4F20A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
331
structure length
331
Chain Sequence
b'AKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGSADGDSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
molecule tags Cell adhesion/cytokine
source organism Staphylococcus aureus
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
total genus 83
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A02
2F6AA 4B60A 4RMBA 5IHWA 3AT0A 5CF3A 2VR3A 1R19A 3IRPX 3V10A 2Y7OA 3ASWA 2Y7LA 4BBWA 4JDZB 4B5ZA 4MBOA 4FJ6A 4LEBA 1R17A 4F24A 4Q6KA 4JDZA 1N67A 3AU0A 4LE8A 4JE0A 2Y7NA 2Z1PA 3IS0X 4F20A 4LEEA 2Y7MA 4F1ZA 4F27A 2YLHA 3IRZA 4MBRA 5CFAA 2RALA 2F68X 3IS1X
chains in the Genus database with same CATH superfamily
1E6JL 3INUH 3N41F 2KDYA 4JFFD 1X5KA 3WLBA 2AJYH 3KS0H 3OV6A 4HUMB 4RCAA 3TV3H 3BVXA 4EOWH 1I4FA 4ADJA 5MENE 2Q10A 3WMPA 3CFTA 4YGAB 4LBAA 4Q52A 5BZDB 3LN5B 2OTPA 3W3BA 4D9QE 3H53A 3O6MH 2Y2YA 3VX0A 3UO1L 1XF5A 1IZJA 2JNZA 1PEZA 1R5VB 4XCNB 5CS7A 1RUQL 4QCIB 4HJGA 4LEOB 1M7DA 2V7HB 1DQQB 1GCYA 2Z1PA 3VACA 2ZOKA 4MB3A 1EFQA 2N3JA 1C16A 2ZXAA 3VGFA 3A4EA 4XN8A 4M4RA 5GHWL 4RGMC 1PNCA 5C0BD 3PREA 4XO5A 2Y7SA 4U1LB 2DS4A 4PJFB 4TMPA 4ZYKA 5E9DD 4ELME 4ZSOE 1ZHNB 3LD8C 3DNKA 1GZQA 2P5EB 1W80A 3EHBD 1A4AA 3JVFC 1TETH 4M5ZH 4AGMA 3HBGA 3VG0H 3V4UL 1Q0XL 1XF3B 2AITA 4PREA 1A6ZB 5IROA 3WDHA 3QUXC 4Q4EA 1IGFH 4L8BA 3F62A 3JYBA 1RUPH 4PG9B 4LU5L 4PLJC 4E9XA 1KPUB 1IAKB 1J0KA 1YPZE 2OFQA 3QJZA 4G11A 3NH7H 3C6LD 5CGYD 5GRYA 2EH7L 5HI4D 1M3JA 3OZLA 4HJJH 5D9SB 3V5KA 1S46A 1SDDB 1MIMH 1WWAX 2ZX8A 2VW6A 2J1KA 5EU6A 4NFCA 4GRLD 4DZBB 1KFAL 3G6JF 5IJKA 2ED8A 1NBYA 5D5MB 2A3TA 2DMGA 1HE7A 4IMLA 3KEDA 3LNEA 2YSTA 5I6KA 3RWFB 1I8IA 4X83A 2F8OA 4ELKA 3TWCL 1G94A 1NL0L 2A77H 2XWTA 2HVJA 4Z0BH 5IK3A 4XXCA 3S37L 2FO4A 2OSLB 1DEEB 2Q7NA 4LLMB 4MVBD 1CLZH 3BT2H 3W9DB 4FG4A 1SLUA 4G9DA 2GTZB 4CSPA 3MLZL 3D12B 4JG9A 3U2IA 3NJFA 3TYGL 2PW2A 4OIIH 5T1MB 4FNUA 5AEAA 5I0DA 2R0KH 4N3TA 3ZDXF 2VDNB 5TE6L 3RWDA 1CGTA 2IBBA 4RA3A 5KANG 4Q6YA 5L4FA 2Y3NA 3OVUB 1A22B 1ODAA 1N5YL 3NJXA 4M48H 3TV8A 3O2WH 4MKTA 1UKQA 1ZTMA 5LBGA 1M9WA 1N7ML 5LNGA 3MX0A 4YDZA 3QA3A 3KYOA 1O9VA 4YDVA 4WSGA 1F4AA 2FEDD 3NZHH 3QI9B 2FIKB 2N59A 1QRNA 2NX5D 4K3EH 3PPSA 1JZJA 1KXTA 1JV2A 2O61A 2BNRA 4MQXC 4X8GA 1A9EA 1IAIL 1RZKL 3DPDA 4PIBA 4NWUL 2E7LA 5T33L 2P5EA 2GBAA 3MBWA 1ZLUK 1S3RA 3HZYA 4IKJA 5DZ9A 1QAWA 2DWDB 1I1AC 4XP9H 4X8JA 4OLXH 4UV7H 1A6TA 2E47A 5FA4B 4FQPA 4YSOA 2BLFA 2OXHA 2EXWC 1JGLL 2HRHA 3MGTB 3VFMA 4IGBC 4QGYA 1KB5H 4DP8X 5FV2A 2G9KA 3VNZA 3EYSH 1B4JH 4WW2B 2F54A 4E9WA 5I1LB 1G9EA 1U3HB 4D0BB 2PXYA 5DJ6A 3D3VB 4U7SA 1Y6KR 4XRCA 2Z91A 4N2DA 1W15A 1T2QL 2VLJB 5D1ZI 3MODH 5LDSA 4NNYA 2P8MA 4DOHE 3V4PB 2MCPH 4GFXA 1FL6A 2AJ3B 12E8H 4BK8A 1FGNH 4KX9A 1MCOH 1G9MH 1CFVL 3BHBA 4PRIB 4BK5A 5GZOD 3CU7A 4GQQA 1AHKA 1K2DA 3WY3A 3KS0J 5B1JA 4JFED 1XCXA 1NFDA 2XU9A 1KBGL 1AQHA 3IS1X 1OARH 1YHPA 3QUXA 3DOSB 5AW8B 3QPQC 4M4PA 5KUKA 4U1KB 3PFUA 4BM7A 5B1AB 3T6VA 3W39B 2EEBA 2VLME 1GZHC 3VXMA 5I30L 1U3HC 1SXZA 2H4EA 2HVBA 3CC1A 2ZWZA 4WWNA 4U1GB 4Z76B 5B3NA 5HSFA 1FC1A 5FV1L 3IT8D 3KXFE 4IMKA 4NQVB 1TTFA 5FA3A 4EI5B 1UVQB 3V4UH 1PG7L 4XPFH 2W81C 1F4WH 3OKMA 2X2UA 3NZ8B 5EU5A 1JYWA 3EHBB 1DJHA 3O3EB 5DRNA 4KK5C 2BRRH 4FTVE 2JXMA 1SEQL 2X38A 3NIGB 6CGTA 2GTZA 1GZQB 5DVMA 3VM7A 4OKVA 4Y4HB 5GSVA 1RULL 4OFPA 1QLEL 3VQ1C 4ANWA 1DQMH 2XWTB 5F9OL 4CW1B 3O0LA 1CO1A 3P3RA 4E9QA 2VDOL 4A7GA 1KMGA 3LS5L 1SGKA 4TLUA 5DR5H 3EJRA 2MMXA 2OV0A 1ULVA 2AQNA 1IO4C 4GAYA 4QRPD 4Y19E 4KU1A 4KH9A 1F3RB 1X5YA 3Q2VA 2VDNL 4ZTEA 3ZKND 4DGIL 3QJFB 2VN4A 3W37A 2VSMB 1WBXA 1D9KD 5GGSY 2WO2B 3AW5A 4WDIA 3UTQA 5F7DA 5IVXA 3ZL2A 1AANA 2CHNA 2HLFC 2MHAA 3B3BA 2HG0A 5LG1A 3MXVH 4OZ4A 2JJTA 4YXHH 3HVDA 5CCKH 2JLLA 2YSSB 4PUBH 3NEOA 1DFXA 4YDJB 5GRWA 5JLZA 1FNGA 4YHPA 4ZO7A 5HGBB 2OJZH 4UB0H 2W65A 2W91A 1A47A 1I7ZA 1RZGB 2KLTA 4ODUB 5EEZA 4K2UH 3CDZB 5F9WB 2HT4C 2ZCKH 3HZVB 3DX6A 1YA5A 4F8OA 3Q8BA 4HSCX 5TTRA 4E9VA 4RDBA 3L6FA 3NMEA 1DQIA 2ZPKL 1FFOB 3L3OC 1DSYA 4QRTB 2NR6A 3EYOA 4LBEB 1R9FA 2KI6A 2TRHA 4JDZB 1ZJAA 2YUZA 4B0MM 4XPTH 4MKMA 3ARPA 4J3BA 4Y9EA 1TUPA 1H3GA 2HT3C 1MREL 1UH3A 2A77L 3NEXA 5LGKA 1UXSB 2R59A 2Y25A 3TO2B 3HPJB 4PGEA 2ZYIA 3OR6B 3VFNA 3NJLA 1HILB 1JXGA 3X1EA 4JKKA 4GBXD 3U4BL 2LABA 4RWHA 4YSSA 4R4NC 4HS3A 4BCZA 3BAIA 1KLGA 2VH5L 3G6JA 4UUJA 5HYJA 3P73A 2BSEA 1UM4H 1CDHA 3AREC 2WXLA 3OL2A 1I8UA 5IMLB 1HYSD 3FQRB 4L0ZA 4OQTH 3NPSB 5EC1A 3BHBB 3GBMH 2BSED 1OOAA 1PZ5A 4PBDA 3HRPA 1MCNA 3P02A 1O7DE 2P47B 2EYSB 4JFDA 4KFMA 3GMOB 1G9ML 2CNZA 5F2FA 3GSQA 4G43B 35C8H 1ORSB 1U8IA 4PJFE 2O5ZH 4F9LA 2DZEA 1FCGA 5CIPB 1RUKL 1KC5L 1SBSL 2CUAA 5LJYH 3O4LD 5FM4A 1CR9H 4PQXA 1FPTH 4P46A 3MRIB 2YAQA 4LLYB 4UT7L 2X2JA 1OCWL 1SN2A 1FSKB 4TPRL 4W70A 4ZW7A 4BCYA 1NEUA 1BZDA 5DJ0A 3D25B 1CDGA 3W11D 4X4XB 3GRGA 2P28B 3HS9A 2P42B 2B9AA 4F2ME 1CGYA 4OF5A 3H55A 3FYIB 4YSDA 1MCSA 3VD2A 1EJFA 3WJLC 2YS4A 3S3CB 2VDPH 3AY2A 5G55A 4OU3A 3OMIB 5DJAA 2Z92A 5INDB 4Z7UF 1B4RA 3L3JB 4Q56A 5EU6E 5C0BB 2DJUA 3SE8L 4PJHB 2C7FA 4BA8A 5JIPA 5ILTL 1CFTB 4TSAH 3GHEL 2PP7A 3FBKA 1CGUA 4JFXB 1H8OA 4U1JA 2IEPA 2XV6B 2X0VA 4RGNE 5JXAL 4DQOH 4PLKC 2GK2A 2DWEB 2G9HA 4WFEE 1QLRB 3JV6B 4N2LA 2H1PL 3MJGX 1N6QL 2IPUK 2QBWA 3O8XC 3E9UA 2Q6WB 5I1EH 5IB1B 4NM4L 1TEGA 3FU3A 5EZLA 5HHOA 4TN9A 3NGBB 1EGJA 4DKFL 3FN3A 1CXIA 1MPAL 5H94A 3IFLH 4PGBA 3TO4B 2TRYA 5FW6A 1XXFC 4YXHL 2F5AL 2PO6A 4FQJL 4FQ2H 2ED9A 5T3XH 3N06B 1NUDA 4QTHA 2A4ZA 3X1BA 4F37F 1EDYA 1AKJD 2EDEA 3KPPA 3WUWG 1WCBB 5ETUA 3NJKA 1B88A 3G5YA 4UZUA 2GJ6D 4HZLB 4A6YB 1EERB 2BSRA 1MELA 1K8DB 4IRSB 2LFEA 3DOHA 1YEHH 4EN3D 1KEGH 4JB9H 3RDTA 1NAKH 3WIIH 1G7QB 5I5IA 3S34L 5DA0B 4QY8A 4GY4A 1FNGB 2YEZA 3LS5H 4H0LC 3SJVB 1NKRA 1RFDH 5AW0B 3RDTC 3VFSB 2A73B 2HT2C 2Z7WA 1ZT7B 1I1FB 1Y0LA 2FL5B 2L3BA 1WBZA 3G7TA 4MNGE 3QT2A 4QHMB 4LHJB 3AU1B 4I88A 4OM1L 4BFEA 4ONFH 1BZ9B 25C8H 3ECQA 5L2JA 3U48A 4IIQC 4RZCB 4I1NB 1G0XA 3FS9A 1N59B 4I2XB 5EB9A 1KYUA 3PAVA 2DL9A 4HG4K 5GZNC 1GHFH 5DD3L 4A7GF 2J8UF 1RIVL 1E30A 1JHLL 4Y4FB 2QJDA 5D7JB 2X4TA 4AEIH 4AOFA 5KAQF 1G5AA 2WCSA 3GBML 4BH7B 2M1KA 1BD2E 4HBQA 4IRJB 5E5RB 1RZJC 5C08B 3CFNA 3T8XA 2GT9B 1E6OL 4JRYE 3T2NH 1JDCA 4R7XA 1I9IH 1S9WB 1PKQA 1PIFA 1FAKT 1UZ6F 5CJQH 4O2CA 2DQCL 4M3KB 1Q8MA 4ERSH 2CLVA 4X9GA 3FSWA 3QDHA 4LSSH 7CGTA 1AQDB 1WE5A 4EXKA 3U0TB 5LGJA 3F7YB 3OGCA 3N1MC 1LVEA 2CPCA 1P5UC 2WNXA 3ZDZF 4I0PD 4C4KO 4HA1A 3QIWA 3EDJA 5C0BA 2ARJQ 3BVVA 1Q94A 4YHLL 3NRPA 3DUUB 4FG6D 4YHKL 3VXTB 3GLZA 2P3YA 3KPPB 4CADB 2APBA 4P5KA 1TJIL 1N0XL 1OLZA 1OXYA 2YXMA 4LP4A 4WO4C 2GVYA 4WJ5A 2XZAH 5IMOA 4TUKH 2OCFD 4QGTA 4NHUA 1UURA 5EU7E 5JO5B 4P8QA 3AUWB 3WKMH 1I1CA 1NLBL 5CBAB 2OM5A 3O45A 3PG2A 2XKSA 3H3BC 4NQEB 5HVHC 2ZNXA 3ATEA 4L4TB 3HE6B 4HUWB 3O8XA 5FYLE 1TVHA 4P46B 2OK0L 2D31A 3NIFE 3BD3A 3D3VA 1P2CB 1KTCA 4B97A 1PLGH 2VISA 3X1FA 3QWOB 1QRNE 4GRLA 2NDGA 2ARJB 3A4DA 2WTOA 1A7OL 3QG6A 4M7KL 3KPQA 4WFHD 2LAAA 5CZVL 1KBBA 3IRZA 3QQ3A 2R1YA 4Y19A 1IVTA 4EAEA 3T0EC 2QPUA 3NCFB 4ZOAA 3VFMB 2CJUL 3S2AA 3CN3A 2IH8A 3ARGB 1SY6H 2TAAA 2FEJA 5KAQG 2XN9E 1NGPH 1XGTA 3IDJB 4XXDB 2NR6C 1EHNA 1U8LB 5EIIB 1OP9A 3ZE0F 1HU8A 4UDTA 4HIEA 4HYTB 5T3XL 2X1WL 4LEEA 2E9JA 2EIBA 2EKSB 1JV2B 4PD4K 1X7SA 2O61B 1BBDL 2R15A 3NZ8A 5EU5B 2XKNB 1DANT 4FFZH 3BMVA 2C9PA 2DJSA 3MACH 4J27A 3T2LA 3MX0B 3APCA 1NANI 4YHIA 3FC8A 2BOCB 2IG2H 3ULAB 3T4AB 3QXDB 1IM3A 3UPRB 3V9FA 4NPYA 4NUJA 1HCZA 2C26A 2NY5L 1BIIA 5K9QI 2AJUL 1CF8H 1G1YA 5DLMH 1FJ1B 5KS9A 1NTDA 1R0AH 4JN2B 3EG9A 2BCKB 3B9DA 5I76A 4HCRL 2HT2D 1A6WL 3U46B 3ZTNH 1XHHA 3DX3A 5KVEH 1ZWIB 4HIIA 4BFRA 2VCOA 4MAUH 3CSTA 2WBKA 4O2FB 4YEEA 5FHBH 3SYCA 3WFBL 5K9OA 4YL9A 2EVIA 2P8MB 4LLUB 4GXVH 4Z9KB 2IAMA 4K9EL 4OFVA 3SDDB 1QQDA 4OH2A 1Q9LA 2FEDC 4OCMC 1S7WA 2CJTA 2VLRD 1BVNP 4MNGA 5LUMA 1MJ8H 4JS7A 4W9LC 4N0FA 5IGXH 2PXYD 4N9GB 1TLKA 1B9KA 1UACH 3AMKA 5IM7A 4A68A 5F8RC 1AQDA 2JCCE 3UC0H 1N12A 5E8EB 3TWYA 5IJDC 1DL7H 2A83B 3ARFA 5GZOA 1THAA 3C87A 1S78C 3MLWH 4PJBE 3D51A 2E8ZA 3E8VA 4KRMB 4R6UA 4E5XA 2PR9A 5I17A 5JOFB 3QJFA 1AY1L 4IGBD 4IOFD 1BMGA 3GSOA 2E3VA 2YRBA 1R3LA 2JWYA 2WK2A 3LKQA 5B8CC 5EDSA 3DOSA 5KUMA 1CLOL 3P3YA 4WJKB 4R96B 4ODSH 5ESQA 1MW1A 1WGVA 3H4FA 3NSDA 3IJHB 5FYKH 5AOLA 1DN0B 4M02A 5K59F 1ZCRA 2ZUQB 3DTUB 3D69A 3FQYA 4N0RA 5DZLA 5H8DA 1NPJA 1H5BA 2QPDB 3A6BL 4FFVD 3MCLH 3U4EB 3QI9C 2ITDB 1HINH 4NZDA 5FHAH 5FYLL 3NZUA 4NNYB 2JKTM 3EADA 4RQQA 5A2LH 3BUTA 4ZNCD 1N4XL 4UAOC 5DA4A 4C56E 5E0QA 1OGSA 3AXIA 3SCMC 2VOTA 3ZE1B 2XSKA 5FUZH 3MLXH 4CDGC 3B43A 1UB6B 4HK0B 5FR3A 1JNNH 1FVDB 4OI8A 3FU7B 3TT1H 4MNHA 4NQEE 2UZPA 1TPXC 2P4AB 4ZQTA 4IM8A 3SKJH 2VDQH 2Y5EA 3ZZ1A 1QKZL 4W6YB 4L05A 4KKAC 4Z76A 3D85A 1S3KL 4GKOA 4K8RD 5C7XL 4OD3H 5AW7B 1BFVH 1T6VN 4NJAH 2FUQA 1WIUA 1PJWA 1IC7H 2BERA 2W94A 4TVPE 3WNPA 1AZNA 2MKWA 5I0YA 3D85D 5T3XE 2J3SA 4IDJL 1A3LH 3NT0A 2BOBA 2YKLL 4XT1C 4OV5B 2VSKB 4BSVA 1JVOA 1R47A 3G5XB 3GGWB 3TLRA 3RPIB 1Z9MA 1A1OA 1F8TH 1J05A 4P2YA 1HXMA 2FB4H 3WGUB 1ECZA 3FPXA 2A4CA 3U9UA 4ORGA 4ONOA 1HXYA 1D7DA 3GMMA 3E7JA 4KPHH 4OLVL 4H25B 4ZRGA 4E41B 1QBAA 2A6JB 4IJ3C 3IFPB 4HFWB 4JFOB 4N9GA 4B9IA 4HJ0D 1CD9B 1LD9A 5C09E 2OK0H 1BX2A 1G7HA 2YRZA 4JG1L 4L3CA 3WKPA 1SQ2N 1I8MA 4CVUA 3SKNA 5TE4H 4BKSC 2OMVB 3D39A 4PRPE 1X5ZA 2UY6A 2YPKB 5IEHB 3LV3B 1KPVB 2VXQH 4PJFA 2ZXEB 3WN5A 5E9DA 3UTSB 2HTLC 3SGJA 3PL6B 2DQIL 5BZZA 3EGXA 4W9HC 1WGOA 1DQQA 1W9XA 1E4XL 1MUJA 5EA0L 5LN4A 2H6UA 3BO8A 4LLWA 5ESQB 3V5DA 3LEXA 2EJ1A 1NC4D 2V8LA 3NEEA 1KEMH 3GJEB 3UTSD 1CTOA 1CU4H 5I1GL 2OCJA 1SLWA 2EDRA 3IPEA 5F6IC 4EQ2A 3N91A 4PJHE 3QO0A 5HI3D 1P9MA 4ELDA 5ABAA 5JDJA 3BPNC 4JBSA 2KPWA 3HZMA 5DEFB 5JA9A 1IC5L 4GW1B 4AMKL 4LCUB 4GRWF 4RH4A 1AJ7L 3BVUA 2R1XB 4N22A 2NY1B 1TLMA 2BXZA 1KXQA 1X5XA 1VF5C 1FNHA 4Y9FA 1FFQA 3M1CA 2V7NA 1R3KB 2EYRB 3ZE1F 2BVEA 1Q9LB 5L6YH 4I3RL 1E8ZA 3DJSA 3L5WA 1NL0H 2CCVA 3BIKA 3X3GH 1KXTB 1W8EA 4LLUA 2GCYB 1YYMH 1ZIBA 4L2LA 4LE8A 1CYXA 1NBYB 3C9NA 1ZLWK 1AR1D 1USZA 4LF3B 1JDAA 3ATFA 1O9WA 5IB3B 4JEGB 2HJKA 1JFHA 3UACA 4JUTA 3LYRA 3U1SH 3AWFA 3GMMB 4PJFF 3FMGL 4PV1C 1Z9OA 1ZV5A 1RHHB 3IU3B 4L0PB 2WXNA 5B4MD 2EADA 3HE7D 1J9SA 4W93A 3UDWC 2FBJH 1CF1A 3CLEL 4OTXH 3HUJF 5AAMC 5DGQA 5HDQL 2XKUA 4GW5B 3KMDA 2JLPA 3QQDB 2B39A 4LPTA 5MERA 2XWZA 1NCUA 2ZUQC 1HE8A 4HSQA 5F6HI 5A2AA 2HPOA 5FDYA 5FGSA 3U25A 2J6EA 3HG3A 4P2CG 4PJXF 2ZT9C 3PDOA 2VDMB 4YE0A 4QKXB 1SOXA 3GK8H 3SKJL 1AQ8A 5CHNB 2AJ3A 2CBQA 1H5BB 3DVIA 3VYNA 5HYQA 4ATTA 1M6OA 4XP9L 3GXDA 3DI3B 3H42H 5KVDE 5L88L 4LQFH 3Q8CA 1LQSR 4B5ZA 1BVKB 4K8RC 4XP5L 5EZIL 1XGUB 2CUHA 1UB6A 5D4JA 3EYQC 1UCBL 3HN5A 4HP5A 5IFJA 3GO1L 4GPVA 4JKNA 4YK4B 3V4LA 1QX1A 4U1MA 4BZYA 1YZZA 2KZBA 1QW9A 1OM3H 4DP4X 3K3QA 2X6BA 1U42A 4MNHB 4J4PA 5E8PB 4Z7VA 1YMME 3W2DH 1IBHA 4OFYD 5F0JB 2UV3A 5L2KA 4ALAC 4IHOA 5IQOA 1MVFA 5T1DH 4L1HA 4ANUA 1XEDA 1NEPA 4JKMA 5GRVK 5DK0B 1GKEA 2F58L 2NNAB 4X7SH 3L3HA 2AVGA 4U6VH 4H1LH 4HXBL 5IG7B 3V5HA 4M93B 1F1AA 1T03H 1EO8H 1UFGA 2W0KA 3QSKB 5I8KH 1J12A 1K4CB 3EJYC 4OZHE 3SQOH 1I85C 3TH3T 4E41E 4JZJA 1FFNA 1YUHA 3PNWB 1EZVY 3CFDB 1GL4B 2CBPA 2Y7QB 4P5TD 3HS0B 3O0RL 3LKRA 3RDTD 3SQBA 3VGHA 2D9CA 3VD5A 4B27A 7TAAA 1IQDB 4XBEH 5J0BA 2BP8B 2D4DA 1SRDA 2BHYA 4MA8H 5D7EA 2A6KA 2DBLH 2IQAA 3LMJL 4TQEH 1CG9A 3KJ6H 4CADA 1DO6A 1QBML 4JREC 4OCWH 4AE0A 5IB2A 2P9RA 2X87A 4LSQH 1FVEB 1PG7H 4NO3B 4XPFL 4ELMB 2R27A 1PYWA 5JR1L 3DUSB 1FI8C 2R4RL 3BIAX 3RYMA 2FB4L 4TM9A 3MOBL 5CBAA 4AIZA 2PPCA 3IN0A 3K72A 2EUWA 1V7NL 5L8JB 3HS0C 1J0HA 3O41A 1W0WA 1EFXD 4HMEA 2AQSA 2IVFC 2PWDA 4EEEA 3DSFL 2PMZA 2E7HA 2GSGA 2I9LB 1OAQH 4WUKH 4EN3B 4ZUTA 3FB7B 3D50A 4OD2A 5HJDA 5DVLA 5IMMB 1NM4A 4LSDA 4NO5B 2EE0A 3QUKA 1RZJL 1DLFL 4FS0A 1D5BA 1KXHA 1Q94B 3BSGA 2VABB 4EN2A 2X4TB 2WXRA 2YD8A 3JXAA 4ZNEE 4HPOL 2CO3A 2EDFA 4GQ9H 5FUOL 4Q0XL 5LGJB 4L5FE 4BXSV 1D9KA 1T7WA 4WO4A 1E2ZA 4A7TA 4JMXA 4I0PA 2Z4QA 4JUSA 4BZ2H 4ETQB 4F33B 2FNWA 3CFQA 2VLRB 4PBWD 1Z1WA 4WO4D 1S7VA 5CJBA 2PYEE 2YD6A 3G5VA 4PJEA 2BMKB 4PJBB 3MCKA 5DMKA 3G6AA 4YDNA 4GKZB 3LQAH 3AABA 3ZDZB 5C0DA 2XKNA 1ZA3B 3V0VB 4NJ9L 1NCWL 1DQLH 1KN4H 3MJ6A 4R7NA 2WN2A 1C16B 5F3FA 1EZUA 5HYQB 2NR6D 2A9MH 1NCIA 5ALBH 3FO0H 4Y1AE 4M61A 4A1RA 3VSQA 3VG9C 4WWPA 3AB0C 4RAUA 3CSYB 4P4RA 4DJMA 3NPSC 3CD4A 1RL1A 4Y1SA 3OJDA 1BEYL 2NX5E 4FQHA 3E3QC 4L1LA 3L6FB 5D8JH 1LK2B 1FV1B 3OXSA 5HYSA 5JPNB 3FTGB 2W95A 3QULB 1AGEA 4QRQB 4BCXA 5ADOL 3IDYC 4Z3GA 1E8WA 4HUWA 1VACA 2Z0UA 5D71L 3BGMB 3C5ZB 3ABMB 1HEJC 1QA9A 4PWJA 3S4SG 3HHMA 4JG0H 5INCB 4DZ8B 2D2CC 5JNYB 1P0SE 1V7MH 4D7PA 4K73A 4IHBA 2ZNWA 4XX1G 3PWVA 4MS8D 3V0FA 2W60A 2NY2B 3DUHA 3I6GB 3JWOC 3TJEL 2X0WA 1Q0YL 4R7LA 1MIEL 1MG2C 4YSTA 2EINB 3G9AB 4ISVB 4LRIC 4XI5C 5D2LB 4FQ1H 2AK4E 4O02B 2UWEB 3ZSSA 3DOIA 2QSCL 2R0LL 4JFDB 1U8KA 4HEME 4AXWB 3INOA 5EZJB 4F7MA 4J2XA 1X9RA 4W4NA 3MRMA 2IOOA 2NSXA 5DZAA 1BEXA 1JMXA 4O4YL 4UTAH 2VLJE 5C0FA 5DD6B 3D1MC 1DQVA 4P0DA 5EF0A 2IFFH 4Y5YA 3O4LA 2VXSL 4NENA 3EFDH 5EZOH 4ZS7H 5ICXA 3ZUCA 2IH3B 3TNNB 4P46D 1NKOA 4E68A 4KNQA 2XV0A 2BMKA 4PJBA 1HQ4B 4YZWA 4ACTA 5KVGL 1ONQA 5JORB 2DQTH 5EBLB 3ZDYF 1KCRH 2OYLA 4ZSOA 1J48A 2RTTA 4N2FA 15C8H 1J1XL 3T3ME 1HAUA 2Z4QB 1E9QB 3WGVB 1FNFA 2L8AA 1Q0XH 3J2PA 3TIEB 1OM3L 5IESH 1WZLA 4QHNB 4YE4L 1MOEA 4NDMB 2GITB 4AZUA 1ZVNA 4L9LC 1MCEA 1YEWA 3VTTA 2IAMD 4WI0B 5DMIH 3NDYE 2CK0H 3QEGL 4HJJL 4D9LH 2GTWB 1IT9H 1DVYA 4PFEA 3C6LA 3GMOA 4F1SA 2Z7UA 2RB8A 3M45A 3ZKMC 3ZO9A 3HBZA 1ETZA 1AC0A 1U3YA 3FB6A 5I5MA 2JH2A 1M7DB 5FXCH 1N8OE 3VFGL 4Z7UB 1T20A 4X80H 5E8EA 5C0DB 3IFPA 4HFWA 1A2YB 1T0MA 3K72B 5BQDA 3GKWH 4N8CL 1TOXA 1YDPA 4B9KC 4M1GH 1OSZA 1FL3A 5JYLA 3K1KC 3TTYA 5GGVH 1WZ1L 1SM3H 3ZHLA 4ELMF 2I69A 3ZBMA 5H4ZA 4JFVA 1CIDA 1CLCA 2X4RB 3BT2L 4AC4A 1LEGB 3S98A 1OCZB 5CGYC 2R8SH 4L9LB 4BFBD 2DH2A 2FJHB 4RFEA 1TETL 1KJ2H 4OIIL 3STLB 4U49A 5F9AC 4PJ9C 1MCBA 4HZ1A 2EXWD 3RDTB 4TNWK 1ACYL 1AAJA 1CGWA 5HHQB 1KPRB 3TNMA 1IUZA 1AP2A 1IGYB 1RUPL 4BZ1A 1DSWA 2ZCZA 1JGDB 1INQB 1MLBB 1N3NB 3CC5A 4Q4IA 4DEUA 5HPMA 3PWNA 4B95C 5ITBL 1RJZB 2BZDA 2JELL 2VE6A 3O2DA 3MR9B 1EHAA 5C9JA 4KHXL 4ZO6A 4HIXH 1KFAH 5EZPA 4PAZA 1EEQA 4CA4A 1RZKH 4DP1X 1KBKA 5C09A 4NAQA 3MAWA 3EJPA 1LHZA 3FB8B 4U1IB 3FL7A 2OYKA 1HJCA 1MDTA 3LN4A 4Q6KA 4R8WL 4DP6X 4XC1L 5GS1A 4ZUSA 3SE3C 3LHAA 2XX0A 1IBDA 3QDGE 3DIFA 3IJ9A 3WKYA 4OM1H 1H8NA 1PEWA 2AXGB 5JTWA 2FGWH 2P5WD 3HW7A 3V6OC 3WV0A 3OZKA 3SBPA 5B22A 2ZKHH 4CC4C 1HHIB 5ESAB 1UM6H 2R39A 2BWIA 4HQQH 3NVQA 2UZXA 4XH2A 3CXDL 2QQKL 4PV9B 5FFOA 5IHZB 1IQWL 1GGTA 3RGBA 1DP0A 3WEXB 2DAVA 4C54A 2WN3A 4PJIA 1UCTA 2O1AA 2DLFH 3EYUH 1DVQA 4KC3B 4MRCA 5IW3A 4PRID 3QXAA 1DYZA 3KJ4B 2VLKA 3KWUA 1CFVH 1HQRB 3DMMB 3FAWA 1CDJA 5DC2A 4NOBA 4UTAL 1YY8B 4WWKD 3RY6C 2OBGA 2IGFL 3HNVH 4F7EB 1BPVA 1TVHB 4BE6A 3T65B 3MNVB 2PPFA 4K94C 2ITCA 4R0LA 4PTUA 4LKCB 1J0YA 2DTML 5KVFE 4LSRH 4H25A 4Z0XB 3V6ZB 4P46C 4GS7B 4WGWB 2AXJA 4X6BB 4F8TA 3BKML 4PP2A 4YHZL 3UGUA 1QASA 5EU3B 2XT1B 3R06A 3GXIA 5AKRA 3UROR 5C6TL 5AW4B 1IAII 1HZHL 4WJG3 5FUCE 2LW3A 3L4XA 1UXLA 3N3EA 4HUCA 4AENB 1KPVA 1F13A 3CMOH 1NGXB 4A67A 1G4RA 2C3WA 2W9DH 4UANA 3VXTA 3UTSA 1UD5A 3OJVC 1BM3H 1G87A 2X09A 5K1JA 4N2OA 3T0WA 5IJBC 2Y5TB 4RBPK 4YHYC 4WU5B 1BGXH 3B8YA 4MD5A 4AQEA 4FYQA 3SKNB 2DM2A 4E42A 1MCFA 3RGVA 1J0JA 4Y5VA 4KMTH 3TBVB 4L4VA 3QEQE 5DWPA 5KSUB 1J1PH 2BSTB 1SXSA 2JQAA 5HHVH 2GKIA 4BRJA 2E7MA 3EZJB 4KRPB 1CPUA 2CO6B 2ICWA 2IH1B 2RGSA 3AS0A 3HKZA 4X9HA 3EFDL 5EZOL 4DQAA 4PVBA 5ITFA 3UH8A 4ZXBB 3UJIH 3BLPX 1QI3A 1K5NB 1QLEB 3JUYA 1R5WA 3REWA 3VMNA 3GIZH 1JHTA 2VDNH 5AW1B 2ZCHH 1AGCA 3CZSA 2VMFA 3ULVF 5B38G 3BE1H 4LOEA 3GT6A 5CR1A 2O26U 2VN7A 5IB3A 1NAMA 5EC2B 1QZ1A 1E7UA 3O3AB 4IJ3B 3K6NA 1MJ7H 1UC6A 4TUJA 2F7OA 1LO3H 3I3BA 1T4KA 4FN0A 5E6YA 3VDBA 2GAZB 3NAAL 3QE5A 5BXFA 5EF2A 5EFIB 1XCQB 1DZBA 3MRCB 1ZGLP 4FXKC 3CCHA 4MHHG 3P30L 4URKA 5JIQA 3FFDA 2JELH 3LRMA 4D9RD 1X6LA 4IJTA 5ICZA 4HIXL 4M8VA 2N0KA 3DURA 3N42F 4OF6A 1BP3B 5F7DB 5HDBE 1GOGA 1QRND 2NX5A 4DW2H 4LCWA 3GI9H 2BS71 3V0GA 4XP4L 2BNRD 5LGHH 2YRLA 3D08A 5JUEL 1XF3A 4Z7IA 2IMMA 1PY0A 3ULSB 1D5BB 1AIZA 2DTSA 2OQJB 2Y6SD 3IFOB 5K9JL 3SDCC 2ICES 1CQYA 2ZSWA 1BVZA 3EOYG 4FQIH 3CDYA 5I9QB 2BIHA 4APXA 1N64H 4GBXA 1KJ2L 2AEPH 1A8ZA 2X9WA 4ADGA 5I75B 4GXUN 5CCKL 3MLTB 4AT6A 4PCSA 2OJZL 2BP5M 1F4XH 4OFYA 1R5VA 2N0MA 4XCNA 4K15A 4IMLB 4AIOA 1MFCH 1ORQA 3QW9A 4G6KH 3P77B 3US1A 5AW3B 4M6NH 3SGEH 4PIRF 4ZS6C 1FZMB 4NQXA 3GI8L 3Q6FA 2ZCKL 5JDSA 3GNML 1WQVT 3JTTB 4QXUH 4CSSA 1JZ7A 1C8PA 5EIVA 3NFSH 4MAYA 3C75A 3KYKL 3REWB 3F85A 3WLBB 1CG9B 2B5IC 2O5ZL 4X7TB 4ENZA 4XCYA 3P11H 1O5PA 3KGUA 2I25N 4IOIA 3Q7JA 2XQYK 2YRPA 1HCFX 5JW4N 3MQIA 1DBKL 2UY7A 1EQWA 3RY4A 1JZ5A 4WK4B 3TBVA 2EAEA 3TZVB 2E4FA 5I0ZA 3GMQA 3D69B 2PPEA 1H6FA 2RA1A 5DJYA 2WW8A 2I9TB 1F90L 1XMWA 2AZAA 1GAFH 3H7BA 3BZEB 4APQC 4F27A 4U1LA 3KYNB 3ULVD 4GEIA 1CC3A 3VD1A 1QRNB 3JVGA 2R56H 3ZK0A 1QHQA 1N4XH 4LPWA 3GKZA 1BQKA 4JO2L 4OSUL 1ZVSB 1PG7X 2WVUA 4GAAA 3VAEA 2PYFB 1L9TA 2PTUA 2NX5B 3KDMA 4WFFE 1T1YA 2WQXA 2D73A 3FFDB 1MH5B 4PLJD 3G04B 5ILTH 4MAZA 3MNDA 5ICZB 1KYAA 4UAHA 3X14B 4XVOA 4TQPA 3RL1B 1K8IA 3M86A 5BXFB 2IGFH 4DERA 3ECUA 1NUFA 3Q9QA 3CU1A 4XBPA 3L3DA 3NRQA 4MB5A 1FFRA 1XGPB 4NJAL 2XY2A 3Q1SH 5GS2H 4U1JB 3P2BA 3MLTA 4AT6B 5BRZE 2J72A 5KN5B 3O6FC 1D7CA 2ZONA 4ZAKB 5I23A 2BSSA 2JK5B 3AG1B 3MRFB 3L3JA 5IB5B 3PWJB 2Z91B 3IFLL 4PSRA 4PJXE 4FMFA 2W9EL 4JJ5A 1ZA6B 5EOCL 2A5UA 4ZXBA 2XN9B 1CK0H 5DEGA 1R5WB 5DZNA 1GW0A 3W1ZA 2FX9H 3V6OA 2X44D 3QFGA 5T1MA 5SWSA 5DUMH 2Q0ZX 1JYXA 4UQIM 3OQ3B 4WW2C 3L16A 1SPDA 3MOQA 5C0JA 4JB9L 2DWSA 4L5FL 1HKFA 5C2BL 4XOCA 1UATA 4TSAL 5TE4L 2YQGA 5TGBA 2Q87A 3NIDF 3S3PA 1ETZB 1HQ4A 1QPKA 1YJDL 2EDWA 4H88L 1XCQA 2MIZA 1FNSL 3D2UB 3NFNB 5HDBB 1MKFA 3T8XB 4N9OB 3G9VA 4WJ5B 2V5MA 2H0JA 3AY4A 4AQ1C 3RE0A 5E8OA 1RP9A 4X99A 2BHZA 4OBRA 5I2IB 4NRYB 1GIGH 4Y0GA 1ACXA 4J3VA 5DD5H 5E9DB 1Z3GL 5DI8B 1BSIA 2B3RA 3AG3B 5D1QD 1KENL 3W57A 2R0ZH 4IOIB 2WSKA 5D7JD 5DD3H 5FX3A 2VERA 3QUMA 3HRZC 4YPJA 3EIFA 1SF3A 2D7OA 1HZKA 5FGBA 1MFCL 3Q6GH 5KYWA 3BRGC 5CCJA 2D03L 2EDLA 3JWOL 1L5GA 3K0YA 4GAYB 2ADYA 3TBWA 3O3DA 2F68X 3SN6N 1M1XB 4H1LB 4BFFA 4XHJD 4DTGL 1RK0B 1FG2A 3KCPA 2WLJA 3SJVA 1X4YA 2JTDA 5HPMB 1EJ8A 2QSQA 1OSZB 3DWTA 4H8QA 4WI2A 4ZPVB 3GDCA 4JFDD 3VFUA 3DYMA 1U8OA 5I26A 3S37X 3WAJA 3SJVD 5B3JF 4OKDA 1AZZC 1U8LA 2FLRT 4GRWE 4K55A 5DVKA 5KYYB 3FTSA 3B1TA 3SOTA 5GS0L 2AP2A 2FTAA 4P4KC 3O3EA 1EUUA 4ONFL 1KIUA 4S1DD 4AZ8B 2EEXA 1R3JA 1L4IA 2ESVD 3LB6C 4WI0A 5MEPB 2D9QB 2EECA 3OPZL 3APNA 1OSEA 3FW6A 3LCYA 1Q9OB 3I6SA 3WUWA 4EIGB 1RIVH 2AMUA 2FGZA 5IV2B 3FQ4A 1VGKB 5EUOF 5FOBB 4LHUG 4WI8A 3EH5B 4UM9A 3X11B 4DKEL 2VL4A 5E94A 3FQ2A 2YC1A 3CBJB 4Z7UA 2JQZA 3FH5A 5E8DL 3DHPA 1WCQA 2XUWA 3PU7A 3IRCA 2LU5A 4OZIB 4KTDL 3NA4A 2Z8WC 1KYOK 3BWSA 5DSCA 4O51A 4FNQA 5KBNC 3H7BB 1E8YA 1NKGA 3I6KA 1ITBB 2Y36L 4X6DF 4XPGH 2EZ0C 4YC2C 1T22B 1VA9A 4JFYA 3O4OC 4NN7C 4DN4L 4LEOA 4C56A 4BGDA 2Y7QA 3I74A 3SQBB 4HHAA 1LNUA 3RI5K 4YDJA 5JLZB 5L4MA 2NY3B 5FYJU 3VD9A 2HT4D 4JDTH 4OGYH 1DQJB 4I5BA 1NSNH 1EJOH 4P5TB 2J88H 3I75A 4Z3TA 2BCMA 5F7EH 3PCYA 4KK8D 3V7AG 4BRVA 1R3IH 1SZNA 4P48A 5LCVH 4UTBA 6FABL 1GZPA 5HHOD 4HWBA 3TURA 5DK0A 4XMKH 1CFSB 3ARBC 5IVXF 1CK0L 1LXMA 2YD2A 4BKLB 3K71A 5K1VA 3MYJA 4JO8A 1AGBB 3OX8A 3SOBH 1GYVA 4ZMNA 1CS6A 4X5XA 5I6XB 4HCIA 5F71A 2R2EA 1JGIA 3KPNB 3SKMB 2ZUXA 1FRGH 1T20B 2H3KA 1T2XA 3M17B 4UI2A 3Q06A 2C1OA 2Y5TA 3KYMA 4GRMA 1UQSA 2B1AL 3QUHA 1HKLH 2GJ6A 2IAMB 2VZTA 1IM3D 4YBHA 4OCXH 2EILB 3V4VB 1PZSA 4BH8A 1A7OH 4M7KH 4NQUA 4C47A 4V1DA 3TESA 2DD8H 3QJVB 4JJ5B 3FTXA 3IM1A 3SB3A 3SZ6A 1NCCL 1TQBB 3RTLA 5IJVB 3ATDA 2YPVH 2QV4A 3QORD 4Y7MA 4MDJA 1RK1A 3FO1A 1JI2A 1ZTXE 3WNNA 1J1OL 2E6JA 3OKNA 3MXWH 1U92A 2B14A 1C1EH 4RRPG 1C5DA 4FQCH 4AQ1A 4JFXA 1IIIA 2JCCB 5AB0A 5EOTA 1MEXL 3QORB 2GSIA 5LBSA 2B2XH 2XQYG 4OZIF 1M7XA 1NBZA 1P4LA 1EVUA 3VGGA 2E4TA 2W0FA 5IBTH 4XH2B 2ZOLB 5IMLA 3B34A 3MRPB 3VXPA 5DUBA 4PJ9A 5BRQA 3FUFA 4POYA 4M43H 1A64A 2OZ4L 5GJSL 4M61B 4AQOA 4UIMA 2Q20A 4CMMB 2XG4B 5IMMA 1FNSH 5CAYB 4NNPL 4XO8A 4KX8A 3TBBA 4M29A 2H6OA 1UJ3A 2WKGA 2KMWA 5IFAH 1IGCL 4DPRA 1FG2B 2X1OA 3CHPA 3MBEC 2VRAA 3T0DA 3MJWA 1KENH 3BW9B 1U30A 1UH4A 4IBUA 3TEUA 4N90D 5HGAA 2ADFH 1KIPB 4CJ0A 3CBKB 2ZKMX 4GXVL 3RNKB 2UVEA 5F88B 2X2YA 3FT0A 1DLHA 3RWGB 5AOKA 4I4WB 4L0YA 3VD7A 1TTCA 2XVGA 4PJGB 4WU5A 4DUVA 3BZDA 3SGDI 2HAZA 1G7IA 2EABA 3C60C 4KVNH 4GLRI 2B16A 3S35X 3U2JA 1NGXA 4L4VD 4N5EC 4DHLA 3VFWA 3PABA 4P2QE 3F6IA 5DHEA 4OUUA 1AO7E 5FECB 4P2QD 3WY4A 3BEVB 5DURB 3S5LG 4KRNA 4G1EB 2QQNH 3A23A 4KJQC 2B3IA 4G9FB 4UT9H 4UQDA 2WWNA 3F7QA 4G3YH 3SHSA 2R69L 1D5IH 1S7QA 3K5SA 1N68A 5T5FL 2XC8A 4X7TA 4APXB 4HWBH 3VWJC 2EIJB 3KW8A 2Y0SA 4L3CB 3IVKB 3R7QA 1ZTXL 2GJZB 2YC1B 1V7ML 3MFFA 4LO9A 2NUTA 1MNUH 1J8KA 2HFFB 5KBLA 4K23H 2ZCLL 2IXQA 1WYJA 4BZ1H 2FZ3A 3DROB 3HZ3A 2FWOA 3KJ4C 5ACLA 4B9JA 2J2ZB 1WEJL 4ODVL 5IF0B 1WTLA 4Z3IA 2IQ9H 4WK2B 3UG3A 1MFEH 4QYOA 3EJQA 3ARWA 4YSUA 3GS7A 4L1DA 2VXTH 2YPVA 1A1OB 3BYTA 3BQUA 4KNTA 1UYWH 4GAGL 1Q0EA 1WISA 2MCPL 5E1GA 2XIDA 2AJZA 1ZHKA 3MUUA 1F1DA 3NCJL 3V8OA 3WCYA 2ESVB 5A2FA 3RI5F 4LIQE 2VSDA 2QLYA 1J11A 4HDIB 2GAZA 3VXSE 4Z78B 1PD1A 2KZKA 3D39E 5B7FA 4ZS7L 4JFEB 5HHPB 3D39D 1IEBB 4RZCA 1IGTB 1CYGA 1NIAA 1U3JA 1ZJBA 5EC2A 5DFAA 3K71B 5AVSB 1A7QH 1IGML 3UG5A 4OGXH 3LHPL 5AYTA 1NC4B 1O7DC 1U3HA 2FHFA 4JDTL 4D0BA 4FZEL 5I8OH 2GHWB 1WFJA 5I6PA 3WSQH 3QG7H 5FAAA 1IGJB 4IRJA 2QHLA 4OF7A 1XT5A 4QRSB 3MNWB 1FZMA 1R3IL 1S5HB 1U3HD 4NQXB 1AHMA 1KT2B 3QAQA 2EDTA 2PYFA 3RVTC 3TYFB 4X98A 1O6VA 2EVGA 3U0WH 3OTTA 4J3UA 4ODHL 2G2RA 3MC0A 5EZJA 4F7MB 3NTCL 3CZLA 4ZMVA 1NCAH 3CZNA 3HMXH 4MXQD 1AP2B 4PJ9B 3RVXC 2FSEA 3ULVL 3MTRA 5F7WC 1JWUA 1YEHL 3CDZA 1JZ6A 4XOEA 5T5NG 1BFOB 3RPBA 3CQPA 3GMQB 5L6YL 5F1NA 1KDJA 2FX7H 3MV8E 4M43L 4QJ4B 1TJGH 3GXMA 2I7OA 2V8MA 3EJUA 1FLRH 4IS6A 4Q89A 1WIOA 1UWFA 3H0TB 3P54A 2PWFA 4ZQKB 4WDIB 1XR9B 1Z32X 1OHQA 5FOJA 4LCUA 4K7PH 2FK9A 3RIKA 5CBEB 1XTLA 3RNQA 5HHNB 2QVKA 2J4WH 3RVUC 3P9MA 4H8WC 1AHWC 4H13C 4X5LA 3IF1B 1F56A 4BE5A 3P77A 5HI5D 2OULB 2X3AA 3CLEH 4OTXL 3B9AA 1U58A 1U8MA 3C8KB 3UOAB 3VH8G 1OV8A 4Q14A 2KC0A 4WU7B 4XMUA 2XJLA 3BUDA 3QYMA 1FF5A 3ULUH 3F01A 1BVNT 4Z7QF 4E9RA 3KWWA 3FNKA 1I3RA 3JTBA 3ML9A 5FECA 1HI6A 5CKGA 5E08L 1A8JH 4NUGL 3L7FA 4WGKA 2DI9A 3M46A 4ZTOL 3ESVF 2J20A 2UY7B 4M5TA 5I1KL 3ME0B 5G4OA 2C3VA 1D5RA 1L5GB 5MHSE 4GRWB 5T5NF 4X42A 2IIJA 4X7EC 5BZWB 3DGGB 3PWLB 5GS2D 2QQNL 1U41A 3L3HB 4E9LA 4EI6A 4L3FA 1B3JA 1H3PH 5GJSH 3KLHC 5I66A 4WUUA 3VXSD 1FFPB 3Q5TA 5D1XE 4JN1H 5AOIA 4WENB 2X4SA 4GRLB 4XOAA 3DMMC 1MRDH 5D2LE 2D0HA 4R4BB 5D7SH 4ZDHA 4NI3A 2VO5A 1Q9WA 3QJXA 4MMXA 1X3DA 5SWSB 1ZLVK 3RHWF 3UABA 2D3LA 1X5HA 5E2TL 3CX5J 3UTZB 4WFGE 1INDL 1FA4A 1MFEL 4PRHE 2AJYL 1ZHBA 1PQZA 1QFPA 4G5AA 1YJDC 3DO4A 1IRAY 2NY4D 3IJYA 2F19H 1E27B 3DV6B 3N42B 3VU1A 3BPOC 5E8NB 1EO8L 5I8KL 3BZ4A 3VSUA 4KY2A 3B37A 4MDIA 4FERA 1E40A 2YEQA 2VWEE 5I28A 1TKWB 3JSSA 4J3WA 3HKFA 1UKTA 2MTAA 5A3IC 1GMEA 3ZDXB 3MRHB 1REIA 2WWOA 3K46A 4HS3B 2J12B 3H42L 4B9ZA 4XOBA 4B9YA 2C3XA 2IH1A 5C8JB 2NW3B 4ZPTA 3HI5H 3BN9D 3QIUD 1BLNA 1L9PA 4S0TD 4P3DA 3VG0L 1ND0B 3PXLA 3QCTL 4L4VB 1JWMA 1MAJA 2FJUB 3IBOA 3L3KB 4GIPD 4M3HA 4JK0D 2A9NH 2NY6D 4ZFFA 4ZW5A 3VXNA 1AOZA 1EHKB 1RKRA 5AW2B 3X17A 1UJ3C 3V4PL 2M83A 5MP6H 4LDOB 2WHVA 4TQIA 1KTLB 1L6PA 5D4IA 4UWQB 2FHBA 3QDMD 3O6KL 4EVNA 1AGCB 3P9MB 1BZEA 3LKQB 1YY9D 3VD4A 4MZRA 4QNPE 2NTFA 5AWNL 4QNPF 3KAAA 1YMHA 2QDWA 2VUOA 5CR8A 1I8AA 3U9WA 3MJ9H 1Q9WB 5JXAH 3QFDA 4K7FA 3UIZA 4U6HA 3CHRA 4PJ8D 2YEZB 5J1TC 3C5JA 1FFPA 1U91A 5DJXA 1A6WH 3FQUA 1M71A 3L08A 1S7UA 3CPUA 3PXJA 4BK4A 4UIKL 2BS9A 2LAGB 1E50A 1SYSA 3PAUA 5ACZA 1B2YA 3OR7B 2OSLA 2BX5A 4NOFA 1JV5A 2X10A 3ERXA 3BP5A 1OAKL 4XP6L 4TNFA 3LQAL 2YGQA 2IDFA 3MOBH 3NABL 4S2SB 1ACZA 5ANMA 1KTDA 4P99A 3VB9A 2VKWA 3GMNB 4GUPB 1BXXA 1NCWH 2K0RA 1QOKA 4RGND 1H0DB 2YPKA 2IANE 4RESB 4Y4FD 2Z7YA 5BJTB 4LARL 4AQ1B 4ZTOH 4W9FC 2RIKA 5I0WA 1NAKL 3WIIL 1VB9A 2O72A 3JV6A 2XX1A 5DD0H 4HUUB 1OAUL 2FL5A 2WLLA 4JM0A 1T7VA 4YO0B 4W81A 4HZAA 3WTWA 1AGFB 2H8PB 5LXGH 4GKLA 2WZPA 5DJ8A 1Z9SA 4ZFOL 5SWZE 5FYKL 2HVKA 1XSJA 1Z2KA 5E2VL 4H44C 1QACA 4EIBA 5F7BA 2F6AA 4HJ0C 1ADQA 1IKOP 1PZBA 2VB5A 1X7TA 4JPVH 5L4IA 3KL0A 1CL7I 3ARBD 1DCLA 3B6SB 3WL9B 2FQGA 4A7UA 4WHDA 1UXWB 1JHLH 1ETJA 5LDUA 4YDKH 3BD5A 1MCDA 3VXNB 2OMTB 5HYJD 3S0PA 1XB8A 3WO4B 5L9DL 4UQ3A 5F1IA 3O2WL 1EWHA 1LEKA 5I24A 2QSCH 5L2KD 2Y1ZA 3MODL 4MXVF 4MAYD 3NCYS 2F15A 4Y16C 1P4LB 3APFA 4XRCB 4I18A 1YEEL 3TASA 3VXSB 4CC1A 4AVIA 3HG4A 4O4YH 2PXYB 2CKBB 4G1MA 4ZX3A 4G9FE 4I3SH 5DJZB 2F1EA 4ERSL 2DIEA 4GRWH 3FQWB 1IJ9A 4PRHA 2ZIDA 1P6FA 1ETB1 1FG9C 2OMBA 3K80A 1EXGA 1OTUD 3ZLQC 2VISB 2K4WA 4P5TA 3FPYA 2WZ5A 5DDHA 4C83A 2MNUA 1H8SA 4XAWL 4Y5YB 2FD6L 4MDIB 4L3EB 4X9YA 2VZSA 1A3LL 5F89B 2NNXA 3UMNA 1JGDA 5LN8A 4AC2A 1EEUA 2UY6B 4P04A 1DBJL 4NRXB 1QLFB 4POZD 3HNTL 4GI8A 4V1DB 4XAKE 1JWSB 1Z5LB 5SV4A 5A16A 1LE9B 2F9BT 2ICEB 5D96C 2AQ1A 2R56L 4Y8AA 4M9PA 4YSAA 1P6WA 1R24B 2NY2D 2BC4B 4NAJA 1E5AA 2MPAL 4P4KB 4F2MA 2A74A 3NP4A 3L4YA 3ENEA 4FQ1L 1S7SA 4D9LL 1TJMA 3NCWA 2FJHA 4HHWA 4YAQB 4YXLH 4PJ6A 2F08A 4AYBA 4QYOB 3RAJH 1A7PL 4DK6A 4OCSL 4EBQH 2W0LA 4MJIB 5DJ8B 3VFGH 1QSFA 4XNAA 2X5PA 3VWJD 4DUWA 4H20L 1Z7JA 2ADIB 1UJ3B 3BVDB 5C0CB 1U92B 5KVEE 4M1GL 2MWCA 1M42A 3QK0A 2CRIA 4MDRA 4PJ9D 1Q1JH 1W72A 4PI2A 3IGAB 1XGTB 3US0A 4Y9GA 5EO1A 3BUPA 3EDKA 3ARGD 3WD5H 3ARYA 3BIKB 3IFNH 3QHZL 1KZYA 1V3LA 3D18B 5KJRH 3MRKB 2VQUA 4WHYH 1AR1C 4BFJA 5EOCH 4XMTA 3ZYJA 1ED3B 2GPZA 3LPWA 1F86A 4F7TB 3AQYA 3UZVA 1HTYA 2EDXA 4Y5XA 2H41A 2PW1A 4QT5A 4O02L 3ZE2B 1I7TB 2V17L 4K4KA 5FYJL 4F7EA 3QG6B 2ZX5A 3CFIC 5ITBH 4X6DA 4HUUA 4CMHB 5A2BA 2BNQB 3K2UH 5LAXB 2YMTA 5ACZB 1KBWA 2IG2L 3OLIA 3QIWC 1HSAB 1E3ZA 4GSDH 3ROLB 1S7QB 3BH8A 1W72L 2W5PA 2AXFA 4EO5A 2C9QA 3NSFA 1IGTA 4LRNL 3UEQA 1G7LB 5IT2L 5JOEA 2WIMA 2JCCF 2WYZA 1DANU 2KLRA 3ABLB 2K8QA 3UMTA 4D9RE 5D6CA 1E0OB 5BOZG 4PJ5E 1UASA 4OI9A 3FF8A 3QC5X 4OFQA 4JQXC 5DHVA 2CWRA 4MCZB 1H15B 3B2UD 3FHAA 1YNTF 5DRXB 1QBBA 2Y69B 2BK8A 2H0EA 2I5YL 3GSOB 1F42A 4F57L 2NUPA 3NFNA 4NPKA 4DFIA 3QCUL 5LKNA 3OZ9H 5D9SA 3AGVA 2ZAHA 3V5HB 5IG7A 1HNYA 1FH5H 2K9UA 4X98B 3QIWB 4JGMA 2Q86B 2W65B 3VFUB 2VLLA 1Z0NA 1XAUA 4DO4A 1FZJA 4WSJA 4HXAL 1IBGH 4YSRA 3M6DA 2IF7A 2XZQH 1A4CA 4XNQB 4AE1A 2ADIA 3ZMRA 5J9PA 4XMLH 3TBWB 3FHEA 4H2AA 4M7JL 5CU9A 3DTXA 4DGWC 2N4IA 5ITFB 4U1MB 3C2AH 3MYZA 3CGTA 1DUZA 5IVZA 4UU9B 1T1WA 4BFIB 2LGNA 2VR7A 1DL7L 4MQTB 3T3PF 5KYWB 3GSQB 3MV8D 1A7RH 3OR6A 4FQQB 4WWKA 2A74B 1HHGA 2AQTA 2OMYA 4RNRA 3EFOA 4HD9A 4AQEB 3KVDD 2FR4A 3CUPA 3MV8A 5DFVD 3RWCA 4NLAA 3E9TA 3TBCA 5JMRA 1EEZA 1W0YT 1NBCA 1K3IA 1HHHA 2ESVA 3DI2B 2WLIB 3K6DA 2UUDK 4RISL 2V6HA 1UT1A 2APXA 4JZJB 3H2PA 5HPOA 3L95A 3PGDB 4GUOA 1JZFA 2JKXA 3P73B 4QOKA 4B9FA 1HZHH 4JVWA 4X7DC 1KJVA 1A9BA 4MFHA 3GEWB 1U36A 2QGDA 3C60B 3L5XH 4GMTH 3GHPA 4PJAF 5EU3A 1W8OA 4UM9D 3FFOA 4LPYA 4M8QB 3X11A 3LEYH 3IAQA 2KL6A 5I1HH 1MW2A 1S7RA 2GBTA 4XHJC 4KUCF 3ULVE 3LZOA 4Y5XB 1QSFB 4P9HH 5FUZL 1AQKH 1MAKA 2ZF9A 5J06A 1MLCB 1DVFB 5KJ7E 3AU0A 3KLHD 3OSVA 4JPWL 4LLVB 1TTGA 1W6WA 4U1SB 4HEPG 2Y7NA 4GO9A 3VWJB 2E75C 2IWKA 1VERA 1RU9L 2VJXA 1LWJA 1N0LA 1WV7T 4P23C 2V2XB 4FYSA 1UEMA 2WXKA 4Q9RH 3BZ4B 1ZXQA 5EO1B 4P4KA 1C9SA 3HCVA 4XBEL 3MRCA 3WDJA 3UJIL 5IQMA 2CCLA 3LNFA 3L4TA 1YYLH 2ICEA 2NT0A 3BAJA 3TC9A 3MUHL 3QIBC 4Q9BA 4XCFL 1I3GH 5EO9A 3ESUF 5DMJB 2I9LA 1FLTX 4WUUE 4ZUWA 3FFCB 4W9ZA 5CJ8A 1CT8A 5DJ0B 1OTSC 4FJ6A 4PTTB 2C4XA 1T0NA 4GSXA 1IBBA 1MCHA 3G3LA 5IB1A 2J25A 3IFNL 3AG4B 5D2NE 3RX8A 3BRFA 1ZA3A 3HLAB 5HDBF 1PX8A 5HI5C 1C5BL 1DJIA 1LYQA 4X0NA 2J1ZA 4PI0A 1LO3L 3TX4A 3O2DL 4OY9A 2RCSL 3ZRCC 1P7HL 4OZFB 5LAXA 2XVBA 3D2TA 4Z7NB 1FP5A 5JW3L 4P23B 4KBPA 4MDJB 3NH7L 4HJEA 5IY5B 4RMTA 1IFGA 4NENB 2DMHA 1MHEB 1MIML 3BH9B 4YHMH 1P7KA 2XBTA 3KWTA 5JIHA 4HWZB 2FQFA 2C7UA 3KPRB 4L18A 1C7SA 1AGEB 3GHEH 4QRQA 1RY7B 3VFPB 1ASPA 2YD9A 3MUGA 5EWIL 1OPOA 2EDNA 3I6KB 3K81A 1IKNA 1BG9A 5I1IH 1EO5A 2VM4A 1YEKL 3DLQR 1NDTA 3UYOD 5CFHA 2WXIA 2MNWA 2XWCA 4Z0BL 4FTDA 1BBJA 2QQLH 1BZ7B 1Z9LA 1PS3A 4F2EA 4GO8A 4XI5D 3WJMB 4FA7B 4I8DA 5DRNB 4FQIL 1OK8A 5A2KH 5CZXC 2F61A 3QORA 3TO4A 1I9RH 4JG5A 4DKFH 1XGRB 3CDCA 3D34A 3QHZH 3SZKC 3TYGH 1N70A 3FQXA 1HHGB 3C5JB 3MRDB 3BGAA 4HH9A 3ZQ9A 1GY1A 1T1YB 4KKBC 2WYHA 3TO4D 5BO1L 4LVNB 3ZKSD 2L04A 1P7BA 3DHMA 3FTGA 4PJCE 4YHOH 1R75A 3NAAH 2DLEA 2LU7A 3TFBA 4U7MA 1TMQA 3HG1E 1XH1A 1ZSHA 4BFOA 3T6WA 4NJ9H 5DS2A 1A9VA 4G82A 3Q05A 3OHXA 3PGDA 1KGIA 4JGJA 1XGQB 3HAEG 4X6CA 5FCUL 1IILE 4TXVB 2UZIH 2X6UA 3KYNA 2BIIA 4J5VA 4FQXC 43C9A 2YA1A 2I32A 3IGKA 1U6AH 5C0EA 1WWBX 3TJHD 5L7XL 2VLKD 2HG5B 3A6OA 3GI9L 5IIEB 4R83A 4D94A 1H3XA 3HUJB 4JE0A 5DHXB 3VNYA 3U2SA 1YEIL 5CP7B 3OG4B 2MOQA 3UTTA 1DUZB 4M5YH 1YY9C 2HKAA 4GBXB 4W4OC 6TAAA 1I7ZB 4QF1A 3ASOB 4NQCE 4C58B 3EYSL 4MAYB 3IGUA 4H8PA 1F41A 2P1YA 1MJJB 4LSUL 4NIKB 3CFKB 4DPAX 1MHPH 4JHZA 5BV7B 2RQEA 1QEWA 3WTSA 3WLWC 4N86A 3WKML 2HLAB 1WFNA 2A7BA 4P3CL 4MMYA 4JDZA 4MJIE 4RGOH 2DOCA 4M7JH 5I71C 4RGMB 3VSVA 2F53B 2V33A 3KHQA 2XETA 3DIDA 4EKJA 5IHBA 5TFSL 4NN5C 1ZHKB 4ONGL 2J6EL 4XBGB 1IAOA 3NIGF 1NAML 4LNRA 3BP6A 2VDRL 2MQ0A 5ISZE 3HHRB 3KLQA 2K3HA 1DBKH 2W07B 4DGUA 3PABB 1S9VB 2OX5B 4OGZA 3EYVB 1D7FA 5F9WC 4PJ8A 5C0AA 4HUVB 1HN1A 1UB5A 1U91B 4JQIA 2HJLA 3GXNA 1T5KA 1GAFL 3UJTH 5AG9A 2R9HD 4Q6IC 1WC7A 3JBG7 3QB7C 3ZX1A 4ZNEA 5LWYH 4TUKL 4MBRA 2QADD 1OANA 1JTPA 4U6XB 3IETA 3PWJA 1J5OH 1RZ7L 1BBDH 1N6VA 3KDMB 3LEXB 3CLFH 2WP3T 2E86A 2CK0L 2DL2A 3MGOA 1KTDB 1YMHB 3V6BR 4MMZB 1T1ZA 2VW4A 3P0YH 1G7PB 1UENA 2OYPA 1JNLH 3LQAC 3GZQA 2OSXA 1P1ZA 2ZSVB 1BVKA 4X9BA 5CLZA 5TDNB 3QUZB 4Z1PA 3I50H 4TVPH 4QRUB 5CU5A 3WEBA 1S7UB 1JYVA 2VDLL 2WVSA 4QD2E 1KGWA 4K5MA 1UVQA 4N2IA 1IGMH 2BWQA 4D2NA 3RIAF 3W82A 3LEVL 3CPLA 3OQRA 2C7UB 4EI0A 4A6YH 4DGYL 3ESPA 2EICA 3U7YH 3VTAA 5IOKA 4XAKD 5JR1H 4ZQKA 4OQ1A 3BQUC 3LKSB 1QFWI 4QIRA 3IK2A 2OW7A 1DBBL 1OKEA 4PUBL 5DJCB 5DU7A 3ZT6A 1LP9A 1T7ZA 3NJIA 2P8PB 4G42B 3TU6A 1MXGA 3DRQA 4G1MB 1KBVA 4N8VA 3UERA 5CP7A 1YY8A 4OJEH 1QQDB 1IEAA 4TF4A 4NKMB 4WHCA 4KOCA 5F1SA 1LEKB 5FCUH 1J5HA 4Z7QB 2XLLA 2FLBT 1ZLSL 2D3VA 5E8OB 3ILQC 2J8UE 2W07A 5C0ND 1TSRA 4IRZH 2YFNA 4LVOB 3KXFA 4K71B 2Z93A 2WXJA 3K7UA 4MX7A 4FYTA 5MERB 1O9ZA 2OMWA 2BY1A 3L5JA 1MFMA 3SYPA 1AMYA 5FUOH 2X9ZA 3BAEH 4QXGL 1VAHA 4H8WL 4A37A 3TF4A 4FRWA 1VGEL 1H6UA 3HPJA 2Y5QA 2GC7C 1WA0X 3H3KA 4K7PL 2FGWL 2P44B 1I31A 3CZEA 5IR1B 2BJMH 1NDGA 2IWFA 5EN2A 2DRUA 3O4LE 5FHBL 3PGCA 3WFBH 3OD3A 5F1IB 3G6DH 5E4EC 5G5DA 1UTDA 5KOVC 4LSUH 3MKKA 4HWEH 1QPXA 2DM4A 3QNXB 5I82A 2XVKA 4EI5D 3U4KA 4ZT1A 2LTQC 1A3QA 3M7OA 3ETBJ 5D2NC 3DBXA 3T77A 5A6MA 1EX0A 1X5AA 3D33A 3SE6A 4JM2F 3T0EA 4JFZH 4AENA 2ATPB 4JPSA 4ONHB 2WZAA 1AI1L 4YXKH 4DSYA 1F2XK 1G6RB 1UD6A 4FKEA 2PYEA 2VDQL 3PIQA 5F3HB 4E5XB 5JOFA 1QKZH 5BV7C 4F7PA 5J12C 3OM3B 2J6EH 3V6FA 1BD2B 1QR4A 4G5ZH 4I2XA 4DZBA 1NIEA 4F5CA 3HB3C 2A99A 1Y6NR 2BNUA 3O2VH 4BWTA 5AVZB 1WC7B 3F7RA 3V0EA 2M2DA 3IBEA 4FL4C 2EVFA 3ZYOA 3ZDZE 4N2MA 4OLUL 2C9VA 4LOUD 4CL7A 4PY8I 2H47C 1CTNA 2FO4B 1DFBH 2V5TA 3CIQA 3FCTA 3MNZA 4WWID 5C08A 1BZOA 3W9DA 4P5MA 2G30A 3ZXAC 1EAJA 1CBVH 4XXCC 2XYBA 1HXMB 2O5YH 2EYSA 4JM2A 4MQXD 3II1A 1F1GA 2Y07H 2ZG2A 4XC3H 5TQ2H 3SCMA 5CD5D 1BGXL 4R7VA 4XPHL 1TQWA 4OR1A 1Y6MR 3MLXL 5HHOE 3TN0D 4ZMYA 1N2RB 2CBOA 2DIJA 1CFNA 2H32A 4ODTL 4HX1A 3RBSA 4G7VH 5I75C 3BLBA 4KTDH 2FWLB 1LO5B 2X1PA 4FFZA 2NLJA 3SPVA 5BRPA 3JV4A 3V5KB 5E95B 3C5ZD 4KXBA 2XZCL 4Y16B 4NUQA 1A4KA 1E42A 1D2OA 4JAMA 1IFRA 4ZPTB 4C4UA 1M56B 1UUSA 4U2ZA 3CVCA 3NP3A 1YDPB 1J05B 2JCWA 1V55B 3E3QE 2IBGA 3AT9A 3HI5L 2FATL 2YKLH 1I1RA 2DQMA 2J44A 1PLBA 3QCTH 3QJHA 3U7YL 1S7TB 4JFDE 1D5ZB 1TZHB 1ESOA 5I1GH 3T5WA 1XR8B 2XJKA 2LT9A 4K07A 4LHUA 4MWFA 1JCVA 4Q2ZA 4Q58C 1KLUB 4HIJB 2L0DA 1FHNA 3TZVC 4NZTH 1G0YR 1T4WA 2IJ0C 5JXEA 3FUKA 4MZ2A 2YIHA 2ZOTA 3CLFL 4ALAH 4KO9A 3FB6B 4YQXL 2NYKA 2CJSA 3DVNA 2CGRH 3QNZB 3SYAA 3DVFA 3HCVB 4PJGF 4X80L 3FRPB 4UU9A 5KS9E 1C8QA 2DKMA 4LSVL 3IU4L 2FJGA 1SHSA 3T6ZA 5J6HA 1SM3L 4IEFA 5DJXB 1N5AB 4LL1A 2F8IA 3MO1A 3BAEL 4N28A 4LK4A 5M7QA 1WJ3A 3CAFA 5ELIA 1NCCH 2O6PA 3HLAA 5IFAL 3UZEA 3QO0B 1TU2A 4Q7DA 1FAIH 1TEFA 1GXEA 3RUGF 1BJ8A 1P4BH 3CN4A 5E6ZA 5IQ7H 4F7PB 5TF1L 3OXSB 4I7ZC 2LU3A 3WI9A 4WI4A 5C70A 4H5SA 2CIIB 3QULA 1HL4A 4MD4A 3H3PH 4G8EB 5EHFA 3RVVC 3UXFA 1A9BB 1F02I 3GYRA 2JV6A 4ONHA 1FIGH 5ESAA 2XN0A 3H9HB 4JFZL 4NQCB 4F93B 5IQNA 4NBZB 4IKIA 1E65A 4DH2A 3NFSL 1QFUH 2UWEF 2HX9A 4QHKJ 4I4WA 2H6PA 4XNUL 3GK8L 5E03A 3QWNA 4I9WD 2GK0B 1YNLH 4R3SA 3UTPD 5JQ6L 4BHUA 5T1LA 1JK9A 1T5XB 5GGVY 3MRRB 1MWAA 1UA3A 2WZPD 4NCDA 1J10A 3T0EE 1P2CA 4AYEC 1JPGA 4Z23A 4Y19D 2Z9TA 4Q97A 4HWBL 3S5LB 4WTZA 2L4OA 2Y23A 1OEZW 5IIEA 4G1EA 1QFWM 3FQXB 3UPAA 2YWYA 1V3KA 1UM5H 3ARBA 3BUIA 4UDUB 2HUEA 1KGYE 4GAJL 4OJDH 4PTTA 4N0UE 3V79C 2QFRA 5K9KA 4MA1C 2IGLA 4KI5F 4RRPA 2AFNA 5DMGC 3QO1A 3ZDYB 1WEJH 2XZAL 3ESNA 1JWUB 1S2EA 4W9EC 4QRTA 2QVFB 1OCRB 3GM8A 3S8WA 3QEQB 2OAAA 2YAPA 4XXWA 1NFAA 3GEFA 3L13A 4TV3A 4EXPX 3JYCA 1KB5B 1CYWA 4F24A 2RHEA 2V2XA 4WHTA 3DSNB 4HH8A 5DS8B 3HUJE 3LRSA 3ZE2F 2GITA 2H3NA 3RVWC 3L54A 1RUQH 2Q2EB 2YUVA 1UOKA 3FT4B 2TSBA 4KXZH 1AGFA 4C83B 1QHPA 4CU6A 4R4ND 5GGTH 3J7HA 2LLGA 1AZRA 3FU0A 3MBXH 3MLVL 3OG6B 4CGTA 5J6HB 1V27A 4V1DD 3IKCB 3F58H 5L0QB 1NCGA 1UCBH 3L2MA 3RG1C 3GO1H 1KWGA 1LO2L 1T89A 5C6TH 4TSCL 3N1GC 3QDME 5JIIA 1UXWA 5GGRA 4W6WB 3BKYH 2KZ1B 4NQCA 3HNTH 3K2KA 2W9EH 3QWRD 4UT6H 4AKOA 5JW4R 1IGFL 5EO0B 3BH4A 4CVXA 1BM3L 1UA6L 4UQ3B 3VSTA 3DDGA 4IQHA 4LPUA 1CBVL 2P7TB 3E8UL 4J6RH 4JHVA 3VRIB 1L6XA 4NZTL 4JZJC 2OJEA 3QWQB 2Y07L 3L9RB 1YPZF 1U95A 3OPUA 4HXBH 5TQ2L 1D5XB 1ROCA 3BC9A 5EEXA 1MFAL 3PPEA 4AGNA 2FJGB 4CRPA 5J1SC 4PJHF 2FX8H 3MCYA 1T66C 4ODTH 2E6PA 3O41B 1EBAA 3P4OB 4MJ2A 3KG5A 3TXAA 1TQUA 2Y72A 1QP1A 1E9OB 3WTVA 3VI3E 2J57A 3V52H 5KW9L 5I73C 3ARFD 5B38B 1A7NL 4H88H 3KLLA 3R0MA 4URTB 5I19L 2O5NA 3EYVA 4NO3A 3KM2A 1GA2A 1N6QH 1HH6A 5IB2B 3DXAE 3D18A 4PJBF 1JTOA 5DJAB 4LFHD 4M56A 5AW6B 4AUJA 4R26H 4TNWF 4HLZG 3RUGB 3QEQA 3ZKQD 4MAUL 5D7KD 2Q9OA 5CCHE 2P24A 1MQKH 2F5AH 4XMXA 4P2OB 3CHOA 4FQ2L 3EH1A 3O6LH 2MRYA 2EUVA 1NOLA 4H1LG 3OXRB 1YPZA 3VDAA 1I1YB 2HSIA 4PS8A 5K59E 3Q3GA 1BF5A 4FNRA 3PHOA 3D25A 1MJ8L 1N7MH 3PHSA 3VQLA 3S36X 3V0VA 1T80A 2E9GA 1PW3A 1Q9OA 3FCSA 4NKIL 5ALBL 3C09C 1EZSA 5JZ7D 4JW3A 1W72H 5DO8A 3EBHA 4A2MA 3IMBA 5I1AB 3HA0A 2D7PA 2WTRB 4HEPA 1RUAL 3ORJA 3UCRA 2BVTA 3CIAA 3NIFF 5E2JA 2Z6FA 4AM0Q 1MCKA 1H3PL 2AF2A 1WVZA 1OTTC 3HE7B 3SSGA 4XMPL 1QFWH 4YHYB 1RVFL 3LDBB 3MRKA 5DC4B 1HOCB 1T3FB 4ABUA 4JPKH 1WH0A 4O51B 3MJ7A 1MG3C 2K3TA 3PXHA 4RRPM 3NIDB 1A1NA 5JOPD 1HL9A 2DYPD 2NY4B 1R17A 1YEJH 1JZ3A 4ZMZA 4FNPA 4GXFA 4PGBB 1BECA 4L29B 1AIFA 4KV5E 1FGVL 4Y2NA 1YN6A 1SXBA 2DYPA 4HUNB 4AV5A 1IE5A 3NZHL 3HMWL 1L0PA 2KQNA 1GSMA 4PJIE 4OLYL 3GSXA 4LAQL 1M05A 2VLKE 1IAIH 3KYAA 2UVFA 5JHDE 3Q01A 5EBMA 2HJKB 1N6UA 2VXSH 1LK2A 2AGJH 3SY0B 2I27N 5I5JA 1WP6A 9CGTA 3B4NA 3O4LB 4OLXL 2QLVB 4UV7L 3MA7A 1ZS8A 3UC2A 3QUXB 3MBXL 1AG6A 3MLVH 4R9HA 5DD6A 5EUOA 4WI7A 1LDPH 4PRAB 2EIEA 4FQXB 1TSHA 1VCAA 1I7RA 15C8L 1J1XH 1VENA 4JFFE 4HMCA 4HKJB 6PCYA 2VZOA 3T8VA 1JSYA 4EMZA 3B9VA 3C5SA 2HVJB 2JCCA 3LZFH 2D8KA 2UWEA 4LDEB 3EGXB 2XBZA 5JYMA 4FG0A 1PQZB 2AKRB 2OJ1A 3FU7A 4OZFH 3GMLA 5KYNA 3O6KH 5DFTA 3PHAA 4MBOA 4DT2A 4PJCF 3QDMA 4AJVA 12E8L 2ROYA 3BGFC 2ENYA 3C6SB 4JMNA 5KS9F 1CXLA 3RB5A 3FO9A 4PRPB 4XWGH 2BW4A 3RGVD 3OF6D 4NO2A 5BOJA 4EI5C 5FIEA 3G5ZB 1X7QA 4MB1A 1XL6A 2B1HL 3FUMA 3LY6A 2OKMA 1OZTG 3OF6A 5EMYA 2AV7B 2YD1A 2X42A 5DCCA 2K8MA 4ZUWB 5C0CE 1KTBA 2XCMC 3WN5B 1JCKA 1N9PA 4JY4B 4XCEA 3U6XA 5FKAB 3OJ2C 2G3MA 3Q48A 3WFDL 4Y4HC 2CPUA 1NGQH 3P4LA 5J3HC 4QHKI 5T1KD 3MRPA 5D4HA 3KLDA 3QAZB 2ZWYA 4UMGA 1RZIB 3CDGB 4YE4H 4QAWA 1ZPUA 2KHAA 3HE7A 2L7QA 3N40P 5C0NC 3AG2B 5FYKD 3UP1A 1I3VA 3H2WA 3PGFH 4KJWD 4BD4A 5ERWB 1CDBA 3TGXA 1TIUA 4N1HB 4WTWA 4PR5B 4NKIH 1E9PB 2LR4A 5E1AB 5I0XA 2Z35A 5BZXA 3WKQA 3KHOA 3DXAD 3W39A 2WUBH 2B0SL 4L5FH 5CUSL 2F7RA 2ZXGA 2E5EA 1IU1A 2AJUH 4HFUH 2BINA 2VE6B 4EUPG 3WN6A 3FUEA 2PYEB 3PIQB 5F3HA 2DLIA 3E6FB 4HCGA 5HJGA 3ET9F 4GKSB 4OLWH 4HK3J 2ATPA 1JNHA 4M00A 5CMAB 3ZYIA 1OE3A 3D09A 3SD5A 2AEWA 4QEGA 1TZHA 1Y1UA 3SE4C 1R46A 1A0QH 1DVUA 3VXQA 4FABH 3FQWA 4KZDH 4RWYH 2YEVB 2R0ZL 3GXPA 3SCMB 3ROOA 4HJ1A 2WOBA 4LLQB 4X8XA 2BO0A 4HQQL 4MJ6A 1IFHL 1RLWA 1OGAD 1I8LA 1SJVA 1KCSH 2VN6A 1DJZA 1RHHA 3PV6A 4J4PD 4XVUC 1J8RA 5L9DH 5MEND 4M8UA 4GBXC 3G5ZA 1LGVA 3S36H 2C8NA 1FVCA 3CFKA 3EJYD 3SGKA 3U9PH 3VA2C 4IKNA 4J3OD 1XL4A 4A7QA 1HDMB 4XTRC 2PCFA 5DZJA 4DTGH 1TZAA 2ZWNA 2PCXA 1AFVH 3O6FB 4KVNL 4XWOC 4X4ME 5DRZA 2NXZC 2YQBA 4QF1B 1IL1B 1Q38A 1CFQA 4Z7VE 2HH0L 3HNVL 3VXOA 2VDMH 3QEHB 4LPXA 1MRFL 3LVTA 1XF4B 2VQ1A 1WFTA 3QUGA 5E4EB 3F7PC 5HHXL 4G3YL 3B7RL 2B15A 1PZCA 2F7IA 4KNSA 3RJQB 2HLAA 2FD6H 3BKMH 4ZFZB 1QFWL 4KKBD 5IB4B 4P2QB 1T22A 4FD0A 1WBYB 2GJ6E 1LEIB 2X88A 4NN5B 4GO6B 4MGXA 2NZIA 3EJTA 3AS1A 1S9YA 4RMSA 2JJSA 3ZW3A 4K3GA 5I16A 3RKDD 4QRBA 1BLIA 1SXNA 4PW4A 3WFCH 2EC8A 4OQTL 4GFTB 4LHUD 4QTFA 4HK3N 4G6AD 5FGCB 5BVPL 4GG8A 4EOWL 1CIUA 7FABL 2CR6A 4UM8B 1L7IL 2DMBA 2MQGA 3HG2A 3IMUA 1XFPA 1A6UH 1EFXA 5B3JE 4TTDC 3PL6C 2VT0A 5C07B 4NC0B 1G1KA 4QOKE 4CU7A 1WT5A 2QSVA 3BUQA 3SQOL 4DCQB 3A4FA 1DN0A 5DO2D 4R96A 5FYJE 2RALA 3QZMA 1ZV9A 1DDHA 4AM0A 3ZIYA 3FQTA 3ZYZA 3HHSB 4DFHA 2BDNH 5E99H 3QDJB 5F6IB 2D0FA 1Q4NX 4NS0A 1JRHI 1C5CH 5EC1B 1ILSA 3ARFB 3EF4A 4JM4L 2ICCA 4YGVA 4AYGA 3FN0H 2B5IB 4Z8FL 5HYEA 1A65A 1DVTA 5K9KB 1GC1H 3L45A 4KKCD 4AGLA 3IDGA 1QFOA 1JHTB 4QTIL 3F5WA 2CBMA 3LZFL 1RQ5A 1M3IA 3L48A 4KKLD 2ORBH 4N0UA 2NY1C 1E9PA 5E1AA 1NA8A 2IV8A 4AG4L 1T1WB 3GSNA 1FYTD 1T21B 2LLLA 2WGNB 3EGSB 1FNAA 5I18L 1AQMA 32C2B 4F7CB 2UXFA 3FO1B 4MYWB 4AVJA 5JPNC 1DUYA 5EFIA 4KVPA 2V2TA 3NTCH 1NMAL 3NCXA 4Z77A 2CSPA 3R18A 4KXCA 3P40A 5D2NA 1A14H 3DX0A 4GKNB 2H2PD 1A21A 4QRPE 3OC5A 2VN3A 4DF9A 3QUYB 1IAOB 4HFUL 5ANHA 2CCWA 2YXWA 2PP8A 4A63A 1NBZB 4FC3E 1H3VA 2QR0B 3CVIH 2VL5B 1W6LA 4M1CC 1FLRL 2D7QA 3KLAA 4G42A 4FLHA 4JQIL 4MJ5A 3TBTA 3TEWA 1A6VL 4PR5A 2D0GA 3IXTA 4L9DA 5BW7C 5E0FA 5LXVA 25C8L 4U31A 2EDYA 3UAAA 3VVWA 2G60H 5GJTL 1X5GA 1LL1A 1KPUA 4ZYKB 2Y7LA 1AXTL 2HRPH 1JF5A 1DBMH 2DI8A 1MLCA 4AV4A 2TSAA 2KS0A 3OAWA 3L1EA 2F18A 4LKXA 1LK3L 4WNQB 4OAWB 3CZFB 4MD0B 5I8EB 1AKJB 4ZAKC 4M6NL 2WVVA 5F7YC 3S36L 4UQEA 2AQPA 2VXQA 1ORQB 3K6OA 4KXDA 5DVPA 4B41A 2VABA 5JW4M 1I9IL 4K9EC 3PDDA 1G7JA 3BWAA 4QWWD 4BDVA 3Q1EA 3FU9A 2FH8A 2XG5A 4NN6C 1GGCH 5IBTL 2HZHA 3G6JE 3KNBB 4IBQA 4NQDE 3F7VA 3VW3H 4AYDC 4X5WA 3BSZH 3X3GL 1XZWA 2PTTA 2Y6SC 5AVYB 4XCYB 2FLMA 4LEXL 3QHTC 1A5FH 4P23D 1JXJA 1D6EB 4OLWL 5E5UB 4U3SB 1SUJA 1BAFH 4Y1TA 4CU8A 3U1SL 4P23A 1FVCB 2I5YH 3NIDE 4KDTC 4HOWA 3UZQB 2LU4A 1HL8A 3GBEA 1B4JL 4EI5A 4L2YA 5H4YA 5C9JB 1UWEH 1QHOA 2IAMC 3KL3A 3MLUH 2WKOF 4NQCD 4BELD 2F7QA 3L95B 5I6MA 1NIDA 5G4MA 2XTJB 4FL4B 2ZUSA 3D0LB 3FB8A 4U1IA 4N0YL 4Z6AT 4F9PC 2CHZA 5FGCE 3S8FB 5JHDB 5EBWB 1YQVL 1DZ0A 2R0WL 3E80A 5GGRB 1TQBC 3RILA 2GJPA 1UWGH 4J39A 1XH3B 2GTWA 5F8QC 1F6LL 1MSPA 3U82B 3AXHA 4MASA 1UGNA 3H4HA 2FR4B 1MRFH 3BFWA 1QSFD 4U1SA 3VWJA 5JHLL 2ZXBA 4JL1A 4L8CA 5HGAB 1X5MA 3W5MA 2WQWA 5JZ7C 3DC0A 1OB0A 1OOWA 1UKSA 1NGPL 2R69A 1GC1L 3P4OA 1JF1A 4K7FB 4AYFB 1F90H 4R97C 3SDDD 4LSPH 2YK1H 1DFBL 4HULB 1T6BX 5C3IA 1KSRA 4FG6C 3R7RA 5I8CB 1ITCA 2PCPA 2RACA 3TA3B 3WFCL 3PUCA 4U6VL 2X2IA 3GLAA 2HG5A 4WGVB 3Q3GB 4OUUB 4HF5H 1DJGA 1CVRA 3FT2A 2A4EA 2ZYSA 3H1ZA 1TJXA 2G5BA 1JE6A 4JY6B 4NQED 5ECJE 5EO9B 2Q8AL 4XVSH 3RFZB 3T0AA 2SEBB 2JIXB 5TDOB 5D1QB 2AANA 3QH3B 4Z5RA 2NY5H 3HAEH 1JPST 4B5EA 2WGXA 5C09D 3F6JA 1BAWA 4O5LL 5DVOA 3CH1A 4NO2B 2VC2B 3VFPA 1YLBB 4KJQD 1A6VH 2KERA 2CLRA 2J2ZA 4QHNA 4WCYL 5FKPB 4Y8DC 3CN1A 4R4FL 2HB0A 4H2CA 1KJ3L 1ZK5A 1MHEA 1OGAE 4RX4A 2OMZA 3WSQL 2Q3ZA 3STBA 5BRZB 4OIBA 3MMEB 3WS3B 2PWEA 2WLLB 1V10A 2PTTB 3UO8B 4RX4D 3JV5A 1RH8A 5KSAB 1A3ZA 4UB0L 5D6DA 4KX7A 2X70B 5EDXA 3SDAD 1MCIA 2APVA 1F45A 4AGPA 1ZLUH 3P4NA 3LOWA 2J71A 3DSFH 4FFZL 3ZR6A 2H0PA 3SY0A 1MCPL 1TJHL 2FEEL 4X5WB 4YVUA 3SDAA 4LARH 5L4JA 4NERA 2RMNA 4W6XB 5FO2A 1BXAA 3K2IA 1GPOL 1XSIA 4K3HA 5IVNA 5EUOB 5C2BH 1U6AL 3BWZA 5T3ZL 1E3XA 3I02B 3VQ2C 5I6XC 2IC2A 2WM0A 4XPTL 1CICC 3NSJA 2ETWA 3SBWC 2DQUL 4QXTA 1T5WB 2QQLL 4BIKA 3UPCA 1BQHG 3TBSB 5K1NA 2Q8BL 4JZNB 4KZEH 4CBPA 1NBQA 2BC4A 3U4BH 4QT5B 4G7QB 5DJZA 4UQ2A 3ZGHA 3IDUA 5EOQH 5D7LD 5E2VH 1ROWA 3GZOA 1I8KA 3F12A 3HZKB 2P48B 3LB6D 3FSOA 4ES8A 4ZW6A 3QZBA 1GZHA 2E27L 2EXYD 3D2UD 5FO8B 3EUUA 5EEVA 2ZKYA 4DP9X 3UDWA 4HLZH 4AQ8C 3TA3A 3MFGB 4WWKC 2OR9L 2NCMA 2WAHA 4JO5A 4M1DL 2WINB 2PETA 4OLZH 3N43B 2MJWA 2AZUA 3FO0L 5A2IH 2UZIL 1BZQK 1AXSA 3I9GL