4F20A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
331
structure length
331
Chain Sequence
AKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGSADGDSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/cytokine
molecule keywords Clumping factor B
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 83
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A02
4BBWA 5CFAA 3IRZA 4MBRA 1R17A 4F27A 3V10A 1N67A 4F1ZA 4JE0A 4JDZA 4LEBA 4Q6KA 3ASWA 2VR3A 4F20A 3AT0A 4JDZB 2Z1PA 2Y7NA 3IS1X 5CF3A 5IHWA 3IS0X 2RALA 2Y7LA 4LE8A 1R19A 2F68X 4F24A 4FJ6A 4RMBA 4LEEA 4MBOA 2YLHA 2Y7OA 3AU0A 4B60A 2F6AA 3IRPX 4B5ZA 2Y7MA
chains in the Genus database with same CATH superfamily
3HI5L 4MSWA 4I87A 3AWFA 4MSWB 3QZWG 3TF4A 3HHMA 4M7JL 1SJHA 4XPTL 2F1BA 1IKFH 4OZIF 1SJHB 4WCYL 3O8XA 5BOZG 5JOEA 2CCVA 4X9BA 3O8XB 2W8CA 3DIDA 3W9DA 1TYJA 4KRMB 5HGBA 4PQXA 2MCMA 1H3GA 4RGNE 4XB7A 4EZJA 1IT9L 5HGBB 4KZ0A 3HS0A 2CG9X 3JYCA 3W9DB 2GHZA 4JO1L 3HS0B 4JS7A 1BQLL 5ERWA 43CAA 2D03L 3P11L 5ERWB 1CLCA 5ANHA 4X80L 43CAB 1HHKA 1HS6A 5FHAL 2IOIA 2XPGA 3QPXL 4N20A 2C5DC 2Y07L 1HHKB 3PHAA 2XPGB 1WISA 4S11A 5HDQL 1V7NH 4M1GL 3LX9A 3OLGA 4ODTH 1TO5A 3FC8A 4MZ2A 4GKZA 5C0JA 4XBEL 4XT1C 5DT1L 1DCLA 4EI5C 1JGUH 4GKZB 4M8VA 4BV1A 2QGEA 5C0JB 1F97A 3HW7A 5GGTA 1QUNA 1WYJA 2Q2EB 1QUNB 3CDFA 2J8UA 3QDJA 5EWIL 4N2DA 1IKOP 2J8UB 3B7RL 3QDJB 4YXLH 2XWEA 2FJSA 4ENED 1IEAA 4JFPA 2DYPD 1I8IA 4RSYA 4RH4A 1IEAB 4JFPB 4UM9D 3TX4A 1I8IB 3ESPA 2ADGA 1BECA 3PRZA 4DK6A 1UH3A 3NPZB 1E50A 4HKBA 2ADGB 3IGAA 1L9TA 3IDXL 3L9EA 2BW5A 1TF4A 2YPLA 4XCYA 3RZWA 4HKBB 4Z0BL 4GG6A 3IGAB 5C3LD 2CK2A 2YPLB 2F5AH 4XCYB 4YHLL 4GG6B 2VMEA 3VFSA 2HUHA 4HK0A 1O9WA 2BS8A 1QW9A 1SOQA 3VFSB 4E41B 1KGIA 3AU1A 4HK0B 5T1JA 2O30A 4JM2C 4H20L 5IEHA 1DTUA 5IEHB 4PCSA 5GSRA 4HGKC 4P0DA 3TZVA 5C1MB 3NK4A 5GSRB 2QGCA 1TJXA 4HCRL 1QBLH 3TZVB 4DTGH 2J4WH 3MX0A 3RVTC 1N8OE 3L4VA 5CMAA 4X5WA 4KKPA 1KEML 3MX0B 1KWGA 5CMAB 3UZEC 3MTXA 4X5WB 1OGAD 2Y7MA 3TOPA 2AEWA 1T5XA 2GJPA 4NGHL 2V9RA 3SCMD 1NLBL 3EO0A 2I9TA 1BGXH 1LDPL 1MFBL 1T5XB 1ID5I 2DQCL 3MV8D 4X7CC 5I1EH 3EO0B 1EA9C 2I9TB 1PZ3A 4BK5A 1HK6A 3KPRE 4KY1L 2ENQA 3VI3F 2PR9A 5GGTL 2G3XA 5D6DC 3UTZA 3EH5B 1JL8A 2W92A 5KSAA 3VG9C 1ODUA 3UTZB 2GI0A 3AQYA 2MSPA 3MJGX 3QJHA 1UT2A 1KIQA 5FX3A 1NFAA 5KSAB 5MEQA 3EJTA 5CUSH 4MJIA 1F4HA 3QJHB 4D94A 1KIQB 3T0WA 5MEQB 1OD7A 4MJIB 1NDTA 2GIYA 3GJFA 5E6UB 1PPIA 3GJFB 1IAOA 5T1KA 1IAOB 4P5RA 4KXZH 3QIWA 1JMZA 2XV0A 4G72B 4L8SA 3O6LH 4YHZL 4HUXA 1T83C 3QIWB 2P5WA 4L8SB 5EOCH 1E5BA 2X40A 3RL2A 4HUXB 1KV7A 1KENL 2P5WB 5IB4A 3RL2B 4KI5D 5TGBA 4JR9H 3QGVA 4UAHA 1SOXA 5IB4B 5TGBB 1XGUA 2ZX6A 5DJ6A 5KBNC 3AT8A 3S37X 1COBA 1XGUB 2R23A 5DJ6B 4O58H 3Q2NA 4HEMA 2NTSP 2OMNA 2J8OA 2JKJA 2R23B 3LS5H 5E0FA 4QCIA 3H8NA 3ZW3A 5D71L 3WG7B 4UMGA 4WWID 4NS0A 4QCIB 4RCAA 3VYOA 5J11C 4PRHE 3WY4A 1FBIL 1NUGA 2CE6A 4HJSA 2VSKB 2RD0A 4L5FL 2CHNA 2VISA 1A9BA 2QPEB 3SE8L 3VA2C 3G7TA 1KGUA 3MNWA 1UD5A 2VISB 1A9BB 3MNWB 1P4BL 2PPCA 4DEPC 2B4CC 3S88H 1H19A 1J48A 4AYDC 5F7BA 4AK1A 1LO0H 4G6JL 4M43L 4FF9A 4P9MH 1GKEA 1RURL 3NIFE 4B27A 1MJ8L 2A2QT 4UNIA 4JDTH 5JHMA 4N2MA 1I9JH 1LEGA 1NPJA 4WLCA 4Z3JA 2QV2A 4JQXA 1LEGB 4FQ2H 2ZXWB 2DQDH 3FFCE 2XTLA 3L4TA 2XX0A 1JRHL 5DC4B 2NY1B 3CPLA 3GUTA 5EC2A 4X7SL 2FATL 2R2BA 3NSFA 5I71C 3CPLB 3S5LA 4XMLH 3GUTB 3B2DC 2R2BB 1MAML 1RULH 3S5LB 5H8DA 2FWLB 4P5TD 2D31A 3T08A 1XBRA 3EZ8A 1NIEA 3EBGA 3L45A 2D31B 3I3DA 1E8ZA 1M57B 4DF9A 2GB2A 3IDJA 3ZTNL 1NEZA 1FJ1A 2PWGA 1YY9D 3IDJB 3JWDH 2MCAA 1NEZB 1FJ1B 1IO4C 1E8XA 3MLPA 1T4WA 4LIQH 5IJDC 3MV7D 2MOQA 2NY5H 4NKQB 4RIRA 4ZMAT 3SHSA 2W0PA 3C5JA 1II4E 5B7MA 1KTLA 4RIRB 3D2UD 1A7QH 2ED8A 2IAMA 3C5JB 4M1DH 2X1XR 1MWAA 1KTLB 1I85A 1QA9A 2IAMB 3BJLA 4GOSA 1MWAB 1QA9B 1UYWL 2BIQA 3MBXH 4OF3A 1S7SA 2F7OA 3NIDE 3QUHA 2BW4A 1FIGH 1SMOA 4E9SA 1S7SB 4EPSA 4PJHA 3S5YA 4O9HL 3UAEA 2GI7A 4BE5A 4KKLC 4PJHB 4UZSA 4RAHA 4F24A 4F80A 5E1IA 3VX1A 1XQ4A 4PEEA 4Y1AA 3P3YA 3UAFA 1CURA 3PPSA 4Y1AB 3UTOA 4UQCA 3VYPA 4ODVL 5GRVL 3M07A 4F7KA 3KYAA 2WZ5A 4XPAH 5TQ0L 5C07E 2CUIA 3AS3A 2V5RA 5EULV 3MU3A 3UJIH 1FFTB 1NPNA 4QRTA 2W1NA 4OVVA 4URTB 4ATTA 4NRZA 1U21A 2NQDA 4G7QB 4QRTB 3WS3A 1A3ZA 2Q7YA 2QJDA 1H8LA 4NRZB 3RLSA 3WS3B 2EVFA 1JYVA 4AYEC 2BVTA 2P80A 1PEWA 3BVNA 5LO7A 1SNRA 2Q7YB 5KVGL 3H42L 1A02N 1CBJA 3BVNB 4A7GA 1RZ7H 2L7UA 4M7ZB 4A67A 5H4YA 2PPEA 2QLYA 3LH2H 35C8H 1OZTG 4C54A 5J5EA 2VXTL 4G7VL 1MCNA 4MXWH 1CLZH 3DURA 3PS6A 5CZKA 3DO3A 4O2CA 4H40A 1RIUH 3DURB 1E2VA 3CDYA 4O2CB 1TCMA 3E8UL 1JGEA 2CBQA 3JXAA 4R2GC 4E42A 3FSWA 3KDPB 1PW3A 1JGEB 5JNYA 1JZ8A 4E42B 2RTTA 2EE9A 4JL2A 1Q72L 5JNYB 4RRPM 5DMGC 5JDSA 3WTVA 3ABKB 1MWAL 4PWEA 4XPFH 3RIAF 3RNQA 4PJCE 5JDSB 2VXQH 3RWEA 3ESVF 5D1XC 3ZQXA 4HBCH 2EDHA 3RNQB 3V6OC 3K2MC 2EXWC 3RWEB 3E3QC 3OLEA 3FCBA 3MUJA 3PWPA 1TYRA 1MLCA 5FA4A 2FHCA 2Z0BA 3PWPB 3RVWC 4JKMA 1MLCB 5FA4B 2G3ZA 1UUNA 4FP8H 3S7GA 4FQ1L 3HHSA 5HYJD 4MS8D 3ZDXE 2Q6WA 2MRYA 2P3YA 3J2PA 3HHSB 2Y6SD 1Z0MA 4RGMB 2Q6WB 1Y0LA 4MMXC 3C5SA 2APSA 4GFXA 1PMYA 2R4RL 3APMA 4RZKA 5LXGL 3VNZA 1Y0LB 3C5SB 3BVDB 4UOW1 4EN3C 5D70L 2VW6A 1EJ8A 2GTZA 2XZAH 4B0MB 4G7RB 4ZMQA 1X9RA 4CJ1A 2GTZB 3A6BL 3S35H 3NESA 5CLWA 1EJOH 1RPQA 1J9SA 3RY6A 4HF5L 5M95B 3FCUB 4ZNEA 1PZSA 4FLRA 3ULUD 4FFYH 4EIGB 5D7LD 4TNWK 2YSTA 1U8CA 5D8JL 1JFQL 2PWFA 3VNYA 1U8CB 2EIBA 1XAUA 2NMSA 3ULVL 1A7NL 5F7KC 4ELKA 3JBG7 2APWA 3ULUH 2BY3A 1IGJA 4ELKB 4JFXB 3ARBC 2ZUTA 1JZIA 1IGJB 3KPSA 3B9EA 3BCDA 3RTQC 2B14A 3CN3A 3VDCA 3KPSB 3NZSA 1OM3H 5E08H 1TJGL 5LGHH 1NINA 1EMTH 2Q7NA 3FXIC 5DD3L 2QQLH 3ILQC 1D7CA 1FQ9C 1EFQA 4OFYA 3LDBB 4J23A 5IQOA 5CHNA 1TIUA 3UBXA 2IDUA 3OAZK 5CHNB 4PB0L 2AF2A 4L3CA 3UBXB 4KTEH 3MACH 4NHUA 4J7RA 4L3CB 4OGQC 3VI4E 3MLYH 4NHUB 5I76A 4LEOA 2XWXA 4Z7WA 4FXGC 2DAVA 3IE9A 5I76B 1XCWA 2OP4L 2F8XC 4LEOB 1WF5A 2BHFA 5HPOA 4JRYD 4GAJH 1KPUA 4D8OA 2NY7H 4FZ8H 4N2OA 2D9CA 3G5VA 1Q9OA 2K7QA 1KPUB 3BYTA 3AGWA 4M4RA 3G5VB 4OGYH 1Q9OB 2ZXAA 4NP4H 5KTEH 1UOKA 4M4RB 1ASOA 2G60H 2OW6A 1JZ5A 4ES9A 4WVRA 1XB3A 3K6DA 2Q0ZX 3DPDA 2NDGA 4PLKD 3U7WL 3QXWA 3CN2A 3M8OH 4NIKB 5FW7A 2WQXA 2VRAA 2FD6L 4PW3A 4J3TA 1XTLA 2V2WA 2ZX8A 3VW3H 3QIBA 2V2WB 5HYIA 5ANME 3QIBB 1JXKA 3U83A 2VN5A 4YBQC 4AGMA 5D7EA 2E56A 1S9XA 4O5LL 1A25A 3UEZA 5DK0A 2EE6A 1S9XB 3IK2A 4GMSH 5CKAA 3OBAA 1A4KA 5DK0B 2WYIA 4OI9A 5J13C 2IQ9L 2EYRA 1A4KB 3GRWA 4P2QE 2ZCLL 2EYRB 1UD6A 3FB5A 5I18H 2W95A 1N26A 2VXVH 4H2CA 3JWNH 4H8PA 3FB5B 5A7EA 4N2AA 2VTFA 3AMKA 4Y16C 1YQVL 5EF3A 2HAZA 1MCLA 1LWJA 1T0MA 4P3CH 2QV4A 3BAYA 4HK3J 4J8QA 1T0MB 5BVPH 5KVDL 2IH9A 2RQ8A 5C71A 3US0A 4XOEA 3ZYIA 1KJ2H 4XC3H 2J20A 2C4FU 3ALXA 4R97B 5GGUA 4AWJC 4GSDH 2VDMH 3IDYC 2AQSA 2UX6A 5FW6A 3F85A 5GGUB 2HKAA 4ONFL 3UBHA 5E1HB 4WRLA 5JPNC 2F8IA 4LMQI 4R96A 1W6WA 4X8XA 3U4BH 4PAZA 1DVQA 1H3XA 4GO8A 4U1LA 2VERA 5E5MA 2LU7A 3M46A 4MD5A 4R96B 1QZNA 4WZ9A 2Q87A 2DD8H 4F9PA 4U1LB 5E5MB 3MLUL 3QIUC 4MD5B 3SGJA 1D9KA 3F6LA 4UT7L 5FM5M 3SYAA 1VCAA 2YEQA 3R7QA 3WLWC 2WVSA 1D9KB 4BYHA 4BUHA 2CA3A 3JWNG 1AD9A 3ESMA 2J8UE 3B2UD 3QDJE 1AGEA 3QJUB 4EKJA 1GY1A 2JSFA 2ZWZA 1U6AH 1AD9B 4Z9KB 5DZVA 2H6OA 1AGEB 2HFFA 3TU6A 4NO2A 5E8NA 3KWXA 2GYSA 4PS4L 1EJFA 2YAQA 4NUQA 5EEYA 3LQAL 2HFFB 4F7TA 4NO2B 3PIQA 5E8NB 3RHWK 1GA2A 5IVXA 1KDJA 1DJGA 1PKQA 3QQ9D 4F7TB 3IRPX 1G7JA 1NC2D 3PIQB 5IVXB 5TE6L 1PKQB 3B1UA 3MOAL 1G7JB 3A67L 4OZHE 3ECBA 5AD0A 4NZRH 2CJ3A 1NGPH 2XKUA 3GRWL 1KC5L 1UC6A 4JDZA 3ECBB 3NFSL 5AD0B 1NCDL 1F0LA 2CWRA 3UYOD 3B2VL 3EAKA 4JDZB 1BREA 2Z1PA 3GZKA 4YDMA 1URIA 1NC4D 4ELMF 3W39A 3CXDL 1AG0A 3MLWL 3W39B 2YQ2A 4DP5X 1URLA 3P30H 1JPFA 2YGPA 1BYPA 3W38A 3DUUA 2Z92A 4MWFA 1JPFB 4FKEA 3DUUB 1EEZA 2Z92B 1ZHBA 4LARH 4H8WC 4MWFB 1MHPL 1EEZB 1PS3A 1ZHBB 5DK3A 1CXHA 3CLEL 3E9TA 3RFRA 3QQ4A 4QT5A 1E0OB 4FADA 4ZAKC 4WHYH 3QQ4B 3PL6A 4PRIA 4QT5B 1JD7A 3TBVA 4RA3A 5CFHA 2PO6D 3PL6B 4PRIB 1M9WA 1JE6A 3TBVB 2ADFH 5GZND 2EE0A 1A5FH 1DSFH 4XI5C 5H37H 4PRBA 5IHZB 2Z91A 4JCWA 3QRGL 4PRBB 3UTTD 2Z91B 3N85L 1HZLA 5EU6D 5E6ZA 1CU4L 1M1SA 1OL0A 4UV4L 1F41A 1RK7A 4L3ED 5DVLA 1MCWM 1OM9A 1JXFA 3BISA 5HGGS 3RPIA 2DBLL 2VLKD 5AL0A 4U1GC 2WQVA 5I5RA 3RPIB 1GL4B 5FYKE 1BQUA 5D55A 5DJ0A 1J9TA 3DIFA 5DJ0B 3SGEH 1TXKA 3GM8A 6PCYA 4J3OF 1U8JA 3DIFB 1RJCA 1RJZA 3AUVA 3PDGA 3KS0J 1U8JB 4FL4B 4ANXA 3L1GA 1RJZB 3T3PF 3ARRA 1I3VA 4WHYG 4KXAA 1KUMA 1TZ8A 1XV8A 5DD1L 1MCQA 4F15B 1OSYA 1A8JH 2C1OA 3AT9A 2E6QA 3OM3B 3CWGA 2Z6FA 2C1OB 5H37G 3O4LE 4NQSA 3DMMC 3IRZA 2H3NA 1IBBA 3D9AL 4NQSB 1B9ZA 5I74C 4EEEA 2H3NB 2MEJB 3HPJA 5D7JD 4TOYL 2AJYL 4EAEA 3HPJB 3BPNB 4ZW3A 3BCFA 4BFJA 3TJHD 3B7YA 3TH4T 3PWUA 4HEME 2NTFA 4BJLA 4YPJA 1ROWA 3PWUB 3P73A 2NTFB 4GJTB 2MQCA 3BIKA 3IJHA 3VM7A 1A7OH 1YNLH 1MCFA 3P73B 4BD4A 1F4WH 1NCOA 1KGJA 2J1ZA 3BIKB 3IJHB 4X4YA 1RV6X 3SCMC 4OCXL 4X4YB 5KJ4A 1OF2A 1L0XA 1QQDA 3QAZC 4IBVA 1OF2B 1QQDB 4JO3H 1JI2A 2B7DT 3MLRH 4AKPA 4B9JA 4EUPA 5JQIB 1G4RA 2BERA 3MR9A 2FJFA 2V9TA 4NQCE 4HZ1A 4A7QA 5IT2L 4EUPB 4ZK8A 1VCBC 3MR9B 2FJFB 2P48B 1IBGH 3ET9F 2F58L 4LDEB 1H3PL 1MFAH 1LO2L 2DF3A 4B9ZA 1ETA1 4NWUH 2HTKC 1DVFD 3VVVA 5I73B 3IJ7A 3QDGE 1FAKT 1CD9B 1LMKA 2R59A 4M8RA 2H45A 4OR1A 1DBKH 3L4XA 4RFNC 5AKRA 2C9RA 2IGFH 3KLHD 4R26L 3ZBMA 5L0QC 4JLRA 1F2QA 3O6FA 2WY3B 4JLRB 1CGSL 1AZVA 2YKLH 3MJ7A 3O6FB 4NQQA 5LUMA 3MJ7B 3FFOA 3FUIA 3MV11 1J1XH 4LSTH 1Q0XL 5ELIA 1UWFA 1FFQA 1TENA 1V54B 2BWIA 1TDQA 3DUHA 2ZYRA 4C55A 1P5UC 3BUPA 4WW1A 3WNIA 4WCYH 5K69A 4ABQA 4WW1B 4YHPA 1GSMA 1XIWD 1DQLL 4YHPB 1MRCL 5AYUL 1E5CA 3IBEA 2X6CA 5SX5H 4KQ0A 4JO1H 3NDYE 3L1OL 5DO2C 4MVBC 4JKLA 1SBBA 5L4MA 3QEHA 2JQZA 3BDYH 5J4MA 3DX7A 3QEHB 4K8RD 3HG3A 3KL5A 3HPLA 1QPKA 4G3YH 3DX7B 1D5MA 2EEXA 3CMOL 3HPLB 1S5IH 4LAQH 1VACA 3QFJA 1D5MB 3MYZA 3JV4A 1O0VA 4PJHE 1VACB 3QFJB 4C59B 4IRZH 3JV4B 4RMVA 3FH8A 4K8RH 3MNDA 2A4ZA 4FYQA 1NICA 1XZ0A 4Y1AE 3II3A 1CL7L 4RESB 1XZ0B 2UZIH 4XBEH 5DT1H 2OZ4H 4URKA 3VU2A 1QX1A 1R3HA 4CJ0A 4XTRD 2X3AA 3CFUA 1R3HB 1UUSA 4JCLA 1M2VA 5EWIH 2X87A 1YECH 1E65A 2LFGA 5GGSA 1M2VB 5GGSB 3WN6A 2F7QA 3WGVB 2OI9B 3H53A 2E86A 3MXVH 4TQEH 5JA9A 1ZLEA 4Y1SA 1K4CB 3K6NA 5GIRA 4I2XA 1MI5A 3JWDC 3KZ8A 2W9LA 4YSTA 5GIRB 4I2XB 1MI5B 2F53D 4J27A 4OQ1A 3IDXH 2I25N 2NR6A 3NCYS 4AMKL 3HNVH 5JW5A 1A3LH 4JN2A 2NXYD 1PD1A 4YHLH 1YY9C 1UZGA 3CFNA 4U0RC 5JW5B 4JN2B 4ZW5A 1E7UA 1UFGA 3IDMA 2OCFD 4DZBA 1UQSA 3EOYG 3QWQB 5C9JA 2IVFC 3IDMB 3LKPA 4K94L 2NW2A 1UQSB 4FTVD 4OFDA 4S1DD 4DZBB 2VQ4A 3CFKA 2ZZUT 1OHZA 3LKPB 5C9JB 2A74C 2NW2B 1V3MA 2JTDA 4CC1A 3CFKB 3HN5A 1GMIA 1AXTL 1CF8L 2UV3A 3OKOA 5CWSA 5C6PB 4HCRH 5AZUA 4JFSA 2JELH 5FUOH 3OKOB 5CWSB 4GYBA 1NL0H 4QLWA 5BQ7A 5FV2A 5KW9L 4GRLD 1KEMH 4ZODA 2GIMA 5BQ7B 2YAEA 4EZLA 3QCVH 5GGRA 5J6GA 3LTVA 5GGRB 4BA8A 1S7RA 1TJHH 2CJSA 2XWZA 4LKCA 2LGNA 5J6GB 5KWYC 1T7YA 2K3TA 1S7RB 4LKCB 2HYMA 3X17A 4JKNA 2XU9A 4PV1C 4U49A 2HZHA 2PTTA 1AR1C 4FN0A 4OJFH 2WCSA 3Q0HA 2N3JA 2UVEA 2PTTB 1RCYA 2BRRH 4FLHA 3IDUA 4HJEA 4ZMNA 4XN1A 1OCWL 4XNUH 2CHXA 4Y4FA 4WW2C 4PCKA 1EO7A 4Y4FB 2P47B 3LS4L 5I1IL 1XT5A 4N2EA 4GQ9H 3MNVA 4HIIA 4HXAL 3DROA 3BKCL 4ZFGL 3MNVB 4HIIB 4E41D 2OTPA 3DK2A 3POHA 3DROB 3FT4A 2VT0A 1G9HA 4XMUA 1JXGA 4OGXH 3AJ7A 3FT4B 4E5XA 3TEZA 2YSSA 1IAIM 4GLRH 4IBTA 3WTSA 4YHZH 1JUFA 4QJ3B 1O7DC 4WFGE 5EZOH 4E5XB 1NBYA 1W91A 3X3FL 1A2YA 5A2AA 1JUFB 4UCFA 1KENH 1NBYB 2EDXA 1A2YB 4NJ9L 4Z7VE 4B9KC 3GJEA 1URZA 3FQ2A 2BRQA 4HALA 3GJEB 5AVTB 3GKWH 3PABA 4WV1C 4OH2A 5K9JH 1MRDH 4PJDE 4QLRA 2O5ZH 1HZHL 2D7OA 3PABB 2AK4A 4BQ8A 5CSGA 3FF7A 2FH6A 1WZKA 1Z9OA 4WTWA 2AK4B 2BOLA 5DF0A 5BNXD 1OCCB 1ET8A 4HWEL 4NZDA 3QZPA 2E0PA 3DHMA 4JL1A 4M6AA 4Z7WE 3N06B 4JFDD 5LB1A 2EE2A 1M2OA 4MS8C 1P4BH 2CDFA 1MRFH 1DCEA 1T21A 4F7MA 3MN8A 2Y6SC 2CDFB 3JZ7A 4L4TD 4RETB 4WFEE 2R2CA 1T21B 4F7MB 1FO0A 4ZDHB 3VH8A 3ZRFC 4S1QH 1ZHLA 1JSYA 1EDHA 1FO0B 5K9QG 3VH8B 3I9AA 1ZHLB 4ODXA 5I0XA 5I75C 3N1MC 1A6VH 4ODXB 3D3VD 3ZZSA 3KJ4C 3T3ME 5KYUA 4BZYA 4NC1C 1FE8H 3MRIA 3FJTA 3ULUC 2Z8RA 4U6VL 1WFIA 5KYUB 4QRPA 4OCNC 4PJFA 4AGQA 3MRIB 4PVNA 1CUOA 2BFVL 2WWOA 4IS6A 4PJFB 4QRPB 1RMFL 5ADOH 3WEXA 1ACXA 5GRZA 4NBYB 4BKSC 1YRKA 4IS6B 3SZ6A 2PCPA 3WEXB 3RVUD 3LEVL 4TYUA 5DSCA 1ZA6A 4ECNA 1GMEA 3NJLA 2PCPB 3VFMA 1KJ2A 2XPYA 3KW7A 1U8HA 4M5TA 5DSCB 1ZA6B 1K2DA 3FN0H 3VFMB 1KJ2B 1SXAA 1U8HB 1MQKH 1SQ2N 1IGIH 1K2DB 1KULA 4L2YA 2FWSA 5FOJA 4YXKH 5F72S 3VJ6A 1PAMA 2VERN 3ARDD 4W9IC 5JIKA 3QWRA 4N1EA 3VJ6B 4V1DD 3OJDA 2Y06L 2Q86A 3FPXA 3OJDB 1BPLB 4GQPH 3VFRA 5JHBA 3IE4A 2Q86B 1W80A 5CSZA 2CUAA 5D2LF 5J1SC 3VFRB 4KTDH 1F2XK 5CSZB 2AJUH 1MEXL 4NOFA 1UEYA 4EO5A 3HCVA 5LDUA 1B90A 4AL8L 1BIIA 3U36B 3VACA 3HCVB 2F7PA 3A4FA 3JVGA 4XVSL 3AU0A 3NSCA 3HI1A 3P3RA 1BIIB 5E1GA 4DP0X 7FABL 1RIHH 3L2LA 3HI1B 3KH3A 2XJKA 3SPVA 1FO0L 3FHEA 1WV7T 4GRMA 4OCMC 3WEAA 5E2TL 3SPVB 2ITEA 1KXQE 4GRMB 3MQIA 1J0JA 5C8JA 3Q2CA 3MRQA 5C8JB 4PLKC 5CJBA 4GPVA 2R9HD 4RMWA 5MP6L 3MRQB 2DWXA 3HE7C 1E42A 4BK4A 4YAQA 4X6DF 3B9DA 2FT8A 1JZDC 4YAQB 5IBTH 2MCG1 3S6CA 2DQ6A 3IEAA 3UP1A 5KVGH 3UP6A 5EEZA 1WIUA 4K7PY 5HI5D 4ATWA 4ZMYA 3SE3A 4V2CB 5IVXE 4YZWA 1AZNA 4XP4H 1WLHA 3OMAB 2N01B 1QBML 1SXZA 2AANA 2XXGA 2D7PA 5KVEL 5G4MA 5KANG 4NN5C 5EF1A 3ZTCC 4RMRA 4Q58C 3MV01 4APQA 1XD1A 4YSUA 3R4RA 2FX9H 4BKTC 3D1MC 4U6YA 4APQB 4LRIA 2C3XA 4RDQF 5L4IA 4ZQTA 2WPGA 5DR5L 2X5PA 1S78D 2HRHA 4U6YB 4YDLB 4MA7H 1IAMA 5BS0A 3D85D 1S46A 3VTTA 5HVHB 1FHGA 3WD5H 5BS0B 1RVFH 2AV1A 2EIKB 4P2OA 1IC4H 4D9QE 4F27A 2AV1B 3MV8E 3BVTA 3OXRA 4Q56A 4P2OB 2UWEA 3CQQA 5ETUA 3OXRB 1W8OA 1CXLA 3O2WH 4JGMA 3QXUA 2UWEB 5ETUB 2NSXA 1E4WH 1J8HA 2P5ED 3T2LA 2N7AA 3CSTA 1J8HB 5D5MF 4OT1L 3FUHA 4PJXE 4G80A 3GFUA 3ZZ1A 4XZUA 4G80B 4NO5A 4C4BA 5CZVL 2XVGA 3B2MA 3PUUA 4XZUB 1UFUA 1R3JA 4NO5B 4ODHL 4TSAL 4YVUA 1MCPL 2R4RH 1KFAH 4W4OA 1R3JB 1RU9H 5A2IH 5BV7H 3B2UC 1THCA 4CN4A 3ULVD 4HF5H 1H5BC 3BN9D 3ZKMD 3NRFA 3OX8A 2XKNA 3N91A 3QQ9C 3UJTH 2BWDA 3HRPA 1ZTMA 3OX8B 4KI5E 2XKNB 4W70A 5CN3A 4XMTA 2RQEA 3R19A 4OU3A 1E43A 2B0SL 2WBKA 5HDRA 4Q97A 3T4YA 3TFKD 1FSKB 2UX7A 4CVXA 1PF3A 3RUGF 3T4YB 5JIIA 3PV7A 4CVXB 4Z7UA 1OE3A 3FTGA 2BIIA 4LBAA 5I30H 2Q9OA 4YC2B 4Z7UB 3LD8C 1I7RA 4FG6D 2VO5A 3FTGB 3GTTA 5AAWA 3ZE2F 4A68A 1I7RB 5JZ7C 1TQBC 3CFJA 2R0WH 1UKQA 4GRWF 4DVRH 3CFJB 3SY6A 3AFLA 4P06A 3BPLB 4AEHL 4QRSA 4OCRH 2X89D 3U1QA 1X5HA 2A77L 4QRSB 1CTMA 4NEHB 1LTXA 3LNFA 3N42F 2VH5L 4M02A 2PO6C 4HJIA 4B5EA 5GZNC 1UA6L 3V5HA 4N2FA 1PAZA 4U1NA 2VXUH 4W68A 3V5HB 4M6NL 4U1NB 1Z2KA 4F7CA 5HHVH 5BUGA 4CSSA 3LNDA 4F7CB 2EZ0C 3GIZL 5GS2D 3V4VH 5JHDD 4QNPF 1T3FA 3CSPA 2MOGA 3SYCA 4ZTPL 3SDXA 3TV3L 1T3FB 4NAJA 3WENA 2WYZA 3NA9L 4DPRA 3SDXB 4LP8A 1KEGL 3ZL2A 2VN3A 4JFHD 2J5LB 3FULA 5EF0A 2AJXH 4K9EH 5GS2H 3L3KA 5F8RC 1KJVA 2V3DA 4LIQE 2FO4A 5K1NA 3L3KB 5I8OL 2Z8SA 1KJVB 4I18A 1J0HA 2H3KA 1UA3A 4R5XA 4I18B 1X7SA 1L7TH 4K2UL 2WBJA 2IGLA 4NZ8A 1DZ0A 4FYSA 4UDTA 2QVMA 2PPAA 2WBJB 2H0FA 1J18A 2F5BL 4UDTB 3TONA 2B1OA 3H9SA 1RZFL 3ARYA 4P23A 4OJAA 4KMQA 4LSRH 3H9SB 4P23B 1U3ZA 4F91B 1KGYE 3MLSL 4IRZA 3VRLE 4NI3A 1U4EA 1E6OL 1U58A 4J4PA 4P9HL 1OZUA 3N55A 4KK9D 2VDQB 3CN1A 1U58B 3HBZA 4ICXA 2EO7A 3TJHC 3VFNA 5EA0L 1OP3H 3WHE1 1QNIA 3L9BA 4NUGL 3VFNB 1KLFA 1RUMH 4FE9A 2AQRA 4MXVE 2O6DA 2YRBA 1KLFB 1KTJA 3QNFA 1GZHA 3I6GA 4DP2X 3MDJA 2W60A 2WIMA 3LNGA 3IU3A 3I6GB 1LQBC 1CCZA 3D18A 4PG9A 5E5RB 3IU3B 1L9QA 2BSED 1KCLA 3ML8A 2AZUA 3D18B 1JGDA 4PG9B 2QVTA 3QFJE 2C4FT 1JHLH 1JGDB 2VLJD 4ONFH 3MCG1 5F96L 1SRDA 2J6EL 4XAKD 2DIAA 2WP3T 4AJWA 3T71A 3EYUL 1Z3GL 2G5UA 3BKYL 3V0DA 1YLBB 1JGLL 3KLKA 1KB3A 2VR6A 3C2SA 1ECZA 1P84K 4V11A 1I7UA 4H0GA 1I8AA 1MCJA 4EXKA 4YHYC 2BVUA 4DJMA 4DPBX 4ZPVA 5HXMA 5H35A 3KLHC 1I7UB 3Q8AA 3QI9A 5HDLA 5IFHH 4ZPVB 2LW3A 5H35B 3FCTA 3QI9B 1TVBA 4N2LA 5LCVH 3IMUA 4JANA 2EDBA 2X9WA 3FCTB 2YR3A 3IU4L 1TVBB 3ECQA 5JO5A 3CIQA 4JANB 4XVJH 5DZ9A 2VDLH 1Y6MR 3FT0A 2YPVA 5JO5B 3S96A 1RK0A 3O41B 4UT6A 3K7UA 5TE6H 2A1WH 3S96B 1RK0B 1R75A 1ROCA 3VGAB 1A9EA 2XETA 3QEGL 4OV5A 1KC5H 2VLRD 1S8DA 4P04A 5H4ZA 4QO1B 2VDQL 1A9EB 4AQZA 4OV5B 1YEIL 1AQKH 1S8DB 2CRIA 4X4MA 2BVQA 1MREL 2V0AA 4HPOL 2VN6A 2BVQB 5I0YA 3MXWL 2DWTA 3LRKA 3ZDZF 3F5WA 3KD4A 3HMWH 4ZSOA 4HSAC 1I3GL 5AUMA 4LPCA 3F5WB 4K8RC 3PAUA 4ZSOB 3BQVA 4HLJA 5AUMB 5IKCA 3V4UH 3ZVVA 2WHVA 2DH2A 4A6YL 3OGCA 5FO2A 1KJMA 1OQXA 5IKCB 2OJ1A 2B1HH 3K4ZA 3OGCB 1JGIA 1KJMB 1OAXL 3WBDA 3QT2A 1KIRA 4N9OB 2PWHA 1JYNA 2E7LA 4XNAA 1KIRB 5CEXA 1TZHA 2C9AA 1OB1A 5CEXB 1TZHB 4ZG1A 2VM4A 1OB1B 3C6LA 4HXBL 4L1TA 4R4FH 5ICYA 1XXDC 3ULUE 3C6LB 5A6IA 1SLWA 2C34A 5ICYB 1CU4H 3RJQB 3ZIYA 2Z1KA 2XBZA 1OE1A 5CEZE 3WJMA 5L8JB 4M1CD 4CN1A 3S3PA 2DBLH 5IROD 3WJMB 2ROXA 1A66A 3ULAB 1J5CA 3FT3A 1ADWA 3FT3B 5CBEA 3O8XC 4TVPL 4X5LA 2YPVL 4Y19A 5CBEB 4XWGL 4LCWA 4PHXA 2BZCA 4Y19B 4Q9RL 1QACA 1AYOA 4MX7A 4LCWB 1UA7A 3HS0C 5IZ7A 4LLAA 4MCYA 4MX7B 2NXYC 2X10A 2IFFL 2YD7A 4MCYB 3VMOA 1OGTA 3AT0A 1XCQA 2EDTA 1OGTB 4JPQA 4ZUSA 4OGAD 2IPUG 3Q8EA 4S1DC 3UJJH 1XCQB 1KBWA 5FHBL 4Y7OC 1W72L 4ZUSB 4ZXBA 4P3DA 1RHHA 5CP3A 4ZXBB 3ZRSA 1OAQH 4IGBD 4P3DB 1RHHB 3LPFA 3BUQA 4HJJH 4GRLC 1XO8A 3QZLA 4XBGA 2AK4E 2ATAA 1OD9A 2F7IA 4XBGB 4TS6A 5E2JA 1W8NA 2ZUQC 5D96C 3NSDA 1CYGA 4AI7A 2A0LD 4FZEL 5LGJA 1NCIA 4EQ2A 4LQFL 5DJCA 5LGJB 1UXSA 4KH9A 1AO7A 1CLOH 1ORQA 4U1IA 1WWWX 4FLOA 5DJCB 3ZKXB 2EIZA 1UXSB 1UOWA 1AO7B 1ORQB 4U1IB 4UIKH 3TO4A 3H9ZA 1YEFL 2WQRA 2F58H 3BVVA 2EIZB 3NIGE 3TO4B 4YX2H 4JPIA 2KDYA 2FIKA 3F6JA 5E00A 1EWHA 2WKOF 4JPIB 1DN0A 2F8VA 5E00B 3X13A 1DN0B 4PJAF 1FLRH 5I19H 5J8OA 4ZOBA 4HVBA 3ILPA 3TIEA 2XTJB 4R7NA 3X13B 4A2HA 4HT1L 4R26H 3ILPB 3JWNE 1A0QH 4QRPE 2WUCH 1XH1A 4PJFE 4R7NB 3TIEB 4B41A 1EZVY 3TNMA 4DAGL 1GPOL 2WBXA 1H3TA 2X12A 2N1TE 3TNMB 3NJGA 3X14A 4KNSA 4FJ6A 3GJFK 3X14B 1E40A 4MNQD 3RGVA 3UCQA 3QUYA 4XNDA 3A22A 3TZVC 3RGVB 3B3BA 3QUYB 4DPAX 3TASA 5EFIA 3WFCH 2R0LH 6TAAA 1XZWA 3MRPA 4TLSA 2PLTA 5CFAA 1M42A 3S36H 3RWJA 5EFIB 2VC2H 3MRPB 1DJSA 2ARWA 2CBPA 4OTXH 5GRUH 3TFBA 3RWJB 4YBHA 3VX0A 3PGFL 2AW2A 2ZPKH 3V52H 3P4OA 1MRCH 1ETJA 1T5KA 4U1HA 3P4OB 2D7NA 1JNNH 1I3UA 4XMZA 3WJJC 1LP9E 1C7TA 5F8QC 1OWRM 3IKKA 4U1HB 1EEUA 2YLHA 1CK0L 3U7YL 1N4XH 3DVGA 3O2VL 1QSEA 3DJSA 3DVGB 5F9OH 1MVFA 1QSEB 2IAND 2R39A 4EMZA 4HJTA 1DJHA 5DJYA 3SODB 5E6RB 5T3XD 5DJYB 2A99A 4EZMA 1USQA 1TZIA 4P2YA 5I1CL 1RZKH 2BVEA 1KYAA 4GBXA 1H15B 1TZIB 2D73A 3L6FA 1RHFA 4GBXB 5D72H 4CUCA 2XYBA 3L6FB 5T3XH 3SZKC 1AQ8A 3WIFA 4FQJL 5AWNH 4ELDA 4L8SC 4JKWA 2ICWA 5FCUL 5ACMA 1OP4A 4XXDA 3WIFB 5GRVK 2ICWB 3VQLA 4XXDB 3I3EA 3HFML 2BHZA 1CDBA 1N6VA 2WJ7A 4XXCC 4DESA 1FFOA 3RVUC 2LTQB 4ZS7L 1MW2A 1FFOB 2F19H 1PFOA 4I3GA 1EHXA 1NIBA 1IGML 2JI2A 1XH3A 1NIDA 3BP7A 1CJYA 3QK0A 5E99H 4LCYA 5IJKC 3U6RA 1XH3B 1VEOA 3BP7B 5IQ7L 1CFSA 4LCYB 4AMKH 4J3OH 3U6RB 6FABL 4PJEA 1CFSB 5EORL 2DI7A 4PJEB 1SMAA 1YZZA 3EADA 1MCOL 1QSFA 3G6DL 1YEHL 3FL7A 5BS0E 1QSFB 1BFVH 4AM0Q 3LCYA 3I3BA 4XNXL 1OHQA 3ATEA 3DX9A 2D0GA 2DMHA 2UWEE 2VXSH 4HAKA 2I60L 4EBQH 2QDWA 3DX9B 4H0HB 2WN3A 4UTAH 1THAA 1GGUA 3K72A 1J8HE 4L3EE 3QPQD 4XMXA 1OSEA 2VZ1A 3K72B 3MNMA 4KAQH 4UNUA 4HIXH 3C5ZA 1ITCA 3E0GA 3FTWA 4X8JA 2VLKE 4X6EA 9CGTA 3O4OC 4B95C 3C5ZB 3LEYH 4X8JB 1FA4A 3MRNA 2IPTL 4X6EB 5DEZA 3I9IA 4J3OG 4HFUH 2ODHA 2EVIA 3MRNB 3ZHFA 3UEQA 2R9HC 4JRXD 3RI5K 3MUHL 4MLSA 3O3BA 5HYQA 3WFBH 3JT0A 4N0YH 4IU2A 3IFLH 3O3BB 5HYQB 2SEBA 5EZPA 4IU2B 5E6IA 2SEBB 3NEOA 4N8CL 1B0WA 5E6IB 2R1WA 1J8KA 1QOKA 2R1WB 2VR4A 3E80A 3BRFA 2VO8A 5F7EL 2O5XL 3SDCD 1KSRA 4U3SA 4CU6A 2PXYA 2FO1A 2ZCKH 4U3SB 1PD0A 2PXYB 3KL0A 2V5MA 4TLTA 1NSNL 4BCZA 1PEZA 4Z7UE 3DX6A 1GYVA 1S78C 1J9CT 3DX6B 2X1QA 2YXWA 3HR5A 2DM7A 3RVVC 1PTZA 1N5AA 3HR5B 1CI3M 3KWWA 4UQ2A 1U8QA 1N5AB 2F54A 3GHBH 4I48A 4LRNL 1OGSA 4UQDA 5AZ2L 1ES0A 3KWWB 5CJXC 1HZHH 4UQ2B 1K8IA 1U8QB 2F54B 3MBED 4I48B 2FTAA 3SYPA 1ES0B 4JRFA 5AKSA 1K8IB 5BCAA 3AUWB 3I9PA 3NCXA 4PIBA 2I9LA 5HDWA 3VXUA 2APFA 3MCYA 3TESA 5E2WL 5GQBA 2H2PC 3VXUB 2I9LB 2E3VA 2X4PA 3G9VA 2VZ3A 2X4PB 1U2CA 4IDJH 2WO3B 4MB1A 2CM5A 2R29A 1CFVH 1QWNA 1ZA3A 3DHJA 1HXMA 1XB6A 3U48A 2AZAA 2J5WA 1ZA3B 2GFBA 4HUMB 4UOZA 1HXMB 2VSCA 3GC3A 2GFBB 4GIPD 1MJJA 1SOSA 4M7ZC 2OR9L 1IV8A 4YIQA 1MJJB 5I6XC 3MLXH 2YD2A 2AMUA 2GTWA 3SDXE 3ULVC 3SPHA 3HN3A 2FEDD 2GTWB 5ECGA 3ZKMC 3QJFA 2YO3A 3DTDA 4FQXA 2YWYA 3QJFB 1T04A 1ECYA 2BFVH 3JUZA 4LL4A 5GGVL 4F2MA 2NX5D 4FQXB 1T04B 1YA5A 2VRKA 4FG2A 4F2MB 3TFKC 2G2PA 1B0RA 2XRAL 1J1PL 4F58L 1B0RB 5B21A 5I8KL 2X6VA 4M6ML 4WGKA 3DV6A 2YGQA 3CZKA 4FG6C 4AX3A 3DV6B 1WFJA 1JCKA 4C56D 2G5BA 4PD4K 3F6IA 5E9DA 4AYSA 3MZGB 2G5BB 3LZLA 1JP5A 1NMAH 5E9DB 1AHMA 3VSTA 3VD9A 3MKGA 3W5MA 1KMGA 5AG9A 1R9FA 2J72A 2JJSA 3K5SA 3UYRH 1QNZH 1ASPA 4BSVA 3QORD 4P59L 4BSVB 2H1PL 4E9QA 1WO2A 2WO2B 4GQQA 1TSHA 4PU2A 3PNRB 3QUML 1N5YL 1MZYA 2VDRH 4AL8H 4G7YL 4KDWA 5D4JA 5DQDL 1CGTA 2R29L 4YFDB 4X99A 3TH2T 5BRQA 3WFZA 4JHWL 2WW8A 2YOAA 4X99B 3TA3D 1YG9A 3I9GL 2VDLB 3DA0A 2X0UA 4N0UA 1RFDL 2F9BT 2FZ3A 4QTFA 5GGRY 1HFUA 3Q8FA 3L3OC 4TPRL 4N0UB 1J8RA 4LDOB 2FZ3B 4FFWD 1BD2A 5A1AA 5KYXA 3U4EA 5I1DA 5FYKU 1BD2B 3D39D 5KYXB 1I9RH 3U4EB 2DTML 5I1DB 1WHOA 4W9CC 3ZHNA 2DKMA 1QPPA 2F53E 1MFUA 3IGUA 2DJMA 3SDAD 2YA2A 1XR8A 2HFTA 5T1LD 2QVKA 4HAFA 3LZPA 5E9AA 1XR8B 3TTSA 2E46A 4LNRA 3BDXA 3TYGH 2HLAA 4WK4B 3ZTDC 4OLYL 4LNRB 4QTHA 4FTVE 2HLAB 5L9DH 1R0AL 1QBMH 2YUZA 4QTHB 1XHHA 2CBTA 2WZAA 1U8PA 2QEJA 1SY6A 2WXGA 4KK9C 5I1HH 2GUYA 2WXRA 2V17H 4MMYA 1U8PB 4BUQA 1N0XL 1NCBL 1ZY9A 3P40A 4JY5H 3FQRA 2G0KA 4MMYB 4Q4IA 1N68A 4OB5H 2BP0A 1QFOA 3FQRB 2XWBA 3U9WA 2BP0B 4XX1G 5IBLC 1WEJL 4H8UA 1WS8A 2XWBB 3BT2L 3L17A 3T0XA 4CU8A 3EYVA 3FZUC 4YMPA 5INCA 5I1LA 1IM3D 3AM8A 3EYVB 3V0WH 4ZMVA 4LOEA 4FXLA 1XGZA 1PNCA 5F7DA 2IH8A 5INCB 3KW8A 2FL5A 1UD2A 3QCTL 4OFIA 5I1LB 2DIBA 5BRPA 5F7DB 2FL5B 3L2NA 2HPTA 4UOJA 3FW6A 5T5FA 2FGWL 3S36X 3L5JA 1X6LA 5IHZA 2A73A 3QIBC 3P9MA 1D2OA 5C0ND 2ZQKA 1MAJA 4QTIH 4Z3IA 1SF5A 2KDGA 2A73B 3MRBA 4W6XB 4WENB 3SO5A 3P9MB 5F93C 5DLLA 1ZSHA 1MCPH 3B5HA 4NPYA 4TRPL 3MRBB 1BVLA 3NFPA 5TQ2L 2QPSA 8PAZA 3IMVA 3DGGA 4NPYB 4DUWA 1BVLB 1GAFL 5C0CD 3BOVA 3NFPB 4JM2F 4A1RA 3DGGB 3ETTA 3P3UA 4F2FA 3GLDA 2Q10A 3OWRA 2GQHA 2NRDA 2X9XA 4DQOL 2A38A 2NXZB 4JVPA 4OZIE 2K8QA 4XCNA 1XB8A 3EUUA 4MLIA 3LKOA 1BBDL 4GXVH 4DN4L 4PRAA 3IN2A 4XCNB 4MCZA 4G6ML 5E70A 3LKOB 4PRAB 4MCZB 1JPSH 3NCMA 3NJJA 1YUHA 3D0VA 5A6MA 1SY6L 2PNDA 5IQMA 1YUHB 4MXQD 4GMTH 1BZQK 2NQ3A 3D0VB 3T0EA 4R97C 4HIQA 1CQKA 4MB5A 4RX4D 1U4FA 4U4BA 1E4XI 3T0EB 1M56B 4FYRA 4HC1A 1QR4A 3F83A 5TF1L 2IH3A 4N0RA 5FFOA 3ILEA 1RI8A 3KLDA 4AG4L 2VLME 4JFDE 1IQWL 2IH3B 4KQ3H 4XP9H 2CR3A 3UOAB 3HKFA 2A77H 5C08A 1EUTA 4ANUA 1TUPA 4RISL 3LZFH 4L4TE 5C08B 5FYLH 3O9WA 1OALA 2WLNA 5LQBL 5GGQH 4ZZFA 3O9WB 2VH5H 5TJWK 3ZQ9A 1YUKB 5CCKL 5HI3D 3KJ6L 1U2HA 5T5FL 2ESVD 3ASOB 1XEDA 5F7LB 4M6NH 3N1FC 1T6VN 1AO7E 4BFKA 2YRLA 2EDDA 3EBAA 4U31A 4GAGH 1OAUH 1G9EA 1E3FA 2CKBH 1BXUA 4PBDA 1NFKA 2FCBA 1UJ3A 3T1FA 5IROC 2MCPL 4KNQA 4HA1A 1IRAY 1UJ3B 4R90L 3T1FB 4F9LA 3QH3A 2XTJE 1QP1A 4WWKD 4YSSA 1XGYL 1PZDA 3AG3B 3QH3B 2Y7LA 1YYMH 3FMGH 3K6FA 1S7UA 3PHQA 4O4YH 1U0QA 1JYXA 3E9UA 4NO0D 2YXMA 3PG2A 4NPKA 1J7VR 1S7UB 3PHQB 4WTZA 3D0LA 1E2ZA 3QS3A 3LXCA 5IW3A 4V1DE 3SGDI 3A24A 3D0LB 4Y8AA 3BSGA 5IWLA 1WK0A 4XPHH 5IMKA 5IVZA 4UV7L 4NQUA 2FO8A 4NFBA 1RZFH 5IVZB 5IMKB 4OGAC 1KBVA 2OFQA 1IFRA 3WIIL 1T2XA 5L2KA 1OTSD 1E6OH 4I1PA 4HC1L 4YLQT 1YMMD 5L2KB 15C8H 4IGBC 4A63A 1J12A 2OX5A 3OD3A 3FHAA 1GVIA 2WAQA 1MW3A 4X9FA 1JXDA 5LGKA 2OX5B 3RGBA 1PG7L 2AAVA 4JPSA 2QQKH 2WQUA 4M9PA 5AB2A 4PLNC 2GY5A 1Z9LA 3DX8A 3IGFA 2A0LC 4MBRA 1S5HA 5SV4A 3DX8B 4LPXA 4Y5XC 1O7VA 3VI3E 2FR4A 1S5HB 1QSEE 4JE0A 4WIQA 1NMCB 2B15A 4NNYA 4NNPL 2FR4B 1OEZW 1AS6A 1PCSA 4EN2A 4NNYB 5DWUH 1IKNC 2J73A 3DOSA 4FERA 4YSRA 2J6EH 4C4KO 3DOSB 3VGDA 4FHBD 2C3GA 1FORL 3EYUH 3VQMA 2AQ3A 1IFHL 3ECVA 5D1ZI 3SBWA 2VKWA 1F42A 5EB9A 4F93B 3TCTA 4F15C 3EFFA 5ILTH 2R2HA 4BKLA 3EFFB 2R2HB 1ZT4A 2X6BA 2V7HA 3RWIA 4BKLB 2I24N 3MLVL 1PZUB 1ZT4B 2V7HB 3RWIB 4RDQG 1CI5A 1PVHA 2H0JA 5BRZA 1Z0NA 3IU4H 4JB9H 1MCBA 5BRZB 1AMYA 5KAQF 2JCCF 4HOZA 5C09A 3VSQA 3BPNC 1EIBA 3Q44A 5C09B 1XH2A 2QKIA 1XSKA 4J3XA 2XXMB 3NJIA 4XXWC 2OA9A 2QKIB 2CR0A 3QEGH 4WHTA 4JN1H 4ZOEA 3WKPA 4PV9A 2K78A 3O0RL 3C09B 4WHTB 1JYWA 1K5NA 2NY0D 2MPAH 4PV9B 1K5NB 4DKEH 4LP4A 1KF9B 1JHKL 2AJVH 4KO6A 1UM4H 3BEVA 2YZ1A 1GGCL 3KVPA 1CIDA 4WKXA 1QSFE 3BEVB 3RX7A 1N3NA 2O6PA 3GUFA 4FNLH 2FSEA 4N3TA 1N3NB 3EG9A 2AI0H 1H9DA 4GRWH 2FSEB 3GMQA 4N26A 3EG9B 1VEMA 4A6YH 5LBSL 3C60A 4FNRA 3TWCL 3GMQB 5I73C 5BVJA 3C60B 4Q9CA 5DD6A 4A55A 1VFAA 4HGWA 5I9QC 5BVJB 5DD6B 4MHHI 1VFAB 4HGWB 4DO4A 1UH4A 2XY1A 3BZ5A 1ZT7B 4IRJD 4LCIH 4KMTL 4XP5L 1HHJA 4KPHL 1H9VA 4MJJA 3NJMA 1P2CA 3OKEA 4ABUA 1HHJB 3O6FC 1DLHA 1HCYA 3OLDA 5D7IA 1P2CB 3OKEB 3GDBA 1DLHB 3HOGA 5D7IB 4ICWA 2APVA 3O0LA 2ZF9A 1P84J 1ZHNA 2XJLA 3LHAA 2OS7A 3V0FA 5IGXL 4E68A 4XN4A 2WXOA 2JMRA 3GXDA 1ZHNB 3B1TA 2DZEA 3FCGA 3T8XA 3GSNL 3K8MA 1GYUA 3KGUA 3T8XB 4F57L 4ZO8A 4I9XA 2MNUA 3KR3H 3DJ9A 5FOBA 3NSJA 4NZFA 4FNPA 4XWGH 4ZMTA 2OL3L 2X3CA 4IJTA 2HG0A 1JTTA 5FOBB 2YC1A 4AQAA 3Q6FA 4MKMA 3X1BA 4Y4KD 4BINA 4YK4B 2BNUA 4K94C 4S2SA 2YC1B 4AQAB 3Q6FB 5C0FA 2WXLA 3MOBL 5J3HC 2BNUB 4S2SB 1N6UA 4JG0H 2IFFH 5C0FB 1JZ7A 2HH0L 1IBHA 2CUMA 3KYKH 4CDGC 2HFGH 5CP7A 1B2WL 4BHUA 2Q5BA 2ORBH 5CP7B 4YFLI 4A7VA 5CJOL 1TO4A 2ZUYA 4WKZA 5D7SH 3Q2VA 4ZJ9A 1BM3L 4O02H 4WKZB 5DUBB 3BKML 5KSBF 4YSCA 4WGVB 3FU9A 2LLLA 3WO4B 3HB3B 2Y2TA 3FUFA 2W0KA 5F88A 2YMXH 1KTRL 3N3EA 3Q13A 2QGBA 5F88B 1K72A 1BSIA 3QPQC 5JHDE 3W5NA 3GMLA 2R69L 5L7XH 2VNCA 3THML 1U3JA 5KJ7E 4S1RH 3GMLB 2V3FA 2VDPB 4FLSA 2D7QA 1S7XA 3IDGA 1S7XB 3IDGB 2PPDA 4LEXH 4XP1L 2VL5A 2JQAA 2X3BA 3SKUD 1WDAA 3VWJD 3RP1A 2VL5B 4TQPA 2DQJH 1A7PL 3GWJA 1YEEH 4IRSD 4OLVL 1BWWA 5FM4A 1SEQL 2AMGA 1NAKH 4YSPA 4DFIA 2GITA 2FBRA 1HXYA 1O9VA 5IF0A 2GITB 1YVLA 1QFUL 1RP8A 1HXYB 3WTXA 4JJ5A 2CGZA 2Z0UA 4KGJA 3L13A 5IF0B 4DAGH 3OKMA 2XYCA 3HIZA 5B1JA 4JJ5B 4U33A 3VGHA 4F2ME 5IB3A 3OKMB 2AXWA 4L9DA 3N44B 5IB3B 2VOTA 3HBPA 2ZWLT 4TUOA 1A4JA 2JI1A 1SM3L 2UZPA 2VDKH 4TUOB 1A4JB 2VDRB 1V7ML 4TNWF 2Q2LA 4PWFA 1Q1JL 4P46D 1JRHI 2J1KA 1P1VA 1IQDA 4NQDA 2IJ0C 1IQDB 4JFFA 4HHWA 4DKFH 4NQDB 2BNRD 4PB9H 5C0RL 1VPOH 1UM5L 4JFFB 3RBSA 2OV0A 3WTYA 2R83A 2R0ZL 4OFVA 2A6DA 5F7WC 1WT5A 1S9YA 1JBJA 2A6DB 2WKLA 1WAAA 3L7FA 5BUAA 4P2RA 1KBGL 3HNSL 3NRPA 4XAKE 1S9YB 3L7FB 1OT4A 2HFEA 3MROA 4P2RB 1KY6A 5H94A 1CK0H 3E2HB 4UB0H 3U7YH 4ZTOH 4OUUA 1OP5H 3ZL1A 5H94B 2HFEB 1FZJA 3MROB 4J2XA 1NCWH 2VDPL 3PNWA 4OUUB 1FZJB 4PS7A 2ETWA 3IAQA 3PNWB 2Y1YA 4BCXA 5E23A 3GZPA 2VDOH 3OLIA 5JW3H 3OHXA 1DQVA 1HILA 4FI8A 4K3EL 2GJ6A 1AACA 3OHXB 1HILB 1I3RA 2DQUH 4QEGA 2GJ6B 3LY6A 1PY4A 5A43C 1BD2E 1I3RB 3QDMA 1MFCH 1JVOA 2FEDC 3IXTA 3C08L 1FL3A 2XN9D 5C6TH 4FQJH 3ALPA 3QDMB 3IXTB 4G6FB 1FL3B 3FU5A 4W9LC 5DJXA 5FCUH 3HRZC 3CNKA 1FG9C 3GMRA 4RMTA 4TULL 5DJXB 1W0VA 3UDWA 3N6YA 2UZXA 3GMRB 2VLRE 3EOTL 1WHPA 1ZANL 2D0HA 1W0VB 4CVWA 4DIXA 1TSRA 2UZXB 3QE5A 4ZS7H 4JO2L 1M4KA 4UNTA 5MI0C 4NNXB 1JNLH 5K59F 3UPRA 5I1GL 2LFEA 1A6WH 3UPRB 3LXAA 2AHIA 5EBWA 3ZQWA 1G5GA 4MDRA 4N68A 4OD3L 4N2HA 5EBWB 3LH8A 3V4PA 2IV9A 6FABH 2FNWA 5EV7A 5EG6C 1O6SA 3V4PB 1A3RL 4XC1L 3X1EA 5PAZA 3LNEA 1HHIA 1O6SB 2H0EA 1BQHG 5DZLA 3VXRA 1B4TA 2G9KA 3VU1A 1U36A 3G6DH 4AL8C 4AIOA 1HHIB 3VXRB 3DC0A 4HUWA 1IGFH 2ITCA 2YPKA 3M1CA 4WAFA 5KS9A 2X4UA 1CDJA 5JW4N 4BRJA 4HUWB 5KS9B 3O6ML 2ITCB 2YPKB 5IFHL 1ZXKA 1AKJD 1DL7L 2X4UB 1L9NA 3VB8A 4DCQA 4X7EC 3QRFM 4DCQB 1U9KA 4AUUA 5IY5B 1WC7A 4ORGB 5EO9A 4O2EA 2Y36H 5E4EC 4JMNA 1WC7B 5EO9B 2NZ9D 4O2EB 2CRMA 4YDKL 5AVRB 3ZYZA 3L4WA 4JY4A 2FQDA 2XZCH 3BFWA 1BBJA 4HLZH 2WB1A 3BO8A 3FB8A 3PJSA 4JY4B 2EC9U 2IPTH 4KOCA 1FFNA 1HQ4A 1EBPA 2WSPA 1X7TA 3BO8B 3FB8B 1CS6A 3PJSB 2BPBA 1F90H 4XCFH 1FFNB 1HQ4B 3SPJA 1IGCL 4WY7L 2ZXEB 1DBJL 1F6AA 1OKEA 4LASL 4ZUTA 3RZCD 5HHXL 3FTVA 5D93B 4P48A 1F6AB 4Z7AA 4ZUTB 3SDAC 4N8CH 2DQEL 1M05A 3V8CA 2ZWYA 1NBVH 5I0WA 4YFEA 1M05B 2FT7A 4BSJA 2MHAA 3CFTA 4KRPD 5F1NA 1K8DA 3WIHL 1Q90A 1P6AB 3T2NH 2MHAB 5F1NB 1FP5A 1K8DB 3G6JF 1CYWA 1B3IA 2EDWA 4DZ8A 5DZJA 5D2LA 3V4PL 5DO8A 3L9YA 3AY4A 4DZ8B 2L7QA 5D2LB 3RHWF 5K33A 2R4SH 3COOA 2WWKO 1MFDL 4GT0A 4YZFF 4ZO7A 1YEDA 1FYTA 1SN0A 4JM0A 1BJ1J 3ARGA 3OKKA 5EUOF 4F8NA 3KLSA 1YEDB 2D8KA 2MJWA 1FYTB 3ARGB 3JVGC 3OKKB 4PJGF 1N67A 4WGWB 3LHPL 5AZ2H 3Q6GH 4OGZA 1F4YL 4XN5A 1NFDF 2C3HA 3KWUA 4YSQA 5CLXA 3HC2A 3H85A 4NN7B 1D7DA 4ZI8A 5E2WH 2PP9A 1G9ML 3ZSTA 2MKLC 1S2EA 4N6RA 5I0VA 2EVJA 3IF1A 4NN6C 2FUTA 4N6RB 4HUNB 5KZCB 3IF1B 1MNUH 3QBTB 4KXDA 4OF8A 2NYYD 2ARJQ 5CLTA 3TN0A 1ZVSA 2ZXQA 2Y3NA 3TIDA 3ARED 1CE6A 2BVYA 1ZVSB 4L1HA 4U1JA 3TIDB 2QTVA 5IJBC 1HKLH 3UG5A 1CE6B 1HL5A 4U1JB 3CBRA 4GP5B 1U8MA 5DUJA 4FQLL 4JG1L 4MNQE 4RGOL 1U8MB 4DWHA 1H3UA 3SIKA 2XQBH 2UUDH 1DDHA 2XV2A 1IM9D 1NUDA 1DDHB 4YDLC 2ZCHL 5T1MA 1CTNA 3S4SA 5T1MB 2WINA 4ELME 2XRAH 5HVHC 3S4SB 3CBKB 1T20A 2WINB 4F58H 3UAJA 5GZOD 1T20B 1ZAGA 4ZW7A 4P2OC 4AJVA 2XZQL 4JM4H 3H6AA 3KEHA 1MCCA 2NY6D 1YEGH 4IMKA 4PJ8A 1A4CA 4DKDC 1CN4A 1MKFA 3N5AA 3QS2A 4PJ8B 3NH7L 4OLUH 1INDL 2IIJA 4Y8DC 1P9MC 4QRRD 1IC5H 5D5MA 1QTYT 4YHML 2VZTA 2YRPA 1J05A 1YHPA 3CBJB 5D5MB 3M7FB 1DANT 4L2LA 5T3XE 4AW4A 1J05B 4ILDA 3T5WA 1IC7L 3B9AA 5DUML 5BO1L 3FO0L 4PJ7A 2X4NA 3C8DA 3NTCL 3LKRA 4W4OC 4G7YH 1DQDL 4PJ7B 2X4NB 2Y2WA 4YDZA 1CB4A 3LKRB 4NAMA 5CN1A 3UROR 3ZUNC 4RMUA 2DKUA 1T2QH 3ZN6A 5CO1A 1RFDH 2YD3A 3W57A 5GS0L 3N40F 4AKQA 1E2WA 1U91A 2W0LA 2XIIA 1CE1L 2TRYA 5F7UA 2VAJA 4UTBH 1N12A 2XQYG 1U91B 4Q0XH 1I8MA 3NCEB 4Q6IA 3TT3H 2P8MA 1I8MB 4Q6IB 3ZDYB 2DTMH 1H6UA 4TSCL 4UT9H 2P8MB 3DRQA 4AC2A 3T3PE 2I7SA 4YC2C 3QJOA 5GJTL 3DRQB 1ONQA 3OB8A 1BXVA 4Z3HA 1CGXA 1ONQB 2ICCA 1EGJH 2A7BA 1SVBA 3E38A 4LSQL 4LVOB 1G84A 5HHPA 3CMGA 3ZE2B 4P9HC 1FI8C 5ALBL 5C09E 3BPLC 4HMCA 4QXGH 5HHPB 4GRWB 1R0AH 2WP3O 3LN9A 5FO7A 1JZ6A 4NT6A 5GRWA 3BLBA 4JZJA 4KVCL 5C0BD 1A6UH 5FO7B 4NT6B 4P5MA 5B4MC 3GTVA 1E5UI 4JZJB 1PZBA 3NOIA 4P5MB 1TTFA 1NCBH 2Z31A 2CGYA 3NA4A 4P2AA 5DHEA 3WKNA 4AQ1A 2WGNB 3B56A 2Z31B 4MA1C 3ATFA 2FQGA 4AQ1B 2J88L 3A5VA 3KS0H 4NM4L 3HUJA 3K2UL 1KACB 1QATA 4YSEA 3HUJB 1AIZA 1TLMA 1MPAL 5TFSH 3T2QA 4PWKA 1CWVA 3D48R 1BZ8A 5AVSB 5JOFA 4JRXE 1FH2A 2BM3A 1Y18A 2J5LC 3V0HA 5JOFB 5ISZD 1W15A 5CINH 3KYOA 4NM8L 5DS8A 2GSIA 3HE6D 1MY5A 3KYOB 2YBRA 3D08A 5DS8B 2GSIB 3VXTA 4AEIH 1ULVA 2YBRB 4KNUA 1SVZA 4ODUA 2LV4A 4PBVC 3FQXA 5FO8A 2ZYIA 1E7VA 1CQYA 3QHZL 5F3BA 4ODUB 3DX2A 4TRPH 3FQXB 3GSQA 5FO8B 2WBJC 3MCLH 5F3BB 4XHQA 3V0VA 2BNQA 3RA7L 3GSQB 4F5CA 1QI4A 1V8HA 4G6AD 4MMZC 3V0VB 1U3HD 3ARQA 2BNQB 2KHAA 4QAWA 4ADJA 1KOAA 2J3SA 4B3VA 1LJMA 2N7BA 5DWPA 3RTLA 5TPWH 5EU7C 3R8QA 1RZJL 2APTA 3QCUL 3GMOA 3MLTA 4J4PC 4LQ1A 4ZD3L 3GMOB 3MLTB 3G04A 5HBBA 3ZTJH 3G04B 3EBHA 4R9HA 5HHMD 4L4JA 4HIHA 2WNKA 1EXUA 2D0FA 4N4YB 1DBAL 3NBNA 2O72A 2Y5QA 4HIHB 1EXUB 4F92B 3NFNA 5DEGA 4IK7A 1BVZA 2XI9A 3NZHH 4PJIA 1QI5A 2QFRA 4AV4A 5JHLH 4FFZA 3NFNB 1RUPH 4WEMB 5DEGB 1P69B 4PJIB 1H0DA 5TF1H 3K8KA 3Q3GA 3TT1L 1FUNA 4AG4H 3WN5A 1IGTA 2RAMA 1IQWH 1H0DB 3FSVA 5LLIC 3Q3GB 1ZHKA 5SWZA 3V95A 3WN5B 1IGTB 4OQTL 1O75A 4WO4A 5HHOD 1ZHKB 1KCRL 3FB6A 2DQHL 5SWZB 4WO4B 3PGDA 3SDDA 3DOHA 3FB6B 1OOAA 1PZAA 1WRFA 4QHMA 3CHOA 3TA4D 3PGDB 5F7AA 3SDDB 3VSVA 3WXVL 4Y4HD 2ZWSA 4DPCX 4QHMB 5CCKH 2EP6A 1EBAA 4M29A 1TQCC 3RFZC 4RWHA 4XOAA 2ZX5A 4XAWL 4KX8A 3INUL 4JUSA 1F02I 2NY4B 3ZTJG 3JVFC 3MV9A 3GB7A 4X2UA 3MV9B 1ZD6A 4WFFD 1NAMB 3F01A 2BH0A 3GB7B 3V4LA 1OTTD 3FNKA 4LHUA 1J0ZA 1MIEL 2VRQA 4LHUB 3BUYA 1BOYA 3PP4H 4N8VG 4KXZI 3CHSA 4TVSa 3BUYB 5JORA 1HINH 4J6RL 4C56E 5JORB 1D7BA 3ASNB 2FLMA 4H1LA 4W6YB 5JPMA 4N1CA 3MRMA 4H1LB 5JPMB 3JUYA 3MRMB 1USZA 1QFPA 5F21B 1XTMA 1MDTA 1XBDA 1X9UA 3QJSB 4B53A 1Y1DA 4WUUA 3ARFD 2AABL 3VD5A 3ZDZB 5FEBA 4WUUB 5E2UL 1ANUA 3IRCA 2IWFA 2YIHA 4C4UA 5FB8A 4FFZL 3C2AL 4RA0C 4PGJA 2E6JA 1ZEAL 1F4XH 4M93C 2BIOA 4OLWL 5FB8B 4OJCA 1MAKA 3GXUB 5AENA 4XO4A 3OB0K 1NCGA 1ZVNA 4PG2A 4EOWH 3P0GB 5D7KD 3CU1A 3OF6A 3FTUA 1FZMA 2IAAC 5A2FA 1CR9L 1T1YA 2OSLA 4XX1E 3C6LC 1FZMB 4AQ8C 1WICA 2AVGA 1T1YB 2OSLB 4X8CA 1N7ML 4CAGA 2BDNL 2HX8A 1E6JH 1NM4A 3IWUA 1B6DA 5DRZA 4NNPH 3OC5A 4RMBA 2JTYA 2VQ1A 5DRZB 3IMSA 3D39E 4KHTH 2Y7OA 4NQVA 2VQ1B 2G30A 1AI1L 1RJLA 3UC0H 1NAML 3PY9A 4NQVB 3VWJC 1RJLB 5EOQL 2NCEA 3WY3A 4IRSC 3ZMEA 2VR5A 3WMQA 2E27H 4OM0L 2GJ6E 2X09A 4OD1L 5B1KA 4KVNH 5C3IA 1IBFA 1CBVL 3OL2A 4K5PA 2DQGL 1A7RL 2YKKA 3QDME 2HPOA 4KZEH 1MXDA 2GAZA 2IG2H 3N04A 3NPSB 3P0YL 5E51A 3TBBA 1S3KL 2ZYSA 2Z7UA 2GAZB 3DSFL 3O6KL 3WTTA 3LJ3A 4DHLA 5CBAA 2QADB 1Y6NR 2YOCA 3X3GL 4YXHH 2V3EA 3H4FA 3L4YA 1CL7I 5CBAB 3RVTD 3SE9H 1MNNA 4OZ4A 3LIZH 3MLZL 5HVFB 1J5IA 4MAUL 4OZ4B 1DBBH 3CZFA 1FNLA 3KPLA 2ED7A 3NCWA 3CZFB 4P46C 2XXCB 3WEOA 3SJVD 1BEYH 3KPLB 3BX7C 1Q1PA 1KCSL 2B77A 2G5RA 5AZEH 1ZPUA 3ELAT 4M5YH 4YUEL 2CGRL 5MHSD 1KCVL 2H2SD 3QNYA 1M3IA 4HEPA 2BXZA 3L3HA 3FUKA 3CD4A 1J5OH 3QNYB 5AVZB 3L3HB 4LEEA 5B1AB 2IBZY 1BQRA 1KXVC 5AW9B 2QSCL 5FYJL 1HJBC 5F89A 5IQ9A 5F89B 2CA4A 5IQ9B 3ZT6A 1B0IA 1D5XA 4M7KH 1X5KA 1C12A 4Z8FL 2HT4D 2OMXA 2WKOA 1D5XB 4YOKA 1C12B 1YPZF 3ZGHA 2OMXB 3G9AB 1CDIA 1Z5HA 1LO3H 5JR1L 4LF3A 2YRZA 4KPHH 5L6YH 1F58H 1WH0A 2FBJH 1JNJA 4LF3B 2W38A 2F6AA 5TDNA 2ZAIA 1AE6H 4AZUA 1I1AD 1G6RA 1GHFH 5TDNB 4CDHA 4KZDH 2WK2A 2JWYA 1G6RB 4Z78A 5DJDA 4N28A 5DLMH 4DOHB 4Z78B 1LK3L 2DQTL 1OTUD 2OM5A 5DJDB 4JO4L 1CLYH 3AROA 3GSNH 3GPSA 1ZGLM 4M48L 1QFWH 5FGSA 2V37A 1HNFA 3IJYA 3Q8CA 2OL3H 4XNYL 3IJYB 4PWIA 2ZP0T 4IKIA 4JVWA 3GRBA 5FYLE 2ICEA 4UI2A 4GO6B 5D2LE 2ICEB 4HUCA 5I26A 5I6MA 1EO8H 1B2WH 4EDWL 3I75A 1RXLA 4Z6AT 3I75B 3IWVA 3IDNA 4KQ4L 1K6QL 1BM3H 3IDNB 3WLBA 2ESVE 3GINA 2WC7A 3WLBB 1UD3A 3IN0A 5DA4A 3N9GL 2ITDA 2H5UA 2WNXA 4GBXC 4AUYA 2ITDB 1VSCA 4LVHB 3SBQA 2NZ9C 1EAJA 2R69H 1ZLWK 2A9ML 4BDVA 5KBDA 1MCRA 4TMPA 2ALWA 4BDVB 3FTZA 4GW5A 4X6DE 2LTQC 1G9NL 4GW5B 4H2AA 4UILL 4XP1H 2R56H 4PJ5D 1MVYA 2H1XA 3PWJA 1UCBL 3D4ZA 3HG1A 3NIDF 3T2PA 3APCA 1SEQH 3PWJB 2XDHA 4KHXH 3HG1B 3SO3B 2YA0A 2COVD 4L4VA 1A9VA 1IGYA 2DLFL 5AQ0A 2QELA 2QBWA 4JQIH 4L4VB 1HQRA 4YSAA 4GKSA 1IGYB 4QHKJ 3SOBH 3QR2A 1WFMA 4G42A 4JG9A 1HQRB 1YC7A 4FQCH 4GKSB 4PRHA 4KRPC 4G42B 2WXKA 1RUQL 5B3NA 3U4AA 4PRHB 2HRPL 4OIAA 3KL3A 4Y0GA 3FF8A 3MRHA 1YMME 3FB7A 4K3DL 2EKJA 3GTNA 3MRHB 3N41F 2E5EA 3FB7B 1A14H 1CYXA 5IHUL 1SM3H 4UMSA 4BCYA 2WWNA 4OFKA 3UCRA 3ULSA 4XCEA 1TQTA 5LAXA 3NIFB 3MPCA 1XCTA 2A9NL 5E1QA 1CDUA 2D7TL 4XCEB 5LAXB 3ULSB 4PVLA 1C1EH 2YGVA 1U42A 1XCTB 5C0RH 1FDLH 1WA1X 1HZKA 3VG0L 5AG8A 3WKQA 3FFCA 2OSXA 1OAJA 3BSZA 4WEEA 3FFCB 5D5ME 3QB7C 2GBAA 2W9EL 3LRHA 1TQSA 1KBGH 1NGXA 3HNSH 3BH9A 1UVQA 1DYZA 4LLMA 1ZMYA 2E9GA 1NGXB 3BH9B 1UVQB 2NY3D 1MJUH 4LLMB 3SBPA 3NGBB 1UZ6F 1PL3A 4Q9QH 5BMFH 4HUUA 4XO3A 4JG5A 4E9WA 5LXVA 1BG9A 1Q9WA 4HUUB 4PIRF 1EAOA 2Y5TA 1Q9WB 3D51A 2P26A 4FXKA 5IOPA 3AREC 1OW0A 3EW3B 2Y5TB 5IOPB 5HJBA 4FXKB 5KAQG 4XMVA 2AEIT 1F3DH 3TXAA 1XEUA 1I1CA 3L9RA 1KTDA 4R2GD 2JIXD 1SMDA 3AB0B 3P2BA 1WVZA 5E1AA 3L9RB 1KTDB 1L7IL 4Y9EA 4TTDD 2HT3C 5E1AB 2V2XA 3JT2A 3BP4A 1JVKA 3RILA 4TULH 1EHLH 1EEYA 5D1QD 2V2XB 3BP4B 1G1OA 1EEYB 1WITA 2H8PA 3A4AA 4YHKL 2JKXA 5D1XD 5KOMC 5TTRA 3ZGIA 3DGCR 1U8KA 2XWCA 5GS1C 3ZE2E 2OAAA 2H8PB 4KROB 3REVA 1MF2L 5FWRA 1U8KB 5GZOC 4DGVL 4GRWE 3REVB 3VXOA 2XVLA 3KNBA 1AOHA 2NY6C 3VFUA 2AKRA 3VXOB 3CK0L 3IBOA 2DEXX 3KNBB 2NUTA 1RPUA 3VFUB 2AKRB 2JVUA 4DP8X 5MEND 2NUTB 3FQ4A 5J12C 1G4MA 5IESH 1S7WA 2R8SL 2C9SA 5C07A 2HMIC 4QHPA 4DW2L 3D52A 3RIAK 1S7WB 5C07B 4WI0A 5EO0A 4HJ1A 1KELL 5CJ5A 2LE9A 3BSZL 4WI0B 5E4OA 5EO0B 3N2JA 1HSBA 4GXFA 3KLLA 4LVNB 4EE2A 4V33A 5JIDA 3WJLC 5A2JH 1HSBB 3U0WL 2LABA 1DL7H 1OANA 4LB8A 1KYDA 1KFGA 3HG2A 1V10A 2W94A 4ZO9A 3CG8A 2WXMA 1P7QD 2XVBA 3JV6A 4QNPE 1P7BA 2K1MA 3JV6B 2Q1EA 1M7IA 1MQ8A 4YDKH 3WNNA 3TVMD 3RU8L 1SLUA 2KKQA 1M7IB 1Y07A 4IBZA 1G7MA 3ARBD 3IYLW 4KV5F 5IFAH 5ACZA 5GPRA 1JZGA 1G7MB 3EDDA 2ZKHH 3GXTA 5ACZB 2EC9T 2IWEA 5CU9A 1IGCH 1UT1A 4HMEA 2DRUA 4WY7H 4CL7A 5L88H 2FX7H 1PG7X 5HHXH 3QUXA 1AH1A 4Q89A 2BNQE 4L8DA 4M3HA 4MS6A 4PJCA 3QUXB 4N8VA 4LFHD 4DKTA 4L8DB 4PJCB 1CDGA 1TETL 1VENA 2ZOUA 1FRGH 4N8VB 2Y1VA 2EDLA 2Q8BH 1DVXA 5I17A 1PG7W 3WIHH 5I17B 3MJ9A 4FEIA 4Y2DD 4N85A 1T6BX 3VDBA 2QQNL 2XN0A 3ESNA 3TBTA 3NSXA 4PVBA 4G8GD 2NUPA 2AJZA 2JJSC 3QARA 1D6VH 3TBTB 4JX0A 3SE6A 2NUPB 2AJZB 4R0LC 2YQGA 3ZIMA 1XF3A 3QUZD 1C5BH 4EJ1C 1XF3B 4J3UA 3LKQA 4A39A 2GJZA 2HX7A 3LZRA 3LKQB 2AEPH 5JHAA 2BJML 1FAIH 1JWUA 2GJZB 4KKRA 1VFUA 2FT6A 1L6XA 1JWUB 2IPUK 5CGBA 2AERT 4APXA 3OAYK 4BZ2A 3BSHA 2DY2A 2XPZA 1BEXA 4APXB 3R18A 4UINH 1E3XA 4NKIH 4F37K 2VMFA 4PRPD 1G9MH 1RUKH 3P1VA 3BXNA 3NACL 1KGCD 4PUBH 3ZSSA 3VFVA 3BXNB 4YBQD 4MGXA 2O61A 3VFVB 4LFHG 4AMWA 1G7IA 2OMZA 3PQYD 1WS7A 2O61B 1AFVH 3AY2A 5JMRA 1KJ3L 4FHKA 1G7IB 2OMZB 5B38G 5E7BA 2G2RA 4NAQA 3OAZH 3QQ3A 2G2RB 1IX2A 5FM8A 4HH9A 3RJOA 3SGEI 3QQ3B 4G6AC 4RFOL 1U3HC 3LMJL 4HH9B 1GOHA 3GO1L 5LNEA 1BQ5A 1B4JL 4N87A 3LXBA 4ZT1A 3V9FA 1NDGA 4X5PA 3GNMH 1OB0A 2G75A 5AKTA 1NDGB 1MOEA 2FJHA 3VI4A 2ZCHH 2G75B 5JUEH 2FJHB 3MJ9L 3VI4B 1OPGL 4X5QA 2AQNA 1SFDA 3FAXA 1GC1H 1BF8A 2XIDA 2WCPA 4D3CH 4EI5A 3JV0A 4XP6L 3CVHH 4EI5B 2YK1H 3ZDZE 1OIOA 1YEKL 4WUUE 5HSFA 3J07A 4HPYL 5CNHA 4NJAH 4OLXL 1W9XA 2A6JA 3GBNL 2E4TA 1P0SE 2A6JB 4UAOB 3II1A 3OZKA 5EIIA 4E2OA 2I26N 2WZPD 2K9FB 4GXUN 3WLWD 4BZ2L 4HWBH 4YHMH 5EIIB 5GJSL 3DHUA 2BSBA 2J1YA 5CJQH 4OM1H 4Y4HC 4ONGL 5CLYA 2BIPA 2DJSA 1BVNP 3LZNA 5BO1H 1XF2A 5FDWA 1OK8A 4MAYA 3NTCH 1P4IL 4EVNA 1XF2B 4DK3A 5FDWB 1BVKA 3DARA 4EVNB 4MAYB 5LAPA 1JERA 1QFHA 1BVKB 4JM2A 3LIZA 4H88L 4MZRA 4LSVL 3P3SA 2YD8A 2CMRL 4JM2B 1EAPA 1FPTL 2GBUA 3L54A 4MZ3A 1G6VK 4P2QA 5A2CA 4KI1A 1EAPB 1GRWA 1OTTC 4P2QB 4TL4A 1TOXA 5DMIL 4HOMA 1ESOA 2AGJL 4MAZA 2KL6A 4GKOA 2D3NA 2ALAA 5B39G 3VVWA 2QHRH 3EH4B 4LBEA 3STZA 4BWTA 3FU7A 1KBPA 4PJ9A 4LBEB 3GSRA 3STZB 1WWBX 3FU7B 4FG0A 4PJ9B 5DEJA 3T0EC 1AAJA 3ZE0F 3GSRB 3DKHA 1JJUA 2O5YL 1I53A 4LDLB 8CGTA 3ARFC 4ZAKD 3BUBA 2E9IA 4K73A 5EHFA 1T03L 2FB4L 4X9HA 4KVCH 2JKTM 1KDIA 4H8WH 4X98A 5HDBF 3VG9B 3UZVA 2CLVA 4XI5D 2I32A 3K46A 4X98B 4QXUL 3GM0A 3UZVB 2AEQH 2CLVB 4P5SA 1BIHA 4JZOA 3VWKD 1OAKH 4JZOB 5ITBL 3BQUA 3CDGA 4TKWA 1ZK9A 3B9KD 3BQUB 3CDGB 1KB5H 3FAWA 4BQ6A 4NDMA 3W2DH 4X6CF 4KFZC 3VAEA 5CLZA 2BY0A 4NDMB 3KHOA 4L9LC 4A2GA 2F1EA 2Y9RT 1OAYL 3FYEB 4YWGL 4Z95L 5TH2A 3HC4L 2JB6A 4H13C 4KK5C 1UJ3C 5TH2B 3OPUA 1PX8A 2JB6B 5J6SA 2R51A 4OZHA 3TEXA 4Y89A 1ZJAA 2ENJA 4OZHB 1LEKA 4PJAE 1INEL 2ZKYA 1LEKB 2O6EA 1TTBA 4HOXA 1NBZA 2AVFA 1NBZB 4W81A 4XNMA 3DMMD 4DETA 4R4BA 3BYYA 3UTSD 4XNMB 3AU1B 4R4BB 4DOHE 5IWLC 3ISRA 5DYOA 3A6CL 3D4GA 5DYOB 1D5IL 3MVSA 5T5NG 3Q8BA 1CO1A 2LU5A 3DXAD 3L3IA 2G4GA 4JEGB 1AY1L 1ADQA 2HKFH 2HWZH 3QCUH 5ABAA 3L3IB 3CLFL 3LPPA 4W9GC 4HS3A 4FCHA 3HMXH 5C0AD 4ZO6A 2Y6TE 4JFWA 3ZUCA 3S3DB 2WLMA 4HS3B 5E8PA 4TQIA 4Z7NF 3EH1A 5E8PB 4FQIL 2TSBA 2FRGP 3U1SH 3L3DA 3QEQD 3ZLQC 1AGCA 1F3JA 4I9WD 4JFZH 4TUKH 1DBAH 1I4FA 3L3DB 1YEJL 2H2SC 3WSQH 1AGCB 1F3JB 3RX5A 1I4FB 2A4CA 3L3GA 2VWEE 2JKIS 2ZUWA 5DD0L 2IEPA 2F2HA 3L3GB 4I77L 5DQJA 4IOIA 2C1PA 5HGHA 2ENYA 5I6PA 4ADIA 2JJVA 5I71B 1NCCL 1OPOA 2HTKD 3BGMA 2C1PB 4IOIB 5DQJB 5HGHB 3OZ9H 4OQTH 5DJ2A 1IC0A 2BZDA 3BGMB 2FX8L 3ARZA 2DQHH 1DVTA 5DJ2B 2CZNA 1HNGA 1FYHB 5CILL 1CXKA 3NEEA 1QKZL 3SBWC 1WBZA 3WXVH 2HT4C 4LSUL 4NC0B 3UMTA 1WBZB 2ERJC 3ELQA 5I2IA 3T77A 5T1KB 3EFDL 4AJYV 5I2IB 4NC2B 3NG5A 3T77B 4L0YA 4MB4A 3BAEH 3LH9A 2PWEA 4M4PA 5IBUG 1RUAL 3E8VA 3O4LA 2QZ5A 5EC1A 3PDDA 3UG3A 3O4LB 1I1AC 3D05A 1ZV9A 5ALCL 5EC1B 3W0WD 3BPOB 3P2TA 2WOBA 2VQUA 3MODL 2JCCA 2C7UA 2KERA 2RB8A 4PH8A 4X6BA 5LWYH 3HG1E 3UG4A 3NYKA 2JCCB 1OTUC 2C7UB 4JFEA 3TM6A 2L3BA 2K6ZA 4HUKB 1C5CH 1QFWM 3BLKA 4JFEB 4L4VE 3SKNA 3TF7C 3F58H 1HOCA 2B4CL 5T3ZE 3IETA 4M7LH 1OVZA 3SKNB 5DO2D 1HOCB 1N8ZA 4I3RL 4MVBD 4NP9A 4UYPA 3RI5F 3IETB 4N2KA 1N8ZB 2DL9A 1PZ5A 4C57C 5LN4A 1TJIL 1WBYA 5K9QI 4KRLB 3CH1A 1PZ5B 2OK0H 1WBYB 2VYRE 2E59A 4ODSL 4AGOA 1KN4L 3CH1B 4MJ2A 1ZSDA 3GMPA 2AABH 2ZJSH 4NQCA 4OLZH 3SQOL 3WKMH 3TBYA 1ZSDB 3GMPB 1D7FA 3L4UA 4NQCB 3BGFB 3GBDA 4HS8L 3JZYA 1IU1A 1R17A 1F8TL 5DGQA 3C60C 3TBYB 3TJEH 5KEZA 3AXLA 3L5XL 1SN5A 3IFPA 1UASA 3KLAA 3WL9A 4K7PL 3AXLB 3IFPB 3P9LA 4LOFA 1AJ7L 3QDGA 2X1PA 3KLAB 5FYKL 4XVTH 3WL9B 2FGZA 3KPNA 3P9LB 3WMSA 4J5VA 3QDGB 4IKNA 1GGBL 3VXMD 2P46B 4FHJA 1ZPLA 3KPNB 4WFHE 3SD2A 1CR9H 3ULVF 1L9PA 5GRJL 5HDOA 4BA0A 5EC2B 4G9FA 2RMNA 1OAZL 3SKJL 3JTTA 1CICD 4G9FB 3GXPA 4RRPA 1MELA 3CFCL 4XMPH 3JTTB 3O11A 1F1GA 1AI1H 1Q0YH 3O11B 3P9WB 1TEYA 3NABH 4LT7A 1QLEH 2CXGA 2DMKA 5EIVA 5JQ6L 1DQML 2IH1A 1Z5YD 3GIVA 1RJYA 4P07A 2IH1B 1NJ9A 3GIVB 1RJYB 5AW8B 4KITB 2ZP8A 1UM6H 1NJ9B 3DSFH 1TTUA 1QRKA 4AGLA 1CXFA 3CSYA 5C0BE 3X3GH 5JXED 5JOPD 4PGZA 3N1PC 1UHVA 3CSYB 3X1NA 4JHAL 4XN8A 4YHOL 2ZTBA 1GZQA 5AW2B 4MMXA 3CLWA 1OV8A