4F20A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
331
structure length
331
Chain Sequence
AKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGSADGDSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion/cytokine
molecule keywords Clumping factor B
total genus 83
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A02
4B5ZA 4B60A 2F68X 4FJ6A 2RALA 1N67A 4F27A 4LE8A 2Y7LA 1R17A 4LEBA 2YLHA 4F1ZA 4F24A 5IHWA 2Y7NA 4JDZB 1R19A 4JDZA 2VR3A 4LEEA 4BBWA 2F6AA 5CFAA 3IS1X 3IS0X 4MBOA 4F20A 4Q6KA 3AT0A 4RMBA 3ASWA 3V10A 4MBRA 3IRPX 2Z1PA 3IRZA 2Y7MA 3AU0A 4JE0A 5CF3A 2Y7OA
chains in the Genus database with same CATH superfamily
4JJHA 1A7OL 1P1ZA 1SJHA 4NQCA 4W9FC 5E51A 4QEGA 4WDIB 1DN0B 2DL2A 2P1YA 5C7XL 1M1SA 3EYSL 3CSPA 3LEXB 3VXSA 3J27A 3UTTA 1ZSHA 3LDBB 5IJVB 2HJKB 3C8KB 4JFOA 1Q9OA 4QXVA 4KY2A 3EOBB 5DJYA 4AIOA 2AI0H 5LQBH 3DGCR 3GSWB 3QWOA 5ADPL 3WJJA 4NP4L 1T0PB 4Y1AD 4MCZB 4F9PC 1KB3A 2WBJC 3JV4B 3JV6A 4FNQA 3ZKMD 4NRXA 4CA4A 5A2FA 2Y0SA 1U8MB 1PZBA 5I15H 2UYLA 4RWYL 1ZCRA 3RFZB 4NERA 3NIFB 4O02L 4O2FB 2B0SH 2FD6L 5KSVB 1V54B 2D03L 1CDUA 1U41A 1PU0A 3S9DB 3CFJA 3EOYG 3S48A 4DK3A 4GSDH 2A74B 5DVOA 3F5WB 3BAXA 3MLYL 4FMKA 4HQQL 3MXWL 3WSQH 1BF8A 3V6OA 4UV7H 1DCEA 1UUNA 1NGPL 1BOYA 1MIMH 3BUIA 3L81A 4PSPA 2VDPL 2CCVA 4XHJC 3GMMA 4QTIH 1P2CB 2OYKA 1ZRUA 2OMZA 2P9RA 4FI6A 2V33A 5CEYB 3MJ9H 3UJTL 5IJDC 2FJFA 4IU2A 4YHLH 2ZAIA 3EBHA 1HCYA 3FYEB 3LMJL 5JHMA 1G84A 4CGUB 4X0KB 3ZO0A 4C4KT 1XGRA 4NBYB 4HWBL 2DQDH 2BHZA 2UYLB 1R5IB 2YKLL 1CGWA 4A6YB 1MSPA 2EDDA 4F7MA 2EDQA 4KITB 3DSFH 3NCFB 1FF5A 4ZTOL 4MNQB 1D9KB 2CHNA 2CIKA 1WD9A 5FYLH 5AD0B 4AV5A 5GS1C 2HFEA 3D06A 1RHHA 4HPYL 4I0PC 1V3JA 5GISL 1WFTA 2XNAB 2E8YA 3HHSB 2G4GA 5DZPA 5DJ0A 4BV1A 2OYMA 2HUEA 3ARQA 3PGDB 3UTTD 4ORZC 4KXZI 5C0BA 3AU0A 4R4BA 2DM7A 1DVUA 4YQXL 5FGBC 2XWTA 1ZHLA 3VFTA 4G9DA 4PJXE 3ZIYA 4KK5C 1PNDA 1S7XA 4ZFOL 2BC4A 3WO3B 1IBGH 4P0DA 4U0QB 3IDGB 5DK0A 5HYEA 1S7QB 1OARH 3MNZB 3FB7A 1BZQK 3SGKC 2H5UA 4OLZL 2W59A 2YMXH 1NH6A 4L1HA 3CUPB 3AW5A 1KCVH 4X7EC 5CNHA 4AM0Q 1QRNB 3IS0X 3NZHL 4KAQL 1O9WA 3HR5A 5EU5A 3W5NA 2YARA 4HBCH 2RQEA 4KUZL 4LSSH 4UV4H 3FT3A 4NO5A 3LQAL 5J1TC 3WCYA 4JQXA 2BXZA 1AXTH 1IIKA 4M7LH 2H6PB 3CCHB 2DJSA 4GAAA 4J6IA 3TCTA 2AJ3A 3ZRCC 4YK4B 3CFCL 3BE1H 4QHUA 3PQYB 5DZNA 3ARBC 3ERXA 2VMCA 4UZSA 3FU9A 1EFXA 2R7EA 4G6JL 1SNRA 4WFGD 4XH2A 4BQ6A 5GRZA 2AF2A 4Y2DB 4ZO7A 5LBVA 3SE3A 3TASA 1ZLEA 4AEHL 1LO2L 2YAEA 3HKZA 4UB0L 2OL3B 5D71H 1WAEA 4N90E 5D6CB 5DJCA 2NCEA 1H8SA 1N5YL 4PMFA 2HT4D 4LRNH 1M2VA 2V17H 5IWLC 4F37K 3V52H 5SWQB 2NY3C 4P46D 2ENQA 2WGNB 2XV6B 1C8PA 3QDGA 5LKNA 1IC4L 2J72A 5C9JA 4L3FA 4O9HL 1DVFB 3QCTL 1XAKA 3R0MA 1A3RH 1LO0H 3CCHA 5D2LE 3T4YB 3QG6A 4Y9CA 5KBLA 5AW6B 5FO9B 1EGJL 1QI5A 3K71A 1LL1A 1S9WB 5B3NA 2FHFA 3V10A 4X99B 1KT2A 2WZ5A 1NMAL 1UM5H 2I25N 2VWEE 1JHLL 1XXDC 3CU1A 4IRJB 2NR6A 4MHHI 4ZSOB 5IJCC 5FYLD 4D8PB 4DVRL 1NFDA 4PJEA 1E42A 2OTUB 2ZOKA 1RKRA 2EYTB 3HE7C 6TAAA 3WYRA 4ZZFA 4QMEA 3GGWB 3GXUB 4AGNA 2R0ZH 4M7JL 4AGMA 5KSUA 2AQQA 1U3HD 3US1A 3OJDA 5T3XL 4WW2F 2PR4H 4P5TB 4AUYA 4PWEA 3BRGC 5EZLA 2ATKB 4LVOB 4ZFGL 2O72A 1X9QA 2JJSA 1M7DA 3S3PA 2RR3A 4XOCA 1IGJA 4AYGA 2OCJA 1WFJA 1KNOB 3ARFD 3QUZC 2QEJA 4PW3A 2RCSL 4WW1A 3ARFA 3L16A 4HETA 1JD9A 3H2WA 3HMWL 4PPTA 2Z0UA 3EJJX 2DM2A 3T8MA 1CT8B 1J1PL 1FN4B 4UWQB 5C0ND 2J21A 2MNJB 3E8UH 2FUQA 1P4UA 1MHPH 3MOAL 2BIHA 3HMWH 5D8JL 4FYTA 3B7SA 4FLHA 3SYAA 5F3BA 1FLRH 5EORH 3LIZL 3Q05A 1HE7A 4V1DA 3OAUL 4N2AA 4PCKA 4FTVA 1HXKA 5KJ4A 1GSKA 1ZTMA 1QVOA 2AXFB 5D7LE 2IAMA 1A9VA 4HKZB 3V4LA 1REIA 3PP3H 4FZEH 4HHAB 1WBXA 3CHOA 3MRFB 1J12A 5INCB 1JPTL 2DMKA 5EUOE 4Z3EA 5E70A 3UTTB 3N0PB 4TSBH 1AKJD 2GHWB 3DX4A 2ZOTA 1A6AA 3ZTDC 5A2JH 4XCEA 1EMTL 5AWNL 5CJXA 3L9BA 4PRBB 1E4XI 4WEBH 1BP3B 4PW4A 3RAJL 4AT6A 3RVTC 1VFAA 5FYKH 2JIXD 5AKVA 4L4JA 4Y7OC 5ALCH 5FF6B 3UGXA 3WY3A 1JWUB 4KO6A 4DKAA 1NMAH 4NPJA 1VF5C 2GIMA 4M43L 2E7CA 2XQYA 3MA9L 1BYNA 4QXWA 1GPOH 1FNHA 3N91A 2OZ4L 1XEUA 1U6AL 4XCCL 3DO4A 3BEWB 2HJKA 1J0ZA 4JFOB 4BCZA 2XJKA 5L8KB 1ZVHA 3FTGA 3ZE1E 2ADIB 3HE7A 1HC1A 4TLUA 4P9HC 1NJ9B 4S11A 5KVEE 5JPMA 3JVGA 4DN4L 1AGDA 3ARGB 3S5LG 3L3OA 1X4ZA 3FTSA 3ZTNH 3G6JB 1ND0A 1F11B 4Y7MA 3V52L 4QJ5B 4C47A 5FK9B 2QT6A 3VI3F 3WS3A 1EHKB 4KJQD 4RGOH 3E3QE 3N04A 2OXHB 5D93C 4I13B 4N9GB 4KOCA 5TE4L 2DLGA 1X44A 4WCYH 3ML8A 3UZVA 1V3KA 3L4VA 3WTVA 1AOZA 2MCAA 4RBPK 1IGCL 1XF4A 5EFIA 4GB9A 5JOEA 1J9TA 2YRPA 1QYGH 5E4EB 3VXNB 4JG9A 3SKNA 2AK4E 5B8CC 4E9SA 3GDBA 2K6YA 2HFFA 1B2WL 1Q94A 5LXGL 1WK0A 5DZLA 1JWMB 4OFDA 1RULL 3L3IA 1DFBH 4G80B 1JHTA 5DSCA 3SE3C 1JNLH 4TSCH 3S3BB 4B41A 1LHZA 1EHLL 4DP5X 1BEYH 4WJG3 3JV0A 5E2TL 3BWZA 3WN5C 4OKDA 1KCVL 1KV7A 4I18A 1M05A 1V7NL 2GIXA 1X7QB 3IMWA 3GMPA 2ZQKA 1ASOA 4RMQA 4X9FA 2WSPA 4R7LA 1KBGH 2E76C 2EUXA 2Z8VC 3ARED 4AQAA 3QQ3B 4FS0A 3I02B 3KHQA 4FCAA 4HGMA 3RWFA 2ALWA 3ZLQC 2VDQL 4GXFA 3QXTA 2GBAA 2OMUB 5DZ9A 5IKCA 4X80L 2DF3A 1BJ1J 1NGXB 4XP1L 3BISA 4U1MA 3UAFA 4X50A 5IB4B 3MJ8A 4Z95L 3HBQA 2AV7B 4OM1L 2CO1A 2A4ZA 1I3GL 1QATA 1N2RA 3K8LA 1TJIL 3G5WA 4NYLB 1N70A 1GGCL 1S9VA 3G9VA 4FP8L 3OPUA 3RNKA 5FCUL 5B21A 4NRYA 2QSTA 4QYOB 1ZLUK 4FQ1H 4RMVA 2L04A 2DN7A 3DJSA 1BYPA 1TMQA 2DYPB 2ICWB 3QO1A 5TE6L 3TFKD 2PR9A 4MQSB 5KYXA 4ZYKA 1KPVA 1IJNA 2C9RA 3KYMB 3QC5X 1J9RA 2W9EL 4QKXB 3B3BA 1H5BB 4AC4A 2GI0A 4ZUTA 3LRMA 4ZX4A 1UWGL 4WFFE 6FABL 1AIFB 4W9IC 4UV7L 1ZS8B 1FAKT 1G7MA 3EJYD 5FO2A 4JFEB 1TKWB 3UBXB 2Q5BA 1JGEB 3HS8A 3TEXA 2XWXA 3U0TB 3TLRA 1A2YA 1D5BB 5J1SC 2NSXA 1DE4A 1OAUH 5CGMA 3CVHH 3HAEG 3FT2B 5E94A 4O02H 3SKMA 4ALAL 4MASA 5GS0D 5DRXA 4OV6F 1JDDA 1EEYB 1NFAA 3O8XA 3HS9A 3N1FC 4XOEA 2DIEA 2GSIA 3GSRA 4S10A 1T2XA 3BZDA 4K3HA 1BFVH 2ITFA 3DLQR 1NMBL 1KG0B 1XCQB 5JNYA 3EYUL 3C2SA 3V0VB 2JJTA 4JG1H 4JQVC 3KPSE 3EYSH 2NXYC 3D33A 4GFXA 2Y6SD 4OFQA 2KZ1B 4U49A 4X7FC 3WTUA 1AGEA 3PP4L 2HT2D 4LEOA 2WBJA 3HBPA 3QZLA 1HHIB 3FYIB 1KXQE 3V5DA 4EI5B 2MWCA 4B9GA 4Y5YB 5F0LB 2P5WE 1TENA 5EULV 1SN5A 3OJVC 5ECGA 3UAJD 3ZL4H 2ROXA 3HS0C 3BZ5A 2C3VB 4G8AC 4R2GC 1JHTB 1BJMA 1OSYA 1RIHH 4KVNL 1IC7L 5C6TL 3G5VB 1E9OA 3O3DB 4J3XA 4EVNA 3MRGB 1W72H 4L37A 1F3JA 3TA4D 1UD2A 5CLZA 1P0SE 1PLCA 4A2HA 3BAIA 3HZMB 4D2NA 2NR6D 2L0DA 3CPLB 4KQ3H 3UC2A 1AMYA 2WVVB 5I17B 4MFHA 3D48R 3CDZB 2WKOA 4XX1E 3WHXA 5MEND 4P5RA 5AVUB 4S0TD 5JORB 4M4RA 3QFJA 3QUYC 3SDXA 3VFWA 4G80A 3WKML 1K4CA 4HJ1A 4HS3A 4WI0B 3RGVD 1OW0A 2HRPL 4ODTH 5FDWB 1DCLA 1YEWA 2IOIA 1NCWL 2BRRH 3GHBH 4XMLH 1AIZA 1CGSL 5CJXC 3O2DL 5FO8A 5A6MA 5DUMH 3UZQA 4G83A 4U3SB 3T6XA 2X1PA 3BWAB 2DLTA 1EUUA 3FTYA 1LO4L 3EJYC 5AB1A 5CWSB 4A7TA 1MJUH 5K1NA 1B4TA 1I1AC 3SY0A 1G6RB 2VLRA 2DIJA 3CNKA 5CINL 2VDPB 1SN2A 2Z91A 1ETA1 2WQUA 4YFDB 4A66A 1KN2H 5D5MA 1A6TA 4YIQA 1NMCB 2GTZB 2R0WL 2JCWA 1U36A 2B08A 3A0OA 3H4FA 2APBA 4QOKB 1WBZA 4G1MA 4U1IA 3DVNB 5AVTB 5AAWA 4KTGA 3CDYA 1RZJC 1E5ZA 3B9KC 5AW1B 1U8JA 1WAAA 4DUVA 3HG1D 4RDQF 5D1XE 2F53A 2ZKMX 5GGSY 4Q89A 1NICA 2GC4C 3DMMC 4P5KA 5I0VA 1FDLL 3PGCA 3PHOA 4FXGB 4XBPB 3OGOE 5C86A 2EVFA 4YVUA 5FYJD 3FN9A 5DLMH 2W9DL 2XN9D 3F58L 4Q6YA 5GS1A 3FRPA 4CW1A 4FHKA 1EVUA 2CQVA 3C60D 4F8PA 3B2DC 2OBGA 5J06A 4EZMA 3KYNB 2NRDA 3LPFA 4IDJH 4F5CA 5IMLA 5AOZA 2IQAA 4ZW7A 4OIIL 2NDFA 3NUKA 4K7PY 3BT0A 3LN4A 4NFCA 4CBZA 4ZPTB 4V1DE 1T83A 5EIIA 3QJHB 5C07E 1BLNB 1O6SA 1SOSA 3NTCH 1WVZA 3ZOAA 2BVQA 4XPTL 4F33A 3E3QC 1CK0L 1WTGT 4YSQA 2D4FA 4J8RB 3DXAE 2Z31B 4HDIB 4NGHL 5INCA 2JI3A 3O6FC 1MF2L 3CXHK 1JPST 2NR6C 2COVD 3WKPA 4Y1AB 4AH2A 2AXFA 3Q5YA 4FHBD 4LCCB 1NGZB 3GM8A 2R2EA 1UCBL 4LESA 4OU3A 4XE0A 3VXRA 3KYOA 4H1LH 2V0AA 2V5YA 3O41A 2ZKYA 4MBOA 2FZ3B 5DJAA 1JZEA 4KK8C 5IESH 2P24A 3O0RH 2JKXA 1U3HC 4WHTA 5C0CB 2OS7A 5LCVL 4AKPA 3PUUA 4B9IA 3GK8L 3QFGA 1KGUA 4BKSC 3Q7JA 1YMHB 3G9AB 4W4NA 1KCUH 1NPNA 4ZTPL 3MBEB 4XO3A 3O9WA 4O2EB 3F7PC 1VB9A 3JWOH 3FFCA 4Q97A 1C12A 4K15A 5T5FA 3IWUA 1C7TA 1U8CA 4KHTL 4PRDA 4PVLA 3B2PA 4IRJA 1RIHL 2WVUA 1NIDA 3MCLH 4R2GD 2EYSB 1KWGA 3MNWA 1S9WA 4RA0C 5I75C 3NVQA 4UIMB 4AEIH 5C0NC 1N6QL 3ARDC 4BHUI 1LDSA 4EN3A 2VH5H 3Q2NA 1FZMA 4HF5H 3KLQA 5JTWA 4YDJA 5L4IA 4S2SB 5E08H 4BD4A 4JZOB 4NWUL 4Q6IB 5CD3A 5KS9E 2A83B 1FO0L 4I48B 4ELMB 4MB4A 3WDJA 4HUMB 1NC2B 1U8LB 3EYUH 1LK2A 3QHFL 4WO4B 4GRLC 4XBMA 3A6CL 4BQ8A 1GW0A 4PJGF 4QF1B 1G9MH 4NOBA 4W9EC 3BPNC 2CDFB 3BAEH 3O45A 2B5IC 3VMPA 1QAWA 2P46B 1QKZH 1TU2A 1ZSDA 1ZE3H 4AZ8A 4M6ML 2R0KL 1JWSB 2WBWB 4LHUD 5E2WL 2RGSA 3O4LA 1KWKA 5ISZE 4R5TA 2F58L 5I23A 3S36H 3ZKXB 3QWRA 3G6AB 2I07A 5BW7A 1X5IA 3D52A 3IN0A 5SWQA 1LILA 5IM7A 2GJ6B 1CF8L 4FG6D 2Y6SC 2Y3AA 3C2AH 2Y7NA 2FIKA 3KNBA 4OGYL 2EIMB 1WLHA 2NUTA 3VH8B 1C5DB 1HHJA 2KDYA 1EZVX 3UH8A 1K85A 4GRWF 4A1RA 1CDHA 4HAKA 4WHDA 5E8DL 1M7IB 2QADD 5DC4B 4A38A 2HKHH 3BD5A 1CBVL 4CMMB 1DJWA 4UT9H 1I1AA 1LK3L 3GRWH 3BD4A 1JNJA 2PW2B 3D69A 4AYFA 2QQQA 2YGOA 1D7FA 2WB1A 1S8DB 2QVIA 2YBGA 3O4LE 1F0LA 1X5HA 4Y9BA 3OJMB 3TEWA 4NQEB 4QHLB 2I85A 1IEAA 1YEEL 2ZCHH 3FQWA 1CJYA 4IRZL 5EO1B 2H1LM 2R2HB 3CSFA 3EFDH 4YHMH 4I77H 2L7QA 3OPZH 1JGVL 5C0BB 3QIWC 5CCGE 1DFXA 1R19A 2VDRL 1QD0A 4KUCD 4C8XA 1N7MH 3QEUA 3PNWA 1VFOA 4U2YA 3N85L 4R4NC 2X38A 3APNA 5CSGA 2Q7NA 1A8ZA 1HI6B 3BPLB 4RGNE 5HYIA 4BSJA 2X7LA 4Q6KA 4NEHB 5IBLD 4ZFQA 4Q9QH 2PPAA 4RMTA 1AHWA 4L3AA 4AQOA 2DQHH 1MHCB 1FH5L 2JJVA 2Y7MA 4KMTL 3OLIA 1P7QA 1XGYH 4K55A 3ESOA 4W9HC 5EZJB 1VAHA 4LP4A 1NSNH 1IT9H 5SWZA 3VMOA 4QRTA 3MRRB 3P4NB 4AQ1B 3CQQA 4G3YH 4M6OL 1PZDA 2C8NA 3DRTB 1TETH 1URZA 2W91A 4GO9A 3TTYA 4OZFG 4F9PA 3M17A 1QO3A 4PJ9B 1R47A 2VDLL 2DJ4A 2VR3A 1EHLH 2C3XA 4HK0B 4O2EA 1XF2B 4JPVH 3O9WD 1MQKL 2WXJA 3QZWB 4KVPA 1OD7A 5IEHB 3QI9C 3MBXL 5E6RB 2HN7B 4R26H 3IDMA 2KPWA 2XYCA 1JGDB 2ESVE 3L3OC 3SE4C 2BZDA 2YK1L 3PL6B 4QXGH 1KIQA 2KI6A 3RFZA 1MLBA 2DOCA 3B9AA 2IF7A 3MNMA 3RL2A 2JCCF 4FFVD 1HEJC 1U8IB 1TEGA 4UBDC 5I0XA 1B0WA 4HXAH 1MFBH 2Z93B 1SMAA 4QRPA 3ZT6A 2FTAA 4IGBA 3WFBH 5DXWA 4G6KH 1GXEA 3UYRH 3WEMA 2FVNA 3JYCA 5TH2A 3T77B 2OMTB 3GZOA 4FNTA 1KN4H 5F3FA 3TWCH 4DK5A 5FXCH 3Q01A 2Q6WB 1J8HD 1UASA 1OQOA 5E8NA 3NEXA 2E9BA 4JCWA 1MRCL 1DVTA 1KCRL 2CRIA 1T0MA 2XIBA 4WVRA 5E99L 1KEGL 2VJ8A 4C56B 1GZQB 4PY8I 4RZCB 1Z5HA 2WNKA 1UXLA 2A9DA 3DUSA 3E6FA 1UZ8B 4QR7A 5HDOA 1CFSB 1ZHNB 4NNXB 4YLBA 5EV7A 4WI9A 4OVVA 1LVEA 4PY7B 1ID5I 4JANB 2J8UE 3QS3A 5KBNC 1MXGA 2FLBT 2A4EA 2B1HH 1E9QB 1I8IA 1TZGH 2RBLA 3I6GB 1OWWA 1CIDA 4H25B 4NJAH 1WAAE 2VN3A 5CHNA 4TSBL 4E41B 4ELDA 2ADJB 3GHPA 3FCSA 3P4MA 4XNUH 3T0EB 3F7VB 5D1ZC 3QRFM 4B50A 2WMPB 3OKKA 5IFHH 4MA3B 2A6IB 4YL9A 5HGDB 3HNTH 3US0A 3ARFC 3QUZD 2BSTB 2GJ6D 2V8LA 2Z91B 3RZCB 2ZP8A 3ZHKA 4J3OH 4RRPA 5HYJB 4HZLB 1T04A 4N5EC 3RVXD 1A3QA 2VDNH 2Y06H 1AQ8A 2Q7YA 3CZSA 3AJ7A 4IU3A 4PGEA 2MQCA 1AANA 5IQ9A 3RKDC 4E68A 1J1PH 1M7UA 2XQYK 3QAQA 1IGYA 4U7SA 2RCSH 3G5YA 1WUNT 1MCIA 3HVDA 4HH8A 4WWOA 4HXAL 3RKPA 4J3OD 1D9KC 3F7RA 4AZ8B 1Z3RA 4G11A 2VR6A 2W60A 1VZIA 3WIFB 1A5FH 1PIGA 5CLXA 4PRIA 3SYQA 2DH3A 1AQKL 2OLDA 3IFPB 1WCBA 2FX7L 5KSBA 1ADWA 2IDTA 5T1DH 1WWWX 2QDWA 3X12A 1KTKE 1LEGB 1GIGH 2UZXB 3WFEH 3ZQ9A 1L6ZA 1IGMH 4OB5H 4G8GD 3KPMB 1R3LB 5KVFH 3K8KA 1NGWA 3GDCA 1ZV2A 2VN7A 1LO3H 4ZDHB 3AROA 4AM0B 1F1AA 1FNEB 4S2SA 3UO1H 1ORSB 3WEXB 1FNAA 1KTDB 3CXHJ 5D1ZD 3MRIA 3AXIA 1EBAA 2JVUA 3C9NB 4LXFA 1E30A 1SDAB 1E8ZA 5D9SB 1G7JB 5F7EH 3JTBA 4F7EA 2NYYD 5GSRB 4LCCC 4J3OG 3QRBA 4GMSH 1PAMA 3PNRB 1ETB1 3D30A 3VXPB 4L2YA 1A64A 3DHMA 5DFAA 3G5ZB 3KPSA 3O9WB 4LVHC 1MCPL 1KIUB 3DX8A 3RWIB 4K73A 4EUPB 4HCRH 4DPRA 5K93A 5DRWA 1FSKB 2VDKL 5K5YA 4WW2B 3GS7A 1N4XH 4HIXH 2K70A 3IU3B 2VW7A 2WLLB 4UF7C 5SWSB 3T0WA 3OPZL 1KBKA 4YHNA 3X3FL 5C2UB 2GY5A 3H3KA 3U4KA 5TDOB 2CM6A 3QQ9D 1UQSA 5FYLE 3WMQA 1I8MA 3MR9A 1S7SA 1LE9B 4L9DA 2HRHA 4XNMB 4PJ8B 5B1JA 4YO0B 1X5JA 1FIGH 1GIGL 2DYPD 1LK3H 3GRWL 1VSCA 3CFCH 3I3DA 4BGLA 2BNRA 4MQ7A 5A16A 4YSPA 2EKSA 3KLLA 5TDNA 3MPCA 1KYDA 3LSOA 5F8RC 2VAJA 2DDQH 3IKKA 5I1GL 1KPVB 4LSSL 4KUZH 2V4LA 1IZJA 3E1F1 4LKXA 1IU1A 1X5FA 1DQJB 4HBCL 2VDNB 4YS4A 4LGSB 4JO3H 4MJIE 1V3MA 3Q1SH 1GA2A 1FFRA 4GY4A 1XQ4A 4XPBH 4FA7B 2WQXA 4ADIA 2H6OA 1ICTA 3DPBB 4RGNC 4DP7X 4HS8H 2ATAA 4C58B 3E9UA 1F6AA 2DMBA 4CN1A 2PPFA 1PLAA 1A1MB 2IH3B 2WC7A 2X4PA 1TQBC 3D2TA 1ASQA 2V2WA 3BT2H 3CFMA 1V05A 1BSIA 4I87A 5FAAA 1OT4A 2F74A 1XIWC 3V0JA 5C0EB 1CL7L 2YRZA 5E4IA 5HHPB 2OX5A 3FTZA 5FPIA 4XXCA 5CEXA 3S37X 1ORQA 3CVIL 4G6AD 1BVLB 3CTTA 3QR0A 2HKFL 4YPGA 2YD3A 1A6TB 1ZHKA 4N6QA 3SKJH 1QABA 3C60A 4WWPA 4ETQB 4HF5L 5CLWA 4S1DD 3WS6C 3L5WB 1M05B 3GBLA 1KJVB 5DUJA 3AREC 4R7NA 4JS7A 4Z0XB 4JHBA 1HL4A 2ZG2A 2WM0A 3MRKB 2ENYA 3NA9H 5LG6A 3CZFB 2PO6A 1NFKA 3PCYA 2BW5A 5J13B 4ODVH 1TJHL 3V0WH 5AVYB 5BXFA 2NY1B 4U1KA 3H2PA 3UMTA 1HESA 1JOIA 3VX1A 1QTSA 5L88H 2AK4A 2K3HA 2VDPH 1T66D 2CRYA 4AJ0A 4YHPB 1IL1A 2APVA 3WSQL 4HK3J 1T5XB 5K9QI 4I85A 3FH5A 4M4RB 4H8WL 4I0PD 4C55A 1FZJA 2Z7YA 3VSVA 1FO0B 4FLQA 2J1ZA 4R7VA 2Y4SA 5IBLC 4N2EA 3MROA 3AAZB 4MYWB 1F6LL 4G6KL 2X87A 2G5RA 2CNYA 2J3SA 3VRIA 5FK9A 1EXGA 3BXNB 4XB7A 3BDXA 1CD8A 3FUEA 3ISWA 4ZS6D 5KZCB 4FQQB 5C0FA 4NP4H 1FPTL 4PGEB 4QXGL 1S9XB 3GI8H 5A2AA 1CYWA 5DD6A 1DQDH 3QC6X 5KYWA 3ZMEA 5F6IC 5HYJA 2CGYA 2OZ4A 4JFQB 4HLEA 1NC4A 2EH8H 2VZUA 3U30C 2VXUH 2CO6A 4D0DA 3FPXA 3HI1A 1Q0XH 1YY8A 2P8LA 2WSDA 5CJOH 3UAJC 2VW4A 1D7BA 2AK4D 3QUML 1Y07A 4Y4HD 4ZX5A 4KQ4H 2YAPA 4OIIH 4XWGL 3Q9PA 5DJ2B 1YLBB 5C09E 5EO0A 1S5HA 2QSCH 5L4MA 1YQVH 1SXNA 1IFHL 2IDQA 5CZXC 1RK1A 1FIEA 2VERN 5ALBH 3AQXA 2E6QA 4FJ6A 4NT6A 4OFVA 4ZAKD 3QO0B 4ODSL 3VM7A 2AJUH 4CGTA 1BM7A 1NEUA 5ETUA 5F1SA 4WU5A 1PJWA 3A6BL 4BFRA 4DOHB 2D73A 1S3KH 3HI6H 2ZUSA 1B4RA 2FJHB 4KMTH 5DUPH 4P5MB 4AJYV 3QPKA 4OCRH 4BELD 1OCZB 4K94H 1OL0A 4HAFA 3BUDA 4NQDE 4NQXA 4Q8BA 1ZWIB 2DKMA 1JN6B 4FKKA 4KZ0A 4C56A 3L6FB 4HOZA 5DA4A 2DS4A 3C6SB 3HG5A 3O6MH 1YMMB 1ZOXA 4XNBA 5KSAC 2EEXA 3N85H 6PCYA 3I6KB 3EH2A 3ZGHA 1BBDH 2CHWA 1CZ8H 2QR0B 2XZAL 5D96B 3EYQC 2I27N 3ZL1A 3ZR5A 1C16B 3EH1A 5L4JA 3LHPL 5LO7A 5J11B 1RV6X 4TUOB 3KYMA 4AQEA 1FYTD 1KEML 4ZYKB 2HT3C 2Z8SA 3L9YA 2X4TA 3LKQA 1P9MC 3NCYS 1CFMA 1FZOB 3CFBA 3QXAA 1R24A 2MMXA 2YD2A 3IEAA 4JKKA 4A7VA 1SJXA 1ZD6A 2P42B 2YWZA 3ET9F 4IIQC 4JPIA 5JW5A 3FT9A 4GRWB 4PJCE 2HKHL 4G7SB 1JK8B 2I9LB 1D5IH 2RH0A 3KCPA 2FLRT 4HD9A 2N7AA 1BV8A 3HZVB 4JE0A 3H53A 4X6CA 4EI6A 5KVDE 3VI3A 1WHPA 2X44D 3FQNB 3OZLA 3NZ8A 2W38A 4Y8AA 3WY1A 2APWA 2MPAH 3T0EC 5IV2A 4HP5A 4KI5F 1PZSA 2WPGA 5JLZA 5IB4A 1EX0A 3BGAA 2X2UA 3QBTB 3ZJAA 3K6OA 2X9YA 4KUCF 4XT1C 1U8HB 3VJ6B 3ZKSD 4WFEE 5J6HB 2F58H 2NOYA 1Y6MR 1XF1A 5I8OH 2WCGA 4UT9A 1CPUA 3IM1A 1ZTXL 2MNWA 3JWNE 4PJ7B 4N0CD 4WV1C 1TQWA 2P80D 2DBLL 5I8KL 2DPKA 3TIDA 4PR5B 1UOLA 3M17B 4F15C 4L4TA 4U6XB 5IB5B 5E00B 4UM9A 2WTPA 4U31A 1WPCA 1HIML 1T1YA 1ZT1A 3OC8A 2HJFA 1M3JA 3BJ91 5PAZA 2BRQA 4HWNA 1XCWA 3FQYA 1RZGA 1M2OA 1G7QB 2VR7A 2Z7WA 3L3IB 3PWPD 4KJWD 1P7QD 3PP4H 2C1PB 3B7RL 5DHYA 4Y2DC 4BE5A 3ARDA 2R1XB 4NWUH 3T0VA 3K0WA 5GXBB 4X8CA 1QLEB 2A9ML 3QDGD 5EOQH 1LEGA 3NJVA 2H4EA 3C87A 3PGFH 3II3A 4P46A 4QRPD 4FABL 1Z5LA 1I9RH 1J5OH 3PABA 1YNTF 4Z6AT 2FL5A 4X9HA 4JGUA 2FUTA 4JW3A 4CNIA 2YPLE 2XX1A 3AS1A 1CFTB 3P54A 3R4DA 2F68X 3WIIH 4KHTH 2RMNA 4WJ5A 2OTWB 1MY7A 3VRLE 4ONFH 1VENA 5T1LB 3UGEA 1AY1L 3HE6D 4XH2B 4LHUB 2XVGA 4FNLL 5AKSA 5F89A 1Y0LB 3FOMA 3IBOA 1ULVA 5DC2A 3TNNB 3IGUA 4XC1H 4K3JH 1JZFA 5FHAL 2UX7A 2MOQA 1TQTA 4Z7UA 5B8CB 3EDJA 3ARXA 1ACYH 1SLVA 3L08A 4JDVA 2XN9E 3GSUA 4I5BB 2PPCA 1YYCA 3I9IA 1IGTA 4WWKD 1ZANL 2A6KB 3EOAB 2C9XA 2DYSB 5JIPA 3BEWA 3I74A 2VRAA 3ZE0E 1L7TL 2RFXA 4Y4HB 5F89B 3P0GB 1WF5A 3GEWB 4ELKA 2NXZB 1QPKA 2FEDD 1CICD 1BFOA 3GMOB 3OGCA 2G3XA 2NZ9D 2V5MA 3F7YA 2BNUB 1I8LC 1GGCH 5FC9A 4G6FD 4ESKA 3IF1B 4WTWA 5M94B 4ZNEA 2VO8A 4FNRA 1P5UA 3QQDB 3EDEA 4OFYA 5L6YH 1R5VB 2HVKA 1XGTA 4L23A 3RY5A 5TPWL 43C9B 1F1GA 2ICWJ 4LHUG 3O3EB 4TN9A 4WK4B 3VXSE 1IB5A 2JKWA 4JR9H 5F7DA 3ZDZF 1FNLA 2N0KA 4ADJA 1RH8A 1KPRA 2B3IA 4G43B 3D3VB 2ADGA 2IMMA 3LYRA 3IDYB 3A23A 3OX8A 5LNEA 1K8IB 1KBBA 1MCWW 1G7LB 2A73B 2E27L 5L2KE 3B9KA 1URIA 4KV5F 1OGTA 4MD5B 1RZJL 1OTSC 3V7MA 5HYSA 4YGVA 1OSPH 1IFHH 2QFPA 4BJLA 4DVBB 3TIDB 4WKXA 1E3XA 1E6OH 4GSUA 2P80A 3HW7A 5ESVB 1GYCA 4JM4L 3M1OA 4MA1C 4BK8A 2H47C 2ZCLL 1R3HA 1G4MA 1SXCA 1T1ZB 4KXBA 1MRFH 2AQTA 4WW1B 3II2A 3OAYH 2UXVA 3JVFC 1UACL 3OF6A 1YYML 2NX5A 3POCA 4LMQE 2CKBH 5ILTL 3WLWC 4UZUA 4DZ8A 4MDRA 3CHPA 1GGIH 4MD4B 5I82A 2FZ3A 1OHZA 5EZLB 1AHMA 5CZXD 3EYVA 3IDNA 2NW3A 3VXRD 5MI0B 5IEHA 1OM3L 1OW0C 1FE8L 3ZW3A 4JE4B 4XCFL 1T2QL 4H1LB 5IROD 2CD0A 4AH2B 4QRRB 4JFFD 4P3CL 5BMFH 1R3HB 2WD0A 4OZGF 4R4ND 4BZ2L 3EH4B 3RFRA 1WZKA 5H4YA 2UWEE 1PBYA 3UFIA 4PEEA 3PREA 4FG2A 3FQRA 4F7TB 4ENZA 3S96A 2CHZA 4AVKA 1C08B 5GRJH 2CDEA 4K07A 5DWPA 3W0WB 1G87A 4TUUA 1PY9A 2MTAA 4NQCE 5SWZB 3QJHA 1JYNA 2YPVH 1RCYA 4KY1L 3QG6B 4PI0A 1T66C 1P7QB 3ZHFA 4UM9D 4Z1PA 1F4YH 3FHQA 1W72L 1CIUA 2OQJB 3ILQD 3WI9A 5T3ZE 1ZWIA 4G7QB 1TJHH 3L13A 1IC7H 4LE8A 1LEIB 1CDCA 1S7VB 5ABAA 3T3PF 5KJ7E 5IW6B 2QMKA 3ZT7A 1ZK5A 1FG2B 4EQ2A 3ROLB 2ZOWA 3MLTA 5EU6B 1QW8A 2F0CA 4ADGA 3NIGE 1A4AA 3BYTA 3EJPA 2G4EA 3ME0A 3KGSA 4M1GL 4TULL 2CLZA 3FUNA 4YUEL 3P1VA 1NWOA 3RTQA 3EBGA 3L2LA 4JFUA 1SOQA 1UKSA 3CN1A 5ID0B 5FYJU 2W5PA 3QDME 5HHVH 3HN8A 5KWYC 2D3LA 4V2CB 3PQYE 15C8H 4CKQA 1QFOA 1ET8A 4Y4HA 2VXVL 3BO8A 5IUCA 4TNVK 5DJXA 3GBEA 3LNEA 4HMEA 1JDAA 1NC4B 4P04A 2H6UA 3VXQA 2J7LA 2ZUUA 2PNDA 3TEUA 3UOAB 1E9PB 1U2YA 5DD6B 3O6KL 4HS8L 3DX1A 4PN6A 3DIDA 5GIRB 4EXKA 2VZVA 3CZKA 3UEZA 1R9FA 2FEDC 3G6DL 3ZRSA 3OAZK 2XG4A 3Q6GL 3E38A 4Z3HA 3VI4A 3GSNL 3RWCA 1QTPA 1QLEL 2NXZD 4ABWA 3FB7B 5I1CL 2QGBA 3GPSA 1ZXKA 5E8PA 3CFQA 4Y2DD 1U95B 4TV3A 1VKXA 2OTWA 4MRBA 1JUFA 2EQDA 5D1QD 5GGRB 4OV5A 4Y4KB 1JXDA 3ZT5A 4QY8A 1I7UA 1ECYA 4UTAH 1JTPA 3QEQD 3O3UN 5HDRA 1KLUB 1IBFA 2HZHA 5HI4C 2LU7A 1FFQA 1I9JL 2F54A 4LVNC 4LLQB 1NBVL 3N55A 1G7PB 5GGTL 4OI7A 4ABVA 1QFHA 2W07A 3K72A 2RACA 4I48A 4N0FA 2EXWC 3ZZQA 2PWEA 1TYEB 5CSBA 2EYRA 3P4LA 4JJ5B 3HG1A 4U1KB 2E4TA 5TQ2H 5FGCB 4D3CH 1IAII 3D34A 3FKUS 4JB9H 1BECA 4L3CA 4P9MH 3IRCA 4F7MB 2EICA 2J4WH 4X98A 4WSJA 1RZGB 5JZ7D 2YXMA 4MMYB 2ODIA 4KTEH 2ZXAA 1N4XL 3D09A 4XXDA 1HOEA 3WENA 5H37G 4YSCA 4QRFA 4G70B 2K6ZA 3DJ9A 4BFGA 2ZX9A 1AXSA 5GRWA 2WBJB 4KKZA 5DRZB 5ABDE 1MW3A 4MXVE 5JR1H 5E7FA 1J05A 1IEBA 2W8CA 1AE6L 1BQHB 1UKTA 1KPUB 3GWJA 2BSDA 2WYZA 2G2PA 4NN7C 3NABH 5C0RL 3RKDD 1KBGL 4BUQA 4YHOL 5G5DA 5K59E 3FONA 3LZLA 3O6FB 3L8QA 4KDTA 3CMOL 5JLZB 2CLRA 1OPGH 3D25B 3MJ7A 4Z3GA 1CGUA 3NCWA 1BEYL 5F9WC 4EI6B 1KGIA 3GS4A 2PCFB 2YUZA 3VXRB 1UYWH 4ZI8A 4GIAA 3LD8B 5D70H 2WLHA 1B9ZA 2QBWA 4XPGL 3FUHA 5CO1A 2AEOA 1B2WH 2OSLA 4RQQB 1FCGA 4MJIB 4XO5A 3BQVA 1W0WA 5BV7H 3FT4A 1AC6A 1CUOA 1XD0A 3R7QA 3D0LA 3FB6A 2Z31A 4HDIA 5I71B 3LPPA 5EUOB 4CAGA 2YA1A 5JPNA 1I8KA 4BFOA 2XPZA 3LCYA 4BK5A 5DYFA 1XR9B 3G5XA 3RWGA 1F42A 4JFXB 1UB5B 1YEHL 2BS9A 3QJFB 4HGWA 2W88A 4YDVB 3B9VA 2ESVD 3O4OC 2FO4B 3LS4L 3M7FB 2R23B 5IEKA 4X9BA 5FECA 4H20L 3DROB 3SIKA 1UYWL 4KKCD 1UOKA 4ZMNA 1LGVA 4CSTA 3T5WA 3WNPA 4PGJA 2ZJSL 3HIZA 1KLFB 2ICEC 1ZIBA 3RURA 3ULVD 4DP0X 2YPVL 1J9SA 2R2BA 2XBTA 4RBPH 4DTGL 2QVFB 3RUGE 5CSZA 1S9KC 1MNUH 3WTWA 3U7WH 1A6UL 3TEYA 5EU4B 4UYQA 1U6AH 3TZVD 1HINL 1UM6L 2OV0A 4FXLA 5C2BL 1N64L 3WUWB 4IYKA 1U8OB 5EN3A 2KZWA 1WBZB 1TMCB 4G1MB 1I1YA 4U1IB 3ECWA 1W9XA 1R6VA 5ENWB 3DSFL 4W4OC 2A2QT 4NOFA 4Z7QE 4KXCA 5B38G 1YNTA 2HA1A 3EXLA 4FC3E 1OSEA 2AZAA 1OGAD 2C9UA 4QAMB 5DMGD 3Q8FA 2ZG1A 1RJLA 4X5PA 2YGVA 5JHLL 5IB1B 2YR3A 5HDQL 2VCOA 2VABA 4WI4A 5C0FB 4LCUA 4G8GE 5FO8B 2JCCE 4Y1SA 5D7JA 4NO0A 5LN4A 1JV5A 3H6AA 4LP5A 1OAJA 4GSQA 4TKWA 4HS3B 2LU4A 3MFFA 2N4IA 2ZSVB 4UOJA 3VFVA 3MGTB 3VWKB 3X14B 4AIXA 3VO0A 2A0LD 3PIQB 5IVNA 3L3JB 3QS2A 1FZJB 4PRIB 5E6IC 1MCQA 4DUXA 4FJYA 5JHBA 3AGVA 4JRWA 1JK9B 3KVPA 3ABKB 2BHUA 5KSAB 3UBHA 5CLTA 2JV6A 4P23B 4Z7OF 4LEBA 5F2FA 4GBXD 3FAXA 3H54A 4PVBA 2YOAA 3TONA 1U0QA 3DHJA 4L3EB 3OR6B 3TIEB 1SYVB 2AABH 2G75B 3DV4A 5DK2A 4X4MA 2ZWNA 4N0UB 4FI8A 3BZFA 3NZUA 4NXKA 4NI6A 4UM8A 2NYZA 2AI0L 3CZFA 5L6YL 3ECBA 1TTGA 5I5MA 4R26L 1YQ2A 2Q8AH 4KH2A 3PAZA 3UC0H 3VE0A 5LVEA 1EAQA 4LEOB 1J1XL 2VL5A 4RDBA 1OLLA 1A7OH 3NQIA 4YUEH 3AABA 3NGBC 4O58L 1PX8A 2V7NB 1R5WA 1CYXA 4AYEC 2ED6A 4PB9L 4RSYA 4KKLC 1UEYA 4PJ9C 1UZGA 4LHQB 5JNYB 5CHNB 3PY9A 1OE1A 1KV3A 1WAAF 3UIYA 4DGYH 1OM9A 1DL7L 5BS0D 3ZHNA 1YAIA 2HX7A 5EBWB 1A6AB 1GYWA 3TESA 1JPFB 1V10A 3RPIA 3REVB 3EJSA 2XWJB 1SJEB 5AW7B 3NK4A 4RAHA 3KLHD 3T4AC 3EBAA 3L7EB 3KEHA 3CPUA 2A77L 1I7ZA 3P4OB 1WIPA 3ZXAC 4FNSA 4MJ2A 1E40A 1M3IA 3WHE0 3FN0L 4JY5H 2LR4A 4PJCB 3E9TA 4AOFA 5I6XC 1N12A 4ATWA 2V9RA 7CGTA 4GQQA 1CGYA 4ICXA 5IEKB 2JXMA 4U1HA 5MP6L 4XZUA 3KXFD 4PJFE 3LSOB 4IRZH 3QRGL 3K5RA 5D71L 3VGDA 5J5EA 4MVBC 5TFSL 3PGFL 4WFHE 5LAXB 4AEHH 2IAND 5F7YC 1FYTB 4QDGA 3VFUA 1BQUA 4J12A 1AI1L 4L1BA 2H2SC 3VD9A 2OMBA 4N2NA 4X9YA 4IGBB 4LBAA 4WF7A 4GS7B 4RSVA 1CBVH 3DX0A 2XXFA 1FORL 1I1YB 3V0AC 1TO4A 3X1NA 3GB7A 1N2RB 3WHE1 3SBRA 2KYIA 3LQAH 1MRFL 2HVJA 4LSUH 2NY6D 4BINA 4MYPA 4U7MA 5DS8A 4LLUB 5HHNA 1N0LA 3AT8A 2R27A 4CMHC 4OGXL 5FYJE 1ID2A 2CIIB 4MNQE 1LMIA 3QZWA 4PD4K 1FC1A 1FA4A 4P49A 1ZEAH 4FQHA 5HYQA 2VZOA 4R84A 4OQTH 4IOSD 4OJDH 3RVXC 5LXVA 4HEPA 4F2FA 3TBVB 4PJHA 1RFDL 3I75B 1XVSA 3OKNB 5GGTA 4N2DA 2VIRA 2Q0ZX 2PCPA 1N8OE 5JUEL 1XEDA 4JFHD 3NYKA 3L3DB 4MJ5B 2CUMA 2BCKB 3U9PL 4PV8B 1QSZA 3KG5A 3NIDE 4J3OC 3ZE2B 4F57H 4P3DA 1ZGLB 3CDFA 1CURA 1MFCL 2X7LB 3D39B 4JFYA 1F45A 4MA8H 1WEJH 1NANI 3BH9B 35C8H 1T2JA 2ADFH 2EEFA 3QRLA 3L1FA 3OZ9L 5C0JA 4FLRA 3FCBA 5BOZG 7FABH 3FQTB 3KLHC 3GTVA 4IQHA 1R0AH 4QY8B 1KCLA 3IMVA 1QNIA 4XRCB 2Y2WA 1UXMA 5KSAD 1O5DT 2JB5H 2DWTA 5ACZA 1KXTB 1M9SA 4R8WL 1ED3A 2JKRM 2XWBB 3HE6B 1ROWA 1ACYL 2BNRE 5KYUB 4AZUA 5E9DB 5DZJA 1FFNB 3CG8A 1B3IA 5DEFB 5EU3A 2VSKB 3LJ3A 5FOBA 1U3YA 3UX9B 2X89A 4LGPB 2FYYA 4A7SA 4E0RA 3WDHA 4UQ2B 5J1AB 5FYJH 1C5DA 4Y16B 3FU8A 4JRXD 1T4WA 3PXLA 2FBRA 1AXSB 3GMRA 3M8OL 3QZNA 3MCKA 3EHBD 1WICA 2DJMA 4LDOB 3OXRB 2JK5B 1JF1B 5GRUH 3SB3A 5EF3A 4EDWL 4O58H 2W0FA 1NCHA 3DYMA 4GIPD 1R0AL 3WDIA 4GRWH 4JRYD 4M93C 1DSFL 2HX9A 2QQNH 2VXUL 2XPGB 1QBAA 1XB6A 1FJ1B 3HG1B 2YC1B 1UT9A 1LEKB 3S4SG 1NL0L 4E9XA 4ZMVA 5D7IB 1MFCH 1U21A 1MNNA 1BQ5A 4MAUL 3LZQA 1CG9A 3S8GB 4OZIE 2YLHA 1FPTH 4XP4H 3ZQXA 4U2ZA 4NNXA 1U8LA 4HWZB 4W70A 3MU3A 1U8KA 1J9QA 1RP8A 3BKYH 1MCWM 3P9WB 4X6FB 4Q6IA 2EINB 2NCMA 1KJ3H 5DVMA 4KTDL 2MRYA 1INDH 4K3DH 1I7RB 3WJMA 1C5CL 2VNCA 4WJKB 5F0JB 1ZLWH 1ZEAL 3IDIA 2R29L 3THMH 1DDHA 1BXAA 1IC5H 4GLRI 4XP6L 3HRZB 3TO4D 3S4SA 1DEEA 4OCNC 4UNIA 5MERB 4YXHH 4WI8A 2DLIA 1RK0A 3IDUA 1GS6X 5TD4A 4Q9RH 1H5BC 1LP9B 1PD1A 2YD6A 5DMKA 5CD5C 4LSUL 1AD9A 1F56A 4OAWA 4H1LA 4HMCA 2D31A 3N06B 4ONHB 1E8WA 5HJDA 3B6SA 1DN2A 2WQVA 5CINH 3VQLA 1NAML 3O4LD 4KKLD 5E7BA 1JZ7A 2ATKA 4IBTA 1NOFA 4TQIA 4TVPH 3TL5A 3SKJL 2ZSWA 1Z32X 3CVIH 5C0CD 3HPJB 3GRGA 2R2EB 2N59A 4DP2X 2VJXA 1QP1A 3BUYA 2A1WH 2NY4D 3FSWA 4NRXB 4C4UA 3WTXA 5D7LB 2QGCA 1XF2A 2Y7QB 5B3JF 2FHCA 3ULVE 4L8SC 1NFDB 4PJEB 3RA7L 1OVZA 1GSMA 4BH8A 5D4JA 3GBML 3O2WH 5GS2D 5EIQA 3TFKC 4HKXA 5JW4M 3HC4L 5I6XB 4DTGH 2A73A 2Z4TA 1HHHA 3HZ3A 4JRLA 4PLNC 5J57B 1BAWA 2J8UA 4U1SB 2BZCA 1CGVA 1AFVH 1KYFA 1C08A 4J8QA 5B39G 3R06A 1IKFL 1F3DJ 5ISZB 2Y07L 3SN6N 4Y4KC 2WXRA 3SCMA 5KVDH 1YNLH 5I1GH 3TV8A 2X2JA 5GS2H 3MJGX 1COBA 5CD5D 3GFUA 2J2ZA 1DQTA 1DUZB 3SHSA 3KVDD 1B0IA 2MIZA 1JGUL 1M2VB 5DFVC 2XN9A 5AW3B 3B7TA 3QEQA 4AGLA 3TV3L 5CS7A 4QHKI 1QUNA 3VAEA 4IBZA 5HGHB 4LEXL 1YEGL 1X9LA 3PWPE 3SQOL 1DLHB 3GXDA 1EA9C 4UNVA 2VRQA 4LQFL 2J5LB 5EEWA 1A14L 2YD1A 4K7PL 3T1FA 3NBNA 3VI4F 4WFGE 2YPKB 3TURA 2J8HA 4JZJA 1M7IA 2C3WA 4QRPE 5GS0H 1IGTB 4DO4A 1G6RA 3H56A 4JDVB 1G1KA 2GT9B 4DVBA 2YPLD 3EO1A 4Z7UB 4Q52A 2HPOA 2PUQT 4MXQC 1SEBB 3VMNA 3X1BA 4WEUD 1OZTG 3IDIB 4F8NA 4FQXA 4Z7NF 3SBQA 4R0LC 2HB0A 3P02A 2NX5E 4LSTH 4L1SA 1QFPA 3IDGA 4ZT1A 3M46A 1K4CB 4Z7OE 1YZZA 1AXIB 1QEWA 1YNKL 2C26A 2XXMB 2P5EB 5JORA 4Y4KD 2IWEA 4RH4A 5I19L 4UQBA 1NDMA 1QBMH 3NP4A 4PJHE 1S7UB 4XXWA 4RZKA 1F8TL 3Q5TA 2WO2B 4HJJH 4OCWH 1LO3L 3DDFA 5CILL 5FA4A 1RZKC 2QELA 1EK3A 4NAMA 2EC8A 3GBNL 2A83A 3SCMD 4P2QD 1XB3A 1IGML 1QRKA 1M4KA 1S5IL 4PRAB 2C1PA 4KK6D 1NBVH 3AM8C 1G7QA 1TJIH 2PO6C 1Z3GL 2GK0A 1AQKH 2XJLA 2CJUH 1AO7B 2BVTA 2RJMA 3KM1A 2GC7C 4KOBA 2O5NA 3D6GA 3H9YA 4PWHA 2YLKA 1O7VA 4ZMPA 1NCUA 3MCYA 2NSMA 4X80H 2WBJD 1UB6B 3UEQA 4MQTB 4PRHE 3ZPDA 4S0SD 1IIIA 2Z92A 4E0RB 3HI5H 5CCHE 1N26A 2ZKWA 3NJFA 4PJFF 5AUMB 1A3ZA 1ACXA 2O6PA 1T89A 3KJ6H 1YDPB 4R0LB 4NSKA 3HI5L 3PHAA 5AG8A 4ENED 1KXTA 4FA8A 2Y1YA 4Z7WB 4JO3L 5HD8D 4LBEA 3ESMA 1U33A 2PWDA 2ZXGA 3RTQD 2VITB 1V7ML 2CSPA 4XHJD 3SKUD 2BVYA 2BIOA 4N0CC 1HNYA 5A40E 2MTPA 3PABB 3HG4A 1A7PL 5AZ2H 2XHNA 1KZQA 2ZAHA 4I89A 4RAVA 4NJAL 5D2LF 4L4VE 3BH9A 1BIIA 1TZGL 2F5AL 4I8DA 3UMNA 5LDSA 1N5AA 1OEZW 3MLZL 1PY0A 1ZS8A 4NNYB 3DRQB 4N8CH 3Q2LA 1T21A 3FO9A 2BVQB 5CILH 4NPKA 2X12A 1BLNA 1O6SB 4X7SL 1XO8A 2IGFH 3EYQD 3EH5B 3VFGH 4N1HB 1SYSB 1EAPA 4LNRB 3L3HA 4PTUA 1GOFA 1ZT1B 2BS71 2VXQL 5E2UL 5ECJE 5FGRA 2DYPA 5F7BA 3OKOB 1D9KD 2BP8A 2PTVA 5I5RA 1HQRB 3C6LB 3MLWL 3IMRA 2PYEB 3ULVF 4TVSa 3OHXB 3LKRA 3LQZA 3OKMB 1MCPH 4I9XA 1XB8A 1R3JB 2WQWA 5HYJE 2P5WB 5E1QA 2X6MA 2BERA 4O5LL 1J10A 3QI9D 2P7TA 3NCYP 4WHCA 3RP1A 1CI5A 4NPYA 1JZ4A 4M7KL 2EUWA 3P3UA 4PWJA 5DGQA 4OZHF 4LPWA 4NFDA 5F7EL 2B77A 5DHVA 3QR1A 3NCMA 4HIEA 1OF2A 4PCYA 3V79C 1OV8A 5J11C 1AH1A 1I1AD 4H5SB 3NSCA 4H0LC 4P05A 3GMPB 5TQ2L 1SDYA 4D3CL 1UXWA 3FJTA 4LQFH 3SY0B 2VZ1A 4LLMA 3D8MA 3V4UH 3VGGA 4KGJA 4M62H 2G2RA 1JJUA 2X89D 3CK0L 3MMEB 3QW9A 3QDMD 1J87A 1MWAL 3BP4A 3LZOA 1NBCA 2GITB 4POUB 4X7CC 2ZCLH 1Q8MA 2XWCA 1MWOA 3GZPA 3KGTA 2BNRD 3DNKA 4PH8A 4MDIB 2BP5M 4Z23A 1T83C 1WIOA 4ODWB 4G8GA 5JO5B 1ZIAA 5C0AB 1UJ3A 4KVCL 5I26A 1L3NA 3ZUNC 4GKSB 4PV9A 1IKFH 4N2FA 4G3YL 3V5KA 2PCYA 1IRAY 1OP3H 2PYFA 2WVTA 3DXAA 4XCNA 1HKLL 2ZXBA 4R83A 2DQHL 1IL1B 2Y06L 3O6KH 1NWPA 3HZYA 5ANHA 1F00I 1ITBB 4L9LA 3OKDA 4MBRA 1GMEA 4B9ZA 4LO9A 3APCA 3VG9B 5BXFB 1M42A 2H0EA 1N7ML 5D1XB 3F65A 2OMXB 2DQIL 5IBUB 2CO7B 4UANA 1JGVH 1HWGB 3GUTA 5D1ZB 1AO7D 3OAWA 5CU9A 4NQDA 5DMJB 5EEZA 1CFNB 3ZVVA 5E8OB 2EDLA 4XNUL 3MRJA 2H2SD 3L2MA 3P0VH 3RY4A 4JFQA 2R0ZL 4M7JH 4IRJD 4PREB 1F4WL 3K7UA 2JE8A 3MV8E 1RPQA 4M1GH 4PGBA 5E1IA 2Q86A 4HFUL 1OOWA 4X9GA 3U2SB 2F7OA 3DGGA 3GHEH 3CVCA 5D1XA 4BSWB 4FQQA 1CFBA 3KWWB 2CKNA 4TVPD 5DEFA 4LL9A 4JHUA 3MJ9A 3L3KB 4Z5RA 5KYUA 3PWNB 1E90A 3MRDA 2GTQA 1U3HB 4OZHE 5E5UB 4HLJA 3VNZA 2NY2D 4P5TD 5KSAA 5BS0B 5E99H 2K4AA 1KEGH 1EEZB 5D5ME 1DSYA 1EO5A 5ICXA 1LO0L 2VLRE 4LLWB 2YD8A 4OI9A 4XP5H 4GJTB 3S36L 3BZEB 4DETA 1Q9KB 2XKNB 3THML 3NRFA 5F9OL 4B53A 3NH7H 2ZSVA 1JNHB 1B0GB 2R0KH 3TA3A 1YVLA 2ZONA 4LCWE 4YVNA 4PIBA 5KS9F 4F2EA 5J3HD 2X6UA 3P3RA 3I9GL 2DLFH 4HKBA 3ARDD 3MLUL 4LQ1A 4KJWC 1UWFA 4P3CH 5BMFL 3KXFB 3N2JA 1XWVA 1O9ZA 3QFJE 1NBZA 4X8JA 4X4XB 2AQ1A 3QQXA 4CJ1A 3DX9A 5GQBA 1YEKH 4PP2A 4JY6B 1Z66A 2IVFC 2L7EA 2O5YL 4AMKL 3TBVA 2EIEA 4YMPA 3OB0K 4QRSA 5IWLA 1CLYH 3QIUC 1J11A 2EDTA 5ILTH 3BWUF 4PRPB 3IFNH 2F7IA 3QJTB 1T6WA 2BM3A 2WZPA 3IVKB 4ERSH 1U2CA 4NQVB 4MJ4A 1OP5H 3T71A 2IQ9L 2EDFA 5E2VH 2AEQL 3TCLA 1Z9OA 1KXQA 1JZ3A 4IHOA 1CC3A 5DTFB 3F64A 1BF2A 1IKNA 3ESNA 4XX1G 1A9BB 5TK4A 1GVIA 4P4KC 3V7AG 3BIAX 5EOCH 4APXB 4NZDA 2ZX5A 2F7QA 4L0PB 2EDNA 2LQRA 4JBSA 3VD3A 1HCZA 3IBEA 3LN5B 1D5IL 1AP2A 2W9LA 2OTPA 4JO1H 4MD0A 4YDVA 3QZMA 4HSCX 1MJ7H 4HU2A 5GISH 3WUZA 3F00A 3OLDA 1UB5A 1TTRA 1FNEA 4L8BB 4PJDB 1AHWC 4B0MB 4DGVL 1MJJB 4U1HB 4R4FL 4NFBA 2EC9T 4YHML 4ZTOH 3BIKB 1A7NH 3QIBA 2GSGA 4LVOC 4YSRA 3SKNB 1H3UA 3R1GH 2DQDL 1QI3A 4MJIA 1WCBB 3PPSA 3MO1A 1G7IB 1OGAE 2A6JB 2DD8H 4NZTL 4DGVH 1SJEA 3BMVA 3EJRA 1IVTA 1D5RA 4I0PA 1TJGL 4P57A 2X1XR 4P5SA 4YHLL 4YHNB 2CALA 4B60A 5JUEH 4U6YB 5I76B 5L7XL 3KPRB 2LLNA 3T3ME 2BHYA 3K6DA 4C57C 2DQFB 4XOAA 1UHVA 1IQWH 4RRPM 4XAKE 3IPFA 3LNGA 5AAMA 1RFDH 3OWEA 3PQYA 5BNXD 4ZJ9A 6CGTA 4JDZA 1I8AA 3MLYH 2O5ZL 2UWEF 4LDCA 3TN0B 4G42A 1KIUA 3DGGB 1XIWB 2EIZB 2XYBA 3F3HA 3F01A 2A38A 3U82B 2HMID 4LASH 2X4OB 3MYJB 5DA0B 5TGBA 3X13B 5ALBL 5KANI 4EIUA 2YUXA 5I15L 2XWDA 3ALWA 4OF5A 3B9KD 3VE0B 4BHUA 4G8FA 4B9FA 2VDMB 3AREB 3FF7A 1T1WA 3NJGA 2GUOB 5JXEA 1J5OL 5ADPH 3ARTA 3J07A 1KN2L 1JG9A 3W38A 2EH8L 3ZE2F 1A3LH 4AM0A 2QQLL 2CUIA 2WXNA 3RTQC 1MXDA 1ZVYA 4XAWH 2D9CA 1FO0H 3GSQB 4X5XA 3RI5K 2X70A 2N3JA 3HZYB 5MI0C 4AMXA 3WTTA 3NQKA 4N0YL 5B1JC 3IJHB 4PJXF 3OB0H 3RL1B 5LGKA 2IANE 3EO9L 1HOCA 3C5SB 2BOBA 4WTZA 1MQ8A 5I9QC 4J1UA 1PLBA 4JN1L 2DWEB 2UWEA 3A22A 2BRRL 4XMLL 1M56B 3FULA 4AEIL 3O11B 4B95C 5IQMA 3CHRA 3LKPB 4LIQL 4YLQT 2J6EH 2VSDA 4GKSA 3N3EA 1E5CA 3U0WH 4F7CA 3B4NA 4GRWE 4RNRB 1G9MC 1DQML 3F83A 5TF0A 4EJ1C 1JF6A 3FN0H 4MDIA 2DZEA 3ARGC 4NO0B 1SDDB 3I50L 3JWOL 2D7QA 4OLUH 5CIPA 5LB1A 1UTDA 2ZP0T 2ESVA 5IHUH 1KB5B 2Q6WA 4G5AA 3GRWA 4H8WH 4XODA 2ZX6A 1KCUL 3IXAB 5HHOB 1IE5A 1MHHB 1L0YA 5KSBE 4JKMA 5EEUA 4MS6A 4JFED 4KX7A 1Q1PA 1XF3A 5IESL 3DO7A 3D7PA 1S7RB 3EGSA 5IF0B 5C8JB 4L4VD 1MLCB 1RLWA 4TQPA 1JGIA 4J23A 4JFZH 1PFOA 3LXCA 4ZNCD 4UOW1 3ULUD 3RYMA 1N6VA 4AGOA 2HN7A 1E4JA 1FL3A 1NEZG 2IPKA 2ZNXA 5HJ3B 2NXYB 3IU4H 5CEZH 1YA5A 3HFFA 5CLYA 2PTTB 3GXIA 3N40F 2LV4A 3H55A 2FX8L 4P4KD 2Q8AL 2NT0A 2P8PB 1SUJA 4OQTA 5DJZA 1KGWA 1FVDA 2BSBA 1RIVH 5EBLA 3HOGA 2CGZA 4XMTA 3P9LA 4X7TA 5MEOB 2BWDA 1NMBH 5IVZB 3RVWC 1MCLA 4K9EC 1GY1A 1NAKH 1AR2A 4M56A 4ZPVB 4XN4A 2J1XA 1BMWA 2WXKA 3VRLF 1ECZA 2I5YL 1DJIA 1VFBB 4Z7AA 1QSFB 5FKPA 4AQ8A 5L2KD 1TVDA 2OKMA 3Q6FA 2X2YA 3IRPX 1W80A 2W9DH 3F58H 3A6BH 1JXJA 4PI2A 2QSVA 1OB1B 2O5ZH 4G8IA 4FQJL 5EUOA 5ANMA 3KLAA 1C1EH 1MH5A 1W72B 2AJYH 3QNXB 1RERA 4W4OA 4BUGA 4QRPB 2X4QA 2F15A 3RVUD 4AG4H 4Q56A 3BUYB 4W9ZA 1MVUA 4FTVE 1MW0A 5EO1A 1U9KA 4JM0A 4Z7UE 3S5LA 2L7UA 3MOBL 4UOQA 2VITA 4DKEL 3UPRA 3W9DB 4JFDE 3QDJE 3MJ7B 5T1LD 3SPCA 3EG9A 1LD9A 5AQ0A 4CL7A 1MJUL 2ZWSA 1U8QA 3KMDA 5HDBE 4NWTL 4QHUB 2NX5B 2PPEA 3F62A 5TE7L 1FL6A 2IFFL 1ADQL 4O4YL 4PJDF 1XIWD 4Z76A 3AXHA 4Z7OB 5DUML 1CGSH 3JUZA 1WHOA 2H45A 1RPKA 2YPLA 4HT1L 2CK0H 5CKAA 4XP1H 1QO3B 4WTXA 3ZMNA 3N1GC 2OMNA 3P30H 1NQBA 2F9BT 3DRTA 4WSGA 4FCHA 5EOCL 1J5DA 2H3XC 3ILEA 4O02B 4R5XA 3GIVA 3ZDXB 4QCIB 1OCRB 3VCLA 4ZFZA 2BC4B 5F0PB 5T3ZD 1Q4NX 3CFEB 3LKPA 3MLWH 4RVBA 3MJWA 2R59A 2CDFA 4XNXL 3T09A 2ZPKL 1S7UA 4ODVL 4L4TE 3RVUC 5KYYA 4W9LC 1ET7A 4ETYA 3C08L 5JXAH 4MAZA 2AV1A 4HV8B 2C3GA 4JO2L 4OB5L 4GUCA 3F7YB 4CC0A 5F70A 3MGOB 2YFNA 3VCLB 3EGDA 1T0OA 2E75C 4W1TA 5CJ8A 5CAYB 5EU7E 2V2XA 4PHZA 5E5RB 5LCVA 4IMLB 4J3OF 3VTTA 4KKCC 4PGDB 3PFUA 1SEBA 4X6CE 3CZUB 2LGNA 1KIRA 2KLTA 3BT2L 1LNUA 5IMKB 4JPWH 3GJFK 3VH8A 1NOLA 4XCYB 2VO5A 2BMKB 3QJXA 1O5PA 5E6IA 3SGJC 3TNNA 3GXFA 5IJKC 2YOCA 1MVYA 3BO8B 5DRNB 1NEZA 4LF3B 1L0QA 2VR4A 2WBXA 1E3FA 5J6SA 3NEEA 5GGVL 4XP5L 1BOGA 4GOSA 1NCBL 1RJYA 4H44C 2D7OA 4JFDA 3U1PA 3HBZA 1N18A 1QUNB 5HGHA 1NGYA 3W0WE 3ZKND 1XZ0A 4EDXA 1CFTA 4NAJA 1ERNA 2WLIA 4KROD 5CMAB 4P4KB 4YDIL 2M83A 1E27A 3K6SB 3AU1B 1Q0EA 2P47B 2W9EH 1H6FA 1QPXA 2WW8A 1M9WA 3ZX1A 1BQSA 1FVEA 3BP6A 2Z1KA 2BOCB 2GBVA 4FX5A 4HFUH 4WEBL 1QLRB 5FUOL 2B1HL 3RAJH 2YXFA 4CADB 1QFWM 2PETA 2WOBA 1WFOA 3RBGA 5CD3B 3OVUB 1MJJA 2G5BA 1XGPB 3BUTA 2YEVB 4FQ1L 4G2AA 4FI7A 4K23L 4L8BA 4Z7NB 2PO6D 1F02I 4H13C 2XV0A 1UWEL 4FP8H 4KC3B 4NKQB 3IFLL 3GO1L 2EXYC 3VB9A 4G1EA 2PXYC 3DJRA 3T2LA 2VQTA 4XO9A 1HH6A 1MWAB 4A2EA 5I19H 3CZJA 4GRLB 3FUJA 5EDXA 1HILA 3BAKA 4IEFA 5DYOB 3VGAC 1BQRA 5F9AC 3BP7A 2SEBB 2V37A 1TZHA 3DGDA 2VB5A 3EFFA 4APQC 3SY6A 4QLRA 2EH7H 5AL8A 3FQXA 3L9RB 3CFKB 5GRVL 5DJZB 5IFJB 4B27A 5JIQA 3GS0A 2GCYA 1O0VA 4Z0BL 1HKLH 4P23C 2XWZA 3QI9B 4NKOB 2FJUB 4FQXC 3QWQB 1TJXA 5AYQA 3WFBL 2IBZY 1J86A 5C08E 3TVMD 4Y19B 5I6LA 4NS0A 1MLCA 5FW8A 4YE4L 1FNGA 3MRQA 2QVMA 2VLJE 1AD0A 4OZ4B 1S7RA 4M5ZH 4G8EA 1A14H 4K7PH 15C8L 1XF3B 3GNML 3UTOA 4JRXA 4KZDL 4HKJA 3OLEA 4NKIL 3RPKA 3NSJA 3NMEA 3QZWG 1FGNL 2GY7B 2DL9A 4ZMWA 1CGTA 1D5MA 5MEQB 4DVRH 1ZA3A 2VDLH 3VG0H 3U79A 3FOLB 2GW5A 4QHMA 5J6GA 1KPRB 1K9TA 5KVDL 3RZWA 1WSST 2PKDA 3MKGA 2Y9RT 2X6AA 2NNAB 2OPCA 4M7KH 1F4YL 3FB8B 1BZ9A 3IJYB 4KKQA 5DDHB 4AMWA 2FJHA 1P84J 4ZUSB 3SCMC 4H8QA 3UTTE 3QPQD 2VLKA 2E47A 2EE9A 3C09C 1EEZA 4WI3A 1CG9B 5E4OA 4DCQA 3HC4H 3PHOB 4GAGH 5C07A 1PX3A 4P4RB 3PWUB 2YC1A 5C09B 2KT6A 1TVBB 1YHPA 4NHUB 3EUUA 3U6RA 5JIIA 5C0DA 3WNLA 3ARYA 1QFWH 4EQ3A 1D3CA 4JRYA 2FWOB 2GUOA 3RX9A 4LRNL 4PJIB 3FU0A 4KI5E 2JELH 5FA3B 3VW3L 4F5CE 5F72S 5CFAA 3PV6A 3JV5A 3GO1H 1DVXA 1YEEH 2ZCHL 3MA7A 3NK3A 1LO2H 4PREA 4UB0H 5F88A 2OL3H 5CXPA 2LAGB 2X9ZA 3K3QA 4HK3N 5C71A 3QUXC 3CX5K 5GS0C 3PHQA 3Q0HA 4UQ2A 1EMTH 3WAJA 1SN0A 4UT9L 2VKXA 5DO8A 2ZUYA 5HY9A 4AW4A 4L8DB 2X4NB 3C5JA 4H26B 5E8DH 2G75A 3DV4B 4KJYA 2PXYA 5DQDH 4PJAE 3VM5A 1A7PH 2L3BA 4L3EA 4AUUA 1BF5A 2YWYA 3PUCA 4MS8C 4YDIH 2B59B 5E9NA 4UQDA 3QQ4B 4IHBA 1CF8H 1ZT4A 1IGFH 4BM7A 2XZQH 5CJBA 1K72A 4LARL 4XCNB 1TVHA 3OAUH 2BO0A 4JFEE 2H26A 3FT2A 4WI5A 5E94B 3PIQA 3SKMB 2FSEB 2WKLA 5MENE 2COQA 3F7KA 2AJVL 5E2WH 5C0JB 3KJ6L 3IMUA 3QORD 2RALA 2PWGA 1HXYA 4HX1A 4LAQL 5DT1H 5EUKB 4CVWA 3H0TA 4BKLA 3QIBD 1TG8A 2WNWA 4K3DL 1INDL 4A67A 1JHKH 5EPMB 3ARDB 3HUJF 5J0BA 5I1DA 4WRLA 3SEPA 3BH8A 2ZT9C 4OUOA 3TZVA 4H0HB 3DOHA 1E5AA 1NCAL 4XP4L 5SV4A 2IH8A 4WQOA 1IFGA 5F3HB 1AYRA 3M1CA 4FERA 5KSBF 1MHEB 1AQMA 1OZUA 5KAQG 1EVTC 4AGPA 4IKNA 5FWRA 4IOSA 5T3XH 2EILB 4I3RH 1RZ8B 4PJBE 4JO2H 4WGVB 1E50A 3LH8A 1BGXL 1BIHA 3O9WC 2QLVB 4P06A 4CBPA 2K8QA 5DQ9A 3C08H 4JPVL 4EIZC 3GUFA 1KUMA 1QHOA 2YGQA 3GSNB 1FWXA 2VN5A 2KQNA 3ETBJ 4BDVA 4L1LA 4MS8D 5DS8B 2JF1A 5E6UB 5AW0B 5HHNB 3B9DA 2P5WA 5IV2B 1JVLA 3ZN6A 3AS0A 4LZKA 1O9VA 5HI3D 5T33L 1JI2A 1ZK9A 1NCOA 3JVGC 1YJDL 3IJEB 3QQ3A 4XC3L 4XC1L 1HQ4B 2OJ1A 3RU8H 1NUDA 4G9FB 1FG9C 3D18B 4R8WH 2FSEA 4PRIE 4JK0D 2JWYA 1EZVY 1UCBH 4H0IA 3LKNA 1FYHB 1AIFA 4IRSB 2LT9A 5EWIL 3OG4B 4UT6A 3HCVA 3QDJD 1WA1X 2HFGH 1ZHBB 2VDRH 5GS0L 5HXMA 1J5HA 1UH2A 2Y3NA 5EPMA 3W81A 3B2UC 1N5YH 3SDCD 1A1NA 4PS4L 1N5AB 2N1TE 4TNWK 2WB7A 3D0LB 1MCFA 3FB6B 3NIDF 4I1PA 2XA8L 4LCWA 3X3GL 2WXHA 4MA8L 3VU1A 1DQQA 3FU6A 3LEYL 3QPQC 4RMUA 3SQOH 4KMLB 3GYRA 3P77B 4HIIA 5C7XH 3CHXA 3HHRB 2IADA 3DOSA 4J3WA 1SOKA 5MENA 3RHWK 5GRXG 3U9PH 4LLWA 2Q20A 1S7WA 4UINH 1VEMA 2D7MA 4M7LL 4AG4L 2AXGA 3FH8A 1U3JA 4WW2A 4JMXA 4OVUA 2EDHA 1JGLH 3MV01 4OZHA 5DRWB 4Q2ZB 5FA3A 1ZLVK 1NM9A 4OKVB 3TZVC 3VWJC 2EDMA 2FBJL 1RD6A 4KJYB 5FGBA 3IYLW 3PS6A 2XETA 4PB0H 3BKJL 1OAXH 2ERJC 5F1KC 2ITDB 2VAAB 4OJCA 3KPSB 1NAMB 3SYOA 1HYSD 3BLBA 4FLOA 5ICZB 2I9TA 3N5AA 4M3JA 4AQAB 1KLGA 2AVFA 2BSSA 1XF5A 3QEHB 1JF5A 3MCG1 5IHBA 2IBBA 3MX0B 3ULAB 4Q0XH 3GINA 4OTXH 3GBMH 3IGAB 4RIRA 1D5XA 2NNAA 3NRQA 5BQDA 4UQ3A 3Q8AA 1GH7A 1OCWH 4XN7A 5GZNC 4HU8A 5FF6A 5IQ7L 1FORH 2ZKHH 4MJHA 4YDNA 4JJ5A 1CLOL 3S2CA 1A7BA 1PEWA 3BCFA 2ZXCA 2DKSA 3LH2L 4NO3A 3F6JA 5FYLL 3IU4L 1TNMA 3BN9D 5HYSG 2G0LA 1Z6JT 4DKDC 1XBDA 1IM9D 1LTXA 2FCBA 3NN8B 4NUQA 4UTBH 1KLUA 4X7DC 3WV0A 1NKOA 1IBDA 3QUXA 1ACZA 2W60B 3GMQB 4NIKB 5MP6H 4BBWA 2OR8A 5ESQB 4Z18A 4MX7B 4KXAA 1A7QH 2FNWA 3ETSA 1EFXD 2V5TA 2AK1L 2B20A 3UJTH 5DUBA 4YZWA 2OP4H 5B39B 4PJ8C 2ZUVA 2PN5A 1JL8A 2Z35B 2ATPB 4ZTPH 2H32B 1TYJA 1AZCA 2ICEB 4GMTH 5CJ5A 4JQIA 4BCYA 5I16B 4Z0XA 2VJ0A 4GSDL 4JRXE 2DEWX 1IKNC 2X40A 3I50H 4LLMB 1FHGA 1G7HA 2X1OA 2B0SL 2FD6H 2JKSA 4C4BA 3TJEH 4NO2A 1N0XH 2AAVA 3EXJA 1BWWA 2YD9A 1U93B 5E23A 2OX5B 3ESPA 3F7VA 3KAAA 5IJBC 1W8EA 1ZPUA 3MRPB 2NY3B 1F90L 2EEBA 2F2HA 2IWKA 3GJFH 3F8UB 4OF0A 1Q0XL 2NY6B 5CJOL 1H15A 3QI9A 3I6GA 3KDPB 4EAEA 2LAAA 4S1QL 1T6BX 4I4WB 5T5NG 3L95B 3UC0L 2JIXB 2WXGA 3NJXA 2HT2C 4XPTH 2QPUA 2P8MB 4UDUB 5LHDA 3NAAH 1CFSA 1JRHI 3ATAA 3A21A 3QDGE 1GJWA 2OR7A 1WBXB 4OR1A 3QORA 5GRUL 1FVCB 1KT2B 32C2B 5J13C 2XV2A 1Q0YL 3FQUB 3MRCB 3DROA 1BXUA 5D6DA 3TJEL 2CU9A 3US9A 4JNXA 4V1DB 2WZ6A 4DP1X 3K71B 5D96C 4AC2A 1W16A 1NGYB 1QSFD 5FYJL 2KZBA 5ABZA 4ZOCA 1KJ2A 2BVEA 1RJYB 1WRFA 5DLML 4ODXA 5EU7C 5L9DL 2VZSA 4F7TA 2NQDA 2OJEA 3HB3B 4I1RA 1OPOA 4F7PB 3G08A 3BP6B 2GEQA 4L4VA 5H4ZA 3AWEA 4OI8A 1JTTA 3Q2VA 3VXMB 1BD2B 1QLFB 3FTVA 4XVOA 2HRGA 3F6IA 4XOBA 5H35B 5CBEB 3H9SB 1NDGB 3NFSH 1IGJB 5HDQH 2XICA 2PCFA 4ZS6C 3NA9L 4PP1D 3GLAA 2EIKB 3DWTA 3RNQB 3OZ9H 3TO2A 1UXSB 4D7PA 4Y2OA 1TO5A 1OAYH 4NSKB 3EYFB 1LO4H 4RFEB 4UTBL 5C0CE 4GW1A 2B7DT 4JQIL 4L2LA 3SOBL 3BPOB 43CAA 4OAWB 1GYVA 1PYWA 2YA2A 4OLVH 3KPSD 3TO4C 3Q2WA 2DYRB 3O2DH 4Y1TA 1KTCA 1MCRA 5JHAA 4FYQA 4PJXA 1FFPA 4OZGA 3QUXD 5BO1L 1H6EA 2WXMA 1HINH 1UM6H 4GKLA 5C0BE 2J1WA 4KRPB 4MDJA 5GSRA 2EVJA 1AKJB 3QG7H 3UTSB 3IFOA 4X99A 1XD1A 1OK8A 4F2MB 4XXDB 2ZTBA 4RGNB 1MCDA 3ULUC 1DBKH 5A2IH 5TK2A 5KS9A 2NQCA 4IRSC 3WKYA 1RSYA 1F2QA 1AHWB 2E7DA 5JOFA 3EYFA 3MDJA 1ZT7A 2FEJA 1EIBA 2XU9A 1H6TA 1QI4A 3LEVH 3CH8A 1OANA 3QWNA 1YUHA 2FBJH 3WU1A 2F8OA 4AE0A 2DDQL 3B7UX 4QRUB 1WE5A 4ZMOA 5I2IB 5D6CA 5DJCB 4EO5A 5HVHC 1J1OL 1F3RB 2Z65C 5GGQL 1BD2A 2B15A 1JUFB 4UINL 5CIPH 2OCCB 1YMMD 3PU7A 4HZAA 2EKJA 1HDMB 4AMKH 2O5YH 2B1AL 3WTYA 3Q3GB 2J43A 3QJQB 5HHMD 3HA0A 3KS0H 2UZYA 3W9DA 2JB6B 2B16A 1D6EA 1FAIH 2C5DC 3UTZB 3VXRE 4PJHF 3EF7A 4QXUL 3C6LC 2Q87A 4IKIA 2F18A 3QIUA 4BWTA 3QJZA 3D0AA 2HFGL 3BVWA 3ULSB 4TF4A 1IX2A 2GJ6A 3RZCA 1EJ8A 3KJ4C 1MCKA 3A67L 1JNNH 5TJWK 1BAFL 1RZKH 4JZJB 4GI6A 1IAKA 3NABL 3GSVA 3L45A 3CUPA 3EGXB 2AKRA 3DV6B 2BNQA 2WWMD 2X4RB 4JM2C 4TYUA 1DLHA 5DVKA 4DKFH 5ACZB 1AGBA 1WAPA 3QDJA 4YFLF 3UPRB 5L4FA 1EXUB 4R96B 4QUOA 1NCNA 4OF6A 3MKKA 4GP4B 3U46A 3MV7D 1LYQA 2A74C 4Y5XA 2A9NH 3TBWA 4GQ9L 5IVZA 1QNZH 1K2DA 1A9EB 1PY4A 5ANME 3K2UL 4QRQA 3FRUB 1A65A 2VUYA 4UUJA 5IT2H 5KVGL 1J1XH 3MFGB 4YDJB 4YBLB 4U1LA 3A24A 4V1DD 2CBQA 3CIQA 2Z4QB 5LBSH 4NBZB 4UIMA 2J12B 3C8HA 3Q44A 3CWGA 4NZJA 2C9SA 3PWPB 3R19A 4QI3A 4MZRA 3EYOA 3MRPA 3DMMB 4WHYG 1IQDB 1V55B 5D7IF 5E6ID 1K3ZA 3OR7A 5D8JH 4Z7QB 5IROA 2B9BA 3I6LD 1WFMA 1JHKL 4XPHH 1W8NA 3LZFH 3GZQA 3HE6C 2UUDH 4PJ5B 3OAZH 4YSUA 4ZQTA 1XR8B 5K1VA 3O8XD 1AQDA 4ZTEA 4JFVA 1WO2A 1T7XA 3RGVB 4MD4A 5I30L 5DUBB 1H9VA 3DSNB 5E2TH 4LARH 2EDEA 3Q5OA 4Y19D 4YHZH 5DJ8B 1CR9H 3WY2A 1P1VA 2HFTA 3WG7B 1IGFL 5D1QE 1F4HA 1X7SA 1UZ6E 1BVKA 2WSKA 2ZG3A 1MWAH 3EHBC 4K0OA 4RIRB 1F6FB 2E59A 3BGMB 3MUZ1 1GZPB 2IBGA 4PYHA 4F24A 5IMMA 5HHVL 3C8KA 2EAEA 3ECVA 4L5FL 3UDWA 3QPXL 2UVEA 4ZS7H 4OM0H 3W39B 1WV7T 5SX4I 4ZQKA 3U36B 3J2PA 4ANUA 2DLHA 4NC2B 3B8SA 2O1AA 3PWVA 2R29A 3L48A 4KKPA 5EF1A 4BWUA 5E2JA 5I6PA 3KWUA 3REWB 3SDYH 3U9UA 1T80A 4N0UE 3QUYA 5C2BH 3ARBB 5IMLB 1A1OA 4KROC 2NPLX 2XTJE 3PYCA 4DERA 4G8FB 1I1FB 4CC4A 3QZBA 1VCAA 3TP4A 2EXWD 5IVXF 3U7WL 5EBGA 5I66A 1PW3A 3ZUCA 1AS7A 1Q9WA 3NDZE 3DVFA 3RL1A 3W2DL 1UWXH 4DN4H 4OZIA 5C6PB 4ZW5A 2X70B 4O9HH 3ILDA 3RIAK 3VFSB 4NT6B 1D5ZA 2MSPA 2R1YB 3LZPA 4XP9L 3D05A 5J4MA 1Q9LA 1SGKA 4MZIA 5AW8B 1S5HB 1FCCA 5HHMB 4WUKL 5E2UH 4LPTA 1UXSA 4X7SH 4A2GA 4U6YA 4WWKA 4CU7A 2J88L 4XMUA 3D1MC 4L4TD 5CP7A 2DI9A 3Q8BA 4K7FB 1GS8A 5MENB 5AWNH 3MUGB 4KRNA 3K8MA 4XE5B 3MV9E 4BQBA 1QLFA 1RUPH 1P4LA 5DD0H 4J28A 4BFIB 4P2RE 1SVBA 4NN6C 2NY6C 4NM4H 1UACH 2XV3A 4FL4B 1UKQA 5E1GA 4XVJH 4NCC2 5T3XE 5F6HJ 3VRIB 5GSVA 5GZND 4CSSA 4YE4H 1G9HA 1V7MH 1IO4C 4JUSA 5ID1A 4OFKA 4O51B 5IMOA 3DURA 3CFTA 2YAQA 4LNVA 8FABB 5ACLA 3O45B 3CDZA 1OGAA 3CMOH 3MV7B 2E27H 4OLZH 1ET5A 4UTBA 3V4PB 1UEMA 3QORB 4N8PA 5C3TA 1NSNL 4PWFA 4Z0BH 1SLUA 3QIBB 3EZJB 5GJSL 2WANA 5K59F 3EOTL 2R1XA 4P3DB 5LBSA 1NPJA 5HDBF 2X42A 2Y5EA 2C9QA 3IPEA 1FFOA 2HXAA 5EMYA 3ILQC 1NMCC 3UL4A 3B2UD 5FWQA 1QX1A 5CR8A 1F86A 4FXKA 5EC2A 4HPYH 4ZUVA 2VIRB 2X05A 4JO4L 2VZTA 1SQMA 4GT0A 4HYTB 1Z9LA 4UM9B 2J4WL 1IAOA 3TC9A 3BYYA 3C60B 3HLAB 2CBMA 4APXA 3C6LD 3WMSA 2Q9OA 3ISYA 1LMKA 3S37H 3D2UA 3VDAA 3X1GA 3ZE0F 1UATA 3GBNH 1NC2D 5EDSA 1Y6KR 3MZTA 3V4PA 2IPTL 3IXTA 4IHOB 3V8CA 1LJMA 1OT1A 3CLEH 3K2UH 4GAJH 4HJJL 5G4NA 5T5NF 3V6OC 3LMJH 5AB9A 3SBWA 1TZIB 2J5LC 5BZWB 1I9JH 4L8CB 3MNDA 4GI9A 1UOWA 4DK6A 4O51A 4LLUA 1G9NC 4QD2E 4RAUA 1JHLH 4LPXA 4YE0A 3AC0A 2IC2A 5DD3H 1FFOB 2H32A 4BSVB 1YNKH 4UMGA 1F97A 2B59A 2Q76A 3MXWH 1SXSA 3EJCA 2H1XA 4FG6C 3O2VH 4MLSA 5I1CH 3IMBA 2Z31D 1HYSC 1EERB 1H3VA 2D2CC 2OZNA 2WKGA 2YZ8A 3WNKA 2EE0A 3H0TB 1JV2A 1A3RL 3HTLX 5GGVH 4TTDD 3QORC 4BKLB 4CSPA 2ZYIA 5BRZB 5AB0A 1HXYB 3G6DH 3SYCA 1TQVA 4NI3A 3FCTB 1L4IA 3B3IA 2BOLA 1OK0A 3NPSB 5I0WA 1HWHB 1BZEA 3WIHH 4Z3TA 2J57A 1YC7A 1OP4A 3A67H 4IRSD 2X6CA 1KGJA 2WIIA 3Q43A 2VLME 4PBWD 2YN3A 3NACL 5I6OA 5E95B 1ITCA 4XNYL 1NLBL 4N2LA 1F58H 4PJFA 2OJZL 3LPOA 5A16B 3UG3A 3WE6A 1DJZA 4QXUH 5FLVA 4EKJA 1E7VA 5LQBL 3U83A 3F2LA 4TOYL 1YCSA 4QJ4B 1MW1A 1DUYA 3TA3B 2VERA 1X4XA 3MBED 2JLLA 3H7BA 2HRLA 1TCRB 1E4XH 3CJJA 1KYOJ 3L7EA 5I9QB 4CJ0A 1OAZH 3QCUL 4YBQC 5I5IA 2XWJA 4F8QA 2W80C 4TULH 2P44B 2OA9A 1JPFA 4AIZB 5DDHA 2E7LC 3D25A 1HIMH 1L9QA 1NCJA 4OFIA 5E5LA 1GTFA 1VHPA 4MAYB 4N1CA 3G7TA 2ED7A 5JQ6L 4U1GC