 3QEQA 3FRUA 3D3VB 1FNHA 3SOBH 4F2MB 5KOVC 4HIIB 3QT2A 3WFCL 4YHYB 2ICWB 4C56E 3BEWB 3FB8B 2FL5A 2LAGB 4FG6D 5DURD 5DRXB 5EU6B 3VH8B 3E2HC 1U42A 4H5SA 2ATPB 5C0DB 4P2OA 4NN7C 1YMME 2LTQB 1PZ5A 3L7EB 1Q9OA 1A4JB 4KMTL 1WGOA 3RVVD 3T1WA 2IPTL 3KLSA 3G6JB 1AQKL 4S1RH 5DZOA 4QO1A 2XWJA 5SWQA 2ZSVA 5J6GB 5JTWA 4CGTA 4JREC 4OZIF 2OTUA 5IKCB 4RIRA 3RIFF 4NBZB 1KENH 3AREC 4KTEH 2FYYB 4N0UB 4L4VA 5D5ME 1INDL 3GMOB 3MOAH 4YHKL 4YHYC 3DRTB 2J8OA 4UT6H 1J10A 2ARJA 5C0BB 3REWB 4Y1AA 3LQAL 4ZAKB 1G0YR 1SY6L 3LN4B 3GBNL 5I8CA 5F70A 3KPPB 5GGSY 3PHQB 4LFHD 3UJJH 1QLEL 2EXYD 2W9EH 4DUXA 4OZGF 4FABL 1V3JA 2VL5B 2R2CA 3PNWB 3THML 4AH2A 4KY1L 3PL6D 5IQ9A 4JCMA 5EU5B 2RBLA 2VQUA 4CN4A 3RJQB 1CE6B 1QG3A 3GSUB 3HPJB 4KKBD 2XA8L 2VLJB 3QIUC 4HBCH 3HS0A 4PJEE 2Q1EA 3UC0L 4O5LL 4OBSA 5C0FA 3DHMA 1CDBA 1CR9H 3U6RB 4KTDL 1DEDA 4MNQE 3ZT7A 3TA3D 4QRQB 5HGGS 5JIPA 1QRKA 3N1GC 1JHLH 4LLYB 3CU7A 4HUXA 1SYVA 4K3EH 5E7FA 2ICEA 1GIGH 4U1IA 1NCNA 1R3LB 4K8RC 4MNHB 5I74C 1TITA 3U48A 1PY9A 3B5TA 3WSQH 2E7CA 1A6AB 1KCVH 1L6ZA 1FG2B 4JZJC 3OL2A 1C12B 3RUGA 3RZCB 5FYKD 5KSUB 4MNGE 1FVDA 4EN3A 3TBVA 5F88B 4M6NL 4YBLB 5CEXA 3EBAA 3MRLA 2R39A 4UB0H 2FSEB 2NQCA 4J4PA 4OIIH 1HEZB 2XA3A 1T4KB 3VW3H 1WWWX 3KNBA 2BMKA 4F15B 4H25B 4KGJA 3UROR 2J5LB 3MFGB 3SCMD 3TV3H 4QHUB 2G60H 3CX2A 1FLTX 3V79C 3EZJB 5ID1A 4OCYH 3D3VD 4TSBL 3KPNA 3OX8A 5DD6B 2DLTA 4DGYH 3OAUL 4KI5F 5MENB 2FHCA 4JRYE 2VDMH 3FFDA 3VRLF 1W72L 4HIXH 5EU6D 2C1OB 1EAPA 3KPRB 2Z0BA 2A9MH 1FGVH 4C58B 3BW9A 3BPNC 4CVXB 1KIUA 1ZT1B 4YBLC 2J4WH 5EZJA 1U8KA 3NABH 2B4CL 4MAUL 4TUOB 5GGRB 5LGJA 5E0QA 2AJYL 3S5LG 3TT3L 2R4RL 1Z2KA 5IJKA 4F15C 5C71A 2J5LC 3UDWA 4APQA 4BZ2L 3GKWH 5ENWA 4NKQB 4ODSH 4PY7B 3L3GA 5ETUA 3OKDA 4KXZI 5TE6L 4Q7DA 2XRAH 4ODVL 5KN5A 3QEHA 2A74B 1VGKA 3C5JB 2ZOKA 4H8WL 3CH1B 4H1LH 1Q38A 4WCYL 1VSCA 2DL9A 4OT1H 1QA9A 1VEPA 5C0BD 4WU7A 4JFYB 4ZAKD 4GRLC 1MFBL 4U1MB 4LLQB 5AZEL 3LQMA 3ZT6A 3DARA 2DLGA 3FO2A 1CGSH 5CCKH 2WINB 2V2TA 1JWMA 4QCIB 7FABH 3CSBA 2V17L 3RPKA 1IGIL 4W4OC 4LARH 4XH2B 5EU4A 2VLLA 2AXHA 1A3QA 1M6OA 3STBA 3PGCA 4HXBH 2KZ1B 5FM5M 1NAMA 3MQIA 4IMKA 2VLJD 4K9EH 5J3HC 4WY7H 4M7JH 3V4PH 3BGAA 1CD9B 2AXJA 3SOBL 5E5MA 5EO1A 1UZ8B 3NCJL 5FM8A 3IDYB 3MNWA 5FIEA 1ACYL 1KIQA 1FFNA 3RDTA 2HRPH 2FD6L 3R8BB 3UZQA 2AS5M 1MAML 4M1DL 2A77H 4CVZA 3MUY1 1T5WA 3HNTL 3VWKC 5BVPL 1HHKA 2FO4A 4PJIF 4FNLL 4MAYC 2DWEA 2FCBA 3FMGH 4IIQB 1HHIA 4NNPH 5IIEA 3ILPA 2EYTB 2VZUA 4R4FL 1RIUH 1IT9L 4KROB 1YEJL 1XIWB 4WNQA 3FONA 3W9DB 3QEQE 2DQTH 1GHFH 3RZCD 3OKKB 4UOW1 4UAOB 3NZ8B 1QYGH 4WUUB 1ZGLA 3DECA 3LRSB 2VDQL 4U1KA 1EMTH 5CHNA 4Z0BL 1N2RA 5I8KH 1RK1B 4AIOA 3CDYA 4JG1L 3BN9D 3O8XB 3HE6A 3IJYA 5L7XL 4CL7A 3SDDC 4LVHB 3GMQA 4YR6B 1ZVSA 5HD8C 4LK4A 2OK0L 3LKSB 1L7IH 3QFJA 1RZ8A 4JRXE 3P0YH 4IIQC 1T66C 4ZS7L 4JM2A 1RIVH 1MH5A 3U7WH 4QT5B 3WKML 5MEND 1EO5A 2QR0B 1BVZA 2AXFB 2RFXA 2AJ3B 2YD5A 3WL9A 2A1WL 3NGBB 1LP9B 4M62L 5KZCB 2HAZA 3KPRD 2AK4A 4NT6A 4NNYB 4MXWL 4UAOC 1W0YT 3T0EE 4XVTH 4HH8A 3CAFA 3MUGA 2VDNL 3JWDH 1F00I 1NFIA 4FZ8H 1CFQB 1Z9MA 2IBGA 5AYUH 4NZUH 2LU7A 4HWUA 1TJIH 2ZSWA 3O11A 2Z31C 4OKVA 4Y16C 5KJRL 1PW3A 5C8JA 3JTTA 4PTTB 3RRQA 2ZUTA 4P23A 2D4FA 5HY9A 1FJ1A 3L3OB 1DUZB 3QZWA 1SHMA 2IAMB 4ODWB 4R3SA 4LVOC 4KJPC 1BIHA 1WFNA 2EZ0C 3RAJH 1GYAA 1G1YA 4W6WB 3BP5A 4RMQA 2VH5H 4NRZA 1DBBL 1WITA 4AEFA 1N3NB 1N5YL 5IB3B 2R1YA 1MRCL 3FN9A 3I6LE 1FZOB 4N1HB 1G6VK 1JGLH 4Z7UE 2CLZA 2QV2A 4OFDA 3AU1A 1GZPB 1YEHH 4UV7L 5DD3L 6CGTA 3ZKXC 2XFXB 5BV7H 4ZO9A 2G5BA 3MV9E 3DBXB 4FQPA 4P2CG 4WW2F 5F1KC 3VXOA 1W0WB 3LPWA 2ORBH 1UCBL 1X4YA 3FQTB 3P4OB 4K71B 2EDRA 4X99A 5HXMA 3UBXG 3MOBL 3PHSA 4PRIB 1C1EL 1ITCA 2DD8L 3JWOH 1RZKL 5CSGA 3WCYA 4S10A 2AJUH 4MJ4A 1UADC 1VFAB 3CSGA 5GS0C 1PAMA 5E4EC 3DIFB 3NA4A 3RWDA 4LLMA 3MR9A 2JB6A 2NX5E 3WEXB 5IVZA 1SYSA 1PX4A 4X9GA 4G6KL 5E2WH 1U8LB 2C5DC 4EVNB 2VDML 3NZHL 4MQXD 5IMKB 4RGMC 4OZFH 3JTSB 4PJIA 1FO0A 4JFDE 1CLYH 4HXAL 5LXGH 1XF2A 2J7LA 5F9JB 4P2RB 3NIDE 1U93B 4Q97A 2X4QA 1S9VA 4PJGB 3VA2C 4MS8D 2HFGL 2VQTA 2ZCKH 4FFWD 4KROD 2VQ1A 1XIWD 2RR3A 1BZQK 4Z7QE 1CN4A 1QBAA 3QWRD 5JXED 1LE5A 1G7JB 1QFUL 4ZXBA 2XPGA 1AE6H 4UIKL 2VN4A 2X4TA 2QSVA 5C2UB 5ADOL 1CLCA 4KKCC 3FCTA 4JO4H 3KYOA 1SEBA 3AVEA 1OSZB 4WUUD 4HWBL 4HGMA 1KYOK 4P9HL 1CIUA 1Q0XL 1PEZA 1XF3A 4N90D 3RGVC 4BUGA 4YXLL 1VENA 4HIHB 5GZNC 2HMID 1NMAL 3IDMA 4OF3A 2JLLA 4E41B 1DQJA 2CIIA 5GGVH 2VDOL 2IPKB 3B2VL 3BEVA 3O8XD 3KPTA 2ESVA 4X80L 1LO3L 5J7CC 3P4NA 1MQKL 3BSZL 1FAKT 2WSKA 5EORL 2KQNA 4Z76A 3FZUC 3K3QA 1T20A 3QUKA 1U3HB 4DZ8B 3QDGA 5JW3H 3ARFB 1IQDB 1JMXA 4KK8D 2ITCA 4XBGB 2YPLB 1FSKB 3LZFH 1R5WB 2BHUA 5KZCD 1RV6X 4Q6IB 5DZLA 4ZSOA 1K3ZA 2O61B 1DQMH 3T3MF 1RMFH 4PG2C 3CX5J 2IWGA 1RUPL 4S1QL 5IB1B 3OZ9H 1UYWL 2LV4A 4MB4A 4LSPL 5DD1L 2E6QA 3ULUL 4M7LL 4H20L 3T0WA 4MXQC 2IAMD 3EFFA 4QHLB 1CK0L 4OFYD 4I77L 3QUML 2EXWC 2NZIA 1CL7H 4XC3H 5GS0D 2HP4A 2Q8BL 3ARFC 1T5XB 5IK3B 5FO9A 1AR1D 1QUNA 1V5JA 5BS0A 3X3FH 1XMWA 1CTNA 1KGCE 2EIEA 2GSIA 4KUZL 1IARB 5DJCB 5BRZA 1JRHI 2HLFC 3BMVA 3KJ4C 4M9OA 4PJHA 5KVGL 3LPGA 1UKQA 1PEWA 4RMVA 1JGDA 4EDWH 1T0MB 3TO2A 5ID0A 4LNRB 3ET9F 2XQYG 3DX7B 2B1HH 5JPNB 4YDIL 3AREA 4EOWH 3VXUB 4OZ4A 5L88H 4U7KA 1G7QB 4MX7B 3GBMH 3IJHA 4D3CL 2BRRH 3DMMC 3CFCL 4IM8A 5DI8B 3HB3D 3TFKC 5KSBE 4NNXA 4XMPL 2WBKA 4K7PX 4TVPH 1KPVA 1E4XL 4LEXH 1CZ8L 3EYFB 2DTSA 3GNML 4IJ3B 1OP5K 1NBYA 2KQMA 4BFGA 4OLVL 4XNMA 1HQRA 1OGTB 5LAXB 3IDGB 5D93C 1KB5A 1WZLA 3D0LA 4P2RD 1BWWA 3S5LB 4F3FA 3WS3A 4LEOB 3C60C 1MJ8L 5EBWB 4ZQKA 5TF1H 4RQQB 2V9TA 4J3UA 4MQ7B 4RFNC 3QQ9C 4LSTH 4EUPB 3GMRB 3IXAB 4S1DD 3LPFA 4UZGA 1EO8H 3BT2H 5EOCL 5J56B 3QIUA 2DDQL 1ORSA 1YEDB 4UOW0 5I0DA 3VI4F 5ILTH 2MCPH 2PF6A 4E41D 1PJ9A 3F58H 4P4RB 1FLRL 5CIPA 5GS2D 3ULVC 1G7HA 2JCCA 5JQ6L 5GSRB 3WFEL 1FNLA 4D9QE 3RNKA 4WV1B 4XTRD 5I1JH 4RX4A 1JK8B 4ENEC 4MXQD 3LN5B 1NH6A 2YPVH 1OSPH 4XB8A 1NFDA 1U8NA 5ERWA 3M45A 5L2KB 1U3HD 3HC0B 3VFTA 1KCKA 3U4BH 4JFFB 5FYLD 4JZJA 1BZ9A 2YPLD 2APFA 4G6FB 1DLHB 2IADA 3STLA 1HYSD 3GSUA 5FCUL 3UAJC 5TE4H 4I3RH 5ALCH 4WENB 2DQGH 1S7VA 4Z78B 4WJ5A 1IE5A 4DOHE 1OCWL 3PWUA 1SJEB 2FLBT 3CFEB 4YZFE 1BHGA 4LDLB 1C5DB 1RZFH 2GSGA 2JJWA 1J87A 3QXWA 5IV2A 4WEBL 3W9EA 3CMGA 4J1UB 2D0GA 3QCTL 4Z7VE 3WLBB 4FQLL 2D03L 1GH7A 4XPBH 1M7IA 2FEDC 3P73B 3RY6C 2EDEA 5HGDA 3MUZ1 1XCQB 2EECA 4Z95H 1PG7W 2NXZB 4D0DB 1X5GA 4GRWH 1FG2A 1UB6B 4KJYB 2JJVA 1NC4B 2JJSC 2FATL 1IM3A 3H9SB 3HCVA 3QO1A 1AKJA 3KDMB 3T1FB 4KUCD 5DHXB 4NOBA 3QNXB 5L0QC 5TDNB 3LV3B 3MLZH 5KANG 4E42A 1S7SB 4GAYA 4OCRH 2J6EA 5GJSL 3QRGL 4F8TA 2AP2A 5KTEH 1IL1A 1UKTA 2Q8AH 1EIBA 4F9LC 4ELKB 3GIZH 4GSDL 4JFOA 1DANT 2HWZH 4DVRL 5BO1L 5E8NA 2A6JA 1KJ2L 1MFCH 2Q87A 4LPVA 4J2XA 4FQIL 4FRWA 3DETD 3V52L 3HMXA 4HH9B 3VXUD 2IQAA 1E4KA 4H1LG 4TRPH 3OAZK 2CDFA 4M6AA 3VFNA 2XN9B 4AMKL 4MD5A 1IKFH 4JPKL 2VABB 4Y2DC 3V0WH 4M61A 4NQEA 4G8EA 3GMNB 1FL3A 4K3HA 5JO5B 4TOYH 3O45B 5EBMA 1GCFA 3ULVD 1XGYH 4Z77A 1FFPB 4Y4HC 2C1OA 1C7TA 1A1OA 3KPMB 3QEGL 4ZOBA 1EHLL 3KPRA 4OZHB 5I8EA 5I6XC 2R1XA 3F7YA 4GRLA 5DYOB 3KYKH 3QJHA 3B9KD 2UZIH 2CGRL 4KAQL 1DZBA 4OLWH 2VJXA 2W91A 4RGOL 3NA9H 2FGWH 5GRVK 3WFHA 4PP2B 4QTIL 3GM0A 3TWCL 4U6XB 1NCCH 2P8LA 3RFZC 4GQ9L 2HT4D 1I7UA 3UAJD 1EHXA 1Q0YH 3GJEA 3IAQA 1CDHA 2P44B 3LQAC 5F44A 3OAYK 1CT8A 1I8LC 1I3UA 4Z5RB 1A21A 4PR5A 1HINL 1P7HL 2UZXB 1KFAL 5JA9A 2IAND 4GKNA 32C2A 1RZIA 4LQFL 4X5LA 3CCHA 1MJ7L 3OKNB 2FIKA 4P3WA 5DDHB 5JQHC 3VWKA 3S96A 3VDAA 3SGEI 5L2KD 4LKXB 4MAYA 2X9YA 3CK0L 4QRSB 4JFFD 5IHBA 4GFTB 1Z9LA 4JR9L 1G9MH 3UBXB 3MLSH 1QFPA 4G6FD 3U9UB 2YR3A 1G9NL 2XOTA 3P9MA 4E5XB 5I9QC 4ZPTA 3FOMB 2CRIA 5D6DC 1TPXB 4HD9A 3RY5A 5FUZH 2MKWA 3I2CL 4QRTB 3TO4B 1T04A 2D2OA 5IGXL 4HPOL 1YMHA 5FYKE 5F7WC 2I07A 4IS6A 2BFVL 1IBGH 2Y7QB 3SDDA 1KPRB 1NEUA 4PJHE 4HIJB 2VITA 3P0VL 3GSQB 3MREB 3FRPG 3AGVA 5IM7B 3O6FC 2X89A 2OJEB 5BJTA 3G04A 4IIQA 3BHBA 5JUEL 1OWRM 1J18A 2FBJH 2NXZD 3QXDB 4KHXH 4P5MB 4G5ZL 1MWAA 4HGWA 1JTOA 1NC4D 3H9SD 4TPRH 1Q9WB 3D3VE 3BDYH 2RQ8A 3EDFA 4GT7A 3A0OA 4HLZH 2HKFH 5FUCC 1Y6KR 2IALB 4OV6F 1S78D 5DD5L 3TO4C 5HDQL 3VXSA 5TQ0H 5EU6E 4LRIC 8FABA 2Z31A 1ZHBB 4NZTL 1HILB 1RK1A 2GT9A 4Y16A 4P49A 2HT2D 2EH8L 5ICZA 5AG8A 4S0SD 3KGRA 1L0YA 5T1LB 4OGAC 3OXRB 3HPLB 3G6JE 4KI1A 4YXHL 1D5XA 2X70B 2QLVB 2PN5A 4L8DB 5FHBH 1M7XA 2XN9D 3HG1B 5DJ8A 5JW5B 5IFHL 2I9TA 2DTMH 2QR0A 1ZSDA 4DKAA 2B4CC 3ISWA 2ZKHH 4LLDA 3V5KB 4N0UE 3UO1L 3K2UH 3TH3T 2ZG3A 5ITFA 4DVBA 1TCMA 4OD3L 3VFMB 3SDXB 1M05B 3MV11 3DUSA 3TIDB 3RIFK 3MLWH 3DO7A 2PYEA 2VL4A 4JN1L 3DUHA 4HUUA 4MWFB 4OBRA 3B6SB 5C6PB 5C0BE 5IUSA 3WXWL 4GAFB 4F9PC 1JGVL 1UA6H 2XXCB 3QHTC 2DQFA 3HA0A 1ZHKA 1T0NA 4CKVX 5E70A 4M48L 1DUZA 2GTZA 2JK5A 3U46B 4IDLA 4OFYA 3PWVB 5IFJB 2HTLC 2DJUA 5E2JA 4GOSA 3G6DL 3QUYA 4PP1C 1YJDL 3VFSB 1DN2A 1HKLH 3TEUA 2VLJE 4PRDB 1TVHB 2HJKB 3NN8B 2CLVB 4C54A 3T09A 1EGJL 5B8CB 4Q2ZB 1SJHA 3R06A 5E2TL 1RSFA 4N0CD 1QBMH 1IZJA 4G9DB 4LSVL 4P5TB 1C5CL 2OR8A 5GISH 1NL0L 4MMXC 3S9DB 3IF1A 4IEFB 1A4KB 3O81A 1FZKA 3D69A 4LU5H 4MQSB 1EJ6A 4GBXB 4PRIA 1ZLUK 3STZA 1M71B 2HJLB 1CXLA 4M6OH 5J1SC 5F93C 4K7FA 3TYFA 2CR3A 3EYVA 5D1ZC 3TO4D 1NJ9B 5C7XH 3RGVA 1I9RH 3GO1H 5DR5H 5EC2A 4UOJA 3IFPB 1IC4L 5IMKA 1ZAGA 1ZTXL 2WANA 3IETA 1AXTL 1GGYA 1X6NA 4HJJH 2V9QA 5IW1B 4G8GB 5CEZH 1NCAL 4LSSL 5HGAA 4ODHH 2XWBB 2PO6B 4PRBB 3CDGB 4XPFH 1G0DA 1Q9KB 4W6XB 3D18B 4MA1B 4CN6A 1XGPB 2J8UF 3BI9X 4OCWH 5BW7C 4QY8B 5IMLB 1TDQA 4GG6A 5FOBA 3H8NA 5A2IH 1MCQA 4BELD 4KZDL 1FDLL 1UM5H 3D25A 2O5ZH 4OUUB 4UIMA 5MENE 5HGBA 5IQ7L 4PJBA 1RZGA 3OKOB 1XEDA 1VA9A 4PG2A 1FVCB 4NP4L 1KYOJ 1GPOH 4PREB 3KPRE 3VD7A 2BOCA 3U1SL 1YYML 2IPKA 2OI9C 5HGHB 5E2UH 1PKQA 4X6EB 2Y6SC 1A6UH 1T1WA 3O0RL 5T1LD 1UWXK 3GBLA 5IMMA 3N9GH 4GKZA 1KN2L 5HDLA 4PJCF 1T89C 3WYRA 4A6YH 1T1XB 1I1AC 3BWAB 1NMBH 1M1SA 2EC9T 1S9WB 1QLRB 4DTGL 2VDRL 3HG1D 4R2GC 3GSXA 2V5MA 3ARFA 3FTGA 4EIZC 3HZVB 5HHNA 1V3LA 2C7UB 3U0WH 5EN2B 3X3GH 1A14H 2X2YA 4HF5H 4NRXB 4M6ML 3MV01 2NY7H 4ZS6D 4KVCL 3G5VB 4R96A 2F5BH 1QVOB 1ZVHA 2YRZA 4L8CA 1FIGL 1QTYT 2GFBA 3DX9A 1DR9A 4QRRA 1G7LA 1G7PB 4RWYH 3VGEA 1PG7X 1P4IH 2R4SH 4U05A 3MLRH 4D9LH 2HN7A 5HI3D 1TNMA 2FX8L 3LS4H 2EDFA 5MEOA 1BQSA 3BQUC 5CLTA 1UQSB 3FT3A 2VERN 4JDZA 3DMMA 3ARBB 4NQCB 3NTCL 4YDJA 3KPOB 3JV6A 1KULA 1HI6A 1T22B 3HUJF 4QGYA 3TH2T 1IGYA 3BIAX 2H2SD 2FBOJ 1JNNL 4G80B 5C9JB 4Z8FH 4X5XA 1YA5A 4F7PA 3QXVA 1NGYB 4P5TD 3HE7C 4KGLA 4YHIB 1RZKC 4ETYA 2F58H 4HWZB 5F9OL 2Y06L 3UTOA 3C60A 3EGSB 2VRAA 3WIFB 3LCYA 1XGQB 4PB9H 1IMHC 4MJIA 5B21A 4ODXB 2HVJA 1T83C 3I9GH 1J1OH 1MUJB 4GBXD 2VC2L 1OP5H 3S88H 2CKBA 5CP3A 1NGWB 1GOFA 3MJ9H 4H1LB 1XR8A 2E7BA 2P7TB 4Y5VB 1CFSB 4TTGA 4MX7A 4G8IA 4KDVA 4NRYA 1FAIH 4GKSB 4O2FB 5HSFA 1GJIA 3GIVB 1A3LL 5GGTL 5I1CL 1WCBB 2CJUL 1SEQH 4WUUE 3BP7B 3V0VA 2R0ZL 4N90E 1YEGH 3GSVA 2O93L 2D7QA 2XTJC 4G8GD 4YBQC 3WXVH 4XPAH 5H2BB 3SDYH 4R7NA 1FZMB 2PO6D 5DLMH 1KXQE 2J8UA 3G5YA 5ICYA 1IAOA 4CADB 3LIZH 2FH8A 4P9HC 3AB0C 5FGRA 1NAKL 3E1F1 2NZ9D 5IOPB 2PTUA 3UTTA 3UJTH 3ULSB 1U8JB 3R8QA 4IDJH 1A1NA 2NY3B 3QO0A 1BJ1H 5FM4A 3NAAH 2BVPA 4UT7H 4YHOH 1SMAA 1LP9E 3ARDB 5I18L 1MCHA 5JW4Q 3LEXB 3SGDI 2EDTA 3NFSL 4DKFL 4PJCA 3B3IB 5C0GA 1TETL 3DX8B 2GAZA 5ESAA 2HJFA 3SQOH 4LCUB 1XH3A 3MRMA 4L4TA 3MJ8A 4QRPA 3RY6A 4OFPA 5A40E 3MO1B 4F57H 4XRCA 1BJ1J 5K9OA 1F8TH 2XZAL 5EDXA 4YHZL 2ID5A 3S6CA 5JHDB 2K9UA 5D70L 4GMTL 2H26A 2JJSA 3MRDB 2VE6B 5C0EA 4NN5C 5DWUH 4EXKA 3ULUC 3MV8A 1O7VA 4LLUB 4DZBA 3BRFA 4FXGA 3ALWA 2VWEE 3O2DH 1SJEA 4P48A 5DZNA 4NQVB 4D0BB 5DQDL 3QWQB 4F9LA 1KG0A 1SJVA 3CVIL 3E8UH 4OM0H 4ZUSB 1JPSL 1F3JA 1F6LL 3NH7L 1FN4B 3TNNB 3W81A 4N0YL 4BH8B 3OR7A 2ZOLB 5INCB 4MD0A 4MHHG 3LHPH 2EDLA 2X09A 4CRPA 1K8IB 2CK0L 4PJAA 3CH8A 3HUJA 3ARBD 4NQCD 4Y2DA 4PRIE 4KJYA 2ARWA 3VXNB 2AJZA 4P57A 4Y4HA 1S9YA 2VLMD 2Z91A 3RWFB 2X4OA 1S7SA 5HHMB 5GHWH 4QEGA 2APVA 2BNRA 3C2SA 4H0IA 1NPUA 3SKNA 1QQDB 3OAZH 35C8L 2HKHH 4IRJC 3TNMB 2VIRB 1UGNA 4I3SL 4I48B 4LSUH 5F3HA 5D96C 3Q2CA 3UJIH 2AK1L 1X9QA 3QDAA 1S5HA 4P3DB 5I71B 4XNZC 4P2RE 2WBJB 5FA4B 1FH5H 4LSRL 3UZEA 2QHRH 4PJGE 1NBVL 3HZKB 3DRQA 1RVFL 4JQIL 1VACB 5FYJU 5I73C 1SY6A 4IMLA 3O6LH 1YYLH 1EH9A 3L5JA 2EEBA 5FV2A 5HI4D 1I8LA 2PNDA 1CYGA 2ICWI 1FFPA 1AGEB 5BV7B 3IDUA 1MFDH 15C8H 1OPGL 1G84A 2IFFL 5E1AA 5GRJH 3FKUS 3X11B 1OD7A 4Z7VF 4UV4L 2V7HB 4BFIA 5DYOA 4UBDC 4GXVH 3K1KC 4E41E 4MLIA 3WDJA 5I1EH 4XP4H 3OAYH 1QFOA 4ZOCA 4YHML 3UTZA 4FQCL 1MREL 4UDUB 1MY7A 3FT2B 1AXSA 1DCLA 2G9HB 4EZMA 2NY6B 4LKCA 2R23A 4JANA 3LD8B 1QBLL 5E8PA 2FNBA 1D5ZA 2NY3D 3WD5L 4NFDA 5FYLE 1JNHB 2YPLE 3MRRB 4OZFB 1MHEB 3A6CL 4XPTH 3TGXA 3ARDD 5EBLA 5JIIA 1R0AH 2XACC 3N50A 3MJ7A 4O51B 3D9AL 2CXKA 1DEEB 2R1WB 2YA1A 3CC5B 3RA7H 2E9WA 3F7VB 1FGNH 4XMKL 2W0LA 3IDJB 2WNGA 3O6ML 5I1DB 4JCLA 3TPUB 4AYFA 3WO4B 1YY9C 3A67H 4L8SB 3O6FA 1U8HA 3ESVF 2GEEA 4HQQL 1OAUH 1PSKH 2NY6C 4Y19A 5JHDD 2X4NB 3V4VL 5I1LA 4GW4B 5FECA 3R1GH 1AFVH 3GMLA 1LD9B 4LCIH 3E6FB 1S3KL 1HSBB 4YWGL 5ALBL 4FP8H 4NN6B 5TGBB 4LRIA 4HX1B 1ZEAH 1BF8A 3MRBA 3MRJB 1F13A 4LHUA 3Q0HA 1KCUH 1EFXB 4NJ9H 1W72A 1NCBH 3RPIB 1WT5A 4L8SC 4LSQL 5L9DH 1BM3H 1H3TA 1B0RA 3VMPA 4JO1L 3RX7A 1Q9WA 5T3XL 3VXUE 1TZGH 4HKXB 1XZ0B 3QNZB 2VUYA 1ND0B 5HHMD 1AJ7L 1KIPA 1MCPH 5DO2C 2C3WA 4X6FA 3S35L 2MHAB 4YX2H 2BVTA 1IILE 3PHOB 4CVUA 5HHPB 1BGXL 3ULVE 1GXEA 3QISA 4XWGH 2P24A 1YUHA 4DAGH 2OZ4L 1YEKL 4YHPA 4F7CA 4JKKA 5F1NA 2EYRB 2BERA 4F9PA 5CMAB 5C0CA 4AEHL 3LB6C 2WBJD 2X7LB 3ZTJH 4ORZC 2ADJA 3PXHA 4JJ5A 2OXGA 1I4FB 1RZJL 3WIIH 4NOFA 1JWSA 5ESVB 2R69L 4WW1B 4PBWD 4R4ND 5CLWA 2DM2A 4MA3B 1E4XI 2HFEA 3WDIA 1JVKA 5K9KA 4OD2A 1WBZB 3F8UB 2I25N 3OJVC 2UUDH 1LGVA 3W0WA 3C87A 4FQ1L 3V7AG 2I9LA 3ALXA 3QJFB 2W0FA 1XF4A 1IGJB 4X7EC 2NY4C 4YEFA 3JWNC 3BVNA 4Y89A 5C0RH 4QRPE 4PRPB 4BSWB 1U58A 2NY6D 4GW5A 3DROB 3D87B 1JHKL 2W0PA 1P2CB 4FS0A 1IQWH 3BRGC 5L2KE 3TVMD 3U46A 2F8VA 1NFKA 1BLNB 1OWWA 1DBJH 3FO9A 4HKZA 1JPTH 1J88A 1X5IA 2UZYB 3F65A 5DF0A 3SJVA 2YUXA 3ZE1E 5D1ZA 1YEFL 2VLRA 2YUVA 1NAMH 3BOVA 4MJ5A 2KUTA 1UCTA 2OL3L 3HNVH 3SKOA 4HC1L 5DJAA 1T7YA 3RJDA 1KJMB 2HJKA 2IG2L 4RZCB 4PJ8C 1MLBB 3IU3B 5JW4R 5E8EA 2HH0L 5E5RB 4LPTA 2A6IB 3U4EA 3ARGB 3L3JA 4HUWB 2I5YL 4D0CA 3RWEA 3G6JF 3SDCB 1G9NC 5JPMB 3O2WL 5F7HA 3FB5B 4LLWB 5CGYD 2YZ8A 3UYPA 4I18C 4O4YH 5C09A 2ZUUA 4FQQA 4B0MM 5TDPB 1OAZL 5BW7A 1RUAL 3NCMA 1IFHH 3RVTD 1OAQL 1P5UA 1ZT7B 1KN4H 1CE1H 5CJ5A 1DBAH 1SJXA 5F8RC 5AUMA 4NO3A 2W60B 4MA8L 3UTSB 3H9SE 2UWEB 5DJXB 2ICES 4YDVB 1GGIL 1CVSC 4ETQA 2XNAA 5E8OA 5J06A 4PJ5B 4GUPA 4QXTB 2BNQD 3KVQA 1Q72L 1MJUL 1J11A 3ARGC 1Z6JT 3B43A 1EFXD 4HFUH 4YPGB 1T89A 1I1AA 2FHBA 1DUYB 4XX1G 3QA3B 3QEUB 1KELH 4UT9H 2F9BT 4GXUN 5IW3A 3TT1L 4RSVA 5HYJA 5T1MB 5SV3A 3O3DA 2DQCL 5FAAA 3FL7A 4G6JL 1XGTA 5EUOB 1MCIA 2XN9E 3HC3L 5IESL 1A1MB 2OYPA 2EKSA 2R2HB 2HFTA 1S7TB 5BZWB 2DKUA 3QQ3B 4U1LA 4B5EA 2AV1A 3MCKB 2AVGA 3EDDA 4I0KA 1EHNA 4XWOD 4BSVB 1YNKL 2GCYA 4OZHE 2A6DB 1H3GA 3GI9H 3EOBB 1S9KC 1DQQA 3U30B 1MFAL 1ZGLM 4L3EB 4Q9RH 3FQWB 3KPSA 4MZ3A 3TN0B 1ONQB 5E8DL 4GRWB 4IOFC 4XC1L 4YH6A 3FN3A 1UB5A 4HIEA 5E00B 2IJ0C 3RWCA 1L6XA 1JFQH 5TFSL 4X6DF 3DSFH 3B2UD 4ONHA 1A9EB 3BQUA 3MV7B 1VPOL 1S7RB 2XZQH 2YA0A 3MTRA 3HZVA 1MCSA 1HH6B 1BFSA 4J6RH 4XP5L 5GGRY 3QHZL 4LBEA 5D4QA 4PGBA 1PGRB 4WDIA 5B39A 5KVFH 5D72L 1QSEB 3S4SG 5IVXB 1DVFB 3S3SA 3HE7A 2EDNA 2NY5H 4KPHL 4PS4L 5JW4M 3BE1L 2BSSA 4GJTB 3TESA 3IFLL 4PRPD 2P45B 1YJDC 4K94H 3RNQB 5F7KC 4MB5A 1T83A 4NM4L 5EU3A 3KLHD 1NGPH 1XR9B 4M8QB 2Q3ZA 4TVPD 4Y19E 1MEXL 4UTBH 4X6CB 1AC6A 1F4XH 4K3DL 5C0AA 4YHNB 3ZE0F 3GSOA 4L8BA 4K7PH 3BKCL 3SGJA 4XNYL 3CSYA 5FKPA 2OS7A 1J1XH 3C2AH 3JUZA 4HLJA 5FUCE 4XI5C 4OF0A 4JFPA 1TZIB 1MJJB 2H41A 1CICD 1LEGA 4XVSL 3ARGD 4L9LB 4C4KO 1T2QH 3KJ6H 4OD1L 5BVJB 3C5ZC 3SDCD 3BKJL 5HPMB 1DVFC 3HKFA 2JELH 3PGFL 1HOCA 2NCMA 4O2EB 4XBPA 1LHZA 4HWZA 3INUH 4HWBA 4GO6B 3ECBA 4LL9A 3K4AA 5EO0B 5MI0B 5I15H 3F5WA 1AGDA 5JDSA 4DW2H 4BA8A 1P4BL 1RJZA 1OARL 3BZEB 4MDIB 3VXRA 3UTSD 3VG0L 1X7QB 1R3IL 1VFBB 5KG9B 3VFWA 4LCCC 5DHVB 1CGVA 1B4RA 4PJ5D 5CJOL 4OLUL 1JZ5A 2Z93B 1S7UB 4OSUH 5IVNA 5ICXA 5ADPH 5EU7E 1AHWB 4YGVB 4GG8B 4NHUA 1XGUA 5DSCB 5JORB 4KHTH 4XB7A 3JBG7 3KYMB 4PJDA 3UX9B 3DX6B 2R56H 3Q1SL 1BBDH 1AIFA 3VFRB 5EFIB 5MP6L 4ZFFB 1DDHB 3L9RA 5MI0C 2YK1L 1J12A 1BP3B 3QDMA 3QUXB 2YSSB 3GJFA 4FFVC 3LMJL 1A7NH 4ZO7A 1U8JA 3MRQB 4ZUUB 3HG1E 3EIFA 4ONGH 5J1AB 3GB7A 2VXUH 2E6JA 4RAVB 3TCLA 1BOYA 4RAHA 5D9SA 1H0DB 3MNVB 5CILL 3LEXA 3QUMA 3SDXE 5INDB 5I19H 2EO9A 3MRGA 3CZFA 3DYOA 5DK0A 2DWDA 4YBHA 4L3ED 1JF1B 4PJ9D 4ZD3L 5MERB 3TN0D 5I1HL 5D7JB 4X6DA 5GGUB 3V4UL 3KWWB 3K81A 4JKWA 3MV7D 4LRNL 3CDFA 4QWWD 3WHXB 1U3YA 1IEAB 5DVMA 3SY0A 3T2QA 3SJVE 4PV8B 1IFHL 1N6VA 4UU9B 3NVQA 1NGXB 2D9CA 3GSRA 2IMNA 2JIXB 3PP4H 3O4OB 3H7BB 5JHLL 4ZUWA 1DVFD 1KBGH 5KW9H 2AEPH 1NCDL 3UTPD 4KJWC 4IRJA 1MCBA 4PRAB 2F54A 2VLKB 3WNLA 1A7OL 3NFPA 3QXAB 5GS1C 1YQVH 3O4LB 3PDDA 5BOZG 1A9BA 5BQ7B 5FEBA 2FX7H 3IFOB 2M1KA 4NQSA 3PWPA 5DMGD 2V7NA 4L5FH 1TQBB 1UM4L 1HHJB 3EUUA 2R2EB 3I6GA 2R0KL 5I0ZA 1S7XA 4UINH 2QADB 1ZHNB 4I1NB 4M7ZC 1LP9F 1C08A 5DA0B 3GSNL 3VG9B 4GKOA 2E27L 5GRYA 4JY6B 3HFML 3BDXA 1X3DA 2BRQA 1R3KB 1OF2A 2IQ9H 1OY3B 4CU6A 4PGCB 4JHAH 1UVQA 3C09B 5EIIB 1CIDA 2FZ3B 5ISZA 5AWNL 3Q3GB 3QCVL 5DK2B 5IT2H 4NUGL 4G8GE 4WVRA 3MLXL 3EOAA 4PRNB 5JIKA 1KB5H 1NGZB 1KNOA 4BZ1L 1G7IB 4D2NA 3RVUC 1JGUL 2W9DL 4FXKA 1QSZA 5FA4A 4MLSA 3NPSB 1U8OB 4PJFB 3C8KA 1YNTA 5HYJE 5K93A 3V6FB 5ACZA 1WAAE 4M93C 3Q6GL 4ZO8A 3U0PB 2JJUA 4PJXA 4KQ4L 1MNUL 3OKLB 2BJMH 5FYJL 1V3MA 1S7WA 2P42B 5EC1A 1A6ZB 1MHCA 5CIPH 1TCRA 5E9DA 3W82A 1FNGA 1RIHL 1U8IB 5F96L 2B1AL 4LIQH 4NSKB 1NSNH 2YBRB 5JNYA 4UDUA 3BO8B 5JMRA 1I1FB 1KPUA 3QUXD 4U6YA 4K8RH 4X7TA 4DUVA 2CIKB 1F2QA 2DQUH 5JZ7D 4PB0L 4P46C 5EBGA 4ODTH 2BNUB 1YMMB 1EEZB 4FXLA 3MPCA 2LE9A 3BD5A 1S5IL 4K2UH 1MCOH 2Z92B 3WFDH 1BVLA 5F9WB 5IBTL 4BYHA 1F4YL 3CFJB 4GW1B 3C6LC 2Z4QB 5D7JD 2VR9A 4GS7B 3DURB 4JN2A 5EZIH 5KAQG 3BH8B 1HNFA 4WFFD 3BXNB 3ZKND 4L8SA 5F7FA 3WNPA 3RHWK 3WLWC 3T4AA 5EPMB 4AIZB 1ZWIB 1JYVA 4GW4A 4JO3H 5IWLC 1LDSA 2GW5A 5T3ZH 3RWGB 1HIML 4NQCE 3CXHK 2JIXD 2IH3B 5DRNA 1KJ2A 1WLHA 5HHVL 1KJVA 1WWCA 4C4KT 1F90L 2VLME 1G6RL 4HX1A 3LEYH 4A6YB 1P1ZB 1A6WL 2VLKD 2J6EH 3ZTJG 4JFXA 3O4LD 3ZO0A 5EZLB 2XTJE 2MOVA 5CKGA 3CGTA 3PV6A 3MBEC 5CUSH 1YN7A 5KVDH 4YDKH 1HZHH 4V1DA 3M8OL 3Q48A 3IDNB 2N1KA 1UWEL 4IOIA 2DKMA 5J12B 3HMXH 2QADD 4MA7H 4PUBH 4N5EC 3RI5K 5CP7A 1XGRA 2BSED 4HKXA 1XZ0A 1S7QA 4JO2L 1CF8H 1M4KA 3PG2A 4XCNA 5H35B 1K4CA 2B7DT 1D5BB 3FO1B 1C5BH 4R4BA 1CD1A 3L7FB 1UJ3B 5I16B 1H3PL 1Q94B 2BVQB 5DEGA 4WFED 1KLUA 4S11A 2D7TH 2ADFH 3P4MA 1JWUA 4O9HL 4MDJA 4JY5L 4KDTC 1DSFH 4RDQF 1R3HA 4CNIB 3GUTA 4EEEA 4BKLA 1KEGH 4X9FA 3QNYA 4UQ3B 3MGOB 4K3JL 1KCSH 1BZ7A 4ODBD 1X6LA 4MCYA 4KUCF 5CEYA 4HS8L 3ULUE 4J3TA 2R29L 4U7SA 5FDWA 4PJ8A 2ERJB 2NYYD 5HVHC 5C0IA 4ELMA 2ENYA 1NGQH 4M3KB 5IMOA 2DQEH 3QIWB 1FL5A 4OLZL 5E08L 3WE6A 4AENA 1O7SA 1F02I 1KTLB 4PG9A 1T03L 3FOLA 4BQ8A 1PZUB 3UCRA 3NCEB 3VCLA 4ACPA 4I18A 5DFVD 12E8H 1HH9A 4WTZG 5CD3A 1YPZB 3BKMH 2P43B 4EQ3A 1JL8A 1A6VH 2V5SA 4UDTA 5DJ2B 1H5BB 3V9FA 1XCTA 3PQYB 1T3FB 3KPQB 3I02B 4B53A 1UH4A 4TSCL 5ANMA 1AGBA 5JHDE 4ZFOL 1YMMD 3RKDD 3SO3B 2MMXA 1GAFH 3OPZH 1MPAL 3MRIB 3TBTA 5CEZD 5A43C 4YAQB 3D85B 3FFCA 5D71H 3CUPB 4Y4KB 1M7DB 1OAKH 1TMCB 2AAVA 3VXPB 5IF0A 4CMMB 1NC2A 2C3HA 4G6AC 3FB5A 4JFEB 4NPYB 3FQNB 1BOGA 4OQTL 5DJYA 2WIIB 5HYSA 3VRIB 5DJ0B 3DVGA 1A0QL 2FJFA 1RUKH 3OWEA 1TFHA 3TBSA 1H8OA 5A2LH 4MCZB 2VR4A 1MWAH 5A2KH 1CGYA 2BC4B 4FTVA 1FPTH 4GAJH 3P0GB 3QFDB 1F58H 1Y18B 3QPQC 1RUQL 4HK3N 3C5SA 2FB4L 5HHME 2R2BB 2ZCLH 4AEIL 2GYSA 2GITA 4HV8A 5EOTB 1QNZH 4ZDHB 5IFAH 4Z7WB 4G43A 2DQDL 4YGAB 1U8PA 2WUCL 2GUOA 1JV5B 1WC7B 4RISL 1UM6H 5D7SH 1D6VL 2E8ZA 3ZE1F 2GI7A 4J12A 1OTSC 4JM4L 3WUWG 5JXAH 3PWLB 4U6VL 1KUMA 3PUCA 4R97B 2DJ4A 3BUYB 4NKMA 3MLUL 3S98A 4FQXA 3LH2H 3L3DB 3ARWA 4QHKJ 1JRHH 1N6QH 1R5IA 1G0XA 2XT1B 3EYOA 2EH7L 2P8PB 4NHCH 2PYFA 2PETA 3GHBL 4XNQB 1G1CA 1K2DB 1DQLL 1A5FL 3DV4B 3PIQA 3QDJA 3V6ZA 1PG7H 4HUVA 2OL3B 5A16B 2OSLB 1RY7B 1INQA 3MCLL 3FRUB 5DUMH 1E28A 1EGJA 1LO0L 4KRNA 1BREA 1A9EA 1ZS8A 3T8XA 2FL5B 1VGEH 4H5SB 2VN7A 1UH2A 4P2OB 1MHHA 4F58H 1PZ5B 1B9ZA 1Q9OB 4QXGL 3JVGC 5LVEA 1P69B 4NWUH 3QIWD 1EZVY 4M5YH 1KTKE 3C5ZA 4NM8L 1QSEA 5T5FH 1MRFL 3ZKMC 2XICA 1FZJA 1DVFA 2QSCL 5HI5D 1MCDA 1P5VA 4OB5L 4KKAD 2XWJB 5SWQB 2ZSVB 2HT3D 4XCCL 3PGDA 4DQOH 2DS4A 5C08A 1A7RH 3TZVA 4M5ZH 3H3PH 2K7PA 3G5XA 2GY7B 2OTUB 1BVKA 4RIRB 3GI8L 3T0DA 1LK3H 4EBQL 5I2IA 3PQYD 3EOTH 4EI6A 4L4VB 3HRZA 4PGDA 3R0NA 2OTPA 4QHMB 2M26A 4LCCA 5K9JH 5J13B 2QQKL 3U82B 1RUML 1YN6A 3D85D 2ARJB 3BPLC 4Y4KD 5IP4A 4OF6A 4Y1AB 4KV5F 5FF6A 3HC4H 1J0HA 1GOHA 3CVHL 5EIVA 4OTXL 2YD8A 2P8MA 5I8CB 4OGXL 4CBPA 4JFED 1ULVA 3L3KA 3G5ZB 3MGTA 2XQYK 4U6HA 2UV3A 1GGBL 4NCDA 1ACZA 5B38A 5GJTL 5IQ9B 3V0AC 1XF1A 2GIYA 5AZ2H 2P5WA 2B2XH 4NJAL 4R26L 4Z7NE 1Z9OA 1CFTA 4KWUA 3HS0B 3QHFH 5C0FB 5DHVA 2CO6B 2Q76A 1D9KC 1JYNA 1CLZH 2IGFH 2NR6C 4HULB 2E3VA 5LGHL 2DYPA 2NY0B 4HUXB 1SYVB 1F6FB 4BM7A 2ICEB 4U1IB 4HT1H 3WFBL 5EFIA 3BISA 4ZFFA 1BQUA 1P9MC 1WEJH 5GSVA 2VZTA 2O5XL 4F80A 2J88H 4JB9L 3HI6H 2EDYA 4AL8L 3RUGB 3G9VA 4WEMB 2RCSH 2EIDA 1FVDB 3FB6A 4EN3B 4ZNEA 1CXFA 5J1AA 2DB8A 4M00A 1LEIA 1U8MA 3UZVB 2AI0H 3TBVB 1A7QH 2YN3A 2QQNL 1MCEA 5CEXB 3MRLB 1WFTA 5KS9A 4NQXA 4Y5XA 1V7NH 3VFVA 3KNBB 4IRSA 2BMKB 4TQEH 2AQ2A 4YDLB 5GS1A 2E6PA 3FQUA 1BAFL 1ZLSL 5ID1B 3GMMA 4O02H 2BOBA 2DQIH 4WGWB 3QEQD 4FQHA 4JG0L 4XCFL 3VRJA 1V7ML 3KPNB 5GGUA 3OX8B 4HK0A 3GEWB 1KEML 4ONFL 4PRPE 5A1AA 1E4JA 4QYOA 5I1AA 4RAUB 2DM3A 5GPRA 1MI5A 1DTUA 3O6KH 4O2CA 5GRWA 4ZODA 3WHXA 2Y07L 3FFDB 5CJQL 1KACB 4H88H 3T0BA 3U4AA 1EAPB 4P2OD 4TVPE 2D0FA 3BW9B 5B3JE 1A3RL 5DMKA 5LQBL 5EZJB 1KOAA 1U8KB 3T0XA 1RZ7H 3DGCR 4GAJL 4LAQL 5LGJB 5J57B 3MJGX 1JUFA 4XNUH 1I1CA 3ZDZF 4ZUTA 3DHJA 1IC7L 4APQB 2Z8VC 5ENWB 1KLFA 2GHWB 1QO3A 5EZOH 3AS0A 2AABH 3L3GB 4LGSB 5ETUB 2JB5H 5GGTA 2X4SA 4PLKC 3OKDB 2EC8A 5T5NF 5KN5B 2CD0A 1B2WL 2NY2B 4L4VD 3QEHB 1WUNT 1P6AB 5CGTA 3PJSA 4HG4K 3GGWA 4M7KL 1VGKB 5L6YL 3VE0A 1ZOXA 2CKBH 2VDPH 5CP3H 5DJ6B 4S1SH 4WHDA 4P9MH 1YZZA 3VXQA 4AEEA 1UACH 2WWKO 3SDXF 1VEOA 1N4XH 4DN4L 1QA9B 4FTVE 4WU7B 3UTSE 4LVNB 4Y1AD 2UWEE 5IW6A 3PABA 3FO2B 3V7MA 2V2TB 3SGEH 1JWMB 3IU4H 4X6BB 5EWIH 4PJ5E 1Q1JL 4OZGB 4M1GL 2E7HA 3K80A 1IC1A 4APQC 5EU4B 5DK2A 4I4WA 2VLLB 3DV6A 4HZLA 4FQ2H 4ALAL 2XY1A 1KC5L 1M6OB 1NGZA 3PGCB 4X9BA 2ZUQB 5IEHA 2EDXA 1MFEL 1NAMB 2N7AA 3PE9A 4P46A 4JVUA 1BD2A 4YIQA 3N1MC 4L1HA 2PW2B 3OV6A 4FFYL 1RFDH 5E5MB 5EO1B 2AV7A 3F62A 2CDGA 3MNWB 1KIQB 1FFNB 3RDTB 5I75B 4P3CL 1S8DB 4NYLA 3AAZA 4BFEA 4CVZB 25C8L 1ZMYA 1FYTA 1T5WB 1CU4L 2NY0D 3C6LA 5D7IF 1HHKB 2FO4B 3GJFK 1N7ML 3SE8H 2DWEB 2IF7A 2OXHA 2XQBH 2YHGA 5TQ2L 1HHIB 3BZ4A 4L3EE 5IIEB 2LFGA 3ILPB 3BIKA 1WVZA 4ZO6A 1MAJA 1DLFL 3FONB 4GRWE 5EA0L 5IWLA 2MFNA 2DLFL 4EN3D 4OM1L 4P2QA 1N5AA 1ZGLB 4KQ3L 3N1QC 4U1KB 5CHNB 1N2RB 4J4PD 4PGEA 1QACA 5I75C 2RAMA 2QQQA 3FQRA 3QG6A 5M7QA 2Y36H 3HE6B 3IJYB 1K4DA 3QB7C 1YEIL 1QSEE 3GMQB 5IVXE 1ZVSB 1RAMA 5MHSD 3PDOA 3UTPE 4OCXL 3MBEA 4KTYA 2ZJSL 1RZ8B 3QFJB 3WFCH 4U4BA 1O5DT 1P6FA 4TUJB 4X4MA 4YXKL 5IROC 4JM2B 1MH5B 3MRKA 1WV7T 3ZDXF 1U95A 2RFXB 4XP6L 2E9JA 3MRCA 2AK4B 4NT6B 4X6CE 3HAEG 4KMTH 4WO4C 3MUGB 3MLTA 2P5EA 2AW2A 2OP4L 1NFIB 3HNSL 3B4NA 3FT4A 2IPTH 1AQKH 2DMBA 4CN1A 2ZSWB 2HTKD 4KMLB 3O11B 1CLOL 3CXHJ 4OKVB 1LE9A 3VMNA 5C8JB 3DUUA 3JTTB 4APQD 2F15A 4P23B 5HY9B 5F1OB 1FJ1B 3EFDL 5F3BA 2FDBP 2NTSP 3M07A 3WKNA 1NCUA 3P2TA 1INDH 4UQ2A 4RA0C 4R3SB 2NY2D 4YHKH 2R15A 1JPGA 3MXVL 2P46B 1D5MA 3BP5B 1J1PL 2AERT 1P53A 5LCVL 4X0KA 5C07A 1PYWA 4HUMB 5J9PA 4RGNC 3KXFA 1MCJA 2R1YB 3LQAH 3QI9C 1SY6H 3NOIA 5FYKU 4BJLA 1KTDB 2CLZB 4MJ2A 2X1PA 3GBNH 3AU1B 5I1GL 1FNSL 2HFFA 1QLEH 5F1IA 2G5BB 1QFWL 4JLRA 1DN0A 3VXOB 2DQJL 4FABH 1OOAA 1U0QA 3THMH 4KY1H 2W59A 3T4YA 1Y0LA 1J8HA 4X99B 3ESUF 2XA8H 4PFEA 5F6IC 3EJYC 4XPGL 5F71A 5AAMA 3UC0H 4O5LH 3RWDB 4LLMB 3MR9B 2JB6B 4KTDH 5IVZB 1SYSB 2PW1A 5DA4A 4ZMAT 1UEYA 3RDTD 4P4KC 4DGIL 2DIBA 2CRZA 2SEBA 3T0AA 5I8OL 4ZTOL 5HHXL 1RU9L 5D7IA 2X4RA 4PJIB 4QTHA 1JNLL 2D7PA 1XF2B 3S4SA 4K94C 1BJ8A 4MQTB 5DUBA 4Q6YA 5K59F 2X4QB 1S9VB 3BD3A 2GQHA 1B6DA 1YPZA 2VQ1B 3NCYP 1LE5B 1OTTD 3ZTNL 3ZSTA 2XPGB 3C08L 3QUZC 2X4TB 4WFFE 4M1CC 3FCTB 3T2NL 3KYOB 1SEBB 4M6NH 4O58L 1IVLA 3LKPA 1XF3B 3F7RA 4NQDA 4X8XA 1NBQA 4LQ1A 5D2LF 1T6WA 3IDMB 2ZCHL 1YC8A 4S0TD 1DQJB 3WS6C 2CIIB 1PX3A 4FQJL 3BEVB 3HE6D 3ARRA 1SBBA 2ESVB 5DHYA 3BFOA 3P4NB 5J6HA 3VXPA 1AC0A 1NDGA 4TSBH 4Z76B 3UMTA 1I9EA 3UYRL 3QFJD 2VLKE 4KI5D 4Z7OE 3QUKB 1QLFA 1T20B 2AJXL 3OAUH 3O4LE 2B5IC 3H0TA 5L8JB 3QDGB 2WIIA 4JM2D 1W72H 4OGYL 4YQXL 2ITCB 4YK4B 2HG5A 3I3BA 5IBLD 3KHQA 2AK4D 2OZ4A 2W65A 3VFGL 4ZSOB 1R3JA 1IAIL 2B4CH 4L3CA 4MAUH 2WWKT 3NCYS 3VXMA 2AJYH 3TT3H 2R4RH 3HI5L 4BZ2H 4P23D 5EIQA 1N0LA 3RWIB 4ZFGL 3L3HA 4ZDHA 4F7TA 2DICA 4Z7WA 5TE6H 3VWJA 4ODVH 4Z6AT 3EFFB 1GRWA 5DJDA 4JY4A 4WFEE 4NC1E 5CJBA 3NFNA 4TNVF 1K5NA 4N68A 1MVUA 1WC7A 4H8WH 3H9HA 4N0FA 4OUOA 4XAKD 4WCYH 3RWHA 1MF2L 4YK4C 5FO9B 3EOYG 4ZPVA 2O26U 1RURL 4HBQA 5BS0B 5CGMA 5IEKA 1MFBH 4Z0XA 5AZEH 3E2HB 1TJHL 4NN7B 3TJEL 4Y5YC 2GSIB 1LO4L 2XKNA 5BRZB 1OP3K 2D7NA 3JVGA 2V17H 4HJGA 1IGIH 5B3NA 4PJHB 5E2VL 2L0DA 3VDCA 3P9LA 1LK2A 4JREB 4G8FA 1JGDB 3V7AE 2CH8A 3TO2B 5ID0B 2OL3A 2YD9A 4HC1A 2DN7A 2OSLA 2VDKL 4WHTA 3AREB 2EE2A 4OZ4B 3K8LA 3MROA 5JR1L 3IJHB 3NCJH 5GRXG 1FL6A 4NNXB 1ACYH 3C9NA 5F7YC 43CAA 5J11C 2WQ8A 2FD6H 1KPVB 1U9KA 5DFTA 1MAMH 2PCPA 4M1DH 5IB5A 1KT2A 1ZT4A 4F7EA 3HNTH 1QSFA 1NBYB 4POZC 5BVPH 4XNMB 1HQRB 4WW2C 4FNLH 3LN9A 5CEZE 5CD5D 1KB5B 4HEME 3D0LB 4R4FH 4F3FB 3VDBA 3WS3B 1IT9H 1W0VA 2AJVL 4ZQKB 1YEJH 3WHE1 4GMSL 2NW2A 4LLAA 1EDQA 4F37F 2PTVA 4ZXBD 3IFNL 5C1MB 4X4ME 1FV1B 1R6VA 3OG6B 2VDQH 5D2LA 4Z0BH 1UWGL 4AIXA 3QIUB 3LEVL 1ORSB 4QHMA 2DMKA 4JG1H 3SGDH 2F19L 3FAXA 5CIPB 2CRYA 2AQ3A 5L7XH 1D9KA 5F72S 1G7HB 1FFOA 2JCCB 1A8JH 2ESVD 4EDXA 3RNKB 2OK0H 1F11A 5F6HJ 1INEL 3L1OL 3ILQC 3GK8L 2H2PC 1NFDB 1U8NB 3IJSA 4ZS7H 5ERWB 3G5ZA 3WKMH 5I74B 3QDGD 3VFTB 4OAWA 1P9MA 2A1WH 4UNTA 4X98A 5DS8A 4HK3J 4M62H 3A6OA 4JZJB 1BZ9B 2C3XA 1J5OL 4MXWH 2XZCL 5GGVY 2IADB 1J05A 3STLB 1ORQA 4XX1E 3HMWL 2VDNH 1KCRL 1U41A 4N8CL 4R0LC 3S35X 3EDKA 1S7VB 3MFFA 4WJ5B 5KJRH 1A02N 3PWUB 5I66A 3VFPA 3GSWA 4BSJA 1D7FA 1KJ3H 2GSGB 3VMOA 5IV2B 3W9EB 4WI3A 4JHZA 4NO5A 4DFHA 2R9HD 1M7IB 3LKOB 1WBYA 1F97A 1QOKA 4URTB 2X1QA 2Y1VA 5HGDB 3U9PL 3OR6A 1A7PL 1DBBH 4ZYKA 5D7LA 5SX5K 5JIHA 4BUHA 1N5YH 1FE8L 2EEAA 3RZWA 4DFIA 1MRCH 3QO1B 5BS0D 1IM3B 3HCVB 1AKJB 4U1JA 3TPKA 4UV7H 4E42B 2I26N 5DD3H 4GAYB 1Z3GL 3P30L 5TPWL 5BRZD 3BPNB 1B0GA 1I9JL 4U7MA 2CMRL 3G6AA 5CWSA 3U7YL 1IL1B 4U2ZA 2WUBL 4U3XA 3MCG1 1UCBH 2WW8A 2ZZUT 3HZMA 1BEYL 1UEMA 2VISB 2X10A 4JFOB 3MOBH 5E8NB 2A6JB 4HMDA 4EI5C 2PR4L 1C1EH 2DD8H 1RZKH 2VXSL 3B83A 3ZLQC 1DE4A 3B9AA 3ARED 3RL2A 2IQAB 1OGAA 2CDFB 3V6OE 3VFNB 1YPZE 4MD5B 4LMQE 4Z7NF 4G6KH 4RAUA 4XVUC 1K6QL 4M61B 1U2CA 4NQEB 4G8EB 1FL3B 3CMOL 3NZHH 3PQYE 5EBMB 2XKSA 2F5AL 4Z77B 4MJ6A 1A1OB 1LMKA 4XGZA 5I8EB 1A22B 1I8KA 4AT6A 3ARPA 2R1XB 3F7YB 3WN5B 2A2QT 4GRLB 2MPAL 4HXAH 1DQTA 3NCFB 3QJHB 2ITDA 5DEFA 1I9IL 2NTFA 3OGCA 2VXTL 4A2MA 2HFGH 4OZIA 3EKCA 2G2RA 4XMLL 3PDGA 3E6HA 1QFUH 3WFHB 4U31A 4UIKH 4CU8A 5ADOH 2KZWA 4JFEE 2P8LB 1J86A 4HWBH 1MCWM 1E4KC 1EUUA 2Z35A 1I7UB 2EIBA 4P9HH 1Q0XH 3GJEB 4PJ7F 4YXLH 4ONOA 4CJ1A 3QIUD 1L7TL 1NMAH 5D2NC 1CT8B 4LASL 1W2KT 5DJ6A 4HG4J 5GZOC 2VDOH 3B2VH 5DVNA 3K1DA 4PR5B 4X80H 1I3GL 4RFOL 1LO3H 1MQKH 3BSZH 3WN5C 4GKNB 5EORH 4JDVA 5C3LD 3EYQC 4RX4D 1EJOL 1RZIB 32C2B 2ZNXA 3VD3A 3CCHB 3WO3B 4KH2A 4TULL 3S3PA 3IB4A 2FIKB 4HDIA 4RMUA 4X6BA 4JDTL 3VWKB 3CLEL 2XWTA 3S96B 4KZEL 4OZGA 4NFBA 4K8RD 4MAYB 5TDOA 3G9AB 4Z7WE 1ERNA 1NCTA 5HPOA 3LOWA 3P9MB 1E6OL 3EHBC 2BSTA 5EOQL 4ZPTB 4BQBA 3GJFH 1RUPH 3RTQC 1ETZA 4S1QH 4N8VG 3GMPA 2PW2A 1T04B 1UYWH 5D7KD 4LSPH 3KPLA 4B7LA 2AEQL 5DD1H 1X4ZA 1YMHB 2XXMB 3HHRB 2I07B 5DVLA 1F4HA 4IS6B 3ULUH 4POYA 4M7LH 4H20H 3T3PE 4UTAL 1S8DA 3X14A 2YMXL 4Q9QL 1ZKAA 1CK0H 3SDDB 3S36L 4I77H 2DBLL 3QUMH 2AKRA 2VITB 2Q8BH 1FO0L 1P4LA 5GGSA 1FVEA 1RJLA 5BJTB 5FOJA 3G04B 3BIBX 3BHBB 1QBBA 4X83A 4WTZA 5IROA 5T3ZD 5IG7A 3QPXL 1MWAB 4HGWB 5BCAA 1AKJD 1LILA 5SV4A 4FFZL 1OLLA 4U1GC 4KUZH 3SO5A 2YA2A 3KHOA 1F45A 4PRHA 4WO4A 4QOKA 3W11C 4IHOA 1UXSA 1GGCL 5KVGH 3VXSB 1LO2L 3VFUA 8FABB 4CDGC 1U8QA 2Z31B 2GT9B 4Y16B 1Z5LA 2BX5A 3E3QE 1OB1A 5ICZB 3I50L 3D5OF 3GHEL 1UH3A 4QF1A 4YDIH 3GRWL 1D5XB 1IGCL 5FXCH 3GSNA 4D3CH 3CFCH 4LVOB 4G9FA 3MLYL 3ARYA 5DJ8B 4TUJA 4XMPH 4HKBA 4JKPL 5IHZA 2I9TB 4NQED 1ZSDB 1E4XH 2IFGA 5EUOF 1CZ8H 4LLDB 4NO2A 3GNMH 4L4VE 2MQ3A 5ITFB 4DVBB 4M4PA 1H15A 3H42L 4OLVH 3QI9A 4GRLD 1IAMA 3DUSB 5CZXC 3CFBA 1CTOA 1WBXA 4LCWA 1HXMA 3C6SA 3REVA 3ZKXB 1R5VA 3BZFA 3DO7B 2PYEB 1MJ8H 4HUUB 1JPFA 1A2YA 1NQBA 4Y1AE 2RB8A 2XG5A 1KJ3L 2DQFB 1ZHKB 1T0NB 4M03A 3WHE0 2GTZB 4PJ7A 5EOCH 2JK5B 2YEZB 2GJ6A 1K8DA 1FORL 2DDQH 5J3HD 1B6UA 4JFZL 5E4EB 1RQ5A 4OLEA 1HXYB 3FQXA 4MD4A 3MRNB 2DBJA 1FLRH 3MLVL 3QUYB 1F6AA 3B9DA 3WUWA 2WLYA 3CZJA 4U1SA 5JQ6H 2IPUK 3WFEH 2F74A 1H3UA 2PXYC 2WAHA 4KK9C 5IB4A 4P4KA 4HSQA 4NKDA 1KTDA 1SJHB 4OLXL 4RGMB 3OG4B 3R06B 5DD0L 2EYSA 5FYKL 5IVXF 1DBKL 3T65A 5EOCJ 3VWKD 5E6YA 1OW0C 5T1DL 1AO7B 4MAYD 5CAYB 1T2JA 3BP4A 3IF1B 1Q9LB 3K8KA 2ZUYA 5TE7L 1IC5L 1FZKB 5E94A 5FCUH 2EDBA 2KBGA 3D69B 3STZB 3L5WB 5FB8A 4ISVA 3QUZA 3UP1A 5DQ9A 3D39A 5H94A 3RX8A 1JNJA 2N7BA 1QRNA 4K7FB 3TYFB 1OCWH 2BVOA 3EYVB 1A7BA 5GGQL 4NKIL 4JQVC 5FK9A 3RGVB 3RUGE 3S37L 3QUYC 5A3IC 2HVKA 1T1ZA 4WEBH 5EC2B 2A0LC 2R0LL 3QCTH 3FN0L 2D03H 4FQLH 1U6AL 3WS6A 2E7MA 1I7ZA 3TJHC 2WK2A 1MCFA 3EJZC 1JJUA 3IETB 2AXGA 1FNAA 1NDMA 4LHUG 3SDDD 2MTPA 3O3UN 5HD8D 4QLRA 1DANU 3AS3A 5HGAB 4DN3L 3IXTA 3O3EA 1V8HA 2X89D 1F4WL 4HS3A 1T66D 4R90L 2FATH 3MRFA 5MHSE 4GG6B 5FOBB 1PLGL 2IBZY 1G6RA 3D25B 4WI6A 5EO9A 2EDJA 5BXFA 5GJSH 4UIMB 3QRGH 5HGBB 3VFOB 4PJBB 4NZRL 5I30L 1RZGB 4RRPA 3VXSD 4KK6C 1AI1L 3FO0L 2Z31D 1HNGA 1NLBL 5F89A 4Y16D 5DTFA 2BOCB 3D1MC 4GSDH 4ZFZA 4DVRH 5DT1L 5BO1H 1ES0A 2APBA 1PKQB 1KJ2H 1P7KA 1LDPL 1T1WB 5IMMB 3O2VL 4FQIH 2FRGP 1MCLA 2BSRA 1EEQA 4G7VL 4GKZB 4XZUA 3V52H 2CXGA 5D1XC 3AY4C 3WJJC 4AMKH 4RMRA 4TVSa 4JPKH 3P11L 1CGWA 3GSXB 4KJPD 2EZ0D 4EKXA 1I8MA 5GRZA 4X4XA 3FTGB 1EHLH 3QEGH 3D0VA 4X4ZA 5HHNB 3GKZA 4LPUA 3DYMA 1VKXA 3QAZC 2B8OT 4Y5YA 1I1YA 4KRPB 2CGRH 4KAQH 1CFVL 2LU4A 5GRUL 4R96B 4JZNA 5HHOA 2PYED 3I84A 4TSAL 2LU3A 4RGOH 1J0JA 4L8CB 5DEZA 1QP1A 3KJ4B 3I75A 2GFBB 3DX9B 1WIOA 4QTIH 3RBSA 2PTTA 3TWCH 1BX2A 4QRRB 1JZ4A 3RWIA 1A6TA 2D3VA 1G7LB 4GQ9H 3DXAA 4OZGE 3EO1A 1OP3H 2VDLL 2HN7B 5IHUL 5IB2B 4NCC2 1PVHA 3ROOA 5MEOB 1VADA 3ZL4L 1WIUA 3FT3B 4JDZB 3DMMB 3QUYD 3ZHKA 4YDJB 1HINH 3JV6B 3O9WB 1HI6B 1KFAH 2A0LD 2A83B 4Y88A 1WCQA 4K23L 4WWKC 1IGYB 3HZYA 5F97E 5FHAL 1CDUA 4LQFH 5C86A 4TUKL 1MJ7H 4KRPC 3ETBF 4X5XB 4F7PB 1BMGA 5F7EL 4RMTA 4WW2A 2L7UA 2P4AB 4Y4FC 3BAEL 4HFWA 3CK0H 5D93B 3JV4A 3J8F7 1BBJA 2LAAA 4Z7OF 1JHTA 4JR9H 5F7UA 3C60B 4G7YL 4HHAA 2XI9A 5SWSA 4ZFOA 1HDMA 1G9NH 4MJIB 2Q7NA 2KH2B 2HVJB 4RFNB 3S7GA 4PRID 3W39A 2CKBB 4KVNL 3GDBA 4KKCD 1XR8B 4RFEA 3I2CH 3QDHA 2UVEA 1U92A 4G8IB 4NRYB 3RGVD 5IGXH 4HPOH 5GZND 3O9WC 1CDYA 3QG7L 4I3GA 2BFVH 4NUJA 5J1TC 2CUMA 4OQTA 2QEJA 3V0VB 3CIQA 1C7SA 3IDXL 3GSVB 3P0VH 1T1YA 4R7NB 2BHYA 4OCLC 1MY5A 2APXA 5JUEH 2J8UB 3FZUD 3G5YB 4I0CC 5ICYB 1IAOB 1AP2A 4G5ZH 1X5LA 2ATKA 1MIML 2H6PA 3UTTB 4WI4A 3QFJE 3T0EC 2ZG1A 4KI5E 4PJFF 1A1NB 3QO0B 5DD5H 1FV1A 4AY0A 5HDQH 4R0LA 2BVPB 1HHHB 4HS6A 1JI1A 4NZTH 1EHAA 4ERSL 2AK4E 5CINL 2EH8H 3ZDYF 2Q86A 4PJCB 2V2XA 4R8WL 1ZE3C 5C0GB 4YXHH 2GAZB 5BOPA 5ESAB 2HJFB 5JOEA 1XH3B 3MRMB 4L4TB 2FJHA 3MJ8B 4QRPB 1MLCA 1U3ZA 4D8PA 1FBIL 2EXWD 4XRCB 5IFHH 5K9OB 3LS5L 3ZZ1A 3ARFD 1E6JL 2HRLA 4HWEL 1ZLVH 3UO1H 2GJ6E 1YNLL 4OD3H 2H26B 4XHJC 5C0EB 5L0QB 1CS6A 1ZANL 3MV8B 1N64L 5KSVA 4XAKE 4DZBB 4KRPD 4JN1H 4FXGB 5B39G 4E0RA 3HR6A 4DGVL 4KKLC 3WXWH 2HLFD 5SX5H 1JGVH 4PBXA 3B5GA 5SWZA 1KG0B 4JGUA 4M48H 4QRRD 1MIEL 1F3JB 3ALPA 2WLZA 3LKOA 2DQHL 5FCSH 4EI5A 2DKSA 3ARXA 3OR7B 4MD0B 3RU8L 2UY6A 1BQLL 2DMCA 4PJAB 2X44D 3G6DH 5DUPL 1YJDH 5D5MF 3HUJB 5MEQA 3DMMD 3TFKD 4Y2DB 3O9WD 5HJ3A 2AJZB 1EGJH 3LQZA 5FGBC 4XAWL 2YKLL 4P57B 4Y4HB 1S9YB 5E2TH 3W5MA 2Z91B 4NKOA 2X4OB 5D1QA 3SKNB 2BNRB 3MYZA 4LSVH 5I6XB 1CD0A 1C5CH 1QFWI 4CW1A 1IGFL 5C3TA 4YHLL 1NL0H 4KDWA 4RMSA 4MXVE 3RIAK 3C60D 5AEAA 1JI2A 4PJIE 2VISA 5F3HB 4DKEL 3U2SA 1LEKA 3IAGC 4MJID