3V10A

Crystal structure of the collagen binding domain of erysipelothrix rhusiopathiae surface protein rspb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
318
structure length
310
Chain Sequence
b'AKDYTNEAIFTQFDVNPKGLINNPSQPIEFNLAFSDMNNGQKVKFKPGDFFDLTLPSNDEVSLRSLRAMGSKMPVLAKKEITLGELTFNGSHIHFEFMEDVLQLENVTGTINLKSVYDNAYRGEDDKIAELPTNLGLGSLDKQMITISQPGTPTSPIFYWKTGTFSTEVHGDMNWWLNINSPKEAVQSDVKVIDTIGEGHKLVDGSIMVDVEANGELKHISAEAFNKEYGTITVEGQVLTVMIPKEKAAKTTFTVTYDTRAFDKKLENYKNSSTIEYKDESGNLVTDTPKHYTDTSVVNMFDDATIGGEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhusiopathiae surface protein B
molecule tags Cell adhesion
source organism Erysipelothrix rhusiopathiae
publication title Collagen adhesin-nanoparticle interaction impairs adhesin's ligand binding mechanism
pubmed doi rcsb
total genus 67
structure length 310
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A01
4IGBC 3RKPA 4IGBD 2YLHA 1R19A 4F24A 3HTLX 2Y7NA 3UXFA 2X9XA 4MBRA 4JDZA 3AU0A 4JDZB 2Z1PA 4UZGA 4HSQA 4LE8A 3IS1X 4IGBB 4P0DA 5CF3A 4Z23A 5DZAA 4LEBA 3AT0A 3IRZA 1AMXA 2VR3A 2F6AA 4F1ZA 3KPTA 3QDHA 2X9ZA 4Z1PA 2Y1VA 2Y7MA 2XTLA 4B60A 4JE0A 2RALA 3HR6A 1R17A 4IGBA 2WQSA 3IS0X 4B5ZA 4OFQA 2X9WA 3ASWA 3OPUA 3IRPX 2F68X 4LEEA 5CFAA 3V10A 2X9YA 4F27A 3RPKA 3PF2A 2Y7LA 3PG2A 4MBOA 2WZAA 4F20A 2Y7OA 5IHWA 1N67A 2WOYA 3QE5A 5DZ9A 2OKMA
chains in the Genus database with same CATH superfamily
3CZLA 1MN4A 4LPXA 1FPTL 1MFDL 3M7FB 3UTOA 3US1A 1A25A 4JVUA 1WHOA 1SY6H 4GKLA 4H7VA 2PO6A 1I1YB 3ILQC 2AAAA 1H8NA 4XXCA 3R18A 5TF1H 3T6VA 1V54B 2DTSA 3FNKA 3UTPE 4HDIA 1YPZA 5C0BB 1PLAA 3NA9L 3OTTA 5F8RC 1Z5HA 3PWVB 4C83B 1ZGLA 1KTDA 4R3SB 4Y5VC 2DWXA 1FNSH 1T89C 4X7EC 3MA7A 4YDIH 3QRGH 4E41B 3N43F 1G9NC 3BAKA 4PMFA 3S88H 3B2DC 3HMXH 1HHGA 5JIDA 2Z8VC 4A7SA 4FQPA 1GR7A 2Y06L 3SDDA 3RP1A 3WEMA 4RRPG 2WYIA 3BP6A 3CDFA 2YD3A 1S7XA 2CR6A 1A6WL 2GUYA 3GO1L 1N8OE 2LGNA 2ATPA 3GRWA 2LAGB 3S7GA 4Y7OC 5AAWA 4JFHE 2E6JA 3FFCB 4K94C 4HUWA 5CEYB 1PVHA 3H0TB 5FO9B 2EEBA 3NSCA 4HUMB 1DJHA 1HINH 4JRYA 5I1CL 1A1NB 2ZWZA 1REIA 1XIWB 2WSPA 1PLCA 1M4KA 2W9EH 4KY1H 4UAHA 3T77A 3LKRA 1E9QB 4GI6A 4KAQL 2EVIA 2WXOA 4P06A 4NOBA 3ZE0F 3QH3B 3IDIB 4K71B 4ZTPL 4DP2X 4HGMA 1BPVA 4ONHB 2Y7SA 3V0EA 3UAJC 3UZVA 4OI8A 2BK8A 2Z8SA 3SE3A 3VXUA 3QNXB 1KCLA 2WBXA 4JR9L 2HP4A 5CU9A 5K9OB 3R0MA 3PHOA 4K3EH 2A83A 3DJ9A 3BKYH 1ACYH 4IEFB 3QA3A 1UWGL 1HVXA 3BSGA 3N85H 3O2VH 1NMBH 4PCTA 4HULB 3SPHA 1PJWA 1FVCB 3BGFB 4UUJB 2AEPH 4QHMB 4XMZA 1J5OH 5SX5K 4QRSB 3S5LG 2A1WH 3KLDA 1JN6A 3KPSE 2PTVA 2FO1A 5BQDA 1BEXA 3VI3F 2C5DC 3QRBA 4MZRA 1KYOK 1K8IA 3HRZB 4QRBA 4FLRA 5ES4B 3UJTH 3GHBL 4U1LA 1IL1A 3S3PA 2BVPA 4G8GA 4R5TA 5E0QA 3HE6A 3FQ4A 1KBBA 2ZAIA 1Q1JL 4FA8A 3GKZA 3M45A 2NNAB 4W1TA 3OL2A 4RBPK 5E9NA 1YQVH 2ESVD 2Y2WA 5D7IF 4MA3B 3D87B 5IVZA 4FABH 2EXSA 4XMLH 1HIML 3C60C 4E9LA 4NQCB 4N2CA 1RJYA 3QJFB 5I6KA 4JDEB 4UT9H 4WW2C 2VL5B 3WIFA 3WGUB 4AM0A 4NJAL 1KXTB 2R29H 1KYFA 3S35L 1OTSD 4OFDA 3K46A 3HN3A 4ZO7A 2CKBA 3O9WC 3DSNA 1XVSA 3WTXA 4KRPB 5IW1B 3RA7L 4I3RH 4BK4A 1M7IA 2NY2C 4TQEL 3MO1A 2F7RA 3MTXA 1F56A 5DHMC 1I9IL 2X1OA 2R2HB 3A24A 3RPIA 1WO2A 3UMTA 2QQLL 3GTNA 4FP8L 1QRNB 1NLBH 1NSNH 2CHZA 2O1AA 3TEWA 5A2CA 4U3XA 4CU7A 3OMIB 4MD4A 4UB0H 4WHCA 1TNNA 3Q2WA 3QIBD 1KLUA 1W0VB 1P4IH 2ED9A 1ACCA 2ESVA 1T0NA 1CXHA 4YDVB 1BFOB 2AABL 5DS1A 1CURA 4C56E 1QO3B 1YEHH 4N2LA 1CLCA 4HIIA 5DZPA 4QHUA 4G70B 4HIEA 3W9DA 1T3FA 4HCIA 2E9BA 4L9LB 1NL0H 5ICXB 4KHTL 1ZHNA 5IB1A 4RZKA 1DBAH 4NRZA 2WLKA 4AENA 4P3WA 3H7BB 1NGPH 1MY7A 3AY4A 4HIHA 1QFUH 5AW7B 4AIZA 2Y5TB 2B5IC 5HHPB 3BAYA 2OMNA 3PWPE 3UXFA 1DDTA 1QYGL 1U8IB 3E2HB 4JB9H 5F0PB 1I85C 4HWEL 4MJID 4B50A 4BSVB 3QYMA 1BJ8A 1T22A 1XL4A 4PB0L 3WTSA 1SEQH 1OK8A 4P3CL 1CYXA 1FZMA 5CBEB 4L3AA 3ZTEA 2PNDA 4NUJA 1ZSDA 4X9IA 5CCKL 1NIAA 1JP5A 3MRQA 4PWKA 1MPAH 1JD9A 5E8DH 5FHAL 1E6JL 4PJ9B 4F8OA 5BO0D 5FW6A 4O5LL 3GF8A 1B0GB 5F1NA 4R83A 5D70L 1WA0X 2JB5L 3MNDA 4OZFH 4JZJC 3AM8A 1JTOA 2NDFA 3CFJB 1R47A 3U2SA 4JFDB 8CGTA 2MQCA 3BGFC 4QRRD 4FI8A 1KBGH 1F58L 2V6HA 1KJVB 1KBVA 1QKZL 4FXGA 5ELIA 1MLCA 2BWDA 4X8GA 3DPDA 4QPEA 3MUGA 1PIFA 2X3CA 3CPLB 3HCVB 4OGZA 5A43C 1LEGB 5L6YH 2ZUQB 4I18A 5D2LA 1D5MA 2X0WA 3CE1A 3U4EA 2QGBA 2YUXA 5E2VH 1QFPA 1AGBA 1E28A 1PEZA 3G5XA 3ENEA 3ARRA 5I76A 1E6OH 1QD0A 5C0BA 4CVXA 4RGMC 4OJDH 3MRMA 1LO2H 3HLKA 1RZPA 1MZYA 2Y2TA 4Y5YC 3EZJB 2A6IA 2XX0A 3NSYA 5D1QD 3WEAA 5DEFB 2K8MA 3SDAA 2YQGA 4DCQB 3QIWD 1BM3H 1THCA 2VLRA 1CD0A 2K9FB 2J1XA 2W0KA 1RZ7H 2CHXA 3OWEA 5FLUA 2B9BA 1P2CB 2MIZA 2CALA 5DMKA 5GS1B 3LNGA 3M8OH 3DV6B 4S10A 3ZDYB 4JGNA 4KI5D 4XN1A 5DI8B 1JZ7A 2JJTC 4N2MA 2WB1A 3OG4B 2EVFA 5E4IA 2ZUWA 4X7DC 4ZUTA 3QZLA 1YMHA 3CFUA 4QAWA 2QPDB 2R23A 2R1YA 1XHHA 2J72A 3BW9B 3WIIL 4HC1L 3AQYA 3LKQA 4I9WE 4YSTA 3TNMA 4R8WL 1KCUL 3VFSA 3CWGA 1KJ2A 4JRXB 1DBAL 3N42B 5FIEA 5FPIA 4JRXA 3G9VA 2Y9RT 2OYKA 1NMBL 1QFWH 4WW2A 1WITA 4WEMB 2AQ3A 1D5RA 4WHYG 3DVNA 2D73A 2PPCA 1IV8A 4LOFA 3EGXB 1G1KA 4H25B 4DGIL 4NC2B 1WAAF 4M7ZC 4XHJC 2AJSL 2HRPH 2P46B 1JK9B 5FV1L 5DD0H 4LB8A 1NOLA 1B3JA 1UA6H 3JWDH 4HJ1A 4M6OH 1EZVY 3KXFA 4Z76B 2NDGA 3OSKA 3R7RA 3IU3A 4GXUN 5GGRA 1JV2A 2DD8H 5J3HC 4IDJH 3DMMA 4MKMA 3RY6C 4FL4C 5IFJA 2OYPA 3GSQB 3VXMA 4FFYA 1FYHB 4OCXL 4PW3A 3QHFH 1ID5I 4RBPH 3QUXB 4EUPG 4MA8L 5EU6E 4NJAH 2BJMH 2VSCA 4ZUSA 5BQ7B 3WTUA 1GGIH 2WBWB 3L13A 3BXNB 3BVXA 2NT1A 3PHQB 3S8GB 4NQVB 2NY4D 1QKZH 2DWDA 5AVXB 3DYOA 2FR4A 4YZFE 4QRRB 4C59B 1KV3A 2CSPA 1R6VA 2L0DA 2O30A 1RL1A 3O9WA 5BUPA 3LPWA 3FT2A 3SYOA 2GABA 1MEXH 2W60A 3PDOB 1CF8H 3ZDXF 3WJLC 2LHAA 1NLDL 1VHPA 4MMXB 3AT0A 3EOTL 1EEYB 1JNLH 3P3TA 2PO6D 4MDJB 4DQOL 3FB6A 1MWAH 1CWVA 1BLIA 1L0PA 2N56A 3P4LA 5TQ0H 2ED8A 1FSKC 1NCCL 1I8IA 5I1DB 5I0YA 5E5LA 1GCYA 1INDL 1OF2A 1DVFC 1UENA 1UWFA 2GITB 3C2AH 3NQKA 2CXKA 1OHQA 2Z31C 2QFPA 4BELD 3S48A 3D3VB 1KENL 4QRTB 1NM9A 3JWOC 3R0NA 5IOPB 4IW4C 1FIGH 2H45A 5C9JB 3SDDB 5L4IA 4V11A 3E3QE 2AXFB 2HVJA 1IAKB 4JZJA 4F58H 4Q0XL 2ICCA 5CLXA 3GJEA 2MCMA 4GOSA 4IHOB 2LR4A 5T5NG 1DL7H 1QFWI 2QBWA 3O6FB 4HK3J 4QHPA 5CR8A 1HI6B 1ADQA 3O3BA 4XX5A 5JPMA 2HJLA 4HS8L 2Z6FA 2OK0H 4IOFC 5J12C 5ITBL 3L1GA 3DRQB 3PXHA 4WI9A 1DVUA 4M5YL 1MUJB 3S3BB 1DQDH 2B0SL 2B20A 4AW7A 3MLUL 5INDA 5J6HB 1KLGA 3O45B 2B3RA 4M43L 1WAPA 4BQBA 3VJ6B 5ERWB 1U3HB 1DJYA 1PYWB 4I3SL 4TULL 1T5WA 5MEPB 2FLRT 1EX0A 1YEIH 2XZCL 2NY4B 2OMXA 2YEQA 1JI1A 4MRBA 4X6EA 3QJTB 4LSVH 2AJYH 3TEYA 1TTUA 2J6EH 4UNIA 2BVOA 4YXHH 4NQQA 4EXPX 1DBJL 4X6DB 1AGCA 3H4HA 1MWAB 4FTVE 1FZOB 4ORZC 15C8L 3V5KB 2EDXA 2PCFB 2YRZA 3SGEH 5I73B 4RNRA 4XT1C 3FQXA 3QA3B 1UA6L 3O8XC 4ZMXA 4RA3A 5L4JA 1DO5A 1SHMA 4H8WC 5C0IB 1DFBH 1J12A 2WIIB 2W9LA 2GJ6D 1X9RA 3EYFB 4A2FA 4WK4B 4AGLA 4PJAE 5D7LD 3MR9A 2D7MA 3APDA 3QAZC 1E5YA 1H5BC 5BOJA 5DJ0B 3U9WA 2EDYA 4G3YL 3RPBA 1BFTA 4Y1AD 1FRGH 3QJVB 1WC7B 2P44B 2VE6B 3QEGL 3T0ED 4ZZKA 1BQLH 32C2B 1KGWA 3N1QC 2IOOA 1BZ8A 4C54A 3OLIA 1UZ8A 3V0HA 1IVLA 4BE6A 2AI0L 3CDYA 2PTUA 1NAMB 1W72H 1MHHB 3QWOA 3G6DL 4R7DB 3VGAC 1ES0A 4J6RL 1X7SA 4ELMA 4NO0A 4OZ4A 4GAYA 2XICA 3SBWA 3NJVA 2YC1A 5D4QA 3PJNA 4AITA 3G7TA 5BUAA 2XQYG 4EBQL 3L5XL 3B37A 4XB8A 1KDIA 2JXMB 3KGUA 2FLBT 4R7VA 1M7DA 2QHRL 1FF5A 4H1LA 2RGSA 4GRLD 5F44A 3CK0L 3MLXH 1RZIB 1IX2A 1MVUA 3BVNB 4PJ9D 2MCPH 1F5WA 3EO1A 1P1VA 4UT7L 4X7SL 5ABZA 3M88A 2VO8A 5F88A 4U1MB 1I4FA 1MAML 1P4LB 1PX4A 3BJ91 4DNLA 4K5OA 4IRJA 3MBEC 5ICXA 3V4PA 3H9HB 1AZNA 3SQBB 3V6BR 5GRUH 3MAWA 5FOBA 1SLVA 2ZSVB 5DD3H 3V52H 4DO5A 2P5WB 2FH6A 4PRPA 3NJIA 2DAVA 1N8ZB 1OE2A 5BS0E 3EO9L 4L37A 1JZGA 1AQDB 2OP4L 3Q1EA 1PKQB 3DO4A 1TSRA 3EGXA 3VH8A 1QEWB 3ZDZE 3WFHB 3NACH 5MI0B 5IM7B 4NC0B 3D09A 4H5SB 5DWUH 4PLKC 2E3VA 3IJ8A 5AW8B 1NA8A 3M07A 3KLSA 5F3BA 5B1KA 4NDMB 3NA9H 2XYBA 4BSJA 5C09A 1QLFB 3V7MA 1ID2A 2A6DB 2V2XA 4ZDHB 5HYQB 1EHLL 3FSAA 4JANB 3U7WL 3MCLH 1JZ4A 4YHML 2Y5QA 3P40A 4DKAA 2EDWA 3BVWA 1KCRH 3AC0A 4Z7WA 1CD9B 1IE4A 4U1HB 4RGOL 1KPRA 5F8QC 3ZDYE 4BZ1A 5I0XA 4RVBA 5HPMB 4G6AC 4PAZA 3P9LB 2GY7B 2ZP0T 4FAAB 3GNMH 3I6GA 3MLRL 4CU6A 4RMQA 4PR5B 4GBXA 1KFAL 5JYLA 3LPPA 5D1ZI 3V5HA 4AVKA 1PL3A 3GXTA 4ZUVA 1EEYA 2HG5B 3F01A 5FKAA 1CR9L 2ZYSA 5CAYB 2EP6A 2WO4A 4EZMA 4ODWB 4HCGA 4HJSA 4TQ8A 2A6IB 4QHMA 2EXWD 3IS1X 1OSZA 4W9JC 4H20L 3V4VH 5JHAA 1U91A 3CLFL 3KBEA 4HWNA 3ARBC 1HILA 3O41A 1B4LA 5EU4A 1L7IH 1ZV9A 3HJ0A 4AEIH 1MREH 2XYCA 3K6FA 5D7KE 1ZJBA 5ABDE 2FR4B 3EH1A 3QDGB 2IFFL 4HKZA 4WWNA 5FO8A 1HYSC 4E9SA 5CD3A 1BFVH 3ZYIA 2Z92A 3TPUB 2QFRA 5D1XC 2J6EL 2PCXA 4JR9H 1IGIL 4LPCA 3DETD 3VQ2C 5BV7L 1NLDH 3PV6B 4X8JB 1MCNA 1EXHA 4DQOH 4FULA 4YS4A 4I77L 4LRNH 2CQVA 3VSQA 4M3JA 3TA4D 3T3PF 3GMMA 1AZUA 1FFPA 4TN9A 2EO9A 1QSFD 4OF8A 3GKWH 3SGJA 3MLTB 5EEXA 1E5BA 3P9LA 2PXYA 5BS0A 1RIHH 1DQVA 1WFIA 4KNTA 1Q9OB 2QPFA 4LU5H 4BA0A 1QLRA 4DVBB 1HL9A 1HN1A 2B4CH 4KKLD 1O6TA 5T3XD 2G0KA 1DQML 1KUMA 2FWLB 4NENB 3LB6D 4JFOB 1CI5A 3FTZA 1SDYA 3FSZA 1N59B 5C7XH 4N28A 2LFGA 3GBEA 3DVGA 3CFDB 3TZVD 5L2KA 1U30A 2YMOA 2X4PA 4UILL 3FQRA 4ZFGL 1P5UC 5EU6D 4JK0D 1XSJA 3V10A 1NEZB 3ZZ1A 4F7TB 3F85A 3FU7A 3D3VA 3UYRH 1EGJA 2IALB 4ODUA 4F91B 4Q56A 4X5RA 1A6TB 1IRAY 2PYFA 5A1AA 1LWRA 2JNZA 2YD5A 1MCHA 5J6SA 1U93B 1S7WB 2RHEA 1FFNB 5AVZB 4CNIA 1DLFH 3SBWC 2H26A 4L1SA 2CNZA 1UATA 2DQHL 4WHDA 1IKNC 3E8UL 2YAHA 1EFXB 1FV1A 1T83C 2WYHA 4H88H 4EQ2A 3QEHA 5LBSH 4B95C 3UZQA 1L6XA 1C5BH 4H8UA 4YNYB 4HBQA 4ODSH 2VLRD 1M2VB 2R4SH 2W38A 1CT8B 1LDSA 3KPRA 4FFVD 4YLQT 2HTKC 3X3GH 1DUYB 2HVKB 5I15L 5C0FB 1WTLA 1SOQA 1NDMB 3LSOB 4QXUL 2WGNB 2UZYB 3UACA 4F7MA 2VDLB 1AO7A 2UZIH 1PZCA 2XDHA 4XP5L 4QTFA 3M46A 4GSDH 4CW1A 4X6BB 1C8PA 4X8XA 3V5KA 3KLHD 3JBG7 2VXQA 4HZLB 4WUKH 2N01B 4U3SA 4XCFH 1BQ5A 3RWFB 2HJKB 5TH2A 5IHUH 3V9CA 1S9VB 2K7QA 3GMQB 4W81A 4L1HA 1F45A 5KYUB 3CXHJ 1ZLWK 3WXWH 4LCYA 4GB9A 5MERA 4LOUC 4ZAKD 3MROA 4PGEA 4BA8A 3NIDE 5F9DC 2DS4A 1IZJA 2R1WA 5D2LF 3GBNL 5T33L 2E7LC 4MCYB 4JFEB 3UABA 5A2FA 1JFHA 5HHPA 1AOZA 2BERA 2CO3A 5AYUL 2Q6WA 2NW3B 4DN3L 5ENWB 1XSOA 1WG3A 3BZFB 1HSBB 4LKCB 4EZJA 4APQD 1KACB 1T22B 1XL6A 2PP8A 2AEQL 5F6IC 4MJ6A 4EI5D 3IGAA 3L3IB 1F3JA 4EBQH 4QF1B 2B1HL 2DLTA 2HKAA 5E56A 4HIJA 3NP3A 3OSVA 3VFNB 4HK0A 3CUPA 1ZT7A 2Z7WA 3T8VA 2OM5A 4PGBB 1NPUA 1BBJB 1KGXA 3TYGL 3FO0H 1RCYA 3MXVH 3KLKA 1SLUA 4I88A 1JGVH 4P9HH 1BEYL 5HYJA 1DEEB 1P6WA 4DGYL 1V7NL 4HZ1A 1B0RA 2UXGA 3FT0A 2QR0B 2EEDA 2X6VA 1Z0NA 4B9JA 2NRDA 4L4JA 1D5BA 5AW1B 5AKRA 2OTUB 3NVQA 1FGVL 3KM1A 4QY8B 1Q72L 1DVFD 1F13A 2YGPA 3LEXA 4ODTH 3U4EB 4I18B 5D2LB 3WN6A 3IAGC 1J9CT 5AAMA 4LVNB 5JNYA 4U1MA 3MRDB 4QXWA 5KVGH 5T1LB 3OKOB 4KAQH 4KO9A 1AKPA 3VB9A 2X41A 4XI5D 4YL4A 3RA7H 1I7ZA 1PDKB 4F15B 4UTBL 1G6VK 3VGEA 2HKHH 1SN2A 2GJZA 1ZCRA 3QJZA 3A3YB 3RGVC 1T66D 5EG6C 3FCBA 4UOW0 5EF1A 5DWPA 2UZIL 3LOWA 5SV3A 2X53A 5E5MB 2CKBH 4WTXA 4BKLB 2ORBH 5ALBL 5K1NA 2K6ZA 1HE7A 3V6OA 1UURA 1XH1A 2ZNXA 3FUIA 4TVPD 2OSWA 1JPST 3VFWB 3OQ3B 2XY1A 3TFKC 1K4DB 4U2YA 3D08A 1RUQL 3V0WL 2EQDA 1K4DA 1DVZA 4N9GA 3FUJA 5AYQA 1OLZA 5FYKH 4Z5RB 1XMEB 5HBBA 1CXFA 1WFOA 3OC5A 1DQJB 1A7QH 3M1BA 4TLUA 1DBML 2KL6A 3D9AH 2WCPA 5DJXA 3F5WA 1QYGH 4OJEH 3VB8A 1N0XH 3UEQA 5EEUA 4JDTL 2KQNA 1RZKH 3WU1A 3H56A 3VUAA 4HKBA 5PAZA 2AV7A 4MB5A 3TJPA 3FUFA 1U8NA 2WXJA 3DETC 3PWLA 4FMVA 3PL6C 3Q13A 1CG9B 1VEOA 1A1MB 1MRCH 3QR0A 5JLZB 3BLKA 1J10A 3MLSH 3IKCB 4U6VH 1FZKB 4OCSH 3DXAD 1WZ1H 1J0KA 3MFGB 2WMPA 1Q90A 4GKNA 3K2IA 3L3GB 4ODWA 4QYAA 4ZMOA 1GKOA 4TSBL 4LCIL 5C0GB 1J0YA 5KTEH 3UG4A 4TTDD 1CLYL 3TEXA 4P3DA 1PG7L 1P5VB 2P45B 3C8KB 4PJHA 4XBPB 5AKVA 5TGBB 1EXUA 3KH4A 2ZUTA 1OTTC 4Y19E 3WELA 2V3FA 5D1XB 3QVAA 3LH8A 1Q9LA 4QRFA 5E6ZA 4OKDA 3DJRA 1Y18A 1EJOL 3BQUB 5H94A 3MGTB 1D5IL 4YOKA 3EDEA 3LTVA 3NAAL 1NBVL 4MTMA 5I0WA 2O5XL 3T3PB 3BEVB 1RIHL 1J1OL 3JSSA 4LU5L 5AVUB 3N2JA 4FG4A 3GXUB 3NCXA 4JFFE 3ZXAC 3O4OC 4PLNC 4XNMA 4L0ZA 3KEHA 3WIFB 1TJXA 2DQDH 3WN5B 5KEZA 1T5XB 1YVLA 2APTA 2EXWC 2W91A 3FOLB 3TN0C 1XB6A 3SODB 2WXLA 1PSKL 3ZX1A 2OR9L 1HESA 1RZ8A 2FJGB 3MV11 2Q86B 3MCYA 2QSCH 1OP5K 5AW0B 3RVUC 1T7XA 5DURB 4IGBA 2EIEA 2XETA 4X5WB 5B1JC 4DETA 3OLDA 5HJGA 4HGKC 2XRAL 3S8WA 3NP4A 1MJ8H 4BQ6A 5EEWA 1G7PB 3MRJA 1CXIA 2Z35A 1JVLA 1W91A 2A83B 3AAZB 3VI3E 2QHRH 1KGCE 2HX9A 3QRGL 4X6FA 1CTNA 5EZLB 3EBIA 1BG1A 3K0YA 3GUTA 5IJKA 1XH2A 3MREB 3GS7A 5D7JB 4AV0A 2K4AA 4JG5A 3D39A 3MUZ1 3ARGD 3L7EB 5F96H 1J87A 3HR6A 4OLXH 1BZEA 1YYML 3IS0X 3MYJB 4NRZB 5DHXB 3SDXB 1U42A 1YEGH 3WYRA 2XT1B 1NDMA 2P5EE 1BZ9A 2PLTA 3DGGB 3MOBH 3QO0A 4G5ZL 5D5MF 2JJUA 1CPUA 1TJHL 2NLJB 3A6CL 3L3KA 3L3OB 4KTGA 4DW2L 1AIFA 4BCXA 3ARXA 1QBAA 3DROB 2NYZA 4X7TB 3UTPD 4GRWH 3UBXA 3VI4B 5EEZA 1FRGL 3FTVA 2YK1L 2DLIA 2JQAA 3UZQB 4QI3A 5J56B 2WAHA 1O5PA 4B0MB 3ESVF 4JO3H 1GPOH 4M03A 3QDJB 5CKAA 4PRHB 2PPEA 2L7JA 4Z8FH 4M3KB 5C8JB 3WMQA 2BW5A 3R06A 1X5LA 2AAVA 3D5OF 4JY6A 2VDQL 4QXGL 3D51A 3ESMA 4ODUB 1X5JA 3TYFA 5DVKA 1FL6B 4XP1H 4ZMNA 4XBGB 1I8KB 3QG6A 5LHDA 1IARB 2XWJB 3O6FA 4POYA 3FQ2A 2YAQA 3DTUB 5JZ7C 3Q8AA 4LVHB 4MA3A 3VH8B 1TQVA 2G3XA 2EDFA 4Z18A 3T0EB 5IVNA 4U1SB 3D4GA 3FUDA 5BVPH 3RWIA 3U4BL 4F9PC 2MCPL 2UYLA 5FM5M 5ITFA 2AXJA 5AZUA 1AAJA 1CXKA 1L5GB 4TNVK 5C08B 1L9SA 2V3DA 3LX9A 1SJHB 3O3AB 3OHXC 4PRID 2VDPH 1Z9SA 4TF4A 2DLFL 1F6AA 3D33A 4DCQA 5CWSB 1D7BA 1MH5B 3UYPA 4ZMYA 5FECA 2ZCZA 4GG6B 1MH5A 3N0PB 3UTSE 3ESOA 3C6SA 1UUNA 1HNFA 1ZWIB 3GMRA 1DEEA 1ETA1 4Y2DB 4D0BB 2VMCA 5GZNC 4GW4B 3TCLB 2OXGA 2OK0L 3EBGA 4JO8A 4PBWD 2J1KA 1K6QL 1P9MC 1YPZE 3QZWA 5HP5A 4BKTC 1E3FA 2J8UB 3HCVA 3QZWG 4U3CA 3SY0A 4B9IA 5KVFL 3NK3A 3LN5B 3WFZA 2OMTB 3ATBA 1KB5L 1ORQB 2AQSA 4HIQA 5EC2B 3PQYA 3CFCH 1AY1L 1R3IH 3RU8H 2B08A 4L4VE 3MV8D 1TSHA 5JHLA 3GB7A 1BAFL 2GIYA 4GLRH 4ATWA 3CHXA 1RH8A 5CUSL 3ZJAA 5D7IA 2JI2A 2HMID 3DI3B 4FHJA 4QRAA 4U2ZA 4XRCB 3S34H 3MRIA 4AKPA 3ZE1F 1VRSA 3L5IA 1JNLL 3AXHA 3FK3A 1T1ZB 4LSTL 4BCZA 5DMGD 4L2LA 3FU0A 3OKDA 1EGJL 1NM4A 1FFQA 1RPKA 2MNJB 2WNXA 3ULVD 4PJBB 3UO1H 2VZUA 2XXFA 4JLRB 4AL8L 3H9SD 4HS3B 1UT2A 5AOMA 5HY9A 4JY5L 4PRBB 1E9PB 1S5HB 2VM3A 2GUOA 3EFOA 3BT0A 3FONA 2X05A 4UTCA 5CLWA 2FWOB 4JFQB 2JLLA 4N24A 1AKJA 4WFED 1DJIA 5DJ6B 1XD0A 5C09B 4R2GD 5HYQA 4I8DA 3F6JA 1TENA 2W8CA 4P5SA 2RIKA 5F9WB 1MCRA 1AMYA 1OQXA 3NIFB 1J0HA 3D07A 3WMPA 3TVMA 2DN7A 5EC1B 1L4IA 1FNGB 3C5SB 3EG9A 3EHBB 1B0IA 3IDIA 2OTUA 2PXYB 4JN1H 3TXAA 5BS0B 2DEXX 4JGUA 4EOWL 2RFXA 5DQJA 1IGJB 3DX8A 3EUUA 1L9RA 2XKSA 3MLUH 2Y1YA 3BFOA 1FWXA 4OFVA 5EULV 5FFGA 1QNIA 5SWZD 3TF7C 3V0AC 4Y4KA 3Q8FA 3JV4B 1UH4A 4GAJH 3FN0L 2KLRA 4OQ1A 3MBXH 1OE3A 1UYWH 3KVDD 4RQQA 1K5NB 4MCNA 5KVGE 4XCYB 4YSPA 3D39E 4RLDA 2ZOOA 2ARJB 4F57H 1X5GA 1TOXA 5KVEL 1FVDB 2ZQKA 4ICWA 4Z3JA 5K93A 1EIBA 1FO0H 1KIRA 1ZLDA 5KW9H 2CDGA 3WDJA 2EDKA 3KYNA 2WP3T 1QABA 4JPIA 1SVCP 5HDBB 4X5LA 5I6PA 4YDJA 1WD9A 5JIHA 1RZJH 1EFXD 3AMKA 3QJHB 3TVMD 2HG0A 3QZOA 4GIPD 2JELH 5FGCB 3BZEB 2A9BA 1JPGB 5HD8C 2H6PB 3CHOA 3NZ8A 4TUKH 5FFOA 2VLKB 4XMKH 3VXOA 3X1NA 2TAAA 2Y23A 4Y5XB 1D5XB 4Q9BA 1E4XI 2GPZA 3NT0A 2DYPD 2VO5A 3ECBA 4HT1H 4J3BA 1B3IA 4NQCE 4UDTB 1KEMH 3A5VA 4KKZA 4PJ5B 1BMZA 3T0XA 3RTQA 1RZ7L 1P7KA 1VGEL 1Z5YD 3FTSA 4GS7C 1FJ1A 4WI8A 5JW4N 2ZWKA 2E76C 2MQGA 4PH8A 4JG0H 1QVOB 3RHWF 1OAKL 2DQDL 5TTRA 4AJVA 3FQYA 4XGZB 1GYCA 1TCMA 1JTPA 1FFPB 3ALPA 5GZOC 4WSKA 2XTJD 3QXTA 5T33H 3T3PE 1WWCA 3AT8A 5TQ0L 3ZKXC 4F1SA 3L3OA 2ZCKL 3ZYJA 3K2MC 3Q1SH 2ERJB 3WNKA 1A6VL 2AJUL 6PAZA 5IJVB 1OB1A 4KK5D 3VO0A 4D0DA 4CVZB 1R0AL 1RUPL 3MBED 4XE5B 1WEJL 1M9WA 4QR7A 1DZ0A 1ITCA 2GCYB 3NCFB 4PRHD 4JKLA 4TTDC 2W9DL 3H9YA 1G1YA 1J0ZA 5JPNB 3FO9B 5AOJA 4F5CA 1YUHA 2IMMA 4N2IA 3EYFA 3EGSB 2M26A 5MHSD 3BD4A 2NQ3A 2QVFB 2FLMA 4M6AA 4V1DE 4Z7OB 1SBSL 2VDLL 2VAJA 4K3DH 4LASH 2Q8AH 3T0AA 3IRZA 1F00I 1WFMA 4XP4L 3SCMB 4WGVB 1M7UA 3SPGA 1BDYA 3QZMA 3W11D 3MPCA 1GGCH 1WAEA 2EXYD 5AW6B 2XPYA 1QI3A 1YMMB 1AACA 1MAJA 4P2QB 3VWKB 3K72A 4Q7DA 5AZEL 2FHBA 2VXVH 3RWEB 4YGVB 3U46A 5JXEC 3SPIA 1BZDA 2G4GA 4N8PA 3WDHA 3RGVD 4KVPA 2MH4A 2HX8A 2N4IA 1T66C 1E4WL 2P49B 1Q72H 4RMSA 3LMJH 4Q6KA 3WY2A 4LLYA 3DRTA 4M5ZL 4XHJD 4Y16B 2HFEB 4ZUUA 3GYRA 1XWVA 4I2XE 3QJUB 1WE5A 1LILA 2IADA 2ZXEB 4FXKB 1LTXA 4P57B 4UQ3B 4J39A 5IUSA 3EYVB 3NDZE 4UQCA 3KYOB 1EUTA 5BRPA 2BW4A 2X9YA 1JXFA 1F1AA 2HH0L 4JFFD 3WY3A 1NKRA 2IBZY 4LAQL 4XPFH 2FIKB 1MRFH 4KMQA 3D05A 1WFJA 4DN3H 3BDXA 2EDJA 1T20B 5ID1A 4TUJB 2I9LB 1O75A 3QUMB 5HHNB 4DZBA 5T3ZE 1YN6A 2UWEE 2QSTA 1C5CH 3C2AL 3FRUA 2GG1A 4XWOD 1OGAD 2XCMC 4JQIL 1QBBA 3FT9A 3MUJA 1UJ3A 4HIEB 4L0YA 1YPZB 4OZFB 4R7DA 3TBWB 1VADB 1ET8A 2F58L 2B59A 5DJAB 1U21A 3WG7B 2EACA 4R4FL 3L81A 2VAAB 4NUMA 1TPXC 3RZWA 1IM9D 4BZ2H 5D93B 3LD8B 1S9XB 3B7YA 1FVEB 1U41A 2PYEE 4XOEA 3ZE2B 2QQNH 4KTYA 5GHWL 4N25A 4CSZA 4DGYH 5KBKA 4TNWF 2IH1B 4RMWA 2UVFA 4JPQA 4LL9A 2IGLA 1XZ0B 4A6YL 1GTNA 4PRPE 1NKGA 1WD8A 1AQKH 5H37A 1N9PA 5E8PB 1CLZL 3EO1B 1GOGA 3QIBB 3L5XH 4JFXB 4ZXBB 4EOWH 3U2IA 2GI7A 2X89D 4XXWC 4YHIA 2AS5M 3NQIA 4WFGD 5FUZH 3O81A 4KC3B 2V9RA 3BLPX 3T3ME 5HHOB 1D9KD 2BCKB 1E4HA 1NCGA 4F92B 1FYTB 1YEDA 2WN3A 3HMXA 5GS0C 4JUSA 3EW3B 2UXTA 2CJUL 4Q2ZB 3IJEB 5IKCB 2DQHH 2JIXD 2VRAA 4ZNEE 4X83A 2XOTA 5IK3A 3NIFF 5CEXB 1NFDA 8FABB 1I7UB 2WXFA 1R46A 1VENA 4OIFA 4WK2B 4XP6H 4FG0A 3RVTC 3CFKA 2HCZX 2GB2A 2Z34A 2VIRB 4TVPE 2D0GA 3RRQA 1RAMA 4L3ED 4PIBA 4FABL 4LLWA 4K9EC 5I6OA 2E46A 5AB2A 1JK9A 5CJOH 1XB3A 5LGJA 5LBVA 2ZSWA 3SYCA 3NA4A 4EN3D 3S37L 7PAZA 1XGPA 3JWNG 4ES9A 4JM2A 3IMUA 2P24B 1N0LA 2V8LA 4P5RA 1FFOB 4M02A 2ZJSL 2QDWA 1NUFA 5D71L 2XJKA 4GSDL 3CVDA 4S1DC 1JVKA 4YDMA 1G7HB 5I1AA 4G6MH 1KJ3H 3SSGA 5D1XA 3KCPA 3AG2B 2QSCL 1PKQA 4JFYA 5F89B 3K6SB 2HLEB 4JG0L 3BP7B 2E47A 1NSNL 4TVPH 1HQRA 1I1YA 1OAYH 4YSRA 5C0AE 2XJLA 3FFCE 3QORA 3RE0A 3G9AB 1YMHB 4YWGH 5HGGS 5D93C 4UNVA 2WW8A 3DV4A 5DK2A 1Z3GH 2C7FA 4N1EA 4A55A 5AD0A 4N8VA 4TNWK 1QG3A 2XQBH 4G6FD 3S36L 2J8UF 2VXQH 5EZJB 1J18A 4RFEB 1X4XA 2V9QA 3ATAA 1C16A 3E7JA 3NJHA 3OAUH 1DLFL 1UXWA 5HDBF 2Q86A 3GSOB 4BZ2L 3C5JB 1EA9C 2BSBA 3G5ZB 1IC0A 1NC4A 1E27A 1TTBA 5IBUG 5KYYA 4QXTA 5ETUB 4HKBB 1MF2H 2VDMB 5LBSL 3ZMNA 1YQ2A 5JHLL 4P2RB 4EE2A 4YO0A 1LQBC 4LXFA 1E28B 5KJ7E 4JFOA 1ASQA 1U3ZA 4N2EA 4MAUL 4PJGB 2LABA 4P59H 1I9RL 4PQXA 1YNKL 2YK1H 2VTFA 2XX1A 4AX3A 3C08L 3S3DB 1EJFA 3NK4A 5EDSA 5JXEA 5KS9B 3VFVB 2X4RA 4CC4A 3S2CA 5I74C 2I25N 1U92A 5L2KE 2OQJA 3GXFA 2CDEA 3IDMB 4OW6A 2V17H 3SDAD 1CC3A 1IL1B 1TQWA 3KPSB 3DDFA 3FOMA 3QO0B 2BNUB 5FB8A 4GKSB 5JMRA 4J3OF 3P30L 4BE5A 4M1CC 2JMRA 2GK2A 3DOIA 2WNKA 1PZ5B 4UOJA 5IVOA 1FAIL 4PVLA 3ECBB 1XCTB 4UDTA 3V0GA 2EDQA 1XF3A 1YEHL 5TE4L 5T3XE 4UQ2B 3B3BA 3GKWL 3HAEA 4PRIA 4ZBJA 2X70B 4OUOA 4TL5A 2R1XA 2X4UA 4WO4A 1ZGLP 3DECA 4YLBA 1RUKL 4PJIF 2GBUA 4AEHH 3VI4F 2VYRE 1CVRA 1J5DA 4KXZI 4P46A 2A74B 4AGNA 1YUHB 2F19H 3HFML 4K8RH 1PFOA 2PR4L 4YHLL 2F8XC 3SKOB 2O5YH 4JPIB 5D5MB 2Z31D 4KDTA 5BVJA 4OLXL 2VLRE 4UU9A 3ZDXB 3R1GH 3RJQB 2J1WA 4OTXL 3S88L 4U1JB 2WWKO 4WDIA 1QR1B 2YD2A 4L8CA 1N70A 3DBXB 4DQAA 4K9EL 2EEFA 4WFFE 3K1KC 3JTTB 4RIRA 5IJDC 2O6FA 3WS3B 3FTWA 4MNHB 1E6JH 1KLUB 1W0VA 2AQNA 3A0OA 3CVHL 4C56A 1WWAX 3X13B 4A6YH 3CLFH 1FL3B 3WE6B 2LU5A 4XNZC 4OZFA 2VRQA 3MRMB 4A39A 5INDB 3B7TA 5IHBA 1YRKA 2NY5L 3DTXA 4WAFA 3WE1A 1OCWL 4HEPA 3IKKA 2VN3A 4KOBA 5ERWA 3RTQD 3KLAB 3ZE2E 1L9OA 4M5ZH 3ECWA 1OARL 1SVBA 4AT6B 2I07A 5DJ8B 4OZIB 1NCNA 5GGUA 5AVVB 2R4SL 3H2WA 2ZOWA 5I1GL 3EF7A 4IKNA 5IB4B 2NY1D 4MSWA 4S1QL 4XNXL 2WOBA 4LCIH 5KTEL 4FFTA 2DI9A 3ZO0A 1WZAA 3MRCA 2Q87A 3TT1H 2F1AA 4P59L 4LO9A 4ZUTB 1KIPB 4W6XB 2AANA 3EDDA 4K3EL 2N59A 5KAQF 2DQUH 4LLUB 1IVTA 2AHIA 1CCZA 4EIZC 2YD9A 2YBRA 3SDYH 3E0GA 3BX7C 5EOQL 4YHOL 1J8HE 5D5MA 5BVJB 5SWSA 2P5WA 1N3NA 3Q01A 5H37G 2Q20A 4JQVA 3KWWA 3QPQD 3LRSA 3OKLA 4ZODA 4A67A 1J9SA 2EC9U 1PKQE 4DFIA 2ENJA 1LNUA 3BC9A 3VXSE 4CSTA 2MCAA 4G11A 4QHLA 2I26N 4FG6C 1RSFA 2ZUXA 1HCZA 4JN1L 4WFGE 4BK5A 1AGBB 3HG5A 4MD5A 2HJFB 3PFUA 5CCHE 4XXDB 5CINL 1OAYL 1P53A 3VFUA 2C4FU 3ZSTA 2C34A 1UH3A 1ACZA 3IN0A 4IMKA 1C5DB 1A7NH 3C6EA 4U1GB 1E7VA 3GSQA 5HYEA 3GHPA 3TJEL 4OF0A 3T65B 3RWDB 4N8UA 4U0QB 5KJ4A 1C12B 1TUPA 1NUDA 1MQ8A 1DVFB 3C9NB 3CZNA 3OX8B 4GW1B 4NAJA 1T0MB 2MNUA 2HRPL 3G6JE 3W39A 5I5RA 4ZXBD 4QD2E 5F7WC 4A6YA 5FM5O 4KQ4L 2OL3A 1HJCA 2IPKB 1Q1PA 1UQSB 3DNKA 3QPKA 5IEHA 5DRXB 4W4NA 1OGAE 3T2QA 3TH4T 4PGCA 4AVJA 3GB7B 4ELME 5IB1B 3HA0A 2VZTA 2QL1A 3LN4B 4NO3A 3MOBL 3L1OL 2CO7B 2YPVA 2WZ0A 4ORGB 1QTSA 1NBVH 4XH2B 3SDCA 1KFGA 5LGYA 3AWGA 1LO0L 2WQVA 3KYNB 3RKPA 1IGYB 3V0FA 4R90H 3BRGC 4JFDE 1X5YA 4K2UL 1OTTD 3ECQA 4AYEC 3KAAA 2WVTA 4S2SB 3TV8A 4XHQA 1VZIA 1SJEA 4LCCB 3T9WA 2P8PA 2KZ1B 3WFHA 2K7PA 2UY7B 1MAKA 3I3DA 1LP9A 4U6YA 1TU2B 1ZA6B 4LBAA 4G9FB 3BPOC 5BJTB 1H15A 5FYKU 3BT2H 1WEJH 1FNEA 4I5BA 5K39B 4JFHD 3MBXL 3RX5A 4ZOBA 3SGDH 4LCCC 5IMOB 2FL5B 1T6WA 2CIIB 5C3LD 3QZNA 2VXSH 2CUAA 4KVNL 3ABMB 4IMLA 2EUXA 3WHXA 1A9BA 4UTAA 1JVOA 4OAWA 5HGDB 2BC4B 5KVDH 2AV1B 2A74C 1CO1A 3FRPA 1MW3A 4NQVA 3EIFA 4H8HA 4X6DE 1A7QL 4UT6H 3RVTD 5KSUB 2Y7QB 2EUZA 1A1MA 5LAXA 4GI9A 3D48R 1A4JB 4G9FD 1DN2A 1ECZA 1OE1A 3FB5B 1WFNA 3I2CL 4FTVD 4Y2OB 1PNDA 2EKSB 5KSAB 1GYVA 4HKXA 2J73A 3ULSA 3T2PA 4MJ2A 3TO2B 3G5WA 3WJLA 1UM6H 2WXHA 2J57A 3VFMA 5EBWA 3QARA 3IFPA 1EAPA 2NQDA 3L3DA 1HS6A 1NAKL 1W72A 2HFFB 2YUWA 2XVLA 1Z0MA 1RUML 5FAAA 4QDGA 5KVDE 3Q2NA 5LCVL 4OR1A 5E99L 3AWEA 5EU3A 1TITA 2NX5A 2V8MA 4B96A 2FATL 2NNFA 3F7LA 4WI4A 2VN4A 3L45A 3OXRA 3WFEH 1QASA 2ITDA 5CD3B 32C2A 2HKHL 1G5AA 4G42B 1K3ZA 2B77A 3VWJB 4IK6A 1RK0B 3CZGA 5FK9B 2AQQA 3DK0A 4YNYA 4LHJB 4HWBL 5AWNH 3T4YB 4H2CA 1GZHA 3VXMD 1KT2A 3U82B 5JYMA 3U0PB 2COVD 4CN4A 3ULVL 5HJ3B 1WZMA 3L6FB 1OAZL 5BQ7A 1A0QL 1P4BH 4MQ7B 4K7PY 4PJEB 2NUPB 2KT6A 1T4KA 2L04A 5ESVB 4OCRL 1YJDL 1JFQH 3SGDI 4YEEA 3V0VA 3B9DA 1S3RA 4MX7B 3T1FB 3NZHH 3ZK0A 3TURA 1FIGL 2HFTA 2WXNA 4FDWA 4KROD 5EIIA 1FZOA 1KTLB 2MHAA 5JMOC 2LFEA 1XSKA 3VFOA 2VXVL 2Z91B 2L4OA 2WWNA 1FZJB 1NC2A 1JAEA 1QZNA 1WSST 2P80D 4OD2B 3UBGA 3HI1A 4YAQA 4RISL 1AQKL 2XRAH 1BQHA 4M8VA 3BEWB 4TUOA 1NEZG 3MA7B 1CLZH 1NEZA 3E2HC 1ZK5A 4EDWL 5C97A 2TSBA 4GUCA 4WI0B 1S9WA 3KPMB 2C1OA 3FFCD 4KO6A 3S35H 4MNQB 3D2TA 4LP8A 4R97B 3VRIA 5JQIB 1EXGA 4LLDA 4XPGL 1RHFA 2A4ZA 2YD8A 1AGEA 1G7QB 2H3NA 1BIIB 5CINH 5SWQA 3WY1A 4ELKB 5MEQA 1BIIA 5SWQB 3N1GC 1IQDB 4WU5A 4I18C 1J5IA 1JL8A 4J3XA 4QOKA 5D8JL 1P6FA 2HJLB 5ECJE 3ORJA 4M1DH 5I30H 2EVGA 4BIKA 4IBZA 4BFIB 4F8LA 5IVZB 3T8XB 4EDXB 3ABGA 1OANA 1TO4A 1S7UB 4WFEE 4B41A 4JDVB 5I2IB 2KDYA 1C5CL 4UOW1 4XR8C 4LLYB 3ZRCC 5DQ9A 4PG2A 2JKTM 3I3BA 3UBXG 4L4VA 2V9TA 5B7FA 3VM7A 1WA2X 1A8JH 2EILB 2WLZA 3ISWA 3VQ1C 4BWWA 4HWZB 1BZ9B 3VYPA 1S4IA 1VFBB 3UTSA 1ZDQA 3UO1L 4IU3B 2XPGA 3VRLE 3I9GH 1KEGL 2VXUH 3DX0A 4F7MB 5MP6L 5ICZA 2XACC 1OHZA 2ENYA 2Y6SD 4OSUL 1RJLA 3EKCA 4Z8FL 2G0LA 3D30A 4OCWH 4GQRA 1UVQA 4X6BA 3BAXA 1UVQB 2BS71 1B88A 1UUSA 2E4TA 3RY5A 3SDDD 5GXBB 1A6ZB 4FE9A 4WZ9A 3SY0B 2NZ9D 2WVUA 4LLQA 4RRPM 3IMSA 4FTVB 3W9DB 1MCIA 3OJDA 3OR6A 4XAWH 2HAZA 2HG5A 1GGTA 1TQTA 3O3EA 1YNLH 2FHFA 4M5YH 2EDDA 1EWHA 2AI0H 5HVHC 4XO3A 5L2KD 3QULA 4LRNL 1WJ3A 2DYRB 4GEJA 4WNQA 3WXVL 3WAJA 1YYLH 1KCBA 3MUHL 2W59A 1OOWA 3B34A 3KWWB 3U4BH 4Y19B 2VDOL 2DIEA 3H8NA 3MN8A 4MXQC 5CR1A 1A7NL 2PYED 4FNSA 3MJ7B 3BI9X 3L3JA 1S3KL 2IEPA 4APXB 2AK4E 2AP2A 3A4AA 3ISYA 1S7VB 4ZMAT 5AB0A 1MELA 2GBTA 1BREA 4BH8A 5L88L 3KBHE 4PRNB 1S5IH 3U1SH 4RA0C 2CA4A 3DHMA 4NAQA 4E5XA 4PVBA 3ASNB 3RDTD 4P4RB 1BVLA 5HDWA 4DEUA 4YHPB 4H20H 1AFVH 1BVKA 3NABL 2V2XB 2PUQT 2VR3A 1BP3B 2VR4A 4WI2A 3MRNA 2EIMB 1TVBA 3Q8EA 1NIBA 4HCRH 3HKFA 1WIOA 2AV1A 3B7UX 2AZAA 2V7HA 2YMTA 4FYTA 4URTB 4Y16C 3SYQA 5CEZL 5ID0B 5EN2A 4JCWA 1R3HA 3OKEA 3PJSA 1Y7VA 4QY8A 1LWHA 2AQ2A 1BAFH 4DVBA 2DKUA 2CM6A 1PCXA 1EAOA 3SBQA 1UB6A 4JDZA 2WLNA 4HXBL 4MB3A 1KYDA 3P73A 4JDZB 4XNBA 3U1PA 1QW9A 3MJWA 3DBSA 4XVJL 4PY7B 2HRGA 3D85D 3LV3B 2ZE0A 1K5NA 1G6RL 2AEWA 2D9CA 3ETBJ 3IFOB 3IT8D 1SRDA 1T1WB 2ADJA 2KZKA 3U9PH 3RFZB 5H4YA 5FOBB 4H26B 5LBGA 3CVHA 3DX7A 1AH1A 1BVZA 3D85B 3AFLA 4KXZH 5CU5A 5AAMC 3QFGA 2VMEA 2M8XA 3N1FC 2XI9A 3I6KB 1EVTC 2N7BA 2NY0D 1TMQA 2R2CA 2Z93B 2VXUL 2YPLA 4HWBH 5AWNL 2J25A 4HFWA 3BXNA 3FB7A 3VXRE 4BHUA 3MUY1 4Y5VA 3TO4A 4C56D 4XVSL 2HA1A 2V37A 3UAAA 2VDNL 4K73A 4X80L 2KI6A 4LE8A 2DTML 1MIEL 4ZG1A 4QAMB 1FHNA 2EIZB 4KKLC 4G6JL 4E9QA 4JREC 5MHSE 1ZMYA 5FYKE 3BD3A 5FM4A 3MRLA 3O4LA 1WA1X 2XBZA 3K4DA 5F1NB 4DP0X 2AVFA 4HISA 5T1LD 2BNRB 3C5ZA 3W57A 3QJQB 5IQ9A 5FDWA 1ZTXH 1YY8A 4UQIM 1YEDB 3LQMA 2H32H 3CFEA 1LO3H 3QUKB 4HH9B 5JIPA 3N06B 1R24B 4NQTA 4U0RB 3ME0A 8FABA 1OCWH 4YHZL 2NUTB 4W9HC 1UG9A 4NBXB 1U8CB 1ZT1B 3MNMA 2ADYA 4A7GF 4MASA 1HKLL 4G6KH 3FU3A 3JWOL 4ONOA 4CW1B 2JK5A 4RFNC 4WJ5B 3O0LA 5DRZA 5C6PB 5KYWB 2ESVE 2JV6A 4NPYA 4UYQA 1R75A 5JW3H 4MMYA 5A16B 2BNQA 4R97C 3AGVA 3ARBB 1KTDB 2YO3A 4PJHE 4OZGA 4LPWA 4MVBC 1WBZB 1BG9A 4JHWL 1PDKA 1RSYA 4ODHH 2BP5M 1MNNA 1BQHB 3BH4A 4HIIB 3RY4A 4NZFA 3WSQH 4M56A 3FO0L 3QIWB 4RFOH 2AJ3B 3AQZA 5ALCH 5F1OB 2YGOA 4FFVC 1UFGA 2ZXBA 3F7KA 6FABH 5D7LE 4DOHE 3LHPH 4JW3A 4Z0XB 5E8NA 3BHBB 4MRCA 4AUYA 1KCRL 4MXVF 2BSEA 2EUVA 1A0QH 1P4BL 3EXJA 2G75A 4AG4L 2QZ5A 4U6HA 4J8RA 3S37H 4Y4HA 1OAKH 4HK3N 2BX5A 4HS6A 3VFNA 2FECL 4FZ8L 1CFQA 4HS8H 3T08A 3CVHH 4PJAA 3HKZA 3VXQA 2ZONA 1ZE3H 1O9WA 3MRFA 1Q1JH 4CVWA 1T5XA 3NG5A 1QBMH 4JO4L 1OW0C 3KLQA 5FYLH 1IAIL 4JHUA 4P5MB 3OZKA 5FLVA 1B2WH 2KZWA 4ZO6A 2AEQH 4W9KC 3LQAC 5H8DA 2NYYD 2ATKA 1DN0B 5G4MA 3KL3A 4XC3L 1GJIA 5DLLA 4WWKD 3LKPB 4IHOA 1BBDL 1Z7JA 5DYFA 4L29A 1VSCA 3D0LA 2ITFA 3E9TA 4CU8A 2VERN 2YD6A 4F7CB 3T09A 5FS5A 4TMPA 1GGYA 2D7NA 4MWFA 4EKJA 3MYZA 4WGWB 5D6DC 1O6SA 4I4WB 1JZ2A 1BMWA 4HIXH 1A3LH 1H3PL 4NO5B 4PJXA 4WEBH 1K8IB 4WWPA 5EO9B 3KGTA 4AMKL 4LFHD 1ZT4B 1E0OB 5T8IA 2EYTB 2ZF9A 5DEFA 3SDAB 1T4KB 4O9HL 2R0LL 1E3XA 3IBEA 4NKOB 1U36A 2XN9D 3MRKB 2DICA 2D3JA 1AFVL 2YAMA 4P4KA 2PCPA 5A7EA 3GMPA 2BY2A 5DD5H 4G3YH 4CMMB 2YZ8A 1D6EA 2V2TA 1FORH 2MKLC 4YQXH 3ZTJH 3QZWB 2AEIT 3C08H 1C08B 3LZRA 2XA8H 1A6ZA 1RUAH 3AS3A 3FCSB 1SQ2N 2DY2A 2C4XA 5DHVB 5DRNA 4Z78A 2D31A 2EYRB 2HH0H 5JUEH 4FA7B 4NKMA 1SM3L 5GIRA 1CT8A 1MCEA 2IBZX 4L4VB 1JGDB 1MVYA 4N2OA 1KB9K 5FFLA 5EWIL 3RLSA 4LPTA 2B59B 1D7FA 1VFBA 1NCDH 2FJHA 3EJRA 1MI5A 4XBEH 3HBGA 3RDJA 3WV0A 5LGHL 1GC1C 1X9LA 3BKCH 5JOFB 3BO8B 3GSVB 4QOKB 5DO8A 1U3NA 4M4PA 1E42A 4GW5A 2YFOA 4DZBB 3MNZA 3CZJA 4N90D 4XPAL 3L8QA 5IQOA 3BSZL 5MENA 4WFFD 1FZMB 3E1F1 3QJOA 5E6IA 1F2QA 3RWHA 5A2KH 5DS8A 3CN4A 3UFIA 2IH3B 2XSKA 4AYFB 4M6NH 1YLBB 4OJAA 1TZGH 5DJCA 5KZCD 3CDZA 4N0FA 4LSQH 3U0WH 5F9JA 1BZQK 5CP3H 5DQDL 5ICYB 1N4XH 3PUCA 5EDXA 4N90E 5F1IA 4HCRA 4AT6A 4NZRH 1J8HB 3ZDZF 4KNUA 5AENA 4OAWB 3O8XB 5DEJA 5FC9A 2CZNA 4JVWA 1NAKH 3JWDL 3W3BA 1AMXA 1ZDSA 4NCC2 3RJOA 3RUGB 3OX8A 4GW1A 3TIDB 1LO5B 2HLFD 4P23C 4OCNC 1QPPA 3DV6A 1CE6A 1RZFL 3LY6A 4DTGH 4U05A 3FPYA 1CDJA 1BM3L 1YDPB 3QDJA 5ACMA 2CBQA 4X42A 1XEDA 4JKNA 4PS4L 1A3LL 5DFVC 5EORL 4FMKA 3L3OC 4FXGC 4Z95H 5HHOA 3TBVA 1HU8A 1T21B 1OT2A 2MPAH 3LDBB 3QSKB 2G2NA 5LNGA 3SGJC 3T6ZA 4WNQB 4ILDA 2PXYC 5KSAC 5DJ0A 3L4WA 1MEXL 1FO0A 2CJ3A 5I75B 1RMFH 1YN7A 3A21A 3WIHH 4QTIH 3V6ZB 4FNPA 2BH0A 2FBRA 4PJDA 3QDMB 3H6AA 4MJ6B 4O2FA 1U8LB 1CB4A 2PYEB 2JJSC 5I16A 3PIQA 5INCA 3C6LB 3FO1B 1VGKA 4PI0A 5DRZB 4WWKB 2ZOTA 4OM1H 1TZOA 3L9RB 1SN0A 4J5VA 3FU6A 4MS8C 3F05A 3FFCA 4JQIA 5DZNA 3SDXF 3DO7A 1CMOA 1GCFA 1SEQL 3GXMA 2WINB 4CGTA 3IYLW 4OT1H 1ET5A 1PTZA 4JUTA 3FQNA 5TFSH 3UIZA 1XF5A 5DC4B 7TAAA 1NMAL 3ARDA 3EJQA 1R5WA 2DM3A 3H85A 2AJSH 3MCG1 4R4ND 1I1AD 1R17A 1FNAA 2NSQA 3ELAT 4PLOB 4RSVA 1XXFC 2FEEL 5D7KD 5D70H 4BKLA 4F7EA 3TN0B 4B9FA 3LNHA 1O9ZA 4R8WH 4MCZB 4RAUA 4H8WH 1R1CA 5KSUA 3L95A 2RTTA 5C0AD 1BQUA 3SJVB 4MMZB 4Y2OA 2WXMA 1PS3A 3KW7A 4AH2A 1RIUL 4QO1A 2ALWA 3PQYB 1AANA 5DRWB 5I30L 2RQEA 4KDTC 4KO5A 5FUOH 3UTSD 3MOQA 4TVUA 1KTBA 3PXLA 2IC2A 1H6FA 3LIZA 4RAHA 3SCMD 1A6PA 3KHQA 5CGTA 3QI9A 5JW3L 4KI5C 2JCCE 2VJXA 2OCFD 4RAVB 4JFFB 3KHOA 4D9LH 2EYSB 2NY6B 4XODA 1T1YB 2X4TA 5T1KA 2Y06H 4GJTB 3VTAA 3OKMB 4POUB 1L7TH 1KNOB 2HTKD 3LNEA 4FG6D 3TX4A 4NBZB 2BLFA 4Y9EA 2DJUA 3HB3C 5GGQH 3FMGH 5CFHA 5GS1A 1FFNA 2NY0B 3V95A 4UM9B 2E0PA 4LSRH 2Z1PA 5KVFE 4O9HH 2VMFA 3CDCA 2DIJA 3ES6A 4U1GC 3TPUA 3INUL 5EZOL 3CMOL 2AQRA 1QBLH 3IF1A 3TBSA 4NERA 3MNWA 2D4FA 3T4YA 5EORH 4GRWF 4ZO8A 3C6LC 4OU3A 3PL6B 1CICB 3BYTA 3WFDH 4TQPA 5HI3D 4EZLA 5TDOB 1CGTA 1HCVA 4FQXB 4UTBA 4LCUB 3L6FA 4UANA 1TDQA 3MRPB 3QBTB 3T5WA 4HPHA 1YNLL 3UDWA 1S7SB 2VSDA 3HPLB 3S34L 5I6NA 4H8VA 2H5UA 2XU9A 4EIBA 1B4TA 1OPGL 4GKSA 1UD3A 2OA9A 4LEBA 1SOKA 3BOVA 3X3FL 3EOBA 3WBDA 2WNGA 3V5HB 4EXKA 1PF3A 5C6TL 1B4RA 4OM1L 3GIZL 3QQ4A 3BKCL 3VDAA 3UPAA 2IGFH 2XQYK 4LDOB 1DVSA 2F2HA 1FGNH 4B7IA 2H0FA 5KBNC 2HRLA 4JVPA 3MI6A 3B83A 5AAPA 1TXKA 4N3UA 1JN6B 3GHBH 3G5VB 5DF0A 4Y1AA 2XN2A 1AXSB 3WO4C 2A73B 3HB3D 4C55A 2VQUA 2N7AA 2JQMA 1IQDA 4WGKA 3R7QA 2C8NA 1AR2A 4QUOA 4A7QA 5F7DB 3B2VL 1L9QA 3DGGA 3ZQWA 2XG5A 3TESA 4LSSL 3QDGA 4UM9D 2H6PA 1LEKA 3GPEA 1CD1B 3DOSA 3NOIA 3V4UH 1CGVA 5C0CA 5T3ZD 1ADQL 1CD1A 2ZX6A 3DOSB 3OXSB 5G4NA 2YAPA 5HJDA 2QPUA 3ZUNC 4LNRA 4PSRA 2EDMA 5G2NA 5BRZA 2NNXA 3FSVA 4XCFL 4R7NA 1X7QB 4UV4L 3ROLA 3X11A 2EDTA 5I8EB 4ZOAA 3LS4H 2E9GA 4GQQA 2CLRA 3GSUB 4MXWH 1KB5B 2ROXA 1RZFH 2JKLA 4ALAC 2WIIA 4TLTA 3DIDA 2FB4H 2XFXB 1JV5A 5E1IA 5GGTA 2G5BB 3IE4A 1L6ZA 4DEWA 2OSLB 3ETSA 4QRQB 4FLOA 3RDTB 2OYLA 4D0BA 3O6MH 4WTQA 2YMXL 1AP2B 5DK0A 2V7HB 2VDQH 4PV9B 5D4IA 1LO4L 2DF3A 4JFWA 3SQRA 1QAWA 1JF1A 2X7LA 4KUZH 1JZEA 2G9KA 2OULB 3VTMA 1E4JA 2R51A 1MVUB 3BVNA 3I84A 4OLVH 3BUQA 3FRUB 2XY2A 2J44A 3PGDA 5ESQB 2B5IB 2EH7L 4X4YA 2HXAA 1EZLA 3GFUA 3ZL4L 1TFPA 4F3FB 5GRVL 4WI3A 3LIZH 2MOGA 3GHEL 1OSYA 4MNQA 3VRIB 4OKVB 3RWCB 3BVDB 4RMVA 3ABKB 4M8QA 2DL2A 4Z3FA 1KFAH 3TYFB 5JW4Q 4XNUH 3MV8B 4YDLC 1Q38A 4LHUB 2IPUK 2NW3A 2CDFB 4JZOA 2W65A 4H1LG 3E38A 1RP8A 4MDRA 3DX3A 2WTRA 1T0OA 2EDBA 4K94H 5LLIC 1EO5A 3VI4A 1G84A 3FQWA 3CXDH 1UZ8B 4P4KD 4PJDE 4NUJB 4IRSD 4XPBL 3X11B 5KANI 4M5TA 1TJMA 1RKRA 3LH2H 1K6QH 2EYRA 2XKNA 1JNNH 4E68A 3ATEA 5CIPH 1YAIA 2IDTA 3ATFA 3C60A 1OL0A 4U3HA 4IKLA 5CGYD 5I8CB 5FW8A 3II2A 1TFHA 1YO4A 4O00A 3ZE1E 3D12B 2R15A 4NQXB 2C1PB 1FNFA 4IJ3C 4S1QH 1HOCA 4XNXH 3VXPA 4YSQA 1FDLL 5D8JH 2ROYA 4N87A 3EDFA 5EU6A 4XVTH 1CGUA 3SO5A 2YIHA 4G5AA 3AU1B 1AXTL 3I02A 4JZNB 4QLWA 2OMWB 3WIHL 4ONHA 5KS9F 5C0EB 1MHCA 1XGTB 1XH0A 1NEPA 5FX3A 2KZBA 4L23A 2BDNL 1SYVB 4Z7NE 1LXMA 2C26A 1DR9A 2MKWA 4G6JH 3AXLA 3FDWA 1VADA 1OTUD 1U8JB 3E6FA 4A04A 5E1HB 5GGRB 3EZ8A 3WLWD 4LOEA 3B6SA 3HRPA 5KS9A 1OM9A 2ARJQ 3BPCA 5CLTA 5E1AB 3GS0A 2AK4D 2VITA 3DIVA 1K2DA 4CC0A 2YQBA 3HTLX 3NZHL 3X1GA 2I24N 2P52A 4KJQD 4M8QB 5J11C 2P43B 4RMTA 1JDDA 4GRLB 5IBLD 3FHQA 3MV8E 3TC9A 4LBEA 1CFTA 4YVNA 2MJWA 3T2NL 1QBML 1LL1A 2NZ1A 1IM9A 2W65B 4MQSB 3WNJA 2QGEA 4IKIA 5FYLL 4R7XA 3ZHDA 2VW6A 2O61B 2WXKA 5INCB 3CX2A 1IIIA 2DKMA 2FZ3B 2J4WH 4FD0A 2RA1A 3LHAA 1JGLH 4IJ3B 4OUUB 1A7PH 2YQ2A 4HBCL 1OPGH 3OHMB 4U6VL 3B3IB 3BKJL 3GXDA 1K3IA 2WXQA 3EBAA 5CGYC 3TA3C 3MACH 2MTPA 3VFSB 2QKSA 2BP0A 1PD6A 3LKQB 1AE6H 1D9KB 1CICA 2KLTA 3TNMB 3OZ9H 4RFEA 2HLAA 2Y6SC 3MLRH 5CJQL 1JMXA 1JZIA 4H13C 3VFRA 4HUNB 5HYJB 4K07A 3K8MA 5CD5C 4HJUA 2UZXA 1O7DC 4D8PB 3ZDXE 2CDGB 1ZRUA 2XIDA 2B1AH 1O7SA 4WTZG 4GQ9L 4D9RE 4A63A 3OB0H 1USZA 1E5UI 3V8CA 4R7LA 2C9PA 1GC1L 2Y2YA 3HR5A 4IDLA 2D7OA 3JYCA 3WKML 1NDGB 2AGJL 2GK0A 3VD7A 2DRUA 3EGDA 5HGHB 1P6AB 2YLHA 5EUOB 1R19A 2BS8A 3G5XB 3FMGL 5LXVA 3CU1A 1GVIA 3ARBA 5FV2A 1S6NA 4IYKA 3UBFA 3RB5A 3ECUA 3C09C 4DK5A 3IBOA 2P24A 4XN9A 4IRSC 3OMAB 4L48A 3QQDA 2BXYA 3U0PA 4D7PA 1YSOA 1AD0A 4LKXB 3UGUA 3EUDA 4F2EA 2ZWLT 4Z77B 1C1EH 5E03A 4DK3A 2FSEA 4YVUA 1CFVL 4HF5L 3CG8A 1S7TB 3NPZB 4NZJA 5EBMB 4X0NA 3IGLA 3P4NB 4Q9QL 2Q6WB 1AXTH 4XE0A 3AXIA 2LLLA 2PCPB 2KC0A 4GRWE 4ZS7H 5DJYA 3RFZC 2BRRH 1E5AA 5AAWC 2EABA 1EO8L 3RL2B 1Q94B 5CHNB 5E9DA 4MJJA 1JXJA 4FYRA 3RDTC 2F53E 3ZUCA 3HG0A 5L7XL 3LXBA 3RIFF 2ICEC 3ZKMD 3O4LB 3KW8A 3TO2A 1EUUA 3KYKH 4CRPA 2Y36H 1ND0A 3FQUA 5CS7A 1FJ1B 4JPKH 2C3VA 3A6BL 1MHEB 1YY8B 5I1DA 3CLWA 1RU9H 4WV1B 1FH5H 1B2YA 4YHIB 4Y9BA 5EF3A 5GZNA 2Y24A 2Z7YA 1UXSB 4QYOA 4JKWA 3VYNA 4ZD3L 5J13C 4PWIA 3SE3C 1IEHA 4DPAX 3M6DA 1CJYA 1TVDA 1IAOA 1P4UA 3AU0A 1RHHA 1MIMH 4FNLL 2GT9A 5JW4M 2HT2D 3DXAB 2D3VA 3ZOAA 4EIUA 2IGTA 5CCKH 3Q48A 1U8PB 3BESR 2BSSA 1QLEH 2IANA 1NC2B 1T0NB 4OD2A 1WICA 2GJ6A 3MV9E 3PGFL 4GRMA 1RUMH 3GI9L 4EVNA 4ZW3A 1NGWA 4AK2A 3IMRA 1IIKA 4AIEA 3UROR 4GMTL 5CEZH 3UGEA 2BP8B 1JPFB 2VLJE 5CJXA 4FA6A 3PWPB 4J6IA 1MCCA 5ESVA 3DMMC 4YBHA 3RY6A 3VWKC 1FH2A 3BQVA 3WUWA 5BV7H 4HWBA 2Q9OA 1QSEB 3MBEB 3PDDA 5CD5D 3JT0A 2WK2A 3KNBB 4KTEH 1OK0A 2ZAGA 5HVHB 5FWQA 3O6ML 4U7MA 3TS8A 4NENA 3P77A 3OBAA 2J12B 5BXFB 1YN6B 4MAYB 3BZ4A 4GAGL 3CUPB 1HJBC 4WO4B 2VKXA 2XN9E 4AIOA 5A6MA 3JWNH 2H9GB 1OCZB 3GXPA 3HVDA 1BAWA 2CKBL 1JYVA 4PTTA 3DHUA 4WI0A 2HPOA 2X2JA 2FGZA 4NSKA 1KPVB 3MZTA 5A2BA 4JFDA 1EJ8A 4JB9L 3ZZQA 1CGYA 5GRYA 1MI5B 3ARVA 3PAYA 3GXNA 5I18L 1NCAH 2Z31A 1NFDB 4CJ0A 1BFSA 4HUVA 4KH9A 4HZLA 3Q5TA 2BIOA 5FDYA 3KWXA 1ZLVK 1A4AA 2VIRA 1DBMH 5C0EA 1JGVL 3G5YB 3IDUA 5I26A 1W80A 4L1LA 3HEIB 1N5AB 1CYWA 1KCUH 5IHLB 3KR3L 1QW8A 5CZXC 5KSBF 3AY4C 2ITCB 4NYLA 4S0SD 4DZ8A 3NRPA 5FCSH 3ZE2F 1DUYA 3KS0H 3F58H 4HBCH 4JFUA 4PGDA 4BYHA 4PRPD 2PMZA 4Y5XC 1VAHA 4S1RL 4MMZC 3S96B 4PJHF 2BY0A 1I3GH 1RVFL 2FTAA 5ICZB 4ENEC 4JFDD 3UTQB 3GXIA 4ZS6D 3HOGA 3EJZD 3GSRA 3OGCB 3NPSC 4OZFG 3Q3GB 2HUEA 4CMMA 3V5DB 3MMEB 3OGOE 3F00A 4TSBH 4UT6A 1JZ5A 1A22B 1P1ZA 2Y69B 2ZYRA 1DQQA 3K5SA 2R8SL 1HAWA 2WGXA 5L9DL 1YCSA 2BINA 3GSNL 5G5DA 3P11H 4PJIB 5CILL 2KPNA 2GJ6E 3MV9A 4S0TD 1QFOA 2IOIA 1BVNP 5C0AB 1P7BA 3F7RA 4OCYL 4OM0L 2X9ZA 2R7EA 1M3JA 1B0WA 1VKXA 4WUKL 2G3MA 4NSKB 3D4ZA 4JFED 1EAPB 2N1KA 3JVGC 2AEOA 3GQFA 1T03H 1NPNA 2JCWA 4KO7A 1WWBX 3T0EC 5KVGL 2CDFA 2G60L 2NSMA 2UZPA 5AW9B 5I1AB 2CRZA 2KLSA 2R0WH 1OALA 4I3GA 2X09A 3DXAE 5IG7B 4UYPA 5FGSA 3UX9B 2YSSB 4PJGE 2ZUYA 5IM7A 2J8UE 4PRNA 2GYSA 5F9WC 5FGBC 4YHNA 3B9KD 4LNVA 1X44A 2J2ZB 2AFNA 2L7QA 3HBPA 3SDDC 5J4MA 1I3RA 4KWUA 3F12A 5DC0A 3T0VA 3AT9A 1KXVA 1F41A 1I7TB 2JB5H 2XWTA 1S7QA 2ILLA 5ISZB 4E9YA 3NTCL 4N68A 1LK2B 2A4CA 3T65A 4D9LL 3TM6A 1UWEH 1ZEAL 3ZTNH 1M71B 1A2YB 2JI3A 4YBQD 1U95B 2RFXB 3QNFA 5LN4A 5T1JA 4NJ9H 2C3HA 3HZ3A 1IGTA 3HZMB 4JPSA 1U4EA 3KPSD 2DW5A 3KPNB 3TIEA 4UQEA 4WSJA 2I60H 2DM7A 2YXVA 2C7UB 3SD5A 3JWNE 3LQZA 3DGDA 2PP7A 1PAZA 2WZAA 1MIML 5JA8B 5D2NA 5HYIA 2F53A 4PJBF 1MCFA 5ANHA 3MX0B 1NWOA 3NDYE 1KV7A 1T2QL 3AWFA 3SKJL 3O6KL 4I0PD 3EF4A 4OZHE 1UEYA 1XO8A 2VQ1B 2YD4A 4HLZG 3U0TB 1N3NB 2QGCA 3H9ZA 3DX6B 1CDYA 3M17B 2BMKB 1PSKH 2WKOA 4Y2DC 3Q1SL 1PZUB 2DZEA 4YK4B 3U30C 1WIUA 3SYAA 4IGBC 3IU3B 1ZANH 4MNQD 1URZA 3EBHA 2Q5BA 4JAMA 4OM0H 4H8PA 1I31A 2VLJB 3HE7C 3LIUA 1TF4A 7PCYA 1H3XA 5HDOA 1WDAA 3AB0B 3KJ6L 1AD0B 1F4AA 1QVOA 2KMWA 3W9EB 1RUQH 4G6FB 3MRPA 4FJYA 2AJXL 4LCUA 1T03L 5KBDA 3ULUE 1MCSA 2VW7A 1F02I 4LVHC 4TYUA 2I07B 4P2OC 1M3IA 3QO1A 4FXTA 3U9UA 4PP1D 1QLRB 2P1YA 1RP9A 3VDBA 4A1RA 4FI6A 2APVA 1IAIH 2ZKYA 3DLQR 4EN3C 4UAOB 2E27L 2C7UA 2HYMA 2WBJC 4AKQA 2N3JA 4HZAA 4LEOA 3IJSB 3MRFB 2JH2A 1FP5A 4P46D 1XCXA 4QHUB 5DYOB 1NOFA 3N42F 3MLSL 1HZLA 4CMHB 1ZAGA 1HSAA 1WZ1L 1XGQB 2H1PH 3LEVL 4I0PB 3LZOA 1Z9NA 2XN9B 4KKAC 4U6TA 4Q6IA 1DE4B 4U1IB 4B9ZA 1HTYA 1SHXA 3RYMA 1VEMA 3RVWD 2IAAC 1H6TA 5D7LB 4WUUE 2Q76A 1NKOA 4HKZB 4HQQL 5FO8B 1DLHB 1GZPB 3JVGA 2CE6A 2JKRM 5C3TA 1VACB 5C0CB 2NX5D 4MSWB 4XMTA 4X6CE 2GQHA 2I60L 3VMNA 4KJQC 4WENB 1AIZA 2WLIB 4G8EB 5F9OH 3UO8B 1U3JA 5C0JA 4RSYA 4AM0B 2VL4A 4JFQA 5DUMH 2R0ZL 3H9SE 1BECA 3O6FC 1QNZH 3SOBH 5JXAL 1ZT4A 4GAYB 2Q7YA 4TPRL 4XP9L 3NN8A 3CFJA 1OLLA 4FXKA 4K0OA 4K9JA 4UM8B 4XP5H 3T6WA 1ZD6A 2R2BB 1AJ7H 2FQFA 2ZXCA 5D4JA 3GINA 2R39A 5DHDA 2YJLA 5F70A 1LDPH 1OGPA 2AXFA 3FCUB 2OP4H 1SJMA 1CDBA 2F18A 4RRPA 1AP2A 5DK0B 3VXTA 3DROA 3QRFM 5JOFA 3NJGA 4AXWB 1IFGA 2Z31B 1KGUA 3I85A 2XVGA 4JPWL 1SYSA 4QRRE 3U6RA 3A67H 2NW2A 3HG1A 5IMLA 3IJYA 4K94L 3W0WA 4OFYD 1U9KA 5KSAA 5LAPA 2OMZA 5DD6B 4FFYH 4UOQA 4UUJA 4E9WA 1B2WL 2WUBL 4BUHA 2GW5A 4MMXC 5TF1L 1RZGA 2GTZA 4LLMB 5EN3A 4DVRH 2KKQA 3QXVA 1WGVA 2ALAA 5TDPA 4DN4L 1OIOA 4KX8A 1E43A 4RZCB 3OZLA 4AI7A 1NFDE 4NI3A 4M43H 2EAEA 4DP6X 2WQUA 4BRVA 3SB3A 4XMXA 1K4CA 3HC2A 2E7MA 2XG5B 3V6ZA 3GMPB 4M7LH 3L9EA 1AZBA 1H8SA 2NTFA 1J5HA 4YFEA 2D8KA 1KXVC 4X4ZA 3EJUA 1MWAA 3CHPA 3WNPA 4JCLA 4OJFH 2J43A 3DPBB 5KSVB 3WTTA 1ZEAH 4PSPA 4JDVA 5T1MA 3KH3A 3LS5L 3ZTNL 2XKNB 4N9GB 4Y9GA 2H6OA 3G6AA 5AVQB 3ULUC 2OZ4L 1CYGA 5CSGA 1EAQA 3FQTB 2QPEB 1HHIA 5AW3B 1XCWA 2NZIA 3RX9A 1U3YA 4JQXC 4NP9A 3TU6A 1F6AB 3QXDB 5IW1A 4YUEH 1GGUA 2X44D 3UAJD 1PZBA 4JRWA 3VXME 1UT1A 4JREB 1WVZA 4OLWL 2E7HA 2UZXB 3VH8G 4AJWA 2MWCA 3U79A 1KPRB 4PG9A 2GC7C 3PHAA 4JFVA 4HKJB 1MJ7H 4NQDE 3CH8A 2YRBA 4RDBA 2DBJA 5EV7A 5C9KA 2H3XC 4HHWA 2DPKA 1ZVSA 5E24E 3INOA 4YSOA 5JNYB 3OMNB 4FCAA 4YPJA 1IT9L 4M7JL 4MCMA 5D7SL 4QTIL 5EIIG 2Q8BL 3A23A 5LGJB 4GO9A 4Y7MA 1TTRA 1YNTA 1OM3H 4C83A 4NXKA 3UYPB 2XZAL 1Q9WB 1ZK9A 3SY6A 3BPCB 4Y2NA 2YPLD 1RK7A 4P49A 4RGOH 2EE9A 3FHAA 5GS1C 5IMOA 5TE7L 2QZQA 5I1EH 1X5MA 4F9LC 4JM4L 3UTTB 2FECI 1CS6A 1J11A 1XMWA 3V2AR 4GRLA 4A7UA 5IB3A 3PS6A 1FL5A 1NGZA 1XIWD 4U1LB 3S97C 1MFCL 2IGFL 3OLGA 2E74C 5DR5H 2DBLL 5CN3A 3S9DB 3EAKA 1VGKB 4G9FE 4LHUG 4J23A 2WYZA 2BRQA 1YMMA 3K6OA 4P2QA 3U0WL 3S2AA 3MRHA 2V9UA 3WFCH 4IM8A 1Q0YL 2AGJH 4G42A 3W2DL 1NCBH 3KLHC 5EC2A 1W6WA 5DFAA 3UDWC 4O2EA 2QQQA 4MDIB 4K71C 4PRHE 2BHUA 4J3OH 5ESAA 4NO3B 3B2PA 2AKRA 1CBVH 1HIMH 4XPTL 4HVBA 1ED3B 1NBYB 5JO5A 1Q0EA 1Z9LA 1SQMA 5BZZA 1QACA 1U91B 3V52L 2R69H 4PJFA 3IVKB 4ZTOH 1JRHL 5D1QB 1KIQA 3QFJA 4KKNA 2Y5EA 4MNGE 1VGEH 4ZPVB 4GBXB 5K9JH 1X7TA 4MQXD 4N2HA 1IQWH 4N0UB 4NKIL 2LU7A 3R19A 4DO4A 4HS3A 1FO0L 1QHOA 5KW9L 2IV8A 1ROCA 4OZIF 4L5FE 3T0EE 3IMBA 1WZLA 4JRLA 5TH2B 1CLYH 4PJGA 5DWUL 5HDLA 3RTLA 5E6UB 2WB7A 2VC2H 2IDUA 3HN8A 3I74A 1IKFL 4MB1A 1Q8MA 5CCGE 2JELL 4JO5A 2A6DA 1KCVL 2YKLH 1HOEA 1LHZA 2X4RB 5FW7A 3NABH 1QSED 3B5TA 3I9AA 3A6BH 5TDOA 4X4ME 3B9KA 1Z9OA 3HI5H 2XLLA 4WUUB 1UD8A 4PUBH 2BC4A 4F8NA 3VD1A 3MBWA 3F7QA 1P7HL 1X5FA 3CCHA 3O0RL 3IDJB 4Y5VB 5EOCJ 5E8EA 4Y19D 2Q76B 4B0MM 1E8YA 1XGRA 1CGWA 3GIVA 4UV7H 4Y5YA 5DI8A 3AUVA 2I27N 2J3SA 1JZJA 4LQFH 4YH6A 2V7NB 4TVSa 3K71B 5AD0B 3C8HA 4P9HC 3N04A 3RQ3A 4W68A 5GS0H 1QLEL 4P04A 3HI1B 3Q44A 3K91A 1OF2B 3WKYA 5JHMA 4Y4HC 2E9WA 3MCKA 3NCJH 4JFFA 2CD0A 2NUPA 4FQ2H 4IIQC 2BVQB 4AWJC 5HGBA 4AQOA 4URKA 4R4BA 1TTAA 2FEEI 3AZUA 1KC5L 3DVIA 1ZXQA 3DWTA 4EDWH 5I8OL 3LRMA 2YBGA 5AW5B 3U9UB 3DURB 5CZVL 4FHBD 4KRPC 1EEUA 5ID0A 4QJ5B 5KVEH 2EZ0C 2NR6A 3OAZK 4OLUH 5D1XD 4AYGA 1T1XA 1WGOA 2A77L 3ARSA 3NFPA 4M7LL 4OLYL 1O9VA 3HUJA 4PRDB 5TJWK 2DQTH 3MREA 2PETA 4LFHG 1JGIA 2C3GA 2CLZA 1J0IA 3QJFA 2VLJA 3BVTA 4TLKA 5E94A 5SX5H 2ADFL 1GHFH 4PJEF 2PABA 1J8HD 2V33A 4NO0B 5AL0A 5AZEH 2JLPA 3WL9A 4FGMA 2A6KB 1AZCA 4XPHH 1A6AA 3T2LA 1NCJA 5IFAL 2F08A 5LWYL 4QTHA 1W0YT 2H6UA 3QEQD 2WJ7A 1QBLL 2LLNA 1JWSA 4LGSB 3SPVA 5HVFB 1GSMA 3I9GL 2VISA 5EHFA 1HDMA 4UI2A 3GRWL 3TTYA 2QHLA 1N5YL 2J6EA 3P02A 2Y07L 3PHOB 4XN7A 1E4XL 2VW4A 4XNMB 3REWB 4WEUD 1BIHA 4L3EB 2IWGA 2NTSP 4ODHL 1PG7X 1ADWA 2N7SA 3EOAA 3OJDB 3OR6B 4JHZA 3ARED 5SWZE 2E8ZA 4RFOL 1G4MA 4KNQA 4F7KA 1S9WB 3VWJC 3E6HA 3ARQA 3Q8CA 4Y4FD 2UVEA 5CEZD 5I1LB 1HOCB 3VXPB 3GSOA 1MW0A 2W88A 5I5JA 5EIQA 2H0EA 1GYUA 2R27A 1JF1B 1YYLL 3KPQB 3SKNA 4PFEA 1AS8A 1N8ZA 1OV8A 3ZRFC 4LASL 4NT6A 3K2UH 3OAUL 3BKML 2Q1EA 4PD4K 5T3XH 5HYSB 5L9DH 3KD4A 2A4EA 3GSNH 2UYLB 2WMPB 1YNTB 5BJTA 4JRXE 4ZW7A 1BBJA 3H2QA 3ULVF 5E23A 5DJAA 5E8OB 3IGFA 4XO8A 1BF8A 1SJHA 2PP9A 3O3AA 3VFVA 3DSFH 5ICYA 4EN3B 3AREA 1QPXA 2A9DA 7FABH 2OMUB 4XWOC 2VZSA 1WCBA 5MEPA 3NSXA 2RR3A 5DJ8A 1VEPA 4HEPG 1OPOA 4OGXH 4AGQA 4N86A 2GFBB 4WCYL 4IDJL 2UUDK 4YZWA 1JCVA 5IV2B 1T20A 4OCSL 4RESB 3I50H 1XH3B 3C5XA 3F83A 3QEQB 1TTCA 2OL3B 1AZVA 4LDCA 5D71H 4Y1TA 2DWSA 2OPCA 5ILTH 1JTTA 4GMTH 3DUSB 2DQTL 5KSBA 5EZIH 4XZ4A 2BOCA 1QZ1A 2R7EB 1Y07A 2RB8A 3RB7A 2IAMB 1CF8L 5IEKA 3E6FB 5E95B 2B7DT 1TNMA 1KIUA 2OMVA 3ZKXB 3VXNA 3RI5F 5L4FA 3PWJB 1PZSA 2D0FA 5IKCA 4ZX5A 3N44F 2PWHA 4XAKD 4N22A 4H0GA 1UOLA 4XRCA 4N3TA 4G6AD 1I9JH 1MFUA 1H3UA 4U7SA 3U0TA 1L0YA 4KHTH 4XCEB 4XB7A 4EI5B 5EU7E 3B2XA 5I16B 2MQ0A 3BGAA 5DTFB 2P5ED 3EO0B 1KENH 3RPKA 3PNWB 2M2DA 1NGXB 5E70A 1FZKA 4BRJA 4GSQA 4ZQKA 1KULA 3L9RA 5DR5L 1F86A 5IUCA 1L9TA 4OH2A 5DZ9A 2VQTA 4CVXB 5K33A 4G6ML 1H5BB 3UMNA 1GJUA 4KJWC 3ARWA 3VFGH 3VWKD 5L0QB 4KH2A 5DJDA 5JHLH 3EXLA 2DMCA 5A6LA 1DBBH 4JRYB 3APNA 2CIIA 2W1NA 12E8H 2PWGA 4L4TB 4Z7UB 4EUPA 1UJTA 5IGXH 2R29L 4D3CH 2EVJA 3US9A 4GUOA 3SE4C 3MVSA 1E9QA 4X0KB 5AVYB 1EEZA 4NBYB 5CLYA 1X4YA 3G6JF 1GS7A 4A7VA 3FULA 1IEAA 2OKMA 3T6QC 2ZP9A 4I3SH 4KI5E 4TULH 4OB5L 1YDPA 4HQQH 3RZCA 1JGUH 1VCAA 2IH8A 2LVEA 4KVCL 4UZSA 1U3HC 4GQ9H 5IF0B 2Q3AA 4MJIE 5GPRA 1N26A 2DMKA 5FR3A 4R26H 4OLEA 1YYMH 1N6QL 3RAJL 1BZ7A 2K1MA 3MLVH 4KKBD 4DKEH 1JPTH 2YA1A 5D1QE 4OV5A 3F6LA 3RGBA 1D2OA 2XTJB 3PWNB 3WSQL 1UD4A 5J12B 2JCCF 4FKHA 4YE4H 2WUCL 4EJ1C 2VCOA 3ZKND 2Y5TA 2O61A 1Q9LB 5B7EA 1ET7A 2UXFA 4YIQA 5D7LA 3TT1L 2F8VA 1CE1H 2X38A 1QSZA 4Z3TA 2ICES 1INDH 1KTKE 3RI5K 4LAJH 1I8MA 3TNNA 5BMFL 5ALBH 4BJLA 4A7TA 3WS3A 3LXAA 2MSPA 5MENB 4KZEH 5C0GA 5DHYB 1FN4B 2A9NL 2A38A 1FL3A 2NY0C 2WINA 4I5BB 3NJJA 4Z95L 5CZRA 3IETA 3KG5A 4MQ7A 3SGKA 1YHPA 1ZTXL 3B9VA 1JHTA