3S97C

Ptprz cntn1 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
197
structure length
197
Chain Sequence
GYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase zeta
publication title A complex between contactin-1 and the protein tyrosine phosphatase PTPRZ controls the development of oligodendrocyte precursor cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 46
structure length 197
sequence length 197
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s97C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s97C02
5D7LA 1AQKH 3VFMA 4XC1L 1MFEL 4H25B 1NAKL 5JLZB 1BOYA 3MV9E 2KL6A 2OTWB 3EYUL 5HGAA 1FG2B 5JOEA 1CFQB 3MLYH 2XTJD 1ZWIB 1RIVH 5EIVA 4Q0XL 1MPAH 3VMOA 3WJLC 3MRKB 3P4OA 3MRFA 3Q6GH 3QCTL 3SQBA 3HI1B 4MAYB 1KB5H 2ZJSH 2NMSA 3ARVA 4PY8J 4NQEB 2CLZB 5DFVC 2VLKA 1MHEB 2AK1L 2ARJQ 2DLFL 3P4NB 5GS2H 3DUUA 4FS0A 2ED7A 3GJEA 4JO4H 2ICWI 1KXVC 2AQ3A 4M8VA 1U2HA 1U3JA 1BZ9B 2XQYG 4MDIB 2DQDL 3FQNB 5JOPD 4H8WL 2WIIA 1LEKB 3MA7B 5E2UH 3V52L 3B5TA 2XZAL 4Y5XB 3B2UC 1CGYA 3KDMB 1H3PH 1I3UA 2FX9H 3DV6B 2XY1A 4UOJA 4UNVA 1MI5D 5D9SB 5HGHA 1Q0XH 4P46B 4OLZL 4KKLC 1T89A 1OPGL 1J8HA 4U6YA 3F6LA 4HC1A 4R9HA 1UWGH 4X4MA 2DQHH 3MYZA 1JYWA 5MEOB 1DBBL 3MFFB 3BGFB 3CFBA 1JPST 4WHCA 3TA3D 5I74C 3JWOL 3L3IB 4KRNA 4XGZA 1B3JA 2LAAA 3SDAA 1WAAF 1OAZL 1I85A 3ZTNH 2KH2B 4HWBH 2XYCA 4QEGA 3ZKQD 2GW5A 4MHHI 3JV4B 3STLA 1QZ1A 1YEJL 4PV8B 5F7WC 4LU5H 4G6AC 3ULSB 2IAMD 3FO9B 3BZFB 4QY8B 1J1OL 1YEIL 5FDYA 3MRNA 5ACLA 2FDBP 4QXGL 3WJLA 1TITA 5D6CA 4OTXL 1ZMYA 4F3FA 4ZTPL 3AREA 1FYTB 5BXFB 3V4PH 1YZZA 7FABL 4ZAKD 2MNUA 4FQCL 5FYJU 2NTFA 5GHWL 2I60L 3D39B 5TDNA 1MF2L 2DIBA 2FZ3B 1ND0A 3VXUE 3MUY1 4K7PX 5INCB 5HI3D 3O3AB 4WFFE 3BQUC 5D7LD 2X4RB 4NZRH 1I1YA 5FGBC 1F8TL 2HFFA 3CVIH 4NWTL 3VWJD 2XG4A 5JORB 3MRBB 3OZ9L 4X80L 1DE4B 1PLGH 1NCTA 1UB5B 2D4DA 5E8OB 1NEZG 4OFKA 3A6CH 5GJSL 2MKWA 1AC6A 4P2QE 1A4KB 2XACC 1A22B 1P1ZA 4G43A 5FYKE 1S7UB 1LVEA 1KTDA 4MD5A 3QCUH 2OL3L 4YDJA 3SCMA 4WUUB 4KZEH 3WIIL 1CLYH 5T3ZL 3T65A 3K1DA 3TT1L 2VLJD 3DGCR 3F6IA 1C5DB 3V5DA 2VLKD 2MCPH 5DYOA 2IMNA 3R06A 4Z5RB 1RUML 4NJAH 2O5YL 3IB4A 2NLJA 5JZ7C 1NCCL 2AEQL 4KK8D 3ZKMD 3E8UL 1GJIA 1YEFL 3IJHB 5ETUB 2V5MA 1WVZA 4M8QA 4G8GE 4HIJB 4XH2B 1UC6A 1KT2B 3VXQA 1L9MA 2BHZA 4JFED 4MJ4A 4MQSB 4MYWB 2F58H 3L6FB 1J8HD 2VZ1A 5I75C 3G6JA 5EH1A 3V4VH 4Q7DA 4DKFL 3LKPA 2W91A 4X6BA 3VFRB 3C8HA 4RDQF 4JR9H 4ODHL 3A6OA 4K94H 1AC0A 4JB9L 3MUGA 5CSZB 4HIEB 5CMAA 1YECL 3FQRB 4L3AA 2IBZY 1KENL 1MWAB 4HH9A 3O8XB 3C6SB 4YQXH 5BQ7B 5JPNB 2AJ3B 4EZMA 3I75A 4BH7B 5B8CC 5SX5H 2CIKA 4Z7NF 4XVJL 1G1CA 4OZIF 4R97C 4RFEA 1A2YB 2BY3A 2YPLD 4L3EB 1OSPH 3UTSE 4JZJA 1QFWH 4AEIL 3ARED 3V5HA 5T5NF 3G5YA 5F9DC 5DRXB 4YC2C 5DFVD 3MLRH 1CG9B 3QEHB 4G8EB 4NRXA 3EBAA 1IC4H 1U3HB 1RJZB 1HXYA 3CC5A 3MLZL 5EC2A 2X1PA 3LIZL 4MGXA 4DCQA 3S37L 1JZ6A 4M1DH 3TBTA 3GSVB 3KNBB 2GTWA 1MCNA 5T3XD 1FNHA 4NHUB 3B2UD 2QQNH 2RJMA 2W0FB 1B2WL 3LHPH 3EHBC 5IB3B 1F5WA 1KV3A 4HWEH 1JUFA 5C0EA 5EO9B 3U7YH 1SHMA 4KKLD 2VH5L 4LRNL 5TH2B 3KLAA 4Z0XA 3DO7B 2R29H 5IB1A 4OGXL 4CVZA 3FAXA 1MWAL 3QXTA 3WCYA 1MOEA 3GSRA 1R5IB 1A6TB 5CJOL 2DJ4A 1KCUL 2O5ZH 2FIKB 4OBRA 1XGPB 5DK2A 3SN6N 5IEHB 1IGMH 2EDNA 5AZ2L 2KQNA 1KPVB 2J3SA 2FO4A 2AW2A 4ZYKA 4APQA 1IL1A 2V2TA 2ICWJ 2FJFA 1OT1A 1JN6A 1A9BB 1RZGA 4IMLB 4G6AD 5B8CA 1LO5A 4QHMA 3N1FC 4GG8A 1S7XA 1YEDB 1HOCA 2HAZA 2V6HA 4E0RB 1EPFA 2CIIA 3FAWA 2YBRB 5JQHC 4QRTA 3VFPB 5C0GA 3P2TA 1AGDB 3EFFA 3B5HA 4ISVB 3VD9A 3L5JA 4FQ1L 1X3DA 5LAXA 4P9ML 5ID1B 1T0PB 2JCCB 3C2SA 3C8KB 1SEBB 4P2OB 1UWXK 4TRPH 3CDCA 4V2BA 2PXYC 3SPVA 1OAQH 4IDJL 4PUBH 3BQUD 1NGZB 1GC1C 4O4YH 2Z8WC 1RURH 5D1QA 2OR9H 2VAAB 1NMCC 1D5IH 1JHLH 1NUNB 3FB5A 5DJ6A 3WFBH 2D03H 4QCIB 5GGRB 3BGMB 4YHZH 3OGCB 4ZNEA 1Q9LB 43CAA 2GK0A 4LVNB 1YYMH 4KHTH 4MXWH 3RBGA 3C2AL 1BBDH 5EN2B 1ZT1A 1MAMH 5C0IB 4LSUL 2FATH 1A6UL 1CU4L 1RU9H 3U2SB 4K55A 3SDCB 5HVHB 5ICXA 1CFNA 3QIWB 5E5RB 3CZJA 1K3IA 4LGPB 3ARTA 2WINA 1P4LA 3GMLB 3E0GA 3TO2B 5JZ7D 1EGJA 2NTSP 5DJ8B 1IQWL 3UTSB 2Q6WB 1ONQA 1NPUA 3VH8B 1EEUA 3CDYA 4HKBA 4RFNC 1S9YB 2EDBA 1INEL 5I8EB 3RHWK 3DYPA 4UNUA 3SE3C 1GAFH 3O3BA 3T0EE 4XNUH 1ZLWH 4OBSA 2P24B 15C8L 1T1XB 2X10A 1FNGA 1NAMA 4X6EB 4ONOA 1MJ7H 2C9AA 3C9NA 4JRYA 3MRMB 3P9LB 3UAJC 1FIEA 5DRNA 2AVGA 1ZVSA 3G04A 5J6GA 3V0AC 4MLSA 4MMZC 1K5NA 2PYFA 5FUCC 2GEEA 1NDMA 4HKXB 4PJ7B 1I7TB 1MCLA 3VRLF 2Z93A 1GHFH 1MJJB 5GGRY 1B0RB 5J9PB 3QJHB 5CUSL 4DTGL 3FQWA 5DD3H 4M48L 2CDEB 3C09B 2HH0L 1LP9A 1EHXA 4W70A 4YBLC 1ZEAL 2MFNA 3OKEA 1EEZA 5LCVL 3N1MC 1U8OA 1AQKL 4OQTA 3S98A 3NCJH 2Q20A 5IOPB 3HC4H 3NGBC 4JO2H 5D96C 1TFHA 1CE6B 3E6FB 5H35B 3MLYL 1JI2A 1XCTA 2FGZA 3T3PF 5EBWA 3ZKNC 4JEGB 1F58L 3KYAA 4NGHH 1HI6B 1Z3GH 3QDME 3P77B 3VI3F 5C0DA 3NAAH 3UROR 2PYEA 1L7IH 2ZJSL 2V17H 2ZCHH 3FQUA 1DN2A 1CDHA 4JFFE 3N50A 3EHBD 5IMMB 3T8XA 4XAWH 3RU8H 3ZT5A 4JO4L 5IVXF 2EC9U 1EZVX 1F45A 1R3IL 3HUJA 1NC2D 4C55A 2BVYA 4Y4HC 4TPRH 3U1SL 4KRPC 4Z9KB 3ZSSA 3PQYA 1ZVHA 4MB4A 3MOBH 4JN2A 2FX9L 4QHKJ 4Q9RH 3EFDH 4M03A 4XZUA 1Q0XL 2C4XA 1J0IA 4PRHB 5KVEL 2HJLA 1XIWB 5ISZE 1EFXB 4Z7UF 3HPLA 5MENE 5FHBH 1FFOB 3EJZC 2Z8VC 4N8VB 4NCC2 4P4RA 4BSWA 3QQ3A 4OLWH 4MCZB 1CD0A 4GMSH 3IFOB 3GMPA 3QFDB 4IOFC 5KSAB 4YHOH 4W4OC 3RWHB 5KVGH 3WKNA 4HWBL 4UINH 4HJJH 5B3JF 3CK0L 5IM7A 8FABB 3IAQA 3L3DB 3HNSL 1T22B 5KOMC 5C0JB 1RJLB 3B4NA 3I3EA 4LU5L 4KZDL 5JTWA 3LKQA 1SBBA 3HZKA 5HGDA 4X6CA 2PXYD 1FCCA 1LDSA 4U6HA 1CLZL 4CL7A 2FBJH 3OR7B 1VFAB 5DVLA 4R4BA 3V4PL 2XZQL 3RZWA 5T1DH 4MQTB 5HYJB 5EU6E 3RWFB 2QR0A 2HLFC 3VXOA 3QZWB 6CGTA 2BNUB 5I76A 2YOCA 4PP1D 4FNLL 4IM8A 2IPTH 4LDEB 2X4SB 4PJXA 1EHNA 3PWNA 2OM5A 4ZUVB 1Q9KA 3GIZH 4NZRL 3MJ7B 3CVIL 4MZ2A 2ZUVA 5M95B 2NNAB 1PLGL 3CFJA 3VE0A 4K7PH 3HI5H 1AXIB 3L5XH 1Z6JT 1T4KB 2W60A 1OSZB 3VFNB 3HE7B 3QCUL 1GGIL 1I1RA 2HRLA 3BFOA 3QDJE 4JZNB 2PYED 5B39A 4KZEL 5TJWK 3RDTB 4AM0A 4HG4J 4NO0B 2MCPL 2B7DT 3H7LA 3QH3A 1B6UA 1MFDH 5CBEA 3EDFA 4NJAL 3BHBB 4LLWB 4W4OA 5F70A 4D9RE 1M7DB 2X9WA 3UAJD 3NFPA 3PQYD 3S88H 1BQHG 5SWSA 2VISB 3DSNA 2AEIT 5HHOD 3QAZC 3TBYB 3QEGH 5D7KE 1P4IH 3KYOB 4QHUA 4ELMA 2M26A 2SEBB 2F58L 5FEBA 3ELAT 4IRZH 3V4VL 5ACZB 3OXRB 5EU5A 3QT2A 4L1DA 4NKDA 3OX8B 3WUWG 2IGFH 4JR9L 1U8JB 3QWRA 4K94L 2EECA 4G7VH 2CKNA 4GMTH 5F97E 4XVSH 5F7LB 2ENYA 4F57H 5I17A 1FL6B 3SGJC 2ATPB 4OGZA 1QBMH 5BS0D 2IALA 4TN9A 3MRIB 2CLRB 4YQXL 1T83C 2GJZB 3T04D 4OZHA 2XWJA 4X8XA 1U58B 1JGEA 4U1MA 3KLHC 3RY6C 1TVHB 3VGDA 3BDYH 3ZKND 4N5EC 3JTSB 1DL7L 1OSPL 4OLUH 3BPNB 4NKIH 1QFWL 2YD8A 3SY0A 1D5ZA 1MIEH 5FYJD 3GMOB 3GSNB 4FQPA 2R0ZL 4QXTA 1SEQH 1A02N 3MLRL 4GQ9H 4OCNC 1OTTC 5CP7A 2V5YA 1L4IA 5I2IB 1IC4L 3I50H 3NA9L 1S7WB 1ADQH 4L3CA 2DQGH 4Y4HD 3KXFA 4M1DL 4KRPD 2X9XA 4I2XE 5DTFB 2QQNL 2X4TB 1HILA 3LHPL 4HKJB 2R23A 4K9EH 4L1HA 4M7LH 1J8KA 1AXTH 1FFNB 3TN0B 3BKML 3U7YL 1G7MA 3QG6A 2DJSA 4KI1A 1OOAA 4JFZH 2R29L 2A6KA 3O6FB 3NIDF 1JMZA 1PSKH 2IPKB 1IM3B 2FJHA 2J8OA 3EJZD 4F7EA 2H26A 2O5ZL 4LCUB 4BQ6A 2NY5C 4ZQKB 2AJSL 4WEBL 2ZOKA 4G6FB 1IGML 4KROC 4IOFD 4U1IB 1IKFH 1NGYA 3O3UN 4Q9BA 3SGJA 3EW3B 2DD8H 1F00I 4U0QB 5D2NC 1I7UB 1U91A 4LBEB 3JXAA 2PKDA 2DWDB 1MFCH 4PRPA 4WWKC 3M17B 1L6XA 3DUHA 2MOVA 2MKLC 3AS3A 2W07A 1ACYH 4NRZB 3T4YB 3KPSB 1QLFA 1VESA 2E27H 2C3XA 1U8QA 1OCWH 1EAPB 4OGYH 4EI6A 2R2CA 43C9A 5DMIH 4KC3B 1H3WM 1DQQA 4HXAL 3RUGB 5B38G 3VCLA 1FZKB 3QWOB 4I4WB 1MCSA 2CKBA 3TO4B 4OI7A 4D8PB 4NYLB 2HLFD 5J1SC 4TRPL 3SE8H 4R96B 1YN7A 1CQYA 3QRGH 1OAQL 3T3ME 2AQ2A 4PUBL 4MD4A 2KDGA 1MIML 2N7BA 3HC3H 3B9KC 4X7TB 3WN5B 3ARPA 4O4YL 4HCRH 5J89A 3UPRA 1RURL 4MNGB 5E8PB 4B5EA 3I6GB 2OR9L 5KVMC 1JHLL 3WFBL 2IANA 2D03L 1RFDH 4YHZL 1AXSA 2V5TA 1J1PL 4ORZC 4Y88A 4P4KC 2CUMA 1ZOXA 4QTHA 3IXTB 1H3VA 1RK0A 1YYML 3B9EA 4KHTL 4MXWL 4P2RE 5BMFH 1BBDL 2Z35A 4RAHA 4YEFA 1JWSB 3WXWL 4L8CB 3W9DA 3CAFA 5IV2B 4GBXB 1AGBB 1MAML 1U8NA 1IAOB 3ES6B 2MSPA 2FATL 4U7KA 1P7KB 2AK4E 1RU9L 4LK4A 4AQOA 5FO8A 3FO1B 3H9SA 1G9EA 3E2HC 4JKLA 4WV1C 2GTZB 2P8MA 5EOTB 1X5HA 5DEFB 4ZUWB 3PL6B 4ODXB 4MWFB 3MV7A 1BVLA 2BJMH 1D5BB 1GAFL 2R4RL 4XNUL 2YN3A 4U3HA 4JCLA 4OZIE 1MJ7L 2CDFA 1SYVA 4U2ZA 4PRBA 1Y18A 4I13B 3NBNA 4I2XB 4L8DA 4QXWA 4P2YA 5FM8A 4XBPA 3S9DB 5DHYA 1SJXA 1VGKA 1NC4A 4X4YB 1Q9OA 3ARBC 2BSRA 4WEMB 1T7VA 1SYSA 4X9GA 3B9KA 1GHFL 3LPFA 3ZE1E 4F7CA 5HHNA 4CU8A 5IROA 5DD3L 1T1ZA 1FYHB 3QDGB 3KLHD 5J7CC 5EBMB 4BZ2H 4P4KA 2JB5H 1AE6H 3VRJA 4RRPA 3EOAB 4N5ED 1T0NB 5AWNH 2UUDK 3NCJL 3SE4C 3HC4L 4JO2L 1OTTD 4R90H 2EYSA 1I8MA 4KTYA 4LKCB 4XPAH 3B9VA 4QWWC 5MEQA 4NGHL 1J7VR 3EYVA 3TEUA 2YEZA 2PTVA 4Y8AA 4ZUUA 3NAAL 1MCWM 3WIFB 2IC2A 5DEGA 2V17L 3TVMB 4P5KB 4Y19A 2IAND 2I9LA 4FQXB 5DK3A 4XAWL 5T1LB 2ATKB 3RU8L 5CEZL 5HHXH 1IEBB 3ROLA 2CK2A 2A6IA 2LU4A 1SMAA 3O11B 1QSEE 1PBYA 4TPRL 3P0YL 5C0CA 3GSOA 5IIEA 4Y16C 3BUYA 3CDFA 3MOBL 4H1LH 5F3HA 1BOGA 4JAMB 2ADIB 1WT5C 2D7QA 1NDGA 4OF5A 4X7CC 4Q9RL 4KROD 3EFDL 2ZSVB 3OKMA 3ARBA 1OD7A 3AUVA 1BLNB 1L6ZA 2AJUL 1M7IA 5E6IC 4LSRL 1MLCB 4P2RB 5FHBL 5HBBA 1MCKA 4WWKD 4RGNE 5ANMB 5IMLB 2C1PA 3MV7D 5KZCD 1G7PB 5CHNA 4OLWL 1UEMA 1N59B 4GMSL 1OLZA 3O81A 3GSQB 1A6AB 1J0ZA 4LLDB 2GSGB 4XAKE 1JWUA 4YHOL 2WWKO 4DK3A 2HJFB 5CCKL 5IFJA 4UINL 4HJJL 1SJEA 2FL5A 2F53B 1QSFE 5I1LB 2LTQC 4M5YH 5DK0B 1HQ4B 2BNQB 5E8EB 4G8FA 2EYTA 2DWEB 1JZ4A 2AJXH 3CFDA 3LN4A 3ULVF 5E9DA 4M61A 1KC5L 4WI4A 3CSYB 2F74A 1UT9A 5CP3A 2FBJL 2AJZB 3B9KD 3RX7A 3BISA 4NC1E 1A1OA 4XNZB 3TYFB 5T1DL 3MX0A 3DRTB 3EDKA 5EU4B 1IE5A 3WE6B 4P4KD 1H15A 2IPTL 1XGTB 4YHNA 3GIZL 4NN7C 4Y16A 3SKNB 5GS1B 5SV4A 1PZ5B 3RZCA 3VXNB 4QNPE 5IW6A 4DN4H 4K7PL 1RJYB 3W9EB 3HI5L 1HCVA 5D1ZC 4WCYL 3L5XL 5J4MA 3QA3A 3T1FA 4JJHA 5DVKA 5C08A 2AXGB 2QSTA 5E6IA 4D0DB 4K7PY 2H3NB 4MNQA 2ADFH 1CD1A 1MCJA 5DD5H 1YY8A 3MRJB 1TIUA 4QRPB 3G08B 1V3KA 1EBPA 4LRIC 4N1HB 5DZLA 4J3WA 3GFUA 4J7RA 1MFDL 3RY4A 5BOPA 1H8NA 3LKRB 1M05A 3NFNA 5HHQB 5DJZA 1GGTA 5FA4B 5DJXA 3B8SA 1WCQA 2EKSB 3S88L 4R0LB 4YLQT 5GRJH 2J8HA 4OAWA 1G6RH 3P0GB 3BPLB 1W0WA 3QEGL 3WKMH 1P4IL 5JXAH 5EIIA 1I7RB 1FVCB 5BRZA 4LCWE 4RGOH 3QUMA 3ARBD 3T3PE 4OF6A 5GRVK 4IRZL 5F88B 1QSEB 3BDXA 2Y36H 4Z7WA 4OKDA 3FCTA 3EOYG 1QFHA 1NCWL 5JOFB 1ETZB 2IGFL 3V7MA 2HWZH 4G7VL 4MCYB 3VFWB 4IIQA 4XVSL 4YUEL 1HHHA 4F57L 5HYSB 1JF1A 2DQEL 4ZPTA 1QBML 1YPZF 1NGWA 2OJZH 4RGMB 5IVXE 4O5LH 4WI6A 2CXKA 1IGCH 4KHXH 1MCIA 2VDOH 1J18A 5C92A 3C5SA 4PTTA 4RGNB 1KTKE 2YD5A 4Z76B 5D1ZA 2WBJC 1SY6A 1WCBB 3BDYL 3QNZA 4N1CA 4QWWD 5E8NA 1N5YH 4NHCH 3O2DA 3BP6B 4AT6A 3ZYZA 3L5WA 4NKIL 5J06A 4XB8A 4Z7UE 5CKGA 1MIEL 5KTEL 2FHBA 1JNHB 1DQDH 1CD8A 3LSOB 4GQ9L 4LRIA 4ZFOB 4PJ8A 4GXUN 4V1DB 2BC4B 4CADA 5DJAA 2A6JA 2I26N 2ZUWA 1HE7A 3TWCH 1ADQL 3BSZH 4HQQH 1G7IB 5B3NA 4Y16D 2OLDA 1KJ2A 2WP3O 2XFXA 4QHLB 5B3JE 3S5LB 4ZXBB 5L2KE 2DQUH 2YD9A 4ELKB 3BEWA 3LCYA 2Z9TA 4K9EL 4O9HL 4M7LL 1AXTL 3Q48A 4WU5A 5C08D 5E6ID 1RUPH 4OZGA 1PSKL 4EQ2A 2R2BA 5FAAA 2EDEA 3MRLA 1F3DH 3IDIA 1AHWC 1J86A 3LQZA 5C07E 2F5AH 4X5XB 1FZJA 1IKFL 4PJFA 2DD8L 1KTLB 1ZHNA 4WTZG 2X05A 5TE6H 2YD6A 3DX9A 1OGAE 4PB0H 4XCYA 1CVSC 4FQ2H 2ZOLA 3PDDA 2CSPA 1ACYL 2AQ1A 4X8JA 3UC0H 4ZFOL 3P30H 3E6HB 1KIRA 1HN1A 2E27L 3C6LC 5SWZE 3UZQA 5DDHB 2WUCH 1OCWL 5DUPL 5HHME 4OGYL 4LKXB 1N64H 4F2MB 1FLRL 1ZLVH 1BBJA 2W9EH 1E28A 3TIDA 3L3HA 3LKSB 1P4BH 2D0HA 4Q9QH 2HN7A 3SE8L 3ZKXC 3Q3GA 1CDBA 1LP9F 3PABA 3QRGL 1A47A 1TZIA 4MJIB 1U3YA 4I18C 3HC3L 2VDPH 4AIZB 4X4XB 3GMRB 4HCRL 5EOCJ 3RA7H 4EKXA 4CGTA 1UCBL 3RNQA 1GSMA 4HGKC 3MLWH 4I9WD 1RFDL 5D1ZD 1IGIH 1EUTA 4LP5A 4EN3C 3I6KA 2MQCA 3GB7A 3RP1A 1KEGH 3H0TB 1RY7B 4JDZA 5IVXB 3L3OB 4CW1B 2AI0H 2CUIA 1AHWA 3S4SA 1Z0MA 5IMOA 4RSVA 1CICB 2YXMA 4ZO6A 1R3JB 3PJSB 3CXHK 1X5JA 5IBUB 1A6ZB 4OD1H 2YD1A 3S35X 4JFQB 1I4FA 4JO3H 4LSQH 4Z7UB 1G7JB 2JB6A 1EO5A 5DQ9A 1KPRB 4NSKA 4GG6A 3C6LA 4U33A 3VFUB 3DMMC 1A1MA 2F54A 2XTJE 2HA1A 1P6AB 1KG0A 3TCLA 3VXRB 3FRPA 1F4XH 3QG7H 1F3JB 1IEHA 3KJ4C 4AEHL 5FGCE 1KBGH 1HHJB 1PKQE 5K93A 1K8DB 4L8SC 4HEME 1FL5B 5IBTH 3AM8A 1OWRM 1DVFC 3BW9B 5T3XH 2Z31B 1BIIA 4NIKB 2VYRE 4M7ZB 3MRCB 4PS4H 4UV4L 4KKAC 1KIPA 4H1LB 5TGBB 1FORH 3T4AA 1XH3B 5JOPE 3VFTA 3RWGB 2EE2A 5FCSH 1YUHB 2WBJD 25C8H 3MNZA 4BZ2L 5C07B 1HHIA 2P8LB 2JB5L 4Y0GA 3F58H 1AE6L 3TH3T 4GLRI 4QRQB 4X6CF 1MI5E 4DKDC 3BZ4B 1AO7A 4OCRH 2APBA 1I9IH 2P5EA 2H41A 3NIDE 3VH8G 4AENB 1WIOA 4P23A 3IXAB 4R90L 4KWUA 4WHYH 4XPAL 3MJGX 1H8OA 1N0XH 4PP2A 1JPFA 3HRZB 4BUGA 4PJXF 2J8UF 4XPFH 1ZLUH 4EI5A 1EXUA 3U0WH 1J1XL 2G2RA 4BFIA 5IWLA 1WZLA 5FB8A 1WBZB 2Y7QB 5HHXL 4O2FB 4CMHC 3UJTL 4NKQB 5KN5B 4XX1G 3X3FH 4C56D 2EIZB 5J8OA 5CJ8A 4Y2DC 4X98B 5IB2B 3MUZ1 4PY7B 1TPXB 4M3KB 2OL3A 3U48A 1ZHKA 1B0WA 3M8OH 2VXTH 1QO3B 1IC1A 5T33H 4HUVA 3IT8D 1EZVY 2C7UA 3ZE0E 5I0ZA 5F89B 2B1AL 3HE6C 5DR5H 2YSSB 5JDSB 4NQDB 4KUCF 1PG7W 4HX1B 2X7LA 1BJ1J 3VGEA 5D7LE 2DM7A 3DURA 4MB5A 3GSWB 3QEQD 3C6LD 4GAYB 2ADJA 5BXFA 3D85D 5H2BB 2YZ8A 2F54D 3DX6A 4ELMF 1MH5A 3QI9C 1FIGH 4QOKB 3VGGA 1NFIB 3LAFA 4X0KB 5JHDB 3WFZA 4M5YL 4S2SB 3AS1A 3VJ6B 2VDML 1A9EB 1ZA3A 2IPUK 3QNXB 1GIGH 4OZ4A 5L8KB 2AJXL 5ERWA 1FO0H 2QKIB 2VLJE 1FDLH 5D5MA 1V5JA 2VLKE 4KJYA 5DFTA 2XTJB 1EIBA 4S0SD 2IH3B 3BP4A 3MO1A 4K8RL 3DBXB 2UUDH 4OZHF 4EN3D 3HPJB 1S9XB 4QYOA 4RAVB 1XF4B 1DN0A 1RQ5A 5GIRB 2D4FA 3MV9A 5DJCA 3SBWC 1S5HA 1UKQA 2P5ED 2EH8H 4JFEE 1U9KA 4Y2DA 1J8HE 4ORGB 1DSFH 3PDOA 3CPLA 3GI9H 4H26A 2GT9A 1XF2B 1MVUA 4X4ME 1P7HL 3RWIB 4KRMB 1BQUA 3AB0C 2A6DA 1A6VH 1C12A 2ADFL 5DVNA 5DD5L 5J3HC 4YFEA 4JJ5A 3WYRA 4YR6A 3B3IB 3QUYC 2ICCA 1PY9A 3I02A 4KQ4H 5D7SH 1QR1A 1P2CA 3NCEB 4G7YH 4GRLB 2EYRA 2Q86B 4UUJB 3DMMD 3WLBB 1IM9A 3QI9A 2RGSA 2ZCKH 3PE9A 2VIRB 2YWZA 4P2CG 1TQBC 5HSFA 3CU1A 4M4RA 4NT6B 4J3SA 4EUPH 2YPLE 3H7BA 4UILH 3QUKB 2LVCA 2NY2C 3HCVA 3QZWG 1DVFD 1JHKH 3NCMA 4OFIA 2VB5A 3ECBB 3U36A 2G5BB 1F6FB 4ZSOA 4XRCA 4MLIA 4LLYA 2Y36L 4G42A 3D69B 4KKAD 4XCNA 1FJ1A 5EFIB 3SDXF 3F7VB 1KFAH 4HF5H 4HZLB 5FHAH 4NUJA 3Q2CA 4OT1H 1LWRA 2HWZL 3HZYA 3G6AB 4HS8H 3ILPA 2L0DA 4ZAKB 3OF6A 2XXCB 4JVUA 2OJZL 3SBWA 4O5LL 4QRUA 1DBJL 5I8OH 1IGCL 4KHXL 3OQ3B 2Q87A 3F7RA 3CDGB 3G5XA 1YQ2A 4Q6IC 5D7LB 3VFMB 3DVNA 1N5YL 1U8HA 4NHCL 1J0YA 4WEUD 5HGAB 1YEKH 4F8TA 1T04A 1YMMA 3O3DA 5JIKA 4F37K 1NGQL 4HXBH 3QUYA 3ULUC 5AEAA 4KMLB 3P4OB 3VXUA 1NAMH 3MRFB 4XP4H 4ZODA 2FR4A 1RUAH 3TESA 3I85A 2VZVA 2Z8SA 1T1WA 3TWCL 4OFPA 4J6RL 3BSZL 4HQQL 2VLKB 3MV9D 3PXHA 3DUUB 1XR9A 3GJEB 4XXCC 4Y2DD 5JIPA 4WO4C 4X9HA 3L3JA 4P2QA 5F9AC 1NL0H 4DKEH 1GC1H 2WIIB 1JVKA 3EZJB 5MEPA 1RUPL 5CWSA 1R0AH 5K33A 1JZ8A 5HGHB 1JGUL 1RK1A 3WD5L 4B50A 3HE6D 4R8WH 5GGQH 4ONGL 1I1FA 5FXCH 3IS0X 3RTQC 1J8HB 5J13C 2UZXB 4F80A 3IS1X 2F5AL 1CXIA 2Z4QA 1KJMA 3QI9D 2E7HA 1CIDA 4ZPVA 1MCOH 3CFBB 3NCYS 5TE6L 3AGVA 1LEIA 4PB0L 1MY7A 2BRQA 3QIBC 4G8GA 4JM2A 4MS8C 4XGZB 4FQ2L 3P73A 1KYOJ 2JJTA 2D31A 4GUPA 4U6VH 3SDAB 2FX8L 1TNMA 4JY4A 4WFGD 2OYPA 3RIAK 3UC0L 4LLQA 1A6WH 2EIBA 4PJAE 3U30C 2WUCL 3STLB 3CJJA 3GMQA 1MQ8A 4I3GA 3D87B 5FO9A 2COQA 1N64L 4FZEH 4ZO7A 1CQKA 3MRNB 4WTWA 5C3TA 2ARWA 2F8OA 5D6CB 5HHVL 1P4BL 4F3FB 2ZUQB 3AREB 5J1AA 4Q9QL 4FQLH 1I8LC 2R69L 3QFJA 3C60C 2NTFB 3QO0A 5KVFH 5LG1A 4M62H 4AY0A 5TDNB 2BXYA 5C0IA 2VDPL 1OY3B 1ND0B 2HRPH 2FNBA 1HYSC 5FF6A 3MLWL 1FNLA 1G7LA 5KOVC 4AJ0A 1VENA 1IGIL 5GSRA 3TO2A 1I1YB 4J4PC 5FK9A 4YJZL 4V2CB 5IJKC 2XZZA 2HFFB 2JELH 4IEFB 2AV7A 4UV7H 4HPYH 1YMMD 3EOBA 1YJDC 2BVUA 5J3HD 2AI0L 1K85A 2VXSH 4HFWA 3QUYD 1P1ZB 4G43B 3LVEA 4MD5B 1KTDB 2BZDA 2J5LC 4LLMA 4PJ5A 4WU7A 4EXKA 4YDJB 5FM5M 3SCMB 4ODVH 4OD1L 1KB5A 4WIQA 3ZT7A 3CH1A 1F4YH 3T65B 1QOKA 3KYKH 3V5DB 5CJXA 3H9HA 4JO3L 5DYOB 1KN2L 3RKDC 1YPZE 1KELH 1CGWA 5C70A 3R06B 4U05A 3FRUA 3UYPA 3KYMA 2NY2D 3S35H 2G60H 2X70A 2NLJB 5FYJH 5AAMA 5HJ3A 4F37F 3IETA 4M8QB 5DUBA 2A83A 4OD2A 4XP5H 5DRWA 3VXQB 1WIPA 1F4XL 3QG7L 4X7DC 5FDWA 2OXGA 2VTFA 1KXQE 1KBGL 3G6JB 4RAUA 3LKPB 4X6BB 1I8LA 5T3XL 3OAZK 4YHMH 4TSCH 5IB5A 4ENEC 3LEXA 1FH5L 1CE6A 4PS4L 3MUGB 1JPSH 2JK5A 1FORL 4ZOCA 4C83A 1FZMA 5CMAB 4KV5F 4NZUL 4HH9B 3QXAA 4HWBA 25C8L 4J4PA 2Q7YA 2Y07H 3SKJH 1OARH 4KY1H 5J56B 2XOTA 3I75B 4OCRL 1I9IL 2CIKB 1PX3A 4R2GC 1LO3H 4MA1C 5KG9A 3ULUD 3DV4A 4RFEB 4KGLA 5HYFA 3PP4H 3QIUA 4JZJB 2I27N 3PP3K 1J87A 3V5HB 1QPPA 5AAWA 1N0XL 2EDHA 3G5YB 5J11C 3QFJD 5DMKA 4NKOA 1BWWA 3LB6C 4NRXB 2DQIH 4XPFL 3CU7A 5F1SA 2E7LC 1HXYB 2DLHA 2GITA 3CC5B 5EC2B 5E4EB 4DCQB 3DARA 3JVGA 3TBTB 4NNYA 2V9RA 4GAJH 2GTWB 5DWUH 3JWNC 4U1KA 5MERA 3FHAA 2BDNH 1BFOA 2QHLA 4BFGA 4ZS7H 3Q0HA 1J0HA 1IC5H 3ULVL 1NFDA 1NSNH 4GW4A 4AYFA 1JUFB 5C0EB 1T6WA 4NBZB 1NLBH 4QTIL 3RTQD 1U8LA 3KLAB 4OM0L 4XCCL 4Z0XB 4WJ5A 5GGSA 5IB1B 1IGYA 3VDAA 4CVZB 4PJ5D 1I9RH 1QRNA 2FJGA 3GSRB 2BSSA 2VXTL 5T33L 5E8DH 2BHUA 5DK2B 1W2KT 3MJ8B 4KAQH 3QIBD 4MS8D 5DR5L 2FO4B 3T0EA 2W9LA 4ZYKB 4APQB 3E1F1 3WEXA 5BV7B 4PLKC 1IL1B 5FGRA 3P4MA 2V2TB 2FJFB 3GMMA 12E8L 2WLYA 1JN6B 1AY1H 1RZGB 5B8CB 1LO5B 4QHMB 4FQJH 2IF7A 4GG8B 4M4PA 5JW4M 1S7XB 4KI5E 1HOCB 4Z7WF 4W68A 3UDWC 1GIGL 1KLUA 3OB0K 5C09D 2CIIB 4QRTB 1ZHBA 2PYEE 1FO0L 5C0GB 3EFFB 5EO0A 3CX2A 4C4KO 3O4LA 3KAAA 5LAXB 1T1YA 3C60D 1FDLL 2LAGB 2GCYA 2CQVA 3QBTB 3SPVB 3BKYH 1BVZA 1HIMH 1HYSD 3ZDYF 1YYLH 3PQYE 1BF8A 2DQFA 4UAOC 4J4PD 4MJ2A 5D1QB 5HHOE 2R8SH 4WFED 5DJ6B 3FB5B 2EO9A 1JF6A 4KUZH 5FUCE 4FXGB 3WL9A 43CAB 4XVTH 2GK0B 1DSFL 3GI9L 3RY5A 1EUUA 5BV7L 4RDQG 3QDMA 4KVCH 5TE7L 1ZT1B 2XI9A 2F8XC 2PW1A 5TDOA 4Q97A 1E4KC 2BXZA 1A6VL 3RKDD 4JFFA 1UM4H 1Q72H 2YD7A 1CFNB 1RZKC 5ICXB 1I8KA 2WINB 3RPIA 5BS0E 1P4LB 4KQ4L 5D7SL 1MAJA 4G7YL 1ONQB 4NFCA 2ZCLL 3D0LA 1JTPA 1WUNT 2EH7H 2ZCKL 4HKBB 4L4TD 2H9GA 1C8PA 2F5BH 2DQJL 3HMWL 3O3BB 4OZGF 3RGHA 4UILL 5C0AD 3PHQA 4NJ9H 1FNGB 1NAMB 2AEPH 2BMKA 3KJ6L 5ISZA 3C9NB 1QRND 3EDEA 3GKWH 4JRYB 5FYJE 5MENA 3MRIA 1JHKL 1WSST 5DRNB 1AFVH 1V3MA 1ZVSB 4ENED 3BH8B 1QHPA 3G04B 4RMVA 4OLYH 3FHQA 5J6GB 5T5FH 2V7HA 4X9IA 1I1AC 1K5NB 2PYFB 5JR1L 3RVXC 3ZDXF 1KFAL 2J8UE 1NDMB 4HF5L 4JQIH 5FHAL 4OT1L 3CVHA 2Z93B 3KPRA 4LPUA 4HS8L 2C4FU 3FQWB 1NMCB 4NFDA 2NY5H 3LQAC 2O61A 4M9PA 4R2GD 5I8OL 1LP9B 2NY3B 4F7PA 1ZKAA 4PJHE 3OKEB 1EEZB 1U93A 4GAGH 1U8OB 3BP7A 3F7PC 1UADC 3O4LD 4RMWA 5DLMH 1K2DA 1YEKL 4RBPH 3U6RA 3LB6D 1FV1A 1XCTB 1J88A 1RI8A 4HIIA 5EBWB 5EU6A 3X12A 1UXWA 3CD4A 1NAML 4XP4L 5C0DB 4I0KA 4CUCA 1T5WA 1RUAL 2PYEB 3I3BA 1S78C 3FQUB 1EMTH 5D2LE 3T8XB 3QPQC 5DF0A 5IW3A 2VDRH 5F7DA 4KDTC 3LDBC 3RVTC 3HUJB 1JP5A 2DB8A 1NL0L 4DKEL 1GC1L 3PQYB 3RKPA 2ICEA 3QDMD 1BEYH 4QGTA 3QDJA 5HYSG 3NTCL 2PW2A 4JN2B 3BRGC 5KVDL 3NOIA 3D3VA 4XZUB 1R0AL 4PRID 4HIHA 3LV3A 4R8WL 5GGQL 3VGBA 2HJLB 4MA7H 4XCEA 4YHYC 4LPVA 3HPLB 5C3LD 4POZC 4PLKD 4I48A 2EDJA 1WZ1H 4GG6F 2V2WA 3GGWA 4LVOC 5CEXA 4P4RB 4BSWB 3QQ3B 1MCOL 4PGZA 3MNWA 3EO9H 3K4ZA 4MA8H 3GMPB 4BQ8A 3L5HA 1A0QH 3N85L 4DKAA 4U6VL 4NOFA 1DBAH 1A6WL 2ZWLT 4XHQA 5IM7B 3WSQL 4PGJA 1BJ8A 3NGBB 3VI4F 5D96B 3LKQB 5KSVA 2VABA 3HZKB 5HGDB 4FZEL 1BFVH 4W6XB 5GS0L 4X6CB 4U6HB 3S5LG 2P44B 3KPRD 4S1DC 4R4BB 3FONA 4UU9A 4DW2H 3EIFA 3O0RH 4FQLL 2BVEA 4JDTH 4OZFH 4WFHD 3QUXC 1QBLH 1L9NA 5A3IC 5KVFL 4M62L 4MJ6A 2QR0B 3VXOB 5I76B 1Z2KA 2ZUYA 2HRPL 4XNYL 2DQTH 4KU1A 1MRDL 4PJXB 5E1HB 3PWNB 1U92A 2XV6B 1CFTA 2E9JA 1G84A 1Q9KB 4OSUH 3PV7A 1CFSA 3Q6FA 4I0CC 3U9PH 3CFJB 3VE0B 5EWIH 4UV7L 1RPQA 4HPYL 2XQYK 3B2VH 2J4WH 2R15A 4DZBA 4JZOA 2VXSL 5K59F 2W60B 5IFHH 1ITBB 2DIJA 4IRJC 4P3DA 1IZJA 5F8QC 1U36A 3SDXE 4L8BA 3WLWC 5BCAA 5B39B 4AM0B 4YO0A 1UB6A 1F4YL 4I2XA 1ERNA 5ALBL 3KYKL 5F8RC 3DNKA 1KB9J 3QH3B 1KELL 3SEPA 1KOAA 2Z0BA 5CBEB 2PUQT 3S35L 4U1GC 1HH9A 1LILA 3NFPB 1X9QA 1GOHA 5F7YC 1GOGA 5SWSB 3IDMA 4TUOA 5I1HL 4F15B 3D3VD 4QHUB 4ELMB 1I1AD 3RVXD 1EHLH 3RGVC 1K4DA 5EU5B 3ARGC 4XPGH 4YHML 4TSCL 3O3EA 1N4XH 2RBLA 3O2VL 3MODH 1F97A 1V8HA 1JPSL 5D7KD 5I17B 1QYGH 4DK6A 2AXFA 2IALB 3OBAA 3VXMA 2VSDA 2XZCH 3MCKA 3EDDA 3TV3H 4LSPH 2P1YA 2Y07L 5HGBA 4OZHB 1OARL 2XWJB 1AD0A 4YWGH 4E41A 1JGEB 3MRHA 5EB9A 4U1MB 3DX8A 3MLTA 5D5MF 1R5VA 3EAKA 1U3ZA 5D2NE 3V0VA 3N06B 4IRJA 1CIUA 4FRWA 5HTSA 1MFNA 4KK6C 5BOZG 2A2QT 3SY0B 1D5ZB 3QEUA 2V5RA 1S78D 1MRCH 3MV7E 5EU3A 4QXTB 1U8PA 5D6DA 5CP7B 3QPQD 2DQIL 2VR5A 5EIQA 5KJRH 1BJMA 2H8PA 2R0LH 3RVTD 5DMYA 4UT7H 3QUMH 1KN4H 4L3CB 4HAFA 3W0WA 3KXFB 3L3KB 1S8DA 5DVOA 5DWUL 4CU7A 1SQ2N 2YD3A 2BDNL 2DYPD 3QXUA 2D3VA 4ZS7L 1HILB 3WNMA 1D9KA 4TNWK 1IC5L 1NSNL 2R23B 5A2JH 2VZOA 5EZLA 1G7MB 4H1LG 1NLBL 4GOSA 2AK4A 4KK5C 4O02H 4PGDA 1REIA 3QG6B 3RGVA 1HXMA 4POZD 2ZUTA 4G9FD 3SDDC 2A6KB 3PHOA 3OR6A 4C59B 1Q9WA 1I9RL 2FSEA 5GRWA 5DC4B 2FJHB 3ARGA 2DM4A 4F7EB 2H26B 5I73C 5E8DL 3VWKA 4NQCD 2WM0A 2ZOKB 3BO8A 4WHDA 4KAQL 1WZKA 5BW7C 1NGYB 4D0CA 1SY6H 1GL4B 5AYUH 1FSKC 5IVOA 1JYXA 3OKLA 1U91B 3WUZA 5A1AA 1OP5K 3MNVA 1PVHA 1CFVH 4PRPB 4OZIA 4O00A 1IT9H 1INDH 4M02A 1AY1L 3T0WA 3OAZH 3IU3A 4FQJL 4S10A 1QLFB 3KHQA 4BJLA 3FL7A 1U8QB 4PG2A 4K3GA 5FECA 3AMKA 5F96H 4S1DD 3O9WA 4EI6B 2ZKHH 43C9B 3H6JA 2A73A 1DQQB 3QUXD 5AZEL 5I30L 2V2XA 4H8WC 3VCLB 3CFCH 5A3ID 4BA8A 2CKBB 3F7QA 3BWAA 4K3EH 2QADB 4OB5H 1YN7B 3BKYL 4MD4B 3VXMD 3EYQD 2APWA 3UPRB 4YK4C 5JIIA 1P7QA 2R8SL 4E41D 3PP3H 4DWHA 4OKVA 4MNHA 4S1SH 2IANB 1A7QL 4KUZL 3O2WH 1AXSB 5CINH 5J6HA 4P57A 5AG8A 3EYSH 4XVTL 2X1QA 4QTHB 4OCXL 1RK0B 4IRJD 3LEVH 3SKMA 5D7JC 4LHUA 1CGTA 2Z35B 3WLWD 4LMQE 3W9DB 3UZVB 5FUZH 2D7OA 1U8NB 3ALXA 2NX5D 1X4XA 4JDVA 3PWLA 4KROB 4MAYC 4WGWB 5BW7A 1UM4L 2FB4H 1Q72L 5FO8B 4ZMAT 3H9SB 4IRSA 1BD2A 2NCMA 2P8MB 1MFAH 3FB6A 3W0WD 1ZAGA 3GKZA 2ESVD 3UX9B 1R24A 5IQ7H 1A3RH 2EH7L 3MV7B 5KZCB 2YC1A 4EOWH 1BVLB 2F5BL 3MGOA 4WI9A 5GGTA 3VXSA 5D7IA 3AS2A 2BOCA 3RGVD 1YEEL 4NJ9L 2AEPL 2CDFB 1SYVB 5I1EH 4PRBB 3GKWL 2E9BA 1Y18B 4OCSH 3ARGD 4D9LH 4L8DB 3QXVA 2GKIA 3SOBH 4YZFE 4XBPB 4OLYL 3ZLQC 5DHYB 1VGKB 1NC4B 3DIFA 1Q9OB 3EJYC 2BSRB 3BGFC 1SYSB 5F7KC 1NCAH 2JIXD 3S6CA 4PRNA 3B9KB 1GZQA 3O4OB 4F7CB 4KVNH 5HHNB 4BKLA 2QSCH 4TNWF 4UTBH 1UJ3A 1QSFA 1T1ZB 1JGDA 3VW3H 4GXUM 4P4KB 5C08E 4JGMA 3VRJB 5JA9A 4PRAA 5D7JA 1SBSH 1X5ZA 4RX4A 2FBOJ 2IMMA 5IBLC 1H8SA 1TQCC 5DLML 1XF5A 3HAEH 1ZA6A 2EYSB 1I8MB 2H2PC 4YDIH 1KLGA 1UKTA 4LLVA 3E2HB 3K80A 3C5ZC 5MEQB 1EVUA 2P5WA 3EYVB 2YEZB 1ORSA 4Y4FC 2Y5TA 3KPLA 4ZUUB 2PO6A 5DEGB 3IJYA 1OD9A 4RMRA 2RHEA 1EMTL 1P7QD 3QQ9C 4UT9L 5GGUA 4Y19B 3VGAC 1MNUH 2I9LB 4ZDHA 1G9NC 2GHWB 1K8IA 2VDRL 4P0DA 5TF1H 3ROLB 4KK5D 1B9ZA 1FGNH 2A6IB 3SDDD 3RQ3A 5L7XH 1NBZA 5C0CB 1PYWA 3GSOB 1KCLA 2DL9A 1DEEA 1HSAA 4RCAA 4TVSa 3BUYB 5IIEB 1BEYL 5SX4H 3QXWA 5HI5C 1FVEA 3C08L 5F3HB 1BOGB 1UA6L 1NDGB 4PG9A 1OAYH 2EEBA 3TF7C 3OKMB 3ARBB 3KWWB 3DYMA 5C0BA 3WS3A 2VR9A 1BD2D 1M7IB 4DGVL 2VSCA 3TLRA 5I66A 1LE9A 3QCVH 1OTSC 3H42L 2JJVA 1JI1A 2C1PB 1G0XA 4I9WE 1RJCA 1BIHA 5CHNB 4AK1A 1SVZA 3EO9L 4RA3A 4TUJB 4POYA 3VXSD 1A0QL 1S7SA 1JWUB 4LCWA 2B1HL 3RVUC 5IFJB 4OV5A 1YNKH 3E3QC 1SJEB 2FL5B 5HY9A 1DBAL 3WV0A 1F4WH 4RMTA 4G8FB 1S7QA 2EYTB 2FHCA 1T7YA 2HT2C 3CFDB 2HT4C 3LN4B 4E5XA 3NIFF 5E9DB 4M61B 1BFVL 2Z8RA 2YKLH 1A8JH 5HD8C 3C5ZA 2Q7NA 2Q76A 4UOW0 2F74B 4TULH 4Y4FA 4KKNA 4U1HA 5DURB 3S7GA 4DW2L 3O0RL 4NDMA 4YDKH 1A1OB 4JDTL 5TPWH 5I19H 1QBLL 1RZJC 1LMKA 1B90A 3NPSB 3THMH 3PIQA 3D25A 3F5WA 3PJSA 4F7MA 3IDNA 4FQHA 2DQTL 3QSKB 1H15B 3O6KH 5C7XL 5D7JD 3VFGH 1H3GA 2WBWB 4YHNB 4UDUA 4Y16B 5LBSH 2QSQA 4R3SA 3RZCB 3UEZA 3U9PL 5IW6B 4MAYD 1CE1H 3CXDH 2J4WL 3QA3B 4XBGA 3T1FB 5C08B 1Q1JH 2MHAA 2O5XH 1TZHA 2P5WD 1DBKH 5E6IB 4MNQB 3ZDXE 2EDXA 1CD1B 1U3HC 4U4BA 1YY8B 4HMDA 1QHOA 3ZTJH 2DIAA 4JFDA 2W59A 3SDYH 2A38A 4K3DH 5L2KA 2ZG2A 1NFDF 4HIXL 3RAJH 4O51A 1M05B 3NFNB 3MR9A 5DJZB 1ZSDA 1H3XA 5DJXB 5L0QB 2LTQB 4A6YA 4IBLT 4WI2A 4WUKL 3BJ91 2IG2H 4OAWB 1HNGA 1OGTA 2ZUSA 1W0WB 3HI6H 2DMKA 4R4FH 4ZTOH 5EIIB 1UM6H 3QUMB 3EJYD 1EHLL 5C0BD 3W82A 2LFGA 4M5ZH 4U1JA 4QRQA 4Z7WB 2MMXA 3FCTB 1RD6A 4OUOA 1OGAA 1QSZA 1F90H 3MODL 3MLSH 4HUKB 5T3ZD 4IIQB 1NLDH 4FTVA 5KW9H 1HHHB 1QYGL 4I3RH 4N1EA 1JF1B 4ZPTB 1NGWB 5SWZA 4C56E 1QPXA 2XZCL 3TV3L 4NN7B 3G5VA 4LSPL 5IBLD 4DVRL 2V7NA 1U6AL 1UH3A 4WTZA 3U79A 1QNZL 5IHBA 1MCWW 3C5SB 1BQLH 4PTTB 4YWGL 5EPMA 3SKUD 1L7TH 1FYTD 2H2PD 5D1ZB 2UZIH 5F9JA 4OJFH 4NZTH 3QNZB 5CZKA 5E8NB 3C5ZD 4AT6B 4QRRE 3LZFH 1NH6A 3D39D 4Y4FD 3L5WB 3MLVH 1GGUA 3KR3H 1AJ7H 4O2EA 1MRCL 2NY4C 3U7AA 3QQ9D 1JPTH 5GRUL 2FGWH 1E6JL 5JW5A 3QEQE 4PJ8B 3SO3C 4JPWH 5KJRL 1E6OH 2F54E 2GQHA 4CADB 2R0LL 5DJAB 2A6JB 2NY0B 4UT7L 3QUML 1RZIA 1KN4L 2VN7A 2KQMA 5H37G 3GM8A 3K8LA 4FFYL 1ZLWK 5HVFB 3OKOA 4LPWA 5E03A 1KJ2B 5T1KA 3U4AA 2XFXB 4GRWH 5HI5D 4GFTB 4LVNC 2OI9C 4MQXC 3DVIA 1GGBH 3WHXA 3BEWB 1DZBA 4WUUD 3T2OA 1YEHH 1MCQA 1A6PA 5F7HA 3T2NH 4O02L 4WU5B 4XNQA 4E42A 4OZGB 2YRPA 5HVHC 2CRZA 2R2BB 2OJEA 3MRLB 3IDIB 1E27A 3LQZB 4KTEH 5B22A 4JFDD 2D9CA 3IDYB 3JSSA 1FZJB 1J12A 4PJFB 1SY6L 5AYUL 3TBSB 2YUWA 3O2DL 1ZHNB 3RVUD 4K2UH 4CU6A 2P5EE 1QEWA 3DX9B 4WNQA 5HHPA 4YIQA 4XCYB 2VZTA 1IT9L 1OVZA 4IS6A 1NMAH 5B4MC 2I9TA 2J6EA 5INDA 2ZOLB 4DOHE 2HT2D 1G6RA 2HT4D 1PW3A 5HYIA 4X8JB 1KIRB 1PKQA 5HD8D 2DTSA 4M6OH 4HMCA 1TJGH 3AY4C 5K59E 5F96L 4X6DE 4AMKH 3H3PH 2ZKHL 5I8CA 1JTOA 2P8PA 3OXSA 4UT6H 1KJ2L 1BBJB 4FFVC 1E28B 3SJVA 2NY7H 3DXAA 1JZ7A 3TIDB 3L3HB 3CFCL 5F1IA 5IJVA 5J12C 4LFHG 4K3EL 4OCWH 5F1NA 4PJIF 4OB5L 5FYKH 2HN7B 4FTVD 3Q3GB 1EDQA 3FN0H 3PABB 1TZIB 3C09C 4ZOBA 3VRIA 4WRLA 5SWZD 3ZZ1A 1MI5A 1GGYA 5DQDH 4JREB 5D93B 4ZD3H 1CGVA 4L3ED 3RNQB 2GIYA 4ZG1A 3GSXA 1P84J 2CGRL 3O2WL 5F71A 4X5LA 3EYSL 3I6KB 3GB7B 3LEVL 1AGCA 1Z9MA 5DRZA 4JDZB 1U3HD 3EYFA 4WI3A 1CR9H 4ODTH 3TGXA 1T03H 1AHWB 3S4SB 3TA3A 5FUZL 4IMKA 5IMOB 4U7MA 2YMXL 5A2IH 4G5ZH 2FB4L 5IK3A 3BMVA 5L2JA 5HPMA 1MFAL 5LGJA 4DGYL 1I4FB 4JY5L 4QLRA 2IAMA 4EVNA 2JB6B 4H20H 1C5CH 5IQ7L 4W81A 1A3RL 1WTLA 4JFHD 5DQ9B 2OZ4H 4NSKB 4GG6B 3C6LB 4JFPA 3DJ9A 5D5ME 1A1MB 1B6DA 2GFBA 2F54B 1Y6MR 3AY4A 3QHTC 1KG0B 1WBYA 1T2JA 5I1EL 1CLCA 1XIWC 4NUGH 1T66C 2CK0H 4N0UA 5M7QA 1EEQA 2N4IA 3WFEH 4BZYA 2QJDA 1JK8A 4GKSA 4J3VA 5I1AA 5JW3L 2PN5A 1T5XA 4HKZA 1BIIB 1NCAL 3VWJA 3M45A 5KSAC 5ESQA 4KVNL 3CLFH 1KIPB 2QSCL 1V3LA 3OG4B 4UTBL 3T4AB 3D0VA 3VFTB 1X7QA 1JNLH 3J7HA 3MNZB 1HHIB 4NM8H 3BESR 4YHPA 4XPTH 5TFSH 2AKRA 4BM7A 1AO7B 2J7LA 2VLJA 4LPYA 2P5EB 3CFKA 1KCKA 4QXUH 2NY4D 3SJVD 3DXAD 4P23B 2YWYA 4LNRA 1BGXH 1JV5A 3OAYH 1X6LA 4YDIL 3UYOD 2C3HA 1YMHA 3JWDC 2ED9A 4JHAH 4U1NA 4PP2B 4JKMA 3MSPA 5BJTA 1JPFB 1OWWA 4EI5B 1EXUB 5DD1H 2XPGA 4K7FA 2OTPA 1I7ZA 4G6JH 4MQXD 2YHGA 4JFEA 2G2RB 4BFIB 4WFGE 2NY1C 4X5WA 1OW0A 1MNUL 4HUWA 5FB8B 3VDBA 2WANA 2VZUA 5TF1L 3ARYA 4MB3A 1FGNL 5F9WC 4LF3A 2EXYC 4ZSOE 1EFQA 2E7MA 3F62A 4GRWE 5L7XL 1UGNA 2MPAH 4IDLA 1MUJA 4AIXA 3KJ4B 1X4YA 1OAYL 3RDTC 1L0YA 2OL3B 1MHHA 1ZHKB 5D1XC 1QA9A 3U0TA 4HUVB 1AP2A 3LS5H 2C7UB 5JMOC 3IKCA 1YJDH 3QCVL 1K6QH 5B4MD 1RVFH 2B8OT 2X7LB 3D6GA 1ZLSL 5MI0C 3DURB 2YPLA 4FQIH 4Y1AA 3LY6A 3IU4H 2ADJB 3DX6B 1MH5B 1P84K 1YMME 4EIZC 5L88H 2CJUH 3BE1L 1YNKL 3FOMA 1F4WL 4FFVD 3ORJA 1ZA3B 4OZ4B 2X4QA 1RUQH 2YPKA 5ERWB 1R3KA 1QUNA 1GXEA 5D5MB 4KJYB 3VG9B 1UEYA 5I18H 3U9UA 5E70A 5F6HJ 4NCC1 3BP4B 4YDKL 3BD3A 3MO1B 1IAKA 5I19L 1OF2A 5DA0B 1JNNL 2OSLA 1LDPH 5C6WH 3K2UH 3THML 1KJ3L 1HINH 2I5YH 2C1OA 4QYOB 1MCPH 3VFGL 5DI8A 1DN0B 2EDWA 3VXPA 3V9FA 3MV9B 3NH7H 5DJCB 4O2CB 1S5HB 1SVCP 5DHVA 3LH2H 4Y2DB 3T3MF 2BVQA 2YRZA 3BPNC 4U6XA 1HKLH 3PDOB 3CPLB 4H26B 2GT9B 4OFVA 1MVUB 3P9WB 5D1XA 3RI5K 4CN1A 3CMOH 1Q1JL 2O5XL 1DBKL 1AQDA 2A6DB 1C12B 2UVFA 3AU1A 3AMLA 1D7FA 4PB9H 5TQ2H 1G0YR 4JJ5B 3LD8C 1EEYA 4YR6B 3IKKA 1RIUH 3I02B 1A7PH 1QR1B 1P2CB 3SDYL 4ESKA 4K3DL 1RUKH 2HLAA 2EYRB 3RAJL 5A43C 1OAKH 3VMPA 1IM9B 1DCLA 3QI9B 4OF8A 3RNKA 3PWJA 4GW5B 4PRHD 3T2PA 4K07A 1XIWD 3ULUE 1EFXD 1UJTA 1T66D 5FYLD 3CMGA 2IG2L 3H7BB 2W0KA 3QXDA 3HI6L 3HCVB 4R4FL 5C86A 3QQ4A 4ZTOL 3BQUA 1P6FA 3QFJE 3GIVA 5FGBA 1A3LH 1RULH 3U36B 1CD9B 4ZSOB 4XRCB 4LLYB 4M6MH 1KIQA 4JQVC 4G42B 5KSAD 3N1PC 3D18A 1WICA 4XCNB 1FJ1B 3TJEL 3LQMA 4GS7B 3PUCA 1F90L 1VEMA 4NUJB 5FKAA 3MLSL 2RIKA 3HZYB 4P48A 1DR9A 2WK2A 3MGAA 3ILPB 4Y1AD 5KW9L 4WGVB 1MCEA 3BT2H 4I3RL 4PJAA 5JQ6H 4H5SA 3Q1SH 4QRUB 1F11A 4JFOA 5B39G 1NGXA 2WUBH 1NCUA 1BQLL 2Q8AL 1GOFA 4PJ5E 3G5XB 2UZIL 3ZE1F 1CTOA 1FO0A 3OPZL 4NZTL 3DVNB 5E5MA 1JCKA 5HYJD 1U8HB 3TO4C 3LZFL 2E8ZA 1T04B 1YMMB 3GHBL 3O3DB 2PTTA 1AJ7L 4PBVC 3QUYB 4K3HA 1FBIH 1XMWA 1JPTL 2NY1D 3HRPA 2FGWL 5GISH 2CPCA 2FR4B 3VXUB 2WWKT 4Q58C 4OI8A 5DMJB 4JPWL 1DLFH 1E6OL 2VDKL 3GDBA 1T1WB 2EXYD 1QKZH 1EO8H 4URTB 1OQXA 1WWBX 2KZ1B 1XR9B 2FEDC 1ZE3C 2X1WL 3MJ8A 2XTLA 2ZP0T 5C09E 3HA0A 1MLBA 1GGBL 3HS0A 2NY2B 3FO0H 3L3JB 4P2QB 4DGIH 5SWQA 1BX2A 4PREA 3RDTD 3CVHH 1M6OA 3WIHA 4GBXC 2VQ1A 5D1XD 3CCHA 2IJ0C 3NIFE 3T2NL 1G7QA 4NO0D 5MEPB 3V5KA 5CWSB 1KCVH 4JY6A 4OF0A 1A7OH 1RK1B 3OSKA 3EJJX 1B4RA 1I1FB 1FAIH 4PJ9C 3L7FA 4KTEL 3GBMH 1NEZB 1YPZA 3WFCH 3PL6C 1NANI 1HKFA 1VFOA 2Z4QB 4JHZA 4WFEE 1V7MH 1KJMB 4YPGA 4LARH 4ZPVB 5D7IF 1X5IA 3FB7A 4K2UL 5LJYH 1LEIB 1CDUA 3UYRH 3QQNA 1RZKH 1A21A 1QBBA 4G8GB 1NMAL 4JM2B 4EUPA 4JN1H 1J10A 3P73B 2D31B 4GUPB 4JY4B 3RI5F 4BQ9A 4LLQB 1YC7A 4UDTA 1LO0H 2VUOA 4XNXH 1TJGL 3GMQB 3TNMA 4YHLH 4AMKL 5FO9B 3H3PL 5ILTH 4NWUH 3V6OC 4FXGA 4UT6L 2NY7L 3MXWH 3L9RA 2IFFH 3BPOB 2W0LA 1NC2A 2BRRH 4OCWL 5J1AB 4B7IA 5FYKL 3QFJB 3KPQA 4L4TE 5HDBF 3FN0L 1NFDE 3QO0B 4UNTA 3K81A 2KPNA 3VD4A 4DN3H 3O6ML 1PDKA 4XHJC 4ZD3L 5C0AE 5CBAA 3J8F7 3C5JA 1GVIA 4S11A 5CGTA 4KI5C 5FF6B 1G7LB 1QRNE 2X4PA 5ABDE 5GSRB 5FK9B 4PJGE 3ARDC 4I77H 1UACH 2AV7B 3MBXL 4F9PC 5FA3A 1WK0A 3LQAH 3EOBB 4DUXA 4ODTL 2CLVA 4DFHA 1T03L 1GYAA 4PJ9A 4HFWB 3BP5A 4WY7L 4HUXA 2PR4H 4LCIH 5J1TC 4G5ZL 4LLMB 4PJ5B 1ZS8A 2NXYB 4WU7B 1R3HA 5IFAH 3SGKC 5C0RH 4N90D 1KB5B 3CH1B 1BJ1H 1T6VN 4QNPF 3UO1H 3NABL 1NKOA 3MA9H 3H9HB 3BH8A 3S3SA 2GSIA 3BVNA 1O0VA 2OTUA 5LGHH 4H20L 4UIMA 1C5CL 4AL8H 2PXYA 3FRUB 3ESVF 3KYMB 2OZ4L 2X70B 4N9GA 2UYLA 1LE5A 3O4LE 3U30B 2R0WH 3HC0A 3QR2A 2ERJB 4G6FD 5HJ3B 3IETB 5CJQH 3K1KC 4M1GH 2A83B 5DUBB 3RL2A 4OD2B 4CMMA 3QUZC 5DRWB 2HFGL 1F3DJ 4DQOL 4NUGL 2CK0L 5FDWB 3W5MA 1SMOA 4RAUB 3IFNL 4Y2OA 5F6IC 3WFEL 3DHMA 2AXJA 4HLZG 1N3NA 4C54A 5ID0A 2WP3T 3T0AA 5IB5B 3KPSD 2BVOA 4F8QA 3LEXB 3K2MC 3GNMH 4K3JH 4J8RA 3FQTA 2JK5B 3CLFL 3W39A 1RIVL 4C83B 1FZMB 1NBVH 1MPAL 4ACPA 3QXAB 3MGTA 4UB0H 1JNLL 2Q7YB 1CXEA 3Q6GL 1BP3B 3TO4D 1KB5L 1ROWA 4NM8L 5TFSL 3WDJA 5F7FA 4J23A 2QQLH 4PRIE 2X4UA 5KG9B 3SE3A 2XKNA 4ZUTA 3DV4B 1N2RA 1ODAA 1BGXL 3QIUB 4U49A 3SGKA 3NZ8A 4JHAL 3V79C 5E2UL 5DD0H 2JE8A 1MREH 5DMKB 1Q0YH 4NKOB 3FO2A 1H3PL 5HHOA 4UOW1 1EH9A 3UBXA 2FEDD 3BXNA 4G6JL 2GITB 4GSDH 2CO7B 1DDHA 1KGCD 2R2HA 4PJDE 3ZMRA 5GS1C 4NNYB 4GBXD 3TNNA 1IEAA 4U1KB 5MERB 1BFOB 3ROOA 5K9QI 1UWGL 2DQHL 1NFDB 4HBQA 4GW4B 5EBGA 5FKPA 2CD0A 3QUZA 1QLRA 2BK8A 5C9JA 4PJ9D 1OAXH 2BY1A 3HN3A 1U8LB 1FE8H 5GGSB 4WJ5B 3QNYA 3PL6D 3KPRE 1IGYB 2GJ6A 3RJQB 4PTUA 5BS0A 1QRNB 2FJGB 4PJCA 3ZTNL 4WFHE 2J88H 2BSSB 2Y5EA 5A16A 1MSPA 3JV0A 4RRPG 4PJIE 4JPVH 2V9TA 3LS5L 4QO1A 1YJDL 1K6QL 2OK0H 1RVFL 5A2KH 2P47B 3T0EB 3WEXB 3P4MB 3GMMB 4FQIL 3IU4L 1P5VA 1JL8A 1DLHA 3MV01 5CEZD 2CJUL 4R2GB 1VPOH 4MA1B 4AQ1B 5JW4N 3T77A 2YA0A 2LU7A 1KLUB 3ISWA 2XKSA 3MV8A 3U46A 5AD0A 1ZHBB 2J8UA 3FZUC 4Y4HA 4Y8DC 5EO0B 3O4LB 4M6AA 5J11B 1T1YB 3QDGD 1CVRA 2UWEE 2GCYB 4LAJH 1IAMA 3IRZA 4DUWA 4XHJD 3A6CL 4CDGC 4RGMC 1AIFA 2EO1A 4KI5D 1H9VA 1TTFA 2DQFB 1Q8MA 2WMPA 4PJHA 1RV6X 5DD6A 5EU7C 3BH9A 1HINL 1MJ8H 2I5YL 1FNEA 3ARDD 4UZGA 3MZGB 1MCPL 4YNYA 1CLYL 5GGSY 2M8XA 3D3VE 3NH7L 1LD9A 3WL9B 3BJLA 3LH2L 1HKLL 4OIIH 2Y6SC 3BYTA 3QDMB 1PEWA 1DQLH 5FCUH 3CMOL 2PW1B 5DC9B 4MAUH 3UP1A 5TDOB 3ARUA 1CBVH 5EG6C 5EZJA 5IHZA 5D2LA 4JFFB 4PB9L 2NZIA 5TQ2L 4RNRA 1I8KB 1V7NH 2VQTA 3RPIB 2OBGA 1RIUL 1A7PL 1QVOA 3K46A 5JA8B 1FFPA 1RUKL 2OXHA 5SV3A 3OHXA 5B21A 4ZXBC 1OAKL 4HHAA 4JQXC 1A7RH 3D0LB 4EJ1C 4RMUA 3RIFK 2H9GB 2AJYH 3R4DA 3QUZD 5BO1H 4WHTA 4JFXA 3PHQB 3REVA 3B83A 1ED3A 2BMKB 2GJ6D 5ISZB 2EDRA 4L4VA 4LHQB 1ZLVK 5MENB 2MTPA 1KJVA 2ZPKH 1A3LL 1RULL 3NPZB 5JW4Q 5CIPA 4B41A 4M6ML 1IBGH 3GI8H 2V7HB 4UMGA 1FNSH 1KCRH 2XICA 2YD2A 4PBXA 2PF6A 1NQBA 2F53D 3CVHB 4OLEA 3QP3A 3KPRB 4UAOB 2BNQD 2E6JA 3UBXI 5E4IA 3BT2L 3ZL4H 2JCCF 3R0MA 4PJIB 2O61B 1MFEH 3Q1SL 4D94A 3PF2A 1X5AA 2Y06H 4JG0H 4F7PB 2WUBL 1KSRA 4YGVA 4G9FE 4TQEH 5GRZA 1U93B 3MV8D 3DHJA 3TC9A 4Q0XH 3L3KA 1MJUH 3BP7B 4J3UA 1K2DB 1A64A 1VHPA 2VZ3A 2BNRA 4NQCE 4YAQA 5DJ2A 2VL4A 1ZK9A 3MZTA 2O93L 3U6RB 1FV1B 4LP4A 3WNLA 4HWEL 5GGTH 4HIIB 4PLNC 1EAJA 5EU6B 1FBIL 2FD6H 1JYNA 1O5DT 3KPMA 2DLFH 3X12B 3HNTH 1UXWB 5GISL 3FTGA 3FOLA 1CGUA 3W11C 3MLUH 1T5WB 1DLFL 1WBXA 4JQXA 1QKZL 1CXKA 4H8WH 1EO8L 5I9QC 2XZAH 5F7DB 1XGQA 4ZUSA 4HUUA 5ADOH 3OKNA 2XNAA 2CDGA 1WITA 3CVHL 4ZS6C 1NCNA 3MJ9H 4JANA 5ITFA 2ICEB 2GK2A 1T83A 3DUSA 3SDXA 3QDJB 2PW2B 4HBCH 1KCVL 5LGKA 3D3VB 3RY6A 2X09A 1A7OL 4QRSA 4HIHB 2L4OA 3LV3B 1FAIL 4XCEB 2VLMD 2WQ8A 3GBML 3VXME 3WFCL 4PGEA 4I48B 4P3CH 3QHFH 2V2WB 3GGWB 4E41E 1V7ML 2DDQH 4LARL 5CEXB 2H1PH 4JKWA 3BAEH 4LQFH 4ETQA 1AGEA 3MNWB 3MBEC 1A3QA 3V6ZA 1RZKL 3NCFB 4JN1L 4YDVA 5E0QA 2QEJA 2XT1B 3NZHH 2R1YA 3QYCA 3ZE0F 1S9WA 3FZUD 4L4VD 1J1OH 1LO0L 5F7EH 3KPTA 4LPTA 2E6QA 2NX5E 4YHLL 3OKDA 5EA0H 5KSVB 2VABB 1D5IL 7FABH 1ORQA 5ILTL 4KMQA 3BOVA 4NWUL 4ODWA 1BAFH 3MXWL 2IFFL 3W0WE 2ESVE 1MF2H 1ZLUK 2BRRL 2FX7H 5IEKA 3FONB 4UU9B 3VFVA 3LN9A 4W6WB 3RIFF 4LPCA 4TSBH 1JZ2A 1AR1C 2ITCA 3DYOA 4WDIA 4MJ6B 1H5BC 4NWTH 4DN3L 4X80H 2R0KH 1U92B 5GJSH 5D2NA 1CFTB 3ARXA 2Y6SD 3WO3B 4WWKA 3FFDA 1CFSB 4I77L 5KAQG 3Q6FB 2B5IC 2BNRD 4U3CA 2HP4A 3G5ZA 4CVXA 4BK5A 4TOYH 3WIIH 4V1DD 3GJFA 3AS0A 3LRHA 2OQJA 5T3ZH 1VKXB 4DZBB 4JZOB 4YHYB 3KPNA 4OI9A 3C87A 2PR4L 1B0GA 4LCIL 4P3DB 4AZ8A 4EBQH 4L8BB 5I15H 4MXQC 5IFAL 3UXFA 4O58H 5C0RL 1RUMH 4ZXBD 4YO0B 4LVOB 2JJWA 1UB6B 3IAPA 3UTTE 3UO1L 3MA9L 5E94A 1UQSA 3MBEA 5JMRA 5LGHL 4AL8L 1HQRA 2ILLA 1HWGB 3JBG7 5AYQA 3QB7C 1HH9B 1YN6A 2HVJA 4K8RC 1OB1A 2XA8H 3X17A 4M7KH 3IDXH 2R0WL 1KXTB 3IDMB 4TUOB 1Z5LA 1P9MC 3I2CH 4EDWH 4M1GL 4KK9C 2VLLA 1GCFA 1WTGT 3KGRA 1G9NH 3O41A 5DS8A 2V9QA 4JB9H 1KCSH 1K4DB 4M6NH 1IRAY 4PY8I 5HVGB 3O3EB 2G9HA 1H5BA 3NVQA 4LAQH 4QHNA 5ACMA 3GNML 3NA4A 4K3JL 3S4SG 1XF3A 3S96A 2DAVA 1NBVL 3HR6A 2AXFB 4WV1A 3VXMB 1Z3GL 3MCKB 4NQVA 3CZFA 3UPAA 5HGBB 1MY5A 1L7IL 1AD0B 4E41B 2ZCHL 4AEIH 3MRHB 5ICYA 3DX8B 3MLTB 5K9JH 3FFCA 1R5VB 4NN6C 3IDGA 4EQ3A 2OP4H 1BD2E 3V0VB 4IRJB 2DQCH 3W11D 1F42A 3JZ7A 3QEUB 4C57C 3S37H 5EU3B 3P11H 4OZFA 1D5MA 5DD0L 4A6YH 1U8PB 3F12A 1MREL 3TBWA 1Q0YL 3VXSE 5D7IE 2BSTA 3FRPG 2H8PB 4GSDL 5EUOE 3KWWA 4L29A 4FQQA 2GUOA 3W0WB 1S8DB 4ZS6D 2VH5H 3REWA 3L3GA 3OG6B 1K4CA 4Z6AT 3WDIA 2APXA 1P9MA 5EULV 1D9KB 1M7XA 4KMTH 1RZJH 5CJOH 3SO5A 2DMBA 2NZ9C 4TUJA 4I1NB 5EZLB 4PGDB 1OAXL 2AK4B 2XWBA 3RGVB 1HXMB 1TJHH 5DJ0B 4BSVA 3PHOB 3OR6B 5C0FA 2EDFA 1Q9WB 4Z8FH 2FSEB 1TDQA 5KVGL 3ARGB 2J88L 4UQ3A 3SE4A 5HYEA 3U83A 4JPVL 3U82B 4GRLC 3Q5OA 3VWKB 2ICWA 2DLEA 3BO8B 5C1MB 3MBED 5HDBE 1T0MA 1C7TA 4D0CB 4DAGH 3DETC 2OK0L 2B2XH 3OKLB 5CEYA 3VXRD 3H2WA 3MNVB 4OZIB 3BYYA 5ENWA 2O26U 5GZNC 4OUUA 3BZDA 2KKQA 2CO6B 2NXZB 1JYVA 2YZ1A 2X42A 3IU3B 4MVBC 2P5WE 5T1MA 3U4EA 5FECB 3O9WB 3BWUC 3MROA 2A73B 2V2XB 1I9JH 1JWMA 1WWWX 1AR1D 1WT5A 3TBVA 1G9MH 3BWAB 4PJAF 2GAZA 1LGVA 2YA1A 4XWOC 3NCCB 3MRPA 3C8DA 2LVEA 1MJ8L 1PZUB 3VGHA 3C2AH 1P7QB 4MD0A 4J1UA 4OKVB 4MNHB 1C7SA 3ILQC 1N6VA 2HKHH 3FFCD 2WBKA 4ZFZA 4P57B 4KDWA 1HYRC 5C0BE 5J6HB 4LSUH 1S9VA 4JFYA 4YE4H 2E8YA 3HLAA 1CYGA 3SKMB 4F7TA 2F19H 4HWZA 4LHUB 3PWPA 4MXQD 4OIIL 5CILH 4MAUL 2J6EH 4LSSH 1IQWH 1CBVL 5T3ZE 4JDVB 3PWLB 1ITCA 4PGCA 3ZTJG 1IQDA 1V7NL 1FSKB 4IRSB 9CGTA 3PXJA 3DO3A 1BD2B 3FB6B 3BD5A 2R1XA 4K8RD 5K9KA 4L9DA 5FOBA 1IC7H 5F21B 15C8H 4TNVK 1R24B 3CXHJ 1A7RL 1MHCA 1FYTE 2YC1B 1IZKA 2AJYL 3EZ8A 4PJEA 4KK9D 3MGOB 2IBBA 5FO7A 5BO1L 4PYHA 3VXSB 5D7IB 3D39E 1X44A 2BOCB 4GMTL 3VG0H 3DTXA 2Z91A 1O7VA 2APVA 3VFSA 4NQDD 2HFEA 1EBAA 2ZPKL 3DGGA 1PG7H 1WEJH 2DBLH 3AXLA 1JFQH 1IBGL 3GI8L 3KLDA 1NBYA 3DIFB 1FNSL 1HDMA 5FGSA 1KCRL 4RMQA 3EUUA 4PRNB 1W0VA 1GZQB 1ZEAH 3FQXA 4G8IA 4OLUL 3U4BH 1OP3K 4BKLB 4YXLH 3SDAC 3GSUA 5LCVH 3OMZA 1UJ3B 3R1GH 1QSFB 4WUUE 2Q1EA 1SEQL 1JGDB 4HV8A 2Y06L 2EKJA 3TIEA 1N7MH 4JG0L 1VADA 4TQEL 3I50L 3KPPA 4LASH 4PRAB 3B9AA 5D7JB 2AAVA 4LMQI 1UKSA 2OMNA 2DQGL 2IADA 2RR3A 4GKZA 1AR2A 1F58H 1MJUL 5AUMA 2A9MH 1XF5B 4ODBD 2G5RA 2WV3A 4LGRB 4JFDE 2CRMA 4MSWA 1ZA6B 4J3TA 4NZDA 2ZUQC 3AREC 4FHBD 4E9LA 1I3RA 3EYOA 1KLGB 1A4JA 5GGTL 4LLVB 4HK0A 2FD6L 4ZNCD 2MQ3A 4WW1A 1A14H 2P5WB 3HNTL 2P7TA 3E3QE 1ORSB 2KBGA 4JFZL 2Y5TB 3KPLB 3MLUL 2PO6B 1R3IH 5DJYA 3IJYB 5BZWA 3TM6A 3OV6A 3SGDH 3U1SH 5I8KH 3FJTA 5GGUB 1VEOA 4ZDHB 3CNKA 1K8IB 2NZ9D 4LVHC 5F44A 5F7UA 4C4KT 5TDPA 4JCMA 5ADOL 3DVGA 3TBSA 4I8DA 3PWPD 1FVDA 1NBZB 5KVEH 1D6EA 1PYWB 4IOIA 3MJ9L 3RWDA 1DEEB 1HSAB 3V0WH 5HYQA 1MFCL 2P46B 1FVEB 3GEWB 4GRLD 4HBCL 1J05A 4PG9B 3SCMC 2ZG1A 1MVFA 2CUHA 4FTVE 1S7VA 4MDJA 2P42B 2WBJA 3DETD 3HZVA 2WSKA 5C0BB 3WS3B 2ZG3A 4M43H 2VDLH 4GJTB 1X5LA 2BCKA 1H3TA 4P3CL 3QHFL 5I66B 4L3EE 4FFWC 1LE9B 5GZND 5DMIL 2DDQL 2XQBH 5CFHA 3AAZA 2H1PL 2B20A 2VZSA 3BAEL 4LQFL 3CK0H 5EOQH 4MVBD 3HNSH 1N26A 4KZDH 3M1BA 3IGAA 1S7SB 1ZTXH 4LCWB 2XRAH 3NZHL 5FV2A 1TVDA 2NW2A 4JKKA 3ZDZE 4OV5B 5HY9B 2RFXA 1TQCB 5E2VH 1CLZH 4N68A 4U2YA 5F7EL 3ARFC 2A74A 1S7QB 4ZO8A 5H94A 5EA0L 4E5XB 1XFPA 1HSBA 2H32A 2XZQH 4XWOD 3ULVC 3S97C 3C5ZB 2Q76B 1BAFL 4U6TA 4Y4FB 2X5PA 4TNVF 4FNLH 2FX7L 4U1HB 1FC1A 4KI5F 5BMFL 2BY0A 4NDMB 3X14A 4C56A 4M00A 3BGAA 1B88A 4JFHE 4TSBL 3FT2A 5FYLH 3L5IA 3ILQD 3VGAB 3CFEA 2VAJA 3ZE2E 3HMXH 4BQBA 5I6XB 5DA4A 3PIQB 3D25B 3F5WB 2JLLA 4F7MB 1SJVA 3IDNB 5CZXC 4FQHB 3RX8A 3N1GC 4X6FA 5DGQA 2R0KL 4IJ3C 3K0WA 4QRRA 4NN5B 4UDUB 3CLEH 4CAGA 4G80A 4R3SB 3HAEA 1GGIH 3MTRA 4JZJC 1XGRA 3K8KA 1IAII 5D70H 2EE3A 4TOYL 4PR5A 3ZO0A 2BJML 3QEQA 4XBGB 2HKFH 1BZ7A 1MRFH 4Z7VA 2MHAB 3P0VH 1TZHB 1T3FA 3D85A 3KS0J 1KNOA 1JNJA 1TXKA 4EBQL 2YK1H 5I15L 4O58L 5E4EC 1EA9C 5EO1A 3ZHDA 4ZOAA 4JFDB 4LSDA 1FG9C 4K71B 5GZOC 2JCCE 5HDQH 5L2KB 1WJ3A 4U1LA 3JWDH 2NQCA 2APTA 4O51B 3MR9B 4XMKH 1ZSDB 1E4XI 4WTXA 3UJJH 1NANH 5ESVA 2XA8L 4P5MA 4I18A 1BWMA 4LLUA 4M7KL 3IDXL 3SJVE 3DXAE 4A6YB 3ARFA 4PJCF 4HGWA 3ZKSD 5C6PB 3I2CL 1OGTB 4EDWL 3P9MA 5BVPH 1G9NL 4TUKH 5KANG 2NY6C 4EN3A 2DS4A 3FT4A 4YX2H 1ZGLA 1KCSL 4U1JB 4M6NL 4U1SA 3FT3A 4RFOH 2DBJA 5AWNL 3SDAD 4DEPB 5DHVH 1OGAB 4APQC 5BV7C 4OF3A 4FMKA 4LAQL 4ERSH 3Q5TA 1S7TA 4FTVB 2Y72A 4S1QH 4OGAC 3S3JA 5SWZB 3G5VB 5HHMB 2PNDA 2V7NB 4TSAH 1Q38A 4X6DA 1Q94A 4L5FH 1DL7H 3K3QA 5EPMB 4QHKI 4NO5A 5K9JL 4YBQC 2R0ZH 5F9JB 3MFGB 5I71C 2OP4L 1PKOA 2Y9RT 3DMMA 4YDLB 1INQA 2DQCL 3HFMH 5GGVH 1R5WA 2X4OA 5IG7A 4X7EC 4YGAB 4FXLA 3NA9H 4O2EB 4PJHF 3P11L 4A6YL 4PV9A 2LQRA 3GRWA 5JW5B 4AH2A 1E4JA 4L8SA 5D1QC 1IGFH 1DVFA 1RZIB 2D0GA 1UM5H 3BKMH 1U2CA 4QRRD 3OKOB 5T1KB 4N0UE 4PJ7E 4XX1E 2D9QB 1S7RA 2GY5A 5F1OB 4H0IA 4PIRF 2DF3A 4KMTL 3SCMD 1RZJL 3WHXB 1YNTA 4PD4J 2IH1A 3ARZA 5JPMA 4F33A 5D2LF 2AJSH 4WEBH 4HFUH 1TJHL 4XNQB 4JRXA 4E42B 5DQJA 2P45B 4Z8FL 5DUMH 2E9WA 2OJEB 4FFWD 3DRQA 4NBXB 1E27B 4N0CC 1Z9LA 3KLSA 4Y7MA 4CN6A 4ALAH 5F72S 2AXHA 4A2LA 1BVKA 2DI7A 3GSNH 3IFPA 4DAGL 3TJHC 3ZYIA 2B2XL 4OQ1A 1QEWB 4WNQB 5HHPB 5L6YH 4YIQB 3RL1A 4HS6A 4IS6B 1TLKA 3ARFD 5EZOH 2I9TB 3UTPE 5INDB 4A2MA 2A9NH 3VXTA 1G6RB 5H8DA 2N56A 3WNOA 4HXAH 5FGCB 3PV6A 4XC3H 1PKQB 3ULVD 1MAKA 4L4JA 2DN7A 4RBPK 1YY9C 3PWUA 3NIGE 4NPYA 3OJDA 3GJFK 4GW1A 4GRMA 4X99A 5I8CB 2P8PB 4O2CA 3OXSB 2NY4B 3SJVB 3DXAB 1I9JL 1MIMH 3S36X 4ZFFA 5F1IB 5IJVB 4N8VG 2BHYA 3SO3B 1G9ML 1PY4A 4NC2B 5F1NB 4DN4L 5CZXD 3WIHH 5JXEC 5BZDA 3LOWA 4MXVF 4PRHE 3VRIB 2YUZA 1J1PH 4PP1C 2NY3C 2AJVH 1MI5B 5DXWA 5FYLE 2OI9B 3HE6A 4NC0B 1PAMA 4Z95H 3WXWH 3GSXB 2HG5A 2HKHL 3BD4A 3MRQA 2BOBA 4YBHA 1WQVT 4MJ5A 1IGTA 5SX4I 1KUMA 3RPKA 1LNUA 4YE4L 1AGCB 5DRZB 2F19L 3EYFB 1QFUH 3HKFA 4GW5A 5CILL 3RX5A 3TA3B 1HEZA 2MJWA 2NW3A 1VFMA 5GRJL 2J6EL 4LSSL 1FLTX 4NQXA 4XXDA 1G6RL 2CMRH 3H3BC 4FXKA 4Y1AE 5GZOD 1DBMH 2ARJA 5IK3B 5L2JB 3WKML 5JXAL 5HPMB 4BH8A 4TVPD 2I07A 5HXMA 4RGOL 4EIGB 4LFHD 4Y89A 3UJIH 3GMNA 3PNWA 5LGJB 5GS0C 2R4RH 1OQOA 2IAMB 1IC7L 4EVNB 4X7FC 3GK8H 4NFBA 4DUVA 1VERA 3BRDA 5IR1A 5JDJA 2NY6D 5HYJE 1TTUA 4JFPB 1FFQA 1T7ZA 2GFBB 4JRXD 4HWNA 1VSCA 3VG0L 1I3GH 1WBYB 4NKMA 2E5EA 2XN9A 2XY2A 1AGFA 1XCQA 4R6UA 4N0UB 4APQD 2VDOL 2VXVH 1CDYA 1PG7L 1ZHLA 1UH4A 4JHBA 5J12B 1WEJL 3STZA 2QLVB 2DBLL 1JFQL 1JK8B 3N9GH 5JXEA 4GKSB 4UBDC 5I1AB 4OGAD 1T5XB 4HKZB 3MC0A 3VWJB 4KFZC 5EDXA 1C5BH 3U4BL 4ETYA 5ESQB 2DM2A 4CVWA 4YXLL 3R1GL 1DP0A 3D0VB 1X7QB 1DQDL 2FYYA 5I1IH 4YBQD 3ARQA 4TTGA 2B4CC 4LSVH 4P9HC 1RZ8A 5F7MC 4LCCC 1N7ML 3KPOA 4U0RC 2D7NA 4LASL 4YHPB 4PJBA 2AKRB 2XIDA 2VLJB 2W65A 3MCLH 4PD4K 1JRHI 2A1WH 3CFKB 5A40E 2A9ML 5JNYA 2AV1A 1T21A 4LNRB 3V6FA 4DFIA 1JV5B 4QF1A 2DQUL 5D1QD 5IF0A 3DX7A 1YMHB 3JV6A 4U1NB 1A14L 5BJTB 4CNIA 5CEZH 2K3TA 2OR7A 3AFLA 1DANT 3A67H 3H3KA 1TVBA 2G75A 2XPGB 4K7FB 1I7ZB 5FM4A 3UCRA 4JFEB 3P0YH 3DWTA 5I8KL 1WIUA 4X5WB 3GO1H 1M71A 1DQMH 1NEZA 1PGRB 3D1MC 4HUWB 3RWJA 5D4QA 4LF3B 5C8JA 2FWOA