3C5ZD

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
202
Chain Sequence
FEAQKAKANKAVDGERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords TCR B3K506 Alpha Chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 202
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c5zD01
1Q1JH 1J8KA 2UWEA 5F7EL 3D0LA 1LP9A 5F9WC 1BZ7B 3VWKA 3RIFK 5TH2A 4RFEA 1KXTB 3X14A 1IMHC 4P23B 1KPUB 2J8UB 4UILL 4AY0A 3TIDB 1ZHLA 5D2NC 1DUZB 1ED3B 4NO0A 3OG4B 4JPVH 5DHVB 3TBSA 1AKJB 4ZFOA 2V6HA 4OLVH 3RWGA 2Y5TB 3HC3H 4Y89A 3QJHB 1WZLA 3LKSB 3T0EB 4XCNA 5CZVH 1HXMA 3S35X 4HIIA 4KKLC 1DBJL 5C0GB 4MXWL 3VFTB 5KVGL 4I5BA 5GSRA 3SBWC 2P8LA 1PAMA 4R7DA 5C2BH 2ITCA 3ALPA 3G6JB 3GMPB 4OM0L 3K8LA 3MA9L 4JGJA 4KJQC 2I26N 3ZTJG 4HJ0C 3QUZD 3R4DA 4RWYL 1AR1C 2P47B 4N5ED 1MRCL 4QRPB 4Y5XA 5IMKB 3WS6C 4MVBC 5AG9A 4Q97A 2PKDA 1MREH 5TDPA 2Q3ZA 3QEGH 2D4FA 4C56D 3MXWL 1NAMA 4Z95H 4NUGH 4G8GA 5C0ND 3ZL4H 1KV3A 3JWOH 3MNWB 3ESVF 2C1PA 3KJ6H 4M7LT 1MCIA 3INUL 2UYLB 4E41B 5GS0C 1YY8B 2VLJE 2GSIA 5HD8C 4G5ZL 3SCMB 3IJHB 2BXZA 4GAGL 4I13B 1CD8A 4N8PA 3PHOA 5KVEL 2JCCE 4BH8B 4M6NL 3JZ7A 2PW2B 4LARL 3DMMD 3NTCL 2R2CA 1YNLL 2MNUA 4I2XB 4LVHB 4Z7VA 1FL3A 5DJAB 3MOBH 3RPIB 2CUMA 1PSKL 1PZUB 4YZFE 3K4ZA 3EYVB 1LE9A 4GO6B 1CR9L 3KVQA 2EDTA 1JFQL 4IM8A 4OLZH 2HFTA 3QG7H 5ID1B 4OQTA 1KEGL 3MLRH 2FX9H 4X8XA 1X5XA 4OD2B 4U3CA 4ONHA 3WHXA 5DGQA 1ONQA 5KANG 4K8RL 3QFDB 1P9MC 5HYJB 5CEZE 1YDPB 5DRWA 3CC5B 5MP6H 1C1EL 2CK0L 2VDLH 5C08E 3C5ZD 4KZEL 2R1YB 3EOBA 4NWUL 4EN3D 2ICEB 4H26A 4FQXC 1C16B 3S36L 4EI6A 3PQYD 4LEXL 4WENB 1OAYL 3GRWL 3CFEA 1MFEH 5C07E 1F3JA 5CJ8A 2AXFA 1GC1C 5ISZB 2J5LC 3VXMD 3BYYA 3GMMA 4F9PC 2OR9H 4DVBA 2Q8AL 5BMFH 2GJZB 4RA0C 4H5SA 1T1WB 2DF3A 4RX4D 4S1SH 3B3IB 2H41A 3Q3GA 2BNUA 4ODHH 4NKQB 3GSNB 25C8H 4PRHB 1X7QB 1GYAA 1IQWL 1ZT1B 5TF1H 1ZVHA 2F9BT 3IDIA 5D5ME 2FX8H 3BDXA 4NPYA 5EU4A 1PG7W 4UIMA 1LDPH 2XZQH 2D7QA 3BO8A 3L5HA 4FQIL 4X7DC 4ZNEA 2AV7B 1O0VA 1S78C 3RUGE 3D69A 1CGSH 1F6AA 4UOW0 2IPKA 3GKWH 4TSAL 1I1CA 1DBAH 3L1OL 4WO4B 5CHNB 3ZKMC 1J8HB 1LVEA 4ODWB 1T4KB 3WE6B 2PXYB 1F4YH 2R0LH 3BXNB 4AENB 5I1KH 2FO4A 1LEIB 2EO1A 5I1IH 3DLQR 4JFFB 1OHQA 1J0YA 3PGDA 4W68A 3HZVA 4M48H 2DN7A 3SDXE 5AD0A 2L7JA 2VAAB 2AQ1A 1QSVA 1PG7L 5IQ7H 1S7WB 1ZT7A 4H20L 2E7BA 1BBDH 4P4RA 3AS0A 5LGHH 5IB3B 3WNLA 1VGEL 5HHQA 2Y5EA 1CIUA 1FLTX 3F7PC 3H42H 3U0PB 5C7XH 3G6JF 3L7FB 3SE8L 2EIEA 3OF6D 4LVOB 1MQKH 4NO2B 2AI0L 3ILQC 4X0KA 1MWAA 1XIWD 2VDMH 3SE4C 3VH8G 4DKFH 2W0FB 5IW3A 4R3SB 5I6XC 3HG1A 4LLYB 4CADB 3S34L 3C8HA 4LHJB 2V2TB 1K6QH 4XNZC 1K8IA 4BH7B 2EYTA 5CGYC 3WUWB 4TSCH 1CT8B 3DIFB 4JE4B 3NOIA 4P57B 43CAB 4Z7OF 3G5ZA 4P5TC 4JR9H 2FL5A 1FG2B 3JTTB 3L3IA 4Z7WA 5AWNL 1UYWL 2L0DA 4OJFL 5KJRL 1ND0B 1NGWA 1U8KA 4QXUH 1W72L 4WEUD 2VISA 1W72B 1QPXA 4IBLT 1ORQA 4BSVB 1PGRB 4HBQA 3ZE2F 1IL1B 3C6SA 5LQBL 2B7DT 4L4TA 2O5XH 3PV6A 1H3WM 1WZMA 2YK1L 4R8WH 2W92A 5IMLA 1IAIM 3EFDH 4XBPA 2Q86B 2N7BA 4WW1B 3PWPE 3DX6A 5GPRA 4LOUD 1BFVH 1A9EA 2XACC 3VRLE 2I9TB 4PRPB 3VXOB 1NFIB 4Z7NF 3IXTB 4R7NA 1S7RB 5GGSY 3OKYA 3OJDB 4MD4A 2NY1C 4S2SB 3ULUH 3HR5B 3BISA 3T0VA 4JPVL 5EOTB 3QIBA 2AKRB 5BV7H 3MUJA 1CD9B 4OLVL 4AM0B 3HC3L 5E8OA 3DRQA 4S1DD 4YBLB 4WVRA 1UXSB 1PY9A 3LH2H 4GMSH 4HIJA 3P4OB 4Y1AA 3NFPA 1T66C 5GGTH 3KDMA 3IDYB 5F7DA 1KT2B 4GXVL 4R97C 5HGGS 3B5TA 2OJZL 4WNQA 5SWZB 3DVIA 4JFZL 4X6CA 5EC2B 5C2BL 3JWDC 4NQDA 3X13B 4MAYD 3SDDD 4OZIA 4GMTL 3QT2A 3BX7C 1QBAA 4U1LA 3MV7E 1WBXA 5D70H 1M6OB 1QFOA 4ZFGL 4L9DA 1MREL 3CCHA 2YD5A 3WIHA 3QEGL 1KLUA 4GAYA 2D4DA 4Z95L 5BOPA 2X9WA 3LSOA 2X4QA 3MLTA 1G0YR 4J8RB 3JWOL 4K7PY 3D2UB 1UXWA 2D9QB 3RL2A 1DBKH 4WWKC 4LCCB 2O26U 4OM1H 5DI8A 4CN1A 3WDJA 1QSFE 2ED8A 1AO7A 1T04B 3DYOA 3T3ME 2FJHA 3V5HB 4CBPA 4XCFH 4KH2A 1G9NH 4N0UB 5IIEA 4HXBL 4CU7A 2FDBP 1UM6L 3NBNA 2OXGA 3CDYA 3ULSB 4TNWK 5JNYA 4F2MA 1UQSB 3UMTA 1EHAA 1CFTB 1YEGL 5I19H 2CQVA 1NLBH 4XX1E 1FZJB 3MRMB 5F1NB 2E7LC 1NH6A 4EIGB 3MOBL 5IFHH 2BVTA 1UCTA 5GS1B 1UGNA 4NT6B 5DURB 4EIZC 3LQAH 5SWQB 5JOEA 3CVIL 3LIZH 4KROD 5T3ZE 5T1LA 4OLZL 4JFYA 5A2IH 3EFFA 4QOKE 1JNNH 4LPTA 4UTAL 1IAKB 1PX3A 2C1OB 2RIKA 4OKDA 3SBWA 1P4LB 4TTDC 3F65A 3RI5K 1YMHA 4CVZA 2E27H 4YJZL 5JTWA 1TCMA 4PJFA 3VXPA 2AK4D 5FYLH 5L2KA 4XVSH 2Q6WA 5I15H 3GDBA 1I75A 4D9RE 1OTUD 4GRLD 4G9DB 1GSMA 2NXZC 2I9LA 3EYUH 1MFEL 3IXAB 3MV11 4NQEB 2VAJA 3KXFB 2OR9L 3OQ3B 3E6HA 4L4VD 3AMKA 3CPLA 5BMFL 1CBVH 1W2KT 3SY0A 4S1SL 5CWSB 1MJJA 1L0XA 3PWLB 5FYJD 3ARBA 4ODHL 5ESAB 4M7JH 2QADD 3HA0A 2EDDA 1YEDB 3EDEA 3IU3B 1A14H 5KSAC 2VIRB 5CSZB 5D7JC 1RMFH 4P46A 3QIUD 2BY3A 1Z0NA 2FX8L 3EO0B 1LDPL 3U4EB 2XZQL 2VMFA 1I7ZA 4NYLA 5J6GA 1QD0A 3DI3B 1J1OH 1N59A 2P24B 1OAZL 3EO9H 2C3HA 4WEMB 2EDRA 4NQSB 3QDME 4ZAKB 5E00A 1CGSL 4KMLB 3GKWL 3ESUF 3IT8D 2B1AH 2NXYB 1ADQL 4NQCD 1ZS8B 1IVLA 1ZE3C 3DURB 3MJ7B 4BSWB 1G7PA 5DS8A 5I1KL 3DX7B 4WGWB 5IEHB 5LCVL 1N0LA 3VXRB 3UBXA 1G0DA 4MNQD 5H35A 5I1IL 3JTSB 3KPLA 5DD0H 5CJOH 4JFQA 4FRWA 1UKSA 4N8CL 2APXA 4XNMA 1PQZB 2B2XH 5CJXC 3DVFA 2H9GB 1M71B 4Z0BH 3SGJA 3BT2H 4FQXA 5IQ7L 3PWUB 1XF5A 1RVFH 4MNHA 4G8EA 3SJVA 4A2LA 1Z6JT 1BBDL 3QAZC 4JM2C 5ICYB 1FCCA 3PL6C 4LAQH 2HFGH 5LGHL 1BPVA 3BJLA 5GS3A 4J3VA 4F9PA 3DXAE 1WBZA 5IR1A 2FH6A 2DYPA 1II4E 3S5LB 1X5ZA 4IJ3C 5DF0A 5C7XL 1JHKH 2OS7A 2NY5H 3QQ9C 1U8PA 1MQKL 1JL8A 3VRIB 1TETH 4GG6E 2OQJB 2VDML 3EOAB 4DKFL 5IGXL 2YC1A 2FJGA 5IB1A 5JORB 1LNUB 3QXUA 1PJ9A 1CICA 2Z8VC 3LHPL 4G9FB 2LABA 2EE6A 1RUMH 4K3DH 3TO2A 4YWGH 4TSCL 1UKQA 1FBIH 2HG5A 4IRJD 1AXSB 1EEYB 4PLKD 4PGBB 4YLQT 1R5IA 1EO5A 5F7NC 2HFEA 3OGCA 5JMRA 2R2HA 2A6KA 4ONGH 4WEBH 2EEBA 4F7CB 3QI9A 4QXUL 2N1KA 4HAFA 2WK2A 2X4UB 5HGAA 4DGVL 2EO9A 4P5KA 4XTRD 4IIQC 2VTFA 3KPSE 2ZUXA 4OCWL 4XPBH 5GJSL 1YN6B 3QZWB 2R29H 1FVEB 3HMWH 2O5XL 4HEPG 1CVSC 1V7NH 4JGUA 4NZJA 2K3TA 3VDBA 4KVNH 4R8WL 3EGSA 2R0WH 4U6YB 3EFDL 1A3RH 2BC4B 2Z35A 4JRYD 5C0CD 3FRUA 5I8EA 1CTOA 4K7FA 3FT2B 5ACMA 1QUNA 3RWCA 3ULUL 3E3QE 2YZ8A 1TTUA 2FGWH 1AP2B 3QHTC 5IJKC 4ISVA 1SVCP 3U36A 1MQ8A 5F7MC 5I2IB 5MENE 1IM9A 3SE4A 3IKCB 3RGVD 4G6KL 1WVZA 2KZ1B 5BV7L 1QLEH 1TJHL 5BV7B 4TULH 3VFOB 3BUYA 5C0FA 5C8JB 4GMSL 4UDTB 2C5DC 4L3EA 4LSTH 1R5VB 5GGTL 4XP4H 2ILLA 3WIFB 1D5IH 2ZUTA 2GT9B 5EUKB 4KI5D 5J6HB 4TUJB 4P5TA 1Q0YH 4XCEB 1FORL 3L3GB 2WZPD 4P9HC 4LP4A 3PWNA 2Z31C 4LIQE 4DN3L 5D70L 2M8XA 5FUOH 1RI8A 3V0VA 4PGCA 5FKAA 4K2UH 1WAAE 3IDMA 5L2JA 3BD5A 4X4XA 5KS9F 3DARA 1QQDB 5DR5L 1NCDH 1JGLH 1QNZH 4ETQA 3W0WA 4YDKH 1DBKL 1TMCB 4KK8D 2AQ2A 4N90D 4OM1L 4L8CB 2E6PA 3MRRA 1AD0A 3M1BA 1CN4A 3MJ6A 5T3XH 3K81A 3LS4H 4PRDB 4Z7UB 4PGZA 1G9NL 3OTTA 1MHCA 1MCWW 1KIPB 3QXTA 4I77H 4K3JH 4YDLC 5GGSB 4JG0L 4PJCA 4X6EB 4HLJA 1T7VA 3KPTA 4TPRH 4YBQD 5SV3A 3OKEA 5I19L 4OGAC 4OIAA 4X99B 1NLBL 4K71B 5D7KE 1OGTA 5F6HI 4OFDA 1ES0A 1U58A 4OFPA 1P7KB 1U42A 3ARGD 3QDGE 1Q9WB 4J1UA 4RGNB 3LQAL 1Z9SA 4EDWH 1IGFL 2OTUB 4P2RB 3BSZH 4KUZL 2R4SH 2IAMD 4GJTB 4LGPB 2P5EA 2A6IB 4BZ2H 3AMLA 3ROLB 2MHAA 3LKRB 5CBAB 3U6RB 3KPPA 3ZKXC 1W0WB 1S7VB 4LLVB 5E9DA 1G7QA 5E6IC 2OL3H 2P5WE 2DKSA 2E27L 2Q7NA 3ZMRA 3OB0K 3RVXC 1HNFA 5F9OH 3BN3B 3VWKD 3PWJB 5H8DA 5FYLL 4ALAH 3SKJH 1EGJA 4OZGA 3IVKA 4XVSL 3ZDXE 5CEXB 3OKNB 5I15L 3BYTA 1IARB 3VFRB 2X9YA 3MA7B 3Q1SH 3AY4C 1QSEB 3FQTA 1S9YB 4NO0D 1EFXA 3IAGC 4F58L 3SGKC 2I60H 4KFZC 4R90L 3PABA 5ILTH 2OLDA 4PP2B 3SDCA 5DZLA 4HK0A 1UB5A 4P2YA 1EERB 1RJLA 5HI5C 1CBVL 1RZIA 5FV1L 3PP3K 4PV8B 4O2CB 3EDFA 1KULA 4YFLF 4IRZH 4AT6A 2NLJA 4FP8H 2F54A 4BQ8A 1KFAL 3O9WC 5E7FA 1RZ8B 1RMFL 3FRPG 5T1KA 5JW4Q 1NPUA 3R06A 1GZPB 3MX0A 3RBGA 1YMMA 3HRPA 3C5JA 1U8MB 5DDHB 4QY8A 4G8GD 5MERB 3L3HA 3QULA 1A1OA 2ESVA 4P23C 5E2VH 3EO9L 2VXTH 2XA3A 2ZCKH 4YR6B 3TIEB 4FFYH 2B4CL 4HC1H 4NN7C 3TNMB 1U41A 3FONB 2B1AL 2DWDB 1ZK9A 4LSRH 2V17H 1JPTH 4G8IA 5C0DA 4QRRB 5J11B 4HV8B 3C60A 1D9KA 1S7SA 4P2OD 1QLRA 3MV9A 5DD0L 5CJOL 2EEAA 2HT3C 3BDBA 3KPRB 1ZTXL 4OZGF 2YRLA 4DKEL 2Z93B 4Y16A 1V3KA 1W0VB 3C5SA 1FFNA 3CX5K 1NMCB 3BT2L 2J6EA 1S7XB 4LF3B 2QBWA 4ZTPH 4JFHE 1RVFL 1UJ3A 1AGEA 4AZ8A 3GMQA 4BJLA 4N0YH 4I3GA 4QNPF 3HI6H 5F7LB 2XRAL 2VQ1B 1ROWA 3TFKC 1BX2B 2KQMA 2WLYA 4BFGA 1JV5A 4XMLH 1F4WH 1JHKL 2PW1A 4UI2A 2NY5L 2ZUQC 1PZ5A 3JUYA 1C5BH 1M7IB 3OKDB 2IANE 5D7IF 1RK0A 1CZ8H 1QVOA 1FZOA 1EEZA 4HF5H 4ELKB 4XCYB 4RZCB 3P9MA 1HHGA 1N5AB 3SCMC 1MHEA 4PTUA 4HG4K 2PYEA 1OB1A 4HW6A 2FYYB 3OXRB 3VFMA 2PYFB 1NSNH 1CDHA 1RUML 1UVQA 3MRJA 4YWGL 4PJ9A 3O3UN 1IEHA 3VH8B 5ID0B 1EJOH 1I3VA 1MLBB 4O00A 1FBIL 2Y72A 3T0BA 1PY4A 5HHOE 4P4KC 3V9FA 4E0RA 3FB8B 4FMKA 3T77A 3KPNA 4LVHC 2IMMA 2OP4H 3FB7B 5FDYA 3WNMA 1DUYA 3HMXH 5C0JB 2EC8A 2EDYA 2YHGA 4KRPD 5EU6E 4ONGL 1NBQA 3NGBC 4WU7B 4XNQA 1MJUL 3F8UB 1QACA 3VXSD 4HDIB 4W4NA 4G6AD 4KJPD 1G6RA 3RU8L 3ARFA 4ELMB 1DSFL 3I84A 2X10A 2R29L 3D18B 2NY2D 1CYGA 3HMWL 4LKCB 1V7NL 4BQ6A 4FXKA 4EBQH 4KVNL 5D1XD 3GSOB 3RTQC 5H2BB 2H6PA 2R0WL 5IMMA 2YBRA 1F4XH 3F7RA 1A3RL 2BNQA 2NY7H 3E8UH 4KJWD 4MJID 4NN5B 4RIRB 3WNPA 2JF1A 1CDBA 1ZA6A 3HE7B 4GKZA 4PRBB 1EUUA 2VR5A 1V8HA 4MQ7B 5E1AA 1CFVH 1UWEH 3QUXB 1FZKA 3WFCH 4J7RA 2FGWL 2XZCH 1B2WL 1D5MB 5DA4A 3ARTA 4EOWL 5GRYA 4JFXA 1KJVB 3C8KA 2ENYA 1DQQB 2JB6B 2W65A 1QLEL 3DUSB 1IE5A 4OI8A 1EVUA 4TULL 2O5ZH 3U2SB 3QQNA 2OBGA 5IB5A 4I48B 4PLOB 3TWCL 3PWVA 3FO1A 4K9EH 3RJDA 4LSTL 2F58H 2GKIA 4H0HB 4XP4L 4IS6B 2R0ZL 5DEFA 4X7TB 3F58H 5C9JB 2A9NH 3AREA 2IG2H 1Q0YL 2Z4QA 3VI4F 2W59A 4OZ4A 2QR0B 3X11A 3VDAA 1I8LC 5A2FA 4HMCA 5FUOL 1CXKA 2X70A 4K2UL 1JZ3A 1X4ZA 4IIQA 5D72H 2AXGA 2HJFA 4KK6D 1DCLA 3WBDA 4WO4C 2EDNA 2I07A 1PDKA 2WM0A 4RMVA 1NCDL 1JGLL 1QNZL 3ILPA 4PJ7E 5GS2D 2ICWJ 3CFKB 1RJZA 3O4LA 2PXYC 4PJXE 4RMSA 2EDOA 3D3VE 3D85B 1I85A 1PEZA 5T3XL 3LRSB 2F53B 1OVZA 3L3KB 1EIBA 1MJ8H 1Q72L 4LLWA 1N6UA 4JJ5B 2ZG1A 1FZMA 3OJVC 1BOGB 2XKNA 3K2MC 3MC0A 4I77L 4K3JL 5LGJB 1K8DB 1ORSA 3ARPA 3J8F7 5EUOA 4ZOBA 3LRGA 4O58L 1XGUB 3TYGH 4ZFZA 4PJEA 2XQYG 3T65B 5DFTA 1TJGH 2GJ6A 1LGVA 3V6FB 1AGBA 3WL9B 3OAZH 3QEQB 5IJKA 5CEZH 3ARDB 4DGIL 3QJFB 4ZOAA 1L0YA 2G5BA 1BJMA 2DIJA 3BSZL 2GTZA 1JHTA 4L4TD 3DGCR 2R4SL 3GJFK 4NSKA 5DJXB 3CZFA 2ID5A 5F1SA 4BZ2L 1ODAA 1T0MA 1QHOA 2AJXL 4OZHF 1YECH 1CL7I 3OX8B 2GQHA 1H3UA 3F7VA 3MO1B 5T33L 3E2HC 5F9OL 3OB8A 5BRZE 1MLCA 2G60H 1IGIH 3GHEH 4ALAL 5EIVA 4WWID 4YXKH 2HT2C 2FBJL 4H0GA 4JFDB 15C8H 3V5DB 2JIXD 4KTDL 4Y19A 2A2QT 1UM4L 3HCVA 3O0RH 1U8OA 3ZKND 2D0GA 5D6DC 1FGNH 2I60L 3UPAA 4PJAE 4PJ5A 5ILTL 1FV1A 5SWSB 1KCSL 3UPRA 3GSWA 2W9EL 3SE3C 1LO2H 4Y1AD 3OKMB 2VLKA 3PP4L 1NC2D 1GOFA 2CDEA 3OR6A 3GK8L 4IRZL 4MDIA 4Y5VA 3SO3B 1RK1A 3TVMA 4FP8L 4ZS6C 5EN2B 4RAUA 1A6TA 2BOBA 4X6FB 4NQDD 4D3CH 5I16B 3QDJA 2AJVH 2JK5B 1DQTA 4LRNL 3ULVF 2GY7B 4DJMA 4C59B 1PW3A 4QYOA 2ZWLT 2A74B 5ENWB 4ZXBC 3ZDZE 3NPSB 4KDTC 1SY6A 1XGYH 3DI2B 4FFWD 5DJ8B 5I71B 4OKVB 5E2VL 2VXTL 1I1RA 2ZCKL 3NVQA 1W8OA 3NACH 4JZJA 1KLGB 4FFYL 4J3SA 3VJ6A 1H5BA 4XAWH 5CMAB 1BVKA 4J3WA 1IM3A 1TQBB 3W9EA 1T5WA 4Q9QH 4PYGA 3MODL 4LSRL 4MAUH 4HJJH 2V17L 1UG9A 3CJJA 3BP4B 5EO1A 4YBLC 3S9DB 5DJCA 3RZCB 3X12A 5TE7H 3VDCA 4F7PB 1R3JA 4WV1B 4GW4A 5KZCD 3IDYC 2NX5E 3O3DB 2KH2B 1FLRH 1H8OA 1X4YA 3QFJA 4FG6C 2F5BH 1V3MA 4E42B 4LCWA 1NQBA 4RAVB 3UTSD 4N0YL 3HI6L 2GAZA 4J4PC 3BKCH 3UJTH 2P7TB 3WFDH 4OCXH 4MWFB 1AGDA 3VXNB 5CAYB 2R15A 2ZKHH 1F4WL 3X3FH 5DVMA 1C5BL 3JWOC 3T09A 4XPHL 1CZ8L 2HMIC 5TE4H 1N3NB 1HKFA 4C55A 1QRNB 1A6PA 3X3GH 4CKVX 4NKDB 4KJQD 5I1LB 1I3RA 5E08H 4HJ0D 5L2KD 2I5YH 1AR1D 3BKMH 4UAOC 3KYKH 1NSNL 4MVBD 2X4TA 5KOMC 3BP7B 1BZ7A 3C09C 1EJOL 1FO0H 2ITDA 1OP3H 4KY1H 1B4JH 1CG9B 1K4CA 1LILA 4QEGA 3PHQB 4UT6L 3LPWA 1JF1B 4FTVE 1JJUA 3TIDA 5EOCH 1OGAA 3P4LA 1U91B 1ED3A 5GS1C 3HMXL 5DHVA 1AKJA 4X5XB 5HD8D 4QCIB 1VCAA 4OFIA 5JW5A 2VSCA 2NCMA 2YN3A 3ZO0A 3VFVB 1T2JA 3O11A 3ZE0E 3ARBD 3R1GH 1S5IL 3T0EA 1MRFL 5C0GA 1KG0B 1U3HB 4P2QE 3VFTA 4P46D 4CGTA 3CH1A 3FB6B 4EBQL 2NTFB 3GMPA 5HPOA 1B3JA 1IKNC 4P3DA 5I0DA 1F3DH 1A3LL 3CSYB 4URTB 1N4XL 1IGCH 4AEIH 2NY7L 4QRPA 5IMKA 2DRUA 1WFTA 5DYOB 5C71A 3B2UD 3WFEH 4WFHD 3C08L 3GBNH 1K4DB 1QYGL 1SBSH 1RJYA 1CFVL 1JYWA 3WFCL 1RFDH 3MNWA 2EICA 4X80H 2ZNXA 3BDYH 1FIGH 2KBGA 5JZ7C 3KLAB 4KZDH 4RISH 4PY7B 4V1DD 4M03A 4E41A 2DAVA 5JW4R 4M62H 2BVPB 3IJHA 5FO9B 5F7FA 3RWDA 4Z5RB 1MCNA 2ZSWB 4F15B 4MZ3A 3CGTA 4X6DE 2FHCA 3VG0H 3V2AR 4BH8A 5DJYA 1DQJB 1S3KH 3RIAF 4EUPH 2PW2A 4NZRH 4HPYH 4FQXD 2F58L 3DGGA 1HQRB 3SJVD 3RX8A 3VI3E 4U2ZA 3JVGA 2A9NL 5HYFA 1CXEA 5DJAA 3RPIA 2VLJB 5KBNC 5DXWA 4KI1A 3P4NB 5FAAA 1BREA 3TA3B 1IGMH 3N9GL 3RDTA 1XGPB 2JCCB 4ZAKC 4CVXB 5I9QB 3B4NA 3GO1L 4WIQA 4RGOL 2NXYC 3WN5C 1FHGA 1UZ6F 4H0IA 3REVB 1LMKA 5I1DB 1I1FB 2V5TA 2OR7A 3RIFF 5I75C 2AK1H 3PE9A 2XTJD 2HH0H 3LEVL 3ZYOA 5T3ZH 3TCLB 1YDPA 3UZQA 4HBCH 1S78D 3CC5A 1BEYL 4JFEA 4O2EA 2D9CA 1VSCA 1YEEH 4M61B 2ZZUT 4ZSOE 4HHAB 1BOYA 2H45A 3MNVB 3SPVB 3TYGL 1BD2D 1FYHB 2R1WB 3QYCA 3QI9D 3MBEB 1TJGL 1YNTB 5ISZA 1JF5A 3GJEA 3GRWA 4H88H 3MRDA 3MUY1 5CEZL 1SEBB 3RY6C 3SKOB 5EIIB 1QRKA 5E2TH 1T1WA 3VD4A 4ZD3H 2MPAL 2DQTH 2EZ0D 3B3IA 4N1EA 2IJ0C 1GGUA 3MYJB 5C08B 2HTKC 4UV7L 4DFHA 3FHAA 2D31A 1T89A 4R4BB 4N90E 5FUCC 2EDKA 5IBUG 3RNKB 4NKOA 1EMTH 1X7QA 5C07B 2NW3A 1ZT1A 1TPXC 1YECL 3L3OB 5DQJB 1I8MA 1U93B 4ZTOH 2BSRB 2G60L 1IGIL 3GHEL 2LU4A 3HUJA 3V0AC 1CXLA 3JUZA 4YXKL 4YHYB 2AV7A 4Q2ZA 15C8L 1LEKA 3OG6B 2Z8WC 1JF6A 2NY0B 5F7UA 1IM9D 3ILQD 4U3XA 4PIRF 4WO4A 5CHNA 1FGNL 4R4ND 5FYKD 3BZFB 1J8HA 4AENA 5CGYD 4F7MB 1U2CA 3CXDH 1LO2L 2ED7A 1XF3B 4JFFA 3GBML 1U8IB 3MYZA 9CGTA 3AGVA 5HHMD 4H1LG 3RUGB 2PUQT 1QFUH 4P5TD 3K7UA 4QRSA 1YNKL 1RIUL 3G5VA 2VAAA 2QKIA 1XGRB 1DVFB 1LP9E 4D3CL 3GMNA 2X4NA 1S7WA 1K5NB 4W4OA 2AJVL 1CK0L 5IB3A 4ZQKA 2FCBA 4G7VL 3QWQB 1U0QA 3U0PA 3S96A 5DUPH 3L7FA 2HLFD 3SDXB 3QO1A 2WNGA 3SDAB 4NO2A 1X5IA 4XAWL 4X83A 2W0FA 3TT1L 4R3SA 1C12B 5JW3H 4LLYA 4Z78B 4CADA 4MAUL 3GI9H 4HJJL 1EX0A 5JDSB 2UZIH 3O41B 1N64H 2ARJB 5TE7L 3PHSA 3DIFA 1ZLUK 3HAEH 4OF0A 2BOCB 3HUJF 1IKFH 4P57A 2DQJH 43CAA 1FLRL 4GBXA 1LO5B 1EV2E 4R4FH 4APQC 3T2NH 3TNNB 4I0PB 2YD6A 2EH8L 1FG2A 3JTTA 2C9AA 3QISA 4X9IA 2F5BL 5FGSA 5L9DH 2W0LA 1WWWX 1ITCA 3VD5A 1OD7A 5DA0B 3RQ3A 5FF6B 1W72A 3BGMB 2ZKHL 1T66D 1KC5H 1YZZA 3U9PL 1CLZH 3X3FL 1U8JB 2D0FA 3U1SH 1IL1A 3IDGB 5E9DD 5D2LA 1L7TH 1T7WA 1N5YL 4L8SB 3X3GL 4JB9H 5EZLB 2WINB 4IMKC 5E08L 2ICCA 5SV4A 2I5YL 2Q86A 3BKML 1ZGLP 5K9JL 1G9NC 4LNRB 2OR8A 3KYKL 1G7JA 3MRGB 3L5JA 1FO0L 1EFXD 3UYRH 2YPKB 1NFIA 3IXTA 1FO0B 4UT7L 1S7RA 4DKAA 5FGBC 3OJDA 4KRLB 4K71C 4HUWB 1MCFA 2V9QA 3HR5A 5EOCL 1XF1A 5CIPA 1FL5B 1A7PH 3HI5L 4OFKA 3QEHB 4JPWH 5EOTA 4LGSB 2AKRA 2FEEI 4RGNC 5JW4M 5IHBA 3PWPB 4AM0A 1INQB 3LQAC 2ZCHL 4ZO7A 4DK3A 2F54D 3R1GL 3HPLB 4XI5D 1UXSA 2IH3B 3CUPB 4DCQB 5SWZA 1E4KC 4LLDA 3GM0A 3EHBC 3V4UH 3N06B 5FUZH 3X13A 1JGEB 4OZFH 4G43A 3TV3H 1IGCL 3MCLL 4AEIL 4N0RA 2ESVD 2BY0A 2QV2A 2J88H 3QUKB 3AB0C 1M6OA 4MD0A 4J4PA 2A83B 2VDRH 3IU4L 3GBNL 1JWMB 1SBSL 2PO6C 1LE5A 4OT1H 1VGKB 4J8RA 4UNVA 1I7RB 1RFDL 1I9IH 4OTXH 3D2UA 2JB5L 3FMGH 4X80L 3BDYL 4LCCA 1U95B 3QRGH 4LIQH 5D2LF 4KZDL 3C60D 4RISL 1D9KD 1T04A 4LGRB 3V5HA 1DN0B 2EC9U 2VOTA 4U6TA 4NO5B 3MV7B 3BQUC 2AV1A 1AFVL 4DKDC 3KPOA 2Z0BA 5D5MF 2VDOL 4N0UA 5FGRA 4YHZH 1KYOJ 4XAKD 2BJML 3UEZA 4RQQB 4NZRL 4HPYL 2NYYC 5EOQL 5EWIH 3ULSA 2F19H 3VXUE 3UDWA 1UQSA 3HPJB 1CFTA 4EUPB 4YDVB 3ARYA 2VR9A 5EBLB 4R96B 1FZJA 5A16A 3BWAB 4CJ0A 1BWMA 1QSFB 1FNSL 1HK6A 4Z7OE 1CFQB 4KRMB 4NT6A 5E8EB 4GS7B 1A6UH 4L5FH 5J57B 3H9HB 1JPFB 4R0LA 1J86A 3NA4A 4U1SB 3RNQB 3A0OA 2VB5A 3T0DA 1G6VK 5L0QC 2PYED 1IAKA 4Y2OA 3TEUA 4PJHF 1MI5D 2C1OA 1NFDF 4NNXA 5CGTA 3ZE2E 5F97E 3TZVB 4PJ9D 3SDXF 2AK1L 1DE4B 4KQ4H 5T1DL 3TBVB 1AJ7H 4RMQA 3PIQB 2BERA 7FABL 1NMBH 1BZ9B 1CDYA 1RURH 1YEEL 2CUHA 2R1XA 4K3EL 5DD6A 4NRXB 1ZHKB 4YHOH 2EDEA 3MRKB 4QOKB 2E9BA 4G9DA 3V6BR 3IXAA 5C70A 1KCRL 4NQEA 4LMQI 4H88L 2XG5A 2DD8L 5E2TL 3FO2B 5CWSA 3HG1E 5GHWL 3PWLA 2NY5C 5JIPA 1MCJA 1U8QA 1SJHB 1NC4B 4PPTA 1HINH 5IOPB 3T4YB 1UA6H 3HS0B 1FNGA 4PJ8C 1YEDA 3IU3A 2VIRA 4D2NA 5CSZA 2BNQD 1VENA 4JM2D 1CL7H 3EO0A 4JHAH 2UZYB 2WWKT 1FAKT 3CDGA 3QDHA 4OD3H 3U4EA 3NCYS 1ZHNA 2MTPA 4XP6H 4N0FA 3QQ9D 4X98A 4ZAKA 4KVCH 5E0QA 5IBLC 1I1AB 5DD5H 2CIKB 3QCVH 4WUUD 4JEGB 1ZS8A 5E6YA 5J1SC 3IDUA 2E3VA 4BSWA 1ADQA 4UV4H 3DX7A 3K80A 5ECJE 5IEHA 3EJJX 3VXRA 1YEKL 3U4AA 3SQOH 1AH1A 4TNWF 5DJ6B 3JTSA 5J3HD 2ARJQ 1RZJL 3BFOA 3QDMB 4PG2C 3S4SA 5D8JH 5T5NF 3JSSA 2FGZA 1QFUL 2DLIA 4NUJA 3ARED 1RY7B 1BQLH 4MQXC 2H9GA 3U4BL 2XNAB 5FHAH 4LKXB 1WV7T 3LKOB 3RL1B 1NEUA 3PWUA 5D1XB 4NN5C 2WWMC 4OV5B 1P4BL 1X5YA 2YSSB 4U1NB 1MEXH 5ICYA 3HE7C 1G7HA 4KKBC 2X4PB 4G8FB 4HSQA 4WUKH 1CVRA 3S5LA 4M1CC 5GIRA 1MCWM 3PDOB 3QUXC 4OQ1A 4Y4FC 5FOBA 4YE4L 5FCSH 3O4LD 2XICA 3TC9A 2XN9D 1GPOL 3RI5F 5IW6A 2A77L 3TO4B 3VRIA 2OQJA 3Q5OA 3EOAA 2CIIA 5JW3L 5JORA 4HXAH 5HBBA 1CFNB 3GI9L 4UBDD 4L8BA 3BPCB 4MCYB 2NPLX 2ZSVB 4HS3B 1X5GA 2DB8A 3I75A 3DXAB 1N64L 2YXMA 3O6FC 5B4MD 1T1XB 4NNYA 2DJSA 1S8DB 4I18B 4X6CE 1D3CA 2CUIA 3RZWA 2LAAA 1ZANH 5DEGB 3HAEB 3W9DB 2DQJL 4OZIE 2GJ6D 1EEYA 3AS2A 3UTTA 4PGBA 1INEH 2BVOB 4HX1B 4FQHA 1Y18B 2AGJL 4F7CA 5L9DL 3G6AA 4QRUB 1JZ7A 5D96B 3GI8L 2X4UA 3TN0B 4OFYD 5CJ5A 2M2DA 4JN2B 3F6LA 4FNLH 1VADB 5MEQB 1Q9KB 3D87B 4KHTL 4HCRA 5C0AE 1CLZL 1AO7E 1G7MB 4M1GL 1GIGH 3QZWA 3DNKA 5TJWK 2JJUA 1FVEA 2NZ9C 5F3HB 4PJBB 1L7TL 5CP7A 3TBWB 2VLRA 4EEEA 3DRTA 5AEAA 1OLZA 4U6YA 2GJJA 2Z31D 4OD1L 4OF8A 2BC4A 4ZUUB 2Y9RT 3KPSB 2BRQA 4L9LC 1QFPA 1X5KA 2C26A 1HN1A 1ZLWH 5L88H 4XP5H 4QRTB 3CD4A 3UYRL 1JNJA 2H32B 5KG9A 4PJ5D 3Q6GL 3HZKB 1KN4H 4JQVC 3WJLA 1AP2A 4JPWL 5I2IA 3IKCA 3C6LB 1WCBA 1P7QD 3ZSSA 3DOSA 2EIZB 3VFOA 3MRPB 3WJJA 1FG9C 2ZCLH 2CMRL 4W6YB 1N2RB 1HE7A 4MNGE 5DJDA 2QQKH 5F89B 1E0OB 1R5VA 1WQVT 3OXSA 3QDJD 1HHHB 4QF1B 3WIFA 3MRNA 5ACZA 5FM4A 5GGTA 5EUKA 3VXTB 4TUJA 4Z6AT 3V4UL 2CH8A 4Q74A 4GW5A 3MLSH 5GRVK 2HWZH 3TV3L 3GEWB 3EZ8A 3QCUL 4GSDH 2X7LB 4OZFB 2A1WH 4F8QA 2J88L 4LBEB 2CDFB 2CJUH 2DTSA 4OT1L 4IHOB 4K7PX 3MLYH 1I9IL 4G3YH 5L6YH 3FMGL 3PGFH 5J89A 4L8CA 5EBWB 3WFBH 4D9QE 1C5DB 4TVPD 5E6ID 2AXJA 2RGSA 2DJ4A 4NBXB 3BP5B 3RVXD 4PRDA 4Z7UA 2XKUA 1YQ2A 2R9HC 1QP1A 5CILH 1A6AA 1KIPA 5GRVL 4MMXC 4B5EA 4YHZL 2E8ZA 1XGTB 5GGSA 2NY6B 4JPIA 1KCUH 4WFGD 3QFJD 1URLA 5EWIL 1WUNT 4M9PA 4AEHH 4LCWD 4X99A 1AXIB 1E4WH 1TQCB 1OT1A 4LRIC 1NCUA 1OSZB 3NPSC 1P7KA 1T20B 5GRJH 3T0WA 2DL9A 1KLFA 4NRZA 2CXKA 2OTUA 4O51B 1A6UL 4P2RA 2JJSA 1YEHH 1SYVB 3KJ4B 3ZT7A 2LTQB 3SKNB 2ERJB 3EYFB 3O6MH 3QNYA 4NNPL 5I30H 2A6IA 1TQBC 3O9WD 4XNXH 2C3XA 3LKRA 5CBAA 3U6RA 1UWGL 4YPJA 3KYAA 4X9FA 2WP3O 2WAHA 5GJTH 3QDGB 4KQ4L 5BS0E 3PWJA 3QWOB 2CLVB 3QUYA 1AJ7L 5CEXA 4RNRB 2X4OB 4X9HA 3OKNA 5JMOC 4P23D 1NMBL 3VFRA 3GB7B 1RURL 3H9SE 3MA7A 4YBHA 1R0AH 5CKAA 1QSEA 4YHOL 1QKZH 1S9YA 4BFBD 4KXZI 1AKJD 1AY1L 1SMOA 1YEFH 1AXTH 3HE6A 3O45B 3LKPB 5JW4N 3QB7C 1KELH 2P5WB 3WIIH 4PP2A 1CF8L 1AC0A 1DEEA 5ICXB 4M7KL 3T0ED 4GG6F 5HI3D 2C4FT 4YHNB 1OSPL 2HT3D 4WFFE 3JV4B 4PV8A 4O2CA 3HLAB 4IOIB 5HHNB 2D3VA 1ZLVK 2XY2A 4X5WB 2ZUYA 1MNUL 5SX5K 2VXUH 3HC0B 3V6OA 3JWDH 5FV2A 1KGCE 1QBLH 1OWWA 3K8MA 2XIDA 3N1FC 3STBA 4QRPD 1CL7L 4JHAL 3FOLB 5IBUB 1U8MA 3FQXB 5DDHA 4DZBB 5MERA 3O3AA 4PGEA 2A0LD 4LLUB 2DQCL 4TOYH 2GITB 4MJ2A 1S9KC 4PJDB 1EFQA 4HT1H 3EJYD 5HDQH 3TIEA 4PS4L 1QBMH 4DVRH 3TNMA 5DD5L 4XHJC 2WBJC 4XBGA 4BUGA 3FONA 4FQCL 4E41D 1TVBB 3QCVL 5GS0L 5KS9E 1D5ZA 4O9HH 5DD3L 3SCMD 3Q5TA 4UV4L 3BP6B 4G6JH 4QRRA 4HV8A 3SQOL 1FGVH 3NCFB 3OR7B 4MXQD 4CU6A 3KPRA 1OWRM 4OLUH 4NC0B 2IFFL 1UFUA 4Z77B 5DZOA 2Z93A 4D9LH 1BQLL 1W0VA 4BK5A 5FHAL 4PG9B 2Y06H 4Y8AA 4LF3A 2RB8A 4S11A 4XPGH 4H1LB 2IC2A 3DSFH 4JLRA 4LASH 3FKUS 5AUMB 1E6OL 1BX2A 1T83A 3KHOA 4WUKL 1HZHH 4C56A 1OQXA 1M7IA 1ZVSB 4QHKJ 2ICWI 2OTWB 3C2SA 4ELKA 4XCYA 5DMYA 1XR9A 3R0NA 1N5AA 3RTQD 1XZ0A 4HXAL 5HYJD 3LDBB 4UIKH 4K8RD 4L3EE 3LZFH 2FYYA 4Q6IA 4CUCA 1VEOA 3OXRA 3S7GA 3RX5A 2PYFA 3NH7H 4YEFA 3VH8A 4J3XA 5ID0A 3BPLC 3KYOA 3CVHH 4K9EC 2VDPL 2IANB 3V6ZB 2QSVA 2WUBH 1A0QL 3FB8A 1B6UA 4CN6A 3I3DA 5FUCE 2W07A 3KHQA 5ISZD 3MGOB 1RUAH 5B3NA 3NA9H 1I8KB 5HHVH 1WAAF 1V3JA 5C0JA 1AD9B 2HFFA 1OAXH 1H15A 3EO1B 4WU7A 1OF2B 2WIIB 5B8CA 4KKCC 1YYLL 3NCCB 2JELH 4D0DB 4KQ3H 4LPWA 4HDIA 3W0WE 2SEBB 3MLXL 5HGBA 5A2KH 3TCXA 2CO7B 5HHOB 1P5VA 4FQQB 1FYTE 4PRHD 4GOSA 5HY9B 1YYMH 5FHBL 3D18A 2EDQA 3L5XH 4LKCA 5INCB 4OGXH 4WGVB 5EU6B 1ZAGA 4K55A 3G08A 3GSOA 2G75B 5ELIA 3DVGA 3L6FB 4RIRA 4HWEL 3KR3L 5K9KA 2BSED 1KJ2A 1IC7L 4NCDA 2NR6C 1DFBH 3WHE1 5L88L 4XP5L 5EU7E 4LNVA 3W2DH 4WO4D 4EN3A 3QUXA 3ALXA 1GGTA 1J8HD 3PQYA 1D5MA 2ENSA 3CFJB 2PXYD 1C8PA 4FABH 4Z7QF 1KJVA 3MFFB 1VESA 4KMTH 3VXMA 1DQQA 2JB6A 4JFFD 4JZOB 3VFUB 5J9PB 2P5EE 3DUSA 4YHIB 5GGUA 3FT3A 4YX2H 4I48A 4RX4A 3MREB 2QQKL 4ZODA 2DM7A 2DM4A 4LFHD 4X7TA 5TDNB 3QEUA 3RRQA 4KUCD 1ZV5A 4OZGE 5C9JA 2QR0A 1ZKAA 4RSVA 1RUKH 2G5RA 1R3HB 4JANB 3MLSL 43C9A 1OCWH 4GSDL 5I1JH 4ZS7L 2A1WL 3HTLX 2HT4C 4QHUB 2NY0C 2Q1EA 2CJUL 4NHUB 1DJSA 3IDXL 4MMZC 1WT5C 4NWTH 1IEAB 1VA9A 3MLYL 5FYKL 5L6YL 3PGFL 4MB3A 5KOVC 5H94B 5I6XB 3W39A 1N26A 3D85A 3GGWB 2JLLA 4P59L 3GSQB 5I73C 5D7IE 4XNZB 2VLMD 3LRSA 4POZC 1YA5A 2F53A 4W6WB 4RBPK 4AG4L 3NIDF 4JJ5A 1HOCB 3LN9A 1MPAL 1BOGA 3DX8B 1NLDH 3GMLB 5CILL 3F7QA 5H37G 2VE6B 5LGJA 1KCUL 1UWXH 3MTRA 3ETBF 4K3HA 1DVFC 5C9KA 1YMME 3LEXB 1XGUA 4PJXB 1YEIH 4AEHL 1A7NH 5IK3B 3D3VB 4WJ5A 1E4WL 1FNAA 4JQVA 3V6FA 4NBZB 3IFOB 3QEQA 1OTTC 1J10A 4IDJH 3ARDA 2EXWC 5GRJL 3RVVC 5D9SB 1T21B 4BFEA 3BZDA 5GRUH 3QJFA 1CDUA 4NC2B 3FB5B 4ZS6D 5GGRY 3SDAC 1YC8A 2VLLA 5DJXA 4N9GB 2JJTA 3OF6A 3DVNB 2DMCA 4XNXL 2Q8BL 1XIWA 2WQRA 3MV9E 3OX8A 1BHGA 3GSXB 3MV01 4WDIA 4NFBA 5GJTL 2LV4A 4PRPD 1HH6B 1OTSC 4HKBB 3I6LD 4EZMA 1G84A 5EORH 2ZOKB 4U6XB 2EDLA 5EB9A 1KPVA 3HRZB 5HYEA 5E6ZA 5EC1B 4I0PC 3D0VA 2NY1B 4JY4B 3ZT6A 1QKZL 2GI7A 1ACZA 2F5AH 2PCPB 4EI5C 3P4MB 1RULL 1YEFL 4NZUH 3DO7B 1EO8H 4M9OA 3B8SA 3WIIL 3OJ2C 5F72S 3O4OB 5BRZB 2YPVL 3WYRA 1D6VH 1KB5H 2OSLB 2RJMA 1IRAY 1VFAB 4JM4H 3BH9B 5SWZD 4MXVF 4X6FA 5EO9B 2VXUL 3JWDL 4PJAB 4FG6D 5GZOC 5I16A 4P9HH 1QBLL 4KGJA 2JK5A 5MEPA 4KK9D 1CS6A 4ZYKB 4J4PD 5ENWA 5D1ZC 3BIBX 4XXCC 1X5AA 3P9WB 1N6VA 1DANU 2FJFB 2B5IB 3D2UD 4TOYL 3IJSA 3O8XB 4HT1L 5HDQL 1KLGA 4PP1C 1QBML 3MLPA 3MXVH 4WWKB 5C3LD 3NFNB 2W0PA 4G6FB 2DQEH 1EA9C 1MAJA 1X5JA 4O9HL 3FO9B 4PLNC 2YPLE 4G6JL 3BP4A 3FAXA 1FSKC 3RZCA 1EAPB 4LFHG 1BVZA 1FGVL 4LSSH 1C08B 5D93B 4F7PA 4W70A 5JDJA 3FQRB 4WV1A 1BVLB 4OLUL 3OKOB 4DQOH 5AZ2H 1MCHA 1RUQH 1IEBB 5EZOH 2AEPL 3BZ4B 4D9LL 2Y06L 1HYSC 4XPGL 2Y07H 4JO2H 4Q7DA 5DURD 4E42A 4MAYA 4JN1H 4RAVA 3DSFL 4LASL 4AIZA 1J88A 1RZ7H 3WUWG 1CFSB 1SYSA 2NX5B 4XBEH 4PR5B 4U1HB 2MCG1 4ENED 1JYNA 2AEWA 3SHSA 1N3NA 2DDQH 1MCRA 1NAMH 4TUKH 1QRNA 4GQPH 5MEOB 4LQ1A 1RZGB 4NKDA 3EAKA 5I1LA 4WU5B 1L6XA 1S9VA 3IB4A 1F5WA 3DUHA 5IB4B 4OCRH 4OZHE 3NH7L 4JY5H 2MQ3A 3BP7A 2BMKB 3CVHL 5J1AB 2F8XC 4O4YH 2WUBL 5GGVH 4ZFFB 3CVHB 1JF1A 2LQRA 1M4KA 2NXZB 4KAQH 3VWJB 5DRXB 1U91A 3FFCE 3KXFD 4QXGL 2GTWB 2V9TA 3ZSTA 1OAXL 4X5XA 4QCIA 3HMXA 3SQBA 5D7LD 2JELL 5TE6H 4KQ3L 4PJ7F 1N0XH 3MLVH 3ZLQC 2GSGA 4JAMB 2IMNA 1MIEH 4HJGB 1KG0A 1U3HA 1JPGB 3FHQA 1BGXH 2AJUL 4FTVB 1YYML 4HUMB 4ODSL 3L5XL 3WUZA 5KSAB 3TZVC 3LN4B 3UAJD 5D7JB 4WI3A 3N1GC 1CIDA 4OGXL 2NTFA 3MOAH 4OQTH 5AAMA 2ARWA 4ONOA 3CSYA 2JJVA 4OUOA 2NNAB 1DZBA 5IF0B 1T3FB 2H2SC 3FCTB 5FECA 3BRDA 1YPZF 5IVXA 5IWLA 2EDFA 4U0RB 4Y5YA 1AE6L 5D7SH 4ZAKD 3ULVE 5HJ3B 5M95B 5DC9B 3VD3A 4P2QB 1K4DA 3W2DL 2NXYD 1F42A 4GKSA 3VXRD 2GUOB 2KUTA 4KV5E 4PY7A 4KMTL 4Z18A 1MCCA 3P2TA 5JQHC 1FFOB 2BVPA 4U1KB 4L4VA 5ESQB 2FEEL 3ARSA 2DLEA 3BAEH 4YX2L 3B9KC 5CJQH 3VXQB 2D7NA 1T1YB 1NBYB 4XC3H 3RWHB 4AMKH 3STLB 2ATKB 1U8NB 1BM3H 1HQRA 1IT9H 3AXLB 3TLRA 4FOMA 2VLJA 4JM2B 1JTTA 2FSEB 1RUKL 4LSPL 3PL6B 4Y19E 4C4KO 3P4NA 3TA3A 4YO0A 1GGYA 1UB6A 3OAYH 5C0BB 1KTDB 1XGPA 2F8VA 4IJ3B 2OM5A 3D39B 1I1AC 3STZA 3ABZA 1A2YB 1NDMA 3BMVA 2VLKE 3HC4H 5I66A 4G9FD 1I1FA 4KC3B 4NDMA 3DTXB 3L3JB 4HWZB 2DQFB 4HIEB 4PB9H 5IB2B 5DC0A 3TCLA 1XT5A 1QR4A 5IVXF 1NLDL 4WTZG 3RPKA 1DQDH 2YN5A 4WW2F 1KJMB 1R3KB 4XNUH 1X4XA 1RHHB 4M61A 1G7IB 3WS3B 3ZDZF 4HHAA 1NGQH 3SPVA 1CGWA 5BZDB 1XMWA 2R1WA 3MBEA 1G1CA 4WFED 4AEEA 1SEBA 3IKKA 3SKOA 5DRZA 2HVJB 3T0AA 1DDHA 3VGAB 4RFOH 3MYJA 5C08A 1R3LB 3V0WL 4R4BA 4Y2DC 4ZSOB 2OCFD 4TVPE 5C07A 4ZPTB 4CMMB 3L3OA 1WIUA 1XF4B 1GRWA 1MWAH 2J4WH 3TJEL 2W60B 4LPYA 1SJVA 3IS0X 2FO1A 2BSRA 3MV8D 2DM2A 3SKUD 2J12B 3IGAB 5EORL 4KU1A 2C3GA 4CAGA 2GHWB 3ULUD 1SMAA 2NY3B 4AEFA 4ORZC 3SO5A 5I8CB 3DV4B 5D96C 4KXZH 1A7OL 4F7MA 1TJIH 4LCUB 1QO3B 3L3DB 3TN0C 5L8KB 2H26B 4BM7A 1LO4H 2VRAA 2V7HB 2YMXH 1XF3A 1VACB 1VEPA 2XFXB 3RUGA 2BDNL 1B88A 3FOMB 2RBLA 5D1QC 3A6BH 4LDOB 3WDHA 5DK0A 35C8H 3ARVA 5AYQA 4P9HL 4PV9B 1OT2A 3BEWB 1I7UB 4MQSB 3KPMB 5DHYA 3NZHH 3HI1B 3LB6C 1A6WH 4JRYA 4LHUB 1OGAE 1AR2A 2X44D 5GGRB 2Q7YA 3FRPA 4MZ2A 1JHLH 5F7WC 3T2QA 3MRIB 4ODTL 5D71H 3RA7H 1LP9B 1J0IA 3C6LC 2DQEL 5TH2B 2O5YH 4Z78A 2D03H 3RGVA 4M3KB 3X14B 2R2BB 1UZ6E 5JDSA 5DMIH 3O41A 1ZHLB 2ARJA 4XC1L 4LSSL 4FQJL 4ZFOL 5DMKB 3T04D 1GZQB 5DQDH 4YDLB 2BOCA 4ZFOB 5AZ2L 3TH2T 2AJ3B 2DQIH 5EZOL 3TBTB 1LO5A 4TSBH 2ZPKL 3TNNA 3BE1H 4P3CH 1BP3B 4MSWB 4PJIF 4LU5H 1AI1L 1V05A 4JO2L 1EXUB 1J11A 4X7FC 4RGND 4P2RD 1NBZA 1QOKA 1OPGH 2XZAH 3FT4B 4CL7A 3T1FA 1REIA 4EKXA 2PTTA 1PEWA 1P6FA 1RZ7L 4Y4KC 5FF6A 4IRSC 3BGMA 4XBEL 3CX2A 4YEEA 4DWHA 5TQ2H 1U8JA 4A6YH 2AJYL 1LDSA 3IDGA 2LU7A 3WIHH 4FZEH 4X6DF 1NDGB 2DDQL 5E8PB 3U30C 5KVDH 3EHBD 4L8SA 2HP4A 3IRPX 5EZLA 4EDXA 1NAMB 4H25B 4YXHH 5IUSA 4LNRA 2UUDH 3CMOH 5FYLD 1NCCH 3MRGA 4JY5L 2NY6C 2N4IA 3CX5J 5CKGA 3JV5A 1QSED 2YPKA 4NGHH 1FO0A 5GGVL 3LS5H 4HUWA 4KAQL 3VFPB 1FL5A 1T2QH 5DJ0B 5EU3A 5DLMH 3BPNB 4RFNB 3PWPA 1INQA 5TE6L 3ARGA 2ORBH 3SGEH 1WFOA 3FJTA 5HGDA 3HPLA 2LTQC 4OIIH 1MUJB 4FQ1H 2IAMA 3QUZC 1HHIA 4HG4J 3S35L 4DCQA 4OLEA 3PXJA 3SE9H 2EYRB 5JIIA 5JUEH 4JFPA 1J12A 4KI5F 1KXQE 3S98A 4OQTL 4JFEE 1JGEA 4PRAB 3A67H 4JREC 3N1MC 3QUKA 5A40E 3CFCH 2A83A 1ONQB 5DUMH 3MGTB 3QQ4B 2Y25A 4NN7B 1U95A 3S37H 4QRRD 4YC2C 5BO1H 1DN0A 2FD6L 3DMMC 4EI6B 3KPRD 3B9DA 3CFEB 3U0WH 3BAEL 1F3JB 2EEDA 3DHJA 2A38A 1OLLA 1OW0A 4JRXE 4HZAA 4AMKL 1JNLH 4RQQA 5FM5O 4JDTL 3LPGA 4YDVA 1BM3L 5E7BA 5EBLA 1JWUB 1WEJL 4R96A 3HUJE 3BWAA 1IT9L 3UCRA 4MGXA 1MFDH 3BVNB 5E5RB 3M17A 2ZJSH 1CFQA 3AUVA 1FPTL 5E8EA 5EFIA 2R8SH 3TT3H 3H9HA 3IDIB 1L0QA 4F9LA 2ZUQB 3F7YB 4U1SA 2WBWB 3VXUB 3I9GH 3BO8B 3RNQA 3BN9D 5EH1A 4ZPVA 3V52H 4NOFA 2EE2A 4MHHI 3HC4L 1KN2L 3IYLW 3QSKB 4WI2A 5C09B 3C5ZC 4U1MB 1IAIH 3VFSB 1DE4A 2UWEF 1HQ4A 4PB9L 4H8WH 4I0KA 4QGYA 4WY7L 1LP9F 4P2OA 3TBVA 1G9MH 3PIQA 4UUJA 5E70A 1BFOA 4NQVB 1NCNA 4QKXB 1DQDL 4Y0GA 1BZ9A 2A9MH 4LL9A 2VQTA 4P4KB 2GYSA 2J8OA 4NRXA 5ADOH 1NGQL 3MRKA 1AQDA 3O3EB 3F12B 4QTIH 1B4RA 3HZVB 1QZ1A 3VRJA 1EHLH 2YKLL 4HK3N 4AJ0A 3NGBB 1V7ML 4RMTA 3AAZB 5ETUB 4KDWA 3UO1H 2FX7H 1A7RH 4NKMB 4RFOL 3OKKB 4P4RB 1SJHA 2YA1A 4BA8A 1JRHI 4MQXD 1OP5K 3DV6A 1P7HL 5IOPA 3T4YA 3HS0A 1NGZB 4G6MH 3LDBC 5EG6C 3QUML 2DKUA 1AGCA 3UTOA 5BCAA 5ALBH 2Z91A 3RTQB 3QUMB 1BIHA 4JKPH 3WLBB 1MWAL 2J4WL 3HE7D 1BJ8A 2J3SA 2R2EA 4X0KB 1MWAB 1P4IL 4OLWH 3BUTA 3LN5B 4XMKH 5KW9H 1JGUH 3QUXD 2CGRL 5F9AC 1K8IB 2EYTB 2P8MB 3P0VL 1I1AA 4XNYH 4DUXA 2CIKA 1ZVYA 1GHFH 1EDQA 2YD8A 1NCAH 3OHXB 2VITB 5DJZB 4PJGA 3VXSA 4I9WE 5DJ6A 1GGBH 3GSNL 2DQUH 5BW7A 2FL5B 1A4KB 5D2LE 3L3IB 5FEBA 1RZFL 2FB4H 1T80A 3QDMA 5DT1H 5EZJB 1NGWB 1U8KB 1Z0MA 1C7SA 1LHZA 2XA8L 2YWYA 4LKXA 4Z7VF 3LKOA 35C8L 3RL1A 2YD2A 1UCBH 5D1XA 3NZHL 4U1NA 4BSJA 3KWWB 5I76A 4C83B 4MJIA 5LAXB 1A6WL 5DD1H 1EAJA 4G8FA 1IC4H 3PDOA 3HZMA 1OY3B 2DIBA 4XBPB 1JHLL 1ZOXA 3D9AH 4XWGL 1A3QA 2PTVA 1WCQA 3D85D 4HS6A 5D71L 3TO4A 4HFUH 3RA7L 5HSFA 1E4JA 2F53D 2O5YL 5T3XD 5E8DH 2D03L 4BK4A 5ADPH 2Z8RA 2ZSVA 3ZYZA 4HS3A 1RUPH 5DMIL 4PJHE 4DOHE 1T1XA 1NFDE 4ZOCA 2R56L 4I18A 3QIBB 2HRPL 2VL4A 3W9DA 1CD1B 3PGCB 2DWEB 3V7AE 5E8OB 4TSBL 3DRQB 3QEQD 3BE1L 2VDKL 1MH5B 3ARDD 1K2DB 5DVOA 4LU5L 1T7ZA 3PV7A 3KDMB 1CFBA 4QRUA 5F7DB 3T4AB 5AYUH 2XZAL 3GHBH 1EHNA 1SBBA 4WNQB 2BHYA 3TN0A 3THML 3P9LB 4JN2A 1LO0H 1Z9LA 5EBMB 4PRID 1Q9KA 1FVDB 4FHBD 1G7MA 4OZIB 4A6YL 4U1LB 4F37K 4LOUC 4A6YB 1D6EB 2OYPA 1KCLA 1FP5A 2VUOA 2YR3A 4PJBA 3TBWA 3VGEA 1GXEA 3CCHB 3WKNA 3QNZB 4GAYB 1HH9B 4MA7H 2ICWB 3E2HB 2X4QB 2VXQL 1BLNA 4JFDD 1MY7A 3RL2B 3JV0A 4ZUUA 5HYSG 5DI8B 3KPSA 3QIWB 4Q58C 5C0AB 1AO7B 4QRTA 4NKIH 2H32A 2PNDA 5BXFB 3LS5L 1ACYH 5SWSD 1T2QL 4XGZB 3GNML 3TF7C 1MFBL 1BMGA 5DLML 2MFNA 2RR3A 1ERNA 2VL5B 2EIZA 2ORBL 2VQUA 3MRPA 3I6KA 3U79A 5DEZA 1N2RA 5KVMC 3SDDC 1UM5H 5F89A 2AAVA 3FTGB 3WO3B 5LVEA 3SE9L 1KB9K 3VXTA 4U31A 1Y6KR 1NUDA 2GFBA 1Q1JL 2V5MA 2VN4A 3E6FB 5EIQA 4JQXC 1F58H 2GK0A 3QNXA 5T1LB 5GGQH 4NP4H 4QTHB 1BF2A 2IPUG 3FN3A 1Y0LA 3EFFB 4ZXBB 3A67L 2X7LA 3RVWC 4LBEA 4Z8FH 2CDFA 4MNGB 5MHSE 4OV6F 2E6QA 2AW2A 1U8LB 3O2DH 4CVZB 1AHWC 4NQEE 2JIXA 1EGJH 2G2RA 5DUML 2VJXA 2XT1B 1JN6A 4MQTB 4JZNB 4QXWA 5DO2C 5IM7B 1DBBH 2APBA 3O4OC 1C5DA 3RZCD 3MRQA 3NIFE 3S3PA 5BO1L 2UV3A 2YEZB 3LV3A 2VDNH 5F9JA 4FS0A 5CZVL 5L8LB 1NC2A 1HCFX 2PTUA 3VW3H 3MLUH 1XGTA 4CMHC 3E6HB 3ARUA 5JIKA 1HNGA 2F74A 4Z7WF 1HI6B 3I02B 4KWUA 4U49A 4U1JB 1OSZA 5GQBA 2ZJSL 1ZSDA 4UTBH 4Z0XA 2YOCA 1I1YB 1HILB 2R8SL 2KZWA 3ME0A 3TT3L 3UTPD 2B5IC 3R8BB 4NUGL 3AVEA 3O8XC 3ZL4L 3S37X 1F97A 4NO3B 6FABH 3SKNA 4QHKI 2Y7QA 1QRND 3I9GL 3K74B 3KJ6L 4YHPA 4MHHG 3MR9B 3V52L 2RFXB 4NYLB 4WW2C 3U46B 1IQDA 2X6MA 2VZ3A 5K59F 5AZEH 2DQGH 1HDMA 5D93C 5JHDE 4UAOB 4GRLC 1O5DT 3QDGA 4DGYH 2XY1A 3QWOA 2BNRD 3C09B 2BFVH 2X4OA 1S9WB 1CGXA 2A9ML 3GB7A 3DX9B 3LQZA 3MRFB 3MLZH 1JNHB 5H35B 4XHJD 1M7XA 3RWIA 4JFQB 5D2NA 4QTIL 1PKQA 2HJKB 2D7MA 2RAMA 4XNMB 2CDGA 3MRCA 3UTSA 4OF3A 5BS0B 3WKMH 2J6EH 2O61A 3IRZA 3UO1L 4YHNA 1U3HD 2BY2A 1A7RL 3JV4A 4M7LH 3HLAA 5HHNA 3QG7L 5EO0B 3QIUC 3H9SB 3HB3D 4F57H 3MLRL 4X5WA 2FX9L 2BVEA 5DC4B 4G6ML 2DBJA 2DYPB 3T8XA 3QPXH 4X6CF 2DLFH 3RVTC 1MCDA 2H3NB 4HLZG 5ALBL 3D5OF 3L95A 1P53A 3D25B 4OZIF 1U8PB 1Q0XH 3I6GA 1S7TB 4KHXH 5MP6L 3UTTE 3WS6A 3FQXA 4OLWL 2VDLL 4DZBA 2X9XA 4XMKL 1OQOA 5KW9L 1J9CT 1JGUL 2E9IA 4LLUA 3EJZD 2GITA 1CICB 1NCTA 4PJDA 2YA0A 3VWJC 1WZ1H 3FN0H 4KGLA 1HKLH 4EXPX 1TVBA 4LCYB 1J0HA 1GHFL 5FA4B 4BYHA 3UYPA 3BP6A 5TFSH 5DZNA 7CGTA 2WUCH 5D7LB 1EBPA 2DQUL 3OR7A 2HFEB 4MDJB 3OGCB 5I18H 1MFAH 2VLRE 2FB4L 4X4YB 4YHMH 2VC2H 1MELA 25C8L 4Z77A 3VFWA 3KG5A 5TF1L 1G6RH 4P5KB 2VLJD 5KS9B 2FIKB 4ZNCD 4H1LA 4N5UA 3TA3D 4U0RC 3K46A 2CLRA 2N56A 5AUMA 3T2OA 2NY4B 1YEJH 1QEWB 2Y36H 3LKQA 5FM8A 3ZTNH 4GKNA 3B5GA 4F33B 1DBAL 3V8OA 5KSBA 1ZVSA 2Z35B 3WN5B 2V5RA 2OTWA 3FRUB 5I8EB 4K7FB 2R0LL 1F4YL 2DLTA 4IRJC 4LSVH 1NGPH 2HYMA 4V1DA 5I75B 2IBBA 3E0GA 4YAQA 5ADPL 5ALCH 3GSUB 1P9MA 4PJFF 4PLKC 3I2CH 4M48L 4S0TD 2NR6D 5K9QI 1EPFA 4JCMA 2BCKA 2IANA 3MBED 4NJAH 3MGOA 4XTRC 5JOPE 1NUNB 4CJ1A 1I8KA 3I50H 1AD9A 4EXKA 2FRGP 3QDAA 3CK0H 5CEZD 1S5HB 3EO1A 1OF2A 2WIIA 3RWJB 2Q76A 3ARXA 5AYUL 4D0DA 4U3HA 3H42L 3B8YA 5C08D 5BZWB 3BKYH 1GGIH 2X89A 2BX5A 5HHOA 1DTUA 4LLQB 5C07D 5DFWH 2A73A 5FDWB 1K6QL 5DVKA 4BQCA 4PGCB 1TPXB 5L2JB 3NCJH 3UZEA 3RY4A 3M45A 4ZUVB 4PYHA 4GQ9H 1D5BA 4DEPB 5FYJU 3BKJH 1AD0B 5JPMB 5HVHC 2NY0D 1FYTB 1BQHG 1J87A 4JR9L 5DUBA 4NKIL 5HYQA 1MHCB 5DVNA 3CFJA 1BD2A 1ACYL 3OKLB 5KSBF 5E1HB 4EQ3A 3MFFA 1SEQH 1IGJB 2H1PH 4RRPG 1ZHBB 3PNWB 4POZD 4JZOA 3VFUA 4NRYB 3ULVH 3WLWC 2N7AA 3VGAC 4YHIA 3OKEB 2ADIB 4KI5C 1CXIA 4ODXA 3FL7A 1UM5L 4F80A 1DVFD 4J1UB 3A6OA 1L4IA 5ITBH 4NFDA 4I8DA 5TDNA 4ODBD 12E8H 2DTMH 3CFDB 3JV6B 2AEQH 1F58L 1FL6B 2EXWD 2P5EB 1F4AA 3RVVD 1BFVL 1R3HA 4JANA 5ANMA 3PJSB 3KPPB 3MV8B 3MCKB 2NY3C 4MB4A 1Z2KA 3SDAD 3O2DL 3U82B 3DYPA 4WHDA 1EGJL 2FATH 3NZ8B 5E8NB 1IEAA 4OZGB 3IVKB 5H94A 3NCBB 5ITFB 3GGWA 4Y4HB 3GSQA 1DBBL 2BP3A 1Y6NR 4M00A 1WWBX 2VDNL 3V8CA 3LH2L 5D6CB 1KUMA 3V6OE 4M1DH 3DX8A 3PABB 1CU4H 3GMLA 3VW3L 3MLUL 2VE6A 3SDCB 4I0PD 1PYWA 5DFVD 3LEXA 4APQB 4PJXA 4UOW1 5AG8A 2FWOA 5D7IB 5A2LH 1E6JH 2CRIA 1UZ8B 5D9SA 1T21A 3QQ3B 4JO4H 2IGFH 4M43H 4IDLA 4J3OC 1QFWI 3IS1X 5T1KB 5SX4H 4HUNB 5KSUA 1E28B 3UC0H 3ES6B 3R06B 6FABL 1SY6H 4N9GA 1YMMB 3BIKB 1HSBB 3VWKC 3DVNA 4QY8B 3CXHK 5GZOD 1BQSA 3L3HB 3MFGB 3QHFH 4ORGB 2E7CA 1VEMA 1K3ZA 4XCFL 1P1ZB 2DQGL 2MKWA 5JPNA 1S7QB 5E4EC 4DGYL 4OIBA 1HH6A 4HKBA 2Y23A 1H3XA 2P8PB 2BFVL 2HN7B 4B7IA 2ZOKA 4G8IB 4TVPH 4YH6A 2IBGA 5EC1A 1S7SB 3QG6B 3DUUA 3DO3A 1I3GH 1J5OH 2PCPA 1M05A 3P4MA 5GRZA 5IFHL 5HGHA 1MCBA 1Q9LB 2FLBT 2IBZX 3PWPD 3QBTB 3RY5A 4C56E 3O6KH 4Y16B 2I25N 2XTLA 3N50A 5BRZA 3WKML 1TXKA 4Z7QE 3GIVA 4LQFH 3GKZA 3LIZL 2UY7A 3Q6FA 4OGYH 2OI9B 1UJ3B 3EOYG 5F6HJ 4Y5XC 4F57L 1JNNL 4F7EB 4ZG1A 4XVJH 4ONFH 1JV5B 1JRHH 2ED9A 3TYFB 4L4JA 1HYSD 1MHHA 3QPXL 2IEPA 5I74B 2LVCA 2AABH 3VGGA 1RK0B 1DL7H 1QVOB 3L5WA 4FXGA 1EEZB 1KCVH 1Q0XL 2QSCH 4KHXL 1VFUA 3AB0B 4HLZH 3SEPA 1FNEB 4M5ZH 2FJFA 5ESVB 1JGVH 2XZZA 2X4RB 3MMEA 1IAOB 2PO6B 1OB1B 1LK3H 3EYUL 3K2UH 1HKLL 4WWKA 3MNZB 2VKWA 2E7MA 3NFNA 2BHUA 1F6FB 3BPNC 1R3IH 5J13C 4RFNC 3MV7D 5TGBB 1J1PH 3T77B 3KPNB 5TFSL 4M02A 2WUCL 1EAPA 1FQ9C 1DP0A 3BQUB 3FZUC 1C08A 3DETD 3JXAA 1E27B 1MFAL 3FQRA 4M7JL 3OKOA 4PJCF 3O81A 2VC2L 4YHML 3NIDE 3O3BA 3RHWK 1XH3B 1A14L 3EBAA 1QSFD 2FHBA 1G6RL 1OAKH 1WGOA 5EBGA 2E7LA 1G6RB 5HVFB 1DBJH 5IQ9B 3ARFB 3IAPA 2YPLB 5KVGH 3V7AG 1FNHA 6CGTA 3PQYE 1J1OL 1BFTA 1YEJL 2I24N 1WWAX 1CFSA 4OM0H 5IV2B 1AC6A 4PR5A 2H6PB 3S8WA 4U1HA 3VXME 4DAGH 1OL0A 1MRCH 4FQPA 3BD4A 4OCSH 3TZVD 5JOFA 5L0QB 4GAFB 1RZGA 3H3BC 4LSVL 1OM3H 4WU5A 3WD5H 1FZKB 2H2SD 5ALCL 5IB4A 5FA3B 2DJUA 3CFBB 5T3ZD 5K9QG 3I2CL 2B2XL 3LEYH 5C2UB 4KRPC 4M8QA 4QOKD 5J1AA 4Z0BL 4ZFFA 3CVHA 2KQNA 5IB5B 1P6AB 5KVEH 4G6AC 4KJPC 3PWVB 4LSQH 4BQBA 4LAQL 3I50L 3AC0A 4M6NH 2HFGL 5BJTB 3CK0L 4LARH 5IFAH 3NTCH 4S0SD 2OK0H 1IILE 1M1SA 1YY9C 4OZHB 2NY2C 4D9RD 3BKYL 1NC4D 3N0PB 4JAMA 2FECI 4HJGA 1JPGA 1TETL 2R4RH 4FTVA 5E95B 3CNKA 4PJ8B 5KSAA 3FFCB 5D7JA 3MZTA 2X70B 1MI5A 3C8DA 4MXVE 2AXGB 2HJFB 3NCJL 4K3DL 1DR9A 4JY6B 3S97C 5IF0A 2NQCA 3FCTA 1KEGH 1RJZB 4GQ9L 1A1NB 5T5NG 3BKJL 5J1TC 1I1AD 4P2QA 2YS4A 5FKPB 4I4WB 4K8RH 1P84K 2JJWA 3ECBA 5HYSB 5J56B 4WEBL 4N9OB 1DQMH 3UP1A 5E5MB 1C1EH 1SEQL 1ORSB 4A2MA 1G0XA 4NWUH 4UZGA 1NANI 2IQ9H 1FFOA 3ULVL 5BQ7A 4LEXH 4ZFZB 4YXLH 5ESQA 3GRWH 3QDMD 4DZ8A 1JK8B 3MRHB 4PTTB 4X8JB 4XPBL 3WDIA 3RWHA 3WFHB 2ATKA 4PREB 3CMGA 5CJXA 4HGWB 5ABDE 4RMRA 2IH1B 5ITBL 3AXLA 3IJYB 1UENA 2AEQL 4HUXB 4Z76A 4JM2A 2C7UB 2FSEA 4NSKB 2G9HB 2BK8A 3CZFB 3PL6A 4JVPA 5C0BA 4B50A 1EZVY 5FK9A 1KTDA 3F6IA 3D39A 4Y4FB 3TO4D 4GRWF 3F7VB 1A2YA 5IT2H 2B39A 2FATL 4U1IB 4BKLB 1FFPA 4M7ZC 2VXVH 4FXLA 4WUUA 2AJZA 4PLJD 4X6BB 4EUPG 3DXAD 3DTXA 4Y19B 3L3JA 4HWZA 2DQFA 4HIEA 2E6JA 4P48A 3O6FB 3L1OH 1NBVH 4KTYA 5CUSH 4OUUB 2DIAA 4OAWA 1R3KA 1D5IL 1RHHA 4KKAC 4KRNA 3WV0A 3QXVA 2VLKB 5BZDA 3QPQC 1HSAB 4P3WA 4HWBA 1SJEB 4N8VG 4R2GB 4Y5VB 3SDYH 1RK1B 4XX1G 3RKDC 3TN0D 1E6JL 2DI7A 1X44A 4QWWC 2B8OT 1XCTA 4JO4L 2IGFL 3BRGC 1PG7H 1FN4A 2HVJA 3OBAA 4L1DA 2W1NA 2BZDA 3MRBB 3UC0L 1EH9A 3ZDYE 2X5PA 4ZSOA 1SY6L 4YDKL 1KPRA 4PY8I 2XN9A 1VGEH 5D1QD 2X05A 3ZYIA 4GRMB 1QSZA 1KTKE 1TTFA 1C7TA 4ZPTA 4CMMA 3LS4L 3SE8H 1XF4A 1ITBB 4F7TB 4JZJB 2V2XA 3KPSD 5IW1A 1PLGH 2CSPA 3ZKNC 4IMLA 1ZMYA 1SM3H 1BVKB 1IM3B 3QIBC 4L9LB 4MCZA 1HEZA 4N0CC 1BAFH 3S34H 3IGAA 3P40A 4TPRL 1YPZE 3U7WH 2EC9T 4XWOD 3X12B 4QXTB 3BW9A 5I8CA 2YRZA 3C6LD 3Q5YA 1LK2B 3DV4A 1F4HA 4U6VH 3V95A 4LCUA 3L3DA 4EDWL 4HZLB 2H26A 5DMGC 4HKZA 4LQFL 4OFYA 4YNYA 3ZE1F 3NABH 1YUHB 4OGYL 1VACA 4OJFH 4PRIB 5KJRH 2XFXA 1A02N 3G9VA 2VWEE 4U05A 2GAZB 2HA1A 3GUTA 4XVJL 1RAMA 1JRHL 4U33A 5DJ2A 2OL3L 4PV9A 2WQ8A 3BEWA 1I7UA 3KPMA 2OL3B 3HI1A 4X7CC 2Z31A 3SKJL 3QIWC 5LQBH 4CN4A 1FJ1A 1KCVL 2QSCL 2Z92B 2XWJA 1YJDH 1G1YA 1JE6A 3P77B 3Q1SL 4M5ZL 5GGRA 4YDJB 1I3RB 3KYNB 1T1ZB 3MRIA 1LK3L 2X4TB 1HWGB 3K2UL 4RGMB 2ITDB 1R3IL 1K4CB 1J1PL 4HKXB 2R2BA 1BIIB 1P7QA 5CIPH 1MAMH 1VKXB 2XWTB 3T3PE 1OGAB 2NY6D 4P5MB 5DMKA 1GZQA 1Z9MA 3CSBA 5IHZB 2X4SB 2DLHA 1CXHA 2AJ3A 5EUOF 4HMDA 5CZXC 4QT5B 5JW5B 3RJQB 1WFUA 3TBTA 1PX4A 5IVXE 2NW2B 3P0YH 3O11B 4PJEF 5GRXG 5EULV 2AK4E 1A9BB 1OAKL 4MSWA 5JHLH 1OARH 3TPUB 1EXUA 3AU1A 1P69B 4GW1B 4GXVH 3S88H 3FT4A 2OJZH 1TZIB 4JFZH 3CH1B 1B90A 4X7EC 1MCLA 2AEIT 4KV5F 4P3DB 4HC1L 4GMTH 5KSVB 2RHEA 3LCYA 1JZ8A 5D7KD 4DAGL 5CP3A 4YGVB 4HUVB 4L4VE 3EYQD 4OCSL 1NDGA 3HAEG 5E8PA 4ZFGH 1JPTL 2X1OA 4WTWA 3QDGD 3VD7A 3P73B 1W0YT 5E6IA 1RJYB 3QCTH 4H25A 4QHNB 5FYJE 5B39G 1OM3L 3WD5L 4HWUA 4MS8C 4CNIA 2FNBA 2FHFA 3CLEH 3LEYL 4UNUA 3UTQB 1G7LA 1S7UB 4L3AA 3AY4A 4NZDA 3RWDB 1L9NA 4ZTPL 3SGKA 3UTZA 2P5WD 3ARBC 5TQ0H 5C6PB 3CU1A 3VFPA 1BQUA 4ODUB 1ZA3B 4LSQL 4HXBH 5DJ0A 5DJYB 1UM6H 1XFPA 1KEMH 3H3PH 4D8PB 5IFAL 3DGGB 4JG1H 5F8QC 2OK0L 4P46C 1YEGH 2VSDA 4KKLD 4XMLL 1LD9B 1I9JH 1VFBB 4NQCE 4N68A 1MUJA 5E94A 4HF5L 2R4RL 1VB9A 2EYRA 3RDTB 3O9WA 3EYOB 4MNQE 2HKHH 3CVIH 3B2UC 3BJ91 4H8WC 4PRAA 4XMPH 2BNRB 1G9MC 4UTAH 5KN5B 1J18A 4P23A 2V9RA 3CH8A 1KPUA 5EZIH 2J8UA 2OP4L 1X9QA 3DSNA 3MGTA 4LHQB 3QQ4A 1MF2H 1ULVA 1DUZA 1TZHB 2CKNA 2W91A 2WBJB 2ZNWA 5C86A 1IGYB 5GS0D 1TVHB 3LRHA 3FFDB 4JFEB 1DQML 4O2EB 1U3YA 2Y5TA 1XF2B 1BQHB 4X4MA 3SGJC 3QJHA 2H8PB 2IQ9L 3LKSA 1KIQB 4YXLL 4NQUA 1CLYH 1B0RB 5F1IB 1B0WA 3GJEB 3MRDB 4OZFG 1MCOH 2XV6B 3BWUC 4HUKB 3G6JA 3QHZH 1QBBA 1JWUA 4TRPH 1F4XL 1E4XI 3BVNA 3E8UL 1F2QA 2D31B 2XQBH 2CRYA 5DTFB 2K1MA 3ARQA 3WNOA 4NKOB 3MROB 2NW3B 4PJIE 5JO5B 1CICC 4JRXB 4KJYB 1UWEL 1GH7A 4QLRA 1I3UA 3CLFH 3F7YA 5CLTA 2JE8A 2XZCL 5FXCH 1I8MB 3VXUA 2XTJC 1JZ5A 5IT2L 4JFHD 3KLDA 3S36X 3HUJB 2UYLA 2VXVL 1YY8A 1OAZH 4Q2ZB 5C09A 3SCMA 1LEKB 3MSPA 4Q6YA 4U1MA 4NHCH 3VFSA 3PG2A 3IDJB 2O5ZL 3W11C 1ADQH 2P43B 2IAND 4K9EL 1NBVL 3QI9C 5J8OA 3BPLB 5CUSL 4NQVA 5FO8B 4NCC1 4P4KA 5LCVH 3F58L 4I2XA 2J8UF 2IG2L 5GSVB 4JRYE 3O3EA 5C0CE 3ZYJA 3F12A 2EZ0C 1JMXA 4QRQB 4N8CH 3SDYL 1FIEA 3EYVA 4QRSB 2NY4C 2X89D 3G5VB 3AAZA 5ETUA 2QKIB 5HHOD 3M07A 3GMNB 2X4NB 4NKMA 5D72L 3FQWB 3OKKA 5ID1A 4M5YH 3OAZK 4M6MH 1QFWH 2VZOA 3DROB 4L8DB 4ZQKB 4J6RH 1FE8H 1A4JB 5EU6D 1NGZA 3QXAB 4OD2A 1INDH 4HUUB 2VKXA 4AH2B 3S96B 4OSUH 1MJ8L 3QFDA 3RTQA 5HYJA 3QUMA 3WLBA 2IQAB 4B0MM 3QO1B 8FABB 1PLGL 1SM3L 4FFVC 4HH9B 4OF5A 4KI5E 5F3BB 5IGXH 3LN5A 4R4NC 2R1YA 1BAFL 1NAKH 1NFKA 2ICEA 3RVUC 1C16A 2P8MA 3LHPH 3MACH 3U7WL 2FIRT 2M1KA 3JWNC 3ZKMD 3QXDB 3LKNB 2YUWA 5I0ZA 1PG7X 4PBVC 2J8HA 4U6VL 2GJZA 4ZDHB 3OHXA 4GBXB 4WI7A 1NL0H 3U7AA 2VITA 5DJZA 3BGAA 2Y4SA 1XCQB 1F2XK 2EDHA 1WWCA 1A4KA 3NABL 3GSNA 4PRHA 4F3FB 5EZJA 4DGVH 4XHQA 4M4PA 3EIFA 3QO0B 4HCRH 4OCWH 3MUGB 5HHXH 3HFMH 2HLFC 5GJSH 3O6LH 3X17A 3WO4B 4DEPC 3KWWA 1I8LA 4C83A 5LAXA 1T5XB 5D2LB 4P99A 1LQSR 2WMPA 1YJDL 1K3IA 3UJIH 3O0RL 4RDQF 3VGBA 2EDWA 4LSUH 3AS1A 4TNVK 1MCQA 5D5MB 3WCYA 1G7JB 1WBYB 4DUWA 4ODWA 1T4KA 3WE6A 2PXYA 3BXNA 1LEIA 5I73B 4WI6A 3H9YA 4CVUA 5CD3B 1MAML 2VZUA 1AGFB 5EU7C 5CIPB 4LAJH 3H0TB 5KAQG 2NMSA 1KNOB 4G6KH 3UJJH 2UWEE 3U7YH 3MJ9H 1M7DB 1I8IB 1TJHH 3FN9A 1CD1A 3D3VD 3SGDI 3PGCA 2DWEA 2FR4B 3DWTA 3P0YL 5CSBA 1MH5A 4V2BA 5JHLL 1K2DA 3RP1A 1OARL 3QA3B 1JYVA 1NMAH 5KVFH 1XGYL 3T4AA 3BH8B 5C0EB 3S88L 4PJHB 4DOHB 4M93B 1NFDB 3MPCA 4G80B 3A6CH 3P9LA 1YN7B 4LLDB 5C92A 1N6QH 1FORH 5EBMA 3NACL 2PN5A 1FVDA 4MA3B 5DQ9B 4G43B 1NEZG 4DN3H 4G42B 2V2TA 4Q9QL 4Y4HC 4A6YA 1D6EA 5HI4C 4BH7A 4MD0B 3ZTJH 1FVCB 3WUWA 2LVEA 3QNZA 5FCUH 5F88B 1HH9A 2EXYC 1KIRB 3QCTL 1CT8A 2ICWA 3KS0J 5DR5H 1LE5B 1IZJA 2HTLC 1VERA 4U1GC 3TESA 3SDCC 3RVWD 3QIWA 4D0BB 2NY1D 3KYMB 3CLEL 5C0AA 3HZYB 5IKCB 5BXFA 2AV1B 2P4AB 5DO2D 4EI5B 1UACH 5D6DA 3KPOB 5TQ0L 5M94B 4XI5C 1ND0A 4G8GE 4TUOB 5BRZD 1OP3K 4JG0H 4XGZA 1KEML 3H3PL 5CD5C 1RV6X 3P3YA 3BKCL 1FNFA 3UJTL 3WFDL 3SE3A 4JG1L 4OCXL 2XXMB 1MJ7H 2QQQA 2VL5A 5A16B 1I9JL 4BSVA 1KIUA 3TJHC 5TE4L 3FTGA 1NJ9B 5FYKU 1IGFH 2DMKA 4R0LB 2HKHL 1KENH 3E6FA 1RQ5A 4PB0H 3LAFA 4KUZH 4KUCF 4WW1A 5IEKB 4QTHA 4Q9BA 4Z7VE 4ZXBA 5D1ZB 4XMPL 4KDTA 5E2WH 2I9TA 4PRPA 3VXOA 2P49B 1T22B 4KY1L 1B4JL 4L29B 3O8XD 4MNGA 1QHPA 4MJ5B 4NNXB 1XR8B 3C60C 3KPQB 4S2SA 5I1AB 1D9KC 5EZIL 1U8LA 4POUB 4WWKD 5MI0C 2BSTB 3CDCA 4G6FD 1MF2L 3B5HA 3ET9F 4JZNA 5IM7A 3GSRB 4FQLH 4YHKH 4K7PH 2ADFH 4Y16C 2R1XB 5DD6B 1OOAA 1FSKB 2YEZA 4F58H 2OI9C 1UJ3C 3P4OA 1CLYL 1NANH 4R90H 2DQHH 4XRCB 1KT2A 4O02H 5HVGB 1MCOL 5B38G 3K0WA 3K3QA 5EC2A 5I74C 3QHZL 1K9TA 4JJHA 4TRPL 1HI6A 2DM3A 3I02A 3OB0H 4LEOB 2AVGA 4U1JA 3VE0B 1U8QB 2XQBL 2BSSB 1KFAH 1I1YA 1FNGB 1HILA 1QPPA 1ETZB 2NX5D 4YIQB 3WFEL 1CE1H 4F37F 4P0DA 1AIFB 3B9EA 4NO3A 5LBSH 3CLFL 4PJ9C 4WI5A 5DWUH 3CDGB 1FIGL 4PJGE 3VXSE 3MR9A 4TTDD 1ZHNB 2RFXA 4PBXA 3U46A 3RVTD 4M62L 4N0FB 4X98B 5E03A 4XPFH 5E2UH 3PP3H 4NHCL 2B4CH 2EECA 1A6ZB 1HHKB 3VG0L 4CU8A 4OFVA 2CRZA