1IGYB

Structure of immunoglobulin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
434
structure length
434
Chain Sequence
VKLQESGAELARPGASVKMSCKASGYTFTTYTIHWIKQRPGQGLEWIGYINPSSVYTNYNQRFKDKATLTRDRSSNTANIHLSSLTSDDSAVYYCVREGEVPYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDTLLITVTPKVTCVVVDISKDDPEVQFSWFVDNVEVHTAQTQPREEQFNSTFRVVSALPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGKPRAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQSDGQAPENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1 INTACT ANTIBODY MAB61.1.3
publication title Crystallographic structure of an intact IgG1 monoclonal antibody.
pubmed doi rcsb
total genus 45
structure length 434
sequence length 434
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB03
1QFOA 4Y4KC 3L5IA 1FVEB 3SDAD 1MY5A 3UC0H 4OF7A 1RHHB 4MJ6B 1BD2B 1JGLH 4YH6A 4H26B 3JTSA 5HD8D 1XGTA 4ZMAT 1JFQL 2J5LB 5ALCH 1MEXH 5EH1A 4BJLA 2QSCH 3HR5B 3L6FB 1SYSB 4MNHB 2BFVL 1CK0L 4JAMB 5GGQL 2MSPA 4ZS6C 5F7DA 7FABH 2FH6A 4MYWB 1Y6NR 2WM0A 4XVTL 3FQUA 1C5CH 2DQCH 2VDLL 2FGWL 2ZJSH 4XCYA 2EXWD 2ICWI 3ZKNC 2JCCF 1A0QL 4LHJB 2PXYB 4PJIB 4I0PA 4Y19E 3TIDB 2OMBA 3VFPA 3BZFA 1KIQB 2XTLA 1XIWB 3BEVB 2V5RA 1G7IA 3FB8B 3CIQA 4FN0A 4K3DH 4KROB 1LE9B 2AK4E 1QBLL 3OZ9L 4ZTPH 1DQQA 5MENA 5TDNA 4MX7A 4N90D 4X6DB 2RBLA 5F70A 5IOPA 3VJ6A 1YZZA 2OCFD 1J0HA 3F65A 4AH2A 5DUBB 3TO4D 3OJ2C 5DD0H 5TDPB 2VDOH 3V6FA 1R3HB 4S2SA 4YWGL 3UZEA 4ZOEA 5JPNA 4HUVA 3C8KB 1D5IL 3MJ9A 4WFHD 3MV7B 4LLUB 4ZQKA 4P2RA 2VE6A 2OL3L 3OAUL 5H2BB 1HEZB 3QIBD 5JDSB 4KQ4L 2Q20A 3OB8A 1S9XB 2J5LC 2DQDH 4G3YL 5IEKB 5BRZE 2ZP0T 3QQ3A 4G7YH 4PB0H 4KMTL 5C09E 1CFQA 2CLVA 3NVQA 4I2XA 4HWEH 3RA7H 4IJ3B 2O5ZL 3ZE1F 1KPVA 2P1YA 5I16B 4LQ1A 1WEJH 1I1FA 1V8HA 1IQWH 2ZUQB 5GHWL 5K9JH 4IRSD 2NZIA 5T3XH 1FRGL 4JDVA 4JKMA 3O6LH 1IFHL 2ZSWB 3HUJB 2HFFB 4HBCL 2R8SL 4UT7H 3VDCA 5B39B 2PXYC 1J8HD 3GO1L 4G6FB 2JF1A 1XCTB 1EHNA 2C4FU 4LVOB 3F7RA 3C6LD 3O45A 3DI2B 2WANA 4J1UB 3TBVA 1H15A 1R5IA 2YWYA 1QBML 1CFTA 4GRWB 1DE4A 1UWEH 4GSDL 3G5ZB 3WLWC 2AEPL 2ZZUT 1KXVC 2W07A 1W8OA 4IIQA 4MAUH 4ONHB 1G0YR 1PEWA 2CR3A 2Q7NA 1XR9B 4M93B 1YMMD 4NC1C 3FL7A 3D2UB 3GB7B 4RFNB 1SY6H 1WISA 4Y4KD 1QSVA 4Q9RH 3QWOB 3O9WB 3B9VA 4PJAA 5FYJU 3U79A 3N9GH 1N0XL 5IUSA 1RZGA 1A7QH 2F58H 4FQLH 5BJTB 4XNUL 1A9BA 3KR3H 1CGVA 2J8UF 1CD1A 3O3BB 4KKBC 4LHQB 5T1LD 3WIIH 3P73B 1P7KB 5IVOA 1OAYH 4O9HH 5L88H 3SJVE 3QULA 1C12B 4ZS6D 1CD0A 1E4WL 5DQJA 3MMEA 1I1AC 1QLEL 3BFOA 4Z0BL 3CDGB 3O4LB 5CP7B 4IJ3C 1I7ZB 1T21B 1BGXL 3SDAA 5T5NF 3HE6B 4MB4A 1YDPB 5J1AA 3ZKND 2HKFH 3V5HA 1KV3A 5I8CA 43CAA 3MBXL 4Q2ZA 4KXZI 4JFDE 3W39B 4Q97A 2BVYA 4XVSL 3PV6A 3MOAH 4HS3A 3O3AA 2YBRA 3MO1A 5ICZA 1DBMH 5SWSE 4M8QA 4F80A 5K59E 4LVOC 1HYSC 2DYPB 1OF2A 1YEJL 2ZSVA 4BM7A 1FYTD 3SDXB 5CJXA 1Q9WA 5B38A 1X9QA 3FO0H 5IHZA 2PCPB 4Q74A 3L3IA 3TNMA 5E2VH 5EZIL 2O93L 3WJJC 1OQXA 3VXRE 3BAEL 2HLAA 3O81A 3O9WC 4U0RB 1MVFA 1BD2D 1NH6A 3BX7C 5BVPH 1A4JA 2J7LA 5DA0B 1WF5A 2X4QA 4PJXF 1WCQA 5FGBA 1P53A 4AIZB 2AEWA 5IMMB 4F9PC 1CLOL 3IDXH 3TPUA 3M1BA 1SJEA 5BCAA 2QR0A 3TO4A 1GAFL 1E27B 3EYSH 3GHBL 4H88H 1A4KA 5INDB 5HHOB 1KB5H 1M7DB 3IVKA 2VTFA 1G7QA 4E0RB 1TETL 1TTUA 4IRZH 5F21B 3WNLA 1QSEB 4MLSA 3QIBA 5GISL 4A6YB 2JIXB 1NGXB 4QRRD 2PXYD 5ESVB 3UAJD 4OZGF 4I9WD 2DQEL 5LQBL 4OCMC 5BMFH 4ELKB 1ETZA 3B5HA 1J0YA 5DVLA 3C2AH 1FV1A 2J6EH 1ZK9A 4DUVA 3QWRA 3QNZA 2X1XR 3GK8L 2R39A 2YZ8A 4IRSA 2P7TB 4WI5A 3WLWD 2P45B 3PGCA 4NKDA 3TH2T 2DWDB 1HIMH 1MIMH 5DJYA 4U05A 2BDNL 4OLZL 3JUZA 1JYWA 1IGIH 1J8HA 2EH7H 5BS0B 3MACH 3OKDA 5DMJB 1N6QL 1BZ7A 4S1RH 1MNUL 1FZJB 1F02I 3WDJA 3EDKA 2R69H 3C6LA 4O4YL 3RA7L 3QDMD 3DX9A 2ZCHL 5I1JH 3UTSB 2JCCE 2DLEA 4KKBD 1MIEH 1SEQL 3MV7D 4K2UL 4JG0L 4EXPX 1JWMB 1RIHL 4OQTH 1JNLH 3VD4A 2VDRH 1ZSDB 1YMMA 2X5PA 1QRNA 3DV4B 5IP4A 1I1AD 1FGNH 2FWOB 1JZ3A 5D7LD 1G6VK 3QUXB 2PETA 1IC7H 5C2UB 3L5XH 2W9EH 5B22A 5L8KB 5EU7E 2EDWA 2HVJA 1AQKL 2IF7A 1LO2H 5ERWB 5DRZA 4FQCH 5CHNB 5EN2A 1Z2KA 5T1LA 4QYOA 3HG1E 5F9OL 3QHTC 3KYNB 2D7MA 3SY0B 5H94B 1MUJB 3KHQA 3KJ6L 3MUHL 4JHBA 4G6FD 1TQCC 4X7EC 4F7TA 1INQA 1HYSD 3DPBA 3A67H 3QDGE 3MXWL 4JO3H 3G6JA 2VXQH 1U8IB 5DVOA 3C09B 3P4LA 3DX8A 2P8MB 1CLCA 2DQJH 1HSBB 4ZFOB 3P77B 4WI2A 2OTPA 4KHXL 5J6GA 4LEOB 3JVGA 4MS8C 2APFA 4L5FH 3O9WD 2UYLA 4W4NA 5JOFB 5MP6H 5I19L 3PGDB 5IHLB 1RK0B 4ALAH 1NAMA 3I2CH 1ZLSL 3LS5L 1LEIA 2Q1EA 5CJOH 1FYTA 4TN9A 1PG7X 3VXQA 5GGRA 1A6TA 4KRMB 3MRIB 1OB1A 4CRPA 3PP3K 5T33L 3RP1A 1NDMA 4PG9A 1ZOXA 1HOCB 2P8LB 4P2QD 3D85B 4CU7A 1L7TL 5F7LB 4LAJH 3O4LD 1UYWH 5AZ2H 1MCWM 3QUXC 3WIHL 3K46A 5AUMB 1RHHA 4JHZA 1BD2A 4MJ6A 4H26A 4L4TB 5D4QA 5KOVC 4MQXC 3BSZH 2EH8H 5E2WL 3HNSH 1TJIL 3HR5A 3L6FA 4OCXL 4H20H 1SYSA 4OCYH 3EOTL 4MNHA 1XCQA 2DD8L 5E1AB 3VGDA 4JAMA 3BOVA 1T7VA 3VFTB 3P4MB 3WXVL 3WFHB 4KZDL 4X5XB 3TBWB 1KCUL 3IS0X 3GI8L 4GAJH 3O6KH 2J8UE 4LPCA 5FYJE 1FBIH 3GI9H 5GPRA 3CZJA 2DYPD 5C9JA 3HFML 4P9MH 1Z6JT 2CMRH 3IS1X 2RB8A 2GK0A 3BRFA 5BVPL 2PXYA 4PJIA 1CGXA 2LABA 3TIDA 1U8MB 2P5EB 1KIQA 4Q9QH 3MUZ1 1J12A 1YEHH 4Q58C 4DGVH 3K8LA 2DL9A 1P7QB 2UVFA 5IT2H 1FNSL 4YZFF 1JF1B 3MJ9H 5K9QI 1ZT4A 5DUPL 2A73B 2VJXA 1TZGL 3MRBA 4X6DA 4CJ1A 4WHTA 3WHXB 5TGBB 5DQ9A 4WO4B 2YXFA 4Z8FH 2UZYB 3OG6B 5DUBA 4N0UE 2AW2A 4MB5A 5E24E 5EZLA 3QDMA 1R3HA 3QHZH 2JJWA 4F3FB 3GBNH 1H8SA 2XOTA 3D39E 3C8KA 2NX5B 3MV7A 4LLUA 1I1RA 1QSED 2E9BA 4Y5XC 1HEZA 4YPGB 3UYRH 4YHPA 3PWNB 1S9XA 4NNYB 1N7MH 5IEKA 4N1HB 2QJDA 3RKDC 4JG1L 1I1AA 5GGVY 5CJ5A 5D7LA 1S7SB 2XQBH 4XGZB 3TZVB 5I16A 1VFAB 1FORH 2QTEA 4P9HL 1CDCA 4GRLB 4PJXE 5F89B 1V3KA 5JW4R 3WFCH 1MCFA 1WZ1H 2R4RH 3UPCA 2VXSH 2ZSWA 3HUJA 4RFOL 2HFFA 4X4YA 3MTRA 5SWZB 2YPKB 5B39A 2X4PB 4MS8D 5JOPE 3CVHL 1KYOK 4OIBA 1ZE3C 1FFNA 2BVOB 1YQ2A 3T0EB 3V0VB 1XCTA 1DN0B 2I5YL 2OR9L 4OTXL 1LGVA 2VR4A 4WUKL 3C5JB 4J1UA 3QBTB 2BNRE 3Q1SL 3G5ZA 1MLCB 3OF6D 4QT5B 2VLMD 2R2HB 2CLRB 4MVBC 4ONHA 1FG2B 3MV01 3D2UA 3GB7A 4JKWA 2WLYA 2X1WL 3WJJA 2VLKB 3QWOA 3O9WA 2FDBP 4IOFC 3QUXD 5KW9L 1KN4H 5AD0A 1IEBB 3PDDA 1KTDB 3PP3H 4U6VL 1A64A 5BOZG 5BJTA 4MQXD 4ZUWB 3DGGB 1DANT 2VH5L 3NCYS 1FNEB 1PZ5B 1T2JA 2ATPB 2X4SB 3P73A 1UKTA 1P6AB 1P7KA 4JJ5A 3V7AE 5ITBH 3W0WE 4LCYB 1C12A 1X5IA 1F97A 2VDQH 4KFZC 4P2QA 5KS9B 3TWCL 3CDGA 3O4LA 2ORBH 1TNNA 5CP7A 1I7ZA 1EUUA 1T21A 3TZVC 5KVMC 3IU4H 4Y5YB 3HE6A 1QHPA 4PG2C 1YDPA 4GRLC 1KJ2H 1OAQH 2PTVA 3W39A 4EIGB 4FXKB 2AXGB 1L6XA 5EU6E 4WUUE 1I9JL 4S1SH 1IBGL 1UQSA 4JPWH 1EHLL 5LKNA 2Z8SA 5K9OB 3HLAB 4LLVB 5ACZB 3NAAL 3RX5A 3TJEL 2QEJA 4FFWC 2DYPA 4KI5C 1UYWL 3NFNB 4WENB 3FO9B 4TSBH 4O2EB 3SDXA 3CC5B 3IJHB 3MV9E 5GS0C 4U3XA 1EK3A 3GRWA 4WEMB 2CDEB 2PCPA 4X5LA 4CDGC 2APBA 1D7FA 3D85D 3OKLB 4K71B 3X3FL 1ZANH 4LASH 3DVGB 1G7HB 1F3DH 2EYRB 1E0OB 2V6HA 4UB0L 3H3PL 1CGYA 3RKDD 1G6RL 4AIZA 5DI8B 2QADB 5IMMA 3GSWB 1S7TB 4OI9A 1QP1A 4OD2B 2X4OB 1E27A 4ELMF 3G5VB 3KXFB 3T0BA 5INDA 3AM8C 4LPXA 5H37G 3VA2C 3U82B 4E0RA 4UQ2B 2CIIB 1H3TA 3ARDB 3DWTA 4QRPE 1QSEA 4U6HB 1TQBB 1IRAY 2BRRH 4A6YA 5T5FH 5FOJA 1NGXA 5ESVA 1SM3H 3VGFA 1QSFB 4JKPH 2A6DB 2P24B 4ELKA 4QRQB 4X9HA 1K4DB 2MCPH 4PBWD 1F4WH 5F9JA 4LQFH 4M5ZH 5T1KB 1V05A 2P7TA 5EZOL 3RQ3A 2DWDA 1CVRA 1LD9B 4MVBD 3IDJB 4X5WA 4YK4B 5CGMA 1CTOA 1G7JB 3B5GA 3WXWL 2LVCA 2P42B 4IOFD 3BYYA 5BS0A 4K3EH 3LRSB 3KPPA 2X7LB 1NGQH 5JXEA 2BNQE 2VWEE 5CAYB 4HX1B 2XQBL 3MLPA 3WD5L 1PYWB 2GW5A 5JW3L 1DQDL 2NX5D 2OK0L 2H45A 3PIQA 3ZE0E 4X7CC 1JWMA 2ZPKH 1NMAL 1ACYL 1P84J 2DLTA 1ODAA 2NXZB 2NZ9C 2R4RL 3DV4A 1ZSDA 4KRNA 1J1OH 1I3UA 4AEHL 5IQ7H 5C71A 3A6BH 3CXDH 3FOLB 4PJGB 5C0AB 3QUXA 3TZVD 1RU9H 1N5YL 4IS6B 4HGWB 3SKOB 1CICB 4OV5A 4GRLD 4X7DC 1WZKA 5BOPA 3MJ8B 4L9LB 5ERWA 5CHNA 3ARDC 1CCZA 5FM8A 4HDIB 4DN4H 5SWZD 3CNKA 3KYNA 3SY0A 5H94A 1IGFH 3CH1B 4XXDB 4Z78B 1MUJA 1A2YB 2O5YH 4KKAC 4N0YL 5GZOC 5GRUL 3T0ED 3HHRB 4FFWD 5CD3A 3UJTH 4KI5D 1RZFH 4KVCH 1NAMH 1U8IA 1NCWL 2W0KA 2AJXL 2NY1B 3LKPB 4O02L 1UA6L 5GS0D 2XI9A 4OF8A 1HSBA 4ZFOA 1OAUL 1ZS8B 1B90A 1KBGH 1QA9A 3P77A 3T0AA 1AKJB 4Z7WF 3NA9H 4NQDD 1OL0A 4LEOA 1CR9H 3T08A 5JOFA 1FAIH 3BGAA 4QHUB 3PGDA 3CFCH 1RK0A 4KVNH 5D71H 5LJYH 5B8CB 1A7PL 2KH2B 4UILH 4NHCH 1TJHL 3KS0H 1D5MB 2VISB 2LQRA 3MRIA 4NOFA 4XCNB 1F45A 3FQXB 3O6MH 1KUMA 4L3CB 4UT9H 2NXZC 1HOCA 2P8LA 3PGFH 3D85A 6FABH 4JZOB 4M7KL 5AUMA 1CICC 3HRZB 2W0FB 2NW2B 1X5XA 1KJVB 3RFZC 2X4RB 5IQ9B 1OGAB 4PYHA 3FB5A 3FB6B 3U4EB 4XP9L 2VXUH 5ITFB 3P4MA 1H8NA 5HHMB 4X5XA 3WFHA 3TBWA 1KPUA 4ISVB 1KXTB 3HMWH 1OP5K 1AD9B 3HNTH 5KG9B 5C2BL 4KAQH 4JB9L 3MOQA 2QL1A 5F7WC 3OJVC 1RURH 1WFOA 4PJHF 4X8JB 3OKKB 2JELL 4OLXL 2VOTA 4NNPL 4OFPA 2BY3A 2ESVE 1U8MA 5I1CL 5H35B 2BERA 4DGYH 1FZOB 4PJBB 3RWJB 5B8CC 5HBBA 2A73A 1JIBA 5JIKA 4K3GA 2NZ9D 3WHXA 4AEIH 3RJQB 4GG6B 1MFEL 1ZT1B 4Y8DC 5HDQH 4U3HA 5DJ6B 5IB2B 5D1XB 4M1DL 1VGEH 4HKZB 3WNMA 4FQ1H 2VDNH 1CDHA 4HT1H 3HI1A 4XPGH 4BK4A 1H5BB 4WI6A 5JQ6L 3ARDD 2NX5A 4YR6A 2H2SC 4ZD3L 3LH2H 1TJGL 1I9RH 3LV3B 1BBDH 1ORSB 3VRLF 4YPGA 1KF9B 4M5ZL 3PWNA 2UZIL 5GGTA 2XXCB 4WW2F 3GIZL 4NNYA 3RWCB 4MMXC 3V79C 2EDKA 5F8RC 4R8WH 4KKAD 4DUXA 5GZOD 1QSFD 5GGUB 4PRNB 4PJCF 1S7SA 5T3XE 1H3PL 2VLRB 1F4YH 3TZVA 4ZUSA 5M94B 3KNBB 5HHXH 1VFAA 1X44A 4PG2A 4BELD 4GRLA 5F89A 4K3EL 4GRWH 3U4BH 5T1KD 1IKFH 1RY7B 3MLVH 3BPOB 2CRMA 3D9AH 1CZ8L 4X6BB 5SWZA 2YPKA 3RVUC 3V4UH 3NGBB 1V3LA 2HAZA 3S5LG 4FQIL 2BVOA 3ZL4H 1TITA 3T0EA 3V0VA 4QXUH 5EU4B 1DN0A 2EE6A 4G5ZH 1I8LC 1JZ8A 1DEDA 3C5JA 3W5MA 1MRFL 1UC6A 5EA0H 5FUOH 1JGUH 3LRHA 4I4WB 5FXCH 5HGDB 2CLRA 1RUAL 4UQ3B 4KUZH 3QUMH 3NCCB 2NXZD 1FG2A 4NQDA 4XTRC 4MAYB 3OGCB 4C57C 2VLKA 5HI5D 3BZEB 2YD2A 2C7UB 2DMCA 5CD5C 1IEBA 1KTDA 4RFEB 1CICD 2VZ3A 3KYAA 3QDJB 3OSKA 4ZUWA 1H5BC 1RZ7L 3DO7B 5BZWA 1FNEA 1PZ5A 4GUPB 5FOBB 2ATPA 1WZLA 2X4SA 4FOMA 4V2CB 4BFBD 3L95B 2ZOLB 5JXAH 4JQIH 4LCYA 1ZLUK 5K33A 1K5NB 1JF5A 4ETYA 3AM8A 5KS9A 1XZ0B 2W0PA 4MGXA 4NQCB 4NJ9H 3KPRE 1OD7A 3MFGB 4HWBL 4XPTL 1BZ9B 3NACL 3O6FB 3NABL 4RCAA 3EFDH 2APTA 1A22B 1PG7H 1OP5H 4UILL 3BPOC 2GT9B 2LTQB 3QCUL 3RVVC 1Q9OB 2AXGA 3GRWH 4K3HA 4JR9L 4LCIH 1FIEA 2Q3AA 1UENA 4WW1B 3AC0A 2MKLC 1B2WH 5K9OA 1WAAE 3HLAA 4EXKA 4LLVA 4CDHA 1DBKH 4JVUA 4DZ8B 2GJZB 3NFNA 3VI3F 3MNVB 1GZPB 4O2EA 4H8WL 1IE5A 3CC5A 3IJHA 4PRPB 1BX2B 1R3KB 4X7SH 3BO8B 3LEVH 3VG9B 2XY1A 2CDEA 5FKPA 2Y36L 1A3RH 2EE2A 5IGXH 4UAOB 3VH8G 3V6BR 1U0QA 5FYKL 3VFGH 3WFDL 2R2CA 4C56D 1N26A 3OKLA 4OFDA 5HYJB 3DVGA 2H2SD 2BX5A 3AB0B 2X2YA 1G7HA 2BSRB 2YR3A 2EYRA 1EMTL 1LEKB 5AYUH 4JHAL 1ZA6B 4Z7WE 2H2PC 4HS8L 5DI8A 1T2XA 1RURL 3GSWA 5GQBA 5ANMB 1JPTH 3Q2CA 1HHKA 3TNNB 2X4OA 3ARXA 2VN4A 4N8VG 5HHMD 4MCZA 3G5VA 2B0SH 3BZDA 4UQ2A 2DQTL 4CN4A 2CIIA 3ARDA 4U6HA 1MHCA 5J13B 5JR1L 3RVUD 1RUQH 2YWZA 3MJ7B 1K6QL 2AJ3A 1BOYA 1E4XL 1QSFA 3AREB 5F9AC 2R4SL 2BHUA 4YPJA 2A6DA 3EYQC 4MXWH 4NQEB 2P24A 4QRQA 2IQAB 2VC2H 4RWYL 5DMIL 1CGTA 5CJ8A 1CGSH 1K4DA 3V9FA 1MCOH 1SYVA 4XP6H 1OVZA 1K8IB 4HCRL 1B4JL 3K4DA 5T1KA 3VXME 1L0YA 4NWUH 2XWJB 4GXUM 4W6WB 3ETBF 4EUPG 5D7SH 4G8GB 1LD9A 4YDJA 3IDJA 1AXSB 1TDQA 3AROA 2EZ0C 4XTRD 1DSFH 5HHNB 1G7JA 1O0VA 3LIZL 1U3HB 3RL1B 4HV8B 3SKMB 5CD5D 5D1XD 1BAFH 2F54B 2ZUSA 4UAOC 5AYQA 3R8BB 3RRQA 5BO1H 5HYSG 3X12A 4HX1A 4PJHE 4OFIA 1FL6A 4MQSB 4JJHA 1YNLL 4DVRL 4YHOH 5ACMA 1CE1H 1ZHBB 4CW1B 3BJLA 2GJ6D 1OAKH 1BFOB 4KK6C 2F53B 2PYEE 2VLRD 3F7YB 3FOLA 3H42H 4PJGA 5FO8B 1JV5B 1QFWH 4HGWA 1ADQA 3U0TB 1CICA 3DRTB 1ZLUH 4ONFH 3MJ6A 1I8KA 4RSVA 1XGQB 3MJ8A 3P11H 4GO6B 3HE7B 3MRPA 5DMKB 1YEEH 3RVVD 4HDIA 5J13C 3BD4A 4EDWL 1WJ3A 5AG8A 1NFIB 3ZTJH 3CH1A 4Z78A 3JZ7A 1VADB 2BNUA 4NRYA 5DJAB 5DEFB 2Q6WB 3CCHB 4YHNB 1QYGL 1RMFH 3UTTE 3LPWA 2WMPA 2R23B 2X4TB 1KIRA 3OPZH 3BRDA 3ARRA 4RX4D 3LKPA 2IANE 4P3CH 4MXVF 1ZS8A 4PJCE 5SX5K 3CFIC 3GZKA 3QPXL 4PP1C 1AKJA 2DIAA 4Y19B 3N1PC 5A2IH 1FZKB 3I50H 3GSNB 3RIFK 1MCHA 3AS3A 2FEEL 4QHUA 4TRPH 5C08D 4XNZB 2YRPA 1IC5L 2BOCB 4MA7H 4WY7L 2EKSB 3U7WL 5B8CA 2C5DC 4LSTH 2AK4B 5HPOA 4NQVB 4FFYL 2QQQA 2H2PD 4NKOB 1AXIB 4WCYL 5ENWB 3QJHA 3QEGH 2K7QA 2VISA 2E8YA 3FQXA 1CGUA 1MCNA 2B5IB 1HILB 3OB0K 4OGXL 4L3CA 4WV1B 1JNNH 4LFHG 4UV4L 3GRWL 1DN2A 4C56A 1W72B 4JZOA 4NQCD 4HULB 3HRZA 1NBZB 2NW2A 2X4RA 5IQ9A 4NN5B 5TE6L 2NR6C 3EYQD 3Q3GB 5BRZB 3PHOB 3FB6A 3U4EA 5C09B 2BHYA 3V6OA 4QXGH 1BLNB 3QIWC 4D0DB 4ISVA 3RWHB 1U6AL 3DYMA 2ADIB 5JUEH 1AD9A 3T77A 5KG9A 2EIEA 1KTLB 5FUCE 4X8JA 2EZ0D 3OKKA 2AJUH 3QPQC 4P2RE 1NCAL 3G6JF 4A6YL 3I6GB 1T4KB 1I8LA 5T1MB 3BD3A 3GGWB 5E00A 4YNYB 5HDBE 1EA9C 3LPGA 5H35A 2HH0H 1NPUA 2R0LH 4CL7A 2HFTA 3CDFA 2XRAH 4PJBA 3RWJA 4YGAB 3RUGF 5FGCE 2H3NB 2B0SL 4PLOB 1TENA 3TCLB 5T3ZL 5DGQA 5GGTH 4KK6D 1HH6A 4P99A 1ZT1A 1AI1L 3ZT7A 1HQ4B 4LIQL 5DJ6A 1IAKA 1ZHKB 4XAWL 1Z9OA 2XKNB 5D1XA 1YA5A 4WV1C 4HKZA 1MJ7H 4P59H 4OB5H 4ZAKB 1H5BA 3VI3E 4EEEA 5JW4Q 3NPZB 2VC2L 5FK9A 1S7QB 2B4CL 3LV3A 2DICA 1ORSA 2ATKB 5D5MA 2XFXA 3LKNA 1MAML 5IBTH 3WSQL 2GSGB 2FX7H 3SJVB 1KTRL 5GGUA 4PRNA 1FFRA 2VLRA 1X6LA 1IM9B 2Q7YA 5LVEA 1MJUH 3KNBA 4MA8L 4FZ8L 2VDML 3OHXA 4CKVX 3WFBL 3X3GH 4BFEA 5I1GL 4R7NA 3ROOB 3U1SH 5GS0H 4JFDB 4PP1D 4IMKC 4K23H 4N1EA 3TH4T 2YD6A 3MUGB 5JW4N 5ABDE 4YX2L 4ZPVB 1EXUB 3GBML 3IXAB 5JORB 1AY1L 2F54D 5SX5H 3FO2B 5SWSB 1EIBA 1P1ZB 2GIYA 2X9WA 1A1NB 3UJIL 1YEFH 4LLDA 3UTZB 2FR4B 1GOFA 4RX4A 5TH2B 3VD7A 4I4WA 5HGDA 3C6SA 1LO4L 4UQ3A 5C6WH 3I9GL 3ES6B 3LRGA 4YHIA 3OAYK 1YPZB 2OTWB 3SCMB 1R5VB 3OGCA 3PWLB 4RAUB 1V3MA 4RMTA 4DW2L 1QLRB 5L6YH 1A1OB 2C7UA 3S3JA 3MREB 4ZUTA 5C08A 5HGGS 3VXRB 4FMKA 4RFEA 3OB0H 3QDJA 4X6DF 3H9SD 5DJ8B 1C5DB 3EYOB 5DT1L 4ZAKC 5IBUB 5IJVA 1Z5LB 3DO7A 1P4BH 2LVEA 3Q0HA 4GUPA 1PG7W 5FOBA 5IB3B 1NGWB 2NR6D 4YHLH 1HDMB 3L95A 2ZOLA 3TFKC 5FFLA 5AWNH 1K5NA 2DTML 3QIWD 3LEYH 1S5HB 1QLFB 1XZ0A 1G9MC 4PY7B 4XBEH 2FHFA 2XZQL 4K7PX 4NQCA 3G9VA 2B1HH 1LVEA 4X9FA 2VIRB 1C8PA 1KCKA 1E6OL 3EW3B 1MCSA 2VERN 1MWAH 2GY5A 4FFVC 2B2XH 4EUPH 5CIPB 3QPQD 4WEBL 2GT9A 4OD3H 1Q9OA 1MCDA 4J8RB 2X4NB 4Y19D 1Q38A 4HG4K 2FHCA 4NP4L 4WW1A 4N90E 4M6OH 1JWUB 2EKJA 1CXEA 7CGTA 3HUJF 3QXWA 4R4FL 4XCEB 2V17L 5DWUL 4DZ8A 1FNLA 3MNVA 4FQ2L 2Q8BH 1JPSL 1GGUA 1JE6A 1BX2A 3CFJB 1R3KA 3OGOE 5C0DA 3BO8A 4WFHE 3NTCH 3PG2A 25C8L 4N5UA 5SWQA 3C08H 4GRWF 4IEFB 5GJSH 2YK1L 3VFSA 1KCLA 4HLZG 3GMPB 3KYKL 2JCCB 2BSRA 1CDJA 2V5YA 2XA3A 5DYOB 4MXVE 1OM3L 4BQCA 5J56B 5IW6B 4EOWL 1ZA6A 2EC8A 1ZA3B 2A77L 4Q0XH 5E4EB 3LHPH 3A6CL 4YDKL 4M7JH 1MFBH 5BRZD 1FO0B 1U8PB 3BPNC 5ANMA 3VFOB 3IFLL 3TNNA 2DAVA 1CQYA 5CMAB 5I17B 2Y5TB 4HWZB 4DQOL 2Y06L 3THMH 1UGNA 3IF1B 4L4VD 1P4IL 3WN5B 4AL8H 4TOYH 3LVEA 3F7VA 4HZAA 2BVQB 4WTZG 32C2B 3NIGE 3SOBH 4YHZL 1GGIL 4HAFA 3O4OB 4N9GB 2CK0H 1CS6A 3HG1B 3BKYH 2A0LC 3VCLA 3AREA 3EO9H 1D6VH 1CBVH 5BZDA 3JWOC 4KPHH 1A9EB 1C1EL 1WBZA 4YE4L 2IQAA 4FQJH 1I3GL 3FFCB 1RJZB 5F7FA 3HKFA 1T03L 2F5BH 4XP1H 3QDGB 1RZJH 4W68A 1F6AB 4QRTA 3PP4H 2XWJA 4J23A 3WFZA 4JO2H 3VFVB 2X41A 2BK8A 5CWSB 4G8GA 5KVFH 2XZAL 4OIAA 1AXSA 1B3JA 3RVWC 4OLUH 1V7MH 1ERNA 1YN6B 1NC2B 2BSED 3GMOB 4U1SB 1AGBA 3RL1A 3ARVA 4ODUB 4GAGH 3SKMA 2F54A 3DVNB 1ADQH 1B6DA 3OAYH 4ZAKD 3CLFL 1DQJB 5EU5B 4JLRB 1UM4L 2WP3O 4OBSA 2QBWA 1ZHBA 3WBDA 3TFKD 4CW1A 1FL3B 2DQUH 1R3JB 1P5UA 1BFOA 2D3VA 2F53A 3UPRB 2FBOJ 3F7YA 5FO8A 4ZFGH 5HI3C 4FTVD 2Q3ZA 3RUGE 4X4MA 2CK2A 3U0TA 3DRTA 1XGQA 4FFVD 1GC1C 1X5GA 1MREH 5GSVB 5C6TH 4ODHL 4Z7VE 4KTEL 5BQ7B 3HE7A 4NT6B 1EEYB 1X5LA 3VDAA 4D9QD 5ADOH 5IR1B 1EFXB 5DMKA 4Y5VC 2HJLB 1IMHC 4F15B 3O4OC 3TBSA 3WJLA 3QIWA 4G42A 1VADA 1I3RB 4ZSOE 3T2QA 5D72L 1J86A 1T5WB 2DQIL 3NIFF 5DJAA 1DDHB 1MSPA 5SWSD 1J5OL 2Q6WA 2J8UB 4YHNA 5TE7H 5L6YL 4HUMB 1EAJA 4UTBL 1VPOH 2R23A 2X4TA 2C1PB 2HA1A 4AJ0A 2DN7A 2WSKA 2MQCA 4HJJL 1OW0C 4WVRA 1FNAA 1NANH 3E8UL 4Y19A 1QUNA 2R56L 3DHMA 3GSNA 4ETQB 3KWWB 1Y0LB 3AGVA 3VXRD 4UMGA 2BOCA 3LEYL 2EKSA 2ZNWA 1JGDA 1GGBL 1IGYB 4NQVA 2YKLH 2B1HL 5LG1A 3OXRB 3RAJH 4NKOA 1ED3B 3HI6L 4IOIB 5ENWA 2D03L 5LAXA 1KN2L 3K8MA 3RWEA 1WCBB 3GMNB 2AXFA 5DZLA 5JNYB 3JV4A 1HILA 4WV1A 1AE6L 5IIEB 4N0UB 4U33A 4QRRE 2EIZA 4LSUL 1W72A 4QTHB 1F8TH 4FNLL 3D39B 3ARPA 5JA9A 2JJUA 1O7SA 1ZGLP 4CVZB 2ITDB 1S9WB 3UEZA 2A0LD 1JGEB 1WIUA 2VYRE 3Q3GA 5BRZA 3PHOA 4LPWA 5C09A 2PTTB 4JRYD 4M7LH 4F15C 3R06A 4JO1L 4N0FB 3HN3A 4NC1E 3RWHA 4WEUD 2NY5C 3NZHL 3LMJH 1N4XL 4ZS7L 4PJXB 1T1XB 4WWID 3QAZB 4F33B 5HHQB 5HHVH 4IMKA 5C8JA 3QDME 4S10A 4NCC1 4DAGL 1NBYA 2CIKA 4LLQB 4NM8H 4ZNEE 1TXKA 3HAEG 3DMMB 5HPMB 1GSMA 5GJTH 4OCRH 5T1MA 4M7JL 3GGWA 2W91A 3JTTB 1PGRB 4XP4L 4YNYA 5D6DC 43C9A 3SE8L 2ADGB 5D7LE 4GAFB 2H3NA 4H1LG 3RHWK 5ADPL 2BNRB 5I73B 4ZODA 1LO0H 3TCLA 4JCMA 4F7MB 1YMHB 3KPSD 4Y4FB 2CKBL 2NTSP 1CWVA 1MFCH 3HC4H 2C9AA 4D9RD 1HQ4A 5HVWA 4JO4L 5HI3D 2XKNA 5GIRB 4GKZB 2YPVH 2X42A 2FZ3B 4XWGL 4FA8A 3MYZA 4IDLA 4ZAKA 3ZLQC 3H9YA 3SKJH 1DR9A 4IDJL 2IEPA 3TYFB 2MOVA 4YC2C 1S7QA 3VXPA 5I1IL 2VQ1B 4Y0GA 4KY1L 3IETB 1XF1A 2ATKA 3O2WL 1ZAGA 1BJ8A 5E2JA 3WNKA 4AIXA 1JI1A 3SJVA 3W0WB 5KVFL 2A9NL 3FFCD 4K7FB 1CFVL 3RGHA 1BOGB 4HK0B 3DUSB 5LXGL 4G8EA 4UT6H 3WUWB 3W5NA 3W2DH 4BZ2L 3QAZC 3ROOA 1ULVA 4UTAL 1A7RH 4JFDA 1ND0B 1UH3A 1NC2D 2DTSA 3DSFH 4AY0A 1DVFC 4HZLB 3MUGA 5EU6B 4WUUB 4ZPVA 3DMMC 3TVMB 3IXAA 5JORA 2ICWB 2YD5A 3FO2A 4C83A 5SWSA 2XWTB 1B0RA 5DRWB 1JHLL 3BP5B 3BIAX 1A1NA 1NGPL 4P2QE 1VSCA 3O4LE 3S97C 5TH2A 1PFCA 4GAYA 4M02A 4CUCA 1S7UA 2C3WA 2L4OA 5I73C 2AEQL 3MV9B 3VD3A 3ES6A 1OWRM 3V6ZB 5CGTA 1YPZA 3GSRB 3T4AB 2WUBH 1E28B 1JYVA 1R5VA 4U0QB 4RAUA 2L7JA 3QHFH 1FPTH 1PY4A 1QLRA 5IVXF 1HHJB 1G0XA 4JFEE 1LK3H 5B3JF 3MREA 4WU5A 3VXRA 3BRGC 4OZFG 5DJ8A 1OT1A 3EYOA 3MFFB 1NEZG 1VEMA 1Z5LA 2PO6B 2HN7B 5IB3A 1EO8H 1NGWA 1EFXD 2Z8WC 4QXTA 5HYFA 1HDMA 1MFDL 4FRWA 3O11B 1DP0A 5F96H 1HKLH 3L3DB 3BDXA 5F1KC 4GKNA 1FCGA 1NCCH 1QLFA 4LSQL 3HPLB 3EYUL 3M07A 1NKRA 4M1GL 5FYJD 1Z9MA 2DQFA 5DRXB 4R7DB 1IAIH 2FH8A 4QRPB 1J0IA 4H5SB 4TUJB 1B9ZA 3T8XB 5CIPA 3IAQA 3EUUA 1YEKL 1CDYA 4JRYA 1RFDH 5DUMH 1JWUA 3B4NA 4JY5L 5J12B 5IMKB 1MCLA 3OBAA 3TVMC 3U7AA 4XCEA 1AQDB 5DSCB 1RUPH 2JB5L 1Z0MA 4KJYB 2NY7L 1XGYH 1AD0B 2CJUH 2YD9A 2VXTH 3CFJA 4JGMA 2Z92B 4E42B 3GHEL 4CMHB 2AVGA 3NIFE 3H2WA 2NXYB 4JPVL 4KI5F 3RVXC 1LE5B 4LCCB 3N85H 2V2WB 1F4XH 3LKSA 2RFXB 4H25B 2GITB 2VAAB 2BNQB 1MCQA 1B4RA 3GMPA 2JCCA 3D39D 4Y2DB 1R3IH 2IMNA 1A6ZB 4FS0A 5ILTH 2E8ZA 2IFFH 3S3SA 5IW6A 3BVNA 3GMQA 4LVEA 2XQYK 1KEGH 1ZA3A 2HRPL 3KPSA 5TF1H 5F3BB 1PKOA 1FO0A 1U8PA 3ZYJA 4Z7UE 3VFOA 2FGZA 3LS4L 1OGTB 1G9NL 3FFDB 5CMAA 1HN1A 2DI9A 1ZTXH 5I17A 2Y5TA 4HWZA 2JJTC 1N6VA 3VGAB 2FX9H 1BFVH 4NGHH 5LCVH 2WBKA 2AJVL 3FQTB 3IF1A 1M05B 3WN5A 1IGTB 2NLJB 3CJJA 4N9OB 3LKOB 4PYGA 1I8IB 2BVQA 4FFZL 4Y5VA 3MRMA 4F58H 32C2A 4BSWB 2ARJQ 3FQNB 5KS9F 3I3DA 1DVFD 5ALBH 3N50A 3ZT5A 5JOPD 1NMBL 4NZRL 1J88A 3DMMD 1KJMB 1A9EA 1W0VB 2VLME 4D0CB 3FFCA 1M4KA 1QFUH 1CLZL 1MFCL 1RJZA 1VDGA 2JK5B 4BZ1H 3QNXA 3QDGA 4X6CE 2JJSC 5J12C 1CU4L 1F6AA 5CILH 1X4ZA 4JZNB 4YAQB 1DL7L 1OW0A 2FBJH 4MA1B 5I1LA 2A9ML 3VFVA 3E6FB 3FT3B 4HK3J 5CWSA 5I1HH 3HMXA 4IMLA 4PTUB 3DUUB 5DK2A 1NC2A 3QFJE 4U1SA 1DFBL 3IDNB 3CMGA 1AHWB 3IJSB 4CMHC 4MNQE 5C0FB 4ODUA 2QHRL 1X5HA 1UH2A 4R0LC 4XB7A 3DVNA 2WWKT 1UM5H 4W70A 5DC4B 3ESUF 1DQJA 2V5MA 2X10A 4LLWB 2I9TB 5DRNB 2OJEB 2VWEC 4ZG1A 5LBSH 2YD4A 1XR8A 1F58H 5EUKB 3ULVL 4G6JH 4Y2DC 4KKNA 1FL3A 2FRGP 3ARFC 2H1PH 1R3JA 2AGJL 1A7NH 1C5BL 1FFOA 2QV2A 1V7NH 3F7QA 5DDHA 3BT2H 4XRCB 4V1DE 3SGDH 3TT1L 4K94L 3LQMA 1QZ1A 4ORZC 3SGEI 4LSVH 4RZCB 2OQJB 3MLXH 1YEIH 5GSVA 5JIHA 3B83A 5IESL 5I30L 3L3JB 3AXLB 4NT6A 5I8KL 1OHQA 3V4PL 5IR1A 1EFXA 2F5AH 2R2EB 1J0ZA 5KJRL 2NY6B 3QIUB 2HJLA 4JY6B 1NAKH 3GSNH 4WUUD 2QQNL 1I3RA 3LPFA 1H3XA 3TVMD 1T5WA 2BSSB 3UJJH 4XNQB 1P6FA 3MRRA 4M6NL 3TIEB 4M5YL 5I1KL 5KTEH 2D7QA 2C1PA 5JHLH 3EJJX 5TE4H 5JOEA 4HIHA 5JO5B 1LDPH 4MA1C 2UUDK 5FB8B 2B8OT 1JTTA 3GSQB 2O5XH 1I75A 3RVXD 2ESVB 4OIIL 5E1HB 4XMLH 1YNKH 1UM6L 1MVUA 1EH9A 1IAOA 5D6DA 4ETQA 3KWWA 2BZDA 3HS0B 3REWB 4QO1A 1Y0LA 1W72H 2IC2A 4K7PH 1NMCB 3DECA 4KK9C 2XTJE 1OARL 1YECH 3R0MA 3RIAK 2QKIB 4MD0B 1IGYA 4HJ0C 1NLDL 1CYGA 5JZ7C 3OXRA 4UU9B 1ED3A 3VI4F 4IOIA 3OR6A 2UY7A 5FDWA 3MRGB 1WCBA 3GMNA 5EBMB 3QUYB 4YGVB 1IEAB 1N3NB 4G7VL 3S88H 4U1MB 5IIEA 3ZKMC 1F2QA 3BKJL 4CGTA 4QTHA 3MRCB 1ZLVK 2NTFB 5KAQG 4M9OA 4LHUD 3D39A 3GBLA 15C8L 1QFWM 1BJ1H 4WWKB 1KLGB 2ITDA 2J2ZA 1MCPL 4PJGF 1JGEA 3KYMA 5IVXE 2NY6C 2VN7A 2PTTA 4LNVA 5B3JE 3QI9B 4N0FA 3X11B 4YFLF 3MZGB 5EUOF 4BA8A 4HC1A 3T3PF 4L1DA 4PJXA 3VGHA 3RY4A 3HCVA 4KHTL 3FHAA 5D2NE 3LD8B 1QNZH 3QRGH 5M7QA 1DVFA 3PWPD 1R3IL 4LLQA 2F19L 5GZNC 1N64L 4K55A 2W65B 1OAXH 3DMMA 5HPMA 4YHKH 4LSRL 1JZ4A 1A6VL 5DMYA 2AEIT 1Q0YH 4YUEL 1PSKL 4IRJB 2BNQD 2ADGA 4NZUL 4O2CB 5F7NC 4NUGH 4LNRA 2JKXA 1NMCC 4UIKL 5ID0B 4Y2DD 4U4BA 5E56A 2I24N 2BNRA 3FQRB 1HK6A 3ARFD 1UACH 4HKXA 4MQ7A 3UROR 1YMHA 3MGTB 1H3UA 3NFPB 1YQVH 4TQEH 4M9PA 4AEFA 1JHKH 5I71B 1G9MH 4X9IA 3EYFA 5GIRA 1U8LB 1G84A 3T4YB 3QUYC 2FZ3A 2C3XA 1E6JH 3RWDB 4AG4H 1ORQB 3F62A 2SEBB 2IFGA 1T7YA 3OXSB 5TQ2L 3TYFA 4J7RA 4BFIB 4KC3B 4PGEB 2VQ1A 3CFBB 2NY4B 3IETA 3EJZC 1KXQE 4XP5H 4QTIL 4KI5E 4GXVH 1X5JA 3F58H 3UO1L 1GYAA 3QCVL 4FP8L 5I1HL 4OI8A 3NCEB 1XEDA 2FD6H 5I8EB 1AFVH 4J4PD 3MRKB 3I85A 4XPBH 2YA0A 1CL7L 1YEGH 4K7FA 3RI5F 3GNMH 4U1LB 3QI9C 4YXLL 4L8BB 1BOGA 4NQDE 5F6IB 3KPRB 3MLWH 3H0TB 1REIA 3DUSA 4YQXL 3QEHB 4XC1L 4I48B 4NC0B 3RZCC 2YSSB 4BYHA 3S4SB 3GKWL 3MA7B 1EO5A 1ND0A 3LD8C 1NSNL 1BEYL 4WUUA 4Z95L 1CFSB 5E8DL 3PJSB 3NBNA 2UUDH 3TVMA 2ICEB 2ICWA 4KK9D 1VERA 5J8OA 2XWTA 3SDCB 2IGFH 5DRWA 2MFNA 4HJ0D 4JFFD 2A83B 5IK3B 3BP5A 5JZ7D 4IRJC 4MMZC 4O5LH 1LILA 1MQKH 2DQHL 4OAWB 3NN8A 1A14L 3MXVL 4YXKH 3MV9A 4CN1A 2PTUA 3V6ZA 1E4XI 3GSRA 3P30L 3T4AA 4DTGL 1E28A 1G9EA 4R90L 3ZKMD 5CZVL 3BYTA 5IB1B 5I76B 4LOUC 1HHJA 1A5FL 1WFNA 2OXHA 3MCG1 3BUYB 3SDYH 1TMCB 3MFFA 2PO6A 2VLJE 2HN7A 1X5YA 1ZLVH 1ZEAH 2OJZH 5CIPH 1KB5B 1T0PB 2NY4C 4Z7WB 2NY6D 3MCKB 3JWOH 3O11A 1Z3GH 1FIGH 1RZ8A 4PJDF 2FATH 2JJTA 2Z91B 2MPAL 4RISH 1UWGH 3HPLA 2OZ4L 4J6RL 5CCKL 5D5MF 5KSBF 5DRXA 5DD1L 4ZYKA 3WNPA 5F6IC 2N4IA 3TYGH 4H5SA 4TUJA 1UB5B 4OGYL 3V0WL 1OLLA 3T8XA 1LMKA 5GZND 1DBAH 5CSBA 4NQXA 2ENYA 2OX5A 2ESVD 5EWIH 1I9IL 1RK1B 4MDIB 5LGJA 2D7TL 4LKXB 2G60L 5IMKA 3EJYC 1X7QB 3WNNA 3RTQB 5CEZH 1CE6B 1AQDA 5DSCA 5DD6B 4XNXH 2D0HA 3VXMB 4KDWA 4KJYA 2ZCLH 1TVHB 4OM1H 5ISZD 1AD0A 3NFSL 5DHVB 2FJFB 1V5JA 4EQ3A 2Z92A 2NYYC 5A2JH 1CLYH 4R0LA 5BXFB 1LE5A 3QUYD 5IFAL 4S1QL 5FKAB 2V2WA 3EO1B 2RFXA 1JRHL 4YHMH 3V5KB 12E8L 4H25A 5I1EL 4OI7A 2BJMH 1GC1H 2GITA 4I77L 2VAAA 1TCRA 2BNQA 4XPHL 2NY2C 5GGVL 4B53A 3DROA 4PJHB 3HI5H 4HUXB 3MLZL 35C8L 3EJZD 4M62H 4QY8B 4Y2DA 1A6ZA 1HCFX 3VG0H 3BKCL 4UIMB 3GUTB 1ZHNB 3MBEB 1RD6A 4HQQH 4L9DA 3D18B 5F3BA 3QQ4B 4U6YB 2HJFB 3LQAC 2AJSH 4I3RH 2PYEB 3FFDA 3QI9D 2HFEB 2FEEI 1NL0L 4LHUG 3BWUC 3FQTA 4TSCH 3VI4E 1M05A 1IGTA 2NLJA 3RZCD 2WZPD 1QTYT 3LKOA 1I8IA 4WI4A 4BSWA 3FCTB 3HMXH 3FQNA 2W9DH 4OD1L 3NA4A 4JN1L 4YEEA 1QACA 1C16B 3EHBC 4KQ3L 1SQ2N 5EBWB 2I27N 1KJMA 4J4PA 1W0VA 4UBDC 4XAKD 5H8DA 1LHZA 3ZTNH 2JK5A 4IRJD 3LN5A 2QQKH 4P23B 1IM3B 1U3JA 1HINL 4HXBH 3GJFB 4ODVL 3QZWA 4JZNA 3FN0L 4ONGL 3RTQC 3UTTB 5KN5A 4WW2B 3E6FA 2ITCA 1QBAA 3FT3A 1S5IL 4UV7L 4WNQB 1AGFB 3SE9L 2IANB 2LAAA 4HWUA 4PTUA 3ZDYF 4HUNB 3DXAB 4LSSH 4PJCB 1IGCH 4ODSH 1YYML 2Y1VA 3IDNA 4LOUD 1U93B 1N2RB 1AHWA 2J12B 3IJSA 5C0FA 4KZEL 5EUOE 3MLUH 3T3PE 3VGBA 3QCTL 3QXTA 4K8RC 1RI8A 1UJTA 2I9TA 5DRNA 2OJEA 4GMTH 2NY4D 4NO2B 3RU8L 5KSUB 4XCYB 4XRCA 4Y88A 4ESKA 2NY3B 3CLEL 5IVNA 3BKML 3CK0H 4I0PB 4RZCA 5FYJH 4JZJB 3CFKA 1FVCA 4WI9A 3L3JA 3RHWF 3AXLA 1NCDL 3DYPA 4XMPH 1ACZA 4XPAL 2N56A 1LWRA 2D9QB 2R2EA 5EULV 4TNVK 5A2KH 4HXAL 4DGIL 1XH3B 1EBPA 5TDNB 5JMOC 3EJYD 2DLFH 2BSSA 4XNQA 4YXHL 2JB6B 1KCRL 3H3BC 2IPTL 3TIEA 4AH2B 2AABL 3KPQB 5AZEH 3P2TA 4GS7B 1FVDB 4HEME 1T1YB 4C56E 4XXCC 5IHUL 1IC4H 5JO5A 5FB8A 2R0ZL 1BQLL 4JDTL 5FYLL 2NYYD 3GSQA 1UKSA 4S2SB 3A0OA 3VD9A 2ESVA 5JPNB 1MAKA 4P2RB 4Z6AT 2VL5B 3HS0A 3REWA 3RL2B 4TTGA 1J7VR 1ZV5A 2NY2D 3RBSA 3CVIH 5F93C 2QKIA 1LQSR 3J8F7 5I74B 4LARL 5T1DL 5EO9B 5FGCB 4HIXL 4UU9A 4LK4A 4DKEL 2IAMB 3P0YH 3NZ8B 1FJ1A 5LWYH 3S36X 3O2VL 2R15A 3QUYA 1UZ8A 1IEAA 1N3NA 2ZUVA 4U1MA 4XZUB 1FP5A 2NY3C 3MRCA 2NTFA 1CFNA 4OT1L 4HC1H 4POYA 1CT8B 3BPLC 4AQ1B 1KG0B 5DK0A 4JZJC 3MRQB 4NM4H 4POUB 2BP3A 3FQWA 3O45B 1CD9B 3EHBD 2C26A 1H3GA 3O2DL 1NCBH 1CFTB 4UBDD 5KVDL 1DQMH 3EKCA 3QI9A 2ILLA 2K1MA 5C07D 2EIDA 1FO0L 3X11A 2D7PA 2WQRA 1JPST 2HYMA 3RTQD 5I9QB 1WK0A 4GS7C 5DC9B 4GW5B 4URTB 4PJDE 4Q9CA 3NCJL 4HHAB 2W65A 1LO3L 4Q7DA 2RJMA 5D5ME 4K8RD 5KSBE 3MLTA 1X5ZA 2NY0B 1RIUH 4U1JB 4N8CL 2GJ6E 3GJEB 4IRJA 1P9MA 2KZ1B 2DJSA 4O2CA 5KSAB 2YD1A 3MA9L 2VLRE 2DBJA 3IFOB 5DQJB 2VXVL 5ID0A 1RZIA 3FQRA 3VGGA 1GGTA 3KPTA 2AK1H 5I74C 3HNVH 3MGTA 3NFPA 4U6XB 1N8ZA 1T04B 1EEUA 2IAMC 5DEGA 1GH7A 43CAB 4F8QA 1YYLL 1U8LA 2PYED 3T4YA 4OQ1A 3V0AC 3RWDA 1ORQA 5B4MC 1GHFH 2VKXA 3VWKC 1OTSC 4BFIA 1HHIB 3DHJA 4WDIB 3O3AB 4PGEA 1BJMA 1RUKH 2YBRB 2ADFH 3MO1B 3U9PL 3CH8A 3CFBA 2EE3A 4U1NB 4JFZL 3KJ4B 4MJIE 3EO0B 1OF2B 1IT9H 1DLFH 1KJ2B 5I8EA 1RAMA 3MRKA 3S37X 1MF2H 3CSBA 3U7YH 4LSPH 5B38B 4L8BA 3KPRA 3H0TA 2ZNXA 4JPIA 3QEHA 1L0QA 4LMQI 2E9WA 1VKXB 1OAZL 4I48A 4QHKJ 3I6LD 2MCG1 5C08E 3S4SA 5I9QC 3WL9A 5TFSH 2IAND 3DXAD 1U8NB 4NQSB 2OP4H 1KT2B 1YUHA 1AXTL 1CFSA 3FMGH 3PJSA 3VW3L 2ICEA 1J1PH 4M3JA 1WAAA 1F3DJ 1OD9A 2EC9U 4BUGA 1IKNC 2NY0C 2A83A 2NY5L 2DKUA 3GKZA 1MRCH 4RMQA 4X9GA 4H0IA 3IDGB 1KACB 4OAWA 5KSAC 1J05A 1CVSC 2RR3A 2IBZX 3RWFA 2HKHL 4HS6B 3HRPA 4OUUB 2VKWA 1TVDA 1A7OL 1I4FB 4MHHG 5FUZL 4R26H 2X6MA 1WT5C 2NY3D 2Q8AH 3QIBB 5IB1A 3L3OB 1T7WA 1VFBB 4XMKL 1BMGA 4EDXB 1UCBH 4XCFH 2HG5B 4M00A 2DM4A 4G6MH 1MI5D 3P9MB 2EICA 3ZDYE 2C3HA 2I60L 3TEUA 3RY5A 3C8DA 3MCLH 1HCVA 3V8OA 3ZYZA 4Z7WA 3MCKA 3KJ4C 3GSVB 4IRSB 1MHPH 2Z91A 4CNIB 3IKKA 4B7IA 2WV3A 4M4PA 2YPLD 4KDTC 5DR5L 3T1WA 2FX8H 2XA8L 3ELAT 4UDUA 2XN9E 2BOBB 4HIEB 3MLRH 2M8XA 1NBVH 4G6KH 1BZ7B 1NUDA 1UB5A 5C86A 3P3YA 2EO9A 2G75A 3DURA 4EIZC 1VFUA 3EDFA 3JV0A 4M43H 3IFNL 2D7OA 4EBQL 2KQMA 1F4HA 2BVTA 3ARTA 1KENH 3QJFB 1RK1A 3VMOA 4MDIA 2B1AH 3TT3H 1AR1C 4LKXA 4LRNL 4JM4H 3ULUC 1INDH 1RULL 2DKSA 4OM0L 3KLHC 1X7QA 5E5RB 4GRMB 5ANME 2RCSL 3RTQA 1SBSL 3S34H 1CE6A 4Y4KB 4R9HA 5DD3H 1IARB 5D8JH 5SX4H 1MLBB 3VXMA 4B41A 5DHVA 4NNXB 1ZMYA 2DKMA 1OSPH 4PS4L 2IAMD 3H9ZA 3T2NL 5K59F 5BXFA 4F57L 3UDWC 5FKAA 1ONQB 3EO1A 5DD5L 5FCUH 5B4MD 2XZCH 5T1LB 3VWKD 3V5KA 1OTSD 1LNUB 1KNOB 4PJHA 1UJ3B 4PLJC 2BY1A 5DLML 5TDOB 4QY8A 3VXUD 1YPZF 4F7TB 1INQB 4UIMA 3WNOA 2MHAB 5BV7B 3GUTA 1M6OB 3MBEA 3MRHB 3D18A 5CUSL 2HJFA 5IFJA 4XPFL 1CF8H 2PYEA 2HRLA 4KXZH 2F8XC 1F42A 3ZDXE 4X6EA 1UXSA 2G5BA 3RUGB 2DM7A 4FABL 4ZOBA 3RIAF 1RZKL 5I1AA 4KTDH 2GAZA 4Z7VB 5F97E 3FCTA 5ACLA 1KJ3H 1T2QL 2XZZA 2DI8A 1IAIM 4QHLB 1DBJL 1F90H 4W81A 1C16A 5BVJA 5CLTA 5EBWA 1LEIB 3HNVL 4ZSOB 2IWGA 3JWNC 5IKCB 5L9DL 2OM5A 3UXFA 5IFHH 2NY0D 1OB1B 1GIGH 3VRIB 4P23A 2BY0A 1EGJL 3GJFA 3KS0J 1X6NA 4XVJL 5KSAD 2R0KH 4XXCA 1TZHB 3AMLA 4WW2A 3U0WL 4LU5L 4WNQA 5L8LB 3CMOH 1AGFA 1VA9A 4X4ME 2IANA 3H9SE 3DXAA 2F15A 2A1WH 4PJCA 4TVPH 1TVBB 4RBPK 1A3LH 1N59B 1U93A 1N2RA 1WVZA 3MOBH 1WC7B 4PRHD 5DZOA 1XF4A 5E9DD 3R1GL 5HY9B 1XCQB 5E7FA 2ZKHL 1IGMH 1UJ3C 1JK8B 1UVQB 2CGRH 3DYOA 4NO2A 4GQPH 5F7KC 5C9JB 5BV7C 5KSUA 4TSAL 3PDGA 2GK0B 4QRRB 3UBXG 1MCRA 4UINH 1MI5A 4JZJA 2OS7A 4PGBB 3MPCA 1J1PL 1GL4B 1S9VB 1ZVHA 3JWDC 3B2VL 5HYEA 5FHAL 4LGSB 1I85C 2DDQH 4HFUL 2DI7A 1NEUA 1U36A 1AR1D 1XH3A 3L3GB 5EORL 3G6DH 3ULUD 1ZT4B 4JFXB 3SHSA 4RGOH 3KLHD 3MRBB 3GSXA 4WHTB 4YDLB 5IB4B 2JB6A 4XCCL 1RVFH 5DQ9B 4ZO9A 2D9CA 4LAQL 3KPQA 2OXGA 4LDOB 4WHYG 1U3ZA 1FVDA 3QO1B 3IDYB 1T1YA 1L9MA 1JP5A 5KVEH 2Y07H 5EZLB 3QDMB 3L3HB 4O58L 2UZXB 2EEBA 3W9EB 3WKMH 3TM6A 2VL5A 3FOMB 1CN4A 3RL2A 2DJ4A 3IT8D 4YHPB 5E6IC 1NDGB 3SEPA 4PLJD 2XV6B 4P3WA 3UPAA 1I1AB 3NH7H 4DFIA 4MDJA 2MJWA 5D7LB 5EO9A 1F6FB 4JHWH 4M7ZB 3QFDB 3QG7H 3Q6FB 4L4VE 5DFWH 2IAMA 5A2FA 3NZ8A 4NWTH 1WTLA 1ZHLB 2WQ8A 2X40A 4ODTH 2YMXL 2AI0H 3RY6C 3VWKA 4XZUA 2GTZB 4X4YB 4OFVA 2YN5A 4XNYL 3S35H 5I15L 1CT8A 3BDYH 1KCVL 1KG0A 1FFNB 4YDIH 1FN4B 3MLYH 3MRQA 5HVGB 4HIJA 4JFPB 2HTKC 2LAGB 4PJEE 4PUBL 1CIDA 4I18C 1BF8A 1Q1JH 1N6UA 1YJDL 4QWWC 1BM3L 2VR5A 5FGSA 5GSRB 1TTFA 4TUOB 5E2TL 1FLRL 4OLYL 4YDLC 5SX4I 4LVNB 4MNGE 5AD0B 4GW5A 1PDKA 3IDYC 4IHOB 4KJPC 5EZJA 4HHAA 3BI9X 1EPFA 5KANI 2C1OB 2O61B 4X4ZA 1S3KH 3TESA 4P49A 4U1JA 4J3TA 3GJEA 4JJ5B 1UT9A 1MJ8H 1WV7T 4P5TB 3QUMB 4RBPH 1Q72L 1JZ2A 3DX7A 3I3EA 5KSAA 4DWHA 3IFOA 5GRWA 4IM8A 4FTVE 4P2QB 3V4VH 3ARYA 3GMMB 4KTDL 1FHGA 1WT5A 4U6XA 3T09A 4M7ZC 1T04A 2PW2B 4D9QE 1F3RB 4PRHA 5FF6B 1K2DB 5E2UH 4UUJA 2FB4L 4PB9H 5E9DA 1DCLA 4JFEB 2VL4A 4OLWL 2IBGA 1H8OA 2D0FA 4NN6C 1HHIA 1UQSB 4WDIA 3NCFB 1A3QA 3V52L 1KEML 5IBUG 4U1NA 2WUCL 3BUTA 1BPVA 4U1GC 3EO0A 5C0IB 2CRIA 2A2QT 2CRZA 3GJFK 1KJ2A 2FLRT 4KDTA 3P0VH 3UC0L 5T3ZE 1JGLL 5FHBH 2EIBA 3FRPG 3KHOA 3ILQC 1YPZE 5ALCL 1JF6A 4NBYB 5DURB 1MEXL 1VKXA 2QSCL 4OLVH 1L7IH 4QGTA 4WI3A 5DK3A 1XF5B 4LVNC 7FABL 1U8NA 4NQSA 1KT2A 4BQ9A 1C5CL 5E8EB 2DQCL 5E6ID 4WFGE 1CXFA 2ZJSL 4DN3H 4Y4HB 3F8UB 4P5TC 4NJAH 3IDGA 4R2GC 4RGMB 3LQAH 4HS6A 4RAVA 3M45A 4OUUA 3UDWA 1KELH 1I4FA 1AGEB 4JE4B 4K3DL 2BVPA 3L3OA 2J4WH 1VFBA 4EDXA 2GY7B 2HG5A 1JGVH 5GRJH 5I6XB 4HLJA 4ZTPL 4K3JH 1G7MA 4FQHB 5MI0C 1INEH 4JRYE 3P9MA 2FCBA 1TQCB 2HTKD 5J06A 4F37K 1F3JB 3SO5A 4EN3C 3BGMB 3MUY1 4LEXH 4Y8AA 2RHEA 4QWWD 5DD0L 1F13A 5F9JB 3GSVA 2VDOL 4QRUA 1FE8H 5LGHH 2K3TA 4Z7UB 4CNIA 2H8PB 5DFVC 4XBPB 4X5WB 4GQ9H 2VDKH 2DQGH 1AJ7H 5A16B 2BOBA 4HIEA 5ETUB 2DBLH 5K93A 2DQDL 4G7YL 4PB0L 3KPPB 5DHVH 1P69B 4HWEL 4KJPD 3TLRA 2EDJA 5CEZE 4Z7OF 4RWHA 4NBZB 2E7CA 1SBBA 4TUKH 1PW3A 3QJFA 3S36H 1PKQA 3VFNA 3PIQB 3MROB 4K8RH 3N1FC 1WEJL 3LZFH 3P4NB 3KPSE 1IQWL 3H3KA 4GRMA 5K9JL 4D9RE 5FEBA 5T3XL 4X6CB 1O5DT 3O6LL 4Y4KA 4Y4HC 1DQLH 4UT7L 3B3IB 1MLBA 4JY4A 5GRVL 1J87A 4RA3A 4NNXA 1FGVH 2Z35B 4OV5B 3CX5K 4RGMC 4TNVF 3QFJB 5F6HJ 2VMFA 4OZHE 4MNQB 1ONQA 5I1DB 4PIRF 4XC3H 1LNUA 4BUHA 1UWEL 5E99H 4B50A 5I6XC 1KNOA 2KZWA 1KGCE 1E4KC 1UJ3A 5TDOA 3M8OH 3FFCE 1Q0XH 4MAUL 4ZDHB 4LPYA 2MHAA 4PRDB 3D69B 4AMKH 5CD3B 1SY6L 3DUHA 4Q9RL 1M6OA 3SPVB 3MRHA 2R0WH 3N9GL 5ESAB 1A7QL 2F58L 3WFEH 4JANB 4FQLL 4V1DB 3ILQD 9CGTA 3KR3L 1SMAA 1QA9B 4KK8C 3RUGA 3D0VB 3GJFH 1WWBX 3WIIL 8CGTA 1OAYL 1I85A 4O9HL 5L88L 4S1DC 4Z7VA 1FFPA 3UTQB 1DBBH 4QHLA 1HSAB 1RJLB 5D2LF 4MHHI 5F7UA 4TPRH 3ZE2F 4ZSOA 5DTFB 5IKCA 4ZTOH 3QUZB 5F71A 2HKFL 4P5TD 3VRIA 1HNFA 2E7LC 5FV1L 1TZHA 1GOHA 1GPOH 3MOAL 4KV5E 4C4KO 5TPWH 1EUTA 4Y5XB 1TVBA 1TTGA 1DBML 4LPUA 2EYSB 1N59A 3QEQB 1WC7A 3GMLB 3Q6GH 3OAZH 5E6IA 1FC2D 3S37H 4OF6A 2HWZH 3DIFA 4JFED 3FB5B 2X89D 1AC0A 5HY9A 3LEXB 5T5NG 5F7HA 2XTJB 2E27H 4KKLC 4EN3D 2X9XA 1JK8A 1UVQA 3FO0L 1KPUB 3KPLB 8FABB 3SDDB 5HI4C 3RY6A 1RV6X 5E2VL 1L7IL 1TPXB 3B9KC 1J1XH 3QH3A 4BQBA 5DFVD 2R1WB 3HR6A 2W60A 3ZE0F 4QRRA 1S7VA 4CU6A 3H7BA 1OCWH 4NKQB 4PGBA 5DURD 1S9VA 5CEXA 3RDTC 4GKSB 3S5LB 3IDXL 4K7PY 1BQHG 4I18A 3AU1B 4PV8A 2M1KA 3QQNA 3EYSL 5IVXB 4H88L 3L3GA 1KB5L 4JFXA 1D9KC 1KOAA 4IRZL 5IB4A 4MQTB 5FO7A 4Y4HD 3KLAB 3QUZC 2AJYH 3VFRA 1JMXA 2P4AB 2HLFC 2XNAB 1T3FA 3QO1A 4O00A 1AGDB 5D2NB 3HI1B 4HIIA 5BMFL 2ED8A 3C2AL 3L3HA 4YR6B 3L1OH 4ZNEA 2J6EL 2R29H 1NLBH 3W9EA 5L0QB 3FOMA 1CL7I 5IM7B 1KB9K 4I0CC 1JWSB 4CADA 1NDGA 3MLSH 3RZWA 1HIML 1MIML 4HMCA 5EO1B 3BEWB 2GKIA 1AP2B 2XTJC 1KLUB 4M1CC 4ZUSB 3VWJC 4DUWA 2HTLC 5JPMB 3FTGB 4Y1AB 1IGIL 3QFDA 3Q6FA 2EH7L 3MACL 2PR4H 1FDLH 4S1RL 1ZHLA 5E08H 3SDDC 4HPOH 2R69L 3TV3H 1DUZB 1TPXC 5I1JL 2J1KA 4LF3A 4KK8D 2GTZA 4P4KB 1MIEL 4B0MM 3PWUB 4MD4B 2EDHA 4NZTH 4OQTL 1JNLL 1FN4A 2VDRL 4JFPA 2H32H 4NPYB 1FGNL 3L5HA 3JV6A 1IQDB 1DQLL 1HZHH 1U8QA 2NNAB 5C0JB 1IC7L 4ZUVB 3L5XL 2W9EL 1CI5A 2R1YB 4UDTB 2WBJC 4HF5H 1LO2L 5GSRA 5CP3A 4TUOA 3D3VE 4FQCL 4RNRB 4NQDB 4OF3A 2GEEA 5FM4A 4WFFE 4D3CH 2BMKA 3WUWG 4IHOA 3HC3H 5D2NC 4LCWE 4D0BB 3QFJD 4WTWA 1EAPA 1ZVSA 3A67L 5BZWB 2R2BA 2C1OA 2O61A 4JO3L 1A47A 2VXQL 4MNQD 4F9PA 1KFAH 1I7TB 3W82A 1S9YA 5L0QC 3UBXI 4P5TA 3QUMA 4KKLD 2WBWB 2DQJL 5L7XH 2P5WE 1SMOA 4Z7OE 1H3WM 5HI4D 2OBGA 3INUH 3QDAA 1UZ6F 4GMSH 3B9KD 3ROLB 3GMMA 4L5FL 1Z9LA 3D25B 5MP6L 2PW2A 5F7YC 1MCIA 1D5BB 3U48A 4JM2C 4DEPB 5FF6A 1K2DA 1WBYA 5A3IC 4ALAL 4RMUA 4V1DD 4FG6C 3I2CL 4JFEA 3S96A 5C7XH 3SE4C 5C0RH 5CJOL 2HT3C 4P4KC 3CVHB 3RDTD 4EQ2A 4NO5B 5E95B 3BMWA 3ECBB 4ODXB 2VLJB 1ITCA 2IQ9H 1NGYA 1R0AH 5EIQA 3T1FB 5C0IA 3JSSA 4S0SD 1RIVH 2WLZA 3KLDA 1D9KD 3PL6B 3ULUH 5AZ2L 1MWAB 4XNMB 1JYXA 3BESR 3U4AA 4EUPB 3QUZD 1F11A 1EJOH 2HLFD 3BSZL 2EH8L 5FKPB 1KCSH 2CXGA 3HNSL 3P9WB 4JFOB 4H20L 4OCYL 3T3MF 3VE0B 4P2CG 4M4RA 2VABB 1XF5A 4E5XB 3L7FB 4J12A 3DV6B 4Q6IC 4P4RB 1T1ZB 4GAJL 3QEQD 3O6KL 5CINH 1FBIL 4M6AA 4HWNA 3GI9L 5E8EA 3FO1B 5B21A 4P9ML 4UOJA 2CMRL 4Y4HA 4OJFH 1H9VA 2XTJD 4M1CD 1HHKB 3VWJD 3OX8A 5F7EH 3MV11 4NO3B 5EPMB 2HTLD 1GGCH 4X4XB 4MCZB 5D2LE 2DLHA 4Q9QL 2LE9A 3SDDD 5DHXB 1YEHL 3ZE2E 1PQZA 1GCFA 4DGVL 1AGEA 4P9HC 1M7IB 1MHCB 5IT2L 4CJ0A 4DEPC 3MJ9L 4UOW0 3AS0A 1E4KA 4X80H 4FQHA 5A2LH 2AJ3B 3T0DA 3KVQA 4ZPTB 2ZCKH 4WHCA 1KPRB 1MRDH 5EO0B 3QWQB 1F3JA 3WLBA 4N0RA 1SYVB 3BGMA 4Z8FL 4Z5RB 1Y6MR 2Z8VC 5C0NC 5GRZA 2WBJD 4Z7UA 3QHZL 2EDOA 3GBNL 2H8PA 3PL6C 4XBPA 4YDJB 3PWPE 4JPKH 4M48H 5JDJA 2VDPH 3UP1A 4Z9KB 5TQ0H 3UYRL 2QQLH 5A16A 4POZC 5ETUA 4HJGB 1N7ML 3FHQA 3D5OF 2OTUB 4HSQA 3X13A 2IPKB 5JIIA 3BXNA 3X12B 4FXLA 5DJZA 1FL6B 1ZXQA 1FORL 3MROA 2XKUA 3QQ9C 4OCSH 3OF6A 3P4NA 3S7GA 1G6RB 4HPOL 2E7LA 3VFMA 3WFCL 1WZ1L 4YO0B 4X6CA 5HJ3B 5GGSY 1BIIB 2VXSL 5EOCH 3B3IA 1EJ6A 3MODH 3E3QE 2YHGA 4RRPG 4OGZA 4Y1AD 5BV7H 2Z35A 4RDQF 1A6WH 1I8KB 1WAAF 3QFJA 4JM2D 5A3ID 1QG3A 1XT5A 4FG6D 1HZHL 4MNQA 5EUOB 3MRPB 5I1DA 4GFTB 2HT3D 1M71B 4FZEH 4P4KD 3JWDH 1U8HB 5I18H 1DLHA 2DF3A 5F1IA 2DJUA 5CFHA 2BNUB 3T2PA 4NRYB 3BP4B 5D70H 4ZDHA 5GS1B 1OTTC 4PRDA 3D69A 4D9LH 1YN7B 3BE1H 3SPVA 5DMGC 1KN4L 1KIRB 5EOQH 3O0RH 5ESAA 4U2ZA 4JANA 4HG4J 1EVTC 4V1DA 2BXYA 5GRXG 3FB7B 2CXKA 1RPQA 3D0VA 2Q86B 3VXTB 2Z9TA 4GBXB 5ITBL 4HUWB 2OMNA 3SQOH 4JFFE 1IAMA 4XBGB 3TH3T 3UTQA 1JBJA 1HSAA 2VDQL 4HPYH 1RJLA 1MCCA 1D9KA 2ORBL 1JHTB 1RZJC 4I8DA 5I8OH 3IU4L 4Y89A 2BRQA 5DTFA 3QJHB 2N7BA 3QUZA 2DMKA 5HGAB 4MJ5A 4TVPE 1KJ2L 1OAQL 2WAHA 1LK2B 2RGSA 3U30B 5IMOB 4HH9A 1QR1A 5CJQH 2EDDA 1J11A 4OF5A 4C56B 4S1SL 1ZWIB 4JPWL 4Y5XA 5DJDB 4PBVC 2EYSA 3QEQA 2AXJA 4M3KB 3GMLA 1NFDB 4PP2B 6CGTA 1X5KA 3C9NB 3DO3A 2EDXA 3LEXA 4TSBL 4F2MB 3UX9B 3L5JA 1FH5H 1RJYB 2VLJD 4OCWH 5DQDH 3S9DB 3KPLA 1MFAH 8FABA 3SDDA 2KQNA 2E5EA 5GS1C 3T77B 5C0ND 3R8QA 3ZO0A 1KC5H 2LU3A 1QOKA 3PL6D 4HAGA 1ZANL 4LASL 2R1WA 1XFPA 5IWLC 5CINL 4POZD 3QXDA 4NCC2 4RGNC 4M6MH 1W2KT 4ERSH 1UZ6E 1YY8B 4GKSA 3S5LA 2A6JB 5E00B 4GBXC 3AU1A 4KMQA 5L2JB 4JQXC 5IVXA 3S3PA 3QQ9D 4X0KB 4RAHA 5ISZE 1JFQH 4PV9A 2E6JA 4LP4A 1HH6B 3LN9A 3KLAA 2BFVH 1CK0H 3AUVA 2BRRL 4BK5A 1BVZA 4JRXD 1IAKB 5GGQH 5T5FL 2PF6A 5CZXC 2Z4QB 2XNAA 1CXLA 3U30C 1SM3L 1MCEA 4MCYB 3KYOB 1AGDA 5D2NA 4JKPL 4XVTH 1CDBA 4PJDB 2VDLH 1M7XA 2WP3T 5FK9B 2NW3B 2FGWH 1SJHB 1GOGA 5MERA 2MCPL 1F4WL 5IM7A 1A0QH 5D5MB 2XFXB 2FEDC 4LQFL 3LKNB 5KSBB 1JWSA 2GJ6B 1UADC 2YRZA 1I1CA 3T3ME 4W6YB 5EO1A 2E3VA 3BEWA 1U9KA 4C58B 1AP2A 2Q7YB 1OTTD 1KLUA 1DANU 5JPMA 2WWKO 3FTGA 4Y1AA 5CKGA 5DMGD 3OHXB 4QOKB 5E4IA 1F00I 1QBLH 1NGQL 1HXYA 1DUZA 4R7NB 3SE4A 1NUNB 4P4KA 5CP3H 3LKQB 5KZCB 4P57A 3PWUA 5EOTA 5F44A 4MD4A 2ZPKL 3G5XB 2CDGB 2Z31C 3PQYE 4XAKE 2P8PB 4NPYA 1J1OL 5IQ7L 1IQDA 4MJIB 4YWGH 3A6BL 3CXDL 3E2HC 2VZUA 4WI8A 2NNAA 4G80B 3K2MC 5C0JA 4LLDB 1RU9L 1D5IH 4ZUVA 3OAUH 2OL3H 2R1YA 2V2XB 3CFEB 5E6ZA 4UDTA 3C6SB 5FECB 4KQ4H 4WJ5A 3BJ91 1RUMH 3I6KB 3B8SA 4G3YH 4RNRA 4YHIB 4KMTH 3KLSA 5DS8B 3I84A 3DTXA 4O2FB 4DN4L 1J0KA 4QNPF 2O5ZH 3VH8A 4LFHD 4F37F 1TLKA 1IGFL 5CJXC 4ZUTB 5C08B 2O5YL 2DM2A 5H37H 4D0BA 5IJVB 2CPCA 4Z7QE 5GHWH 3UJTL 1WBXB 1FRGH 1RZFL 4KVCL 1IFHH 1I7TA 1NAML 3EYVA 2ZUWA 3LSOA 2R8SH 1X4XA 1PJ9A 3K8KA 3QB7C 5J7CC 2VITB 4ZFFB 1KBGL 4P3DB 4XX1G 1S8DB 4N8VA 3NA9L 4TNWK 1HWHB 1CR9L 3U83A 3ROLA 3B2UC 3PNWB 1K8DA 3D25A 5HDBF 1FAIL 4RQQA 1QBMH 1D5BA 3CFCL 1T20B 4KVNL 5D71L 4GSDH 3EOBA 5D9SB 3B43A 2AEPH 1OT2A 4NHCL 2AJZA 3VFUB 4RGND 3CVHA 5C92A 3K1KC 4NO5A 1IGJB 1J18A 3ECBA 4ODXA 2VLJA 4OZIF 4GBXD 2UWEA 3O6ML 4QHNB 3K1DA 1N0XH 3BIKA 3T1FA 4UT9L 4R97C 5F9WC 1EO7A 5F3HB 3PGFL 3H9HB 4XNUH 6FABL 3PL6A 1MWAA 3QEUB 4XNMA 2WIIB 3X17A 4EUPA 5C0DB 1BBJB 2HT4C 2FNBA 5CZXD 2FJHB 1DTUA 1E4WH 2XN9B 4JFOA 5SWQB 3RX7A 3IRZA 1GXEA 5JW4M 1QLEH 3ZYOA 3VE0A 2CDFB 4Z0BH 3VFSB 2VABA 3HA0A 1XF3B 1BP3B 3DX6A 1BGXH 2VXUL 4E5XA 3L7FA 3DV6A 5HYSA 3D1MC 1ROWA 3AS1A 4P4RA 1T1ZA 5J3HC 1F4AA 1WQVT 3HMWL 2FEDD 5ICYB 3MBXH 4YHYB 3FO1A 3HNTL 1I9EA 4KAQL 4OCLC 4XVSH 4GLRI 3M17B 3N0PB 4U7SA 2YC1B 4NO3A 5EPMA 4X4XA 5I2IB 4U1KA 2M2DA 2BVUA 5ID1B 3OR7B 5D93C 1YEJH 3F7VB 1M7IA 3IGAA 4MWFA 4ZOCA 3AAZB 1M1SA 5L2KD 4DGYL 3LKRB 2VB5A 3VCLB 4ZPTA 2Z31D 5BZDB 3MRNB 5C07E 1WBZB 4AEIL 3MV8E 1KPRA 5EO0A 3NMEA 5EZIH 4PRAA 5HDQL 1T7XA 3BAEH 4Z5RA 2A74A 1VGEL 4F7PA 4FQ1L 2VDNL 4QRTB 4HT1L 3TBTB 4XPGL 4P46B 4I3SH 1EHAA 3FRUB 4DVBB 3PDOB 3LH2L 2ZWLT 4WGWB 1I9RL 1BBDL 1CLOH 5F1OB 1AGBB 1I1YA 1U91B 4HJGA 1GAFH 2OTUA 3QISA 1VEOA 2FLBT 2IPKA 3GHBH 4R8WL 4QEGA 3IJYB 1F4YL 1OP9A 1TETH 3CPLA 5HHXL 3JVGC 4MJ4A 4KWUA 2GCYB 1BECA 5GISH 3GSUA 4F8TA 3U4BL 1G6RA 2YOCA 3D48R 4PJFF 4F9LC 4YHYC 1IKFL 3MLVL 4JREC 1FNGB 4YO0A 2DQEH 5HJ3A 3UTOA 4L4JA 5LQBH 1BIIA 1A6PA 3D9AL 5KBNC 3IXTB 3V4UL 3ULUF 5EDXA 3B2UD 1BFSA 1ITBB 1IILE 2L0DA 2X70B 3H9SB 3ZL4L 4N5EC 4QOKD 5C0BE 3FJTA 4J3UA 2CRYA 4QXUL 4G5ZL 5DFTA 3GK8H 5JW5B 5EUOA 3Q5YA 3CD4A 2BDNH 1M71A 4OLZH 3DI3B 4MJ2A 5EA0L 5FUOL 5KZCD 1U8HA 5IF0B 1JGUL 3TBSB 2E6QA 3QIWB 4G42B 1RUML 1N6QH 3BP4A 4KUZL 1MNUH 3QUML 4L8DB 4PD4K 5GS1A 1EEQA 1EX0A 4O4YH 1YN7A 2ZCHH 4MJID 2FYYA 4XVUC 3I6LE 1DJSA 1SEQH 3WDIA 1I7UB 4K2UH 4JG0H 5IWLA 2IH3B 3FN9A 3QWRD 1RIHH 2W38A 1S7RB 3CZFB 3DXAE 3FB7A 4P46C 1EZVX 2HT4D 2PW1B 4L3ED 3A6OA 4H8WC 3HZVB 2Q86A 3VXTA 1TFHA 3HAEB 4GBXA 5JXAL 1YC8A 4HUWA 4JQXA 4JQIL 5DJXA 3TC9A 4XBGA 4PPTA 3S6CA 1BVKB 3TN0B 4NFCA 3UAJC 5J3HD 3KAAA 4H0HB 1JGDB 1AQKH 2GFBA 3BHBB 2UY6A 1XIWC 1JHTA 4NJ9L 1DZBA 4H1LB 5LAXB 4KROC 3RWEB 4JGUA 1TNMA 5F9OH 5HGAA 2F8OA 3NIGF 2AXFB 3EFDL 1LK2A 3JV4B 3IDMA 2N7AA 1K3ZA 2A6KB 2PNDA 1PG7L 5IMOA 3KJ6H 5EFIA 2B7DT 2BY2A 2EIZB 3CAFA 1MI5E 4LCIL 1HXMB 1QRND 1ZWIA 1Z0NA 3MXWH 4QRSB 1B2WL 5DJDA 3PWJB 1G1YA 2IADB 2Q76B 2MTPA 4PP2A 1NFDA 4RMRA 1DBKL 3KPNB 1BJ1J 4NDMB 3C9NA 4KHXH 4QNPE 1P7HL 4F2MA 1T1WA 1RJYA 1PY9A 3R06B 4X7SL 3DRQB 1T83C 2YPLE 3LEVL 3RX8A 5I19H 1A3RL 4F7EB 5IGXL 4PGCB 4L4VB 3VFGL 1ZLSH 3LS5H 5IEHB 3MGOB 3ZZ1A 2VQTA 5C8JB 5J9PA 5L2KA 1IZKA 1NBYB 2CIKB 1XGPB 2Y5EA 2LU7A 2Z31A 5AYUL 1U92B 5BW7C 5T33H 5KSVA 2ZUQC 3IRPX 2XN9D 3LN4A 1YY8A 2A6JA 3G5YB 1L7TH 3K74B 1JPTL 43C9B 2KBGA 5L2JA 4PJEB 3WIHH 1MFNA 2Z93B 4ZO6A 2V9RA 3TN0C 2VLLB 4X0KA 5IMLB 1JZ5A 4G9DB 5E2WH 1TJIH 4Z7VF 4OZIE 4OCXH 4HKJB 3EOTH 3PUCA 3BDBA 2DD8H 5B3NA 1RUQL 2Z4QA 3WXVH 4KZDH 4MCYA 2VR9A 3KYOA 1KCUH 3GI8H 4N5ED 4MXWL 4MNGB 4PJDA 4M93C 1U8KB 4OZFB 4RFNC 1CGSL 3HFMH 2NW3A 1MCOL 3VXUE 3VXPB 3ZYIA 1NEZB 1SJHA 4XP6L 3CU1A 5KSBA 4NWUL 2GJ6A 4I3SL 5D7SL 4J3VA 4KJWC 3R0NA 3ARZA 1JYNA 5L8JB 1DSFL 4FTVB 5E8PB 4NYLB 5CBEA 3WHE1 4NKMB 4XVUD 3X14B 4WFED 3JXAA 4QOKA 1FNSH 1BAFL 4G8EB 1NJ9B 5TF0A 2P46B 4OUOA 5BO1L 2Y9RT 4P46D 3EDJA 5DUPH 3D0LA 5J4MA 1TZGH 5CZKA 5FYLE 3LKQA 3MRJA 3HE6C 5IW1A 4YHOL 1CE1L 3G5XA 2CDGA 2P8PA 3OKNB 4DKDC 5FYKD 1OAKL 4LGRB 4AT6B 4C83B 4CU8A 2FHBA 3ME0A 1B0RB 1JZ7A 4MJIA 1XIWD 3H42L 4PY8J 3WDHA 4G80A 1QFWL 3VXNA 4FMFA 3RPIB 3G04B 2V2XA 3CFEA 4KROD 4ONFL 4GAYB 5FECA 2X09A 4P2YA 1S7UB 3V95A 4BSVB 3I6KA 4L3EA 3B8YA 3P11L 2Y6SC 3PXJA 4JG1H 1QHOA 1BWWA 5DS8A 1YEEL 4PRHE 4ZFOL 5B38G 3DOSA 3IAPA 4O2FA 5E9DE 4CVXB 4Z76A 4PREA 4WU5B 4P9HH 4LLAA 4WU7B 2CUHA 4OBRA 2VO5A 1WBXA 4N68A 1RMFL 2BCKB 4QXTB 4RFOH 1EEZB 3BPNB 3OPZL 4U0RC 2AKRB 3CVHH 3ESVF 4P3CL 2R1XB 2VITA 4GKNB 3UZQA 1FQ9C 4ZFFA 1ZGLA 5IBLC 4P3DA 1S8DA 1MH5B 2XY2A 3I50L 2I5YH 2OR9H 4OTXH 1B0WA 2HFGH 3PNWA 4WUKH 4FQQB 2DQFB 4JN2B 4TRPL 4PJFE 1T20A 3Q1SH 4MA7L 4WTZA 5D9SA 4LSTL 3FONA 3U6RB 3U2SB 3VFUA 1FAKT 4LRIC 3ULUE 4JRYB 3QEGL 1IGJA 5KW9H 4QHNA 3TN0D 1JNNL 4BSJA 4U6VH 5F3HA 3H9HA 4X9BA 3W9DB 1WIPA 2VH5H 5C3LD 3MRFB 3QEUA 3BPCB 2WIIA 2UVEA 5EB9A 3HZMA 1YY9C 4U2YA 4LLMB 1BBJA 5MEOA 3ARBB 2D7NA 2FJHA 2XN9A 4MSWA 3LKSB 3RI5K 2MWCA 3TWCH 2CDFA 3WE6B 3ZE1E 3D2UD 1XF3A 4QXGL 2GHWB 1JNJA 1URLA 3WHE0 4YFDB 5E8OA 5ICYA 4FHBD 5JUEL 4F9LA 3BVNB 3GMQB 3FT4B 2B4CC 4OFKA 5JXEC 3KPSB 4KJWD 3M17A 2FSEB 2AJUL 1I9JH 2YC1A 3SKNB 1IBGH 1EHLH 5GXBB 1VEPA 1P2CB 1U3YA 3NAAH 5I2IA 3TJEH 1JCKA 4HWBA 5ID1A 3OR7A 2XG5A 4Y5VB 4OZHB 3MRMB 2HH0L 1FVEA 2R0LL 1WWCA 3AAZA 2BC4B 1SJVA 2AV1B 3HE6D 1L4IA 2XRAL 3LKRA 2WNGA 2IH1B 1PKQE 3VXSE 3MRNA 5GGTL 5GGSB 2FO4B 3QRFM 3N1MC 4GG8B 3QNXB 4OZ4B 3X3FH 1MJ7L 1UG9A 1FNFA 4P59L 3TBTA 4OB5L 5I1LB 4P46A 2VZTA 5IV2B 2W92A 3K81A 5HTSA 2Y6SD 3FRUA 4IMLB 3H3PH 4UB0H 1G6RH 4DVBA 5DK2B 3BZ4B 3PDOA 2HT2C 1JPFB 3EIFA 3C09C 3V5DB 1U91A 4KUCF 3ARBC 5IBTL 5EIIB 2FX7L 4FQXB 5C9KA 3EZJB