3C5ZD

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
202
Chain Sequence
FEAQKAKANKAVDGERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR B3K506 Alpha Chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
total genus 45
structure length 202
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c5zD01
4WV1A 5LGHL 3UO1H 2Q7YA 4AEIH 5CD3B 3ZKXC 3SDXF 1BOYA 3F7YB 3MV8E 3ARGD 4P5TD 1BVKB 5DJYA 4XNXH 3PE9A 1J8KA 3EJJX 1R24B 4M9OA 5CEZH 2EE9A 5JPNA 1CD1B 4Q9RH 1HZHH 1PZ5A 4X6CA 4IRJA 3PNWA 4M1CC 1SYSA 1KPRA 3HG1A 4M6MH 3VFOB 5I1GH 1BX2B 1J86A 3O3EA 1RFDL 4D9QE 4ZFGL 1KIRB 3QP3A 3N85L 4D0BA 1WJ3A 4LVNC 1CICC 1BVLB 3RL1A 1BQLH 1MI5D 5ACLA 1CE6A 5D7SL 3SQBA 4WV1B 1I1AC 1F3RB 1IBGH 4FFVC 2Q7YB 3C60A 4HEME 1DJSA 3M1BA 1CIDA 2Y07H 4D3CL 5FKPA 5DJYB 5KVFL 1PLGH 5BZDA 1KB9K 1MCNA 4ERSH 1Q0XL 3OKYA 5JPNB 1PZ5B 4X6CB 3I50L 4IRJB 1J5OL 3PNWB 1SYSB 1J8HA 1KPRB 1UENA 3HG1B 5F7YC 3EYUH 5I17A 2IPUG 4XMKH 1QSEE 2X4PA 1FNSH 4HK3N 3O3EB 5GGVY 2OL3H 4I5BA 3WDHA 2GEEA 1F4WH 5A2JH 4D0BB 1Z9OA 5JW4N 4U7KA 3RL1B 1CFVH 3WUZA 1MCPL 5EZOL 1CE6B 4HJ0D 3P9LA 4NOFA 4CW1A 1Q1JH 2D2OA 3O2DA 4FQIL 1J1PL 3C60B 5HHMB 1SBSH 2QTEA 1LE9A 3M1BB 3OXRA 4W70A 5FKPB 2R4SH 5BZDB 2H8PA 3QWRD 2VRAA 1AFVH 4FQXD 1G9NL 1OP3H 5ITFA 3C87A 1J8HB 3PHSA 5IQ7L 5I17B 3G5XA 2X4PB 1MRCL 3AB0B 1KCKA 4WGVB 5D1XA 4OI7A 1NBZA 4KAQL 1CQKA 1W72H 2ESVD 2IG2L 4WRLA 4I5BB 4XVJL 4N5UA 3MTRA 3E0GA 4P59H 1FDLH 3OJVC 5D1QD 2NPLX 4FABH 1CGTA 5EU7C 5FUZL 2GY5A 1U6AL 5FGCB 3S4SG 3P9LB 4CW1B 4KMQA 1K8IA 3GI8L 1EPFA 4M00A 4XPGL 4NZJA 1LE9B 1JGLL 1U92A 1JRHI 3PWNA 3NCYS 4R6UA 3OXRB 5GQBA 5SWSE 4X8XA 2H8PB 3STBA 3WO3B 1PG7L 1J87A 2G5RA 5DVKA 3ZKMD 5F9OL 5TDOA 5ITFB 4C56E 4WFFD 2BOCA 1ZT1A 3G5XB 5D1XB 1JHKL 1NBZB 3OG6B 1ACZA 4OD2A 5EU3A 3WFBH 4F57H 3RJDA 3UZQA 4R90L 1W0WA 3ARBD 3LDBB 2ID5A 3EFDH 5IFHL 4WNQA 2EECA 4KKCC 3UTQA 2J6EL 1K8IB 2DBLH 4ESKA 1U92B 3PWNB 5K9JL 3O6FD 3KJ6L 2FL5A 4QHUA 4TSBH 5F44A 4GRLA 4OB5L 4V1DA 4AEHH 2CRMA 4OM1L 3U30B 4HQQL 2FX8L 1CFTA 2OTPA 1NUDA 5TDOB 4P46D 2XXCB 4OLZH 5E4EC 2DL2A 2CLVA 2BOCB 1ZT1B 5KSBF 2D03H 2Y9RT 3BPNB 3T0AA 4X6DF 4OD2B 5EU3B 3ZE2F 2X44D 4TNWK 1RZ8A 3P40A 1N2RA 5FHBL 3QUKA 2APFA 2EIDA 5L2JA 1W0WB 3QDJD 3UBXA 3MLPA 5BS0E 4WNQB 3UXFA 3UTQB 1I75A 3H3PH 4X9HA 4X80H 2B2XL 5EUOE 4OGXL 3QXTA 3HI6H 1D6VL 2FL5B 2NY1D 4QHUB 5E7BA 4GRLB 4V1DB 2D7PA 2VLRA 1GIGL 4UQ3A 2EEDA 1A22B 4MJ2A 4NBZB 3VD4A 2Z9TA 1CFTB 4O02L 5GGVL 5ICZA 3ULUL 2A9NH 4MA8H 3CFEA 2F58L 3RL2A 4XBEH 2CLVB 5FYKH 2AERT 5J11C 2R29L 1ZGLA 2K7PA 4KZDL 3H2WA 2FX7L 2YOCA 4NRYA 5ABDE 1JNLH 4TSCH 1LO4H 5ANMA 2IEPA 4AY0A 1RZ8B 4E42A 1N2RB 2V5SA 3QUKB 2ZJSH 4PJFE 4RIRA 1DQQA 4PBVC 5L2JB 3W5MA 3KAAA 3UBXB 4KJQC 3TGXA 4Z7VF 1A0QH 3VGAC 5AAMA 2YEZA 2YD2A 3IAGC 2R4RL 4RGNC 3VI3F 1IEHA 4Y1AE 1A02N 3V4VL 2D7TH 4MHHI 3GSNA 2VLRB 4UQ3B 4U1LA 4K7PH 4NZUH 5ICZB 3CFEB 3RL2B 3BDBA 4G8GA 4ODSL 4PD4J 2P1YA 1NC2A 1ZK9A 2WMPA 2HMID 4UAOC 3GMQA 4U3CA 1ZGLB 1YECL 3VD3A 1TQBC 4NRYB 5TGBA 2Y25A 1NUFA 5ANMB 4B0MM 2PXYA 4QXGL 5I8KH 1OB1A 4E42B 4BZ1H 4RIRB 1DQQB 1CLOL 2JIXD 4ZS7H 5C0BE 2VLLA 3BQUC 4CNIA 3SE4C 4HIXL 5DVLA 5DF0A 2YEZB 2PN5A 2CKBL 4YC2C 2IMMA 4KTDL 3C8DA 1KOAA 5J8OA 43CAA 1XGRA 2IANA 4RX4D 4NN6C 5FUOH 2J8OA 3GSNB 4UDUA 3EJZD 4U1LB 1KV3A 4J3OC 4MAYD 5JA8B 4G8GB 2EDRA 4HKBA 4XP6H 1NC2B 3GMQB 5E94A 5BVPL 1OTTD 5TGBB 4TNVF 2F5BL 4DN3H 2PXYB 1IGTA 1OB1B 4NC1C 1B4JL 1M71A 2I9TA 4YHZL 3OQ3B 1BIHA 4RDQF 5DD1L 12E8L 3SDAA 1U41A 2QQKL 3PHQA 4ZOEA 2VLLB 4K3EL 3RDTA 4CNIB 1LO0H 4L4TD 1MCFA 4GKSA 4JZNA 3QXWA 3TV3L 3F7VA 4OBRA 3KR3H 4LLMA 43CAB 3RI5F 1XGRB 2AXFA 1WV7T 2IANB 5IMOA 3VXUE 1YMMD 3E8UH 5EO0A 1AKJD 4UDUB 5I0DA 4QNPF 3V6OA 4F80A 1F45A 4HKBB 5E94B 1HH6A 4Z7QF 1MAMH 2VZSA 2ADJA 1A7RH 1IGTB 1EAPA 3ZDYF 3IU4L 1ZV5A 4L4VD 1M71B 2I9TB 4PRIE 3SDAB 3PHQB 3UTTA 1NCCL 1TNNA 3RDTB 4NZRL 1Z9LA 3TPUA 1H3VA 4GKSB 4JZNB 3PDOA 3F7VB 1MNUL 1N0XL 3DYPA 2WIIA 3GBMH 1FNAA 4LLMB 3M8OL 3RU8L 2AXFB 5IMOB 1V7NH 2OJZH 4YE4H 3DX9A 2VWEE 5EO0B 3WXWH 3GKWL 1F8TH 3IF1B 3QIWD 3KGRA 5F9JA 3O3AA 4AL8H 2DQJL 3AUVA 2E5EA 3C8HA 4KUZL 3H7BA 4YXLH 3UTSE 4DK3A 5I8EA 3TYGL 1HH6B 3QUMH 1PBYA 1I1FA 3H42H 3TC9A 2ADJB 2BJML 1ZOXA 2DWDA 1EAPB 3AXLA 2ZUTA 3PV6A 4L8DA 4RWHA 3OKLA 3WFZA 4HMEA 5I1EL 1CI5A 2IH3A 1CLZH 3UTTB 1JK8A 3TPUB 4DJMA 3QUZA 3PDOB 4NOBA 3O3BA 1QFHA 2WIIB 4BFIA 3DXAD 3HZKA 4DKFL 5L9DL 4U2YA 2EKSA 4ZO9A 3DX9B 4M02A 1A7NL 1X5KA 5BOPA 1I3GH 1T66C 2UZIL 2XRAL 1NCDL 5F9JB 3O3AB 3NVQA 3H7BB 3LKRA 3U7WH 4FQPA 2Q3ZA 5I8EB 4I77L 4GBXD 1I1FB 2XT1B 2HAZA 1ZEAH 3ZKNC 5ESQA 1I4FA 3AXLB 2DWDB 2I5YH 3PV6B 4L8DB 3SDYL 1OP9A 5F1OB 3OKLB 3RVTC 1JF1A 3NABL 5DFVD 2IH3B 2MCG1 3SQOL 3BN3B 1JK8B 2NTSP 3SDCC 2GK2A 1A21A 4RGMC 3T0WA 3QUZB 2VO5A 1FZKA 4BFIB 4R26L 1X4YA 4LVHC 3HZKB 2VLME 3PJSA 2EKSB 3MCG1 5HD8C 2C3HA 2C4FU 2DS4A 2VXTL 5CP3A 4HGKC 4L9LC 4N1EA 4NCC1 3OG4B 5JW4M 3LN5A 3LKRB 3OHXA 1LNUA 5HHVL 2BRQA 3MV9D 4K9EL 2OK0L 4IOSD 3VXNA 3QUYD 4GLRH 5TE7L 5F9WB 5ESQB 4OCSH 1I4FB 4OFYA 4P2RE 1TPXC 1T21A 3Q1SL 1AR1D 1VFUA 1MJ7H 5LWYH 1JF1B 4QHMA 3N1PC 1DCLA 3L9RA 4APQD 4TNWF 4GRWH 4UV4H 4LFHD 1OD9A 3MQIA 1FZKB 3MBEC 1LDPH 3PJSB 5DMGD 4JDTL 3UDWC 1QACA 5CJOH 4F9LA 1X5HA 1N7MH 5D8JL 35C8L 2GJ6E 2ICWI 2YD8A 4JN1L 5LXGH 1OW0A 3JWOC 4E5XA 3LN5B 3SDDD 3HB3D 2F54D 3DV6A 3EIFA 1CICA 3D39A 3D9AL 3OHXB 4MQXC 4TRPH 1LNUB 2MFNA 3VXNB 4Q6IC 1LO3H 1P2CA 3ET9F 2O5ZL 1KCSL 1T21B 3ZKXB 1MH5A 1KFAL 1BD2D 4QHMB 4DGYL 4DN4H 4NBYB 4OCYL 3QCTH 3L9RB 1YEKL 1S5IL 1KJ2A 1RZKH 2NY0D 5HYSG 2CPCA 4PGBA 1QFOA 1EVTC 1FORH 2G2RA 4KJPC 3RWDA 4U0QB 5GRUL 4NFDA 1U8OA 5GHWL 4V2CB 1WC7A 3WKMH 2VLKE 1BPVA 1Z3GL 2APWA 3DMMC 4NM8L 1F58H 4I0KA 1ND0A 4E5XB 3NGBB 4GXUM 5IESL 3DV6B 4LVNB 1CICB 3D39B 3VDBA 1OLZA 4Z5RA 1CVSC 4LLUA 2R69H 3PWPE 1KELL 3EO0A 4GMSH 4MMXC 1IC5H 5BRZA 1P2CB 4DGVL 3G5VA 5DFWH 4DEPB 4J3TA 1MH5B 3T04D 2X4TA 4XCCH 1HK6A 2HT4C 1DBML 2YPKB 2YA0A 4HFWA 3NACH 1AGFA 1KJ2B 1KEMH 1CBVH 1NCAH 5F1IA 2QEJA 4PGBB 3RWDB 2G2RB 3P0YL 4O58L 4ODHL 1GOGA 3P0GB 1U8OB 3P0VH 4CJ0A 5KZCB 3LPGA 1FHGA 1WC7B 2E6PA 3I85A 2IQ9L 4ZXBC 4LEOA 4WWKC 1ND0B 5BW7C 4MA3A 2NXZD 4PP1D 4PJ7F 2HG5A 3L5JA 5HYJE 4IHOA 4PY8I 4Z5RB 5F21B 4LLUB 1G7QA 3EO0B 2VDPH 5BRZB 1UWXK 1DSFH 2ICES 4S1DD 3MODL 2EXWC 3G5VB 4DVBA 3RBSA 3JXAA 5L7XH 2AJXH 2X4TB 5CP7A 3VXMD 2BP3A 3W11C 4X9BA 4HFWB 4YHML 1AGFB 4M8VA 5F1IB 2MOVA 2CRZA 1QBML 4B41A 3U7YH 2DQHL 1IJ9A 4LDEB 4NO3A 4QXUH 4XXDA 4I0PC 5BQ7A 4Y4KC 4OCMC 4YHNA 1YEDA 1MJUH 5DJ0A 2ZNXA 3HN3A 4Q9BA 4NQVA 4OT1H 5T5FH 1NGPH 1F4YH 1X5LA 1U3JA 4LEOB 4YO0A 2YUVA 4XAKD 4MA3B 5L6YL 2R9HD 5C08D 2VAAA 2HG5B 4PB0L 4IHOB 4OTXL 1Z9MA 1G7QB 1RPQA 4GW5A 4ZNCD 1EGJH 3MBXL 5E9DD 4DVBB 2AJSH 1XR8A 5KS9E 4YJZL 5GXBB 2G75A 5CP7B 2DIBA 3TBYA 3AS0A 3W0WA 5GZND 1KNOA 4OCRH 1XIWD 4OCXL 4V2BA 2DMKA 1RZJL 4KI1A 3EOTL 4S1SH 4QRRD 4NO3B 2YN3A 4XXDB 1M1SA 3KHOA 1L6ZA 5DUBA 2BCKA 4YHNB 4JN2A 1F4XH 1YEDB 4M3KB 4MA7L 5JOPE 5GJSH 3STLA 1MWAH 1U8NA 5DJ0B 1AD0A 1XF5A 4NQVB 2YD3A 1IC4H 4M03A 3UTZA 1N6QH 3RWIA 1KN2L 1JMXA 4YO0B 4MD4A 4AJ0A 4HWNA 2PF6A 2EIEA 3WIHL 4OLUL 2VAAB 4IRZL 5C6PB 2XTJC 5SWZE 5MHSD 2F5AL 1T6VN 1F4AA 3ARFC 2CMRH 4GW5B 4Z0BH 4P3WA 1XR8B 3G6DH 4M7LL 1T2QH 1RK1A 4AMKH 4ZQKA 2G75B 4ONGH 3TBYB 1RUPH 1L0YA 3W0WB 1KNOB 1HSAA 5E03A 4PJCE 3O4LA 4LHUA 5E4EB 1BLNA 5DUBB 4LP5A 2BCKB 2V5YA 4JN2B 3U82B 4F58H 5D93B 3TH2T 1QR1A 4RISL 3STLB 1CDIA 5E6ID 1OHQA 1AD0B 1XF5B 1X5YA 3UTZB 3HKFA 3RWIB 2AV7A 4MD4B 3ULVL 3D25A 2NY2D 4YDJA 3W9EA 4JZOA 2DQUH 3LZFL 5I66A 4CVUA 4PJDA 4Z18A 3ZHLA 4G6JL 1EV2E 1XF1A 1QRNE 4WTZG 4AEFA 4PJGE 3OKKA 4JEGB 4XP5H 3JTTA 1Q0YL 2VXSL 5IB4A 1RK1B 4ZQKB 2I60L 3AS3A 3C08H 4DOHB 4IJ3C 1S7TA 1HSAB 3O4LB 1JJUA 1W2KT 1OCWL 2EC8A 2B5IB 4LHUB 5AG9A 5J11B 4NQXA 2YPVL 1BLNB 4M8QA 5C92A 5CBAA 4X6CF 5I1KL 2WWMC 4N0CC 4ETQA 1QR1B 5K33A 2VSCA 1WAAE 4MDIA 1T5WA 3IFLH 4UT7L 1LHZA 3MZTA 4X6DE 1DBBL 1H3PL 3ZE2E 2BNQD 2AV7B 3VWKC 3GRWA 4FQ2L 3D25B 4L5FL 4YDJB 3W9EB 4JZOB 3QSKB 4H8WC 3BQUA 1Z0NA 2XN9D 1KCVL 4PJDB 3SE4A 1P6AB 3RKDD 3DBXA 3MRRA 3SGKC 4YX2L 4RGNB 3OKKB 3JTTB 1EFXD 3IDXL 2E27H 5IB4B 4MD5A 1CFBA 4R4NC 1MHEA 1HHJA 4JFHE 1KJVA 1GHFL 2E7LC 1KBGH 4U6TA 1S7TB 5JHLH 3BMVA 3QDGD 5GS0L 4WFGE 5B4MD 1NEUA 3QI9A 4NQXB 5DLMH 4P3CL 4P4KC 4M8QB 4QTIL 1PQZA 5CBAB 1E6OL 1TQBB 4ETQB 1NEZA 4MDIB 1T5WB 4EUPA 1IKFH 5F3HA 4N0UA 3GDBA 2BRRL 3NH7L 2VYRE 5KSUA 2A2QT 4XWOC 3GK8L 4WU5A 5FYLE 4OCNC 3BQUB 2YRPA 1T0NA 4Z7VE 2AJVL 4HUWA 3DBXB 3MRRB 5EG6C 3ARED 3CK0H 3KVQA 4MD5B 1MHEB 1HHJB 1KJVB 4NN6B 4YUEL 3C8KA 1RUAH 2RCSL 3Q5TA 3T8XA 5K9QG 2VMFA 2XQYG 5I6XC 2B4CH 4JVWA 1MHPL 3WNLA 3QI9B 4P4RA 4HXAL 3K7UA 4N5EC 1PQZB 8FABA 1KIUA 1T89C 2UY6A 1NEZB 4D9LH 5LAXA 2VAJA 4EUPB 5SV4A 2H32A 5F3HB 4N0UB 3VGHA 4BQ8A 4LEXH 5I8CA 5KSUB 2FD6H 2J8UA 4WU5B 2QHRL 4KQ4L 4U1KA 1T0NB 4P2QD 2AQ2A 3MXWH 4HUWB 4YFLF 2ERJC 2Q87A 3C8KB 1H8NA 3T8XB 1ULVA 4FFWD 4ODTL 4XTRD 4MVBD 4J3UA 4XPHL 2YR3A 3HAEG 4P4RB 2EDDA 4ONFH 8FABB 2Q7NA 3J7HA 4JB9L 3RNKA 4D0DA 4N90E 2O61A 1LO2H 3OAYK 5LAXB 3FRPA 3MRGA 1QSFE 2H32B 3DGCR 4U3HA 5I8CB 1BFTA 3MRNA 2J8UB 1ZHLA 2WUBH 1PG7X 4U1KB 3L3OA 3X13A 4YWGL 4I3RL 1YYMH 4PS4H 2QQLH 3UAJD 2Q76A 4JRXE 2APVA 2VQUA 4RWYH 1U8JB 3KYNA 5JR1H 3TJEH 4F8QA 4M93C 5H8DA 3MUGA 2ENYA 3IGAA 1A6PA 5E2UH 4F2MA 4FOMA 4OLYH 4HK0A 1RIVH 4QNPE 5IHBA 3MXVH 1MF2H 4XC3H 3MC0A 3RFZC 4LSRH 4JY4A 4MJ5A 2EDXA 5C0GA 3RNKB 4D0DB 2ZOKA 2O61B 3UC0H 3GNMH 4M5YL 5IBLD 4DUWA 3MRGB 3BGFC 1NSNL 4ZAKD 3MRNB 2EDQA 5EORH 2A1WL 4ELME 4NQDA 1ZHLB 1X4XA 1D5BA 2QV2A 4EVNA 4ZYKA 4U1JA 4M1GL 3L3OB 3H9HA 3SDCA 2ENSA 3X13B 4LLAA 1NBVL 4P2OD 3ALWA 2Q76B 1L7IL 3FT3A 1MFDH 4UV7L 3KYNB 2HFEA 3S34L 3MUGB 3IGAB 4L9LA 4OM0L 5IWLC 4F2MB 2IGFL 4HK0B 2BNRA 4I18A 3DVGA 4JY4B 2O5YH 2BHZA 4MJ5B 4DQOL 4LSSL 5DZLA 9CGTA 2YMXL 1A1NA 5C0GB 2ZOKB 3VFRA 4HCRL 1MJ8L 1HNGA 3ZDZF 1SMOA 1I8KA 1HHIA 5BO1H 2JTDA 4U1HA 4NQDB 1D5BB 4YLQT 2KH2B 3EO9L 4ZYKB 4EVNB 4U1JB 1IGFH 1KLGA 1JNNL 1OAYL 3H9HB 4GQ9H 3SDCB 3LKOA 4HWBH 1N8ZA 1LDSA 2DJ4A 1S9KC 1T2XA 4IOIA 1BEYL 3MBEA 5F89A 1R6VA 3B9KC 4LVHB 1YN7A 3FT3B 4JJHA 4NQEA 1BQUA 1H5BC 3RGHA 2HFEB 3K46A 3UDWA 4MQSB 2VZOA 4XVTL 5DD3L 4L9LB 1X5XA 2P45B 3MLYH 3GI9L 1AO7D 2G5BA 4RBPK 2BNRB 1OAKH 4I18B 2VL4A 3DVGB 5ILTH 4KV5E 2EZ0C 2DM3A 3O81A 5EOCJ 1A1NB 3VFRB 3B4NA 4MXQC 4Q6IA 5LBSL 1K6QH 1JFQL 1I1AD 2FGWH 2B7DT 1I8KB 1TPXB 2Z8VC 3S4SA 1HHIB 3V79C 4U1HB 4X9IA 4JFFD 1DR9A 4P48A 1RZ7H 2VN4A 1O7VA 4U0RC 4FFYL 1KLGB 3V0WH 2XFXA 3U0TA 2R0WL 2XPGA 3QFDA 3LKOB 4Z7WA 1UM5L 1N8ZB 2FB4H 4NJ9H 3DX6A 1NFDA 1T6WA 4EKXA 4OIIH 4IOIB 1BFSA 3MBEB 5F89B 1F90L 3IDUA 1YN7B 1IGIL 2BSSA 2X7LA 3HMWH 1PG7W 4NQEB 1JYNA 3SGDH 4MNGE 2AEPH 3JWDC 3DMMA 3T77A 1V8HA 3GHBH 1CE1L 1MUJA 4LNRA 3O3DA 2G5BB 4ENED 2YWYA 1YPZA 2O26U 4HC1L 4KXZH 1X3DA 4Q6IB 3K1DA 5JQ6L 2QADD 4U1GC 3S4SB 1C08A 3WE6A 4DUXA 1NC4D 4S10A 2M1KA 1GGIL 4ZTPH 4U1MA 2P5WE 2XFXB 4RAVA 2XPGB 3U0TB 3PP4L 3QFDB 4Z7WB 5D7KE 5MEPA 3DX6B 3QRFM 1NFDB 3JV4A 4NNPH 4P9HC 3ELAT 3RHWK 2BSSB 4FTVA 1C5CL 2X7LB 3LH2L 1AHWC 3RWCA 1UEYA 3KPRA 3DMMB 3T77B 2OXGA 4Y2DD 1JYWA 5I1LA 4WWKA 3KXFD 2BNUA 1BAFL 3WFHA 4I1NB 5BW7A 1MUJB 4LNRB 3O3DB 3QRGL 1ODAA 3D0LA 3SJVD 1YPZB 1S3KH 2HP4A 3PDDA 3RNQA 1EO7A 1A3LL 4HFUL 4KUCF 2AK4D 1AE6L 2VWEC 1UKSA 1GAFH 1UWEH 2VLJE 3AROA 3ZKQD 5MEOA 1IAIL 5KTEL 1C08B 3HZMA 2BMKA 4PFEA 3WE6B 3BE1L 1RZFL 3UTPD 4K55A 3IFNH 4U1MB 1FFQA 4RAVB 2IFFH 4R3SA 5JHDD 5MEPB 3O0RL 2PKDA 3JV4B 1JGEA 2DICA 4LBEA 1EHLH 4I0PA 4Y4KA 1I7RA 4NQTA 4FTVB 2GHWB 4PRHE 1BZ9A 2JJTC 2W9LA 3RWCB 5FM5M 4Y8AA 3MRJA 5I1LB 1C16A 2UV3A 4WWKB 1NDGA 2BNUB 5CKGA 4PJXE 1DUYA 3WFHB 1DLFL 3DO7A 1FBIL 1A5FL 2EYSA 4XCNA 2NQCA 2FHBA 2C3XA 2BDNL 3D0LB 5J12C 5AYUL 2VDNL 4KKCD 1CFSA 3OSKA 3WLWC 3RNQB 4KK6C 5DWUL 4GAJH 5MEOB 4X4ZA 1JYVA 4LDLB 3HZMB 3QDME 2BMKB 3L7FA 3RY4A 3EOBA 3RUGE 3C6LC 2BY0A 1WTLA 1RU9L 4R3SB 5EH1A 5FUCE 1MCBA 1XF4A 5IB2A 1JGEB 4HUUA 4LBEB 3UPCA 4I0PB 4Y4KB 1JPTL 1I7RB 1DLHA 1BZ9B 1UH3A 3TWCL 1PDKA 2DLHA 3F7PC 5FK9A 3MRJB 1QYGH 1C16B 1NDGB 2AJUH 1UWGH 1GGBL 2EO1A 1DUYB 3DO7B 2EYSB 4XCNB 4LCWD 4YBQD 2ZUXA 3BD3A 4QYOA 1H8OA 1ADQL 4HS8L 4Y4HC 1EBPA 1EHNA 1CFSB 1E4XH 5EULV 3ARFA 4KRMB 2FZ3A 3WIIL 1CZ8L 4YHYC 5A2IH 5I16A 1G9ML 5E0QA 1S9VA 3L7FB 4GFTB 1I3VA 15C8H 4Y5VC 1VSCA 3FFCE 3EOBB 3T0EE 4GG6A 4RAUA 1OSPH 4NGHH 2CLZA 5C07E 3BKJH 4HF5L 1REIA 4BQBA 5C09E 1VFBA 1XF4B 3CFCH 5IB2B 4HUUB 2Z35A 4PRAA 3UO1L 1DLHB 1N3NA 3JVGC 3MV8A 4AEIL 1FZMA 2EH7L 3UPRA 2VKWA 2EE3A 3LV3A 4XNXL 5FK9B 4GSDH 4XWGH 3S3PA 2WSKA 1OAXL 3K0WA 1AQDA 2CK0H 3LOWA 4DTGL 4Q9RL 5BOZG 1S7WA 4QYOB 2NZIA 2NY5C 2XTJB 4KJQD 3B6SA 4M6ML 4ALAH 1XGTA 3ARFB 5I1GL 4C54A 2FZ3B 5MEQA 2MCPH 1ZTXH 5C71A 5I16B 1S9VB 4IM8A 4OZHE 4Y19D 1TFHA 3IT8D 4GG6B 4RAUB 2CLZB 3EHBC 2HRPH 2CO6B 1BQLL 2FECI 1F02I 1VFBB 4G6KL 2Z35B 1DANT 1KF9B 4PRAB 4NUJA 3T4AA 2YD4A 1S9XA 5F1SA 1N3NB 3UPRB 3MV8B 1CD8A 1FZMB 1KJMA 2VZUA 5HHXH 3PXJA 3IVKA 3MLRH 3B9VA 2XZAH 2F74A 4ZDHA 5E2VH 3LV3B 3EJYD 4OAWA 4PPTA 3VWKA 5MERA 5FHAH 1CL7H 5LGJA 1S7WB 1UXSA 1QSEA 5GRVL 3B6SB 3OPZL 1ZANH 4XP1H 5LG1A 1XGTB 4ZUSA 4XMKL 3SGKA 3BIBX 2R39A 3H9SE 4XPBL 5MEQB 1FNSL 5CZVH 5C6WH 5EU6E 3SKJH 2OL3L 3V5HA 1SY6L 4E41D 2AAVA 2XYCA 1WZLA 1LP9E 1ZVYA 1F4WL 2E7LA 4IJ3B 5GGTH 5I9QC 1CFVL 1KJ3H 3BKML 4KKBC 4XAWH 3RTQA 2DTMH 1RZIA 4P4KA 4TSAL 1Q1JL 4NUJB 4JRYE 3T4AB 1S9XB 2DKSA 3IVKB 1KJMB 1SBSL 4YK4C 2F74B 4ZDHB 1GXEA 4OAWB 1MCCA 1F00I 3VWKB 1WFTA 1YUHA 5MERB 4DKAA 4GRWF 3BIKB 3HCVA 1AFVL 5LGJB 5F7WC 1UXSB 2NY4D 2C1PA 1QSEB 4KRPC 4X5WA 4ZUSB 2O93L 7FABH 3A0OA 4OZFH 4M7ZC 1YJDH 2I9LA 4BKLA 3LRHA 1W72L 3V5HB 4K7PY 4P59L 1FDLL 2DQGH 5AAWA 5SX4I 1XGQA 1AH1A 5HDBF 1HSBA 4FABL 5INCA 4Q9QH 2CUMA 4J3VA 4P9MH 5CS7A 5SWQA 3DRTA 3CLEH 2NZ9C 3RTQB 1RZIB 1CD0A 4P4KB 5LKNA 2F9BT 2NNAA 1FG2A 2EE6A 1P7QA 3QEQE 1OTUC 1DN2A 4X6CE 3NCFB 5SWSA 3HG1E 5BV7L 4CU6A 5C1MB 1YUHB 3WXVH 3HCVB 4JGMA 4KTEL 4C56A 2C1PB 1R3JA 4X5WB 1L0QA 2CLRA 2J4WL 1T1WA 1G7IA 5E2JA 1E4KC 1KB9J 2I9LB 4BKLB 1V3MA 3PGCA 4CKVX 1XGQB 1HSBB 5I6XB 3EFDL 5INCB 5HHME 4D3CH 3HNVL 5KVFH 5SWQB 4O9HL 1RY7B 3DRTB 1WQVT 3FCTA 2WIMA 2NNAB 1FG2B 3ARTA 1P7QB 4KGJA 4P3DB 5HPOA 5SWSB 4JKMA 4KK5C 3M07A 3OAYH 3RHWF 1DN0A 3TZVC 3D3VA 1WZ1L 4C56B 4MJID 4JHZA 1R3JB 4OLZL 5CEZE 2CLRB 1QR4A 3TO4C 1T1WB 2D03L 1G7IB 4XVSH 1N0LA 3MRMA 2ERJB 2J1KA 3PGCB 1MCPH 4XI5C 3IDMA 3OKMA 3KPOA 1J1PH 5BS0A 5I19L 3NPSC 1T66D 3JWNC 5EUOA 3FCTB 1NCBH 2EDLA 3P30L 4X80L 1G9NH 3QFJD 3LS5H 5IQ7H 1FIGL 3GMOA 3HI6L 2E6JA 4Z76A 1MRCH 1QLFA 3KLDA 3DURA 4KAQH 4PRBA 5F7NC 1DN0B 3VXRE 1SEBA 1FL3A 3D3VB 4KJWC 5KBNC 4MA8L 4IIQA 3TP4A 1OPGL 2WLYA 4YGVA 3BMWA 5IVXA 3MRMB 4NO2A 1JNLL 5HYSA 1U6AH 4TSCL 1LO4L 3IDMB 3RIAF 4PJFA 4WGWB 4L1HA 3OKMB 5T1KD 2ZJSL 3KPOB 2JE8A 4M93B 4XPGH 4G6AC 2R0KH 4BJLA 5BS0B 1B0WA 4PJHA 3BPLB 3T4YA 2FH6A 3K80A 1B4RA 3LQZA 1PG7H 5EUOB 2UVFA 3I9GL 3BIAX 4CL7A 5DJ2A 4Y1AA 1MRFH 3VA2C 3GZKA 3GMOB 3FHAA 4Z76B 1QLFB 3DURB 3MA7A 4PRBB 3SKMA 4OFDA 1SEBB 3F6IA 2JCCF 1FL3B 5I18L 3QWQB 4K7PL 4WUKL 4IIQB 5D5ME 1DEEA 5E6YA 4YGVB 3LIZH 5IVXB 1ZLSH 4XXCC 4NO2B 5JDSA 2WWKO 5HYSB 3WIFA 5FA4A 4PJDF 4PJFB 2J6EH 3HC3H 3MJ6A 5I8KL 2VH5H 4BZ1L 1H5BA 4HMCA 1WIUA 5C0BA 4O2FA 4ZS7L 1F6AA 3UROR 5K9JH 3NIFF 4QWWC 4WI4A 3KJ6H 4PJHB 4PJIE 1NANI 3T4YB 4K3JL 4OM1H 3LQZB 5F70A 3ZYIA 4HQQH 2DMCA 4V1DE 5DJ2B 4Y1AB 5EBWA 3VWJC 2W38A 4RBPH 3FHQA 1EX0A 2MKWA 4PBXA 4PTTA 2OTUA 2NXYC 4K23L 4AK1A 2D31A 3N1QC 2X1OA 5HI4C 3MA7B 3SKMB 3VE0A 2EH8L 4HD9A 5ERWA 1YEGH 4WFHD 3U48A 1RQ5A 3HZYA 1DEEB 4XP6L 5GRXG 4XPAH 1J12A 5JDSB 2NX5E 3WIFB 4DN3L 5IW1A 5FA4B 3KPQA 4JFXA 3QEGH 4OGAC 2B2XH 1H5BB 5C0BB 1CN4A 3GMRA 4O2FB 2ED7A 4JR9L 4NQCD 1EHXA 1F6AB 4ODVL 4LLDA 4LSQH 2HTKC 5KG9A 2HYMA 2W60A 1GIGH 4RMVA 3WD5H 2YUZA 3BWUC 1L6XA 5IMKA 2MQ3A 5EBWB 2F58H 3ARDD 3QAZB 4PTTB 3VXUA 4AH2A 2OTUB 3ZDZE 4KZDH 5DYOA 1UZ6F 2B1HH 2D31B 2FX7H 5D71H 3TH3T 3VE0B 5T5NF 5IMLA 1N64H 1FVCA 4XCEA 5ERWB 4OLWL 5DGRA 1B6UA 3P9MA 4U0RB 3HZYB 5AD0A 1MREH 5HHQA 3VFNA 5IW1B 3KPQB 4JFXB 1GC1C 1FN4A 2N1KA 2BY1A 2R4RH 5CLTA 5E2TH 3GMRB 2FJFA 4B53A 5IF0A 4LLDB 4KJYA 4ZXBD 5KG9B 2LU3A 4ODWA 3V4VH 2W60B 2OMNA 3A6BL 3ULSA 1GGUA 4C4KT 2VQ1A 4I9WE 4H5SA 1WISA 4LL9A 3RIFK 5IMKB 2YUXA 1WWAX 3GBML 5H94A 4IMLA 1XAUA 4PYGA 3VXUB 4AH2B 1YECH 5DYOB 2OJZL 4U1GB 4YE4L 2GITA 4MDJA 1V7MH 3WHXA 3WXWL 5IMLB 1YMHA 1F8TL 4FNLL 4EBQH 1FVCB 3D2UA 4XCEB 1YEFH 3W11D 4GQPH 2V2TA 3P9MB 4AL8L 3ULVD 1YC8A 2R2BA 1CLOH 5GRYA 5AD0B 2J8UF 1V05A 1JZ4A 1CXFA 4W68A 5HHQB 3NCCB 5FYKE 3VFNB 3L3GA 2ICWA 3H42L 1FN4B 4U4BA 2DL9A 3BJLA 2JJTA 1MCWM 1L7TL 3T3ME 3OGOE 5F6HI 2FJFB 2ZP0T 5IF0B 4KJYB 4ZNEE 4ODWB 2IANE 3ULSB 2VQ1B 3RVWD 1J9CT 4H5SB 3RRQA 3MRCA 3T08A 5FYJL 5H94B 4IMLB 1T7XA 3T09A 5HDOA 1INQA 5BVPH 2GITB 4MDJB 3WHXB 2F5BH 1YMHB 4WTZA 3D2UB 1I3GL 1CXHA 2V2TB 4AIXA 2AQ1A 4FFZH 1B4JH 3C6LA 3LB6C 1FPTL 2R2BB 4YHZH 5DD1H 12E8H 3U7WL 2QQKH 4F7MA 3O6MH 4K3EH 1RAMA 2HRLA 3L3GB 4NJAH 4TUOA 3TA3D 3HC0A 2ICWB 1J10A 5K59F 2CQVA 1ZEAL 4JFYA 4LSUH 3RX7A 3TV3H 2I5YL 2KDGA 3QHFL 3PL6C 3MLVH 5FV1L 1T3FA 4N68A 3EZJB 3MLZH 2R2CA 3MV7D 3MCLL 2CKBA 5L2KD 2XTJD 3MRCB 5EIVA 4F37K 4DVRL 3QQ9C 4G42A 2GW5A 2X4UA 3V6OE 2OX5A 5I1AA 1INQB 4N1HB 4FQHA 4A6YH 3RVXC 1NLDH 2GJZA 1IARB 1J7VR 2EDBA 2EYRA 3C6LB 4FHBD 4LCUA 1NDMA 4JQVC 4OI8A 2XOTA 1VKXA 4F7MB 1HQ4A 3GGWA 4TUOB 3HC0B 4K94C 3VU2A 3UTTE 5FO7A 3FQTA 4JFYB 3JVGA 2R0LH 1MJJA 5C0ND 1ITBB 1MJ7L 5LWYL 1P69B 4LRNL 1T3FB 3M8OH 3RU8H 2VXVH 3FTGA 4C58B 4LPYA 4UV4L 3CLFL 5JTWA 2CKBB 1UCBH 2V5RA 2P42B 2XKNA 2IBZY 2VXQL 4G42B 3TN0D 2X4UB 4KUZH 3MLUL 3TO2A 3KPLA 5I1AB 5C0AE 4FQHB 4R0LC 4D9QD 2GJ6A 5CJOL 1N7ML 3GEWB 4TULH 2E8ZA 3ZSSA 1NCUA 2BJMH 2VDKH 1P4IH 1CF8H 2GJZB 2EYRB 4LCUB 1WSST 1NDMB 4JPVL 1VKXB 4TRPL 1HQ4B 3GGWB 3OF6A 4CMHC 4CN6A 1X7QA 5FO7B 3FQTB 1MJJB 3ARPA 2WWMD 1EFQA 4HAGA 4N0CD 1K8DA 5DURD 4DN4L 3VG9B 4Y5XC 4Z9KB 5L9DH 3FTGB 4FP8L 4UOJA 4KFZC 5DC4B 4LVEA 1FORL 4WFEE 1KACB 2XKNB 2VLKA 1BM3L 2EDOA 1J0JA 3TO2B 1NGQH 3KPLB 1JTOA 1DEDA 3QXUA 3VFGH 4OZIF 2HT2C 1PKOA 2GJ6B 4R4ND 4BSVA 3CDYA 3T2OA 2X70A 2QR0A 3SDYH 4MNQD 3NABH 3PWPA 2ITDA 3QNYA 4M1DL 1X7QB 2HLFD 3H9YA 4B7LA 1IC5L 2P8LA 4XMLL 2LU4A 3S97C 2FGZA 3L3JA 3KYKL 4Z7WF 1NFDF 3HAEA 5T1MA 5C0RL 4XCCL 1K8DB 4R26H 3VW3H 5KANI 2KKQA 1JPGA 4X7DC 3ZSTA 3NACL 1A6AA 5DHXB 1CBVL 3MUHL 2VXTH 2VR5A 1M7IA 3VXOA 3TFKC 3ZT6A 2P46B 4XVUC 4XNYH 2FRGP 4F9PC 4JO2H 3B2UC 2VLKB 4LLQA 3GSVA 4KY1H 5GISL 2BSRA 3I3DA 1DVFA 5HHVH 1YPZF 1QFPA 2YZ1A 1WVZA 4K9EH 2OK0H 5TE7H 5ENWA 4BSVB 4NBXB 2X70B 3IS1X 2QR0B 3Q1SH 1L9MA 5HYJA 5LVEA 2F53D 4HUVA 1ZLWK 4JM2A 1T22A 5I9QB 2L7JA 3PWPB 2ITDB 3QNYB 1KCRL 4HBCL 2P8LB 1DSFL 3VMPA 1IQWH 2DIAA 2CUIA 3L3JB 5D7JC 43C9A 5L7XL 3HAEB 5T1MB 2FHCA 1T80A 1JPGB 1ZXQA 3QEUA 1MCOH 2Y6SC 1DFBL 1CFQA 4JDTH 1A6AB 4M7JL 1JGVL 1RD6A 1JN6A 1M7IB 3VXOB 5E2WL 3NIDF 5F3BA 5CGYC 2VDOH 35C8H 2HVKA 4JN1H 1A4JA 4KRPB 4FQJL 4LLQB 3GSVB 1SJVA 1E4KA 2BSRB 4KKAD 5DQ9A 2I27N 5ICXA 1DVFB 3BVNA 3DYMA 1GH7A 4OT1L 1HDMA 2Z92A 4S1RH 5ENWB 5T5FL 4KDWA 3U6RA 2O5ZH 1KCSH 2BXZA 5HYJB 4HUVB 4JM2B 4X9FA 4DGYH 5FEBA 3IAPA 3RZCC 1BFOA 1YEKH 1S5IH 5KS9A 1EGJL 2L7UA 5CLWA 5I2IA 43C9B 1MI5E 1J1OH 3WO4C 1MIMH 5GHWH 5J4MA 3CFJA 3QEUB 4NZTL 3ZHKA 1CFQB 1KXTB 3ARQA 3TZVA 1Q9KA 3VH8G 5FUCC 4BUGA 1JN6B 4NM8H 5F3BB 4GRWE 2HVKB 1A4JB 4S1SL 3AS1A 2DF3A 3TO4A 5DQ9B 3RIFF 3VRIA 1T1ZA 5ICXB 3BVNB 1MWAL 1KELH 1OARL 4ZUWA 1HDMB 2Z92B 3A6CH 3O4OC 3U6RB 1S78C 2EEBA 1OLLA 5DEFA 3CVIH 5E8PA 5SWZA 1R5VA 4X9GA 5I76A 1DBMH 2RGSA 3CMGA 1BFOB 3GIVA 5CFHA 2CMRL 4RZCA 5KS9B 4Z0BL 3P0YH 5I2IB 4JFPA 1DBKH 1NKRA 4AMKL 3AFLA 5CEYA 4ONGL 5B8CC 3T0EC 3CFJB 1I9EA 1JPST 2DN7A 2F8VA 2PO6C 4PJCA 3TZVB 1Q9KB 3D85D 3ZTJH 2IQ9H 2NY7H 3MOBL 1IM9D 3D1MC 5FFLA 4WO4C 3TO4B 1FSKC 1OL0A 3AY4C 1N6UA 1AC0A 4H20L 3VRIB 3IDGA 1T1ZB 2P48B 5F6HJ 4ZUWB 3BPOB 3LHPH 2CGRH 3MV01 5DEFB 4LU5H 2ESVE 3U79A 5SWZB 2Q6WA 2F15A 1CS6A 1ACYL 2DQUL 3QEHA 5I76B 3WDJA 1QRNA 3GIVB 4OJFH 5AWNH 1PX3A 3I2CL 3I6GA 4PJGA 3ZT7A 3JWOH 4GG6F 4RZCB 3NFPA 2FJGA 1LEKA 4XP5L 4JFPB 1KENH 1F3JA 3HE7A 5CEYB 2DQDL 1U58A 1B0RA 1H15A 1FAIH 2BY3A 3C08L 2FR4A 4FXLA 4PJCB 1NKOA 2OI9C 1H3XA 3OZ9H 3MZGB 1ES0A 3MOAL 1Q9WA 3G6JA 4OQTL 3K81A 1EXUA 1H0DA 3TBVA 1BWMA 5L6YH 2XZQH 4NKMA 1WAAA 3IFPA 1F11B 2JJSC 3IDGB 4K8RD 1KPVA 4OTXH 4X6DA 3D48R 4WJ5A 1AP2A 2R2HA 3B9KD 3IFLL 4WFFE 5TPWH 1JCKA 1L4IA 3QPQD 2NY6C 2YXMA 2Q6WB 4J4PC 4LASL 3QEHB 4H1LH 4M6NH 1QRNB 4X7FC 3I6GB 4PJGB 2VZ3A 3W0WE 2AJYL 3NFPB 2FJGB 1LEKB 3B5GA 3VWJA 1RZJH 1F3JB 2FATL 3HE7B 1U58B 1B0RB 1H15B 1EEZA 3O8XD 1PKQE 2FR4B 1KBGL 4N8CH 5JHLL 4ODUA 1ES0B 1Q9WB 3LS4H 2EDKA 4UINH 1KN2H 3G6JB 1EXUB 1H0DB 2XQBH 3TBVB 3WIHH 4NKMB 4OLUH 3IFPB 6FABH 1T1XA 5IT2H 4X6DB 1U3YA 1KPVB 3KYAA 4IRSC 5F96H 4WJ5B 4JCLA 1AP2B 1JTPA 2F5AH 1EUUA 2R2HB 3B83A 3WJJC 3CH8A 2VKXA 5ITBL 4M7LH 1NGXA 2E9WA 1VFMA 3B3IA 3WUWG 1U8KA 4J12A 3QDJE 2DKMA 5DJ8A 2QL1A 4ORGA 1LILA 3CK0L 3CFBA 4DOHE 3VWJB 4ODXA 5E56A 1VA9A 2NXYB 4LPWA 1EEZB 1RUAL 4G8EA 5HHOD 4WHYH 2B4CL 4ODUB 1DUZA 2JCCE 3O6KH 3ULVH 2OSLA 1FFPA 2H1PL 4U2ZA 4CUCA 4B7IA 3ILPA 1T1XB 3ZDXE 1HYSC 2IF7A 3V52H 3F7RA 1JWUA 3WBDA 4G6JH 4HHAA 4PRID 4LEXL 6CGTA 2Q1EA 1Q0YH 4UBDC 4URTB 4XZUA 2D7OA 1NGXB 5IB3A 3MV11 3B3IB 3MREA 5DVMA 1VPOL 3S9DB 1U8KB 4OV6F 1JHLH 5DJ8B 1UQSA 1F6FB 3OJDA 3LY6A 4ORGB 1MHCA 4EN3D 3CFBB 4XX1E 4ODXB 5KW9H 5D96B 2YPVH 4XBPA 4LGRB 4Y16D 3K2UH 4G8EB 4AZ8A 4BUHA 4PLKC 4QTHA 3GSQA 1DUZB 3HR5A 1DBBH 5L8LB 3LQAC 3GJFA 1YEEL 4GS7C 3UTSD 3MLWH 5GRVK 2OSLB 1FFPB 4ONFL 3G9AB 3KYOA 3ILPB 1S8DA 1QQDA 1YY9C 1QSFA 1JWUB 5GS2D 3SKOA 4HHAB 4UTBH 4YX2H 1FNFA 4MQ7A 3WNMA 2Z8WC 2PTUA 5IB3B 3PIQA 2AABL 2WUBL 3BEWA 5JPMA 3MREB 1X5AA 5DSCA 1YYML 1UQSB 3RKPA 3OJDB 1D9KA 1MHCB 2R1YA 4JRXA 1P53A 3WLWD 3BP6A 4W6YB 3T1WA 4XBPB 4QTIH 3TJEL 4CVWA 1MEXL 1UZ6E 2LE9A 4XP4H 4OF0A 4QTHB 5E2UL 3GSQB 1I7ZA 3V6BR 1MAKA 3HR5B 4ONOA 2X09A 2BRRH 1RIVL 3GJFB 3MXVL 1MF2L 3GK8H 3INUH 1UKTA 3KYOB 2EIZA 2RB8A 1S8DB 1QQDB 1H9VA 1QSFB 3GNML 3VMNA 3MRBA 5I74C 1GZPA 2X89D 3SKOB 1ZLVK 2AJVH 2NY3C 4PJ5D 4PLJD 4KI5F 5D1XC 3Q6FA 4ELMA 3ZO0A 3PL6A 4MQ7B 5EORL 3PIQB 1EH9A 3VXSD 4LKXA 3BEWB 5JPMB 2EXYC 4YUEH 1VADA 4ETYA 5DSCB 1P5VA 3LDBC 1N5AA 1D9KB 5C86A 3X3GH 2R1YB 4JRXB 2N56A 4Y4HD 2ED9A 1JRHH 5C7XL 1MHPH 3BP6B 4HXAH 5EUOF 1AY1H 5I1CL 4K3DL 1UC6A 4NHCL 4BELD 3DETC 1OGAD 1I7ZB 4MB5A 4BZYA 4BZ2L 1JE6A 2ZUYA 5ECJE 4JQVA 2O5YL 2J8UE 2EIZB 3EOYG 1I1YA 2LU7A 3MRBB 4P2RD 3AS2A 1GZPB 4OLXH 5IVXF 3Q6FB 4ELMB 3EGSA 3PL6B 2GTWA 4LCIL 5BO1L 2BVQA 4D94A 4PJFF 1OAZL 1RUQH 4LKXB 4L4VE 1IGFL 1VADB 4GQ9L 4PJEA 4HIIA 5CINL 1BWWA 2H9GA 1N5AB 1ZSDA 5F88A 4YHKL 4PJHF 4ODTH 3PGDA 5IHUL 5KVMC 1MFBH 4R0LA 4JB9H 5IGXL 1A6ZA 5CEXA 3MLYL 4GRLC 3T1FA 3EHBD 3SHSA 3QQ4A 1FIEA 1HQRA 1ED3B 1I1YB 3BT2H 2R1WA 4YWGH 2HJKA 4DUVA 2FGWL 4EI5D 1OWRM 3EGSB 5CSGA 2GTWB 5F7KC 5IKCA 2BVQB 5DJAA 3TLRA 5EBLA 4G9FD 3V0WL 3QIBC 4PJEB 4QXWA 4HIIB 4K7PX 4XNUH 3IRPX 3MOQA 2A38A 4QHLA 2H9GB 2AXHA 1ZSDB 2FB4L 1JGUH 4NJ9L 5F88B 4HULB 5CIPA 1A6WH 5HI5C 3SKNA 4MNGA 3PGDB 1U8QA 3NCYP 1R3KA 4R0LB 4NRZA 1S9WA 1A6ZB 5CEXB 4OIBA 3NMEA 1FGVH 1FO0A 2YPLD 4W81A 3GHBL 3T1FB 3WNKA 2A1WH 3QQ4B 2FHFA 3KPSD 1HQRB 4CMHB 4NQDE 4Z6AT 2R1WB 3I3BA 2HJKB 2ZCKH 1NBVH 3CC5A 2C7UA 5IKCB 1FYTD 3DIFA 5DJAB 4DK6A 1T03H 5EBLB 1NGWA 2P5WA 4W6WB 4UV7H 1T7WA 4YEFA 3S34H 4Q0XH 4QHLB 2N7AA 5CIPB 1T2JA 4NNPL 3FL7A 1JZ6A 4MNGB 2WBJC 1M7XA 1U8QB 2FBOJ 1R3KB 3B2VL 2YMXH 1X4ZA 2GYSA 4NRZB 1S9WB 4CU7A 1XFPA 5JOFA 4HCRH 1MJ8H 3WNOA 1FO0B 1G1YA 3SN6N 4LQFH 5JLZA 1BJMA 5H37H 1WFUA 1BZQK 1ZLWH 1JNNH 2VLJA 3WFEH 2V6HA 1ZMYA 2XA8H 3DPBA 4YAQA 3U0WH 3CC5B 4PGDA 3QJHA 5D7JA 5IBUG 3VFSA 2ZNWA 3MV9E 5FA3A 2C7UB 1BEYH 3DIFB 3HMXH 2P5WB 3PWVA 1BFVH 4OCWH 3IFNL 2IFFL 4GG8A 4PRHA 1EHLL 1P4LA 5EN2A 3T2QA 4UUJA 2AGJL 5JOFB 1IILE 4I2XE 4PJXA 4OZIE 4F7TA 2PTTA 3IKCA 1QP1A 3OX8A 5JLZB 2OR7A 4G6FD 3RZCA 3MNWA 3DARA 4WHTA 3ULUF 1EEYA 2F54E 1W8NA 2VLJB 4AEEA 4ISVA 4GAJL 3NBNA 4LLYA 4YAQB 2OCFD 1UM5H 3QDMA 3QJHB 4PGDB 5D7JB 3VFSB 4EZMA 1BF8A 5FA3B 3HC4L 1F97A 1NFDE 3LSOA 1SJXA 3RUGA 3PWVB 4KHXL 3G08A 2AJ3A 1KPUA 2XWJA 1G6RA 3SDAC 5M95B 5J57B 4YIQA 2W92A 4GG8B 4PRHB 3QIUC 1P4LB 5EN2B 5CKAA 4UUJB 3EDEA 1KLFA 5DZNA 3U4EA 4PJXB 4F7TB 1QYGL 4XX1G 1RVFH 1AXSA 3TVMC 2AJUL 1UWGL 2PTTB 3IKCB 3OX8B 3I6KA 3N1MC 4Y4FC 5HXMA 1Q8MA 1HHKA 4AG4H 1C5DA 3SO3C 3RZCB 3MNWB 3V6OC 3VFVA 4WHTB 1EEYB 5T1LD 4XMPH 4ISVB 4G9DA 1S9YA 4LLYB 3QDMB 3WO4B 1QFWI 5ISZD 3FFCA 3LSOB 3T0EA 4POZC 3RUGB 3QXAA 1C5CH 2PO6A 2DTSA 1X6NA 1N26A 2IJ0C 3G08B 4RCAA 4XH2A 2AJ3B 4FTVE 1OSPL 3QNXA 5C09A 1KPUB 2XWJB 1G6RB 1RUML 3GSNL 3KPRE 3CFCL 4YIQB 1BAFH 3QPXL 2NLJA 3HE6C 4WO4A 3QRGH 3AY4A 3TH4T 1NMBH 3OR7A 2D7NA 4J2XA 5HGBA 3E2HC 4K8RH 3U4EB 1TJHH 4WUUD 1AE6H 4P99A 4XWGL 2BVUA 3I6KB 1IAIH 5KTEH 5GPRA 2CK0L 1HHKB 3BE1H 5CD5C 5DRXA 1C5DB 5DUPH 4KROD 3VFVB 4HC1A 3RJQB 4ALAL 2BC4A 1JWSA 4G9DB 4O5LL 2ZOLA 1S9YB 2I26N 2MCPL 2Z8SA 1ZTXL 1QRKA 4LIQE 5DHYA 2EEAA 3FFCB 4OZHA 5TE4L 3T0EB 5IV2A 3IDYB 3QXAB 2P4AB 2PO6B 8CGTA 4EJ1C 4XH2B 3H3KA 4HGWA 3CSGA 3CH1A 3TJHD 3QNXB 5C09B 2E6QA 3VXME 2HRPL 5F97E 3BDYH 1DLFH 5JQHC 2NLJB 4WO4B 1FBIH 5ICYB 5F6IB 1FSKB 2BK8A 3QUZC 3TCLA 2JJSA 2FLBT 5AYUH 3OR7B 2VDNH 3MLRL 1MFEL 5HGBB 4Q9CA 1TVDA 3ETBF 1SMAA 5DWUH 4JFZH 2D0GA 4U31A 2H2PC 5FHAL 4JO4H 3WS3A 4QWWD 2XWTA 2P5ED 2EC9T 3JWDH 5DRXB 3SCMD 1ZANL 4XP1L 4XAKE 3H9SA 1YEJH 4MLSA 2BC4B 1JWSB 5EU6A 5C08E 1RU9H 2ZOLB 4U6YA 4XCFH 3VGEA 2FEEL 5DHYB 3SKJL 1BBJA 1LP9A 4NUGH 4OZHB 3U9UA 5IV2B 2OI9B 1AI1H 4HGWB 3CH1B 4IDJH 3TWCH 3LD8B 3S35H 4I8DA 1KJ3L 1UA6L 4XAWL 1UFUA 4JRYA 2CJUH 1RIUH 5E95B 2Y7QA 3TCLB 5FYJD 4IRSA 5SV3A 2DYPA 1Z9SA 4QRRE 1IC7L 3WJJA 2XKUA 3X17A 4RFNC 2YSSA 4O00A 4OGAD 5IW3A 1GGTA 5FYLD 3O3UN 2NY6B 3WS3B 1CK0H 2XWTB 4MZ2A 4TPRH 2HTKD 2IAMD 3J8F7 1WFOA 5EC1A 3VGFA 4Q6YA 3H9SB 2MPAH 1MFCL 7FABL 1NAMA 5EU6B 3G9VA 4RMTA 4HF5H 1XF2A 4GG6E 3VDCA 4U6YB 3Q2CA 1BBJB 1LP9B 2MSPA 3F8UB 5DHVA 2DQGL 3U9UB 4IBLT 1FQ9C 2EH7H 3HNTH 1QSZA 3SPVA 4ZD3H 4Q9QL 3NCBB 3PUCA 4P9ML 3I84A 3CLEL 2EKJA 4JRYB 1OAXH 1II4E 3QEQA 4L8SC 2ZCLL 5AZEL 3OKOA 4KKLD 4DTGH 2JJWA 2OM5A 2Y7QB 3LAFA 4TNVK 1WCQA 4IRSB 3W9DA 2DYPB 4LVOB 1HXYA 4X7EC 4Z95H 4KGLA 2CUHA 2YSSB 4JFDD 5ACZA 5GS2H 4NN7B 4P5TC 3WXVL 4F9LC 3WCYA 2GIYA 2ADGA 4CAGA 1UKQA 1QO3A 1ADQA 1OW0C 5EC1B 4J8RA 3NGBC 1NAMB 4NT6A 5TJWK 4JM2F 5C0CD 1XF2B 1JVKA 3RI5K 4G6KH 2A0LD 2CDEA 3IJSA 3PQYD 5DHVB 3U4BL 1P9MC 4R97B 1LVEA 4BFBD 5DGQA 3WHE0 2V2WA 4DEPC 3CZJA 4QRPD 3SPVB 4IS6A 1FJ1A 2DWEA 1I7UA 3KS0J 3QEQB 3OKOB 4G5ZH 2AS5M 3OPZH 3W9DB 1NCTA 3WFDH 1HXYB 1KN4H 1IFHH 1QTYT 3EDDA 4XPBH 5ACZB 1MOEA 2NW3A 3C5JA 4ZTOH 1SY6H 5D1ZA 1HEZA 1AQKL 2OYPA 1ZHNA 2ADGB 2BNQE 1KGCD 1QO3B 4J8RB 2Y23A 4XVSL 4NT6B 5L8JB 3O9WD 3DVFA 5DUMH 3U0PA 4HPOL 2XN9E 1A2YA 2G9HA 2YN5A 3BKMH 1JUFA 2MNUA 1UM4L 2CDEB 3IJSB 4TSAH 5KS9F 4NO0D 2V2WB 3BI9X 3CJJA 4IS6B 1FJ1B 2DWEB 1I7UB 4GS7B 3LB6D 3DLQR 3HFMH 1NCBL 4HKJA 5IOPA 3DHMA 5CGTA 3QDGE 3LS5L 1W0YT 3DX8A 4GUPA 3VXRA 3FT2A 2IBZX 2NW3B 4LFHG 3C5JB 3QG7H 1ZLVH 1RZKC 4KDTC 5D1ZB 4Y89A 1HEZB 1ZHNB 2WP3T 3PP3K 1D5ZA 4EIZC 1FFRA 1YN6A 1NFIA 3U83A 3U0PB 2P8MA 1A2YB 2G9HB 1ZGLM 1JUFB 2OL3A 5C0JA 1X5GA 2DBJA 4L4JA 5J6GA 4UDTA 2VIRA 4HSQA 5EA0L 2R0KL 4LOUD 2RFXA 5FCSH 1UZ8A 3QCUH 5BV7H 3BKCH 4U1SA 2ADIA 4PJCF 4C57C 1KT2A 4HKJB 1WCBA 5IOPB 4KTEH 4S0SD 3GSWA 1MRFL 4S2SA 5I74B 3DX8B 2J4WH 5C6TL 4GUPB 2NY3B 3VXRB 4CDGC 3CMOH 2NYYD 3FT2B 1C1EL 5DXWA 4OGZA 3FQWA 4L3ED 1LK2A 5D5MA 1FNEA 4M3JA 1J1XH 1D5ZB 4EOWL 1ORSA 1YN6B 5HYQA 3LIZL 1NFIB 4P2CG 1ZLSL 3HNVH 4GXUN 1HHGA 2P8MB 5C0DA 3LKPA 4O9HH 1W72A 4P2QE 4X99A 2OL3B 4PJGF 5C0JB 2A6JA 3HC3L 2VH5L 5J6GB 4UDTB 3DX7A 5F7FA 2VIRB 3DI3B 3NCMA 2RFXB 4PJIA 1UZ8B 5D7IE 2AP2A 1SEQH 4HLZH 2Y5TA 4U1SB 3BYTA 1RHHA 2ADIB 3C5ZD 4KQ3L 4LSDA 1KT2B 5KSAA 4GW4A 1WCBB 5E1HB 1WZ1H 3GSWB 3NOIA 3G6JF 3D3VE 4S2SB 4TVPL 3QHZL 3MRKA 2J2ZA 1WAAF 5D93C 3FQWB 3O6FC 4KI5E 1LK2B 1JBJA 5D5MB 1FNEB 1YEGL 4ZO7A 3QIBA 5D7LD 4XPAL 5I19H 1ORSB 2NX5A 4P46C 5HYQB 4HPYH 1BF2A 1HHGB 5EOCH 3ZT5A 3LKPB 5C0DB 4OF7A 2GFBA 1W72B 1G0XA 2NTFA 4X99B 2A6JB 1IM3A 3CAFA 2I24N 3P30H 3QEGL 3DX7B 1PVHA 2HT2D 4PJIB 1FIGH 3A67H 4QHNA 3UJJH 4GMTL 4LSQL 2GAZA 4ZFOL 3NZHL 3WD5L 1RHHB 4U05A 5KSAB 4GW4B 2YKLL 2WLZA 1NFKA 2DD8L 1OWWA 1CL7I 3R0NA 2B5IC 4NWUH 2YRZA 1CQYA 3LEVL 1OPGH 3MRPA 1ROWA 3MRKB 5JMOC 2B1HL 5D71L 3K3QA 3QULA 1QHOA 1W8OA 3ISWA 1N64L 2NY1C 3QUXD 5IVXE 3BRGC 2DM7A 3NN8A 1V3KA 2X1PA 3QIBB 1U3HA 4YXHH 2NX5B 3TIDA 3VXTA 3LMJL 4XVUD 1MREL 3BFOA 3VH8A 3B2UD 4PJHE 2GFBB 2NTFB 3R4DA 3EDKA 2WBJA 1IM3B 1GGCH 3I9GH 2EICA 4OCLC 5E2TL 3K74B 2Z31D 4QHNB 2VZ1A 3R8BB 2ADFL 2GAZB 3BH8A 3IKKA 1BJ8A 3IDNA 4EEEA 3KPPA 1OY3B 3FN9A 5I18H 1DL7H 4WUKH 1PY4A 1ZKAA 25C8L 5DJXA 2IBBA 3MRPB 4OBSA 1MHHA 4MQTB 1V7ML 3EYFA 3U1SL 3QULB 4EBQL 1YEFL 3NN8B 3PWJA 1S7VA 3I6LD 3QZWG 1IEAA 4JFQA 5D6CA 2K7QA 1GJIA 5I1DA 2J88L 4HZAA 2VB5A 1U3HB 2Q8BH 3TIDB 3VXTB 1UACL 5CGYD 1TVHA 3VH8B 2SEBA 4HDIA 2HMIC 2OZ4H 4K3JH 4XHJD 5TF0A 1Q72L 2WBJB 1TENA 2LABA 4ZNEA 3UBXG 1ZLUK 1MFNA 1N59A 5GRZA 1NUNB 1TDQA 3FRUA 4K23H 3BH8B 3FKUS 3IDNB 3KPPB 1JIBA 3V0VA 3S3SA 4HG4J 2EH8H 3RGVD 5DJXB 1AO7E 3QI9C 3RVUD 3UEZA 4W4OC 2PYEA 4QOKD 1TZGH 3D6GA 1MHHB 4U6HA 3EYFB 5ADOL 2A6IA 4NQUA 3PWJB 3EJZC 1S7VB 4JFQB 1IEAB 4FFZL 5D6CB 1DQLH 4UB0L 4MAYC 1IL1A 4JR9H 2QSCL 4JFFE 5B22A 3ULVF 4ODVH 4OI9A 3WN5A 3O6ML 1TVHB 5L88L 2SEBB 4HDIB 4NJAL 2XACC 4HBQA 2R56L 1KB5H 3BPCA 3S5LG 3QIUA 5DA0B 2VDRL 4LSUL 1AGBA 1EO5A 1TXKA 4DKEL 3MLVL 1MELA 4R9HA 3MLZL 4MGXA 1N59B 3TVMA 5HYIA 3W39A 3FRUB 4TTGA 4Y4FA 1AD9A 2FLRT 3HTLX 3G6AA 4JFED 4NWTH 3V0VB 3FT4A 1FP5A 1VGKA 1HXMA 4OLWH 1GOFA 1FGNL 1UYWL 3C2AL 1UCTA 2ZG2A 2LAAA 3C2SA 1TETH 4U6HB 4XC1L 1NGZA 4A6YL 5T3ZL 2A6IB 1NLDL 2F19L 3T2NL 5H35A 4XT1C 3LEYL 5C07D 4ELMF 2W59A 1IL1B 5CZXC 5HJ3A 2VDMH 3WN5B 4PJ8D 3HE6A 3A6BH 4YDLB 3BPCB 4LSTH 3QIUB 1P4BH 1AGBB 2R0LL 5JIIA 4HS6A 4M62H 2VXVL 4JANA 3TVMB 2CXKA 4HIEA 3W39B 1WITA 4Y4FB 1AD9B 4MS8D 4OV5A 3G6AB 4FNLH 3FT4B 1VGKB 1HXMB 4YDVA 1UCBL 1IAMA 3SO3B 1IKNA 3KXFE 4P23D 3MJ8A 5MEND 5C0AA 3ULUE 4MX7A 3WUWA 4P57A 3SJVE 3ZYOA 5A2LH 1E28A 1NGZB 4MSWA 2XKSA 4TULL 2VDKL 1P4IL 3BISA 1CF8L 1L7TH 5H35B 3QIWC 3KWWA 2V9TA 2H3NA 5HDQL 5JXEA 4B5EA 2D7MA 5HJ3B 3UTPE 2BHUA 3AU1A 3HE6B 1NMCB 4PJEF 4EQ3A 1FVEA 5JHDE 3Q48A 3AAZA 4PRPD 4U6XA 4HS6B 5T1DL 5A2KH 5FYJH 3E2HB 1A47A 4PB9L 1QKZH 5CGMA 4JANB 3ZYZA 4HIEB 4BSWA 2AV1A 1FNGA 4OV5B 5FYLH 2IALA 5J6HA 4YDVB 4J4PD 2R8SH 3S98A 3MJ8B 1GGYA 4R2GB 4WW2C 1FPTH 4KV5F 3B43A 5C0AB 4PJ9A 1NGQL 4MX7B 3WUWB 4P57B 3IB4A 2X6MA 1TJGH 2JELL 3VFGL 1GYAA 1E28B 4OKDA 2RQ8A 4MSWB 3VFUA 4EIGB 3GM0A 1IC1A 3CFKA 3ARXA 1VFAA 3QHFH 2E3VA 3KWWB 5TDPA 2H3NB 4GAGL 3RAJH 4O51A 5F7EL 5FKAA 3QUMA 3AU1B 1SYVA 4GXVH 1FVEB 4GBXC 1A14L 3MCLH 5IR1A 5ALBL 5FGRA 2CIIA 3AAZB 1VERA 3O3BB 4U6XB 1MFAL 1CIUA 4DVRH 3TBSA 3VW3L 5JUEH 3TESA 4GAYA 1GC1H 4HUXA 4OZFG 4BSWB 2AV1B 5DFVC 1FNGB 4DKDC 1AGCA 1U3ZA 4GH7B 5FCUH 2IALB 5J6HB 4XNYL 1FYHB 4YHLH 4JO2L 4FS0A 4OD1L 4BSJA 4YDKL 3L1OL 4KY1L 4I18C 4LCWE 1JI2A 4PJ9B 3MJ9H 3DUSA 3VFUB 1P1ZA 1I8LC 3CFKB 5HGGS 5FV2A 4DFHA 1VFAB 5TDPB 3KLHD 1HKFA 1ZVSA 4LRNH 3B9AA 4O51B 3G5YA 5FKAB 1FVDA 3QUMB 1SYVB 4L8SA 1IQWL 5B38G 4QO1A 2ZZUT 1QA9A 3CLFH 1G0YR 3ZMRA 5IR1B 3VD5A 1JZ5A 2CIIB 3QUYC 4IRJD 1E27A 4PV9A 3OBAA 5A43C 2NR6D 3HG1D 3OTTA 3BYYA 3TBSB 2VXQH 3E6HA 1AR1C 4YQXL 4RFNB 1MCOL 3MLUH 3NFNA 4GAYB 1UH4A 4HUXB 3ARGA 4P5TA 4N1CA 1M6OA 1AGCB 3HPJA 4APQC 1OT1A 2VDOL 4OZGE 1HKLL 4G7VL 3N50A 5F1NA 1BGXL 4JPVH 2X5PA 5F7MC 3DUSB 5GIRA 4S1RL 1P1ZB 1P9MA 4D8PA 2VJXA 3TM6A 3C60D 3DYOA 5HHMD 4PLKD 4R4FH 1ZVSB 2HWZL 3SDDC 4UILL 3G5YB 1FVDB 2YK1H 4FP8H 4Y19E 4L8SB 4KU1A 1MI5A 1QA9B 2ZUVA 1E27B 4PV9B 1J1OL 1YY9D 5C70A 1J8HD 2XWBA 3MRHA 1MIML 1BM3H 3E6HB 4H25A 4X5XA 2X10A 3NFNB 2ZUWA 1P7KA 3ARGB 4P5TB 1M6OB 5HVHC 3HPJB 2ICCA 2WAHA 5FM5O 5EO1A 4PJXF 2GSIA 2G60H 4MAUL 3GIZH 3QT2A 1S7RA 5F1NB 4UQ2A 1XH3A 1KCUH 5JZ7D 4M1DH 1G7MA 5GIRB 3RQ3A 4XMLH 3A6CL 4D8PB 1RIHH 3CVIL 3KYKH 5C0RH 4E41E 1A6VL 5IW6A 2VXUH 2QKIA 3RUGF 2A73A 1VEOA 1MI5B 5J56B 2XY2A 3LEXA 1DBKL 2VQTA 2VR4A 4QLRA 2XWBB 3MRHB 1PFCA 3RWHA 4H25B 4K94H 5GISH 3QDAA 4X5XB 1F5WA 5I15H 5D1XD 4FG6D 1P7KB 2YUWA 4GRWB 2DDQL 2OR9H 2NY7L 4KDTA 2HT3D 1YZZA 5EO1B 4ZS6C 1KTLA 1OP3K 2GSIB 3QWRA 4FQXA 4TQEH 3VA6A 2DB8A 5E24E 1S7RB 1I8IA 4UQ2B 1EA9C 1XH3B 3PP3H 4X7SH 2Y36L 1KCRH 1G7MB 4HBCH 3NA4A 3LHPL 2CGRL 4TN9A 2ESVA 4LU5L 2ZG3A 3BDXA 3DETD 4IDLA 4TOYH 5C0FA 3FJTA 3SE9L 5D1QA 5DVNA 5IW6B 2NXZC 2QKIB 3BN9D 1DFBH 1RV6X 4M7JH 4OJFL 1ZHKA 5AWNL 1JGVH 3JWOL 4WCYL 3CPLA 5J1TC 4RA3A 5E2WH 1KENL 3LEXB 4FQJH 4I3GA 3JV5A 4KVNH 3RWHB 1FAIL 3V5DA 3GKZA 1IMHC 2R0ZH 3OZ9L 5K9QI 1KTLB 3EBAA 4LQ1A 1ZAGA 4G3YL 4FQXB 3HLAA 4BA8A 2XZQL 1I8IB 4BK4A 4U49A 1DE4A 2LQRA 1EEQA 4M5ZH 3SO5A 4LP4A 1XGYH 2FCBA 5TPWL 3NA9H 1IZKA 3CX5J 5HHNA 2QSVA 2M8XA 4POUB 5EZIH 2ESVB 3WV0A 5DMIL 4JPIA 3VCLA 4PGCA 1LE5A 5C0FB 2IWGA 4OZHF 5D1QB 2L4OA 2EDYA 3ARBA 4M6NL 4NZTH 4GRLD 2R9HC 3N1FC 4V1DD 1ZHKB 3CZFA 4ZSOA 3CPLB 2YHGA 4F15C 2BVTA 1PKQA 2D0HA 1UM6L 5BQ7B 3FN3A 3JSSA 3F6LA 1C7SA 3O6FA 4N8CL 3V5DB 5F93C 1OARH 3IXAA 3MRDA 1Q94A 5GZNC 3LS4L 5FM4A 4UINL 5HVFB 2XQBL 4P46A 3HLAB 1MCQA 5KSVA 3BUYA 6FABL 1DE4B 1ZS8A 4MJIE 5IT2L 5F96L 4KHTL 2W0LA 2A74A 1FLTX 5HI5D 5HHNB 4GKOA 2XZCH 3X11A 3N9GL 1AJ7L 2EDEA 2I07A 4JPIB 3VCLB 4PGCB 1FLRL 1LP9F 1T04A 2KQNA 1LE5B 3ARBB 3QDJA 1SM3H 5CJQH 2VLRD 1JP5A 2FYYA 3CZFB 4ZSOB 3MOBH 1EGJA 1WWCA 1TJIH 3QQ3A 1PKQB 5IROC 3KG5A 3O6FB 4H20H 4KTYA 1U8NB 2JCCA 3IXAB 4PUBH 5IBUB 2V5MA 3MRDB 1Q94B 4MZ3A 1A9BA 1KSRA 5DK3A 4IOFD 1UB6A 3O6KL 4N8VA 3PDGA 4X7CC 3AM8C 4P46B 1MSPA 1QPXA 1ACYH 5KAQG 5KSVB 3BUYB 2X4SA 2B0SL 1ZS8B 4YGAB 3V52L 3H7LA 1MWAA 2A74B 3I2CH 3X11B 5E6IC 2WQ8A 2I07B 5BCAA 1T04B 2DQDH 3QDJB 1J0ZA 4X98A 1JHLL 2FYYB 1INEL 2OQJA 3MOAH 2I25N 4LMQE 4G8GD 4OQTH 3QQ3B 1WBZA 5KW9L 1NC2D 2BX5A 3G6JE 5HGAA 1R3HA 4UOW1 3K2UL 3GMLA 2O5XL 2EDHA 4N0FA 2NY1B 2JCCB 4WI7A 5CSBA 3MCKA 1A9BB 2PXYD 5JORA 1UB6B 2C3GA 4N8VB 3FB8A 2AXGA 1T0MA 3MLWL 2JLLA 2FO4A 4JLRA 4LASH 2X4SB 5I66B 3U7AA 1MWAB 2EC9U 3JUZA 4UTBL 2AJYH 4B50A 2V5TA 2X2YA 3UJTL 2FATH 4XRCA 1QFUH 5EIIA 2JIXA 2UYLA 2IAND 4X98B 1O7SA 1ZLUH 4FQCL 4X4YA 3JV6A 2OQJB 2WINA 4WI5A 3RKDC 2RBLA 5JIHA 1WBZB 1R0AL 3RTQC 4W4OA 1WUNT 2DLIA 5HGAB 1R3HB 3GMLB 1GCFA 4PG9A 4N0FB 4M7KH 4RFOH 4RX4A 1BREA 4XP4L 2K1MA 1CD9B 3NCEB 2VDQL 3MCKB 5JORB 3FB8B 2AXGB 1T0MB 2FBJH 5ITBH 4MAYA 5DT1H 1T83C 3INUL 1KG0A 2C26A 5EO9A 3SDAD 2FO4B 4JLRB 1ETZA 4JPWL 5B4MC 3RDTD 4F33A 4Y7MA 2FSEA 5SX4H 5IB5A 2HKHL 1S7XA 1A1OA 5JA9A 2W0PA 4XRCB 2ICWJ 5EIIB 2JIXB 3RZWA 2UYLB 5GRJH 2W91A 3OAUH 1NGYA 4NQCE 4X4YB 3JV6B 3X3GL 4L4TA 4NFCA 1ITCA 1K9TA 2WINB 3NAAL 1URLA 1JRHL 3U9PL 3BXNA 1AIFA 1XEDA 4KUCD 3JTSA 2H1PH 4GJTB 1AY1L 1YYLL 2P7TA 4PG9B 5KN5A 4F7CA 1YMMA 1AKJA 3CUPA 4PY7A 4MAYB 1QFWM 2X1QA 1KG0B 1U8PA 5EO9B 1ETZB 1IAOA 4G43A 3UTTD 5C0IA 4ZOAA 1VPOH 4F33B 2R1XA 2FSEB 1G6VK 4OLXL 3WS6A 5JW3L 5IB5B 4LMQI 5E08H 1S7XB 1A1OB 4L4VA 5FDYA 4DZBA 1RUQL 2DI8A 1CDJA 1DBAH 1NGYB 5CD5D 5DD0H 5D2LA 4L4TB 1P5UA 2BHYA 5GS3A 4Q74A 1YJDC 1YEEH 3BXNB 4FZEH 1TTUA 1AIFB 3JTSB 2OBGA 1MFBL 3CGTA 1D5IL 2P7TB 4NRXA 3Q5YA 5KN5B 2E9IA 4F7CB 2YD1A 4R8WH 1YMMB 1AKJB 3CUPB 3QIWA 4U1NA 4PY7B 2IFGA 2FEDD 3JZ7A 3WYRA 5BXFA 1U8PB 1TMCB 2AABH 4XTRC 5D5MF 4CADA 3LKNA 4MVBC 3HI1A 1IAOB 1LQSR 4G43B 3ULVE 5C0IB 3FZUD 4LAQL 3BT2L 2PNDA 2R1XB 4HZLA 3QUZD 3E1F1 1YEIH 4KI5C 2VABA 4L4VB 3U2SA 3RVVC 4DZBB 1MEXH 4NQSA 3CSYA 2H2PD 4XNUL 4PJIF 4LK4A 5DI8A 1JGUL 3BPLC 4PY8J 1F3DJ 1A6WL 2BFVH 4WW2A 5E99H 4JCMA 3DXAA 4HXBL 4NRXB 2J7LA 4IMKA 1FGVL 4NN5B 3V8OA 1XT5A 3DNKA 3QIWB 2GSGA 4U1NB 5FF6A 5DRNA 1SJEA 5BXFB 4KK8D 2CR6A 4Z8FL 1G9EA 4CADB 3LKNB 4GAFB 3HI1B 4IIQC 1QBBA 5F8RC 4GBXA 4HZLB 1CFNA 2ZCKL 4NIKB 1A9EA 2AEIT 5IBLC 4Z7NF 2VABB 32C2A 2APTA 1KYOJ 5C7XH 1NCWL 1T03L 1YQVL 1YEHH 2ZKHL 3U2SB 4BH8A 3MROA 2B20A 5I1CH 4K3DH 4NHCH 3CSYB 4NQSB 4Q0XL 3PGFH 5DI8B 1BQSA 4AIZA 4BZ2H 1EZVY 2EO9A 3ZKSD 4WW2B 4P2OC 3MV7E 3DXAB 5L2KE 1U8MA 2AI0L 2HN7A 1BBDH 1WBXA 1I8LA 5L0QC 4OFYD 4DAGL 4LQFL 2HFTA 2GSGB 4U1IA 4LCIH 5FF6B 4Q7DA 4XNQA 5DRNB 1SJEB 4GRMA 4BFEA 5JOEA 4CGTA 1OAZH 1G9NC 1T5XA 4JQIH 1K4CA 5CINH 4D0CA 4GBXB 3WFEL 1CFNB 3MV9A 2XA8L 3U0WL 4PJEE 1A9EB 2W9DH 3HS0A 3QUYA 4YHKH 4M1CD 32C2B 2KBGA 3HMXL 4PLNC 4PJAE 1NANH 3BW9A 1BFVL 4OCWL 5IHUH 4BH8B 3V2AR 4MNHA 3MROB 5IGXH 4LCCA 4APQA 3BRFA 4AIZB 1EUTA 3GHEL 4NM4L 4MMZC 1OF2A 1K3IA 1CICD 2QSTA 3D39D 4PP2A 5KOMC 3IAQA 1I9IL 4I2XA 4OZIA 3AMKA 3B5HA 4WI2A 1U8MB 2CDGA 3QAZC 2HN7B 1WBXB 4FFVD 1KCLA 4U1IB 3O2DH 2BVOA 4XNQB 4DFIA 1YNKH 4GRMB 3SDDA 2F54A 5C2UB 4NKDA 5DQDH 1T5XB 5J1SC 1K4CB 4D0CB 4CJ1A 1X44A 3MV9B 1A64A 3HS0B 3QUYB 1KEGL 3Q6GL 1OM3H 3FMGH 5KZCD 3JV0A 3T3MF 1BHGA 3BW9B 1QD0A 1BD2A 1V5JA 3R1GH 1BIIA 4MNHB 4ZOBA 1P84J 4CVXA 4LCCB 1TZHA 5ALCH 4APQB 4HWBA 2E7CA 2B1AH 2VISA 3OXSA 1J0YA 3QXVA 1OF2B 2YS4A 3GSOA 5A3IC 4PP2B 5DEGA 2EYTA 1O0VA 4I2XB 4OZIB 1RURL 3C09C 4TVPD 2CDGB 4WTWA 4MD0A 5BRZD 1CR9L 1RVFL 2MJWA 4OLEA 2W1NA 4FQ1L 3BHBA 2BVOB 4AG4L 3OR6A 3SDDB 2F54B 3ZHDA 4NKDB 4ENEC 4BQ6A 2YD6A 2AEQL 2CRYA 4MNQE 5IJKC 4XMPL 1LMKA 3ZTJG 3L7EA 5C8JA 5GGSA 1JZ8A 2QADC 1BD2B 4CVXB 1BIIB 2X40A 3B2VH 4LSVL 4XNZC 5HVHB 1TZHB 4WW1A 3BOVA 2NY0B 2VISB 5DDHA 3WJLA 3OXSB 4Y88A 1MCKA 4M7LT 1NMBL 3GSOB 2QJDA 5DEGB 2Q86A 4N9GA 2EYTB 2MQCA 1D3CA 4MA1C 4K8RL 1TJHL 4MD0B 4EDXA 4Y2DC 1UWXH 3BHBB 3OR6B 3BZEA 5DUPL 2MQ0A 3ULUC 3MYZA 4S11A 4UNVA 2F53E 5IFAL 4S0TD 5HI3C 3L7EB 5C8JB 3S36H 5DC0A 5GGSB 3HUJE 4UIKL 1JV5A 2JB5L 4HWZA 4J6RL 5I0ZA 4OD3L 3VXMA 2AGJH 3KPRB 3UYPA 3RWFA 1NAKH 1K4DA 4WW1B 3CSPA 1B90A 4A2LA 5TF1L 1AGDA 5DDHB 3BDYL 5FGSA 2WZPD 1CDHA 3KLAA 2Q86B 4N9GB 2IC2A 3RIAK 3S37L 4PBWD 4H1LG 4RA0C 1D5XA 2KZWA 2HTLC 4NO5A 3MPCA 5I1HH 5A2FA 1R3IL 4EDXB 4JFZL 5INDA 4Y0GA 4JO4L 4HWUA 2X41A 3HC4H 3S6CA 1I3RA 3BZEB 3EUUA 3JWDL 2NXZB 4KHXH 5C08A 1YEJL 3W0WD 3REVA 5DEZA 4I13B 4XCFL 4NUGL 5E9DA 1JV5B 4HWZB 4M4PA 5ESVA 3U4AA 3VXMB 5I71C 1AI1L 4IDJL 3RWFB 5DR5L 1K4DB 3S35L 4PIRF 1XIWA 2CJUL 1AGDB 1RIUL 4DW2L 5I1IL 3QZWA 4QRRA 3KLAB 1D5XB 1NPUA 4NO5B 3CVHA 3FO1A 4P9HL 5T33H 5INDB 3BZFA 4OFVA 5KVEL 1B88A 4DCQA 4LRIC 1CK0L 2FNBA 1I3RB 4TPRL 4P5KA 5J9PA 3D5OF 5C08B 3QR2A 2MPAL 4YBQC 5D2NE 3REVB 4K07A 1RUMH 3GSNH 3O4LD 4NC2B 4XB7A 4WHYG 5FXCH 4F15B 1B0GA 4LHUD 1X9QA 4CN4A 5E9DB 3QPXH 5IROA 4AM0A 5F7LB 5ESVB 2DLTA 4PR5A 3HNTL 1CTNA 1A3RH 5D6DC 4ZD3L 3I3EA 2WK2A 4X7TA 3VG9C 1E6JH 1UG9A 3B8SA 1XIWB 3DV4A 3AM8A 1MCIA 3QZWB 4QRRB 1KTDA 4J3SA 4Z95L 5I30L 1Y6KR 3T3PE 2WUCH 3CVHB 1U36A 3FO1B 4O5LH 5E6IA 3BZFB 1NMAH 4RGND 3S5LA 4DCQB 3SGEI 5T3ZD 1EMTH 1MVUA 1Y6NR 3GO1L 3BAEL 5TE4H 4Z7UF 4P5KB 5J9PB 5D72H 3TIEA 4GOSA 3VD9A 3V4UL 2F8XC 4Z7OF 3MLXL 1B0GB 1Z6JT 4N9OB 4AM0B 5LCVL 5IBTH 4Y5YC 4PR5B 1HI6A 1MFEH 3Q3GA 4X7TB 2OMBA 4H88H 1KXVC 1I9JH 3DV4B 1AQDB 2KPNA 2RHEA 4G5ZL 4AENA 1BQHG 1J0HA 3BQUD 1KTDB 3STZA 3WFDL 1FZOA 1KN4L 1IFHL 4U3XA 3TT3L 5E6IB 2L0DA 4QRUA 1CTOA 1MPAL 3S5LB 1KUMA 3TBTA 1FRGH 2DQEL 3EJYC 4X4ME 2COQA 1H3UA 3BX7C 1MVUB 2BNQA 4BQCA 3RBGA 4EXKA 1BJ1J 4ZTOL 2NY2B 4HV8A 3TIEB 4M48H 2XN9A 5DUML 4NNXA 3NIGE 1UA6H 2IPKA 3QI9D 5HVWA 2CH8A 1INDH 1CWVA 5E8DL 1EFXA 2HJFA 1HI6B 4LPTA 1IC7H 3Q3GB 1LD9A 5DJZA 1MQKH 3QDGA 1T83A 3HFML 1SVZA 4UT9L 4AENB 3STZB 1CDBA 1JPSH 3GBLA 1FZOB 1MFCH 2ARWA 3BP4A 1OAUL 4QRUB 1DVFC 3QG7L 3TBTB 5JW4R 5FAAA 2BNQB 1VCAA 1B2WL 1TCMA 3F58H 4HV8B 3E3QE 3VD7A 2NY4C 4I48A 5HTSA 1F4HA 2XN9B 4JM2C 1SJHA 4NNXB 3MJ7A 3EYVA 3H0TA 5KJRL 2NY5L 2IPKB 3AREA 2ZUQC 5E4IA 3OWEA 5EZJA 3TEUA 2ZCLH 5AZEH 1EFXB 1VESA 5ESAA 2HJFB 1QG3A 5GGTA 4WI3A 3QCUL 4JKWA 1LD9B 5DJZB 3BKCL 3IF1A 4HIHA 1N5YL 3QDGB 4RRPG 3KHQA 5DD5L 5FOJA 5HHOE 5CZXD 3DVIA 4LARL 4HJJH 2LV4A 1T20A 3OJ2C 4PG2C 3BP4B 2ARJA 3CMOL 1PZUB 4I4WA 3KLSA 1U91A 3D69A 5IEHA 4JY5L 3U4BH 1CU4L 1J1XL 3TNNA 3FOLA 4I48B 4XPTH 1OAQL 4OZFA 3QNZA 1JI1A 3CCHA 1SJHB 3H8NA 4P2QA 3MJ7B 3EYVB 3H0TB 3T2PA 4AIOA 3AREB 5EZJB 3ZYJA 4UTAL 4K9EC 3UZEA 3VDAA 5ESAB 5D7IA 4RMQA 2FJHA 4YHIA 1SEQL 1RJCA 5HYFA 1XZ0A 4HIHB 4MXVE 3FAXA 1IAII 1AQKH 3CXHK 2IPTL 3ABZA 3BGMA 1T20B 2D9QB 3GBNL 4QF1A 3VI4E 2ARJB 5FO9A 5EDXA 2XTLA 4I4WB 4HPOH 5B38A 4KVCH 1EO8L 7CGTA 1UM4H 1U91B 3BPOC 1P7HL 3D69B 5IEHB 5TQ0H 1VEMA 2IPUK 3TNNB 3FOLB 5BVJA 2Z91A 4OZFB 3QNZB 5CP3H 3CCHB 4P2QB 4HPYL 3MFGB 5EOCL 4JVPA 5B3JE 1NJ9A 5D7IB 4EDWL 3TT1H 3A67L 1JYXA 3UJJL 3ZKND 2FJHB 5HDLA 4YHIB 5BJTA 1XZ0B 2YA2A 5IHLB 3RVTD 2AXJA 2VOTA 5CJXA 4NQDD 2Y5EA 4JHBA 4NWUL 3BGMB 1VENA