4F20A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
331
structure length
331
Chain Sequence
AKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGSADGDSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion/cytokine
total genus 83
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f20A02
3AT0A 5CFAA 3AU0A 2RALA 3IRPX 4F1ZA 2YLHA 4BBWA 3IS0X 1R17A 4JE0A 3IS1X 4JDZA 4FJ6A 2F68X 2Y7LA 1N67A 4JDZB 4MBRA 4LEEA 2Y7NA 3V10A 1R19A 2Y7MA 4F20A 4F27A 2F6AA 3ASWA 2Y7OA 2Z1PA 4B5ZA 4RMBA 4LEBA 4LE8A 4F24A 4B60A 2VR3A 4MBOA 3IRZA 5CF3A 5IHWA 4Q6KA
chains in the Genus database with same CATH superfamily
3GRGA 1RSFA 1K2DA 5F6IB 3FQ2A 5JQHC 4X99B 3INOA 1FYTD 1PFCA 1TKWA 2PW1B 4YNYB 1LJMA 1N4XL 4EIZC 1HNGA 1YN7B 4JFFD 3RIKA 2Y06L 1PAMA 2ZXBA 3ARGA 5KW9H 4AVIA 3V0EA 5I6PA 4LLYA 1OAZL 2Z1PA 2CLZB 4X5WB 5DYOB 4F24A 3MYJB 3JBG7 1HIMH 1EERB 1KEML 4LP8A 2EH7H 4KKBD 4QD2E 4EI5C 3D07A 5IHUH 4OLUH 5IUCA 3QUZD 5FYJL 1BM7A 1CFTB 1T1XA 2XFXB 4Z7WB 3VA2C 2OS7A 3OPZH 3QPQD 2CUIA 3TYGH 4LLAA 1OCCB 3GXTA 1CGSL 5I82A 4UOW1 1AIFB 4U2YA 4UTBL 5BO0D 2OJ1A 3ECBB 1M7DA 5GRVL 3C5SB 5CEXA 5CM1A 2KLSA 4NM4L 2DQJH 4LEOB 3QDMA 5B38G 4MA7H 3GJEB 2G3NA 1UT9A 4H26A 4XVTL 4Z7IA 1IE4A 2NCMA 5BZWA 4FTVD 1AXTH 3KEDA 3PWNB 4R5VA 3VFUB 1DL7H 3OAUH 4Y5VA 1KCSH 2GHWB 5IVZB 3MRPA 3TZVB 2BFVH 3D69A 1DEDA 4JANA 5IROA 1M7IA 4FQJL 4O00A 3RFRA 1ZIAA 5KS9A 1R19A 1MFAH 3LHPL 1QKZL 4XOAA 3SPHA 5HI5D 4K55A 2W0FA 1ZD6A 4R4BB 1J5DA 3WL9B 4G3YL 2VDPB 4TQIA 2BNRD 1F3JB 2IADB 5CCHE 1WBXB 1L9RA 4UT9A 4JGJA 3B7TA 4X7TB 5M7QA 4OFIA 1T0NB 2AEQL 4LLQB 5IHHA 1VGKA 2ADGB 3LRKA 1U58B 1MW1A 3T8MA 3T0EE 1NGWA 5H4YA 4A2EA 3DO7A 3QFDB 5JIKA 3AXHA 1HCVA 1EX0A 4H44C 2FX8H 3QDME 1NCWH 4U1KA 5I1IL 1OARL 5F9WB 2WAQA 4WW2F 1E8ZA 3FKUS 4DZBA 1T89C 3DBXA 4TYUA 3VXSA 1KY7A 1XZWA 2XFGB 3BAIA 3VNYA 4AT6A 1ZLDA 1B4LA 2BMKB 3UYOD 3IMTA 1KMGA 3RWFB 4Z9KB 2HN7A 4YEEA 4XXCA 3KDMA 3GMMB 4G59C 5C0DA 4Y5YA 2Y72A 1NICA 2IV8A 1TQWA 4PJ7A 3P11L 5KS9E 3AITA 1BLNB 4MDIB 4POZD 2C4FT 1ZGLP 3DDFA 2I5YH 5AAMC 4APXB 4H8HA 4D0DB 3CVHA 4M4RB 2JKSA 3SGKA 2PO6A 2BY3A 1E5UI 2VRAA 4PYHA 3EYUL 3PAZA 2VDPH 4U31A 4C57C 4OV5B 1AO7B 1TYRA 4DNLA 2ZE0A 4UCFA 2J1ZA 2CIIB 4KROD 3IS0X 4H0IA 4U7MA 1FYTB 3V4PA 1LWJA 3HLAB 3O8XC 3VGBA 1CXHA 2WXIA 1RZJC 1UWGL 4HIXH 3GBEA 4JFFB 3VXSE 4EN3A 3SGDH 3PWJB 4FFZH 4HHAA 4HJTA 5JW4Q 4OLVH 3QFJA 3AVEA 3CHOA 1QATA 3X13A 5CJXA 1RAMA 3V5HB 2B3IA 4G9DB 2IPUK 3QI9A 2X6CA 3H3PH 3V0GA 2OMWB 3DRTB 2ICWB 3QIWC 1FO0A 4Z7QF 3CMGA 1KB3A 2WHVA 5I9QC 4PJ7E 3MA9H 4Q2ZA 3GHPA 1SQMA 1NBZA 2CLRA 4L0ZA 1LE9B 5IB3A 3QUZB 4AG4L 3FUFA 3I02A 1CUOA 3ISRA 1LXMA 3ZT6A 3C87A 4CNIA 2OAAA 3IU4L 5AFAA 1YEIL 2AJUH 4BSVB 2NNAA 5E8NB 5DJDA 1ZT7B 1VRSA 2AXGA 2VQ1A 4EE2A 2VJXA 3GGWB 4X0KA 1GAFH 3TO2A 1XAKA 2ATPB 2QV2A 5JOEA 2OK0H 2G0LA 4NHUA 1XF4A 1T1ZB 2XZAL 4OV6F 5LGHL 3DOIA 4I77L 4N2DA 4FYTA 4HETA 2X87A 4FTVB 2D31A 4P3WA 4WV1A 4BWUA 1IEBB 3KXFD 5I8CB 4OZGF 2AXFA 1JZ2A 2B1AL 4B53A 2X40A 1N5YL 5LNGA 5DLML 3QFJE 3CH8A 4G2AA 2Q76A 1LEKB 5AVYB 3ATEA 4LDEB 1AQ8A 2F58L 4X6CB 5GGRB 3TFKC 1SYVA 4NSKB 4X4ZA 5F7NC 1RIVL 3MYZA 3T0AA 1QZNA 1F5WA 3PHOA 5KTEL 4HIPA 4JRYD 4KPHL 1OSPL 3AY4A 4N0YH 2FGWL 2HKFH 1BOYA 3H3BC 5CR1A 3D30A 3CLWA 2IG2H 3PIQA 3WMPA 2AABH 3WAJA 1FNAA 1YPZB 3MRGB 3UX9B 1Z0NA 2NR6C 4LHUA 3IGFA 3BGFB 3DHPA 1EJOL 4HISA 5DC2A 1U8MA 4UQCA 2E47A 3G6AA 4JG5A 2Z6FA 6PCYA 1K5NA 4HZAA 5ICYA 1FORH 4Z7NF 5AZEL 3BC9A 3QJSB 2JXMB 3BVNB 1S3KL 1NLDL 5DJAA 2B8OT 2RA1A 3TNMA 3ULSA 5BJTA 3B2PA 4MCYB 3O4OC 4KK6C 2F8XC 5HVHB 1F8TH 1G5GA 2LT9A 3QUMA 4R0LB 1M3IA 4UNIA 4YIQA 5EBMB 3UTTD 4NQVA 4R97B 1GYWA 1UWYA 1WAAA 35C8H 3NQIA 3CHPA 1VB9A 3J27A 1HH9A 5AB2A 5T3ZD 3NFPA 4HSAC 1E6JL 4I9WD 2XJLA 4QHPA 4YBQC 3QORB 4P4RB 4WUUA 5FYJU 1UM5L 2JB6A 2NY3C 3VJ6B 4FULA 1DANT 2VJ8A 4Y1AD 3BX7C 2F0CA 5DJ0B 3OJMB 5AQ0A 3DRQB 3WIHL 4EEEA 5IV2B 1MJ8H 1BX2A 1KLGA 1JNJA 1WGOA 3RDTD 2XV0A 4KROB 4NKMB 1WPCA 2W1NA 4EIUA 5FYKU 4MSWA 4G8GD 1NAKH 2LU3A 5HHXL 5SX4H 3U7YL 3IFPB 2M1KA 3VFVB 4ABVA 2UY7B 4U2ZA 2B0SL 5F6IC 1EEQA 3FU8A 3T65B 4XCFL 1EEYA 5IJDC 2WKOF 4S1RH 5D96B 3SO3B 3QQ9D 1KIQA 1S7RA 2CO1A 3LKQA 4G43B 3P73A 5BCAA 2E7LC 1I8UA 3ILPB 4R7DB 1IEAB 2BP5M 2Y07L 2VLRD 3CUPA 4UYQA 4AMKL 1WAAE 4K23H 1RFDH 1GC1H 5SV3A 3TEZA 3U2JA 4YSOA 3IEAA 4YHKL 4WUUE 4ZD3H 4NJ9H 3TBWA 3GSOA 3UPAA 3KWTA 3P2BA 4HWBA 4JDVA 1G9NL 4QHKI 4OCYL 2Y6TE 2ZX6A 4PJBB 1INDL 2ZAIA 3KPRD 1BVNP 1O6SA 1PCSA 3FQWB 4AUJA 4E9TA 4NWUH 2V37A 3BWUC 2D3VA 1Z5HA 4N2CA 4HVBA 1OGTA 2CCLA 4UQEA 2AI0H 3U0TA 3RPKA 5GSRB 2ITCB 4HUUB 4LLUA 3BKJH 1MFEH 4X4ME 1XTLA 3PNWB 4CILA 2UX6A 4HUNB 2EIZA 1OTSC 2NNCA 1YECL 4PGBB 3KXFB 5AYUL 2ODIA 1HYSC 3L4CA 3I75A 3MMEB 2D9CA 4K3GA 3RL1A 2R69L 2DWTA 1P4IH 2J8OA 4PY7B 1JYNA 4FQLH 2YBRA 2W8CA 3VXUD 1UG9A 1FUNA 1VZGA 1I8LC 2FK9A 2J6EH 4W9KC 4ZO9A 1JJUA 3TZVC 1PD1A 4JRYB 1SHSA 2WO2B 1KTDB 3B1UA 4M3KB 2N0MA 1KIRA 1UD4A 1MNNA 1BAWA 1CLZH 1NMBH 1MVFA 1P6AB 1GYCA 5B38B 1S7XA 3KGTA 1UTDA 3P0GB 4PGCB 4PV9B 3SE9L 4F3FB 4MLSA 1GGYA 2A0LC 4NAJA 3AM8C 4N90E 4M1CD 3V10A 1X7SA 1E4HA 1AGBA 3FB8A 3EO0B 1BCIA 3T0XA 3OKDA 4H8VA 3ARBD 5E2JA 3Q3GB 2VJ0A 5BUGA 3G5XA 2COQA 3ISYA 2XWDA 1ACYL 4OCXH 4FERA 1OV8A 1Q0YL 2B5IC 3HFMH 3RWIA 1IB5A 3WNMA 2MKWA 3F5WB 3BUYB 4K0OA 5F9WC 3S96B 3ILQD 3UTTB 4IBTA 4PBDA 3DX6A 4HJ0C 1T5XA 1RUPH 3CFEB 1E4XL 2Y2TA 1YAIA 3F12B 4ZS7L 1J12A 4HYTB 4JQXC 2GJRA 5D1QA 4KVNL 5DR5L 4NP4L 4K94H 1BHGA 4PJIB 3KHQA 2AQRA 4OGXH 3MROB 3UJIH 3JWNG 3O0RL 1WQVT 1FFTB 3NOIA 3MXVH 2LLNA 5LXVA 1OK8A 2DY2A 5F9AC 3D34A 4IKKA 4UOQA 1NBYB 3QZOA 1P4LA 4OLWL 3UBFA 4UTBA 1YNTB 1JCVA 1K4DA 5IBLC 1WUNT 3RDTB 1Q9KA 2M83A 5DURD 4AVJA 2FRGP 3HKFA 3RWHB 1M3JA 4L4VA 5TE6H 1I1FB 4IBLT 4YHNB 5LLIC 4E9SA 3MKKA 4DN4H 3HE6D 5IHLB 5DJ2A 3FQ4A 1NAML 1M53A 1NCAH 4DO4A 2EUVA 5FO9A 1S9XA 2R7EA 1OF0A 2VDKL 1KGCE 4DCQA 3RQ3A 4G82A 2EXYC 5EZOH 4Q89A 3BZ4A 1HHJB 1QRNA 2J5LB 5D1QE 3Q2CA 4V1DD 3N41B 4MKTA 3TO4D 3F01A 2HKAA 2QVTA 4LKXA 2I9TA 4Z76B 5DRXA 4MKMA 5T3ZH 4H2AA 2MIZA 4O51A 4OKDA 4F91B 1MCCA 3KPRB 2V9UA 1ONQA 3SBWC 2VH5H 2VYRE 1JPGB 3KPNB 5E8EA 2H5UA 1EO8L 3O3BA 3NACL 3LKOB 3QPQC 1LO0L 3VWJD 4YQXL 4WK0B 1SVCP 4NO0D 2EIJB 1NQBA 4FYQA 3UTQB 3WELA 4ENED 4WO4D 3G6JA 2ZCHH 5ELIA 5FYKE 2HG5B 3I6KA 5EEYA 2B9BA 5IQMA 1T4KB 1R3LB 1YQVH 4NZRL 4F7CB 1A14H 3TWYA 3IDJB 3QVAA 1FPTH 3VXUB 5E8DL 4ANKA 1JBJA 2JI2A 4NNPH 3MOAH 1QRNE 3SQOL 3ZDYF 4UQ2B 2XWJA 5GGVH 2APTA 5T1MB 1DUZA 1R5WA 2QPFA 4XX1G 2AEIT 2J12B 2VDNL 4WWOA 2LFGA 2VABA 3QDJA 1QLEL 1RSYA 1GW0A 1KLFB 4HJ1A 1S4IA 4OD1H 4NQTA 2ZG3A 4S2SA 4IK7A 3ARED 1AGFB 4LASH 4RFEB 4GYBA 5DZAA 5F7BA 2X6VA 1MCQA 3M1CA 5L4IA 4OD2A 3MI6A 3MUY1 4N8CH 2CHWA 4XAKE 4Q6IB 3ARBB 3NSYA 4FFYH 1CDIA 3BGFC 3GUTA 3V9EA 1GY1A 1X4ZA 3CN2A 3D18B 2DQEH 3G6JE 1GRWA 2K1MA 4DEPB 4K7PY 3H0TB 1FRGL 1JDDA 4FMFA 1U8CA 4NKDB 1NC4D 3CAFA 4LKCA 4JMNA 3V7AG 4DOHE 3CBJB 2HFGL 1JGEB 1WUZA 5ADPL 4GUQA 2LU7A 5JO5A 5C0EB 5HVHC 3FC8A 3NJMA 4L8SA 4R0LC 1KELH 1DJGA 1KACB 3Q43A 1EHAA 1VFBA 2F54A 3UPRB 1WTGT 1SOQA 3Q8BA 5BV7B 2I07B 2BNUB 1NGYA 1F4WL 1MF2H 4POZC 4G9FA 4DW2H 1BVNT 1FV1A 2V2XA 3QORC 2DI9A 1PZ5B 1LE5A 5LDSA 2ZSWB 1CS6A 2YAQA 1A6UH 4N0UA 1IEHA 5FKPB 5HDWA 3MNWB 2X4PA 5C70A 1NUGA 2J8UA 2YN5A 1U8KA 1MCPL 2DQFB 2FD6L 5DURB 1PG7W 1XB3A 4M6NH 1UD8A 2ZF8A 4FYRA 1IKFH 3PQYD 4FNLL 5FAAA 1YUKB 1ACCA 1AKJA 1GPOL 1ZT4B 4KROC 3UG5A 2WXKA 5L9DH 5TH2B 1H5BA 3SBPA 4MJ5B 1R47A 2F7OA 2VMJA 3L6FB 5F1NA 4F7PB 4YUEL 5D96C 4WCYL 3SO3C 4XNQB 1C8QA 3HZYA 5KSBF 4V1DB 1GCYA 1A66A 1FG2B 2E9JA 3O2DH 4PI2A 3TO4B 2F54E 3KYNB 3MR9B 3BRGC 1BYNA 5EZLB 2VDRB 3TPUB 3QJHB 5FUOL 3O3EA 4BK5C 3WBDA 1WCBA 5AVZB 1U8PB 5G2NA 2AXHA 4K15A 4Y9FA 1MXDA 3QA3A 2XSKA 4P9HC 1WZ1L 4U3CA 1FGVL 3IXTB 4HA1A 5BV7H 1TZGH 5SWQB 3VWJB 2J8UE 3HJ0A 2LFEA 8FABB 1QR1A 4NO0B 4RIRB 1LO3L 2YKLH 1TQBB 4WO4B 2WQSA 4WLCA 1JI2A 3RPIB 2E7HA 5K9JL 4XPFL 2DPKA 4M8RA 4ZNCD 1IE5A 4IJTA 1OAUH 1AR1D 4ETQB 1BFTA 3A6CL 3MRCB 3HC2A 1FGNH 1BSIA 1GZPB 1Q72H 3MV7A 2CALA 4QKTA 5JHDE 5C0RH 4BZ1H 1U3HD 5AWNH 3WD5H 5HDQL 2ZX5A 1FIGL 3D25B 4KXAA 4PR5A 5ITFB 3T6WA 1S5HA 2MCMA 1D5MB 4XZUA 1FZOB 4KKNA 5F3BA 3IDMA 1AGDB 3NA9H 2PR4L 4QI3A 4DP6X 4A04A 3VFSB 1UXSB 4GW5A 4E9YA 1ECYA 4FG0A 3GJFK 3PWLA 3FH7A 4XCYB 3IJEA 1PDKA 4RBPH 2F5AL 4OUUB 1QLRB 3AREB 1FFQA 5F9OL 4AY0A 4BFIB 5CCKH 4GSUA 5KVGE 1T7VA 2VDRH 3V0WL 5EOCH 3OG4B 1MPAH 4CC0A 3VQ2C 3QCTH 1DQLL 1G9MH 5I8EB 4XPTH 1X5GA 2LU4A 3JV4A 3LRMA 3B4NA 4ZMPA 2VR7A 2OJEA 3QJXA 5D5MB 1VPOH 5J1SC 3RKPA 1GMIA 2R2BA 4ICXA 2P8PA 4A63A 2QR0A 4AYFA 1NC4B 1F4YL 2X1PA 1JZ8A 2ENYA 3ZDWA 2K6ZA 4Z77A 3T77B 1NDGB 2V6HA 3MV7E 4ZMVA 1KF9B 1G9HA 2YPLA 3AW5A 3F8UB 3FU3A 5JZ7D 4BRJA 5T5FL 1O0VA 1X4YA 1V8HA 2GSMB 2O30A 1XGUB 1J1XH 2YWYA 3ROOA 4B3EA 3IAGC 1NOLA 1DBMH 1G7QA 4JPKL 4TSAH 3QEUA 1RZFL 2XN9A 1X5ZA 4PB0H 2R0LH 2X0WA 2YAFA 1IBZA 3LQZB 3MRHA 4KKQA 3SKJL 1WA1X 2VISB 2WZ6A 1NMAH 2R4RH 1HHKA 1NBVL 5E2WL 4MB4A 1ORQA 1KBGL 3AB0B 3RVTC 4DVBB 4WF7A 1IM3D 2R1XB 1A9EA 3Q8FA 2X4NB 1FNSH 3D2UA 1E28A 3V0VB 4XMPH 3GI9L 3MO1B 3KLHC 3PQYB 1AS8A 2HPOA 1UB5B 3IDYB 1D2PA 4GG8B 2VR3A 4JY6B 4C58B 5JW4N 3RU8H 3K72A 4KFZC 4EN2A 2QHLA 3DV4A 3OKEA 4ZUTA 5EZIL 4TLTA 4XO8A 1VDGA 2YPLE 4IKJA 4NZ8A 4LPTA 3APCA 3QO1A 5GQBA 4YR6A 4JVUA 2OMUB 5EORL 5AW3B 3MBEC 1QFUL 3MTRA 3L4ZA 4P23D 1CGXA 5DO8A 3CLFH 1UOKA 3L5HA 1QA9B 2J5LC 2NCEA 5MEOB 5K1NA 2ZG1A 4N26A 3ML8A 1J1PL 3K8LA 1MCKA 2XN9E 12E8L 3QS2A 4O2EA 4DP9X 5BOJA 2X3BA 2JIXD 5HDOA 1MCOL 4GRWB 2BP8A 2YO3A 3EGDB 1QPXA 1HE8A 4NKOB 3ETBF 4Y9CA 5D7SH 4E2OA 2OX5A 4LSUL 4PBWD 5EV7A 3QH3B 1GS6X 2BP3A 3ZDZF 5J8OA 5BRPA 3CBKB 3RJQB 3EYQC 2DEYX 1UM6L 3I6GA 3EZ8A 4IOSA 2MPAH 4FLRA 4FJ6A 1YEWA 2OQJB 5GHWH 2YAPA 3X11A 3OQRA 5AW2B 4E9RA 1N2RB 1XIWD 1N59B 2D4FA 1AR1B 4KV5E 3WYRA 3C8KA 4W9LC 4B5EA 3T8XB 4ONGH 4LCYB 3L9RB 4HPOL 4Y4FD 3Q9PA 4M7ZB 3WSQL 4IOIA 4TVPE 1PPIA 1U3HB 3HFFA 4NHCL 5C0AB 3GRWH 2M26A 1HOCB 1L3WA 4OLYH 1YN6A 5C9JB 3ULVL 2NDGA 4HK3N 1OM3H 4PG2A 1HQRB 1T0MA 3QB7C 2HXAA 2FDBP 1CE6B 2FEEI 5EA0L 2BCKA 5F7HA 3CHQA 4ONFH 4LMQE 2JTYA 5DUBA 4QMEA 5L7XL 4M48L 2WLLB 2P5PA 2HFEB 4LNRA 3ZVVA 3FTSA 5KAQG 4G42A 1FNEB 1KJ2A 1M6OA 5TQ2L 3MA7B 4S1QL 3BQUC 1IAOB 3QWOB 1LQBC 3HNTH 4TQEL 3BSZH 3UAAA 3WJMA 4M29A 1W16A 1WP6A 3LRHA 4FADA 5FW7A 5FB8B 2RR3A 3BH8A 4GRWH 3FFCA 1WF5A 4IW4C 3PS6A 5BMFL 2EDLA 4HF5L 3PJSB 3CVDA 1DVQA 3CFJA 1CE1L 3ARBC 4Q6IC 4U0QB 2UYLA 5DMKA 4AYGA 1NL0L 3NPSC 3L4UA 5IB2B 5DT1L 5AVSB 2WWMD 4OZFA 4QRUB 2QPDB 1BJ1J 3MRLA 4DEPC 3G5YB 1HI6B 5KSUB 3ULUE 3WY1A 2WB1A 1AGCA 1AHWA 1UASA 3RY4A 2NZ1A 3MJ8A 1CVRA 1I4FB 1VERA 3FTYA 3TH3T 2A4CA 1C12B 4TLSA 1K6QL 1TT6A 2CNYA 5BV7C 5ITBH 4FD0A 4JBSA 4U1LB 1IM3B 1JHKL 3RWGA 3OR6B 1R75A 5KYWA 2OTUB 3BLPX 3CG8A 3AY2A 3QUYC 5D7IB 1HEJC 2YHGA 3ZHFA 1I9JL 4OI7A 4DN3H 3HMXL 3ZDXE 2EYTA 3AWGA 3FFCE 5DSCB 2JLLA 5LNDA 2IGTA 5D7EA 3L2NA 4LSQH 4HCFA 4B60A 5DDHB 1OHZA 1URLA 4R90L 4WJG3 2HRPH 1MVUB 2AFNA 3HC4L 5MI0C 2IQ9L 5EU6D 1MLBB 4H25A 2YD0A 4UU9A 1SY6H 3VQ1C 5FGBC 4EDWL 2QHRH 1ULVA 1DQQA 4P23B 5GGTH 1UWXH 3M46A 1W0VA 1UH3A 5FFLA 5G4OA 5MERB 2NMSA 4OF8A 3BPLB 3BH9A 4OI9A 5IMOA 4IRZL 4MD5A 3LX9A 2K6YA 1QFWH 1E5YA 2JIXB 4UTAL 1KPRB 2W9DL 1A3RH 4JFWA 2DQ6A 5BVJA 4KTGA 3FCSB 3FQNA 3G04A 4OH2A 1QRKA 3ABGA 5C7XH 5KSVA 3C6LC 1CF8L 1OVZA 3M17B 4DPRA 3MLYL 5H37A 1CICD 5MEQA 2XETA 2P4AB 4JFHD 4W4OA 4Q9RL 4JY4B 1UZ6E 1G7MB 4UV4H 3JQOB 5GISL 3NSJA 4N2EA 5FK9B 1XIWB 2CHDA 5AB9A 4JM4L 1TQBC 4NZUL 3HA0A 4AQ1C 4Y4FB 4NS0A 5ICUA 1ED3A 3KEHA 3D9AH 2BVYA 4PRDA 4D8PA 1SLWA 5F7LB 1CF1A 2HFFB 4M62H 4UDTB 4B95C 5ACZA 2VLJB 1WA2X 4JFYB 5DMIL 5FGCB 4LHQB 3LCYA 1A3ZA 3P0VL 1G43A 3GZOA 3KJ6L 4FQXD 1MRCH 2PKDA 4LL4A 3D5OF 1OAXH 2QZ5A 4LARL 1HYRC 3R06A 4WFGD 2L04A 3T04D 1HNYA 4XXWA 1U3YA 3PNRB 4J23A 2ZXCA 1CLVA 3WFDH 1YMHB 4X7EC 1A5FL 1HEZB 3T3MB 1BLIA 1UKSA 5EFIB 4C4UA 3EGSB 1INQA 5ICXA 3NMEA 2HRGA 4FP8L 2GABA 3AS3A 2X05A 4PPTA 3WTYA 4QRTA 1JFQH 2EECA 4UANA 4G8FA 4GSXA 1ADQL 2R1WB 3IDUA 1J9QA 4HC1H 3VSQA 4DP7X 4IIQC 4QXUL 3V5DA 5CO1A 5B1CA 2WN2A 2Z92A 4NQXA 2EXSA 5KUMA 1KCVL 2IQAB 4FKHA 3O3UN 5DJ8A 5GS1A 3OF6A 4OZIF 2ADJA 1BFOA 4RISL 3IGAB 3L3DA 1U3ZA 5IMLB 1FFNA 4RQQA 1QQDA 3L9EA 2JCCF 1JG9A 2BSDA 1BBDH 2Y5TA 1N3NA 4GKZA 1XF5B 4XN9A 3RNKB 2UY6B 3NCYP 1EAOA 3KPSE 2Y5QA 3L81A 2BOCA 3FU9A 2NY6B 1FFRA 1P7HL 4G6MH 3B9VA 3VFOA 3IVKB 3HZMB 3QDGA 3ARDD 3VD9A 3S35L 2K8QA 4H1LA 4LVOB 2A83B 3WEAA 4APQD 2F5BL 2P5EA 3HI5H 3KPMA 3DVFA 4L3FA 3AB0C 1MFBH 4KDVA 2H2PC 3S4SG 1I85C 1WHOA 1SLVA 2WBJA 3VQMA 4F33B 4FXKA 4LAQL 3MZGB 2FL5B 3EGXA 3PHQA 4LOEA 3X3GL 3CDFA 1FAIL 1CYGA 2Z31C 3GI8L 3KH3A 3OHXC 4LCUA 4PRIA 1VADA 3VXRD 3KL3A 1ZHBA 2A6KB 3NK4A 4U3HA 5EU6B 2H3NA 3BLBA 3QXTA 4QF1A 3ZU8A 1CYXA 1A4JA 1FVEA 3IDYC 2Z4QB 2CJTA 1NLBH 5KANI 3I2CH 2KBGA 1KXVC 1HZHH 5E9DB 1CCZA 2Y1AA 2OZ4L 4IMLB 4KWUA 1IZKA 3BFOA 5CFHA 2KUTA 1NPJA 2WUBH 4KDTC 3OV6A 2JI1A 4IU2A 4Z7QB 1BXVA 4HKBA 2CRMA 1K8DA 4Z7OF 3QDGE 4XMXA 2CJUH 2GCYA 3S34L 3UO1H 3RP1A 3CU1A 1RURH 2HVKB 3EO9H 4HCRA 2CKBL 3LQAH 4M61B 2P49B 1TZ8A 1BXXA 2HLEB 3O2WH 5GRUL 4FNUA 3TN0D 2NLJB 2P5EE 1I1YB 4L1DA 5I0WA 4AYSA 3U30B 3GNML 2IWKA 1CICB 3CZLA 2ZWLT 3HRZB 2N56A 3DGDA 3MCKA 3MLXH 5EU4B 5T33L 2DTSA 2P52A 3UZVB 2JE8A 4XBMA 4HWEL 4WU7A 3HG1A 5E6SB 3O4LA 5GRJL 2BSEA 4PRIE 1COBA 1UCTA 2JQZA 3WJLA 4P2RD 1AR1C 3IDGB 4KMLB 2H4EA 1I9RL 5IFHH 3DBSA 4PVLA 4GJTB 4M7KH 2ZICA 4GUCA 4GT7A 5DJYB 5IB5B 1OT1A 3GS4A 3I9IA 3CCHA 4ZFOA 3TEWA 3HIZA 4FQXB 1BZQK 4XNMA 4IRJC 1S8DB 3UBXI 2P42B 3WIFB 1AKPA 4M43L 2EQDA 4FQCH 1HEHC 3UG4A 1HDMA 2IPUG 4KAQH 4X8JA 4D9LH 1CDUA 4FXGB 4OCLC 2I60H 4L3EE 1BEXA 1CDYA 4YPGB 4OKVB 4GSDH 1G1OA 4LSVH 2YGPA 3R8BB 1PX8A 5DWPA 1OP5H 3GLDA 2X1OA 3DUUA 3QE5A 1HHGA 1KJVB 3H56A 4K7FB 2ZKHH 5DD6A 2P5WD 1F3DJ 1OGAA 3CSPA 2R2HB 1T22B 3NCFB 4FEMA 4QUOA 5C0BD 1ROWA 3L54A 2IH1B 5FYLD 4HULB 3H4HA 2C9UA 4JO2H 3DGGB 5I8OL 1IQWL 3O4LE 3QULA 1EGJA 1EANA 5CGYD 2PYEE 4Z7NB 5ALCH 4MRCA 1VF5C 1KG0A 4C47A 1YEDA 4X7DC 3DXAE 1ZAGA 3H9HB 1MFVA 4OD3L 3GTVA 5J6GA 4PTUA 3MLZL 3FUKA 1T2JA 4DEWA 1GZQA 2CPCA 4LLMB 3V79C 4TKWA 1LVEA 2WLJA 1KB5L 2P80A 3D3VD 4XB8A 4AZ8A 5AZ2L 4MZ3A 4X4YB 3Q6GL 4GINA 3ARDB 1FZJB 2MQCA 4AL8L 4UILL 4X5LA 4Y9GA 2CBQA 3LZNA 5D72H 5F9JA 4APQB 3IT8D 3EYOB 4K3EH 1TU2A 4EPSA 2YARA 2UV3A 3C5JB 3DPBB 2Y7MA 1UATA 2FECI 4M7JH 4XPGL 5IOPB 2Z91A 3VRLE 4I8DA 4NUGL 1OGAE 4H8UA 3UZQA 4PRAA 5ISZD 2WZ0A 3N1QC 1JAEA 5AZUA 3WGUB 4CDGC 1EXUB 4ZSOA 3VXRB 5JW5B 2G3MA 2R9HD 4BQ9A 1O6TA 5K39B 5CS7A 3GSQA 5C6PB 3MRIA 4E41A 5JQ6H 3CD4A 3E7JA 4FF9A 3WLWD 1XSJA 2WMPA 4IYKA 1A7RL 2VL5B 4KTEL 3VFGL 1NPUA 1YC8A 1P2CB 2VMDA 3K4DA 4WI6A 5EZJB 2IMMA 5BXFB 4JO4H 5DK0A 1FL3A 2EO7A 4U1SA 4KQ4L 4ZFQA 4YDLC 3MV11 4XXDB 4P23C 2HJLB 3MRQB 3HUJA 4JPSA 5F1IB 2A77H 2KZBA 3H42L 5FA4B 3T5WA 4F58H 2WXGA 5F96H 4MMYA 3BPLC 4F8QA 1P1VA 3I6LE 2XRAH 3OKLB 1YUHB 4DP8X 2DOCA 3TN0B 2VZUA 3D85D 1IILE 1NIDA 4Q56A 4EF3A 1D5IH 2FBJH 5KEZA 2DMCA 3CN3A 1DBKL 3C08L 2FCBA 2V7HA 2ALWA 3LKPB 1RJCA 5BVPH 1OWWA 8PAZA 4AV5A 1F0LA 1MW3A 2NY7H 2G2NA 4QTHB 3LMJH 4NPYB 25C8L 2CIKA 4ZSOE 3FT0A 3SKNB 3A24A 4P2RB 3O9WA 1ZOXA 1JGLL 3BPNB 3F83A 3P0YL 5DZPA 1A7PL 5E94A 2FVNA 3V6ZB 2N7SA 3K4AA 1ERNA 4E41E 2GAZB 1CDCA 3N2JA 1PLGL 3HTLX 3NAAH 1MHEB 4PSPA 2X6MA 2Z9TA 5DEGB 4MCZB 5EU3A 4B9ZA 5GS0C 1EHXA 3OXRB 3P69A 2LLGA 4JDEA 3MLRL 4V2CB 4E9LA 4KZDL 1UH2A 4RFOL 5EDXA 4CMMB 1R9FA 4Z7VF 2YMOA 4Z95L 1OANA 1AAJA 2AJ3A 2OW6A 1JN6A 2YSSB 3ATFA 3HUJE 4J7RA 1MHHB 3RI5F 1QI4A 4DF9A 4BE5A 1LM8V 3OJDB 1U30A 4N2KA 4HOZA 3RJDA 4ZX4A 2F74B 1BW8A 3P3RA 1IT9L 1U8LA 2P5WB 5ES4B 4QDGA 4TSBH 1G0DA 3PGDA 5I1DB 1LMIA 3FOMA 1HH6B 4C83B 3UAJA 4HV8B 1E0OB 1R24B 3DX7B 4WI0A 5K1JA 4ODWA 4TSCH 2DJMA 3QWQB 1ZT1B 4RLDA 2ODHA 5HGDA 4ZFGH 1WZLA 2N7BA 3QPKA 4JKKA 4N8VG 2OYKA 4ZMOA 3NBNA 1MFCH 3AFLA 4HFWA 4IK6A 3ZRSA 4JW3A 4IGBD 1KC5H 3FSOA 3MCG1 3IJHA 4BSJA 2PTUA 2DS4A 4WW2C 3LZFL 1FDLH 3OLGA 4N2AA 3B9AA 3NIFF 3WTUA 3L13A 1H8NA 4GW1B 2NSQA 3FPXA 1MH5A 3P4MB 1ASOA 4IDLA 3D3VB 4WTQA 1XR9A 3H54A 3TASA 3RIAK 2V2TB 1KYUA 1O9WA 2ZX9A 5DF0A 3WJJA 5L88H 3V9CA 4EDXB 1OLLA 3LQAC 4L3AA 4Q4IA 2EH7L 2NY6C 3OLEA 5IQ9B 3OKKB 2K4WA 5HHPB 4PRPD 5IHUL 2G0KA 4EXPX 5KBKA 3Q8AA 1A2YB 5LKNA 4LVOC 3HB3D 4WIQA 3DSFH 3Q5YA 3LRGA 2D7OA 3TYGL 4PJ8A 3S37X 2XLLA 2C4FU 3OLIA 5ISZB 2CRZA 2X4UB 4QHLA 3OVUB 2H6PA 4GT0A 4XHJC 4NOBA 1Z9SB 1E30A 1XGYH 3BP5B 5B1BB 1NKGA 2M8XA 1LO4H 3FO9B 1PMYA 4M7LT 1H0DB 5SWSB 3F62A 2F1AA 2DQJL 4XP9H 5FYLH 2NUPA 4MA7L 2P48B 4D94A 3QAQA 2JH2A 1AXTL 1D5XA 1Y18B 4JQIH 3EH2A 4FQQB 5CZXD 1WAEA 4JPIA 3TS8A 4E68A 3DC0A 1DL7L 3FL7A 3OAUL 1N5AB 1KCSL 3SJVD 1M57B 1CXFA 2A74B 2CBTA 5GRWA 2BFVL 5HHMB 4OGYH 1EUTA 4XO3A 3EOYG 4KK5D 1OE1A 5B8CB 1QEXA 5JPMA 5JDSA 4KHTL 1J48A 2YRLA 5ETUB 4QXVA 5BO1H 2EUZA 1AZUA 4QOKA 2LV4A 2ED9A 5L8LB 1BFSA 4B96A 2E4FA 3MLPA 3EJPA 1UGKA 3D85B 4MDJA 4NFCA 2R2EA 4Y5XA 2I32A 1ZV9A 4YZFE 5IQ7H 2DQDL 1GY2A 3WG7B 5T3XD 4DK5A 2HVJA 4IDJH 1SXBA 3K6OA 4RWHA 1AXSB 3M07A 3RVWD 4WEBL 3M8OH 5EUOA 3U30C 4A2DA 1MWAA 3HRZC 3OHMB 5D55A 5CD5D 1RUAH 2L4OA 2FX8L 2E0PA 2XKNB 5FDWA 2YUVA 4LSSL 4S1SH 5DHMC 4YSCA 4YDIH 4BKSC 1AZRA 2VXTL 3NFNB 4HS8L 3UTZB 5AW5B 4HH9B 3WV0A 2PLTA 1XF3B 3FT3B 1JERA 1IGIH 1HSBB 4J3BA 4DTGH 3B3BA 1NIAA 4X9HA 3A6BH 3QJTB 3IMUA 3ZDYB 4OIFA 4PFEA 5F6HI 3QIUA 1B4JH 1C08A 1U8QB 2YEVB 4IRSD 1X44A 4JVPA 4LIQE 1BBJB 3F58H 4K8RD 2I5YL 2Y2WA 1ZHLA 4O02B 4QOKE 2ESVD 2E9WA 4FXGC 5L4JA 1G0XA 3KPQA 3RLSA 5B3JE 4N1HB 4P0DA 3HN5A 4JHVA 1S7WA 4JO3H 1DLHB 1P1ZA 2ZONA 5L8JB 4XNZC 4KC3B 2VDPL 3NEEA 2OYMA 4LU5L 3VTMA 1DFBH 3W9DA 3ZE2E 5IEHB 1EUUA 4IGBB 2JMRA 2J6WA 4QCIA 5E9NA 3VG9B 2OYPA 4HIXL 4A1RA 1ZDSA 1MAMH 1R5VA 4FFZL 4KJYA 3TESA 5H35B 1JL8A 1N26A 3NK3A 4XMKH 3DWTA 3FRPA 1DQTA 4J6RH 1ZLWH 3T8VA 4PWJA 5A7EA 3H3PL 1AZVA 3N1FC 4M6AA 3VFMB 1FJ1B 2KQNA 5FM4A 2GTZA 4U1IB 3SE8H 5E0QA 4D0BB 3QUKA 5E1AB 3MA9L 1I3UA 3PP3H 2IDTA 2YR3A 3IDIB 2DM7A 4XMVA 1XB8A 4PRPB 4NIYE 4QIRA 1WBYB 4EI5A 2PWEA 2LABA 2EEDA 3K1KC 4P46A 4UBDD 1MCEA 2EO9A 3HB3B 1NTDA 2AJUL 2A9BA 1A7BA 1AQKH 1U92A 5CP7B 4X6EA 4O02H 2X4QA 2IH3A 3ZMNA 2IDQA 1CLOL 1GAFL 1TQUA 3BUQA 2G9HA 5D4IA 3QNZA 2OK0L 5I73B 3D39D 1DANU 4BH8B 4PB9L 4NRZB 2O5YH 4LP4A 2LR4A 1QBMH 1J5CA 3R0MA 3EOBB 4LEEA 4M5SA 2OCFD 3N55A 5F3HA 2P8MB 4YSDA 1ETJA 5CNHA 4CU6A 3CFCH 5SWZA 1SLUA 3SJVB 2MJWA 2BVEA 4MWFA 3L3JA 3W9EA 1RJZA 9PCYA 4UIMB 3KLAB 1JGIA 3QHFL 4YXLL 3DROA 3EDDA 5KSBB 2E75C 1IQDA 1NC2D 2XNAB 3O6LH 4EVNA 2GBTA 4OZ4A 2HJFA 1PAZA 2NYZA 3UBXG 4HLEA 4KFMA 2DQGL 4PRHA 3E6HB 5K9OB 2GY5A 3KJ4B 3MV9A 4L37A 1DSWA 4JHWH 2OZNA 2HKFL 1OB1B 2UXGA 2QJDA 3OKOB 2J2ZB 1DQMH 3D4ZA 1OPOA 3OR7B 4P05A 2IG2L 1PKQA 2IAMC 4PY8I 4DT2A 2LAAA 1LO5A 1MJUH 3GDBA 5LAXA 4GRLC 4DZ8B 5MEND 2IBGA 1P9MC 5IGXL 1L9TA 1A1OA 4PJGA 3V6FB 2H47C 4AUYA 2UUDH 3G9AB 4PJFF 2IFFH 4AYBA 4Q9QH 3N9GH 1JXKA 1MUJA 4D0CB 3SYCA 1UUNA 5E03A 1GTFA 4HJSA 1AMYA 2Q1EA 4OFDA 1FORL 3KWVA 1G4MA 2V5TA 3IPFA 3VFWB 4HXAH 5T1DH 5AB0A 3CC5B 1F8TL 4ABQA 5SWZE 3EF7A 3B2XA 3BUPA 4FMKA 4A2HA 1YZZA 1QR4A 5C92A 1HJBC 2DWEA 4YO0A 4ZMTA 1F1DA 1PCXA 35C8L 4RVBA 3S0PA 3REWB 4FQPA 4IRSB 4A38A 4XVJL 3WTWA 3NSFA 2P8LA 3QWRD 3AT8A 4BM7A 4NT6A 1SDAB 1FN4A 2HYMA 4PRHE 3VGAB 5E9AA 5AAMA 1XGQB 1XTMA 2ESVB 3MV9E 3CPLB 4UNTA 2EIKB 5KBLA 4MS8C 2IOIA 4C56D 5B4MD 5HYFA 1FYHB 1PKQE 1MJ8L 1T21A 2PXYD 2OMXB 1A6WL 4GKSB 2LTQB 1RZKH 3GMOA 3LXUX 1VHPA 1TJMA 4E0RA 4PJGE 2X5PA 2EDTA 3BVVA 5T3XH 3QXVA 3LHAA 3O3DA 2YAOA 4U6VH 5I6LA 1RZGB 2E76C 1NAKL 1XGRB 1P5UB 4KI5F 3O8XA 5JLZA 1FHNA 4X9IA 2WWNA 2EAEA 1XWVA 2IBBA 3CN0A 1XZ0B 3GRBA 5I16A 4LESA 2YA0A 4S1RL 3GDCA 1IL1A 4RGND 4CVZB 2A99A 4JPVH 1RD6A 3L1EA 4M1DH 5KYXB 3LH9A 4K23L 1RFDL 1GC1L 3DMMD 3QIWA 2V33A 5DRNB 4YL9A 1D6EA 2CXKA 4NQSA 4U6HB 1IVLA 2X2HA 4BWTA 3DTXB 4ZD3L 4NJ9L 5JUEL 2UX7A 4JZOA 1HVXA 1XCWA 1V27A 4ESKA 1T5KA 3UXFA 5JOPD 1SMAA 1MCWM 1ID2A 1U2YA 4K8RH 4N8VB 2WNGA 3D6GA 1JTPA 2YFOA 1BQUA 5J3HC 1VFAA 4IJ3C 4BA8A 3LPFA 3ZK0A 5CEZE 3S88L 2BIPA 5DJ6A 4WDIB 3D39B 4X4XA 1I8IA 3W57A 3EBIA 2VN4A 3HR5A 1MFEL 3N43F 3U0WH 5CINH 1A6ZA 3OKMA 3L4XA 4QHMB 1JMZA 1XMEB 3ARUA 1KGJA 1UM4H 4W6XB 3I3BA 4N2BA 4LBEA 3X1NA 3BKMH 5TJWK 1G7JB 3U2SB 1TNMA 3FW6A 5LBSH 5J1TC 1FP5A 2VZTA 4D9QE 4O5LH 1V7MH 2PW2A 2AJZA 1P4IL 3WLWC 2BIHA 5DVOA 4X6DF 3U2IA 3HG4A 1NC2B 5CJQH 2ENQA 2QQNH 1JPFA 4L9LB 2X4OB 1E9OB 2C26A 2J6EL 4Y4HC 5F97E 3Q1SH 2NQCA 1HWWA 4BZ2H 2IANA 5ESVA 3IAPA 4C4BA 4LCCB 5INCA 1TMQA 3PDGA 5B8CC 1U8IB 2QLVB 2W0KA 5JOFB 2AZAA 4Q74A 5IMKB 4FXTA 4QRSB 1NMBL 5A40E 3ULVF 4L05A 4N28A 3TCLA 2AV1A 5MENB 2P7TB 4N0RA 1DVYA 2QELA 3B3IA 4TTDD 3ZDZB 1CFQB 2NR6A 3FFDA 1KBWA 1OCWH 5JXEC 4TF4A 3QQXA 3SGJC 5C86A 1HXYB 5D2LA 5IFJA 2DJ4A 2VXQH 4KK8D 3NP3A 1CGUA 3N06B 3VFNB 5DD3H 5EULV 3VI3A 4OCXL 1XXDC 4GAJH 3HFML 4I0CC 3L3IA 2VSCA 4ACTA 2BVPB 3EFOB 3ESPA 3OZKA 4P3DB 1EZVX 3LVTA 3ZHKA 2XWZA 3SKMB 3CHXA 4P5KA 1RUPL 3NVQA 2F1BA 1F11A 4FYSA 4MA8H 3H9SA 4AYMC 3TA4D 5J13C 2FH6A 4K94L 2IANE 3GSXA 5FECA 4GO8A 5EN3A 4MNGB 4UV7H 2JJVA 3UJIL 4QXTA 1M4KA 1LK2A 2YJLA 4HJJH 2NUTB 4JR9H 4RZCA 4A7QA 3ARTA 3HBQA 3QJFA 4C56B 1TFHA 3HC3H 4IS6A 4XR8C 2SEBB 3SPVB 2DM3A 2VXSH 3SDDB 2PXYB 5D70H 4TNVK 1ZGLA 3CZSA 3L7FB 5KG9A 4QXGH 5DQDH 3FT9A 3MJGX 3FJTA 3QIBB 2A3TA 4JM0A 2B4CC 5TE6L 2JK5A 1F4XH 2J8HA 3VI3E 3FO1B 3E8UH 3UAEA 1J0IA 4DN4L 2YUZA 5EF1A 4FZEH 4X99A 5D71H 1NCAL 4F7MB 3VXPA 3TT1H 4RGNB 1JOIA 3EUDA 3VG9C 5GRVK 3NIDF 3OMAB 5EZOL 2E7LA 1YN7A 1WBZB 4FHBD 3DMMB 3H9SE 2V17H 3DLQR 4RDQF 1WV7T 3HN3A 3GK8H 1Z7JA 1DQKA 4K7PH 3TF4A 2NX5A 2QQKH 3BCDA 4X7SH 5LN4A 5DYOA 2K3TA 4XN5A 3NEOA 4LOFA 2LQRA 3IF1B 4NLHA 3SGEH 3VU2A 3WIAA 5T3ZL 5JIIA 1AFVH 3TC9A 3MLSH 4HGWB 3CFMA 4QNPE 5LGJA 4TUOA 1ZS8B 1IGJA 3ETBJ 2R29A 2TSBA 3BAJA 1NGXA 1OF2B 4N0CD 2GBUA 2NXZD 3B2UD 1IMHC 3HB3C 1MVYA 2D73A 4JFXA 5I71C 4PBXA 3WE6A 4Q97A 4N8PA 3OSVA 3FCTB 3Q9QA 3BWSA 1T83A 2NY5H 3V4VA 1HOEA 3ZRCC 2ZCHL 3BT0A 1NEZG 1W72B 1ACZA 1AYOA 3C5SA 1ACXA 4JEGB 2CO4A 5DJCA 2Q0ZX 2BH0A 1HKLH 3GJEA 1GGCH 2EDEA 3MOBL 4OLZH 2P24B 1A14L 1U95B 4EAEA 3DX4A 5AKSA 5CZXC 5TDNA 1FPTL 1QD0A 1PYWA 1CN4A 3NIGF 4NNPL 4WENB 3MOAL 5GS2D 4EOWH 1VKXA 3AGVA 1XCQB 3EJTA 5GXBB 5HDBB 1DEEA 4YFDB 1JNNL 4AGMA 5GGVL 3DETC 2V8MA 2KDYA 3O45A 1HFUA 2Q3ZA 4N24A 4KK5C 4ZUSB 1YEGH 1KTCA 2NX5E 2OFQA 2KLRA 3UGXA 3S3SA 4CAGA 3SPGA 5C0IB 2OL3B 3SCMD 3P54A 3VXTB 4PJ7F 2Z7UA 5IJVA 4OD1L 3JV5A 3KJ4C 4AIOA 3HG2A 1KNOA 3OQ3B 3CFBA 5EUKA 4LASL 4UM9A 1SJMA 1HILA 1SDDB 3V4UH 2A9CA 3ZPDA 1RZKC 3LDBC 2HMIC 1WBXA 1N4XH 1JWSA 4X7TA 3AM8A 4N8CL 3QDAA 1T0NA 4J1UB 3K2UH 4LLQA 1UXWA 3JYBA 3H55A 4FFYL 4ZW8A 3RX8A 3BIAX 4OFKA 2WKGA 2DQEL 3N1MC 4FXLA 1ZY9A 2AF2A 5DFVD 5C0FB 3UBXB 5C0GB 1DP0A 1NANI 4U4IA 2CO2A 4MNQD 3D05A 1W72H 1P6FA 2IAAC 2V5SA 5IM7B 1SVZA 3KAAA 1X7TA 2B3RA 4YOKA 1FL5A 2HFTA 2JB5H 4JQXA 4QRBA 4RNRA 3MRJB 1KELL 1VGEH 4ZTOH 5HGBB 4AIXA 1CDGA 3SO5A 2O6DA 3ETTA 3HAEG 2O4EA 1CGSH 4JRXD 4IRSC 4ZXBC 4DW2L 1BLNA 4MDIA 1MJJA 4WHCA 2RQ8A 2XTJE 3AXLA 3VGAC 5C2UB 4D0DA 3GSNA 4YBHA 4G70B 5HY9A 3GBML 4XVTH 4CADA 5A2IH 4ZX6A 1DYZA 1WVZA 2OL3H 3LB6C 3B34A 1FAKT 4I89A 4X5XB 3RBGA 3N85L 4M6NL 3P9MA 3PWPD 5BOPA 4FFVC 3HZVB 3NG5A 2EDJA 2LTQC 3BLKA 3L2MA 1IKFL 3NGBB 2Y6SC 4CMHC 1IC0A 2ZNWA 5D7HA 4AWJC 2NW2A 4HX1B 4TUJB 4P5TD 3LHPH 5L9DL 1N64H 4Q14A 1R5IB 1M71A 1P5UC 2XVLA 4MJID 4W68A 1G1KA 1HN1A 1YEKH 2JCCB 1A6AB 3AWFA 2F8IA 3VW3H 4KMQA 3H53A 3EJZD 4G3YH 3VSTA 1KJMA 1DUYB 2L7QA 3L3HA 5ICZB 3MLVH 2ILLA 3X14B 4IKIA 2EIBA 3O2DL 3K91A 4TNWF 3V5HA 5AAPA 3F7LA 4LBAA 4C59B 4U1HB 2OMWA 5IHZA 4AYDC 4W9CC 3MRBA 5H4ZA 4OF3A 4JLRB 1DVFD 4PP1C 3S3BB 3ARYA 1M2OA 1T03H 1ZLUK 5BRZA 5AL8A 5AVWB 1P5VB 2IPKB 2NXZB 3SBWA 5I1IH 4K71B 1ZXQA 1TZGL 2F19L 1PLBA 4KOCA 4G8EB 5TE4L 2EXWD 1PFOA 4NXKA 1Y6NR 4JPQA 3RILA 1T0OA 1CD1A 2CPUA 3QXDA 5HYEA 2XWCA 3RWJB 3VMOA 3FQYA 3T0BA 1M05A 1H3GA 1OAUL 2VR8A 3K4ZA 3IDNA 1EDQA 4JB9H 4MJJA 1FGNL 1Q72L 3CFKA 5I8CA 1TMCB 5JYMA 2F7RA 2RALA 4BZ1L 2DQMA 3CHSA 5AWNL 4PRNB 3WD5L 4WWKA 1QABA 2HTKC 2X0UA 3GJFB 2YKKA 1LEKA 3D0AA 3NA9L 2OMTB 5JA8B 4F8NA 4X6CA 5F88A 4DQOH 4AM0B 5LQBH 2YPVA 3EYVA 5J6HA 5GGQL 1WAAF 3JWDH 2HX7A 3U7WH 3SCMB 1RVFH 2AQQA 6FABH 4LCCC 1LEGB 4Z3HA 4N5EC 3O2VH 3NT0A 4YHOH 5F7MC 5BRZE 5HHVL 3B9EA 1NFIA 3VD7A 5CCKL 4NERA 5D4HA 2VDRL 1EAJA 4LLWA 4G6AD 5EOCL 1D5ZB 2O6PA 3PDOB 1YA5A 4Y2DD 4YWGH 1UWGH 2EUXA 3QCTL 3VH8G 1G9ML 4XPTL 1JZIA 1I7RA 1IC5H 2J5WA 1A7NH 4YJZL 1GS8A 1L3NA 3MRMB 4MHHG 2PYFA 1VPOL 3VRJA 2WD0A 4XRCB 3F6LA 3UP1A 4LRIC 1X5MA 4MNQB 3V0IA 2OR8A 4CGUB 1KBKA 4QRAA 1EJ8A 1NCJA 1ETA1 3TBSB 2K78A 3TH2T 5J9PA 5FA3A 2X9ZA 4ZS6C 5JW4M 3NN8A 3LEVL 2QADB 4R0LA 2XDHA 4WWID 5FKAB 1J1XL 5CHNB 3C9NB 4CBZA 3CN4A 3F6IA 3HZKA 4O2FA 1DBML 4JRXB 5CP3H 5GS2H 4TSAL 1NGQH 5F0PB 3UDWC 2JJWA 3DK2A 3O0LA 2WXRA 4HIHA 3GJFH 4PJDF 1FL6B 5F7DB 3EFFB 4AQAB 3QORA 4P4RA 3P77B 4L8CB 4I77H 5J1AA 2R4RL 4XX5A 5E1IA 3GXNA 3FONA 2AQ1A 5B4MC 4MS6A 3QAZC 2D0FA 1I9IL 1ZTXL 3PWUA 3D0LB 3TJPA 1FNSL 4BCZA 4FA7B 1N5YH 3SDDC 1DQVA 2PXYC 3PWPB 1MN4A 4XMPL 2GTQA 4PJ5D 2H2SD 5TD4A 3NP4A 2HLAB 4YSPA 1K4CB 4GS7C 3RTQD 4A2LA 4LFHG 2XBZA 2EJ1A 2VB5A 3FN0H 4EQ3A 3IFNH 1X5KA 4X2UA 2VLLB 4P5TB 3U6RB 3T3PE 3QUXD 2CG9X 4NKMA 1U2HA 1JV2B 3QIBC 1RIVH 4MJIB 4CW1B 3RU8L 5ILTH 4TL4A 2WVTA 3VFVA 2MCG1 2UY7A 3QZPA 3T65A 1S7VA 4NO2B 1OSPH 3N6YA 3VXMD 4PVNA 1SHMA 4H8QA 4MXVE 3AAZB 3LKSB 4KX9A 1SOXA 4PJCA 3SODB 2GITB 2FIRT 5D1ZC 3S6CA 4NFBA 2X6BA 5IWLC 4Z7UA 2VR5A 1KCKA 4R7DA 4U6YB 1HXMA 2F18A 1F4HA 2J1YA 1UH4A 3MC0A 3WNPA 1RLWA 1DVFB 3D4CA 2MH4A 3DK0A 3FUDA 2DB8A 3IMWA 3UBHA 4BK5A 2J21A 2OULB 1YEJH 5HDLA 5D7SL 1J0KA 3K6NA 3VXNB 2MOQA 3LXBA 2FQGA 3EYFB 1WT5C 3NJIA 4AYID 4F7EA 3BO8B 4W9HC 2ICEB 1BJ8A 4RMRA 3QWNA 2XHNA 1QYGH 3X3FL 4F27A 4OR1A 4QRQB 4Y2LA 4ENZA 5GHWL 1NCOA 2DWXA 4P48A 5L0QC 4GQQA 2ITCA 4JY5H 4HUUA 5AB1A 2EC8A 4UAOB 2WLIA 1ZHNA 2QVKA 1Z3RA 3E8VA 2B1HL 4ONGL 4PREA 3ZTNL 1QEWA 3MRFA 3K2KA 5I5RA 1RUMH 2W07A 2VKWA 2FWUA 4RGMB 4OLYL 4PJCE 1OM3L 3L1FA 1MKFA 4ZDHB 5INDB 3K0WA 4Z7UE 5K93A 3MNVB 4HP5A 4ONFL 4P4KC 4LPYA 1CO1A 1SF3A 4JM2D 3HPLB 5GIRB 4JRYA 1G6RA 5CIPB 5IBUG 4NKIL 1NEZB 2W0LA 2NW3B 5HHXH 4XZ4A 3HNTL 4JUSA 1BVOA 3BSZL 2R1YA 4Y2DB 3NRPA 3S48A 3OX8B 1ZTMA 4F1ZA 1SN5A 3B6SA 4Y4KD 4PGCA 2IBZX 3A23A 1R34A 2V0AA 4Q9BA 1IBDA 3EOAB 1OCZB 4R96B 4RA0C 4JFQA 3GMRB 3IJ7A 4GG6B 4AMKH 4LK4A 2COVD 1CFVH 2FLRT 3Q3GA 3ZIMA 5DYFA 5IVNA 4YHKH 4LOUC 5I1HL 1RV6X 1SJVA 3GC3A 1TEYA 3BUYA 2X7LB 1QZ1A 5E8PA 3S96A 3IETA 4Z0XB 3ZYOA 3ZBMA 2AERT 2I85A 1HSAA 1RIUL 4I4WA 5E5MB 1GJUA 4FLHA 2O93L 3F12A 1ZA3A 5IF0B 1LNUB 5IOKA 3CX5K 4GQZA 1B0IA 4Z7VB 1J05B 2QKIC 2UWEB 3KCWA 3PFUA 4YDVB 4AKPA 4ZUVB 3KS0J 1A3LH 2OMZB 3KCPA 1YYMH 3MROA 4IU3A 1J7VR 4CN6A 1VEPA 2Z8SA 4TUKL 4FL4B 1P7KB 1Y0LB 1PZAA 1WA0X 4DN3L 3FT2B 4A6YB 4PJ9D 4PJ5B 5CIPH 1UA3A 3RTQB 4YFLI 5ID0B 1KN4L 4LSQL 1PS3A 3COOA 1NCTA 2X89A 3D33A 4LP5A 4MRBA 4N6RA 3QUXB 4OTXH 3NGBC 2B08A 2LU5A 1NUNB 3BHBB 8CGTA 5HYJA 3HAEB 4G8AC 1UD2A 1T04B 1SY6L 1RZ8A 2H6UA 4NC0B 3VXMB 4RA3A 3RNQB 1A64A 2QHRL 4NP9A 3W11C 1CD0A 4B5ZA 3F85A 5JORA 2R59A 2PTTA 5GGTL 2HX8A 4W9IC 5JMRA 4JGUA 4PV8B 3MBEA 3B9KD 1P7QD 3FB7B 3VXOB 1AP2B 3WO3B 5TGBB 2VZVA 3H8NA 5LBGA 4ZFFA 3DOHA 3RGVC 4NUJB 5DCCA 1QFWL 2AJVH 4DK3A 4WFHE 3GXPA 3LY6A 1CLYH 1M7XA 1E9QA 5BZZA 1Z2KA 1ACYH 3L4VA 1CGWA 4LFHD 1AXIB 1Q0YH 1HC1A 1WAPA 3W0WA 4JN2B 2GIYA 3EH1A 4AUUA 5CMAB 1OTUC 4P5RA 2NXZC 4BH7A 4F9LA 3NH7H 1BA9A 1ZV5A 5CWSB 3TA3C 3B7YA 4XP1L 4UV4L 4N5UA 1QI3A 3L3GA 1GSKA 4D8OA 2WXOA 2WVSA 4J8RB 4TNEA 3MRKA 4NNYB 4PJEA 1MI5D 1SNRA 3L3OA 4A6YH 1Q0EA 3UTQA 5EU7E 1LTXA 4K5LA 2FX9H 1ZVSB 3QXWA 5HYJE 3WLBB 2V3EA 3D9AL 4WZ9A 3RWDA 3LQMA 2FBRA 4X9GA 5ABAA 1R3JB 4ODUB 5IVOA 1R3LA 2VLMD 3HAEH 4F7CA 4Z7WF 3IDJA 4FG4A 4L2YA 3RZCD 1MRCL 2IWFA 4YH6A 1JGDB 1OAXL 3C09C 4JM2B 3S5ZA 3WFDL 4H13C 5IIEA 2H8PB 4M03A 4AIZB 3RA7H 2GVYA 3BQUA 1KLFA 1L9MA 4Y4KB 3W0WE 4YLCA 1AGFA 1N68A 2Z7YA 3GSRB 1S9YA 4JJ5A 4YAQA 2AS5M 4HC1L 3VI4B 2VDNB 4PJ6A 4EKXA 1OSZA 2E7MA 2Y1ZA 2OMYB 3ARBA 4PJEE 1QLEB 1MHPH 1VLXA 2KPWA 2XA8H 4G80A 1A6VH 3U36A 5F0MB 3NYKA 1BBDL 2OCCB 2AKRB 4XAWH 3WKMH 5EEWA 4NKDA 2H7WA 5B1JC 3U0PB 3T4AB 3BUBA 1JGEA 4X9BA 1UD6A 1E2WA 2MOVA 3SIKA 2C1PA 1CQKA 2D7PA 3NJKA 2CBMA 2QADC 1HQ4A 3O3AA 3BZEA 3T2NH 3VH8B 5BZDB 4AXWB 3UPRA 4S11A 1L7IH 4S1DD 1Q1JH 3T71A 1EH9A 3CX5J 2ITEA 4U1MB 3HI5L 5DZ9A 3QUYA 4BXVA 5ACMA 4PJ9B 1B6UA 5BS0A 1CZ8H 3CFTA 5FKPA 3H85A 1FNGA 4PGDB 5FCUL 5J0BA 4QHNA 4R3SB 5HJDA 3RHWK 3DX8A 4KJWD 3U79A 3WFBH 3DNKA 4HKJA 1I53A 2H0PA 3KPOA 4MGXA 1F6LL 3TGXA 4Z78B 2VDNH 4N9OB 1CDHA 3JWOH 1AR2A 4P5TC 4WFEE 4KI5D 5D9SB 1HS6A 3RIFF 2VIRA 1NLBL 3SBQA 5FGBA 4RFNB 1MFDH 2WVVB 1QLEH 2BSSA 1HZHL 4WNQB 4XMWA 1L9QA 3QK0A 5TH2A 4OQTH 5I75C 3B9KB 1P7QB 1OE2A 4ODVH 4TULL 4A7TA 1EEZA 2WUBL 3IN0A 3NCJL 4NRXA 4V1DA 3NCXA 1AZBA 1NM9A 4QYOB 4WI3A 4KVCL 43CAB 2CJUL 1JHTB 3MR9A 3SYAA 3UO1L 5AAWA 4XOEA 5IEKA 1DVFC 1OKEA 4KDWA 4KY1H 1E5ZA 3LQAL 5GS3A 1FVCB 3O2WL 3C6LA 1JZ4A 3CZUB 4R2GD 2YEQA 4X8XA 2CO6B 5D8JH 3MLXL 5BS0E 3STLA 3QEQD 5F1OB 4N9GA 3X1BA 1MI5B 1D6VH 4ODXA 8FABA 3AG1B 4RIRA 1UC6A 1GW6A 3IPEA 4XP5L 4JPWH 1KJ3H 3RPIA 3GSVB 4HWZA 4AQ1A 3ECVA 3BWAB 3OC5A 2XKSA 4Y19A 4CL7A 4AJ0A 1G9NC 4I5BA 4OZHE 4WEMB 4YBLB 5IFHL 1F4WH 1TVBB 1BREA 4M7KL 1JWUB 2BXYA 2ADIA 1IBHA 1C7SA 1JVOA 4RGMC 5FHBH 1JD7A 2PABA 4U1NA 3IJSA 4FQCL 5JHBA 3JTSA 1UQSB 2FD6H 2YUWA 4D9LL 3KPLA 3TX4A 1KCLA 4CKVX 5EH1A 1PTZA 5B22A 1KIUB 2GJZB 2V5MA 4GSDL 4LSVL 3FFOA 2MEJB 1Q9OB 1MCNA 1BAGA 2ZKHL 2NTFB 4M3HA 4YSUA 4UB0H 2QGCA 2WXFA 4Y16A 3EJJX 5KWYC 3GSWB 2QDWA 4IIQA 1UKTA 4JO2L 5C08A 1E42A 4YUEH 5I8EA 3HE7C 2XIIA 3VA6A 5HYIA 1HL4A 2QGBA 1O9VA 1TITA 2YRBA 1DDHB 3UERA 2WCSA 5ALCL 2APFA 5IW1B 2IV9A 4Y19E 4HIIA 3E9UA 4XNAA 2C3XA 4KV5F 3L7EA 5D2NB 1EHKB 1IVTA 3BEVA 3VX0A 4EZJA 2Z0BA 5IBUB 1FGVH 1L9NA 4LT7A 4XBPA 5G5DA 1RPQA 5DQ9A 2XU9A 4AIEA 4JZJB 3L16A 4LGPB 5K1VA 3ARGD 1KV7A 3FQUB 1U8JB 5DQJA 2DAVA 1S7TB 5D72L 5LNEA 4PQXA 4K3EL 4LF3B 4X8CA 4YSRA 3H1ZA 5FEBA 2OSLA 4NO5B 3FHQA 4JFPB 2FWSA 2GUOB 2VISA 4YHIA 1IBBA 1ITBB 1BVLB 1P53A 1I85A 4FL4C 2CLVB 1F6AB 5C0CA 5C08E 3APFA 2H2SC 2Z31A 3OHXA 1NDMB 4KTDH 2PCPA 3MO1A 4FQHB 3DTUB 2A9DA 1CJYA 4HKXB 3T0ED 2VDLB 1UB5A 4G7RB 3QUXC 1NBCA 3LV3A 3GRWA 4AW7A 5I17B 4JY6A 4X6FA 1JHLH 1YQ2A 4U1GB 1OB0A 1TFPA 1UOLA 3QDMD 1BQKA 4JO4L 3D08A 2FEDD 5ECJE 4ANXA 4WW1B 1SEBB 4PRBA 3L48A 3TBCA 2MNJB 4LHUG 3QDHA 4KDTA 1WWWX 1V05A 3FUJA 3CV5A 4PS4H 4F58L 2A77L 4KXZI 3VCLA 4BKLB 5F96L 5CJBA 5CGMA 2DM4A 5MEOA 2X41A 2XRAL 1C16B 2C5DC 3EAKA 5IROD 3VWKA 2D0GA 5A7BA 1OTTC 4R2GB 1AGEB 2OXHB 2R8SL 1D5IL 2FBJL 3EGDA 1SN0A 3JZ7A 1F4YH 4MZIA 5BVPL 3QEQB 3LEYH 4A2FA 5KJRH 2LAGB 4PJHE 5JHLH 2BS8A 5C0CE 1Q1PA 5KVEE 2GK0B 3C60A 1DJWA 4HW6A 3RL2B 1J18A 2FJFB 3C5ZB 2ARJB 4MA3B 1P4BH 5ESAA 5I0DA 2BCMA 2YD3A 4LCVA 4LLVA 3NCEB 4OUOA 4ZFZA 1SDYA 3M45A 3NAAL 3FYIB 2ZAGA 3SKJH 1O6VA 3L9RA 2VDLH 1DBAH 2CUMA 2X2IA 4MDRA 2H6OA 3EFDH 4X6DB 3MGTB 3RZWA 1TEFA 5C0AA 3HR6A 3PFQA 4IRJA 3F7YA 3VXSD 4F93B 2OPCA 2R2CA 4LXFA 3RWCB 3FO0H 3FSAA 2UXVA 1FIEA 3LS4H 3ELQA 4KXDA 2EDQA 1IIKA 2ITDA 2WXLA 1CE6A 4OY9A 2AEWA 5DTFA 4BFFA 4XNYH 4XPAH 3T08A 4MBRA 4WJ5B 4XN4A 4BFGA 2WLLA 4DKFH 1FNEA 3KBEA 4E42B 4TSBL 3MA7A 4FC3E 3J2PA 2Y7QB 3O41B 1X6NA 2PO6D 2XQBH 3EZJB 2ADYA 3BVTA 3BYTA 4K5MA 3WN5B 3LD8B 4IMKA 4TSCL 3HHSB 1SJEA 1X5AA 4ZFGL 1H8SA 4HOWA 1G7IA 1SY6A 3S2AA 3BP7A 1MFCL 2AP2A 2AW2A 4AI7A 2WTOA 2VDMB 4TMPA 1KC5L 12E8H 1K2DB 1FDLL 2Y3AA 4GXVH 4P3CH 1IAKB 4KBPA 2ZP0T 1TKWB 3G5YA 5HD8C 1HI6A 3FQ1A 4LSUH 5C0AE 4U6XB 2PN5A 2XWEA 3U46A 3E9TA 3FT4A 3M6DA 4EN3D 3ARGB 1R4XA 3OM3B 3BGMA 3QFJD 5L88L 3K2IA 2NQ3A 1FG9C 3QI9D 2XQYA 1EZVY 2VM9A 2XACC 1C12A 2VNCA 4PGZA 3T1FA 4Z5RA 3FRUA 3DSFL 2YLHA 4HPOH 2E8YA 5IG7B 5JPNB 4NHCH 4C8XA 5CU9A 1XGYL 2ZUXA 1T1XB 4Q8BA 3VYNA 1LO4L 4LMQI 3RVVD 3GKZA 2EABA 3EJCA 5DSCA 4YSEA 1UOWA 5EWIL 4HDIA 4XP9L 5FYLL 3T0EB 4PVBA 5EBGA 1UWEH 3CVIH 1M7DB 2K9FB 4JQIL 5FW8A 4YC2C 1IGTA 4FJZA 5CEXB 1JYXA 2X1QA 3GZKA 1VEMA 3QDMB 2MWCA 2IF7A 1LWRA 4JN1H 4H26B 1PZDA 4FLSA 3NIDB 4JX0A 4RFNC 4W4NA 2VDMH 4MLIA 4NENA 4OGYL 1TTAA 5FM5O 1U2CA 1S9VA 1YNTF 2R83A 5KVMC 4JRLA 4Y5VB 1L6XA 1UA7A 2NNFA 2JSFA 2OI9B 3OWRA 3CC1A 3MRPB 5BO1L 3D69B 3HC0A 3SYQA 2IDFA 3MACH 4ZX3A 1M7IB 1L7TH 3A4AA 1Q94B 1XCXA 5KS9B 1E4XI 1CBJA 1T5WA 5IQ7L 2W0FB 5DT1H 3U4AA 2LW3A 3FB5B 3FCSA 3X12A 4PH8A 1WC7A 1QMUA 3N0AA 4IDJL 1PBYA 4IKNA 3VTAA 3M8OL 4ALAH 3GHBH 3M17A 5CILL 3GMLA 4ZMXA 5F7YC 5F7UA 1Z9OA 3MN8A 4JY4A 1VGKB 3IMRA 3BE1L 1RUAL 1KIPB 4XO5A 1VESA 1REIA 5FGRA 4GI9A 4LHUD 3DO7B 1D9KC 4S1SL 4YLBA 3L9YA 3LJ3A 1K6QH 4YDIL 4K3JH 4X7FC 4U1KB 3E0GA 3LN4A 4AKQA 2IC2A 1DVXA 4YBLC 5KYUA 5I1LA 1IGIL 3NIGB 4DTGL 3DBXB 3VXSB 4DZBB 2G60H 4AT6B 3VD1A 2VLJA 3A6BL 4JFYA 3PAYA 5GRZA 2W9LA 3LSOB 4G6JH 5E6IC 3U4EA 4UUJB 2BS71 1B4JL 1S9KC 3VRIA 3F58L 4HG4K 2HN7B 5HGHA 3KDMB 5C0DB 4Y5YB 2Y7LA 2BZCA 4PJ7B 3DUSA 3KD4A 5DFWH 4PIRF 3HC4H 5LCVA 2DMHA 1YMHA 3FOLA 1HEZA 2Y2YA 3JZYA 4WTWA 4JO3L 4WUUD 3EGSA 4N1CA 3SDAC 3KE0A 3CVHB 3MV8A 4AEHL 2DDQH 4WHTB 4EDWH 2PO6B 4ZZKA 1RK0A 4GEIA 1JPTH 1MZYA 2Y4SA 2EDNA 3BKYL 5CJOL 3AC0A 3TXAA 5C1MB 1RQ5A 3I85A 4UT9H 1JUFA 2N1TE 4BKTC 4NIKB 4Z3TA 1FCGA 1SXAA 1MAML 4QHUB 1RPKA 4WW2A 5IMLA 4A67A 5EEZA 3AS0A 4TNWK 4XMKL 4J6RL 2Z8RA 1TO4A 1FNFA 4N3TA 3GMNA 5D2NC 4EN3B 2VLJE 3G3LA 3FTWA 4XNUH 3QFJB 3SE8L 2XN0A 4I7ZC 5ALBH 3X13B 5AW8B 3NSCA 5GISH 2A6JA 3QI9B 3D12B 2L0DA 4CRPA 1FO0B 1BD2A 3HZMA 4PS3A 1T2QH 5F8RC 3PV6B 1EHLH 4Q2ZB 1BGXH 2EEFA 1AQKL 2CLRB 4UDUA 4FG6C 4O02L 5IB3B 3MV8E 2ZYSA 1BVZA 3I02B 2WWKO 3V2AR 4CNIB 1JK8B 4GXUN 2YRPA 2NNAB 1URIA 4KJWC 2FL5A 2VZ1A 3CVHH 3P0VH 3OB0K 1QBML 2AXGB 1JNLH 3KYOA 1J9TA 4N90D 3TO2B 4PP2A 4LARH 1FLRH 1XF4B 4NHUB 4WEEA 1RJLA 1ZHKA 2ZPKH 3LPGA 2W60A 4KI5C 4NN6B 1JPEA 3CFCL 5ABDE 3CSBA 2UZPA 2G5UA 2D31B 2ZSVA 2I69A 2AXFB 4P04A 5E9DA 4P49A 4RWYH 3WNNA 5GZNC 1CDBA 3O6LL 4W70A 3T09A 1OW0C 4IMLA 4Q58C 2Q76B 1ADQH 4JHWL 3VGDA 4AEIL 5T1KA 1BD2E 1DQML 1ZK5A 3QQ3B 2XWTA 1EZSA 1MHCA 5IKCA 2HT4C 1FSKC 4RISH 1FFOA 4M61A 1SXCA 4R2GC 1MJUL 1FO0H 3ARFC 3IPBA 4KI1A 1JVKA 1ZWIA 4MXWH 1TG8A 2W80C 3HRZA 4QAWA 3PIQB 2ED6A 5CR8A 1H15A 1RU9L 1B3IA 2IFFL 3FB6B 3N9GL 5DUPH 3VRLF 3UZVA 4Q9QL 1B0GA 4DERA 1ANUA 3AXIA 4ODBD 3U25A 4YS4A 2I7OA 3KR3H 5IQOA 2J88H 2WYHA 4I1PA 1ESOA 3C5ZC 1U8MB 4PLJD 5AG9A 3P02A 3G6AB 4HFUH 4HXAL 5FUCC 5T1DL 5C7ZA 1K5NB 2J57A 3QZLA 5EBWA 5DC4B 5ICYB 1EXHA 4OZGA 2Z3FA 1MELA 3MRDA 3KLQA 3ZKMD 5DJAB 1UACH 3TNMB 3MQIA 3ULSB 4AQZA 5E9DE 5BJTB 4U7SA 2J3SA 4XWOD 1KGCD 1BVKA 3QUMB 3TT3H 4YIQB 3SDCB 2DL2A 2W9EH 3MREA 4L1HA 4NQVB 3CSTA 1OXYA 4YHMH 1IC7L 5D1QD 2H26A 4WI9A 3TOPA 3T1WA 1F13A 4YPGA 1YEHH 3LIZL 4OKVA 2JB6B 3ULVC 2P44B 4K7FA 1CK0H 3TTYA 2HUHA 5T3XL 3T9WA 1J5OH 3MNMA 2WQUA 4E36A 2VUOA 3C2AH 4MA1C 4KH9A 4L1LA 4U6VL 1BX2B 1JZJA 2Q10A 3QJVB 2WQVA 4XCCH 1MW0A 3LD8C 4P06A 4BFKA 1HWHB 3IN2A 3K71A 4L8DA 2HT2C 32C2A 3BESR 5I28A 4XNXL 4MSWB 2GI0A 3JV6A 4JPVL 4OZGE 2ZQKA 4M1DL 4HAFA 3C12A 5FYKD 2FLMA 2FEEL 3ASNB 1IM9D 1TTFA 3GNMH 5HYSA 4J3VA 1KIQB 1S7RB 3P73B 4I0KA 3KWWA 1CBVH 3JTTB 5TK2A 1QRND 3CUPB 2VWEC 4HWEH 4PJDB 3MJ9A 3TJHD 3HKZA 5DS2A 1KWGA 5D5MF 4FE9A 3HUJF 1DN2A 3QUMH 3IS1X 4J6IA 4K8RL 1VZIA 1DN0A 4M1GH 5EIVA 2B59A 4ALAC 3TBWB 3GSOB 3K8MA 3F7KA 3OAYH 3C5JA 3FH5A 1A7OH 1I9RH 1KB5B 2ENJA 4L3CA 4Y1TA 4XN7A 4BSWA 2GFBA 2BSTA 1GJWA 4J3OF 1O6SB 3NRFA 4GB9A 5IW6A 5JPNC 3WGVB 5KBDA 3CDCA 3EH5B 5CINL 4NQCE 3U0WL 4Z8FH 1UM4L 2IXQA 1OGTB 4MAYC 4RAVB 4BUQA 3N91A 3BKML 2XPGA 4XAKD 3T0EC 5I1CH 5LBSL 2M2DA 2DLFH 4LLUB 1IUZA 3AQDA 3MXWH 4MQXC 3WFEH 5I19H 3K80A 2IMNA 4O5LL 3UGEA 1PIFA 1V7ML 4Z7NE 2EIZB 3DYPA 2X9WA 3MSPA 1S78D 2WKOA 1D7FA 1XCTA 3I75B 5CJQL 2QQNL 4F57H 1KPVA 4Z3GA 2Y1VA 3C75A 3RL1B 3O6FB 2GYSA 2PWFA 4ZPVA 1ET7A 3RX9A 2OI9C 5FA4A 4LQ1A 3N04A 3UZEC 1KN2H 4F9PA 4GAYA 4DAGL 5IROC 1K5WA 2B14A 2IAMA 1KZYA 1QSFA 4LCWE 3EH3B 4YHPB 2WQ8A 3UC2A 2GTWA 3Q01A 1KIRB 4OCSL 4GRLA 1P9MA 1OCWL 3E1F1 3X1FA 2HUEA 2QQQA 1OALA 1S7XB 4WY7H 2X4SA 2VXQL 2YC1A 3KYKH 3VE0A 4GBXD 4HWBH 3FQTB 5DD3L 2VT0A 4NPYA 4JE4B 4IBUA 2VSKB 1KB5H 2AV7A 4GAJL 1EWHA 3KNBA 5GJSL 4P2OC 3FB8B 2IGFL 3OKDB 3Q6GH 4UZGA 2O5ZH 1AZCA 4KVPA 4AL8H 4UILH 3G5XB 3BDXA 4GRWF 3VO0A 4MA8L 2GAZA 4PMFA 5DEGA 4MVBD 4DKEH 1OOWA 3DX6B 1T5XB 5TFSH 4UV7L 5D1QB 2J43A 4KX8A 4JR9L 4HJJL 3I9PA 3QQ4B 5HDRA 5LWYH 1SRDA 1HCYA 2F54D 2DLGA 4JS7A 1SMOA 2VXSL 2ZYHA 3UABA 5D70L 1QSFE 4P5MB 2CDGB 3SE4A 1GMEA 3ZZQA 5EF2A 1TQVA 4HEPA 3VFGH 4FA6A 2J20A 2ROXA 3D7PA 4EUPA 1V54B 4QXGL 2G5BA 5DQDL 2QSQA 4M9PA 5HJ3B 2W88A 5KVDL 2YFNA 1F4XL 1RJYA 2NDFA 4HK0A 3UIYA 1Q9KB 3HS0B 1E43A 3E8UL 4PJXF 3ZLQC 2ERJB 5HI4D 1IC4L 4FZEL 4XCEB 3H42H 5D71L 3TT1L 1P84J 4W9EC 4XN2A 1QW8A 1AKJD 2IBZY 3VGHA 4DPBX 2CD0A 3C6EA 1IM9B 1D2OA 3GK8L 1S9XB 5FO9B 4K7PL 4DCQB 2QQKL 2WQAA 3QXAA 4X7SL 5IJCC 5JHDD 4F15B 3JT2A 5D93C 1QRNB 3S36H 4H0GA 1N9PA 1T4WA 2GEEA 3WS3B 3DV6A 1AFVL 1A6TA 3MLSL 3PHAA 3A0OA 3V95A 3WFHA 2FB4H 4NQED 4LKXB 3A47A 3P0YH 5DRXB 2FX7L 3ZYIA 2VW6A 1JXFA 4O51B 5B3JF 5KYNA 3NJXA 2Q3AA 3BISA 4NDMA 5DS8A 4LEBA 1E6OH 1ONQB 1I7UB 4FHKA 4ZO6A 3Q06A 3AS2A 1R46A 1CT8A 2NY5L 3C8HA 4GSQA 2DQHH 1YHPA 5E8EB 5F71A 3BP5A 4ECNA 1DDTA 3FO9A 5ANMA 1H0DA 2AQPA 5SWSA 4HS3A 4YVNA 1HKLL 2O5NA 3FDWA 1GGCL 4KGJA 4EI6B 3ZE2F 1NM4A 1Y18A 4DK6A 2H45A 5AW0B 5FHAH 5JYLA 4JFDA 4NN6C 3I6KB 5D7IF 1N5AA 4RX4A 4DOHB 4Y4HA 2ZOLB 2VCOA 1E3ZA 1O9ZA 1YEGL 1JTOA 2AVGA 3SYOA 1YEFH 3MV7D 4KQ3L 1BQHA 2XUWA 5FYKH 1NFDA 1KXTA 1TVDA 1C1EH 4KXCA 5DZVA 1TJXA 3BRDA 1YY9D 4OZFG 1DUZB 3Q6FA 2R56L 4XGZA 3QGVA 4MMXC 4OBRA 4BFEA 2OMVA 3V4UL 2XV6B 3A5VA 1EO7A 3NTCH 4FCHA 4DP2X 2JJTC 4ZG1A 1ZCRA 3UCRA 2V4LA 1J86A 1SUHA 2N3JA 2ZYIA 3BDBA 5I1JH 3K2UL 3LZFH 4S2SB 5JXEA 3SGJA 2FYYA 4GBXB 1NGZB 3GLEA 1KFGA 4OD2B 4KQ0A 2QVMA 1CURA 5ANME 2HZHA 5SWSE 3MX0A 3K6SB 2G3XA 3GUTB 3HNVL 3GZPA 1W72L 5JQIB 3SOBL 3D0VA 2Y9RT 1UWFA 4XHQA 4JFDE 5C0ND 3UO8B 2D2OA 2JB5L 4ZTOL 4HH9A 1VGEL 3FT3A 1SEQH 2N59A 1WG3A 4UNUA 5HHME 3BJ91 3MLUL 2YPLD 4KNUA 4E9XA 1NFDE 5JO5B 1H6FA 3SDCC 4I18B 1VFBB 2F54B 3I6SA 4Q6YA 4ODTH 2YD7A 2CK0L 2K7QA 2OL3L 1NGYB 2CGRH 2XN9D 3FS9A 1FV1B 2V2XB 1RPUA 1LE5B 4XTRD 3RVUC 5B39B 3VXQA 2X4PB 2H9GA 2J8UB 5DVNA 3MRNA 3DIVA 1M9WA 4HIJA 1U8KB 3D2UD 1PJWA 4KHTH 1N64L 3FHAA 2J1KA 3PL6C 4D3CH 1QPPA 4MD4A 3VW3L 1YEKL 1EQWA 3T3MF 1AKJB 1EJ6A 1NDTA 4R6UA 2MQGA 4ZPTA 5H35A 4PGEA 1H5BB 2ZUWA 3MLVL 3FYEB 4YGVA 5H37G 1L0XA 2DQDH 5IHBA 4TVPD 5JHDB 4FN0A 2WM0A 4HUVA 5EO0A 4WEBH 5F1NB 4AJYV 1A6PA 1FJ1A 5L8KB 3Q2NA 2TAAA 5E1AA 3EXLA 3ABMB 4F1SA 1T03L 1R0AH 1FF5A 4W93A 1KTJA 5DGRA 4NQEB 5HHNB 2DQCL 3OZ9H 4PRPA 3APDA 1XF2A 1M2VA 4LSSH 3O3EB 4RRPA 1JGVH 1WCBB 3RAJL 4J3SA 2Q2LA 3FUHA 5I6NA 1TTBA 5DJZA 2WLZA 2VXTH 1NCUA 1ODUA 5CP7A 4HS8H 4YHZH 5SX5K 1AG0A 1F45A 4LSTH 3SDXA 3WNJA 2DKMA 2WNXA 3R1GL 2X10A 4AEEA 1EBAA 7FABL 4H88L 2FQEA 1XGPB 3BFQG 4YDNA 3DO3A 4QGTA 1QR1B 4AL8C 4P2YA 4IOSD 1MG2C 1QSZA 3OXSB 4JB9L 4EZLA 3ROLA 4ZQTA 4K9EH 2YSTA 4P2QA 4UOJA 2P8MA 5I18H 5I6XB 1XQ4A 2XYCA 3U48A 5KVFE 3NCCB 4XO4A 5KSAA 2RCSH 3ZQWA 1QBBA 3GTTA 3LN5B 5E00B 5IBTH 3MV7B 4WNSA 3ZMRA 3QQNA 4DQOL 4J28A 4OGAD 4PR5B 2GSIA 4LU5H 5LQBL 3O6FC 3ULUD 1S5HB 3U7WL 3JWDL 6FABL 3HPJA 1RVFL 4M4PA 4XZUB 1AC6A 3QEHA 5FO7A 3RWEB 4B9YA 2V9QA 3IDMB 3O2VL 4ZUWA 1D3CA 4YHOL 1PZBA 1UEYA 4KKAD 1ZLUH 2FECL 4GW5B 4PRPE 4BFBD 4HPHA 3PWLB 4JDZB 2J2ZA 5E1QA 4N85A 1JZFA 3CDYA 4TVUA 3IJEB 4YWGL 1PDKB 1MREL 3QC5X 2DBJA 2HPTA 3AROA 4B0MM 1LWHA 4DZ8A 2V5RA 1IC5L 3ZE0E 5IR1A 1B0RA 3SDXE 1A7NL 4TTGA 2A6IA 3BUDA 4ZQKA 1QAWA 5KVGH 3FFCD 3ZTJG 4D0CA 5CZVH 3CXDH 4H1LG 2A7BA 2UXFA 2OJEB 3EF4A 4L1TA 4P2QE 1F42A 2VAJA 3NCYS 5GGSB 1IO4C 2AK1H 2R2BB 4OGZA 5HYQA 1A4AA 2QR0B 1UA6H 4AYFB 5E6RB 3DX9A 3ZKMC 1J1OH 3R18A 1EFXA 4N2MA 4OJEH 4Z77B 4B41A 2IIJA 4JL1A 4XNDA 1G6VK 3ZKSD 3KW7A 2YPLB 4XWOC 3A6OA 2EH8L 1CLOH 1NGQL 2MQ0A 4ZXBA 4IRSA 1RZQA 5CSZA 4XMTA 4FFWC 3KBHE 1JZ7A 1JPSH 4PB9H 3ROOB 1KSRA 3X1EA 4HUXA 1G7QB 2CRIA 4OI8A 1QP1A 3QEUB 3RVXD 1TR7A 1OGPA 4IHBA 4OAWA 1RZPA 1JWMA 4PLKC 4KK9C 5JR1H 1KXHA 1I82A 2WBXA 2OMXA 2QKSA 2HT3C 4JFZH 3QHFH 4GKSA 5DUMH 4YXLH 4KITB 1A9EB 5AVXB 3FN0L 2OM5A 3IFNL 1XHHA 3D2UB 3QJUB 2UVFA 1E28B 1I1AA 2BX5A 1FZMA 2YEZB 4UQ9A 4YHLH 1RZGA 5DA4A 4PJAF 2DQGH 5ILTL 3R7RA 1P5UA 3HS0C 1E50A 2YRZA 4UOW0 3OC8A 4HS6A 2NXYC 2DWDB 5D1XC 2BNRB 2KDGA 4OF0A 4YE0A 4UNVA 1Q38A 1YAZA 3IWVA 4DGYH 4F7TA 4BZ2A 3KBPA 4GIPD 3K72B 1WFMA 1U93A 4WNJA 3OKEB 2BNQA 2MFNA 3PXHA 4ZUTB 4AQEB 1IGYA 4NC1C 3PE9A 4QRFA 5IGXH 3VUAA 5I2IA 3QO1B 4YR6B 3IXAB 4U6HA 1LILA 2WAHA 4F15C 1YEJL 5E70A 4CJ1A 1G94A 1PNDA 1TZOA 3TJHC 5FR3A 3EHBD 5AOJA 3TIDA 4E9QA 4O2EB 3VVWA 4N8VA 2GSGA 3SQBA