3V10A

Crystal structure of the collagen binding domain of erysipelothrix rhusiopathiae surface protein rspb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
318
structure length
310
Chain Sequence
AKDYTNEAIFTQFDVNPKGLINNPSQPIEFNLAFSDMNNGQKVKFKPGDFFDLTLPSNDEVSLRSLRAMGSKMPVLAKKEITLGELTFNGSHIHFEFMEDVLQLENVTGTINLKSVYDNAYRGEDDKIAELPTNLGLGSLDKQMITISQPGTPTSPIFYWKTGTFSTEVHGDMNWWLNINSPKEAVQSDVKVIDTIGEGHKLVDGSIMVDVEANGELKHISAEAFNKEYGTITVEGQVLTVMIPKEKAAKTTFTVTYDTRAFDKKLENYKNSSTIEYKDESGNLVTDTPKHYTDTSVVNMFDDATIGGEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Collagen adhesin-nanoparticle interaction impairs adhesin's ligand binding mechanism
pubmed doi rcsb
source organism Erysipelothrix rhusiopathiae
molecule tags Cell adhesion
molecule keywords Rhusiopathiae surface protein B
total genus 67
structure length 310
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A01
2WQSA 2X9XA 4OFQA 4JE0A 3OPUA 3KPTA 3QE5A 3RPKA 4IGBC 4Z23A 3QDHA 2Y7NA 2Y7MA 4LE8A 4IGBB 2Y1VA 5IHWA 3IS0X 4UZGA 4IGBA 1N67A 3IS1X 4MBOA 3V10A 4LEBA 2WOYA 2YLHA 3IRPX 3PF2A 4HSQA 2F6AA 2OKMA 5CFAA 4Z1PA 3AU0A 2X9YA 3IRZA 4F20A 4F1ZA 3ASWA 4JDZB 2Z1PA 4IGBD 4JDZA 2VR3A 2F68X 4B5ZA 3PG2A 4B60A 5DZ9A 2WZAA 2X9WA 4LEEA 4MBRA 3RKPA 3HTLX 1R17A 2Y7OA 3AT0A 1R19A 4F27A 2X9ZA 2Y7LA 4P0DA 4F24A 1AMXA 5DZAA 2XTLA 2RALA 3UXFA 5CF3A 3HR6A
chains in the Genus database with same CATH superfamily
1HEZA 3LDBC 2VLME 1J05A 2NY2C 4JRXA 1IVTA 1IBGL 3NCJL 4OZHA 4B95C 4BDVA 3IVKB 4OF6A 4I87A 4R26H 2JV6A 3LKQB 1ZDQA 5TJWK 1FZMA 2BS71 5DJAB 1J8HA 1E4KA 2QL1A 4NENB 3THMH 4RGMB 3CN1A 3WGUB 5TH2A 5TPWL 1OTTC 1XWVA 5I19H 1AZZC 5AW6B 2XG4A 2FQFA 2ZUTA 3ZQWA 5K5YA 1KJ3L 1VFOA 2CDGB 2D7MA 3J7HA 4A66A 1V54B 1TZOA 3BD3A 5DEFB 3WIHH 1DVQA 4H0GA 4ZTPH 2HFFA 4AH2A 5CEXA 2FLMA 3RJQB 3IAPA 3BAEL 3MRDB 3FUDA 4HWNA 4P5TC 4UI2A 5FYKU 2P52A 5D7IA 4HIPA 5EH1A 5IVXB 5AVWB 3ROOB 1AGDB 4MWFA 4P9HH 2Z91A 4UYQA 3D0AA 3UMTA 2OXHA 5FM5M 4P2CG 3T8MA 1CF1A 3VD7A 1KPRA 2VSCA 4L3AA 5EUOF 5HJBA 3UYRH 1RP9A 2I69A 5IWLA 2IPKB 3TA3B 1WFUA 5KBPA 3GJEA 4OZHB 1E6JH 4QRQA 4FP8H 3SE6A 3EG9B 43C9A 1U8LA 3FB7A 2I9LA 3S0PA 1PZSA 1D7BA 1HCYA 1JZDC 2EECA 2IVFC 4N0UB 5DFTA 4A6YL 5LXGL 1MW0A 1BCIA 1MRFH 4L23A 4AWJC 4GRWF 3M6DA 4YBQC 2QQKL 5AFAA 4JE4B 1OE2A 2IANE 2AXGB 1RU9L 1WG3A 2CHZA 3QDAA 3PJSB 2A4CA 5B3JE 4JBSA 1H15B 4JHAL 1HE7A 4QXGH 3T6ZA 4CA4A 1RZ8A 2AGJH 3GHBL 2BVQA 3UCQA 3ZE0B 4UQ3A 2DM4A 3KS0H 5FO7B 1KTJA 4YZWA 3ARTA 3C8HA 5K39B 4HIJA 2QDVA 2X38A 4EN3A 2NY5H 1F4AA 4OGZA 1UCBL 1PX8A 1T1YA 1XH2A 2W60A 3GMOA 4RRPA 4AZ8A 3FT2A 2EDBA 3AC0A 4MA7L 1MG3C 3QI9B 2X0UA 3ZRCC 3GXMA 2WZAA 5F6HI 5HYIA 1BA9A 3L3DB 2P8PB 3RVXC 2F74B 2V2TB 3CTTA 4LAJH 2FAUA 1TLKA 2FZ3A 1R5VB 4PJ5A 4F7CB 3VCLA 2DIJA 2PWFA 3W0WA 3JV5A 4HA1A 5JW4M 3WYRA 3HC2A 1MI5A 1MJ7H 2JSFA 2X4SA 4U0QB 3C9NB 3V10A 4WWKC 1MRCL 3WSQH 2YJLA 1F02I 1TQBC 2QZ5A 1N5AA 2A9NH 2BY2A 1E2VA 3NPZB 5KYUB 5C9JA 4X8XA 2NY5C 1PKQB 4Z76B 2BIOA 4M6OH 3CK0L 2WGNB 4XPHL 3N1MC 5HGDA 3WKNA 2X12A 4ZZKA 3K71A 5IJVB 4YHKL 2Z4QA 2HLAB 3CDGB 3GMLB 3RVWC 4UM9A 2BIQA 1CGSH 1ZSDA 4IS6A 4M7JH 4OFDA 5KSUA 1NGWA 4L29A 2CIKB 3RWJB 4IU3B 1G84A 1CE6A 3KWWB 3WFBL 1UXWB 5JZ7D 1I9RL 1QFWL 3P9LA 4XB7A 1LM8V 1YN7A 2DQMA 4OUUB 5AAWC 1EVUA 4O2FB 2W0LA 1TZIB 4DPRA 5CCKH 3AWEA 4LQFH 1Q1PA 4TL5A 5BMFH 5I73B 4W9EC 4J3BA 4F33B 3D52A 1I8AA 2FNWA 3T2QA 3EJTA 4RWYL 5KSBF 1MJJA 1CWVA 2VXSH 4PWKA 4ODVH 1P7KA 3OLEA 2L04A 5CGBA 1F4WL 5IHUH 3L7FB 4P06A 5F9JA 1GYUA 1X7SA 3PHOB 1DN0A 1RZ7H 4OGYL 1JNJA 1OQXA 1SY6L 4W4OA 3VACA 3WO3B 5E08H 2AERT 4FQJH 3VGBA 1W80A 4HSQA 1I8IB 4E9XA 4XR8C 5IW6A 1BQLL 4HEME 2NPLX 1G7PA 5CD3A 3LSOA 5ANMA 1DBAL 4PGEB 5F7HA 5LAXA 3W81A 1TYEB 4G3YL 1BXXA 2EDOA 3R18A 2X6BA 3HZ3A 3H6JA 5HPOA 4MB3A 2WCPA 5IROA 4KVCL 2VQ1A 5D8JL 2YD4A 5L2KA 4YDZA 4ZQTA 2FBJH 4HCRL 3PREA 4HC1H 2AQSA 4M7KH 4WKXA 5GRXG 3VJ6A 4DSYA 2AV7B 1J0IA 4X80H 1RJZA 3VWKA 2P46B 2VXVH 4I3GA 2C9SA 2AJZB 3HNVL 5EC2A 5DJ6A 3EJJX 2KH2B 2W9EL 4TUKL 5F9DC 5AOJA 4O2CA 3ZSSA 5IKCA 3CSGA 2EYRB 4NKIL 4X6CA 4KJPD 2WIIB 3D12B 1E7UA 4ODUB 4MXWL 4PY8J 1HJBC 2QQQA 2NY2D 4XC1L 3RWHA 3G04A 1FFNB 3BZ4A 5DSCA 3V4UL 1C8PA 5IMOA 3ESMA 3HG1E 5JOFA 1I7RA 2H47C 3VRLF 4YPGA 2F8IA 4LVHC 4KWUA 5EZLB 2WKGA 3OAZH 3SPHA 3T0DA 3OKEA 3IAGC 1PDKB 2LOEA 3IDIB 4PS4H 3PLYA 4WI2A 5DJDB 1NMAH 2IH3B 3FO0L 5FCUL 4CVXB 5I1KL 3BN9C 2B9AA 1S8DA 4E41B 1A4JA 2LU7A 1P84K 4MBRA 1R1CA 3Q8EA 5EZOL 2XZAH 4ZZFA 1P69B 5T3XD 4CSZA 2A77L 1M42A 1DVFA 4IKKA 5KZCD 2PYED 4U2YA 1U42A 1CXHA 1FE8H 3FB5B 2IBZY 4LDLB 1VCBC 1I7RB 3EDJA 3RGVD 5I71C 3L4VA 3ZR5A 5CILL 4J1UB 5H37H 3T0EA 2ED7A 1DTUA 1EV2E 4I89A 3MUGA 3MRIB 4LCUA 3LRLA 2SODB 2WAHA 2ZWSA 1X5XA 2QVMA 1MREH 2QVKA 4L4TD 4Y5YA 3FU6A 2CR0A 4NOBA 2TAAA 4AYFB 4L3FA 3BCDA 2UZYB 3BYYA 3T2NL 3PAYA 3BJLA 3PJSA 5DS1A 5J1AA 2E7HA 2B15A 3A6CH 2WQSA 2ZUUA 3K6SB 1UD6A 5TE6L 4OLZH 2Q3XA 3GXFA 5IHZB 2UXGA 2CHDA 1NGPL 3D4CA 3VJ6B 2GSGB 3NCXA 1UB5B 1U4FA 5BVJB 2IV8A 4EN3B 3AS3A 4H0IA 5EU3B 5ACMA 5MENA 2NNFA 3VD2A 1WP6A 5GS0H 2EADA 2GTZA 4P3DB 2X6AA 3HE6C 3HUJB 5FUZH 4QWWD 5I1GH 3O3DA 2YGNA 3TA3A 3U7YL 2Q86B 3AY4A 2KHAA 5GZND 2D4FA 3X1FA 4LSUH 4X6FA 5T3XE 1XF5B 4DK3A 1R3HB 3AB0B 5TE7L 1T66D 3TJEL 1UWGH 4YHNA 5IZ7A 5H35A 4AVIA 3FT4B 2CLVA 2AQNA 1TG8A 3ESVF 3RWEA 3U9UA 1Y6KR 1VZGA 4QXUH 3QJZA 3SE9L 1KPVB 3MFFB 5IVXA 3MZTA 3GJFB 2WTRA 1WIOA 4R0LA 2G0KA 5KS9A 1Y6MR 4BFRA 3MJ9A 5JW4N 1EBPA 1ZXKA 2ADYA 2F53A 2PMZA 3O4LD 5IIEB 2WUBL 4HUWB 1MQ8A 2IH1B 2XDHA 1HOCB 4FTVB 4O9HL 4R97B 4ALAH 2MKWA 3FTGB 4FA6A 3A0OA 4NO0D 5IMLB 1OP5H 3P0GB 2J6WA 1DN0B 5HYJB 1G7HB 2GJ6A 2Q9OA 2MOVA 3HNTL 4PRHD 3HPJA 1ASOA 1X4ZA 1A6WH 4A2FA 2F8OA 1DBKH 5JHMA 1MXDA 1PG7L 4PJHA 5C0RL 3QDJB 3APFA 1R75A 1I9JH 1MWAB 1S7UB 2JK5B 1MCEA 2OSXA 2W0KA 1FVCB 4GI8A 3VFMB 4ES9A 3CX2A 2EE2A 2K6ZA 4B9IA 3WD5L 2B14A 5JOPE 4U1NA 4IRZA 2J5LB 5IHZA 3IE9A 3OJMB 3OKLB 3D7PA 1FCGA 3STLA 3WOVA 4EDXA 1S2EA 1WBZA 1FHGA 1IQDA 3GKWL 2APTA 3QNFA 2YXWA 1HIML 1TZAA 4DTGL 4NHUA 1A3LL 1XL6A 5DCCA 4IBWA 3U1SL 3PYCA 1ZV9A 2WJ5A 4HEPG 2MQGA 2Y3AA 4NRYB 1GTFA 3F12A 3U7AA 1NTDA 2BC4A 2LR4A 4KRPD 1AYOA 5E1AB 1OP3K 3CXHJ 4FG6D 3TWYA 3VFGH 1YPZE 2X4RB 5EZIH 4OAWB 3BSGA 4PV1C 1MNUL 5D2LF 4EN3D 3Q06A 4R96A 4MS8D 1OPOA 1J5IA 1M7UA 2HT4D 5KVEL 5AAMA 5D70L 3KG5A 2WB1A 4HJ0C 1OK8A 1OM9A 4XP4L 4LSTH 5D5MA 4C56A 2VH5L 1NDGA 1YG9A 1J8HE 4L4VA 1U33A 4ZW3A 2Q5BA 2YD8A 1YYLL 2VO5A 4XXCC 1N19A 5A2IH 5AAPA 3VFNB 1L7TL 4W6XB 4IRSD 2VTFA 3TCTA 3MV9E 3DX8A 2EINB 1AGBB 3DYPA 4TUJA 5E9DB 4ELME 5JIMA 3SYAA 4KJQD 4YSSA 4QTIL 4ES8A 4QLWA 1BREA 1SEBA 3O0RH 3FT2B 3ZL4L 1DJSA 5C08E 5D71H 2XWXA 4AENB 4A2EA 4YQXL 1ONQB 2OMUA 3FOMB 2WVTA 3HTLX 5GGUB 2DEXX 2W65B 1GGBL 1W0YT 2BX5A 2EEDA 3UBGA 1SBSH 5FV2A 1X5YA 4WFFD 2GEQA 2ICES 1B4JL 4B27A 4G6KH 4HZLB 3CMOL 4O00A 5LHDA 2VL5B 3CFTA 4IMLB 2DLFH 4HJJL 4M7ZC 3MLZL 3U1SH 3WLBA 3DRQB 4ZXBB 4NPJA 4FN0A 5KYYA 1U9KA 1JE6A 5I6OA 2BC4B 1G9MC 1OB0A 4QNPF 2Z4TA 4MA1B 3N85H 1BMZA 2WN3A 2QKSA 3DWTA 5SX4H 1D7DA 2DWEA 3NTCL 2IEPA 5TFSH 5BZDB 1KY7A 2A6IB 3NZSA 3Q01A 2XQYA 5FHAL 2NT1A 3TPUA 2BVPA 1U3NA 1U95A 4XX1E 1D6EB 4ZUVA 3SE8L 4UCFA 1YEGL 3PNWA 3UBXB 4LSQL 3SO3C 4PJIE 3SPVB 3QZWB 1MW3A 2ITFA 3AM8C 1O5PA 3LQMA 3Q3GA 4ETYA 2EEAA 1WBYA 2QGEA 3B7UX 5AVTB 2OMVB 3VFUA 5KVDE 1AQ8A 2VDPH 4BQ8A 5B3SB 4D0BA 1KIQB 1S46A 3EOAA 1QSZA 3PDDA 5AAWA 1M71A 4PRAA 4PRID 2P3YA 4RH4A 3CZSA 2CDGA 2C1PB 1LTXA 2X2UA 1SEQL 4S1RH 5JA8B 1M4KA 3OF6D 5JPNB 4ZAKB 2NQDA 3S34L 5L6YL 1EAOA 3P30L 1U8QB 4CMHC 1EO8H 4AM0Q 1U8IA 4QDGA 3OKKA 4UZSA 4G8GD 1BG9A 4YSTA 1LP9F 4DH2A 3ATFA 3CDCA 5JPMC 5I82A 4M5ZL 2CHXA 3FFCD 2FR4A 2ZT9C 5ES4B 4XMWA 2YBRA 3DA0A 4LBEA 4GXVH 1M1XB 2IBGA 3MRRB 4HT1L 4YHYB 4OKVB 3B2DC 4U1HA 1S7WA 4ZMZA 4U1LA 3BDYH 1GCYA 1BP3B 5DD0H 2X53A 4BDVB 5GGRA 2G9HA 4XNUH 1BYNA 2C1OB 2EDFA 4ELMF 1ID2A 3ARWA 4AXWA 3EJPA 3BP7A 2Q7YA 3WS3A 2KZWA 2A6JA 4BZ1A 3D48R 3ML8A 3D85A 3VFPB 2JCCA 5E95B 5J1SC 2B3IA 4TVPE 1CFNB 3EBIA 5FPIA 3O11B 3L4YA 3B9EA 3K72A 2OX5A 3VXMA 4EUPH 1KV3A 2CA4A 2COQA 4Q9CA 1QPXA 3D0LB 3HR6A 4DO5A 2IMMA 2J8HA 4EDXB 3WFDH 2ZCHH 3D30A 3KL0A 3GIVB 5DA0B 4OZFB 2A6DA 1H3XA 4RGND 2C3HA 2NXZC 5E0QA 4N9GA 1U36A 1XGYH 3O6FC 3V52L 4XNAA 2R0WL 3WAKA 2PPCA 2KT6A 4QXTA 3AADB 1N26A 1KJVA 2VLKB 4J1UA 1BXUA 3MO1A 3V7AE 3DMMA 3IDUA 3HMXA 2X10A 6TAAA 3BT2H 1XR8B 1KENH 4S1SH 5DZ9A 2NY0B 5HI3C 3QIWB 4MSWB 2J88L 1JK9A 2A0LC 3U46A 5CUSH 2CJUH 3VGHA 3LEYH 4X4KA 3W2DH 1HVXA 1T1WB 3EADA 4HUXB 4BELD 2CGRH 4KJPC 1CBVL 5D9SB 4NJ9H 5IQOA 2WSDA 1FWXA 4A2MA 4G7QB 4EPSA 1TQBB 3M1BA 3OLGA 2LU3A 2R2HB 3FPYA 4NCC2 4OKDA 4EI5C 4X7SL 3FUMA 3V4UH 2ZUYA 3ZO9A 4J6IA 3UAFA 5HJGA 5JOPD 1F1AA 2EYTB 5AW4B 3ABGA 2VSDA 1KTRL 1IEHA 2CLZB 2KMWA 3EBAA 2UZXB 3JTTA 4FJ6A 2CLZA 2YZ8A 3TONA 4BM7A 4Y5YC 5EZPA 4ZDHA 2AXJA 2J88H 2HT3D 1L9NA 4ODUA 2YJQA 3ARGB 4AIZA 1HU8A 4RGOH 5CGTA 5C0GA 3QUHA 3CN3A 4U0RB 5TTRA 3QJVB 1IC5L 3KPNB 7PCYA 5FUOH 4DERA 4L0PB 4PIBA 3RY6A 1BAFL 1D5XB 1Q94A 4O4YL 2OR7A 5AB1A 4M8RA 1P4UA 2RFXB 3D6GA 5JZ7C 2X3BA 2R2EA 4ABUA 5I76A 2PUQT 5EN2B 5IGXH 5C9KA 2DQHL 2P7TA 3WELA 4WWID 2VQ1B 4DEWA 1S5IH 3O6FD 3UO1H 4GSXA 4G83A 2YSSA 3HHMA 3MA9L 4M43H 3D87B 2HH0L 4U2ZA 5FYJE 4QHNA 2B59A 2E8ZA 3CVIL 4HWEL 1MH5B 2HCZX 4U6YB 2GCYA 4N2KA 5BJTB 4JFQB 2DI9A 2R69H 3QORA 5DVPA 2X09A 2ODIA 4K8RL 4OQTA 1KT2B 4APXB 4M03A 1T20B 3LV3A 2ZAGA 3VI4F 3CHRA 4LZKA 1KTKE 4B60A 4JN1H 1TU2A 1X5LA 4Z77A 2MEJB 4N2FA 4OJEH 1DVZA 2FSEB 1D7CA 2HN7B 1G5AA 3AWFA 3DTDA 2EVGA 1MJJB 2VXTH 5FKPB 5KSBB 4LQFL 2NY0D 3QJQB 4XCEB 1Z6JT 1FBIL 2PTUA 2Y36H 4P4KA 3KPLA 2GABA 5KVEE 3ZTDC 3WY3A 4PRIE 3DRTB 4GMTL 5JYLA 4IDLA 4X9HA 1RXLA 2VXUH 4K2UL 4OUUA 2V7NA 1SN0A 2UX6A 3D07A 4CVXA 1JWMB 2WAQA 3H8NA 3HVDA 5HHOE 3PWNB 1GPOL 2CNYA 3ARFA 2NY7H 2ZF8A 2XUWA 3ZDYF 4OKVA 2ARWA 1O6VA 1E9QB 2C9UA 5CSZB 2X7LB 2CGYA 1N4XL 1CTNA 2K7PA 3AS1A 5E0FA 2NXZB 3F7LA 4Y9BA 2F19L 1UQSA 3HOGA 2WUCH 4X7SH 4IGBB 2F5BL 2H8PA 32C2B 4P23D 1UUSA 4NKMB 3KDPB 3KLSA 4TNFA 1RMFL 2WXGA 5CIPA 3FUFA 5KYUA 3NDZE 4KKNA 3ECWA 1E5ZA 2C3VB 2HLEB 4NO3B 2A4ZA 4GP8B 5CUSL 5LBSL 2R9HD 4YDJA 5FHBL 3LHAA 3DHUA 2JCCE 1R5VA 2I25N 2WYZA 4AV0A 2IBZX 1Y1UA 5HHQA 3HC4H 3HE7A 1LE5B 3KYOA 2QFRA 3DGGB 4O51B 2B59B 2DD8H 3GSNA 3X3GL 1IFGA 4L0YA 2GK0A 1HAWA 2X70A 4R7NA 3AUVA 2R29L 5JIKA 3LPFA 1L6PA 2D9CA 1T1YB 4UIKH 2Y5TB 1IAIM 3MA7B 1QATA 1YJDL 4G6KL 4IRSB 4TQEL 3QNZB 4TLTA 3UTTA 4EIGB 1BBJA 1OAZL 4FYSA 1QA9A 1X5MA 3UGXA 1OW0C 3CFNA 4M6NL 1B2WH 3PS6A 2E76C 2DKUA 1H15A 1GA2A 1NFDB 3WEXA 4G6AD 4DO6A 3CDFA 5JR1L 3QJOA 1CT8A 1X44A 4QTIH 2MPAL 3JVGC 4PRIB 3BMVA 4JANA 1KCSL 2AV7A 3QUXD 4PJDE 1XCWA 4LCCC 4RNRB 5F8QC 5J13B 2EVJA 5DD1H 3G08B 2UY6B 2X4NA 5J12C 1IT9H 1AHWC 2UY6A 3JSSA 4WWKB 3RUGA 3S36L 3LRSA 5D7LA 1PS3A 5I0YA 4C59B 1KGYE 1M2OA 5D70H 4KJQC 2AK4E 1TJGH 2H2SD 3IJEA 2I24N 4JM0A 4LARL 3IDYB 4H7VA 5I0XA 4OZ4B 5CN2A 5G4MA 1MN4A 1LE5A 2V5RA 5A2CA 5HHVH 3NBNA 4X4YA 1HH9A 5C8JB 4PJEA 1OLZA 1C08B 1DQKA 2OFQA 3AM8A 4G9FA 4Z9KB 1OCWH 1EZVX 4MCYB 3LPOA 4Z7VB 4A2LA 4KNUA 2XFGB 2EDHA 4RFNC 3SZKC 1OAXH 2HJLB 3BAXA 4KI5F 4LMQI 4OR1A 3ROOA 2Y06H 4R3SA 5K9KB 1HKLL 4GLRH 2YAHA 4MA1C 4MMXC 1E5CA 5I0WA 2ZPKL 3D2UD 2GUYA 3NEOA 4P59H 1A3QA 2HT2C 1JV5A 1W8OA 2DEYX 3FFCA 4S1RL 4P48A 1AXSB 2DN7A 3ULVE 1SBBA 5HHQB 1R24A 4WY7L 2YRPA 3QK0A 3VI3F 1B4TA 1MJUH 3MNVA 4YAQA 4WW1A 1I1RA 3AS0A 5GZNC 4M8QB 4NHUB 3MOBL 1PBYA 3SKOA 1JGEA 5JPMA 3MBED 5SV4A 4NENA 4NNXB 3IF1B 4KFZC 3LEXA 4UOQA 1QMUA 4M6ML 3QEQE 2NY1D 1TT6A 4Y2DB 2PYFB 1RZGA 2XWJB 1NJ9A 4A37A 3T4YA 2FO1A 2GIXA 4NRZB 3NIFE 3ZX1A 2VDPB 4LVOC 5I1IL 3FUNA 3KMDA 1NBCA 1S7XA 2E9GA 3ZRFC 3MV9A 1SN5A 2VO8A 3C9NA 2XBDA 2BPBA 1YUKB 5INCB 1X7QA 2X3CA 1EGJA 4L1LA 3BRFA 4HJJH 1HL4A 4TNVK 5EO9A 4NQVB 3ZO0A 4F37F 5EBLB 4FXKA 5ETUB 4LCIH 4XC3L 5DHVA 3ZTCC 4AL8H 2X1QA 1UOKA 4BJLA 3VXOB 3HN8A 1KCRL 5FGRA 2XV6B 2WQVA 4GIOA 4ABWA 1H3VA 5HHXH 1RULH 4GB9A 4AVKA 4U3HA 1LYQA 3TT3L 2FIRT 1OZTG 1X5FA 3B2XA 3OPUA 4L2YA 3S36H 4U1SB 4MCZB 4CADB 5DC9B 2WTOA 2XQBH 4QRBA 4Z7VA 3MLUL 2VWEC 1N0LA 4JDEA 4POYA 1YUHB 2WBXA 1L7TH 4OLUH 4JHBA 4OF0A 2XBZA 4O5LH 2CO2A 2UVFA 2VH5H 5AOKA 5DT1H 3RWDB 2PO6C 3GRBA 1AXTL 3DTXA 1A1OA 1FNHA 3SO5A 3BGAA 3ZE1E 5EOTA 2OYKA 2X4TA 1KDJA 3VXRB 1GH7A 3CU1A 1WBYB 3BRGC 2OMYB 5IW1B 3K80A 4WO0A 4A7UA 3F05A 3V2AR 1QR4A 3BUIA 2GJ6E 5GGSA 3ZKMD 3ZYOA 1RL1A 4BQBA 2Y7QA 2E3VA 3KYKH 3HC3H 1AZVA 2HX8A 3B3IB 5TF1L 5DLML 5TH2B 2ERJC 3VSUA 3WTTA 3GSQB 2BY3A 3V6ZA 4XO9A 4L1HA 1M7DA 3S3BB 3K0WA 4OCLC 4H13C 5JXEC 3BUBA 1XF3A 5EZOH 4PWEA 3KGTA 4PJ9D 4DUWA 1V3JA 2R23B 5CZVH 4HCIA 4N3TA 3MLSH 4WEUD 4XBGA 4DUVA 3KCWA 3RJOA 4EOWL 3FO0H 4HFWA 4Y4HB 1ZT7B 3K5SA 1E4XL 3ETBJ 1RMFH 3TBSA 3BH8B 4OT1H 4R7NB 4W93A 4B3EA 4UZUA 3DJTA 1N5AB 5AVSB 2QSCL 3RY6C 4NRXA 3NJFA 4JDZB 2YN3A 1J9SA 4K23L 5LO7A 4LP4A 1H9VA 4HALA 1FSKB 2BINA 3QDMD 1L9PA 4RZKA 3RWFB 4P2OD 5DZAA 1KJ2B 4TVUA 1WIPA 5BCAA 2CKBB 3TZVB 4L0ZA 3DX2A 3V0GA 4Y4KB 3VDCA 2YMXH 5E1GA 4BFGA 1H6FA 3ELAT 4UTAL 4Q6IA 5C7ZA 5CGMA 4G6JH 1WCBB 5F0MB 5JA9A 4AQAB 2KBGA 1HOEA 2D73A 1KJVB 2VLKA 1JGVH 3WS3B 1JMZA 1T4KB 3ZRSA 5E8PB 2QELA 4OCSH 1JGLH 4PP1C 4ZFGH 1XGPA 1A9BA 3QQXA 5ESVB 3RGBA 2CLRB 1A2YA 1BZDA 3HAEA 4HX1B 3ULVF 3HRZC 2YD1A 1GZHA 1K4DA 5JO5B 2VNCA 3BO8A 4UQDA 4KDWA 2LLLA 5IBUG 1BEXA 4QO1B 1OANA 3H9YA 4CILA 4R97C 2OTUA 2YD0A 3HZMB 1RPQA 3X13A 5B8CC 3S8FB 4UOW0 3DDFA 2Y1AA 3DHPA 4E5XB 1ZVSB 1Q0XH 5DJZB 1S7RA 4NDMA 4AXWB 3CAFA 5DRXB 1HYSC 1F8TL 4FX5A 4M43L 1IGFL 4PYHA 4BK5C 1RZIA 4RVBA 2Q3AA 3V0VA 2AKRA 3UC0H 1A64A 3GXPA 2VKXA 3SCMA 3UO1L 1A9VA 2QVTA 2WKLA 3OWRA 2LABA 3EFFB 1CFQB 3L3HA 3QQ4A 4ZUTB 2VUYA 2AP2A 5KYXB 1JF5A 2BHYA 4KDVA 2JJUA 4X7EC 1AGFB 1TETL 2VJ0A 4P8QA 3LYRA 5D6CA 1D6VL 5HYJA 5FYJD 4M8QA 4NKOB 1Q8MA 1CG9A 1BVNT 2Y7SA 3HKFA 4K4KA 4FXLA 4TOYH 2XFXA 3EH1A 3F7VA 2XU9A 3VXTB 3ELQA 4MFHA 3D0VB 4G5ZH 1EO7A 1DEEB 3DUSA 2EP6A 3H3PL 3LZPA 3QR0A 4OBRA 3QQ9D 1PEWA 4U6VH 2W80C 3U6XA 5D1QC 3G5ZA 3ES6A 3GUTB 3GLDA 1GY1A 1R0AL 2C7UA 2DL2A 1WF5A 1YMHB 3CLEL 4TNEA 2A9NL 3DJRA 3L5WA 3HJEA 4B9CA 2M8XA 1MJ7L 5GS3A 1PZDA 1IV8A 1TMQA 1PG7X 1SJHB 3BFQG 4H8WH 3CFEA 3OMAB 4XCFL 3VXRE 3T1FA 3RI5F 4IMKC 1SHXA 3QWOB 4R2GC 1F58L 3QEQB 3REVB 4DAGL 3BP4A 1JG9A 1HWGB 4RGNC 3UBXA 1CUOA 2VAAA 3V7MA 3LNGA 4PRHB 2W0PA 2X4TB 2P80A 2AQ3A 5DEGB 1VZHA 5F1OB 2C9RA 1JXDA 2EXWC 1BQHA 3U0TB 4ZFOA 4PRIA 5KVFL 3D2UB 4AC2A 2EH7L 1VZIA 4WU7A 2HG5B 1OAKH 4UTBH 4Z1PA 1W0WA 1FN4B 2EE0A 4IIQC 2IXQB 2FNBA 4Y5YB 4S0HA 3C5XA 2E74C 3DTUB 1A9BB 2EC8A 4B5ZA 4FNPA 1JYNA 2QPDB 3L4CA 3MBXL 4Y5VC 1HNYA 3KPRA 3V9FA 3OB8A 1ETZA 5ADOH 1WWAX 4XN7A 4DOHB 2L7EA 4E68A 1GL4B 2D4DA 4NFDA 4NAJA 4K07A 2PW1A 2ZOLB 1BD2A 2APVA 4KXCA 4HIJB 4FQJL 4QMEA 5LXGH 4XO3A 4PY8I 3EGXA 4EAEA 2D2OA 2WLLB 1W8NA 4JDVB 4LCCB 4CC0A 3RFZA 2F54E 3PUCA 2VN7A 3U4EB 2YPKB 1EXGA 1ZGLM 1FCCA 3QZBA 5IBLC 3WL9A 3ZE1F 4ODVL 3NRPA 2BWDA 1VGKB 5TQ2L 3S5LG 1KGUA 2B1AH 2VR7A 2R59A 1RUQH 4I9XA 1TVBB 4PJ9C 1G6RH 4QTFA 3MRKA 5HGAA 3SQBA 2X2YA 4WTQA 2YEVB 1LEGA 2MCG1 1T5XB 3OKLA 4K3GA 3IU3A 5ACZB 4D9QD 3PWJA 1PD0A 4QRAA 3HR5B 4HKBA 1QHQA 1FNEB 2HSIA 2E47A 2AV1B 3KLHC 4L8SC 1LWJA 3LEXB 1MFAH 3WIHA 1P4BL 4N1CA 4FQCH 4GI9A 3F5WB 5HPMA 4LSPL 1A9EA 1P53A 2OULB 2WMPB 4MGXA 2Q6WA 1SEQH 4A63A 1KJ3H 2QZQA 1CU4L 4AG4H 3FS9A 1K4CA 4NQDE 1BD2D 4KTEH 3EFOA 1SVZA 5IM7A 2QQLL 3GLZA 5IW1A 4XMVA 3CHSA 3FT0A 2IG2L 3ERXA 1BQHG 1KXVC 1U8OA 1WTGT 2OL3B 5C7XH 1R3IL 2Z7YA 1E65A 4Z7VE 4R0LB 1RKRA 2EIKB 2UVEA 3QEUA 1MHEB 4Y2NA 1XGQA 5EU6A 4EQ3A 2AEIT 2FLBT 2E9BA 3VXRD 4Z7WB 4PG2A 3FN9A 3PP4H 3P02A 1N5YH 1QFUL 1UADC 1IGJB 1KIUA 4MA7H 2ENJA 3VXUB 3GI8L 4XXWC 2VABB 1YEJL 3FTSA 4JE0A 4HIXH 1GHFH 1E8XA 4QLRA 1N64L 2P24B 2WY3B 4JRXD 1MJ8H 3K4AA 2Y1VA 5DS8B 3WXWL 5IFJA 3BVVA 1CDUA 2YRBA 4G8FA 3AAZB 2H32A 1UXSB 3OJDA 4RZCA 5DRXA 2Y07H 4R4ND 1D9KA 1EIBA 4LAQH 5IB1B 1WC7A 4EIUA 2OMZB 4GAGL 4PGCA 3DGDA 4QRPB 1Z3GH 4RMUA 1BX2B 1X5KA 1I7ZB 1INQB 1RUAL 2FYVA 4N2GA 1KIPA 2HJFB 2Z31C 1MQKH 3PL6C 5IHBA 4LDOB 3FJTA 4KY1L 5E23A 1UFGA 3KLKA 3GK8H 4KOBA 5DO2C 2N7SA 4D0DB 1ZMYA 1T6VN 5FA4B 1BBDL 1FPTL 3PWVB 1HSBB 1XL4A 1KG0A 5F9WC 4D8PA 4KZCA 3MV11 3SBWC 3BGMA 4NLHA 5DQDL 5I2IB 4XP4H 3V5HA 1DUZA 3ILQD 1KXTA 2B1HL 1ZPLA 3CXDL 3OJVC 4RISH 5CMAB 3ME0A 4JUTA 3W9EB 2V4LA 4R7DA 4AX3A 2HT3C 3A21A 1XV8A 1DSYA 4H25B 4L9LA 2HTKD 5DVKA 3NSCA 4J3OD 2N3JA 1ACZA 3N43F 4YE4H 3MLTB 2Y1ZA 25C8L 1TTCA 4OCMC 3BVXA 4P9HL 5DJCB 3V8CA 4I18C 5I0DA 4IDJL 4P57A 5BS0B 5DK3A 2JXMA 1JL8A 4JAMA 5E6UB 2IH3A 5HBBA 3LH2H 1BVKA 4BFIB 3A67H 1F56A 1T04B 2GJZA 2VDLH 1A4AA 2IAMC 3LKRA 4MXVF 5DYOB 3W9EA 4LF3B 1RURH 1C8QA 1SDAB 5DUBB 4RAHA 2B20A 3KPSB 1X9RA 2H2SC 1JK8A 3ZR6A 3TNMB 3MODH 2XTSA 3TV3L 2RQ8A 3UERA 2BVUA 3KBPA 4P46B 2AEPH 4JO4H 4LSSH 1FLRL 2PR4H 5LWYH 3QS3A 4MMZC 2WQ8A 5ABDE 4N2NA 4ALAL 3SZ6A 2H0EA 3PWPE 3VMOA 1CFNA 3U79A 5LQBH 1I85A 2OP4H 4MAUL 4P5MA 5F7LB 2OMXB 4UOJA 5GJSH 5HYEA 1GZHC 4JN2B 3RY5A 3JVFC 3ECBB 3NP3A 1TXKA 3OQRA 4LVOB 3PAUA 4N2HA 1P4IL 3LB6D 4GRMB 3OD3A 1IKFH 1U30A 1FNGA 3WNMA 1Z9NA 4OSUH 1Z66A 2GPZA 3LS4H 3NIGB 3P4LA 4I0PD 4K9EL 4HXAH 4PY7A 5C2BH 3SOBL 4LNRB 1SYSB 2AAAA 4PJEE 4QYOA 4ZYKA 5LGJA 3Q05A 2ZAHA 3OMZA 5C3TA 5T1DH 2JELL 1M6UA 3TJEH 3IFNL 4DW2L 3HS0B 4JJOA 3T3PF 4UINL 3GWJA 5BOJA 3FU8A 4JCMA 4KAQH 5C3LD 3BYTA 1O9WA 2NY1C 3AREA 4F7PB 4AGMA 3G5ZB 1KZQA 1WZLA 4R4FH 1OGAB 4AMKL 2R0LH 4YSEA 2FT8A 1RZFL 2DY2A 1LP9B 1G7LA 1R4XA 1JPGB 1SYVB 1OHQA 2Z35B 2ICWI 2V9RA 3ARBB 2VZOA 3MV7D 4PAZA 5ID1A 1TF4A 5D5ME 1TZIA 4OLYL 1S7TA 4DUXA 2BZDA 1E4JA 1S3KH 1RFDH 4YX2L 1DSFL 3SSGA 4GAJL 2AXFB 3O3AA 3P11H 1A9EB 4HYTB 1MXGA 2WM0A 3HUJF 2FL5A 3D39D 3KW8A 4A7GF 4C54A 4Z7QB 5BV7C 3L08A 2BP0B 5DK2B 3VI4E 5J0BA 2O6EA 5I23A 3VSQA 2UV3A 3JWDC 3IDNA 4AE0A 1S9XA 2BSEA 4N0UE 1KACB 1U21A 3EJRA 4WDIB 5IESL 2BIIA 3GIZH 5C86A 2H1PH 4W9GC 4AQ1C 4DNLA 1GMEA 3PGDB 4D0CB 5JW5A 4K55A 1B2YA 4IEFA 4K94C 1M3JA 2B16A 1QAWA 3V0HA 1X9UA 3MRGA 2XQYK 1U93A 1R5WA 1CB4A 3MLRL 5IB4A 2CCVA 1RERA 3UH8A 1JGDB 3RNKB 1IRAY 1UA6H 1JV2B 2XXFA 3CZFA 3L3OA 3MV01 4IKNA 3L6FB 4JO2H 4F3FB 2JKTM 6FABL 1HZHH 2VC2L 3SGKA 3F7RA 3VI3B 3WY1A 3BQUC 4YFLI 2VRKA 2F61A 1IVLA 4KHTH 1WZ1L 1JN6A 4IMLA 1RIUL 4F9PA 4FNSA 3L3IA 2NYYD 4BQ6A 4OD3L 1F3DH 3RU8L 4I2XA 4TTGA 1OPGL 5TDPA 4NUQA 4P9MH 5DFVC 4LIQH 4MMXB 5EOCL 1B88A 2G2NA 3DXAA 4UM8A 4UTAA 3WN5A 1VERA 2XPYA 2VDLL 2YOAA 2OQJA 3D51A 1L4IA 3RJDA 4AL8C 3CFBB 2E6QA 2LAGB 3JTSA 3QZOA 4C58B 4WK0B 2KDGA 1T21A 2KQMA 5E8NB 4H20H 4DGIH 1LILA 3FAXA 4J4PD 4EN2A 3UTSB 4HHWA 5DD6B 3PGCA 4P04A 2XZQL 1AANA 1XXDC 3IFOA 2FBJL 3RUGB 3D85B 5FA3B 2WOBA 4DP1X 4JHWH 4QKTA 5GSRB 1QRKA 2BXZA 1XIWA 5D8JH 5B3JF 2WXQA 2JKJA 1FYTE 4PJAB 2DF3A 4AUJA 1SJEB 1KIRB 2DMHA 3V5DB 3HRPA 2Z93A 4LHUD 1CTMA 4WNQA 2R2BB 3REWB 3NA4A 3NPSC 4V1DB 5EWIL 4X9BA 4X8JA 1BQLH 5BRZA 4H1LH 2UUDH 3RE0A 1USZA 3IETB 4Z78A 2RMNA 4PJ6A 4MD0B 3MACH 5C09E 5C70A 3GSNH 3CLFH 4TKWA 5FYLD 2Y5TA 3MA7A 3F6LA 2FWLB 4N2DA 4F5CA 1D5ZA 2D3NA 3LZRA 1EAPA 2VXSL 3L16A 4L8SA 4KX7A 5LG6A 1S3RA 4QY8B 1DBMH 3T1FB 2G3ZA 2G5BA 1F3JB 1QBMH 1QI5A 3WKML 5I9QC 1P5UB 3SGDI 3TT1H 2X6CA 3DARA 1F13A 3WY4A 1KPUA 4UIMB 4D7PA 1QTSA 2VABA 5HJ3A 2EKSA 3BKCH 1PNCA 3QS2A 4OLXH 1E4WH 2CUMA 3HC0A 1QFWH 4MWFB 1EFXD 1NUFA 4G1EA 5HI4C 1KBBA 4Y1AA 1UURA 1DVTA 3S5LA 1GHFL 4Y19E 4JFXA 4LLMB 3UDWC 4GG6A 2AS5M 1V5JA 3O6ML 3HZYA 4NYLB 2DM3A 4NPYB 5FDWA 3QA3B 1X5IA 1TIUA 3D09A 3H53A 1ECZA 1CFQA 1QFUH 1UJ3C 3DXAD 4Q8BA 1U3ZA 4ZS7L 2J2ZA 4F7MA 3DSNA 4PTUB 1P6WA 1URIA 2ZCKL 4M6OL 4XXWA 1KNOB 2FDBP 1TKWB 4IGBC 1WISA 5GJTH 1MPAL 2EH8L 1UFUA 1DVYA 1LD9A 4TQHA 4UDTB 4AV5A 5CAYB 4TNWF 3PXLA 4NO5B 3NSYA 2HG0A 4XCNA 5TE4H 4XVTL 5DJAA 2QQLH 1SPDA 5BQ7B 4BSVB 3MRBA 3NFSL 3DHJA 4LDCA 1X6LA 3ZYJA 1DVXA 3GLEA 4PEEA 5HYSB 1CLYL 3GMLA 5A6IA 1KTLB 4N5EC 1KIRA 2EYSB 1JHKL 1GRWA 3JZ7A 3LN4B 5FYKL 3FQTA 4ODSL 1JV2A 4RAVA 2I7OA 5E99H 3RPIA 4F1SA 2V5MA 4YDMA 4E0RB 3TTSA 3WKQA 3U1PA 5F1SA 5AOMA 4A7VA 8FABA 5E5RB 5F3BA 5BZXA 3Q8BA 2QT6A 3E2HB 5CN3A 1RJCA 5D96C 5ACLA 5T3ZD 3BKCL 4GXUM 2CNZA 4OCXL 4TUUA 4JFYB 4GT7A 4M1DL 3WL9B 1FO0H 1NM9A 2XA8H 3WJLA 1KWKA 1I1AC 2B1AL 1YVLA 5TQ2H 3H42L 4OGXH 1CLZH 4F7MB 1XB8A 4EVNA 3VTAA 1UHVA 4XCYA 5DRNB 3SO3B 2XWBB 2Z7UA 1ZANH 3ZZ1A 1T89A 4ZSOA 3SQOL 4MVBC 3UCRA 1HHGB 4JZJC 5ICZA 2PTVA 1MFEL 3MRQA 4WGWB 1AH1A 1FORL 4G6FD 1BECA 3PV6B 4YHZH 4UAHA 4J3UA 1K8IA 5AUMA 3SQOH 1A7RH 1FNLA 1W0WB 3NABH 3NSJA 3G6JB 3Q2VA 2MMXA 1LO3L 4E41A 2AJYL 1UD4A 4QOKB 1FFQA 5B1JA 3QISA 4W4NA 3IT8D 4AIZB 4PJBE 5C0JA 5I1LA 1N8OE 5DJXB 3BZEA 1NKGA 4Q52A 1KFAL 3ZMNA 4UDTA 5GRVL 3TBVA 3EBHA 1BFSA 5J8OA 4K3JH 4XP9H 5TK2A 4ZMYA 3O6KH 4TLUA 1GAFH 2HRPH 4YN3A 3HFML 4YUEH 2YQGA 1N9PA 2QBWA 2X4NB 3QGVA 5LKNA 4JM2C 4NT6B 2NXYB 1MWAA 3MRPB 4PP1D 4P05A 4F8PA 3BT0A 1I7UB 5D4JA 1G4RA 5DI8A 3I84A 2A9DA 3TVMB 2QEJA 2KZKA 4QOKA 4X99B 1CLYH 3B5TA 4JK0D 4WHDA 3UOAB 4LIQL 4EMZA 1YN6A 1RZJL 1YO4A 3GYRA 3IE4A 1JP5A 3G5YA 3HZKB 3VA2C 5K59F 5L7XH 4AQEA 3EXLA 4L1TA 3DURB 2AJ3A 1RIUH 4EQ2A 5DHMC 2A1WL 1MPAH 2EH8H 4XN4A 3MO1B 2ADIB 3KPQA 3ABZA 1IBGH 1K2DA 1T83A 5J9PB 2TRYA 5C0BD 1RPUA 1WSST 3GS7A 2F68X 3VXPA 2K1MA 1M7XA 4C56E 2MFNA 2N1KA 3UTQB 1FIGL 4MHHG 4HP5A 3C6LC 4WO4A 3KBEA 4G5ZL 2YK1L 2FX9L 3KCPA 2COVD 4X5LA 2BP5M 2QADD 4QCIB 5LBSA 3QUXA 5KWYC 1LWRA 1I3RA 4YH6A 5INCA 1UD8A 1E4WL 3D69B 4YDIL 1MFNA 2FQEA 4JG5A 1FFPB 2F1EA 3IDJA 4I2XB 2PTTA 3N91A 4UQEA 1JRHI 1MHPL 4CSSA 2ZOKB 2XIBA 1WA0X 4OAWA 3L7EA 4OFVA 4DQOH 3V8OA 4PG9B 3WTWA 1NKRA 1QBML 2JI1A 5FFOA 3APDA 3F65A 3TBCA 5CEZL 1NLBH 4OLWH 2VR4A 4X7TB 2R51A 4QRPE 4XOCA 2XTJD 1AR1C 3P3SA 2X42A 1RZKL 3L95A 3EUUA 2XKNA 2CBMA 1V7NL 2BWIA 1F86A 4DHLA 1Q0XL 3SCMD 4O02H 1RI8A 3T6VA 3BLPX 2DM7A 4RRPG 2BMKA 1WHOA 3A22A 4D0CA 5T3ZE 3B2UC 1HDMB 4PJBA 2LQRA 4DGYL 2WWKO 5HY9B 3Q0HA 2PYEB 5F96L 3AQYA 3ARDC 4YXKL 5CHNB 1B0WA 4YFEA 5DJ8B 3MNWB 3ENEA 3EJQA 1CL7L 1E5AA 3GSRA 2WXLA 3I02B 3OZ9H 3L3OC 3MLXL 1U8QA 1P9MA 3QQDB 3Q9PA 1NPUA 1PX4A 3AQXA 4HVBA 1KCWA 3V4PH 1S5HB 5EEZA 3IRCA 4XMUA 1XH1A 2XPGB 4PRPB 4P57B 2EDNA 2W0FB 4OSUL 1PZ2A 3AITA 1NQBA 1T2QL 1N6QL 3CZKA 2QPFA 3H7BA 4X5PA 5KSAC 4DZBA 5J3HC 3RTQB 5IIEA 1KCUH 4JG0H 1DFXA 2QVFB 3CIQA 4ODXB 5GJSL 2IWKA 1CXFA 3RB5A 2BSSA 4ZMTA 3OHXA 1PYWB 1EXUB 1JD9A 3E6FA 2GVYA 3W37A 4KXZI 3ARVA 1MHHA 2IGTA 1H3WM 3G04B 2O5ZH 4N8CH 5IK3A 1VPOH 3ZZQA 5K39A 4WDIA 3FFDB 1AP2A 5DMKA 2MQCA 4UNTA 4H88L 2XN1A 3H1ZA 2JJSA 5DC0A 1NH6A 2UYLB 5E4EB 5MEQA 4YR6B 1U2HA 1OARL 4CKQA 1I3GL 1IAKA 2WHVA 2AJZA 3T4AC 4R6UA 2HT4C 3FF8A 3WJJA 4KK9D 5JTWA 4BIKA 4PJAA 4ZO8A 4JLRA 4WUKH 3GNML 3LMJH 3M07A 2G3XA 3PQYE 1TYRA 1KB5B 3A5VA 3MMEA 4JZJB 2FJFA 3O2DL 5C0DB 5EOTB 3NT0A 4CW1A 5EFIB 3EOBB 4Q9BA 1OQOA 4NQUA 3WUWA 4FLSA 2GT9B 1J1OL 4HKJB 2W07B 4ZOBA 2YARA 2V5YA 1A6ZB 1RSYA 5I1CL 4EZLA 5F7NC 1DO5A 3ZHDA 1Z5HA 2DQEL 3BKMH 3P3RA 2EABA 4MAYC 3P3YA 4F37K 1ETA1 1TQWA 3GEWB 4J3XA 4XAWL 3UJJH 5JYMA 2QJDA 4GG6E 1QW8A 5AW1B 1XF1A 4MZIA 3QE5A 2HWZL 3ARGC 5E9DE 1BBDH 2X70B 1PIGA 4TXVB 4LCYB 3HMXL 1WS8A 2DIEA 1WT5A 5J12B 1T0NB 2R1WA 4FQ1H 1FZJB 1A14H 1CFVH 4JPKH 3D50A 2BSRB 1L7IH 3S48A 1HQRA 4LKXA 4B96A 5ETUA 3WCYA 3IGAB 1S8DB 3AG1B 3KL5A 3UDWA 2BH0A 5IB4B 4WV1C 4JQIH 4H1LB 5H37G 1CQYA 3QO0A 2DJMA 3EH4B 3DOIA 4YXHH 3STLB 3OQ3B 5T1LA 1XIWD 4DW2H 1Y6NR 4ZOAA 3O3EB 5E70A 1UYWL 1PZUB 2JNZA 4IGBA 1TCRB 3Q6FB 3BD4A 4HXAL 1OSZB 3FQYA 4Q2ZA 4D8PB 2FB4L 1JZJA 1YQVH 1IUZA 3QJUB 3FKUS 3LN5B 1ACCA 3FO1B 1R6VA 3O9WB 1TITA 4N0FB 1A7NH 4NUJB 4MS6A 4P2OA 1FYTA 3TGXA 5FW7A 4KQ0A 4L8BA 1CTOA 3FT3B 2O6DA 3KNBB 1BX2A 4ZG1A 3VX1A 5FB8A 4M8VA 3VO0A 2E4FA 1KYOK 4GFTB 5E1HB 2H6PA 1OCRB 4B9ZA 3N40F 3ARBA 5C7XL 2FWOB 1FZJA 4W9KC 2WN2A 4S0TD 3KJ4C 2IG2H 3ZHFA 4EI5D 2YEZB 2GB2A 4GIAA 4X5XA 5LB1A 4KTEL 3VB9A 2BW4A 4O2EA 3ZGHA 1HWWA 1ZT1B 2EEFA 4KRPB 4MQ7B 3KD4A 5CMAA 1UKQA 3PWLA 3UIZA 1OIOA 4F8LA 4N0YH 1FVEB 3LQZA 4OI9A 5D2NE 3KPRB 3K81A 1OT4A 5K9OB 1FI8C 2UWEF 1ASPA 3FYIB 4BK8A 2JIXD 1N3NA 5K9JH 5I5RA 1E2ZA 1T89C 3BSZA 3QDGB 1U8PB 2YQ2A 4XVJH 2Q8AL 1HSAA 1JXKA 2K8MA 2X1XR 4FXTA 1L9SA 4LIQE 2JB5H 2WNKA 4FQXB 2GHZA 4JHUA 5EA0H 3K2UL 3W82A 5KAQG 1NDMB 1NC2D 1QSFA 5D7LB 4MD4A 5EC1A 4Y4HD 4Y8DC 4X5WB 2CO7B 2P8MA 4V1DE 4M5TA 4ALAC 2VDKB 4PUBL 3REVA 1EXUA 3PNWB 4RISL 2DQFA 5INDB 3BZFB 1JJUA 4ENEC 2FBOJ 1E5BA 3FC8A 5L0QC 1LEIB 4GNKB 5DJXA 4AV4A 1ZHKA 4XMZA 3VFVA 5DS8A 5EIQA 1UXWA 3L3JB 3NCCB 5C2UB 3K8KA 4JO3L 5CBAB 1FF5A 3QXVA 2DQDH 4HUUB 5A7EA 4N25A 1FNEA 2MPAH 3MRIA 4JHVA 1M05A 1S9WB 3O4OC 4POZC 1MFDL 2NMSA 5EN3A 5BZWA 1LWHA 5JQIB 1NGZB 4YWGH 4JM2A 5CKAA 1TSRA 2H32H 5GS2D 3GI9L 15C8H 4JREB 3MBXH 4TTDD 3ASNB 1S78D 3QQ3B 4K71B 3GT6A 3L1EA 4KHXH 5LN8A 3FRUB 3N9GL 2N0KA 4PJCF 2HKHL 3X3FH 5GXBB 3CFJA 1MG2C 4YLBA 2R29H 4ADJA 3OTTA 4Q97A 1V7MH 3T4AB 3B37A 2BIPA 2WLLA 3S98A 3DI3B 4MRCA 2F6AA 4HC1A 4UQAA 3O4OB 1JTPA 3BDBA 5SWSA 5A40E 5IJKA 4GP4B 4XH2A 1VFMA 1OF2B 5E99L 3L13A 4M8UA 3K72B 3WFZA 5CFHA 2WLKA 3ULUD 3PP4L 4A68A 4FL4C 4FTDA 1ZGLB 3BDXA 5IHHA 2XT1B 3BEWA 3LHPH 3SGDH 3NFSH 3RWHB 2H0JA 2HFGL 3IAQA 3OSKA 8FABB 4DP6X 4W9ZA 2AABH 1GGCH 2CO6A 5E4OA 5GRYA 4TM9A 4PN6A 5CGYC 1QZ1A 3QUXC 5L9DH 3LKPA 2VQTA 3Q1EA 2KLSA 3UG3A 5DU7A 2JKXA 3P9MB 2HG5A 2WYTA 1FFPA 2EXWD 3B7TA 3F12B 1BZ9A 3CLEH 3I6GA 3TPKA 3ILPA 3CU7A 2ITEA 1E28A 2AI0L 1UZGA 4J12A 5EUOB 3VX0A 1AQKL 4LGSB 3MOAL 4FMFA 4A1RA 2OMZA 3MCKA 4HUCA 4QHMB 2X2HA 3BUTA 2VZ3A 4AC4A 4PRNA 1YNKL 1M3IA 2CWRA 1G0XA 3G5VA 5AWNH 3W39B 3RDTC 2ARJB 1A6TB 3KEHA 4ZTOL 3BPNB 2QHLA 3MUUA 3KR3H 4FMKA 4NP9A 4EIZC 1XF2A 3QDJA 3VM5A 2I60H 1W72H 3WBDA 2NDFA 1FBIH 2QDWA 1E9PB 2E75C 1EDQA 4CC1A 1HH6B 3RWCB 3V79C 5ESAA 3IGLA 3RG1C 4JFDA 3FQUA 3MRRA 1RV6X 4TUOB 1RUQL 1EMTH 3GMMA 4UV4L 2IANA 4V2BA 3DX0A 3UZQB 2C4FT 5B39A 5F70A 5T5NF 4JPWH 2YFOA 1HOCA 4FTVA 5B1BB 4Q74A 1KB3A 5HJ3B 2J4WL 4AGNA 3Q5TA 4LPXA 4G9DB 1O7DC 4XB8A 5IB5B 3BQVA 1I8MB 3KWVA 1L3WA 3CQPA 4U05A 1IQWL 3PF2A 4Z0BL 2I9TA 2FECL 4AOFA 2KL6A 2RFXA 1PLAA 2YAOA 1NGZA 2ZWNA 3V55A 4XMPL 2Q6WB 2A6IA 4X99A 5DHEA 4UT7L 3UPRB 3WAJA 2AC0A 4LHJB 1KWGA 4XPFH 3KDMB 5A7BA 3VFVB 1CDHA 4G7RB 1JGVL 1J18A 2D3LA 2PW2A 4O4YH 5IHWA 4ZNEA 1MAML 2BNRB 1NBZA 1NUNB 5AW3B 1JNLL 3JXAA 1JNHB 2ITDA 1ORSA 5F7UA 3SDCC 1WDAA 2CXGA 4Z76A 5I6XC 5EEVA 4ZQKA 2QADB 5I74C 3JBG7 2G3MA 1TLMA 5C0AA 1AR2A 1WITA 2GFBB 1NOFA 3C8KA 3SYOA 3BUYB 1ITCA 4E9RA 5BO0D 5EG6C 1A3RL 2A9BA 3LZNA 4ZJ9A 3FCGA 1F58H 4JCLA 5MI0B 4G71B 5HTSA 4X4ZA 3MPCA 5GRWA 3JT0A 4PCTA 5K1NA 4JFTA 4WI7A 1KY6A 1NSNH 4A55A 1JHLH 1J1PH 4RSVA 4GG8A 1TSHA 4F8TA 1J11A 5DR5L 1SM3H 4OT1L 3T3ME 2FUQA 1N0LB 5IMKB 1J5CA 2VDMH 3J8F7 1E4XH 3MCYA 3QP3A 3O8XC 4JG1H 3BRDA 3BC9A 1HEHC 3HAEH 3E6HB 5A2FA 5JUEH 2DWTA 4CC4C 1ND0A 1QOKA 1M9SA 2ZKHH 3VGEA 1J8SA 1TZ8A 4U1IA 3B7YA 2ZXBA 4R96B 3QYNA 1OAQL 3DK0A 3OPZL 2WGXA 4G59C 2OPCA 1XAKA 1EUUA 5T1MA 5TGBA 3UACA 1ZK5A 2CO4A 1P5VB 3OZLA 1CXLA 4FLRA 4WI0A 2K3TA 1HHKB 2H45A 4YXLH 3VXSD 3VFNA 4DP9X 3P4OA 1XX9C 3O45B 4XP5L 2W91A 3CD4A 5CJXC 2XNAB 4BFNA 1T7VA 3VRLE 2F54D 3V4VA 5JHLL 3I6GB 4IRJA 3HCVB 4XBPB 5C0AB 4F2ME 4GRWB 3B4NA 3ZBMA 3SOTA 1UZ6E 2CDFB 4XGZB 4ZBJA 1JZGA 3KLLA 3UJTL 2MCAA 3UC0L 3MREB 3GSUA 1F6LL 3QO1A 1DVFD 4FYQA 4Y4KC 3D4GA 4UMSA 1SXSA 1ZA3A 2VR8A 3AB0C 4OLUL 4PHZA 3JWOH 2OA9A 3LNIA 2BFVH 3C08H 3MLUH 2X4UB 5AALA 3HC0B 2TRHA 2Z91B 3FO9B 4OF5A 4Y2DC 4BK4A 3N44F 4K7FA 1LDPL 4M3HA 5FV1L 2C9VA 4AY0A 1B0GB 2J56A 1EHAA 1L0XA 3GZQA 5BV7B 4P2OC 2AFNA 5AYTA 2FIKB 2OZNA 1DANU 4NQED 2IFFH 1ZTXH 3FMGH 2HFFB 4AH2B 5CEXB 3VQ2C 2WBJC 2UUDK 3QDHA 2DWSA 3V6FA 3QXWA 1XH3A 3LXBA 1KYFA 3VQLA 4JVUA 3RWEB 1U3HA 1KLUA 2BVEA 1DHKA 1KTBA 2ESVE 4IBYA 3GBLA 4MDIB 3WO4C 3B34A 3GXDA 1JFQH 4LEXL 4WFHE 4K73A 5IMMA 2YMXL 1VGEH 1CC3A 1I8UA 3P30H 3VM7A 3QPKA 4UOW1 3UYPA 5FK9B 3RILA 1KV7A 3GTNA 2VL4A 5J6GB 2DI7A 1MAKA 4FMVA 4PV9B 1NEZA 1QG3A 3CPLA 5INDA 4ZNCD 3SPVA 4KI1A 1TUPA 4HKXB 5CJQH 3NACL 1SQMA 5JQHC 4OIBA 4YPJA 2Q8BL 2WXNA 4IYKA 3PABB 3VXSA 3K46A 4PJDF 1W15A 3BHBA 3MOBH 3MV8E 5L4IA 3RX7A 2C9XA 3SQRA 4FQXA 3TV3H 4HH9A 5HYJE 3FOLB 1T3FB 4WY7H 3N40P 5AD0A 1BM3L 2YUVA 1A2YB 4CDHA 5E2UL 4BKLA 1NIAA 4XPGH 1CDCA 1PMYA 2CG9X 4FI8A 4DKEH 1BVOA 3OGOE 2JJWA 4YNYA 3BWZA 3TIEA 1VEOA 1KLGB 1XBDA 3AG4B 3SDAA 4CADA 3D25A 4UNUA 2GSGA 5ICZB 3L4TA 1AD0B 4UNIA 2V3DA 3WHXA 4DZ8B 4W70A 2VLMD 2E6PA 1FG9C 2DLFL 5I0ZA 1WICA 1BQRA 2QSTA 5IFAH 5HI5C 1OTTD 2BWQA 4KK5C 1M6OA 1NMCC 1AGCB 4F15B 5EORL 2ODHA 1K85A 2QGDA 1UOVA 4UAOB 2UWEB 1HFUA 3P40A 1FFRA 1P2CA 3NPSB 4WJG3 3CFCH 4ZW8A 1YEEH 2LU4A 5D5MB 2VUOA 1IT9L 4H0HB 1S7XB 4QRTA 4NHCH 1THAA 3BVTA 3BH8A 2X4PB 4FTVD 2MJWA 4TSCH 5T3XL 3ILEA 1BWWA 3H2PA 5JW5B 4FOMA 5CU9A 5I1HH 5F7FA 2K9UA 1OT2A 3QUMA 3WEOA 3LCYA 5I1AA 1G6RA 4WHCA 5ECJE 3CWGA 5I30H 2X0WA 4U4IA 5SX4I 4I4WA 1VADB 2YZ1A 3TIDA 5E5MB 3PFQA 1E9QA 4ECNA 2BP0A 2MNWA 3M8OH 3FK3A 3NCWA 1HTYA 3WTXA 4GRLB 1KIPB 4EUPA 4MNQD 3RWIA 1OALA 3FONA 3QNXA 4GRWE 4DETA 4C56D 4HIHB 3TN0B 4F9LC 3WMPA 4LL9A 5ISZD 5EUKA 4WWKA 2WXIA 1F3RB 2GEEA 2BSRA 3GKWH 3V5KA 3WFCL 2GI0A 1Q9OA 3O9WC 4KK5D 3L7EB 5CCJA 4XRCA 1R3JA 5FDWB 1WTLA 1T5WB 4K9EC 1N0XH 4DKTA 3GZOA 2BP3A 4EXKA 1UWYA 1N5YL 2O5XL 1WFMA 5B39B 2R56L 3QULA 4OCYH 1ADWA 1ZLEA 5KTEH 5GRJH 2BZ7A 2XZCH 3MCG1 2AJSL 3HHSB 3AGWA 3MLVL 2VJXA 2IAMD 2VLJB 2IADA 3DJZA 2ESVD 3MGTB 4GEIA 3RWGA 3AT9A 4P49A 1MJUL 1T1ZB 2DI8A 3QR2A 4WUUA 5D2NB 1KJMA 1ZHNB 1EAPB 3B2MA 3CZNA 3NH7L 2I85A 2XTJC 3ARQA 5E7BA 4B0MB 4YSPA 5D6DC 3TBYA 1I82A 4P59L 2XTLA 1Z7JA 1Y07A 1KEML 4G42A 3APNA 2I27N 5SWSD 43CAB 1KB5A 1MCWW 2SEBB 3RTLA 4XN8A 5GRUH 3TN0A 3IJYB 4L8CB 3SDDA 4EKJA 4P23C 4L2LA 2WSPA 2CHWA 1OCWL 4HBQA 1BAWA 3JV6B 4YJZL 4NGHL 1H5BB 4KI5C 3FO1A 1ROCA 2DZEA 4DEPC 3QUZA 2V2XB 3NIFF 3ESNA 1IEBB 4JPVH 1KEGH 2IV9A 1ZJBA 2ZSWA 3LOWA 3BIBX 2OMXA 3KYNA 4K5LA 2WZPA 5I1GL 1A7OL 3MAWA 3Q1SH 1BIHA 1PY0A 2EE3A 5LNEA 4HD5A 1HEZB 4WI6A 4BFJA 4JY6B 1LNUB 1IKNC 3CBRA 3F7YA 5BRPA 5ITFA 2WBJD 3BZEB 4NO0A 5E8NA 3ZDZF 1XAUA 3QPXH 1G9MH 3FNKA 4WJKB 1FL3A 1CD8A 1KCSH 1MCIA 2NLJA 2ZG1A 2OYPA 5KSVB 4GBXC 3UAEA 3GO1L 1HQRB 3HI5H 3EYSH 1CE1H 2NY4C 3TBTB 4WKZB 1Q1JH 1YNTF 3II3A 5D1ZB 4KMTL 1S7SB 4JPIA 2ADGB 5D7KD 1JK9B 3UTSD 3IMTA 5FO8A 1AHKA 4LF3A 4B9FA 5CNHA 2Y3NA 3N42B 4P3WA 5MEOB 2L0DA 2A74C 2XXGA 4KKCD 4MNHB 4P2AA 1LO0H 4PJXF 3APCA 4U33A 3ZYIA 2EH7H 3DVFA 3MBEA 5KYNA 4HCFA 3QCUL 1QNZL 4H5SA 3UO8B 2YAMA 5FA4A 2JE8A 3NK3A 4ODWA 3V4PB 1EK3A 3MRFB 1YA5A 4I48B 4EI5B 1G7IB 4RGOL 4HK3N 1FN4A 1M6OB 4U49A 5F2FA 3B9KC 7CGTA 5KSAB 4FFZH 4Z3TA 1EEUA 3OXRB 3VD4A 1BFVL 5CBEB 2K45A 4K3DL 4M7LT 3KPPB 1DQJB 1LEKB 4PIRF 4JFPB 4QTHA 3POHA 4WAFA 3QHTC 4PJ8D 5B22A 2DJUA 3GHEL 5FW8A 3GM0A 1KULA 4S1DC 4G72B 4RNRA 4YGAB 4L1DA 1JCKA 4HG4K 4IKLA 4JKKA 1JHLL 5ADPL 2ALAA 2VR5A 3W2DL 4BSVA 1SOSA 2QTVA 5CS7A 4WRLA 3SGJA 3RL2A 1JUFA 2YC1A 4XMXA 1UXMA 4PGCB 5JORA 1YPZF 5I8KH 4QRRE 4W9HC 1CDYA 1E4HA 2NY7L 4N0RA 4CAGA 3KLQA 5KEZA 5AL8A 1MCLA 1Y18A 3NZ8B 2AK4D 4HETA 4NSKB 5C6TL 3G3LA 4CDGC 4HLZH 2DICA 4G8FB 3D18B 2PCPA 3HMWH 4Q9QL 2J1YA 1I4FB 1B3JA 1D6VH 2Y36L 4KKLD 4PJIA 2D8KA 2R2CA 1CGXA 4FHBD 3HS9A 3EOTH 3MROA 4X4XA 1F18A 2KZ1B 3BWAA 5DF0A 5CCGE 2R2EB 5IFHH 2V6HA 3QARA 1GZQB 4ATWA 1ZHBA 3GF8A 3UZQA 5BOPA 1KCKA 1R3KA 4JN1L 3ZKXB 4WHYG 1AI1H 1X5HA 1LXMA 3EYSL 4IW4C 1JGUL 3QG6B 2NNAA 1JYXA 1NOAA 3L4XA 3NIGF 1LO4L 4Z0BH 4OUOA 2KLRA 3WGVB 3ZTNH 4BSWB 1KF9B 4JFUA 1U8OB 2QPUA 5IV2A 2GJRA 1D5RA 1BAGA 5HDWA 2B2XL 1BJ1H 5IHUL 3JQOB 3ATEA 5HHPB 4DOHE 4XN1A 1D5ZB 3JTTB 4OZFG 3EAKA 4PJGE 3A6BH 3PY9A 2VN6A 1C5BH 1NIEA 3OKDA 4RMSA 4KTGA 3DROA 5EU4B 3DX7B 4JKPL 3VE0A 2K8QA 3MRKB 5C0JB 4YHPB 1HZKA 2GTQA 4R5VA 3V4VL 5JHLA 1XGUB 1Y0LB 1CE6B 3VB8A 1KTCA 2APWA 1TTRA 3WV0A 2VW7A 3ULUH 2X4OA 3ZQ9A 3BKYH 4XNQA 1ORQB 4G6JL 3BP7B 3ZY7A 4FNTA 1OGSA 4PRBA 5I8KL 5ISZA 2ATKB 4KO7A 1OF0A 5AKRA 1TU2B 5I6MA 5F7YC 3E38A 1S9YB 4JFFE 5CBEA 3NCFB 2VXQA 4MA8L 4XCYB 2Z31B 1ZVYA 1KBVA 1QRNE 5I6PA 1YMME 4QHKI 5E8OB 4NXSA 2Z92A 3QRGH 4E9VA 2Z92B 3VYPA 1P1VA 1MRCH 1D5BA 5KBMA 3WSQL 4TULL 3MLVH 5IJDC 3BPOB 4OH2A 4QRRD 4ZSOE 2XZCL 5F7MC 1A47A 1GGCL 1DQDH 3U48A 5IUCA 2Z9TA 1CGUA 3ATAA 4AJWA 1U8JA 3UJIL 4OCYL 2OXGB 5I6KA 5IEKB 5CZVL 4OGAD 4L5FL 3BUYA 5C0IA 1X5ZA 3MV7B 5EN2A 2LW3A 3TC9A 1EPFA 5JIIA 4H26A 5LVEA 1IGYA 3SE3C 3BT2L 4HUKB 3VSVA 3DLQR 3TO4B 1NCUA 1DCEA 1M7IA 2D03L 2X4OB 3B43A 2VDQH 2YXVA 3HG1B 3M17B 3QCUH 4HAKA 4NRYA 1JPFB 5CBAA 3DDGA 1E90A 4XVOA 2NLJB 2OSYA 1FJ1B 1XGTA 4PJDB 2JTYA 3C8KB 4GUCA 1TDQA 1N2RA 1WC7B 1C5CL 3RTQC 4YLCA 3O4LE 3C6SB 3UBXI 3L2NA 5AVVB 1DQLL 1L0PA 4JFED 1AXTH 1CDJA 1UM4H 4I0PA 4AKPA 4YQXH 5D71L 4ZMLA 5MHSE 2V17L 3OHXB 1SXNA 4FNLH 1D6EA 1EQWA 3HI5L 5DQ9B 1XXFC 2DLIA 5I1HL 3RIKA 4F5CE 2WZPD 2VQUA 4QJ5B 1YEKH 4F2MB 5C07B 3DUHA 1NAMA 1CFTB 2NTFA 3G5WA 4BGDA 3BSZH 2ZUWA 1YEEL 1P7BA 3QNYB 1V3MA 2WKOF 4LSTL 4YMPA 3MC0A 4E9YA 1MFUA 1GZQA 3VD1A 1Z5LB 3NCMA 1QPPA 3A4EA 1JXJA 5ICYA 1M56B 4C4KO 1FVEA 1ACXA 4J8RA 1KEGL 4Q56A 3T9WA 3FQWA 2ZXGA 5IB2A 1I8KA 3T0VA 4LHUA 4BRVA 3ZTJG 1D5MA 3OV6A 2BM3A 3K2UH 2HP4A 3GB7A 1IIKA 2BOLA 4HOXA 4Y4FB 3UABA 1IAOA 4PW3A 5EEUA 3US1A 1ODUA 2Z34A 4NI6A 4NQSA 1LHZA 3MNDA 1ZGLP 3K0YA 5F9AC 3RIAK 2NW3B 3OKMB 4H8QA 3VDAA 1EO8L 4QGYA 4MJIA 3VGDA 5K9QI 1V55B 4XPGL 4DKEL 2WVVA 5EUOA 2UXTA 3JV4A 3QHFH 2DQGH 3KPMB 4L4TE 4MNQB 4UM9D 5GGSY 5IVZA 5IROC 3QQ4B 1BM3H 1DZBA 4WEMB 4X7TA 1YAIA 4KROB 2ZJSL 1U3JA 4G1MA 4HJIA 2IPUK 3UPCA 5C09A 3BVDB 3MYJB 2ARJA 3HR5A 5DDHA 5DD5L 1W72A 3N41F 5DDHB 2DYPD 4BH7A 1IAII 5JHDE 3MRJA 4G43A 4N1HB 1IE4A 2PTTB 4P23A 4JGMA 5CLTA 4RMRA 3TVMD 4R5TA 1MVUA 3NCJH 4YVUA 2P5WB 4HSCX 4PGJA 1V3KA 3T77B 2W8CA 2VZVA 1VGKA 1J7VR 1OF2A 2R56H 4O9HH 5L2KE 5EU5B 1Q72L 2WXJA 3QO0B 3CZUB 3CFBA 3BH4A 2BDNL 1XGZA 1VACB 2BSTA 1MY7A 4L18A 3MNVB 5D7EA 4Y4FA 2FB4H 3L5XL 5GSVA 5E6ZA 2ZG3A 1V3LA 2GKIA 4N8VB 3NRQA 3LAFA 4FKHA 3K6NA 2AQ1A 1ETB1 3CMOH 3Q44A 3SEPA 4D2NA 1O7DE 5TE7H 3UL4A 1J8KA 1SBSL 5SWSB 3N44B 3CMGA 3TCLA 2ICEB 4XZ4A 1UGNA 3E3QE 4PLOB 1JZHA 4WK2B 1PTZA 2JF1A 3ZL4H 2MIZA 1MY5A 5E1QA 3MRCA 7PAZA 4G8IB 4IBUA 5GS0L 1QEWB 3U30B 4ZFOB 4HWZA 4JPKL 4NM4H 2V3FA 5C0EA 1OCOB 1EZSA 2X1WL 3NEEA 1P1ZA 3BQUD 5FF6A 3EHBC 3FRPA 5C07E 3OKOA 2HWZH 1JNHA 3TJHD 3U2IA 3UJTH 3LRKA 5EC1B 5DQJA 4ZFQA 2AQRA 3D05A 4B5EA 1TNMA 2ICEC 4YIQB 4NNPL 4H2AA 4Q6KA 4HHAA 3ECUA 4LEEA 1U4EA 5F3HB 3ARSA 1KB9K 4AKQA 5TQ0H 2OJEA 5HVHC 1BWMA 3S3CB 1PNDA 3SJVA 1ZE3H 3ARBD 3SJVB 1NCIA 4QXWA 3FQRA 3GD1C 1FZKA 3L9RB 4KC3B 4X6BB 4KQ4L 4NC1E 3WY2A 3BVWA 1K8IB 4HHGA 2DDQL 5E6YA 2ICWA 1YUHA 3U0WH 1XCTA 3EGDB 3UG5A 5ID1B 2PWHA 2AJXL 1YQ2A 2YA2A 5FA3A 3EO0B 4X4XB 3HE6A 4ZPTA 4G70B 4WFEE 3V6OE 3W0WE 5I74B 5FXCH 1QW9A 4GW4B 3TA3C 2OM5A 1WAAA 3U9PH 4AMXA 3LNFA 5LBSH 5LN4A 4AGLA 4FZEH 5C6PB 3OR7A 5EF1A 3A6OA 2AJVH 1KBKA 3OM3B 5BW7A 3ARUA 4KJYB 4KZDL 4BH8B 5DMGD 1UT2A 1R3LB 1HAUA 1CZ8H 1I9JL 4KTDL 4XCCH 3OAUL 3ATBA 1Z5YD 4GLRI 2ARJQ 4MLSA 4P9HC 3RX8A 3N1QC 4DGUA 1SM3L 5EO9B 4NIKB 4C57C 2BHUA 3GMPB 3VNYA 2WUCL 2C5DC 3FH8A 2ATKA 4GKNB 3SCMB 4N0FA 3S3JA 4NKIH 3BGFB 4HKZB 4M61B 3QUYB 3S37X 4QRRA 2HLFC 2VZSA 3MNWA 4F58L 5CP3A 2WUBH 3JYBA 4TUKH 3RPIB 4ATTA 1CXIA 3G5VB 2WCSA 2VAJA 5C08A 5FYKD 5G55A 3CZEA 2O30A 4QGTA 5DUPH 3CCHA 3O6FB 3ULUL 3HG0A 2F8VA 2X4UA 4XCNB 3P0YH 1FDLH 4P2RD 1YNLH 5EOCJ 4AVJA 1G7IA 3DIVA 4PI0A 5ESVA 3QZLA 2IFFL 3G5XB 4I4WB 3W0WD 4Y0GA 1KTDB 1MZYA 3RL1A 3VRJB 3N3EA 3KYNB 1R24B 4NQCB 4Z7UF 4MCNA 2NNXA 4HS8L 2WIIA 4N86A 2GJJA 4QF1A 1S9XB 3EYQC 3HA0A 5LXVA 2ZAIA 2C26A 3GMNB 3ZDWA 3GBML 1IC7H 2F54B 4DWHA 1H8OA 2DJ4A 3PP3H 1JGEB 3JWOL 3UZVA 4F8OA 3GMPA 4NQEE 3EYUL 4H4NA 5GRVK 2ERJB 1F6AB 5DVMA 4KXBA 3Q5OA 1EZLA 3NIDF 2OR9L 1J48A 1UOWA 1OT1A 2X6VA 3D39B 3JT2A 4HWBH 1CF8L 2VE6A 2HFEB 4FLOA 5M7QA 1P5UA 3UBXG 2YWZA 3LZOA 4KJWC 2JKLA 2NUPB 5FM5O 3P4NA 5CCKL 3J2PA 5FLUA 1TQVA 3EOBA 3WUWB 2I60L 3ZYZA 1F4XH 5CR1A 5JOFB 1AY1L 4GP5B 1XO8A 4AW7A 3C2AH 1JVKA 5C0BE 3T8XB 2DQUL 4AQEB 3Q8AA 2MQ3A 3V6BR 1OEZW 4JFEB 1KG0B 4KUZL 1O7SA 1XCTB 3EGDA 4HULB 2X1OA 3HS0A 3W9DA 3QUZB 4Q58C 4Q14A 3EKCA 2FX9H 3I85A 3RL2B 4PRHE 3TL5A 1LQSR 2BCKA 2XZAL 3Q6GL 4NN5C 2BCKB 1NFDF 3EO9H 2OI9B 2R2BA 2RALA 4KRNA 2BSDA 5CGYD 3OR7B 3RGVA 3BZFA 4MB1A 3P9WB 1T2XA 2VMCA 3H3KA 3OG4B 2ALWA 3L8QA 2BIMA 5F93C 3AS2A 3TV8A 4HJEA 1QSED 4L3EA 4CJ0A 3AZUA 5KS9E 4L3EB 2CO3A 3HHRB 2ICWB 2NX5B 2FE0A 4XO4A 2H32B 1D2PA 2PN5A 1K9TA 3JWNG 3KH3A 4OD1L 4HOZA 3CFEB 4ODXA 4HJUA 4PJFE 2MHAA 1WWCA 3ESPA 2VDOH 2VE6B 3IYLW 4JM4H 5IEHB 4MNGA 4OIFA 5AKSA 3RVVD 3UAJA 3VXUA 4PJFF 1DL7L 1ZKAA 5KAQF 4LVNC 4PJHE 3LX9A 3H9SD 3ALPA 1E3XA 1GAFL 1XCQA 2ZWYA 4A7QA 1OP9A 2X4PA 3V52H 3WEMA 1KN4L 4HCRH 5KS9F 3GDBA 2X88A 4OF7A 4AK1A 3L3KA 2Z3FA 3CDZA 4FTVE 4KHXL 1AHWA 2AGJL 2V9UA 4F33A 4KVCH 2V9TA 3D39A 4UT7H 4G80B 1KTDA 4YDJB 4Y5XC 3CZFB 3DIFA 4XMPH 4PJ5B 1PY9A 2F8XC 2Y2YA 4Z7NF 1OSYA 3OKYA 3H55A 1PSKL 3WNIA 1LMIA 5FO9A 4NQEB 5CCHE 2F54A 4AMWA 5E08L 1CGWA 4GW1B 1GS6X 3VMPA 2CA3A 2O72A 1YJDC 1OWWA 3FHQA 2V7HA 5CLZA 4FP8L 3Q48A 5I2IA 4GFXA 4GJTB 5L88H 2A6JB 2VLLA 3K71B 5TDOB 3ROLA 4HMCA 1A7OH 4BBWA 2B4CL 5EF3A 5DO8A 3LN4A 3VWJD 2PYEE 5CP7A 1I1YB 2IJ0C 4PJGF 1OTUC 2VERN 3CLWA 2XV2A 4WI5A 3FBKA 4M1DH 3KPTA 4OCXH 3SDDB 2F0CA 4NGHH 4TNVF 3WU1A 3DVGA 4NX0A 5HYJD 1KYUA 4RA3A 4JFVA 1BF2A 5JXED 1QSEB 4H44C 4JFQA 4AIEA 2BNUA 4S2SA 1IGCL 2ZUSA 3I6LD 5I8EB 3RNQB 3QZMA 3GXNA 1IM3A 4H1LG 4FNRA 1A7PL 2ZOKA 1GGIH 3ZT7A 1B90A 3HG1D 5L8KB 4U1IB 2YN5A 1U92B 4QAMB 2EVFA 3NAAL 2QSQA 4E36A 2DQIH 4H40A 1JWUA 1F4YL 1SOKA 3L1FA 2VN4A 3ORJA 1Q90A 2NY4D 3TIEB 2J25A 4Q6IB 4XXDA 4MJ6A 4XVTH 4Y2OA 35C8H 3SDCD 4G7SB 3LPPA 4LEBA 4UB0L 2JKNA 3AFLA 4PRPE 1AZBA 3VFTB 5I1JL 2F18A 3OXSB 4IRSC 1XGQB 2A6KA 4IJ3B 3FOLA 5EU6B 4AQZA 4EI6A 4MZ2A 5KTEL 2BW5A 2B9BA 1W6WA 4LSVL 1NLDH 3R8BB 4BINA 1SJMA 2YPLA 2DEWX 4E41E 6CGTA 1MWAL 2YA0A 4PLJD 3LZQA 4XP1H 5DZNA 4JY4B 3N41B 4I13B 4CGUB 3NZ8A 1GC1C 1WD9A 3IN2A 43C9B 2OZ4A 3VD5A 2AJUH 1V7ML 3N6YA 2PABA 4B6ZA 4K3EH 4LPVA 3P9LB 4A2HA 3UX9B 3CFKA 3AUWB 4JEGB 2DMBA 4UQBA 4XX5A 4C4BA 1ED3A 1CCZA 4FFVC 3EYQD 2RD0A 2HTLD 1U91A 3ZE1B 3G6JF 3FUJA 1SLXA 1QKZH 4HISA 2YPVH 3OAZK 1MLCB 4I0PB 2X9XA 5B1KA 3UEQA 2LHAA 2R29A 4M48H 3GSNL 4M3JA 5C0EB 4DP8X 3LQAL 4JO3H 1J88A 4QXTB 3MXWH 2IPTH 4P5TD 5EBMB 1YYLH 2A6KB 3DX4A 4JJ5A 1L6ZA 5PCYA 2YPKA 3RWDA 1A66A 4JQXC 3B6SA 1INEL 4NN5B 3GUFA 3I9PA 1AGCA 1EJFA 4RMTA 3TCLB 3L3DA 2CR6A 2PLTA 4MSWA 4G8AC 4ONGL 5D1XB 2Q87A 2DQJL 1RK7A 5FGSA 1IBFA 4KMLB 5BW7C 2UZPA 5CO1A 4C56B 5E5UB 2DLHA 1J0YA 5J3HD 1VLXA 2ZXAA 2NTSP 3D25B 2YAPA 4N2OA 1KCVH 4PBWD 5I8OL 1PL3A 3QORC 1NFAA 4PBVC 3F85A 1WBXB 4EO5A 2JLLA 4RIRB 4KKZA 3ARFD 2VITA 3PWUA 3HPLB 4RMBA 4OTXL 1COBA 4EBQH 4FC3E 2W95A 3LY6A 2UXVA 4LRIC 1JGDA 3UTZA 4PD4K 5ICXA 4LU5L 5DFWH 1OM3L 3P54A 3RDJA 1VFBA 1NGQH 4KVPA 3EYFA 4JFZH 5I5MA 1CXKA 4P5KB 1QTPA 4P4KB 2ZCZA 1B6UA 2ZWLT 4AM0B 4KK8C 2MPVA 1PG7H 1FNSH 1DBKL 4NQXA 4P5TA 4E2OA 1UG9A 5AG9A 1TOXA 1A7QH 3F01A 1UT9A 2K3HA 3CHPA 4TMPA 1UD5A 2VDOB 1ZEAL 2V5SA 2Y2TA 3S35X 3ZSTA 4ZS6D 2A2QT 4ONFH 3RKPA 3JV4B 4DVBB 4ANKA 1KPRB 2MNJB 3MLRH 1O5DT 1NCNA 1IJ9A 1P6FA 4DJMA 4LO9A 2HYMA 1AG0A 4MTMA 3I9AA 5HDQH 4XHJD 4PJ7B 2C7UB 4O58L 3RBGA 5CP3H 1JFQL 2IMNA 1IGIH 4JFHE 4L8DB 4S1QL 2R69A 5E6IA 3US0A 4ZXBC 5HI5D 1WLHA 1NAMB 2H1PL 3UAJD 2G4EA 5D4HA 3FU7A 3N0PB 5IESH 2WQUA 1MHCB 3DOSB 3HB3B 1S7VA 2VDKL 4LCWD 1MHCA 3UTTD 4RFNB 1ZTXL 3FMGL 1M1SA 4L8SB 4NZRL 4NUPA 3SCMC 4IBSA 1KGWA 4H8HA 4HFUH 4JQIL 3MR9B 3U0PA 3HG4A 4KQ3H 2BVPB 5F3FA 1N59B 1P5UC 1S3KL 1RUMH 1YZZA 5CZRA 1TZHB 1MIMH 1HHJB 3WNOA 4ICXA 4ZTEA 3PHAA 1LE9A 1RIHL 4FQ1L 1JPFA 3LRHA 4O02L 3CFKB 4JPQA 1ADQL 1I4FA 2FYYB 4BCZA 4EN3C 3OVUB 4D7BA 1NCAL 3SPCA 4KRPC 4BXSV 3KXFD 1KN2H 4AMKH 4OLZL 1R3JB 3KWTA 1IM3B 5E2TH 5H37A 1U8CB 4MAYB 1OW0A 1QFPA 1VCAA 3LKSB 1KBWA 3T2NH 1SDDA 1TQUA 3HEIB 3O4LA 4JFFA 3MCKB 1PF3A 2R83A 4TQPA 3IFNH 3FPXA 3DPBB 1J86A 1CR9L 2PXYB 2HB0A 4Y7OC 3FONB 5A6MA 5ABZA 1T0PB 3M17A 4JM2D 1EEYB 4FRWA 4PWJA 1NCWH 2DKSA 2WOYA 4U1KB 2WYHA 1N7MH 5C0BA 5MERB 3W9DB 4N68A 1IC1A 1JVLA 4AQ8C 5I1AB 3VWKD 3ZMEA 3GS4A 1HXKA 3RZCA 4IMKA 4PLNC 1U2CA 1TEFA 4QR7A 5F0JB 1LMKA 3C5SA 5T33H 1ZEAH 4M5YH 1DQMH 2NUPA 2WANA 5HD8D 1NMAL 5FCUH 3D3VE 4K5NA 3V9EA 4KI5E 4R4BA 5LGYA 4YGVB 2GBVA 2WINB 3V4LA 3MXVL 4XNQB 4H88H 2E86A 1QSEA 1YMMA 3CHXA 4L3ED 4ZPVB 5E9AA 4BZYA 1QPKA 3VWJB 4WK4B 5EBLA 3LNEA 4LVEA 4DCQB 3HLKA 5IJCC 3K6IA 3NK4A 4MMXA 4IIQA 3MRGB 4WFGD 2AHIA 4P2OB 2VC2B 4JFFB 4G82A 1REIA 3MTRA 1A3RH 1UZ8A 2WXRA 1KXQA 3MVSA 2YAQA 1YDPB 1U41A 3MYJA 5DURB 2BRRH 3SBQA 1KLGA 1B9ZA 2FJHB 1AE6L 3HFMH 3Q6FA 2JQAA 2FSDA 4L1BA 1Q9WA 4MLIA 4HUUA 1UGKA 1RUKL 4BSWA 5I8OH 5H4ZA 5IW3A 5KSVA 4OM0L 4NNXA 1O6SB 2R0KL 4KH2A 3CVHA 4N24A 3RFZC 3P73B 1FV1B 4J2XA 3ASWA 3RQ3A 4C4UA 3CH8A 4GEJA 3TEYA 2HX7A 2XETA 2QSVA 5KBNC 2HAZA 1QHOA 3GSXB 5AW8B 3HUJE 3DIFB 4FE9A 4G6MH 4CN1A 5AYUH 3DX9A 1IM3D 4WHTA 5I15L 2AK4A 1DQQA 1AR1D 4V1DD 2YUWA 4HKXA 1G7LB 5HGHB 2FQGA 1CK0L 4P5RA 3G6DL 3RUGE 2EICA 2NZ1A 1AZNA 4OZIF 3LQAH 2VOTA 3TNNA 1HSAB 4D9LH 2D9QB 2CM5A 3MFFA 3MGTA 3RWGB 2VKWA 1RIVH 2J4WH 2NZIA 2WK2A 3VFSA 3UTSE 1M2VB 4JM2B 2MTPA 3KPOB 2Z0UA 3D9AL 4IGBD 1GJUA 1QLEB 4KXAA 2C1PA 1HHIB 5ESAB 4OGXL 3U36A 4FNUA 1LLAA 2MCPH 2CXKA 1RK0B 3ALXA 4G42B 5LLIC 2JI2A 4OD2B 1UJ3B 4ZUUA 3S88H 3RVTD 1I1FB 1UB6A 3RIFK 3SDDD 3LEVH 3V6OA 2YSSB 3D34A 4WSGA 5CLWA 3KJ6H 1PVHA 1UACL 3WUWG 2WWMD 4FABH