1IGYB

Structure of immunoglobulin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
434
structure length
434
Chain Sequence
VKLQESGAELARPGASVKMSCKASGYTFTTYTIHWIKQRPGQGLEWIGYINPSSVYTNYNQRFKDKATLTRDRSSNTANIHLSSLTSDDSAVYYCVREGEVPYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDTLLITVTPKVTCVVVDISKDDPEVQFSWFVDNVEVHTAQTQPREEQFNSTFRVVSALPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGKPRAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQSDGQAPENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 INTACT ANTIBODY MAB61.1.3
publication title Crystallographic structure of an intact IgG1 monoclonal antibody.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 45
structure length 434
sequence length 434
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyB03
1R5WB 3BP4A 3INUL 4HUVB 1MAJA 1NCTA 3HA0A 2WWKT 1DZBA 4V1DE 4XMKL 2C4XA 4JM4L 1PSKH 2OBGA 1SJHB 2NCMA 4P4RA 4NQDE 3NAAH 5EU3A 1H3UA 3BKCH 5HHME 1KXTB 1X5FA 1XGPB 1OARH 2Z4QB 5IB4B 2BY0A 1IQDA 2PYFB 3PV7A 4FQQB 4O2CA 4M48L 4QXUH 5E6IB 4ZD3L 5KSBB 2BNUA 3QH3A 1H3PL 2IGFL 5EU7E 5FA4B 3T0DA 3DRQB 4EJ1C 4Y4HA 2IC2A 2VDLL 4OCRH 4NQDB 4KVCH 3DMMC 5JXEC 1IAII 1ZV5A 3WFBL 3LRGA 4WI6A 3BQUC 4D0DB 3FO0H 4HWNA 2CDEA 2VRAA 3C5ZB 4FQXA 4JREC 5FUOL 5IHLB 2GCYB 2BMKB 2A6DB 4JM2C 4JVPA 1JNJA 1IM3A 3SE9H 5TFSL 5EB9A 3DIFA 5D1ZD 1TCRA 3RNQA 1ZKAA 3QXVA 3QRFM 2OZ4A 4AL8H 1RIVL 5IVXE 2I60H 2PR4L 1HSBB 3MRHB 5BV7H 1VFBB 4TYUA 2NY6B 5IROA 4D9RE 5LXGH 4XC3L 2OSLA 1A0QL 3MLVL 3MR9B 1IARB 2J8UA 3D0LA 3IU3B 1FFRA 1LD9B 4YBQD 2ZCHH 4Z95L 4PRBA 1A4KB 1T0PB 1N26A 2MHAA 5FYJD 1J1OH 3OXRA 4OFVA 4TULH 5CSBA 4DFHA 4WY7H 2X89D 2HJLA 2GJ6D 5GSVB 3GJFB 1IKFH 5D5ME 4MMXC 2EXWD 3VFSA 3VXNA 1NGWA 1JUFA 4X9FA 5GHWL 3BHBB 2DYPA 1IBGL 3OGCA 1KB9K 2J3SA 2Y07H 4RBPK 4UIMA 4OIAA 4RFEB 2L7UA 5ALCL 4BSVA 3BIKA 3RA7L 2DICA 3KR3H 3MV7D 5HXMA 4FG6D 4L8CB 4EUPH 4PV8A 4OD1H 2W60A 4FMKA 5D5MB 4KI5C 1E4XL 2F54D 3QPQC 4WUUE 3M1BB 3MUGB 1KLUB 2E3VA 5ISZD 3SCMD 2WBJC 4BZ2H 3MV8E 1FYTA 4HJJH 5EOQL 4ZNEE 4Q0XH 2E9WA 4JPIA 4HHAA 5F70A 5E2TL 1FZJA 4OD2A 1U36A 2EEDA 4BK4A 2YD5A 1H5BC 1INQA 4U6YA 4WU5A 2BNRE 2J88H 2ZJSL 4Y8AA 1MWAB 2VLKA 4PRIE 4I13B 4IIQC 1DBBH 3RY4A 4LCWD 5I1DA 3H9HA 1T1XA 5I1KH 3H42H 4K3HA 4NN7C 2WQ8A 3QFJA 3RWDA 4D0BB 4H5SA 3EOAB 3G6JE 3KYKH 5C9JA 2X4OB 2ZOLA 3VGFA 1DVFD 5DHXB 2LVCA 4PRIB 4CKVX 3A6BH 1AFVH 2EDWA 3AM8C 3OJ2C 1CXFA 3ZKSD 1JZ6A 5DXWA 3T0ED 1W0WA 1INDL 3O3EA 4MGXA 4TTDC 4O2FA 5D7IE 1IGMH 4U6TA 5I18H 2OK0L 3HB3C 5T5FL 3G6JB 2V2XB 2QLVB 1T66C 4K7FB 1GYAA 3CSYA 5I1JL 2VZUA 3BPLC 3HPLA 4PP1D 2IG2L 3LEXA 3MLUH 4TSAH 1B4RA 3WS3A 1EEQA 2EO9A 4LPTA 2IJ0C 2DWEB 3MRPA 1FLRH 4FXGB 4W6YB 3RZCB 4NQSA 2R23B 5EC2B 2AABL 5MEPB 4IJ3C 3ZKND 4POZD 5FK9A 3I02B 5D7IB 3NH7H 2H9GA 3QAZB 4WWKD 5D1QC 1JWUA 2FEEI 4HZLA 4K94L 5L2KE 4KROC 1MLBA 4DW2L 2ESVE 2B2XL 2VLLA 1YC7A 3WIHL 3TT3L 5FHBH 4PBXA 3BVNB 3H0TB 4Z7OF 3QUML 1DSFL 4XVJL 5GRJL 2FZ3A 2D0FA 4LEOB 3AREC 3RY5A 1OF2B 3GIZH 3MLYL 3VW3H 4GW1B 4G8GE 5KVEH 2GHWB 3NZ8A 5ETUB 4LLDA 3O3BA 1YNKL 1XIWC 4IS6A 4R2GD 2X2YA 4G8IA 4XGZA 3DVGB 1OP3K 1P6FA 3GSQB 2DKUA 5C6PB 5J13B 4HXAL 3VWKC 2CDFB 4MDJB 5H37H 2KQNA 4X6BB 4X7TB 4APQC 4MD5B 5I30H 1L6ZA 1K8IB 4PV9A 4G8GB 1IL1A 2Y36L 3BKJH 1KGCE 4U0RC 3V6ZA 3QQ3A 5EBLB 2EICA 4YHIB 1NDMB 5SWZB 5FB8B 1A1OB 1AO7B 1CDIA 3RVWD 1W72H 4PB9L 3ZE1F 1KJVB 1RZFL 4NYLB 4HBCH 5AUMA 1FJ1B 1SVCP 2E6JA 3I2CL 1VA9A 3LKSB 2NXZD 1A7QL 1Z5LB 4F7MA 1DDHB 2OJZH 4HKJA 4PUBL 4LOUD 1EO8H 3ZKMC 1U8MA 1QEWA 1YMME 2X44D 1F90L 5JUEH 4LPXA 4PJFF 2Q3AA 4LNVA 1BQSA 4J1UA 5C0BE 1G7HA 1GOGA 4YWGH 1LO0H 4DVBA 4BUGA 1T5WB 5AYUH 3CVIH 5T1LA 1SVZA 4PR5A 5D1XC 3WKNA 5C6TL 3B9KA 1ZT4B 3MV9E 4FXKA 1XGTA 2JELH 5BJTA 3DUUB 3DX6B 3UYPA 5INDB 3A0OA 3VXSE 5IVNA 4H26B 3G5XA 1U8IA 5BZDB 4ODTL 4AK1A 1MH5B 4GRLB 3F5WA 5HI5C 1PYWA 2XIDA 3TZVA 4GS7C 4UT9L 2XTJD 3HNTL 4I3RL 1KIQA 2X89A 3C9NA 2GJ6A 3B8SA 4NZTH 3BE1H 1EHLH 1HKLL 4YE4L 3ARZA 2C3HA 1O7VA 3MV9B 1IEAA 4Z5RB 4NKOB 2APBA 3CNKA 5B38B 4F37F 2Z35B 4WHCA 5I66B 3EDJA 1FSKB 3IGAB 2J6EH 4LRIC 3G08B 4R26L 3UZQA 4YFLI 2Q87A 3HZKB 2R1YA 4X7SH 4GO6B 4JG0H 2EDDA 5J6HB 1IGFL 3DJ9A 4MA7H 1A7PH 1BAFL 5DURD 3AGVA 5EUKA 4UT7H 4HCRH 2F15A 1D9KB 3OHXA 4U1IB 2F54A 4Z78A 3TCXA 5ISZA 2OR8A 3SCMA 3O4OB 1SY6A 5D93C 4PGBA 5KSBF 3HAEA 3TBSB 3BD3A 4OQTL 5TQ2H 4AQ1B 4D2NA 1A6AB 5KSUB 3MJ9L 5C0CD 1KEML 1YYML 3QXWA 1FRGH 4LK4A 1GGBL 3NN8A 4NO3B 4K7PH 1KIRB 1XAUA 4OD3L 5I75C 1J18A 1Z0MA 5BQ7A 4TVSa 1A6UL 4JY4A 1U3HC 2BJML 3KLAB 5B39A 3MMEA 3DV6B 5SWSE 2L0DA 5FM5M 5DEGA 2C26A 4RCAA 4O4YL 1NMAL 3JSSA 2E7LA 5ADOL 1D5MB 3G5YA 4IRZH 1X6NA 1OAQL 4NO0D 4ORZC 2VZ3A 1DVFA 5C0FA 1CN4A 5IGXH 1G9NC 4XVTH 4ZFOA 2EKJA 1U8LA 1K2DB 3VFRB 3EO0A 3QDMD 5GXBB 2HRPH 5J6GA 5TGBB 3T0EA 3FQXA 2R0KH 2OCFD 1RZJH 5EO1A 2PW2B 2Y06H 1R3HA 4X8JA 1OW0C 4YHPB 1VEMA 3ALWA 4O02L 3ZSTA 4IOSD 2DLHA 2D4FA 4PJAB 5F1OB 3RQ3A 3RAJH 3TV3H 4DEPC 3RL2A 1EMTH 3L3IB 1CK0L 1X4ZA 5DWUH 4U6VL 5LVEA 4QHNA 3CVHA 1URLA 3L6FB 4KMQA 3U7WL 2EH7H 1MVUA 5LCVH 4MDIB 1CT8B 1J87A 1S9XB 4OFIA 3U2SA 2B1AH 1C16B 4WWKA 5FKAA 2VISB 5JHDE 5HHXH 15C8H 4QGYA 3D48R 2YHGA 1IAOA 4LLVA 5DEFB 1YJDH 3Q48A 3LEYH 4XP5H 3L95B 5GGUB 4KZEH 5D5MF 3TH3T 4X6EA 1UJTA 5MEOA 4F33A 1RK1B 4HF5L 5EO0B 1J8HD 4LSUH 2E7HA 3AUVA 3IDJB 3WHXA 2VWEC 3FOMB 2KH2B 3GBML 1DTUA 1JI2A 3ULVD 3QI9B 5HGGS 4YBHA 5DDHA 3F58L 1JF6A 2RBLA 2I9TB 3UPCA 3QG6A 2VAAA 1G9EA 4BZ1L 5E2WL 4YGVB 3LKPA 1MCWM 4YFEA 2CJUL 1WISA 2CKNA 1NH6A 4NGHL 1U8KA 1CICA 4Y16D 4ELMB 3ZKXB 4P23B 2DIJA 4QRQA 2VR9A 4XPHH 3IDGB 2ZKHH 1KEGH 5BMFH 5CJ8A 4BFIB 4X80H 2NY2C 1MELA 4JFFA 2NW2A 3WO4C 3B9DA 1RURL 1SYVA 2DJSA 4JFXA 3L3HA 3HCVB 4ODHL 3NACL 3WDHA 3WSQH 1BBJB 4ZUVB 2VAJA 1H15B 3VRJB 4HIXL 5DHVA 4MNHB 5T5NF 1LK2B 1T21A 3MXVH 4O58H 5B4MC 3MPCA 3WIFB 2YPKB 3G6JF 1T22B 1CD0A 2X4QB 2LV4A 4KRMB 4OJFH 1KPUB 1YY9D 4R0LC 3HI1B 4HH8A 1T7YA 4LQ1A 4UNVA 5I1IL 5ID1A 5EO9A 3GMOB 4OZHB 1CLOL 3G5ZB 1FFNB 3FRUB 1J05B 2NY0B 2Z0BA 4PJIE 2LQRA 1F4HA 1GAFH 2ADGA 1UH4A 5IF0B 4PJ9A 5D7IF 1U93B 1XGRA 1A7RH 1MLCA 1WFUA 1TENA 3KPTA 4NN6B 1RVFL 2JK5B 3DX7A 1TPXC 3MLRH 2CIKB 4KHXH 1C5CH 3MBXH 4AMKL 5F7WC 5IBUB 1I1RA 4LLUA 2OZ4H 3VMPA 5GZND 4UOW0 3SGKC 2HH0H 3QEGL 3B2UC 1GC1L 4GH7B 5HYQB 4GXUM 3OKEB 3FN9A 2AQ3A 1QLEH 5E4EC 5I1LA 3O6FA 4G42B 4PJIB 1LQSR 4BFEA 4HWEH 4OI9A 4MVBD 3WUZA 2BSRB 4MAYD 3S5LG 4LSTL 3QEUB 1MWAL 1GSMA 1NGZA 3U36A 3EYFA 4IOFC 4GBXC 4RNRB 3OJMB 2V7HA 4UINH 1S5IL 5FYKU 2HLFD 4DOHB 4GW5B 4WFHE 1BFVH 3QRGH 1BGXL 1CQKA 1B2WH 1OF2A 3MNZA 4WI2A 1JF1A 2Z93A 4MS8D 1BVZA 1S9WA 3QDHA 5C0EB 3ES6A 2F74A 2EYTA 2JJSA 4KVNL 4FHBD 4K71B 4QYOA 4ZFZB 4K3JH 4PGEA 1X5LA 4PP1C 1GGIH 1LILA 2NY7L 4U1LA 2YMXH 3RFZC 1LVEA 2NXYC 4U3CA 1FLTX 3QXAB 3S37L 4WHYH 1NGQL 1NDGA 3IVKA 1U3ZA 4L1HA 2V5MA 4KFZC 4V2CB 1HIML 4JHAL 2OL3A 4W4NA 5TDNB 1BWMA 2VNCA 4NQXB 1NCWH 4MYWB 4CL7A 5KSAD 3NGBC 4N8VG 1QLRA 4G43A 5D2NA 5DJ6A 1CD1A 5EG6C 3L3OB 2K9UA 2O5XH 3IXTA 3GM0A 3C60C 3D85D 4R97B 3UJTH 5GSRB 5I1CH 4OTXL 3TN0C 3SQOL 5IJVA 3ZTNL 3K4AA 3C6LB 1P2CA 5KTEH 3LQZB 4KDTC 1D5BB 4UTAL 4MCZA 3HNSH 2IADA 4IRSB 1JRHI 2HT4D 4PRPD 4ZMAT 4WCYL 1EHXA 3Q1SL 1A1NA 3P30H 1QNZH 1FVCA 5HHPB 1K6QL 1G0XA 1OHQA 2CR3A 1HXYB 3WHE1 3C08H 3B43A 2XXMB 1NFDB 2YN5A 1L6XA 2R4SL 3MA7A 5JIPA 5IMOA 5E8EA 4LLYA 2VLJA 5MI0B 5KVGH 1EXUB 4RMQA 3P9MB 4L29A 1VESA 1F4AA 3RVUC 4BH8B 2A6JA 3HE7D 1WFNA 2WMPA 3IGAA 4YHML 3QSKB 1W8OA 4KMTH 4U1GB 1NC4D 2F19L 4QHUB 3DARA 5HY9B 2DLTA 3PIQA 1RUAH 4KY1L 5IW3A 5GRUH 2NXZC 2B0SH 2DWDA 4PJBB 1TQBC 2DLGA 1GZPA 5CZVL 4LPWA 1MHPL 2ADFL 4Q6IA 2I5YH 4HFWB 4POYA 4XWGH 3V8OA 4NOBA 5K9QG 1MFBL 4XBPB 5DFVD 1MCPL 4ODUA 3WFHB 4TPRH 5DQJB 2VLRE 5ANME 2FD6H 4Y16A 3UPRA 4LSSH 1JWMA 1S5HB 4I4WB 4YBLC 5JR1L 4G7YH 1ZVHA 2GKIA 3WXWL 5I16A 4U7MA 1MRDH 4DK3A 1A02N 4JB9H 1CLZH 4M4RA 4KK6C 1ODAA 4EDXB 3W0WE 1JFQH 4PLKD 5HYJA 2AJUL 1CE6A 2Q6WB 2BOBA 3O4LA 4D3CL 5DZOA 2ZUSA 5ANMB 2CDGB 2OQJB 2E8YA 2VMFA 3D87B 2R8SH 3ECBB 4HWUA 4CVXA 4KJPC 5F8RC 3DRTA 1G6RL 4L8DB 1E28A 3AMKA 1AKJB 3JWOL 4ZXBC 5TE7H 5DYOA 5JW3H 3NCFB 1HSAB 4OB5H 3OSKA 4PJAF 2IPKA 3TFKD 5EZLB 3W0WB 2F53E 2YC1B 4NZJA 5HGBB 3PWLA 5TDPB 2UV3A 4FQLL 3CZFA 5DQ9A 3QP3A 1IFHH 4QWWD 5CJBA 3VWJD 5EPMB 3PXJA 1CCZA 5HJ3B 4GMTH 3P4NB 4M7KL 2R0ZL 2P43B 2X1OA 3UYRL 3ZYJA 3SDAB 5MERB 2F53B 2HT2D 2FR4A 1KJ3H 3FONB 4YHLH 2AK4B 1BHGA 2VSDA 4HLZG 5DJZB 2NZ9D 3VGHA 3O2VL 3MRIA 3U0PB 1AD0B 2Q86A 3X3GH 1NL0H 2PO6C 4MAYA 3STZB 4YHOL 1AI1L 5JW5B 3QIBC 3HKFA 1JNHB 2CRMA 3VFOB 2O5YL 2DLFH 1VDGA 1JRHH 4EN3B 2DJUA 3TBTA 2O5ZL 1FV1B 4FFZL 1WZLA 4XVSL 1OAYL 3H3BC 4ELMF 3LHPH 2XKUA 4XP6H 3UDWC 2P5WD 3FFCA 1CS6A 4IDLA 5C0JB 4FTVE 4KRPC 1NKRA 5CP3H 5A3IC 4XNUH 2BY2A 4LQFL 1NAMB 1XR8B 2DQHL 3VD5A 2FECL 2GIYA 1A5FH 3KPQA 2CPCA 1HN1A 1I9RL 2H3NB 3H3KA 1KSRA 1QBML 5EIIA 2FO4B 1SY6H 1OB1A 5D6CB 4AIZB 1FNHA 4OGAD 5IHZB 1EPFA 3FCTA 3HAEH 1VSCA 4L9LA 3ZYZA 4YK4C 4IBLT 3VFNB 4TTGA 1FNAA 4QCIA 3R06A 4G6FD 1FNSL 1HZHH 3G9AB 4AT6A 3N50A 5KSAA 5KG9A 1AJ7H 4IMKA 1OSZA 5DR5L 4L3CB 1XF2A 5BV7C 3LMJH 4FQPA 3ZMRA 5FFLA 1B6DA 2A1WH 4GG8B 2GAZA 1I8LA 4M7JL 4Y5VC 4XVUC 3D85A 4B0MM 5C09E 3JTSA 5C0AD 3RGVD 5E94A 2AW2A 5DO2D 1KCVL 1P9MA 1NMCB 3V5HB 3UO1L 1AXIB 5GJTL 4OLYL 1DQMH 5BS0E 3VFVB 3FTGB 4KTDH 4M43L 4OLZL 4AEIL 4CVZA 4ZG1A 1SEBB 2AK1H 2DBLH 1IGIH 4C4KO 4Y4FC 1TQCB 1J5OL 4XCYA 3TVMB 1YEIH 4PRPA 4E41E 3QDJE 3UTZB 2Z8WC 4PJIF 3BUYA 5D96B 2I07A 4RAVB 4QRPA 5DMIH 3WS6A 1V7MH 1RK0B 4PRAB 5IFJA 5GZOC 2YD1A 1AGBA 5FO9B 4RGMB 3J8F7 2ZUYA 4G7VL 2VXTL 4GAYA 3O3UN 2GUOA 2JB6A 4E41B 3RWCB 1NC4A 5JXAL 2V2WB 1FL3B 4JRXB 1KTLB 3U0WH 2V5SA 2R0LL 5TE6H 1M1SA 3KG5A 4UU9A 2ORBL 4U1JA 5CZXD 1BQLH 5JMRA 3O9WB 5FF6A 2NY3D 2WINB 2EYRB 3FQTB 1CBVL 2MWCA 2VXQL 4JFOA 4KAQH 1YY9C 3BH8A 3CDGB 4WFEE 1G7IB 3V6OA 4NNPL 1MFDL 1KULA 4BH7A 3ZE0E 4UIKL 4X5LA 3TO4C 5M95B 2AQ2A 5GS3A 4S10A 1J0HA 2AS5M 2A9NH 4JPWL 2EYSB 3SE4A 3MREA 3S4SB 5E00B 4XZUA 3MGOB 3W39A 4Q9CA 1HI6A 2ZCKL 2Q8AH 1WFOA 1M7IB 4JCMA 4OGYH 2XQYK 3FQUB 1C5DA 3CH1A 4R3SA 3MNWA 1U8QB 4DQOH 4JZJB 4P59H 4OF6A 5IVZA 5ACZA 3IFPB 2AAVA 3TWCL 1J0ZA 3QO1A 4X4XB 5GIRB 2JE8A 4MVBC 4N0CC 1CLCA 5F9WC 4LLQA 4ZPTA 4UUJB 5JOFA 3OJDB 5DK0B 4PJ5E 5GRYA 3UTQB 5IB5A 2CUIA 3U6RA 3GI9H 2BHYA 1XGUB 2JCCB 3E8UL 32C2A 4J2XA 3OKMB 3SN6N 3TA3B 4Y4KC 4HGWA 3LS5H 1XR9A 4ZPVB 2XZAH 3EYOB 3JVGC 5C0GA 4AEHH 2FGZA 4JR9L 2IAMB 4LKXB 1AXSA 4JO1H 2R2BA 4Z7UA 4YEEA 1A6VH 1D5BA 4L4JA 4FP8H 2GY7B 4K3EL 3V4UL 4HZAA 3RTQB 2YXMA 5F9AC 4QHLA 2AJYL 3C5JB 4WDIB 2DQUH 3AXLB 4WUKH 1U91A 4FQHB 2IFGA 4YX2L 4LVEA 5SV3A 1MCOH 5ADPL 2AJXH 4CMHC 2CMRL 5HYSG 2GEEA 1KUMA 1QYGH 1EFXD 5JW4R 5EU5B 4ODXB 1PEZA 2VZOA 3H2WA 4WI5A 1PGRB 4I0CC 3E1F1 1WF5A 4GXVH 4HFUL 1F6LL 3WLBB 2XWJB 2HJFB 3U9PL 3OGOE 1TZHA 5DJ8B 1IGJB 3D69B 1BQHB 2CKBB 4JFDE 5IFHH 4NFCA 3X3FH 3MLWH 4RGNE 4YHYB 1RFDL 4WTWA 2P5WA 1IC5L 1WSST 3T2NH 3VI4E 1AY1H 4YHKL 4JJ5B 4LCCA 3KVQA 2AJZB 1X7QA 1FNLA 3ZT5A 3CGTA 3B3IB 4JQVA 4RFNB 5F6HI 3WKML 1WAAA 3BSZL 1UJ3B 1UM4H 5HVFB 1RUPH 3KPPA 3T4YA 4YHNA 5JQ6H 5LKNA 4M4PA 4YR6B 2HT4C 3KYOA 5I73B 3ARVA 1PLGL 4OFDA 5D7LE 3FMGL 1AIFA 5GGVL 5LBSL 3MXWH 3F65A 3KDMA 4MA8L 2EE9A 3ARBB 3CCHB 5IB1B 1S7WB 3DVFA 1LE5A 5CHNA 4LU5L 4ODSH 4KKCC 5FGCE 2WUCH 2QBWA 1TMCB 4QRUB 1DANU 3IDIB 1B6UA 4L8SA 4PBWD 1DN0A 4L8DA 1A7OL 4XNMA 3VA6A 4HC1L 1KJ2B 4L4VE 5CJXC 5CEYA 5D7LB 5EWIH 5JORA 2HFGH 2HFTA 1HOCB 3PXHA 1JNLL 1DLFH 3GK8L 4HV8B 1T03L 2FSEB 2A6KA 2P7TA 1A1MB 1M05B 1TETL 5B21A 1I9EA 4OM1L 4ODVH 1K8DA 3R8QA 3REWA 3MFFB 5E9DD 1QRNE 4OKVA 2UYLA 3GKWH 3LAFA 4CN4A 4M6NH 5AZEH 4MJIA 1RUML 4L4VB 3SDCB 1QOKA 4MXVE 3FT4B 4ZSOE 1XGQB 3IJYA 5DJDA 2X4PB 3MROA 5ICZA 3BXNA 1UKQA 3QIUB 4LAQL 1RIUH 1K4CA 1SYSB 4O5LH 5DZLA 1ZHKA 3RDTC 1I4FB 1RPQA 3TBVA 4PLKC 4M6AA 4OAWA 1RD6A 4AEEA 6FABH 5LGHH 4U31A 5IIEB 3STZA 3JXAA 4YNYB 4OLWH 4ZO9A 1UADC 2H2PC 4LSVL 1VGKA 2E7CA 3GNMH 1REIA 1ZLVK 1A8JH 1YZZA 2XKNA 3D39B 4PJDE 1JPGA 4L9DA 4ZSOB 5L88H 1ZOXA 5GPRA 3EOBA 5BRZE 2M8XA 3X13A 2CUMA 3K2UH 2YXFA 4G8FB 5JW4M 3PQYB 1RIHL 5EU4A 5HHQB 1T0MA 1X5IA 1N0LA 2J5LC 4HPOH 1G7PB 2V5TA 4OLXH 2H6PB 3D1MC 3PWUB 4PJDB 2QADC 5C86A 3VWJC 5DSCB 4OM0L 3EBAA 2PW1B 1R24A 5AEAA 1Q9OB 3MRCB 2C7UA 2EEBA 2Q20A 2DKSA 5FO7B 3CFEB 3JV6B 1CGWA 3IETA 3PP3H 2CSPA 3OKNA 1MIML 4WV1C 4JFHD 2NY1B 4FFVD 4QXGH 1JIBA 1KCSH 1YEFH 1C5BH 4HKBA 4NRYA 2R9HD 3VGAB 2P8PB 1F4YH 4XX1G 4LMQE 4KK8C 1HHGB 3V5DA 5IQ7H 4P3CH 4M7ZC 3SGEI 4OCNC 4OCXH 3PE9A 1VKXB 3VFTA 3ILPB 1IKNC 2MPAH 4L5FL 3L7EB 1FZKB 3P0YH 3TCLA 3C8HA 5F7KC 1X5AA 3SKUD 1CE1L 4QGTA 5K9OA 3SY0B 1T5XA 2C3VB 4N1EA 4R4BB 3QUMA 5JOPE 4N0FB 3OKYA 4YXKL 1SHMA 3WJJC 2P5EA 2DTMH 5E6ID 5IJKC 4UT6L 1ZLUH 2FWOB 3EJZC 1YPZE 2HTKD 3K0WA 1KCUH 5T3XE 5C08B 1KB5A 4O2EB 1EFXA 4V1DD 2ADJA 1T3FB 4YO0A 4ENED 4TUJA 3K80A 5E8OB 4NQDD 4PG9B 4BFGA 1NAML 2N56A 3HI5L 1T0NA 3BWAA 4FMFA 4Y0GA 5D72H 5HHMD 5HGHA 3WN5B 2Y25A 2RGSA 2XZQH 4OZGA 4YDLC 1V3JA 5BVPH 1ETZB 4DCQB 3NCEB 4JRXA 4E5XB 1ZVSA 3KXFA 3BGMA 4UOJA 3QHTC 5C07A 2YS4A 5JTWA 5F9OL 5GS0L 2AJ3B 2BOCB 1OLLA 4KUZL 4EUPG 2HA1A 3RGVC 4KPHL 1QLFA 5GGRB 1KTDA 4QXTB 3ARYA 5E5MA 2NY6D 1MHHB 3GSNA 2W9LA 1VFOA 1DBAL 5EULV 2HT3C 1LEIB 1MNUL 4GOSA 3L3DA 5DUPH 2DF3A 2P49B 3E2HC 4LSQL 2YKLL 3UP1A 2NY4B 4DGVL 2QKIB 1VPOL 1PJ9A 3C6SB 4KKNA 1UWGH 4YQXH 4OGXL 4M61B 2ARWA 3KPOA 1S7TA 4D9RD 3H9SE 5DD0L 3IFLH 2JCCF 3C8KA 1OD7A 1NMBL 1TJHL 5GGTL 5B3JE 1UXSB 2DI7A 3MBEA 1EZVX 1LO3L 5BZWB 4FQCL 2UZYB 1FFOB 4DGYL 4U6HA 4J4PA 1IGYB 1TJIL 1XGUA 1I1YB 3SDDC 5DJ0A 3CUPA 2OJEB 3H9SB 1MAKA 1L7IL 5KVDL 4FFWD 1TVHB 3MRGA 4GRMB 2FJFA 3GB7B 4ZYKB 4GG6A 2VDML 3PWVB 3LVEA 1WCBB 3IU4H 3HC0A 1XCTA 2ERJB 2D0HA 1RJYA 4U2ZA 4KJWC 3T0VA 4NM8H 5GS1C 5D1QB 1PZ5A 3SGEH 1G7MB 5LGJB 3L3KB 4WUUD 1KPRB 1UVQA 3CDYA 3IXAA 5E24E 1KJMB 5I1HL 3MV8D 5EORL 1YEHH 2QSCH 2E9IA 1RULL 3UMTA 1NBZA 2WWMD 2XWTA 4BKLA 4OQTA 5I15H 3BRFA 2BNRD 5KVFH 4PRID 4IDJH 4PS4H 4LVNB 3QQ9C 2ZSVA 1UM5L 3LN4A 1E27A 3KWWA 3GIVA 3GRWL 4IMLB 4EI5C 1FBIH 1MIEL 2W91A 3RHWK 2C4FU 3OAYH 5FYJU 4DUVA 4ZUUB 1KCLA 2BY1A 2WIMA 4OZIE 1JHLL 2DIAA 4KK5D 4U3HA 5K33A 4APQB 4MAUL 4PJFA 4N8VB 4X5WA 3MRQA 3VI4F 5C8JB 1I8MA 5AYQA 1BFTA 2D7TH 4PLJD 5AZ2H 5DVLA 4CW1A 1HYSD 3D3VB 1HHIA 4HQQL 3BP5B 3BGAA 4K94C 4YH6A 4JFPB 1Z0NA 2G9HA 4ZAKC 4NIKB 5H37G 3IS0X 4OZIB 4F3FB 1OOAA 3EKCA 4PY7A 3GHBH 2BSSB 5L9DL 4M03A 1B4JL 4FQ2L 4JFQB 3DX8B 2VL5A 3RWFB 4XP4H 2LU7A 3SDYL 3U0TB 3BDYH 4RWYL 1A64A 1DUZB 3EFFB 4XNZC 5ITFA 5T3ZH 2XWBA 1P84J 3PDOA 5IB2A 3LB6D 4P2YA 5TE4L 3GUTA 3QWQB 3UYOD 3O2WH 4XMPL 3WJLC 5C2BH 3GMNA 4QRUA 4ZFGH 5CD3B 1X5YA 2WAHA 3KPRA 2FH6A 1FVEB 3P4OB 4WHTB 2D7OA 4QNPE 3T1FB 3VFPA 4JFEE 3OB0H 1TZGH 2EH8H 2FX9H 1VADA 4MSWA 2OTUA 3X11B 43CAB 1NGXA 3B9AA 1RZGA 4ISVB 1ZS8B 5JNYA 4AYFA 1T04A 4TQEH 1JZ2A 4EOWH 3AAZA 4NN5C 5CBEB 4NNXB 2D03L 5L2KD 4TVPE 2FSEA 3L9RA 1FAKT 2ESVD 3KYMB 5FOJA 3VI3F 4WO4A 5DHYB 5B8CB 4HD9A 5FDYA 2QR0A 2Q7YA 2W0FB 3QYCA 4YDIH 4NJ9L 4JFEB 2QQNH 4NNYB 5EUOA 3BGFC 5GS2H 4G8GD 3OAUH 3O45A 4JFYB 4ZQKB 3VFGH 4F2MB 2BC4A 1PG7H 4V1DA 5HHOA 2FO1A 4MXVF 1FORH 4LARL 4WI9A 4U7KA 2ICEB 5J12C 2X42A 1JGDB 4S1SL 3B6SB 1VHPA 3TYFA 2EKSA 3D0VA 4JY5H 4JG1L 4HS3B 1OGAE 1KIPB 3I3BA 3K3QA 3IDNB 4UI2A 1FZOB 5FGBA 2EDJA 1KENH 5E8NA 3DV4A 2ATPB 1AXTH 2DM7A 1KGCD 2AGJH 1S7XB 1G1YA 5GRVK 1JPFA 5EOCH 4PJDF 4NM4H 4JFZL 1X6LA 3V0VB 1RZKL 4LHQB 1E4KC 1FE8H 1J1PH 5DT1L 4EDWL 2VDOH 1BIIB 2XOTA 1H3VA 4ZTOH 1IQWL 3Q6GL 1Z9OA 1BX2A 1ZHLA 1OM3H 4FZ8L 3EO9H 1CF8L 1EEUA 3EHBD 4TUOA 2AEPH 1YMMD 4JAMB 4Y5XA 5F7LB 1BLNB 1MHEB 1QSEE 1WUNT 3LRHA 1QVOB 4JM2F 4NKMB 5C0BD 3D18A 3JUYA 4M6OH 3T0XA 1HQ4A 3DTXB 5IVXA 3QUYB 3IB4A 1FDLH 3BZEA 3BYTA 4N0YL 3MV9D 5F6IC 1T6WA 3VXSD 3OBAA 4KV5E 3CX5K 1BOYA 1ZAGA 5BOPA 3EYQD 3QZWA 2VDPH 1A7NH 1QSEB 3PL6A 5DK2A 2R1XA 4F57H 1Z9SA 4FFYH 4QY8B 2V9RA 1MI5A 5DGRA 5HI4D 1GPOL 1IT9H 1D5IL 1AE6L 2HWZH 1XZ0A 2MMXA 5ICXA 1U8HB 4HS6B 2PR4H 1ERNA 4DEPB 2WUBH 1ZLWH 1OGTB 1RJZB 3VJ6B 3OAZH 5CGYC 3B9KC 2D7MA 5J1AB 3ET9F 2VUYA 3UPAA 1SBSH 3STBA 4KGLA 2VWEE 1Q9WA 3VD7A 1NC2A 4BYHA 3VH8G 3HR6A 5I0DA 3DXAB 3QB7C 3VFWA 4X4ME 1HHKB 5HGDA 3TZVC 4WUUA 4E42A 1CFSA 1JK8A 3P0VH 1PEWA 3EGSA 4ZNEA 5IV2A 3FB8A 2YD6A 1N7ML 4LLMA 5E7BA 2AP2A 4FZEL 5HI3C 3Q5TA 1YPZF 1QQDB 1HINL 3OTTA 3ZT7A 4BSWA 3LKOB 4G9FB 3K74B 3CLEH 1BF2A 3T09A 1Y6KR 2RAMA 1I1FA 3RIFK 4KGJA 5HHVH 4LEXH 3Q2CA 3MRMA 4P46B 4TRPL 5SWSD 2LAGB 2R29H 1YYLH 3SOBL 5EOQH 3OKOA 4N8PA 3U7YH 1U8OA 5C0RH 1ZGLP 1SJXA 2XFXB 3S34H 3KS0J 3EZ8A 5J89A 2A2QT 1S7RB 2PTVA 1UXWA 1FG2A 3FJTA 3GM8A 3RL1B 5TQ0L 2DQIH 3SDXA 25C8L 3VXME 4Z7VB 4HUMB 4CU8A 5F72S 5DVMA 4P5MB 2RCSL 4KU1A 3RIAF 3MODL 4XH2B 4RMUA 1XEDA 5JOEA 3RUGB 2IQAB 3GHEH 3WD5L 2X4RA 4AEFA 1S7SA 4ZS7H 4X9HA 4N9GB 2E27L 5EZJB 3QA3A 3QWRD 4DKEH 3VXUE 3ARFB 3C5ZC 2DQTL 2DI8A 5DD1L 3BZ4B 4I2XE 4I0PB 4ZS6C 3BPNB 3BEVA 3VD9A 5E2UH 5JHDD 5EU7C 5T5FH 4U1HB 5L2KA 2ESVA 4NWUL 1PKQE 4KRNA 4JPKH 4ELKB 4ERSL 4NC0B 1S9VA 3L3GA 4M6ML 4QHMB 1EV2E 4LCIH 3MV11 5HGAB 3GB7A 3U4EA 1BZ7B 5FGSA 4UQ2A 2HLAA 8FABA 5T3XL 2Z8VC 4XRCA 1Q9KA 5ESVA 1F3RB 1XF4A 4XTRD 3PWNA 2D9CA 1YY8A 4KKBC 2IANE 1HH6B 4GBXB 3G5VB 2IPUK 3NVQA 1BM3L 5J57B 2NLJB 2ZPKH 4MXQC 1F8TL 2FX7H 4JKMA 3V52H 1QO3A 4GT7A 3BPOB 1S7VB 3AB0B 2EIBA 4GRWB 4GW4B 1N3NA 2DQDH 4G9DB 3IDXL 3FT3A 5E1HB 1KB5H 2C1PA 1DQJA 3P9LA 1BVLB 1JPTL 4OI7A 1UKTA 4NSKA 4YDKL 5J56B 4GKSA 2IANB 2HTLD 4NZDA 4J8RB 3W2DL 3KPLA 2NY0D 5J7CC 4G6KL 2YK1L 4XAWL 1RAMA 4OZIF 3F8UB 1RMFH 5EIQA 1MEXL 3NFSL 2CLVA 1EH9A 4MD0B 2AEQH 3N9GL 3EO1B 1G6RA 3FZUD 3PHOB 2J7LA 1CICC 1QHPA 4UB0H 5INCA 3FFDB 4P4KB 4WU7B 4RISL 3ROLA 3DO7B 5C0BA 1Z3GH 2GT9B 2ZG1A 3UTTE 2F58L 1IC1A 2ITCB 5K59E 4XP9H 5E8DL 4OZFA 2GY5A 3MJ7A 5D7SL 4PB9H 4ZOEA 3GSNH 4IOIB 3ZDYE 5IKCB 3NGBB 3LOWA 4HIJA 3MACL 3VXSA 1JYNA 1MF2L 3NFNA 4WHYG 4DUWA 4OCYH 2E8ZA 3VE0B 1WGOA 2P8LB 1WWAX 1BJ8A 1DQDL 2D7PA 2WWMC 5J9PA 1QFUH 1WJ3A 5HYSB 3TIDA 3OG4B 5I8EA 3DROA 5F1SA 1F2XK 1I8KA 3TN0B 3WMSA 2XYCA 3O0RH 2OTWB 2ZOKB 1CR9L 1UB6B 4QNPF 4XPTH 3X11A 1KN4H 2ARJA 2LVEA 3V4PH 4CU6A 4PJ7E 1BD2B 1NBYA 4HUXB 4Z0XB 2BCKB 2ZCLH 1YEJL 3K8LA 4I3RH 4WFHD 1CXIA 2ITDA 5C6WH 4PLJC 1MCNA 2RB8A 5DRNA 4CMMA 5IFAH 5IB3A 3RVTD 1HYSC 3X14A 3RZCC 3NCMA 4AH2B 3IFNH 4ONFL 4AY0A 1MVFA 4PJ7B 2Z8SA 4R26H 5DZNA 3C87A 1JGDA 3QAZC 2F8VA 2GK0A 1OLZA 5DTFA 2F5BH 2PUQT 5DI8B 3QIWB 4ONGL 2N4IA 5CILL 4JO2L 5SWSA 1DCLA 2BSTB 5KAQG 5ERWA 4HX1B 4LNRB 1Q72L 1I1AB 4LAJH 1I7RA 1CDUA 2B1HL 2GTZB 1P7QD 4P2RE 3ORJA 3G6DL 3DBXB 4RGOL 1E6OH 1M71B 1SEQH 1HHHB 4NBXB 5KSVB 4IRSD 3QXDB 4A6YB 5E0QA 4I8DA 3HI6H 2JJTA 4EIGB 5L0QB 4HDIA 5I8KH 2A38A 3FT2B 2CKBH 5J13C 1TFHA 5IEHA 3HMXH 1F3DH 5BO1L 4JLRB 4KQ3L 4O4YH 1NMAH 4WFFE 4YDVA 5MENA 2FB4H 4AQOA 1XF5B 2QHLA 3Q3GB 3W81A 2ZUVA 5ADOH 1T4KB 2ADIA 4P2RB 3PGCA 2EC9U 3UTSE 4Y1AE 4XBEH 4U1NB 2R39A 4QRSB 1BVKB 3TESA 3MRFB 4YUEH 4GKZA 3EJYD 3HR5A 4NQEE 4I77L 1P84K 4PJ8D 4C56E 4OF0A 3ULUF 1QFWM 1CGSL 1YN7B 4XI5D 4KV5F 3O6KL 4UMGA 5DD5L 5D2NC 3ARQA 4Y2DB 4MX7B 4TVPL 5JHDA 3NOIA 2FEDD 4O02H 4RBPH 3UTSB 4Y1AB 3MTRA 2CGRH 4FQ1H 3RKDD 1DQLL 3REVB 4NQEB 4PJXE 4KQ4L 2G60H 2LU4A 1N2RB 3PWPB 4XNYL 2R1WA 5CD5D 1KJ2H 1XCQB 4U4BA 5IW1B 3V7AG 3WXVL 3ZDXE 1YNLL 5IK3B 1B0GA 3QT2A 4XHQA 2YUVA 2PO6B 2G5RA 3LKNA 5DJCB 4GRLC 5DD6A 3TBWB 1PX4A 2G75B 5F1NB 1N8ZA 2HG5A 3T0BA 2OTPA 5MP6H 5DJYA 1EERB 3GSVB 4Z7WB 2VLRD 5TF1H 4PJXB 1HHJB 4KHTL 3FO1B 2APWA 4GKNB 1FSKC 2IPTH 1AKJD 4PLNC 3OPZL 5CMAB 2Y9RT 2UZIH 5K9JL 3CDFA 4KRPB 3FQWA 5T1KB 2AXJA 3ARTA 4WI8A 5HDLA 1YA5A 4RAHA 1TZIA 3W0WD 3HLAB 1VB9A 4HSQA 5KANI 1D9KC 4GMSL 4TSCL 1EJ6A 3VG0L 4Z7VF 3U1SH 2PCPA 3WUWA 1QSFB 3TYGH 4R7DB 1QKZH 3OKKA 3ROOA 4K8RH 5KN5A 4YDJB 1G1CA 1GGUA 5CUSL 2VH5H 2HYMA 4H88L 4X6FA 3UZVB 3QBTB 2NYYC 1DBKH 4AZ8A 3RUGF 1B0WA 4JGUA 4MNQE 1F5WA 1G7QB 3BZFB 1NCBH 3OKDB 2F53D 4HJGA 4R7NB 5BOZG 5EBMA 1FGNH 2Q8BH 4ODHH 1V7NL 1JGEB 3ULUL 2NR6D 4JY6B 3ARDA 5BV7B 1OT2A 5CINH 4QF1A 1S78C 1I7UB 4UQ3A 3BN9C 1KELH 1CD8A 3HAEG 3T65A 5JW4Q 4P5TB 4PTTB 4X6DE 1ZTXH 1EBAA 1DBML 2EXYC 1RUKH 4MNQB 4K23L 1K4DA 4CDHA 3ABZA 1WT5A 1ES0A 1T7WA 3L3JB 2CR6A 3FQRB 5I17A 3DURA 1HNGA 4RFOL 5FCUH 2IWGA 4UV7H 5D7JB 3WFDL 2Z31A 1BQUA 1G7LB 2P42B 1TXKA 5DMKA 3MLPA 1G7JA 4L4TB 2PKDA 5TH2B 5TPWL 1MJJA 2YEZB 4FQJH 4JKWA 1C08A 1CDHA 1L7TL 4EUPB 4F15B 3FO9B 4O51B 4PBVC 1H3XA 1VCAA 5D2LB 1CFVH 3QEHB 4NKIH 1VACB 4FTVD 3WLWD 5AD0A 3G04A 4H1LA 4EVNA 3V6FB 2VDRH 4HT1H 4JHWL 2DQGL 5GS0D 4LSTH 5F9JB 4UDUA 5J11B 1DBJH 3L1OH 1NFIB 3CFCH 4ONOA 4LDEB 4OV6F 1FAIH 1O5DT 1XH3B 2IFFH 3AY4C 4P5KA 1HILB 4XPGL 1T2JA 2XACC 3T8XB 3P9WB 4K7PX 2OX5A 1HH9A 2MNUA 1A9BA 3BRGC 4LHUA 5K93A 3TO4B 2PXYA 3MOBL 1P7QA 5BVJA 1I3RA 3QI9C 5CIPA 4I1NB 4ZDHA 3FQNB 2LU3A 4X99A 1J0IA 1UCBL 2Q1EA 1T1ZA 1AGFA 3QXTA 1TJGH 2D2OA 3L7FB 3O41B 1B88A 4Y8DC 4JDVB 3QQ4A 3EO1A 1YN6A 1J0JA 5C3TA 3AVEA 2CUHA 5CGMA 1WICA 4HC1A 3S96A 4QT5B 3OR7A 2SEBB 5C09D 4P23C 3VXRE 2VDQL 2R4RL 4J3VA 2ITCA 4QRRB 1JZ4A 1T80A 2KDGA 1HIMH 3V4VL 5BS0D 3IKCA 4L9LC 3RWIA 1FNGB 3SKOB 4R90L 5K59F 5FM5O 2W9EH 2VITA 3DUSB 1A4JA 4E41D 3QDJD 1KXQE 1VFAB 1D5XB 1X3DA 4PJ8A 1NSNH 3H7BB 2FX8H 4WIQA 3VE0A 3KJ6L 1PVHA 1BZ9B 3F12B 4GAGH 1W0VB 5IBLD 3C09B 4Y19A 2X9WA 3WNMA 5LQBL 3F6LA 1N4XH 5IMMA 1M7DA 1ZLSL 3RZWA 3IAPA 4X6CE 1FIGL 4CUCA 1IGTA 4AM0B 2W07A 3HG1E 3PP3K 3T08A 2YRPA 2XV6B 3JZ7A 4JRYD 1F4XL 3O8XA 4OIBA 3QEQB 1QA9B 1MREL 1BD2A 1FPTH 1GRWA 1R6VA 2R2HB 4P2OA 3BAEL 2XZZA 4YLQT 4PJ7F 3FZUC 3TJEL 1U58A 4D0CA 3DETC 4NN6C 5DJXA 3WS6C 3QUXD 1IAIM 4PRDB 4X6CB 4WFED 2YZ8A 4NZRL 2VLRA 2FYYB 3QUKB 3A6CL 1OTTC 4GAFB 5T1MB 5FUCC 2BDNH 3V95A 4FABH 1GGCH 2F19H 4XP1H 3PGDB 4EXKA 3L5HA 2V2TA 4I18A 5DRZB 1KV3A 5F7HA 2ZG2A 5DS8A 3O6MH 4I48B 1NUNB 2PF6A 5CP7B 1MHPH 2ADFH 5DMGD 1I9IL 2BSTA 1F97A 5CSGA 2Y7QA 1CDGA 4CAGA 3TA3D 1R0AH 4L8BB 3T0WA 3V0WL 4J12A 1S7QB 4L3EB 5JQHC 1LO5B 1MJ7L 2L4OA 3GMLA 2NW3A 4PJ5D 3BH9B 3MYJB 4JZOB 3V5KB 3BW9B 3OKLB 4NKQB 3U83A 3ULSB 1J86A 4MJ5B 1P7KA 2EDQA 1H3TA 4R96B 5EFIA 1YNTA 4D3CH 1D5ZB 4Y88A 5IT2H 4I3SL 1BOGB 4PP2B 1LNUB 5E2VH 2P8MB 2VABA 3JWOH 4OCLC 3W9DA 5KJRL 4Z8FH 4WNQB 1WWWX 2ICWJ 2OMBA 2FATL 4M93B 2DI9A 1KLFA 4MXWL 2X10A 4K55A 5KS9B 4OZFH 2JB5H 3BT2L 4KJYB 3TT1H 4FQLH 2OR9L 4BJLA 3OX8B 1LP9E 5JO5B 5LAXB 2BXYA 1B3JA 2X1WL 4K9EH 1ACYL 2G2RB 1OTSD 2P1YA 1Q94B 4R97C 1LO4L 4BSJA 3MYZA 4JANB 1WBYB 3QDAA 3NTCH 4F7CA 1HK6A 4HK0B 4DN4H 5JPNB 2BNQE 3CFDB 3HC3H 1AHWB 4XCNA 4W6XB 3C6LC 4PY8J 1F4WL 3BEWB 2CLRB 3O6LH 3LD8B 4JFDD 5FKPA 4YPGA 3RDTB 1YDPB 1P1ZA 4PJXF 4RGND 1FN4A 1RZ8A 3LEVL 1MCLA 4FTVA 2DDQH 2BFVH 2VXUL 3ZDXF 1U2CA 3OXSB 4J3TA 2BXZA 1S7UB 3ARBD 4UBDC 4G3YL 1AC6A 2DBJA 1XF1A 1GGTA 4A6YL 1LEKB 3A67L 1D6VL 3IS1X 1MY7A 3VGBA 1F11B 3MLTB 1UWEH 2GJZA 3CFKB 3P0GB 2XN9A 1WWBX 4HUKB 1Q0XL 4FFZH 2GI7A 3PWJB 1O7SA 4U1GC 5D7LD 3SKMA 3SBWA 3DECA 1CL7H 4GFTB 4MA1B 1JZ7A 2AV1B 3RWJB 2QADB 1ZSDA 2GSGB 5IMKA 1ZHNB 5I2IB 1AD9A 1OPGL 4M9PA 4WW2A 3SE3A 1ITBB 1LE9B 5CSZB 1GZQB 2AV7A 1KBGH 1CU4L 1HQRB 5IESL 3RKDC 3F7YA 4HPYL 1D6EA 3HE6A 2PYEB 4L4VD 3Q6FB 2EZ0C 4XCCL 3O3DB 5C09A 1TVBB 4XCEB 5F89A 1Y18A 5BS0A 3QIUD 2H32A 3R0MA 1MHCA 2XRAL 1N5AB 3S36H 1ED3A 4YFDB 3QDJA 4M7ZB 3OAYK 1QRND 1X9QA 1JV5A 1IZJA 2B39A 5FM4A 5CEZH 2EDRA 4W81A 5K9KB 1ND0B 3I6GB 2GSIB 4OKDA 4X6DF 4S1DC 1I3GL 1YEEH 1R3LB 2PTUA 3BPCB 5GJTH 4MHHI 2IF7A 2Z9TA 3BUTA 1H8SA 4PD4K 1HEZB 1PSKL 4CU7A 2VTFA 4OLZH 1YUHA 4P9MH 3NAAL 2ZP0T 3BKCL 4IRJA 5D2LF 5DRWA 4S1QH 4HS8H 1OARL 1ACZA 3KNBB 4JRYA 5FO8B 2C1OA 1N5YH 4QXUL 3SGDH 1MCDA 3STLA 2B4CH 3AFLA 3FB7B 5BRZD 3D25A 3EIFA 3QUXA 5IOPA 5TDOA 3DMMD 3GMQB 1JN6A 5JXED 2FNBA 3NABL 4OCRL 4JN2B 3SDAC 4D9QE 4KVCL 1UQSA 4M00A 1IEHA 3L5IA 4YDLB 4P2QB 4QOKA 1NCCH 3FO0L 1YQVH 2E6PA 5EA0L 3TNMA 4DKDC 1S3KH 1CGVA 3KPSB 4JM2D 3UJJH 3BOVA 2JIXD 3QUZB 4G6MH 1U8NA 5HTSA 1EAPB 2Q76B 1CWVA 3SE9L 2F8OA 1F58H 4ACPA 3SJVA 3HRZB 4YIQA 4YGAB 3S88H 2P24A 1BFOA 3BP4B 3RPIA 5E99H 4EN3C 4AL8L 3ZHDA 2ED9A 3HC4H 5BV7L 4P4RB 4NNPH 5EU3B 5CGTA 5LXGL 3LPGA 1MJUH 3B83A 5BW7A 1KYOJ 5ELIA 5EU6A 1IQDB 4KRLB 2UWEA 4O2CB 3LN9A 1IAKA 4PJ5A 2BNUB 3GSWA 3QH3B 2ZCHL 3Q5OA 3HZYA 4HK3N 1J1OL 4TULL 4WY7L 2X4SA 2CQVA 4FOMA 4GQ9H 4JDVA 1IKFL 3D9AH 2I9LA 4Y4HB 3IT8D 4WW1A 4QT5A 1S8DA 5C0IA 2SEBA 1OP9A 1FH5H 4X98A 4PJEE 4S2SA 1F2QA 1ZANH 2YPVH 4HWBH 1LK3H 4X83A 3UJIH 3OB8A 2Y07L 4FQXB 5CWSA 1F3JA 1Q0YH 4LGPB 2C9AA 3KR3L 3TO2A 1IM3B 1ZGLA 5SWQA 4F9PA 5JOPD 3DIFB 1TCRB 3RNQB 4OD1L 4MMZC 3SGJC 3EYVA 2WBJD 3QULA 4EBQH 3HRPA 4RX4A 2LABA 4BZ2L 4HGKC 5T3XD 1WC7A 4HJJL 2HMIC 4LCYA 1R5IA 2OSLB 3EDDA 3WHE0 2V7NA 3SEPA 5CAYB 2J8UB 4Y5YA 3M45A 2XPGA 3D0LB 4ZUSA 1T20A 1NMCC 2J88L 4AM0A 4X6CF 4PRBB 1R5VA 2MHAB 4JFDA 3OXRB 1GGYA 2Y5TA 3CD4A 3TVMC 2HJLB 1DBBL 1MCQA 4Q2ZA 1QA9A 4WJ5A 5I1KL 3VFSB 3VXNB 5D96C 1MCRA 1NGWB 3ZSSA 1OCWL 1JUFB 5E6YA 1Q1JH 3KYKL 1IC7H 2DYPB 5D6DA 3OGCB 1BBDH 4UIMB 4BSVB 2CD0A 4PJGE 3BIKB 2DB8A 4RGMC 4H0IA 3A6BL 2BVOA 2VLKE 1AFVL 5FHAH 4QTIH 3TNNA 4G5ZH 4F58H 3OAZK 4PV8B 1I8IA 2YBRA 4TTDD 2W60B 4K3DH 1DUYA 3MNVA 4ZNCD 4UV4L 3HB3D 5FXCH 3DSFH 4Q9QH 1IGML 4H1LH 4NQCA 1FYTB 1T66D 2V9QA 3QJFA 5F88A 5I18L 4JPIB 4NO2A 2NX5A 3ILQC 4HHAB 3UBXA 1FZJB 3ARGB 2V17H 4OD2B 3S35H 2Z92A 3Q5YA 3S9DB 3O9WC 3ZHKA 5MEQA 3H9SD 3JBG7 1INQB 3MLUL 4TSAL 4U6YB 4WU5B 4LDOB 1MY5A 2VB5A 1Z2KA 1FLRL 1NCAH 1U8PA 4GRWH 1SJEA 5I1DB 3H9HB 1T1XB 3FRPA 4XT1C 1MCKA 5D1QD 1DQTA 1CFQA 3QFJB 2VDNL 4JN1H 3RWDB 3CC5A 4KROD 1N59A 4H5SB 3NMEA 5CIPH 4C59B 5IG7A 2DKMA 5C9JB 4DFIA 2ZOLB 1QRNA 7FABH 4YHZH 5FHBL 3MCLH 3QQNA 3ARED 5I76A 2HN7A 4RQQA 3H8NA 1W0WB 3ALPA 3GIZL 4LSPH 5FYLD 1YEKH 3VW3L 3O3EB 3MBEC 5KVEL 4NN5B 4O2FB 1XIWD 3GK8H 1KG0A 4X7DC 1F02I 4NHCH 3CSYB 3NCYP 4OM1H 3VWKD 3FL7A 3LEXB 1FZMA 1K9TA 1OAXH 4APQD 3O2DA 3WS3B 2YPLE 4MZ2A 2HFFA 4MQXC 3MRPB 5I30L 4NQSB 1ITCA 4KKLD 3MGTA 5BRZA 2BVEA 1P4BH 3BIBX 1OAKH 5FK9B 3BKJL 4MA3A 1NLBH 2IAMC 1KLGA 3DMMA 5JXEA 2H9GB 3BQUA 1JWUB 2ILLA 2GW5A 1ONQA 4HZLB 4G6AC 1W72L 3RTQC 1MLBB 2VLLB 4HBCL 1WTLA 1S9YA 4JM2A 4LFHG 4PYHA 2JIXA 3ZKMD 3EFDL 3K8MA 2FZ3B 2OJZL 3ESUF 1EO8L 4J3OC 4MQTB 5JUEL 4PGZA 2JJWA 1C7SA 4YWGL 5AYUL 4DTGH 3CVIL 2RIKA 4JKPH 4LLDB 3O3BB 4IS6B 1BJMA 4G8IB 4XGZB 5FDWA 3TH2T 1Y0LA 3TF7C 1ZEAH 2X1QA 2JELL 3TC9A 4GSDL 5L7XH 1O0VA 5HI5D 3CLFH 4UTBH 4PV9B 1MRFH 1QD0A 1XF3A 5T1DH 3QNYA 1IL1B 1PFCA 2HFEA 3ETBF 3V6ZB 1UB5A 4FXLA 3TJHC 4JFED 4NZTL 4RFNC 3BE1L 1EHLL 1QBAA 3UC0H 4OV5A 4XCEA 3CK0H 2X09A 1QFWH 5I73C 5AUMB 2J6EL 4TVPD 2CH8A 3RU8H 4F7MB 3FB5A 3EDEA 4HKJB 2VR4A 1IZKA 1U8MB 1QEWB 3ARBC 4G6JH 4JG0L 4X7SL 3RX5A 4WVRA 3E6FA 4MA7L 5IWLC 1A7PL 4J1UB 4HCRL 1G7HB 2WBJA 3UXFA 4DVBB 1A14H 1NQBA 5T1LB 5F21B 1K3IA 4PR5B 3EYUH 1MCWW 4FXKB 1XGTB 1H5BA 5BJTB 4KUCF 5TQ2L 4O9HL 4JDTH 2GITA 3G5XB 1U8IB 1FRGL 1OGAD 3C2SA 1RUQH 4IIQA 4K7PL 3F5WB 4KTEH 1PYWB 3TZVB 4WO4C 1KIQB 2AXFA 3C9NB 3U4AA 2PTTA 3H3PH 2GJ6B 4LCUA 4NO5A 2BVPA 1IEAB 4WI4A 4U1MA 3IAGC 3SDCC 3CMGA 3BP7A 1A3LH 4IRZL 4M7LH 4YFLF 2MQ0A 4TOYH 5FYKH 5IGXL 3AM8A 4GJTB 3QIUC 9CGTA 4JDZA 4U6XA 3ESVF 1NFKA 3WIIH 2R1YB 1AGDA 2HRPL 3BKMH 1A7BA 5EUKB 3OHXB 2F54B 2YA1A 1QSED 4Z78B 1KN2H 5ISZB 2Y06L 5FGBC 2QTEA 1KCKA 2Q76A 3RWEA 3SCMB 3DPBA 4K8RC 4PGBB 3LKQB 3S5LA 3HAEB 2A74A 1UEYA 2FDBP 1UACH 3RAJL 3TV3L 5F7MC 4R8WH 3GSOA 3NN8B 5E1AA 1JZ5A 1EMTL 2OP4H 5DWUL 5BQ7B 5ID0A 3CFJA 4JY4B 2M26A 1MFCH 2EH7L 5B39B 5LCVL 2KZ1B 3MMEB 5DEGB 2B1AL 3CJJA 5IP4A 5DJ2B 4J6RH 4Y5XC 2X41A 5CJOH 3G5YB 5HHXL 15C8L 3QPXH 1DVFB 3EOTH 3MRBA 5C0FB 3TLRA 3LEYL 3T2OA 4XP5L 4ZFOB 1U8LB 3AREA 3EO0B 5J6GB 3T0EB 4PJEF 2NY1C 3FQXB 5EO1B 1GH7A 3FN0H 3HZMA 3MJ8A 1R3HB 3VGAC 1XIWA 3HMWH 4X8JB 4CRPA 5AG8A 3VFMA 3H7LA 5A43C 3VWKA 1LEGA 4DN3H 2K1MA 3HS0A 2YA2A 4U1KA 3MC0A 4R9HA 2AXGA 2VZVA 1FL6A 4P57A 1EEYA 1Y6NR 4F7EA 3RL2B 2DQJH 2XTLA 1N0XH 3ZT6A 1UEMA 3BWUC 4QHNB 4WTZA 2NY2D 3CVHB 4XPHL 2FHBA 2ZKHL 1KEGL 1RU9H 5BMFL 1MVUB 4X80L 3U2SB 5ECJE 1GOHA 1NCNA 4WWKB 1TLKA 4ZODA 5FKAB 3BYYA 3RWHA 3VG9C 2HJKA 1BP3B 3NFPA 3WSQL 5EORH 3FAWA 1IAOB 4LLVB 1C12B 2H1PH 1BEYH 3GBLA 1HWGB 3MXVL 4X6EB 5TF0A 5MEOB 5B4MD 4F33B 5D8JL 1KTKE 3V7MA 5GRWA 5IBTH 3GMRA 4O58L 1EEZA 3EW3B 1M6OA 4OCWH 4TUKH 3T04D 3BISA 3WHXB 4Y7MA 1FNEA 5IR1A 5IW6A 2HVKA 5C2UB 4PJGF 1UM5H 3UBXI 5D1XA 1A9EA 5DDHB 4JFFE 3VXMD 1EO7A 3WN5C 1K5NA 4F37K 4DZBA 4R2GB 3QG6B 2VAAB 5HBBA 4MJ6A 3LKPB 4HUWA 5JLZA 4MAUH 1IEBA 1GAFL 1U8KB 1CICB 2QEJA 5EUOE 3ARGA 3DYMA 1A7RL 3GMMA 1KCRH 4QRQB 2FHCA 4PGCA 4WRLA 4UAOB 4KHXL 2EDOA 4KXZH 5I0ZA 4JFFB 1C5CL 3MBXL 4UNTA 3B2UD 2NW2B 3VXUD 3RIFF 2OZ4L 4X8XA 1SYVB 4NHUA 3QDGA 3B9VA 3PHQA 4JFXB 2HH0L 4LBEA 3L3HB 4XBGB 3CZJA 1YEDA 1QLEL 4HWEL 4FQ2H 1RI8A 5DHVB 1T21B 2I25N 3VGGA 2AI0H 2NY4C 3QCUL 4IOFD 4GBXD 2VZTA 1T1WA 4M7LT 4ONHA 4XWOC 4LP4A 4P9HH 3GI8L 5DD3H 4UINL 2BK8A 4JQXC 2X7LA 1BFVL 3QRGL 5A2LH 2YUZA 2X5PA 1B2WL 2AEWA 4R4FH 4MB4A 2H26A 1V3KA 1T89C 5ID1B 4NT6A 1EGJH 2YD4A 5E6ZA 5EO9B 5KAQF 1TTGA 1QR1B 4XB8A 4OCSH 4PRHA 2ADGB 2M1KA 3S4SG 2IAND 4POUB 4PJ9B 1ZLVH 3OMZA 2BERA 1XGRB 1MLCB 5EC1A 1OGAA 5JIKA 2QHRL 3JWDH 3GBNH 1IAIH 4ETQA 5DEZA 4K3JL 3GSRA 3DX7B 1EAJA 2XTJB 4RDQG 1GGIL 1U3HA 2NXYD 2UUDK 4JKLA 2YMXL 1VERA 5KOMC 4DKAA 4LLUB 3MOAH 2P48B 5J8OA 3K4DA 4FA8A 5I1LB 4RMWA 2ERJC 2F5AH 3O6FB 1NGPH 4EZMA 1NGZB 1YQ2A 3U36B 3EYFB 3MOQA 1NCWL 2XZCH 3B5HA 2V7HB 1HWHB 4LLWA 2DD8L 1OW0A 5A16A 4JQIH 3C60D 2N7AA 4DAGH 3MNZB 1TNMA 3UTTD 2O5XL 3TBYA 1JF1B 2Z93B 3UJTL 1BREA 1S9WB 3TN0D 4LVNC 3ES6B 2XA8L 1RZKH 2OXGA 5I1CL 2F74B 2EYTB 2K7PA 4LSRH 1X4XA 5SWZE 2GYSA 1AO7E 4QYOB 4XPBH 5KTEL 2ZWLT 3HNSL 4PGEB 3O3AB 4U1LB 1QNZL 5D2NE 3CXHJ 3C08L 4HG4K 3LS4H 4KKLC 2EDNA 1NDGB 3IVKB 5KVGL 4B41A 3RVUD 2EE2A 5JHLH 5D71H 2OL3B 2XQBH 3FKUS 1BQHG 3M17A 2AJVH 1RJCA 4KMTL 5F44A 1J1XH 3BDBA 5ICYA 4K9EC 1QLRB 4G43B 5D2NB 5DA4A 1RUAL 2P47B 4X4MA 5DJ6B 5GRUL 1CD1B 2B0SL 3EDKA 2O61A 3IXTB 5IM7A 5D1ZA 2FGWH 2CK0L 1CZ8H 1GPOH 5DJAA 2JF1A 3GSUA 5I6XB 1BJ1J 2VLJE 2I5YL 1DLHA 2A6IB 3OWEA 4XWGL 5IJVB 1P2CB 3CU7A 2W9DL 4TPRL 5HYIA 4BQ8A 4MCZB 2FD6L 1CVRA 2X4TA 3U9UA 2IADB 2NMSA 3CSPA 3CPLA 3KPMA 4LSSL 1A1NB 1FVCB 4G7YL 3BMWA 5B22A 4KK6D 3LY6A 4HULB 1XGYL 1MRDL 4LGRB 1MFAH 4XC1H 4JB9L 1CLZL 4PGJA 3MA7B 5IMOB 5E8EB 4LLYB 1JFQL 2VLJB 5EOCJ 5B8CC 4L29B 3U7AA 4KJPD 1JVKA 3RVVC 3O2DH 4HIHB 2R8SL 3X12A 1P5UA 1HINH 2A6JB 4HAGA 4ZXBD 3GGWA 4KZDH 1NUGA 4S0TD 5TE7L 1WWCA 3GSXA 3BESR 5JW3L 3PIQB 4MJ2A 3MV7A 4R0LA 4OB5L 2DWDB 5GGVY 1WIUA 1GZPB 2WZPD 3VXMA 2UY6A 4J7RA 1OVZA 2A9MH 3MRNA 4NKDA 4Q6IB 5HYJE 4WFFD 5DC9B 1HNFA 4WWID 2VLME 4S1RH 3O4LE 1IFHL 4ODUB 3LKQA 5I1GH 4KK9C 1BFSA 4Y16B 3UTSD 3UPRB 4Y1AD 4GMTL 1JWMB 3TIEA 1INEH 3FOLA 5I16B 1P53A 4NQED 3SGKA 1V5JA 3VXUA 1JCKA 2QL1A 4FQIH 4C56D 1KJ3L 4YHLL 4LRNH 5HYJB 1WLHA 4LCWA 4I2XA 1CE6B 1ULVA 2PO6D 2BOBB 3O4LB 5CEXA 4U0QB 4MCYA 3X3GL 5DJ2A 4F9LA 2QSVA 1PKQA 1PZUB 3U48A 4CVXB 2H41A 1F13A 3QIBD 5CKAA 3DRTB 1E28B 3I6LE 5DYOB 1MCHA 3N06B 3QUYC 4PJAE 5LWYH 2DLFL 4M62H 1JRHL 3VDAA 3EYSH 2IPKB 3SPVA 1NLDH 2DL9A 3PWLB 1IGCH 5IMLA 4KRPD 5C0DA 3CZFB 2ZUQB 4RRPG 5DQ9B 5T1KD 2MQ3A 1JGVH 3LHPL 4XP6L 3ME0A 3JV4A 1JHKH 4M8QA 5A3ID 2B4CC 2DOCA 5DVNA 2A83A 4URTB 3WNOA 5FOBA 2DM3A 4W4OC 4XNUL 4HH9A 3C2AH 5I19H 2DLEA 4GAJH 1JPSH 2B5IB 4M6MH 1PG7X 3L5WA 1A5FL 1CXEA 4P48A 4KH2A 4JRWA 4D8PA 3ULUC 2FR4B 2VDKH 3HUJA 4OUUA 1G6VK 2B8OT 1SY6L 2VE6A 4JKKA 3MRIB 2FBJH 3ARUA 3DYPA 12E8H 4JO3H 2Q86B 5J1TC 3MLSH 3FFCE 4MAYB 1WZ1H 1EK3A 1F8TH 1TVDA 1C12A 2DJ4A 1YMHA 1AJ7L 5KW9H 3VD4A 3TBTB 5CKGA 4XVUD 3C60A 2A1WL 1E4WH 3O11A 3PGFH 4ELME 3UTTA 1LDPH 4MNQD 5I71B 3UTPE 5F3BA 4N1CA 2GTWA 3FFCB 1BF8A 1MQKH 2FIKA 4KDTA 1DQML 4Y4FD 1AC0A 4KTDL 2VXSH 1JGLH 2AK1L 2DBLL 1NAKH 4P46C 2BVQA 4HMEA 1YEIL 1DP0A 1HKFA 3KPQB 2A73A 3P73A 4ODWB 1OSPH 5CLTA 4OSUL 3GMPA 5EIIB 5DMIL 1OB1B 3VRIA 5GZOD 1V7ML 35C8H 5CFHA 1P4IH 3NCJH 2AJSH 3FCTB 1ZA6A 2CLZA 4L9LB 1EJOL 2QQLH 2IALA 2R0WH 4QLRA 4M1GH 4QCIB 4XBGA 3R06B 4AT6B 5C1MB 4OZHE 5KSAB 5KG9B 3ARDC 1U95A 1OSZB 1ZT1A 1XF2B 3U0WL 1FVDA 4DVRH 4XPAH 5TE6L 3SE8H 1OL0A 2GAZB 4QRPE 1BQLL 3D85B 5KANG 1CLYH 3JTSB 5E94B 1V3MA 5C3LD 1I3VA 1AGCA 3HNVH 2IBZX 3CFBA 2B20A 2APVA 5FUCE 4CVZB 1Q8MA 1QR1A 4AENA 3ARFC 4XCYB 3TO4D 4PRPB 4I0PC 3BPNC 5FYLH 4CDGC 3BUYB 2I07B 2A9NL 3NIFE 4QRPB 4X5XA 2Z31C 4Q9RH 4JPVH 4RAUA 5IFJB 4DOHE 4ORGA 1AGBB 1ZA3A 2Q8AL 4GAYB 1U6AH 2GUOB 2JB6B 1N6QH 3IFOA 4DQOL 3V6OE 4ZXBA 1J7VR 4P59L 1NC4B 4X4YA 4N0CD 5CBAA 3F7RA 2DQFA 3F7PC 2J8HA 5T3ZE 4UU9B 2DMBA 4U1JB 2OMNA 3LN5A 3GI9L 4PIRF 5FF6B 5ESAA 5F7NC 1T2XA 4JFOB 4NJAH 3VXRD 3BPOC 3AB0C 2H8PA 4I5BA 4Y4KD 3BH8B 1N6UA 1A6TA 1U3JA 1U42A 2HVJA 3I75A 4BH7B 1UC6A 2B1HH 3FB6A 3LS5L 2XZAL 4U1SB 1YECH 5C0CA 4AEHL 4XNXH 4XXDA 4JO1L 1CG9A 1A6VL 4E0RA 4QRTA 4C56A 4FP8L 4MB3A 3MREB 3O3AA 5FA3A 4XZUB 1JPST 3W9EA 5D70L 2DQUL 1AGEA 3W39B 3WFEH 1HI6B 2WIIA 3LV3A 4WUKL 5KBNC 2WBWB 4KQ3H 1M7XA 2WP3O 3CXDL 1R3IH 1MCOL 4CN6A 2YD3A 2AJXL 1C5DB 1RHFA 1OTUC 3CH1B 4P4KC 4R3SB 3BN3B 3MNWB 1GHFH 1QYGL 2E7BA 1PQZA 4NO0A 5IVZB 5ACZB 3QO1B 4F80A 4GXVL 1JE6A 5A40E 3HG1D 5JOFB 4LLQB 4ZPTB 3QDMA 2NTSP 4Z7UE 4Q9BA 4OF7A 5IB5B 1UZ8A 2ENYA 3U6RB 3UDWA 3X3FL 3WFCH 3MLWL 1CDCA 4TVPH 32C2B 3T2NL 1AY1L 1NFDE 4HGWB 7CGTA 1XR9B 4OZFG 2AEIT 2A6IA 5C0GB 1G9MH 1AXSB 2EIZA 2H2SC 2YWYA 5GGSA 2R2BB 4Z7UB 3VXQA 4FS0A 3DVNA 4BZYA 1C1EH 1UM4L 1RUPL 5JQ6L 3QXUA 4QHLB 3BRDA 1AH1A 1CFNA 1U91B 3O8XC 5C0NC 4OCMC 3NIDE 4P2OC 3MXWL 4PJBE 5AWNH 1OP5K 4H20H 2VZ1A 3MUJA 4KKCD 3SHSA 3QHFL 5KZCD 1F6FB 1CFTA 4ODSL 3PABA 4HIHA 2WUCL 1DANT 4P99A 1TZHB 4Y5VA 3MRDA 1J8HA 3CAFA 5EWIL 2HFGL 1OAZH 1F3DJ 4NBZB 5F1IA 1QBLH 1DEEA 2P5WB 1G9NH 1I9JL 2EDFA 1DLFL 4ZO8A 4FN0A 4Y4FA 4LCCB 3PV6A 5DMYA 3QIWC 3IDMA 1RHHA 4ODVL 5LG1A 4PREA 5DRXA 4TSCH 1IM9D 1X7QB 3IKKA 5HSFA 1KNOA 5ESQA 4EQ3A 3GKWL 4X6DA 2E9BA 4M6NL 5CUSH 1I1AC 1NGYB 5AZEL 2E6QA 3KPPB 3T4YB 4YHNB 4ZUTA 3KYOB 1JL8A 3THML 1FFPA 2DLIA 5A2KH 4ZTPH 1AIFB 1EVTC 2ED7A 1ORQA 1RIUL 4NPYA 3RDTD 3CXHK 3KDMB 3S98A 1KB9J 5L0QC 4G6FB 4O5LL 1LE5B 3CIQA 5CHNB 6FABL 5LGHL 2R2EA 2H2PD 2NZIA 4OLWL 3S97C 4L8SB 1DN0B 3GNML 4XNMB 4Z77B 2BNQD 3MLXH 1KT2A 3OR6A 4MJIE 1DFBH 5CEYB 5JORB 5L88L 1WBXA 4WEBH 1J9CT 3BO8A 2A6KB 2P7TB 5DGQA 3K2UL 2AK4E 5I8CA 1K8DB 3REWB 5JDSA 3HPJA 4YPJA 4HPOL 4OKVB 2QADD 2UYLB 4Y2DC 4PGDA 4OLXL 4MJIB 1L9NA 3DOSA 3WE6A 4V2BA 3IJYB 5DJDB 1UFUA 5ICZB 3MROB 3BXNB 3LZFH 2X4NA 2WWKO 1NANI 1XMWA 2EDXA 3QCVH 1II4E 1K4CB 1ZHKB 1QSVA 3QNXA 3TBVB 4OAWB 4U05A 4QXGL 4Z0BH 1KCSL 1YEFL 3DO3A 4KK8D 5ENWA 1C5BL 3RI5F 1F4YL 1VGEH 1VGKB 5LJYH 1NEZA 5IQ7L 2XKNB 1JPGB 4P3CL 5FYJH 2DQEH 5T33H 5DLMH 1MUJA 3EOBB 5C7XH 5J3HC 2NY3B 4OCXL 4PTUA 4QTHA 3VXRA 3I84A 3T4AA 3X13B 2MPAL 4Y4KA 3MRRA 1FGVH 3OZ9H 3E0GA 3P0YL 3T3ME 4PJHA 2VKXA 1I3UA 5EU4B 1T0MB 2AKRA 5FECA 2EIEA 3QFDA 4GUPA 4N0UA 2EDKA 4Z76A 3C8DA 3I9GH 1R24B 4OQ1A 3UZEA 5FEBA 3OQ3B 5F96H 3EJZD 4ODWA 2C7UB 2DTML 5ABDE 4KUCD 4N90E 4ESKA 4DKFH 3IETB 1OAUH 4JHZA 1KCUL 3OKNB 2WV3A 3BZDA 2OYPA 4HKBB 4NRYB 3UTOA 5HYEA 1JNNH 3HG1A 5D72L 2MTPA 2VJXA 3V5DB 2XZQL 4J3XA 2QQKH 1X5XA 5B3NA 2GQHA 3WUWG 4OZHF 1QHOA 1ADQA 3QNZA 3VFTB 3MCG1 2P5EE 3GDBA 4P5TC 1F6AB 3PHSA 3TCLB 3LQAH 3MCKA 5FUZH 2JJUA 4D9QD 3K1DA 5K9OB 2NNAA 1T5XB 5CJ5A 5IHUH 4MWFA 1W72A 3QCTH 2HT3D 4WI3A 1P4LA 1MPAH 2VQTA 1ROWA 2ZSWA 4OZGE 3QUMB 3L5JA 4IRJC 2P5EB 4JRXE 3KXFE 3BAEH 4OI8A 2XICA 4NRXA 4WEMB 4PJCA 5D7JC 5C07E 4BUHA 3F7QA 2X70A 1FO0A 4NP4H 3NIFF 4C55A 1KB5B 1EFXB 1UWGL 2ADJB 4YO0B 4NZRH 4TUJB 4YQXL 1T0NB 2EC8A 3BWAB 4O00A 1HCVA 3ZL4H 4F15C 1TITA 5HGHB 3IFLL 5I8OH 3HE7A 4OZGB 5CJXA 3U4BH 3W11C 3CVHH 1ZVSB 3KXFB 3BGMB 2C3XA 3NZHH 4MHHG 5C07B 2VC2H 3QR2A 3SDDD 1IRAY 2NTFB 3WL9A 5J11C 5L2JA 3U30B 4LPYA 3JTTA 1NANH 1IM9A 1QLFB 1KTDB 3IF1A 5E5MB 2XY2A 1GIGH 1PW3A 3GSNB 5I1AA 3D2UD 4H1LG 4U1SA 1FFQA 1BECA 3IU4L 4KJWD 3RY6C 3I85A 2A0LC 2VIRA 5H94A 3L3DB 4MD4A 4NM8L 5MHSE 1T1YA 1UWXH 5GJSH 1LP9A 4HCRA 4P9HC 3JUZA 1A6PA 3RRQA 2JCCE 1YEHL 5ALBH 2QSCL 2MOVA 3KPOB 1S7TB 1D7FA 4N68A 1MRCH 3AS0A 2BP3A 3C8KB 5I15L 4LHUG 1NBVH 2DYPD 4GG6E 4P3DB 2BNQA 3QQ9D 3MBEB 4NC1C 5KVFL 4IDJL 4PS4L 1OT1A 1MCBA 4EI5D 3I6KA 2XI9A 3JWDC 4U6HB 2C4FT 4Z7UF 4P3WA 3CMOH 5DJ0B 3CUPB 4J3UA 1FHGA 5DHVH 1EX0A 3VWJA 1UA6H 3DX9A 4DGIH 1WV7T 3MRGB 4EI6A 2FJFB 1NJ9A 3QWOA 1R3JA 2MCPH 4YXHH 4GG6B 4HEPG 2J8OA 1NFDF 3C09C 2NQCA 3HC0B 1NCUA 2D7TL 1XCTB 4QO1A 5AZ2L 1RJYB 2VLKD 4ZAKD 5A2JH 4UNUA 1PZ5B 1U92A 4WV1A 4ZUWA 3KGRA 1JHTA 1UVQB 4RZCA 3IXAB 4TSBH 3LEVH 5ITBH 3GHBL 3F7VA 4YJZL 5GQBA 5SX5H 1NBZB 4XP4L 2XWTB 3BDYL 3NIDF 5DUBA 4BKLB 3VH8A 4Y89A 5T3ZL 4PJBF 3MX0A 1T83A 3QO0A 5D6DC 3O2WL 3ZYOA 1FL5A 1EHNA 5C2BL 3KLHC 2ZSVB 1IKNA 2HAZA 1SM3H 4ZFGL 5I1EH 5F7DA 4WFGE 3LN4B 1E27B 3DSNA 3KWWB 3GIVB 4LPCA 1TZGL 1UZ6E 2FX9L 2VKWA 3W5NA 4TQEL 4EOWL 3WNKA 1RZIA 4PJFB 4X5WB 3MRQB 1I8MB 3VXOA 3T77A 1LDSA 3RWGA 3WJJA 5E8PA 4TNWF 3V2AR 4CW1B 3T3PF 4NQVA 1HHIB 4YDIL 4XPFH 3VDCA 1NGYA 2R56L 2G9HB 2JJVA 3KPRE 4XCCH 4XHJC 3OAUL 3VFUA 3VFGL 4PY7B 2COQA 1PG7L 1FORL 2VL5B 4M1DH 4M5YH 5F93C 5C70A 5ITFB 2XWBB 2UVFA 1FQ9C 3PDOB 2D31A 5IB2B 3GFUA 4JY5L 4NFDA 3GUTB 1YC8A 3HFMH 1QPXA 4L1DA 2YPLD 2XG5A 1KFAH 4HJ0D 2V5YA 3GMNB 3KPRB 3RNKB 1CXLA 1T2QH 3VFPB 1AXTL 4K2UL 4Z77A 3KYNA 1VADB 4MSWB 4HKXA 2OTUB 1I3GH 3RGVA 1NGXB 1PAMA 4NM4L 1RZGB 5EOCL 5C0AA 4R4NC 5JNYB 4MQ7A 4YAQA 1T04B 2UVEA 5HHOE 3AAZB 4M93C 4X0KA 3SO3C 3VI3E 2OL3H 1JYVA 3L9RB 1FE8L 1J1PL 2YRZA 2VDOL 4LVOB 4NRZA 5CJQH 3ZTJH 4WO4B 4ZTOL 4ZFFA 2HKHH 2QR0B 2M2DA 5IQ9A 2Q7YB 1OM3L 3EO9L 2UY7A 2AEPL 2CO7B 4OLVH 5EUOB 1I85C 3O45B 5DUML 3D39E 4XMLH 2BC4B 4HBQA 4M6OL 4XXCC 3P4MA 4V1DB 2EDHA 5HHOB 4ZOAA 3NABH 1AHWC 4H0GA 4HKZA 1FDLL 2OS7A 3LD8C 5HHMB 4H8WH 2MCG1 2Y6SC 4NWTH 5EA0H 3TYFB 4G80A 2EKSB 3D0VB 3PQYE 4K3GA 3KS0H 5E8NB 2VDPL 1A7NL 3DV4B 3IYLW 2XNAA 4F57L 1ZMYA 4FFYL 3SDDA 1JPFB 1QBBA 4N8CH 4U49A 2FL5A 3LRSA 1IT9L 2A77L 4YC2B 2HWZL 4Q97A 5T1LD 1AQKH 4PJEA 5JPMA 4WI7A 2WUBL 3B9KD 5CGYD 1DJSA 3PJSA 5E56A 4AG4H 3D2UA 2XQYG 1JWSA 4MA1C 1BX2B 1ZHLB 1I7ZA 1ZWIA 1SBSL 3T3MF 5GS1A 2G5BA 4TUOB 4YXLH 1MAML 2ATKA 1LO2H 5EDXA 4PG2A 4FNLH 1H0DA 4Y5XB 3TZVD 5I9QC 3ULVH 4JCLA 1CTNA 2VXVH 3D18B 4X7CC 1MI5E 2BVTA 2DMCA 1HQ4B 1KC5H 5IVXB 3AU1A 5D9SA 3P0VL 2FJGA 3BZEB 5HI3D 3VXPA 5FAAA 3QHZH 1B0RA 1OQXA 4I3GA 4NUGH 1RZJC 3VXTB 3NCYS 3CLEL 1NCDL 3DNKA 1TCMA 3BMVA 3E6HA 3QZWB 1PD6A 1PX3A 1HXMA 3PL6B 5DK2B 2EDTA 2R1XB 4C4KT 4EI5A 1MI5B 5HHVL 4LEXL 1F00I 4RMRA 1XZ0B 2R29L 1EDQA 5ICXB 5F7EH 1YYLL 2BZDA 4OZ4A 1WCQA 1F6AA 3U7YL 5C0RL 1ORSA 1CQYA 4PJGA 5C08E 3S34L 4RIRA 4B7IA 3WEXA 1Q9WB 1NC2B 2W1NA 4ZAKA 5EN2A 4PPTA 3WIHA 4OT1H 4CNIA 3VFWB 3VG9B 2DQIL 5HGDB 2JTDA 1YJDC 2HKFH 4WUUB 4E42B 1CFSB 4OZGF 1JK8B 3MV8B 3EGSB 1EZVY 4M5ZH 3L5XH 5IV2B 2VUOA 3FB8B 3MRKA 3VD3A 3G6AA 4LLMB 5L6YL 3BP6A 1OCWH 1A2YA 5HPMA 3MLZH 4BSWB 5TJWK 2BNRB 3WJLA 3GHEL 1HDMA 4HXBH 4HWZA 1I1FB 4ZS7L 4M1CC 4XNQA 3WYRA 3C5ZD 4DKEL 3MRMB 2ICWA 3WBDA 1DL7H 1E6JH 3MA9H 3SDXE 4ZS6D 4UV4H 3QUZC 3WDJA 3OKOB 1DQQA 5E2UL 5D4QA 3PF2A 2NTFA 1U8OB 4JPKL 5EZOH 1A3QA 3LH2H 4QHKJ 5JA9A 4H25A 5E95B 1U8JA 1A6ZA 1FG2B 1UXWB 4G8EA 4JZNA 4LCIL 1Q9LA 4RDQF 5ILTH 4HIEA 3S36X 2OR7A 2XXCB 3SDXB 3BKYH 5C71A 5FV1L 4F7PA 4ZOCA 3DGGA 1RZ7H 2VDNH 4KKBD 2YSSB 2GFBA 4LP5A 2FJHA 4MXQD 5BXFA 1UYWH 2DL2A 1ZT7A 2ZPKL 2FX7L 3V52L 2X4RB 2YPLA 4Y4HC 1S7SB 4DZ8A 4C83A 3U46A 2X4UA 4P3DA 3QA3B 3KPNA 2DQDL 4FQXC 4GG6F 1A3RH 1ZE3C 1KB5L 4KKAC 43C9A 1LGVA 1E4KA 4PLOB 4OIIH 2CIIA 3BEVB 5CLWA 2FH8A 5L2KB 2X05A 2ESVB 1G0YR 2BRRH 4PB0H 5EZIH 4NZUH 5E9DA 1S9VB 3L3GB 1CICD 1RMFL 4WTXA 3CX2A 1ADQH 5HDBE 2AEQL 1UG9A 3U4EB 4PRNA 5IROC 1V3LA 4UB0L 4UQ2B 2HLAB 2CO6B 8FABB 1L0YA 1FNFA 1Z3GL 4XRCB 1Q9KB 5ESVB 4MNGA 4N5UA 4JFFD 4JGMA 4UDTA 4XP9L 2Z91A 1XF4B 1ZHBA 2OI9B 1R3KA 4LF3A 3PWNB 1YY8B 1I75A 3GSNL 3P11H 1H8NA 5IEKA 1W0YT 1QO3B 4OCYL 3EFDH 1EFQA 1JGUH 2J4WL 2VQ1A 3MJ9A 5H2BA 1QFUL 3QJHA 1BWWA 1N3NB 1FO0H 3FT3B 3B9EA 3PNWB 2C1PB 1DQJB 3P9LB 2IQ9H 3O0RL 4UILH 3D3VE 4NSKB 1OQOA 4GKSB 2RFXA 3MRJA 2LTQB 4XPTL 1KN4L 4GSDH 3KPLB 1UZ6F 4XCFL 1YEGH 2IH3A 5GGQH 4LASH 3V4PL 1FCCA 1KOAA 4PJ9D 2CLVB 1YMMB 4GXUN 1G6RB 3AS1A 4MJ4A 2DN7A 3ARGC 5INCB 1WBZA 2ZCLL 4IHOA 3ROLB 5C0BB 3F6IA 2P45B 1UM6H 3LKRA 3BD5A 5IFAL 4HIIA 4OZFB 3RZCD 3MJ7B 1KPVA 3FO2A 4NOFA 3MZGB 3FAXA 3IFNL 3O6FD 1KXVC 4HIJB 3VXSB 3NFNB 3P4LA 3HZVB 5CP3A 3UBXG 3CU1A 2KUTA 2W65A 3B2VH 5J9PB 4LIQH 5F8QC 2F5BL 2MQCA 3TIDB 5FGRA 3R1GH 5I8EB 1G9MC 1AQDA 3DROB 1I8KB 2YR3A 4KJQC 1N64H 3RNKA 3RIAK 3WDIA 1WZMA 5EOTA 1B9ZA 4NUJA 3IJHA 3LSOA 3FRPG 2ARJB 1R5WA 4HUVA 3M8OH 5EUOF 4O9HH 1VEPA 1SJHA 3QG7H 1NBYB 1AR1C 1E6OL 1SEQL 3NCBB 1XGPA 1IC4H 3HI6L 1ZK9A 2Z4QA 5IB4A 2PYFA 2ITDB 4FQQA 5I8KL 5DRNB 4CMMB 2CKBL 3HMXL 5E6IA 5KSBA 5IB3B 1E4XI 3X14B 2FB4L 5FA4A 2KQMA 3DRQA 3NA9H 2EC9T 5SWZD 3RVXC 4HLJA 4NQDA 1AO7D 3UAJC 4XBEL 4D0DA 2GK0B 2NY5H 4YUEL 1E4JA 5DTFB 2C5DC 3C5ZA 2WSKA 2I24N 3S35X 2GCYA 1GCFA 2BMKA 2JLLA 5CEZE 5SWSB 2A6DA 3MJ6A 5E08H 5ERWB 4HJ0C 1HCFX 2R69H 1JJUA 5MENE 4DWHA 3INUH 1I7RB 3K4ZA 4XMKH 4JM4H 2CGRL 3MRHA 1HSBA 3OG6B 4FQ1L 1VFBA 2VSCA 4S0SD 5IVXF 3MR9A 4Z7NE 4K07A 3WV0A 2G60L 3IU3A 4HDIB 1KJ2L 4BFBD 1LD9A