3V10A

Crystal structure of the collagen binding domain of erysipelothrix rhusiopathiae surface protein rspb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
318
structure length
310
Chain Sequence
AKDYTNEAIFTQFDVNPKGLINNPSQPIEFNLAFSDMNNGQKVKFKPGDFFDLTLPSNDEVSLRSLRAMGSKMPVLAKKEITLGELTFNGSHIHFEFMEDVLQLENVTGTINLKSVYDNAYRGEDDKIAELPTNLGLGSLDKQMITISQPGTPTSPIFYWKTGTFSTEVHGDMNWWLNINSPKEAVQSDVKVIDTIGEGHKLVDGSIMVDVEANGELKHISAEAFNKEYGTITVEGQVLTVMIPKEKAAKTTFTVTYDTRAFDKKLENYKNSSTIEYKDESGNLVTDTPKHYTDTSVVNMFDDATIGGEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhusiopathiae surface protein B
publication title Collagen adhesin-nanoparticle interaction impairs adhesin's ligand binding mechanism
pubmed doi rcsb
source organism Erysipelothrix rhusiopathiae
molecule tags Cell adhesion
total genus 67
structure length 310
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A01
2WOYA 5CFAA 4IGBA 2X9ZA 4P0DA 3IS0X 4HSQA 4JDZB 3QDHA 3HTLX 2X9WA 2OKMA 1AMXA 2WZAA 1N67A 4IGBD 3V10A 4B5ZA 3UXFA 3PF2A 3QE5A 2Y7LA 2Y7OA 4JE0A 3RKPA 2F68X 2Y1VA 1R19A 3AU0A 1R17A 2RALA 3ASWA 2Y7MA 4LEBA 4F24A 4IGBB 2X9XA 4LEEA 3IS1X 2X9YA 2Y7NA 4MBOA 2WQSA 5DZAA 4IGBC 4Z23A 4MBRA 2Z1PA 3RPKA 4F20A 3KPTA 5DZ9A 2YLHA 2XTLA 3IRPX 4B60A 4LE8A 5CF3A 3IRZA 4JDZA 2VR3A 4F27A 4Z1PA 3OPUA 3AT0A 3HR6A 4F1ZA 4OFQA 3PG2A 4UZGA 5IHWA 2F6AA
chains in the Genus database with same CATH superfamily
2BNQD 3A6CL 2CDEA 3P3RA 5BVJB 2PXYC 3HG1D 4OZIB 4HFWA 4FYRA 3ZYIA 1SBSL 4FHJA 1CTNA 3MHZA 4IRJD 4G5ZH 3IDIB 4X8JA 3UJJH 1ET8A 4LLVA 4G8GE 4NWUL 2DQHH 5GRWA 4W93A 1G43A 2APWA 4X6BA 4A2EA 4HCGA 1UEYA 3SDXA 5DD3L 1WCBA 4FQXD 2VR5A 3DLQR 4X9BA 4BHUA 5DMGC 4ELMF 5D9SA 1PX8A 5E1AB 5FYKD 2Y07L 3O6FB 1U4EA 2E9GA 2QKIA 2NY6C 3SYAA 5KUKA 3BN9C 3FF8A 5SX5H 4U1JB 2EYTB 5J9PA 2BFVH 2D0HA 1NWPA 1TJGH 3A4DA 3RTQA 1NGQH 2KERA 3QJRB 5ANMA 3C08L 2N1TE 4J3TA 1HFUA 4GT7A 1AO7E 4FC3E 3U0TB 2EP6A 4UV4L 4CC4A 3IKCA 3ULUL 3CX2A 4I7ZC 4RESB 3CLEL 3A4FA 3QIWC 2CWRA 3BPNB 4P2AA 2VWEC 5E4EB 4D9RE 4ODVL 3QO0B 3U6XS 3GPEA 5T3XL 3VTMA 3PY9A 4WFED 3QDMA 3T0ED 3D1MC 3F6LA 3VXQA 5KYNA 2R0WL 5E5RB 3FUDA 1DCEA 4R96A 3QS2A 5AOKA 2YRPA 4FKEA 4LL9A 2G60L 4PGEA 3HB3B 3DMMA 3VXOA 3SIKA 1L0QA 1JPSL 4JJ5B 4NS0A 2ISDA 1EHLL 2LVEA 4QRPB 3TNMB 3FCGA 1YVLA 4V33A 4E9TA 4NFCA 2PPEA 2AZUA 4WFGD 3FU7A 2JB6A 1CD1A 3V0JA 3RUGE 2OMWB 5CEZD 2ILLA 4F8LA 2A77L 3CXHJ 2WVVA 4XCEA 3TN0C 1P4IL 2RQ8A 1LEKA 3RZCA 1S9XA 1KGWA 4GG8A 4N6RB 3G08A 1RP8A 2WIIA 1CPUA 4BSJA 1W80A 3D25A 3NGBC 2HVBA 2C4FT 2JJTA 1QI4A 1WIPA 2ZXGA 2A6KA 4G8AC 1Q38A 3OBAA 5I1IH 3T6QC 1MRDH 4UTAA 3K6SB 5LVEA 1DJHA 1W8OA 4QRRE 4QKTA 3GK8H 4YXLL 1CD8A 2IWGA 1XIWB 2HFGH 2PW1A 1FYTE 2LABA 3NJIA 4F7CA 1F11B 4TQIA 3DK0A 3I6KB 1MW1A 5E8DH 1JF1A 3AXLB 3MRHA 3ATDA 1RH8A 3BHBA 3TBSB 2DQTL 2CKBH 4JFDB 4IK7A 4QHKJ 1A7QH 1OV8A 3S5LG 1HHJB 3ZMRA 3V7MA 1PBYA 2Y7LA 4JG9A 2I25N 1PEWA 2F7OA 1EEZB 1VA9A 2ZG3A 3DX2A 3MOBH 4ZUVA 3KPSD 1S5IH 5CD5C 4RGMB 1OLLA 2MQCA 4JRYE 4QKXB 5I8OL 4XNQB 3SJVB 4KOBA 1K8DB 2NT1A 4Z76B 3T2LA 1HZKA 3QHZL 4KHTH 4Z7VE 5EU6E 5E00B 4XBPA 1UA6H 1LMIA 3G6JE 1Y6MR 25C8L 4YBLC 1QR1A 2WYTA 1IB5A 2Y7SA 1N6QH 3BUYA 4J7RA 4PRPE 4Z3TA 5JW3H 4PLJD 1R34A 2FDBP 4Y88A 4NN5C 2EYSA 5C09A 4PLKC 4KXAA 1CICB 5HI4D 4EI5D 3VVWA 4Y4KC 4I85A 4ZFOL 3PDOB 5FLUA 1DFXA 3M07A 2WSPA 3FUHA 3PWVA 5IM7A 3F5WB 1XH1A 1Q94A 1PCXA 1G9ML 3CFBB 2FQFA 5KUMA 4CGUB 2ADFH 2N7SA 1G6VK 4LCCB 4JQVA 1W0VA 4DKFH 1O6TA 2ZWSA 2JCCA 3IJYA 5KS9F 1NDMB 5C0BA 3QPQC 2EO9A 5C0NC 5KVEL 2EDMA 2BZ7A 3D07A 4JAMA 5GGQL 5TDOB 1DN0A 1DQIA 1JGIA 1G94A 3FQ2A 2RR3A 5IVZB 1A66A 4RAVA 4G82A 3BZEA 3ZYJA 4JFXA 2QVKA 1T3FA 3I6LE 3T2NL 2WY3B 1K3ZA 3WEBA 2I69A 1JZGA 5IW6A 1YY9C 2WLZA 3EH5B 4QHUB 3RIAK 3EXJA 1CGYA 3MRGA 1OGAA 3KDMA 5M7QA 3U9UB 4NQEB 4FL4B 4R5XA 1LEIA 2BY3A 1G7MB 3G04B 4Z7AA 3B1TA 1KV3A 4OD3H 5IWLA 2XWZA 5E1QA 2GTZA 3BW9A 3VFGH 2NNRA 2IAMA 3MFFB 4RSYA 5D1XA 3GIZH 1ZS2A 5AW6B 2P47B 3H9YA 3UBFA 1P5UC 3V0WL 3O8XB 2GVYA 1JS4A 1RZIA 3MLVH 1UZ6E 3ATEA 2P5EE 5DMKA 4JANA 3QSKB 3MKKA 5BZWA 1NGPH 3EYUH 3HI6H 4C57C 2NY0D 3H42L 1JGDA 1XB6A 2DWXA 3DTDA 2G9HA 1SMOA 1Y0LA 3BGFC 3W5MA 1MLBB 3K5SA 2D3VA 1N3NB 5I1AB 2CR3A 5LGHL 1IGCL 5IBTL 1OK0A 1YMHB 3GZPA 1FN4B 4YFLF 1K6QL 5C0GA 1YNTA 1J86A 2ZCLL 2ESVA 3PXHA 4K71C 5HHPB 2AKRB 2H1PH 3VXNB 4HJUA 1PD6A 5ACLA 1E0OB 5BQ7A 3QFJA 4JPVH 2UVEA 3VGFA 4HJGB 3RFZC 4IRSA 4M7LL 2ADGB 2ZAIA 4XXCC 5TDPB 3B7UX 4XCCL 4XWOC 4YUEH 5CGBA 1O9WA 2X70A 4E41E 5H4ZA 2BS8A 1RMFL 4PJHF 1IGJB 4W9FC 1XHHA 5DHVB 4YDKH 4RISL 3LMJH 4N0FB 5BMFL 1SN0A 3OB0K 2W1NA 2BSBA 3T04D 3PAVA 4OD2B 4EBQH 2NXZD 1J5HA 5DEGB 2VQTA 4QRSB 2EXTA 2AABH 2CCVA 1MOEA 2DLEA 1Z9SA 4BFIA 2LLGA 1A3ZA 1AR1D 1KLFB 4X9GA 3X14B 4P2RE 4XNAA 1FH2A 5DVOA 4JFPB 4BDVA 4IU3A 2DF3A 3N42B 2CMRH 2D2CC 3FCTA 2R0ZL 4Y5VB 3L4XA 1T04B 4XTRC 5I74B 2VDOL 4FP8L 4LP8A 4OQTA 4UZGA 4Y19E 5F72S 1EDYA 2VRQA 2WXFA 4P23B 2R2BA 2VYRE 4XMKL 1NMBH 3FHEA 5HHNB 2DWYA 1NCCH 4GW5A 3C87A 3JSSA 4WVRA 4A6YA 1TCMA 3LEXA 4FZEL 5SWSA 4KK5D 5DWPA 2DEXX 1CXHA 4OFYD 1UXWB 4H8PA 2ARWA 4L8SB 3MFGB 5EPMA 1YAIA 4J4PC 4X8XA 1U93B 1VSCA 2R69L 2VM3A 2CO7A 3PWPE 1MCWW 4RDQG 4OU3A 2YUZA 5DFWH 4OVVA 4JCMA 4ZFFA 1YN7B 4Q2ZA 2FR4A 1L5GA 4ZUTB 2EDQA 3S36H 2CGRL 2Q2EB 2H0JA 3KXFB 3IBEA 5HYJD 5AW9B 1IGYB 3GM0A 3UMTA 3D6GA 1DBMH 1MFMA 4M43H 1JGEA 3P02A 4MGXA 4B9ZA 4DN3L 4RFNC 1J8HD 3OAYH 4K3DL 1G4RA 2DI8A 3LNIA 3W81A 4MNQB 2Z7ZA 4TLSA 2GHZA 3NZUA 4ENED 4RWHA 1BOGA 4MXVE 1SEQH 3HE6B 5HPOA 3RVWC 1DBKL 1WE5A 3DUHA 1PQZA 1KF9B 4D9LL 2ZD0A 3QDGE 4DZBA 3WLWC 2NTFA 4FXGA 3VFGL 2DICA 3PHSA 4R4BA 3FZUC 3O2VL 4NOFA 4ABWA 4D3CH 5I76B 4H0HB 3QIUC 4S2SA 4WCYL 3RNQA 1GJUA 3VD1A 1ND0B 2HN7B 4PJFF 4NI3A 4ZDHB 5B1KA 3E38A 3PYCA 5T1MA 4PBXA 2YD5A 1FH5H 2FX9L 1MCRA 1OCOB 3D85A 4POUB 1R24B 3TZVD 4UOZA 5KAQG 3HC0A 1KOAA 4YXHH 4GAFB 4X7FC 4F15C 5I8EA 3CLWA 2NX5D 3G5YB 2E8YA 2DWDB 1YEFH 1DQLH 4PJIE 4XN2A 1L0YA 2QEJA 4H1LA 3ZSSA 2QGCA 3U30C 1I7TB 3CVHH 3FCUB 4HYTB 1ML0A 5AYUH 3UTSE 1FFTB 1FFNB 1CI3M 5DGQA 4DT2A 5JYLA 3D34A 4JPVL 1J5DA 1TTCA 2XQ0A 3QG6B 4JFQA 4R7LA 1HKFA 4KUZH 1EWHA 3C5ZB 3OZ9L 1NGYB 4AKQA 1U2HA 1VKXB 3CVBA 3Q3GA 4CSZA 4QLRA 4JE4B 4Z0XB 4H8UA 5SWZB 4DKTA 3N50A 2V0AA 1RZKC 2NY3B 3QUYA 2AEQH 2NY2D 1JPGB 2VLME 2DJSA 4H4NA 3O0LA 3VA6A 2UZYB 2VSKB 5KVGE 2AJYH 3LMJL 3ZTJG 5D2NC 3NAAL 3OV6A 4XC3H 3QHFH 4JN2A 1JFHA 2Z8WC 1RUKH 1HHGA 3IGFA 5EIVA 4HOWA 1BAWA 4LKXA 4GXVL 1KTLB 2VZTA 1DANU 3G5XA 3FQTA 2WM0A 2DH3A 4F3FB 1AXSA 3KYMA 4Z7OB 1YEWA 3ZR5A 2YPLA 3WU1A 5TE7L 3ARYA 4H8WH 1VZGA 3Q6GH 1X7QB 2EINB 3AG2B 3CFMA 5MEQA 3UX9B 3ZGIA 2IIJA 3P30H 3TEYA 3BVUA 4HZLB 2Q9OA 3IPBA 4TUJB 4K7PH 1XXFC 1NCCL 2VH5L 4HETA 2WCGA 2LFGA 1KIUB 5EIIB 5T1LD 5I23A 3BPLC 2WXPA 3T6WA 2OYLA 3TU6A 5EB9A 4DK3A 2VT0A 3WNMA 2F18A 1H8OA 1U92B 1BPLB 1CU4L 2XJKA 3U4EA 2N0KA 4IGBC 1TMCB 2R1WA 3TF7C 3NJFA 1G6RH 1GC1C 1NCDL 2XVKA 1MJJB 3AMKA 3F62A 1XR9B 4FTVE 1GS7A 4AYMC 3MYJB 5A2CA 5F70A 2F9BT 3NPSB 4M6OH 5JMOC 3KWXA 1UKSA 4XN9A 4ANWA 5CUSH 2VDKL 4W9HC 3ARQA 3OHMB 5DSCA 5H37H 1KGCD 1D7DA 1PNCA 3HG3A 2EEDA 5HVGB 1WFOA 3V5KB 3FQNA 4P5RA 2KT6A 4JFZH 3ATBA 2BIQA 3US1A 1F3JB 2D31A 3BPOB 3CHPA 2O5XL 5B7MA 4PBDA 3O2DL 3UG5A 2ENSA 4P57B 5L8LB 4JFHD 1RLBA 3KNBA 4E5XB 3GO1H 3STZA 2QHRH 1BDYA 4WI9A 4MMZA 3GUTB 2CM5A 3IMWA 5AB0A 2Y06L 3FFCA 4MMYA 3KHOA 2YK1H 4L4TD 4AC4A 4X6DF 4G9FA 3TURA 4AQZA 2FHBA 1TDQA 5DS8B 4PRHD 4XMUA 2NR6D 5EU4A 1AQKH 5IMKB 3JWNG 3BD4A 3DPDA 2ZOWA 4N85A 4NWTH 1KPUB 2KPNA 2Y7OA 4GAYA 1KB9J 5FYJH 2BSED 4BGLA 5J6GB 3OMIB 5LN8A 4PWHA 4DQOH 3HUJA 4ISVA 5KYWB 2OJ1A 1TF4A 1HZHH 5DJDB 2OQJB 1R33A 3MLYH 3OVUB 3O6KL 3AY4A 2ZCKH 2ZUWA 5B8CA 1SFDA 5J12C 2X4UB 5J4MA 1YC7A 1HC1A 1QOKA 5DZLA 5I73B 1FFQA 1RULL 1I3GH 2L7QA 3ARBA 1YEFL 2E74C 3CLFL 3ZR6A 2MKWA 4Q0XL 1QVOA 3K4DA 2X3BA 4HISA 4NDMB 4LIQE 5I18H 4HH9B 1NC2B 5AOZA 3BD3A 2DQGL 1Q9LA 1HN1A 3MRMA 3Q2NA 5DO2C 5IB3A 2Y3NA 4WIQA 4G8EB 3S3BB 4WEBL 3L9BA 4M93C 1LO0H 5EIIG 1HQRB 1JSYA 1TMQA 3FC8A 4LVNB 5IT2L 3ARDA 4KVNL 4NI6A 1AQHA 4WWKB 1A02N 1KT2A 3KPQB 1NOAA 3IJEB 4ZX4A 1SEBA 1FSKC 3CZFA 3BOVA 1OE1A 4YE0A 2HRGA 3QHFL 4BSWB 3LXAA 4J1UA 3P4NA 2KPWA 1MG2C 1ERNA 3ULVC 5E2JA 3B2PA 2P1YA 2D9QB 4O58L 4MJ4A 3OJMB 5DRWB 1EPFA 1W72B 1YEEL 4HV8A 3IMVA 3KPTA 2HX9A 5G5DB 4EQ3A 4RMRA 3OAUH 1J9QA 2FB4H 1FVDB 2IAAC 2RD0A 5DUBA 1UG9A 1S5HB 1SBBA 5EUOA 4ZXBD 1SHMA 4Z5RB 4XCYA 1CLZH 1DQTA 1ZSDB 5C97A 1R0AL 4FS0A 1CE6B 1GHFH 4GQPH 2XRAH 4AZUA 1AGCB 3DXAA 3QUKB 4HX1A 2VDNB 5LNDA 3MUHL 5EU5A 5ICXA 1FNEB 4L4VA 4DW2H 4UTBL 3P4MA 2NNXA 3ASNB 4X6EB 4GH7B 4AYFB 3KL0A 4E5XG 3UZQA 4JDEA 4ILDA 5C07A 4MBOA 5D7LA 1JXJA 3SGJC 2A4ZA 2NCMA 4MBRA 2Q8BH 2ARJQ 4U7KA 1AS6A 2BS9A 2XWCA 1UM6L 4GNKB 2J1KA 4RIRA 3TWYA 5CINL 3EHBD 5LWYL 1PTZA 1TJHH 2Y5QA 1L3NA 4JY4B 3L3OA 3WHXA 1YC8A 4S1RH 4HIJA 2VMEA 1QHOA 2C8NA 3NG5A 2YO3A 5DJ2A 4JO8A 4MDRA 2MKLC 1WIUA 4IMKC 4WDIA 1OM3L 5EEVA 2A9NH 2EVFA 1FZKB 4EMZA 1NCGA 4PB0L 1CG9B 4B27A 3BAIA 1SLXA 1B9ZA 1MVYA 2Z35B 3RJDA 3N40F 5BS0B 1A4BA 2UYLA 3GMOA 4NZTL 4HC1A 1MCBA 1W16A 4KY1H 2WKOF 5JHBA 1QWUA 3RJOA 2PYEB 5GRVK 5LG1A 3TJEL 3RPIB 5JPMC 3ZTNL 3TBYB 2VW4A 5CD3A 3K6OA 2V33A 5HYEA 2YK1L 4HK0A 1U8QB 5ID1A 4QF1B 2HTKC 2G75A 4HF5H 4J6IA 4W9LC 1TQVA 1MIMH 3QXVA 3EJZD 1H3WM 1UM5H 3M46A 5FFGA 1LE9A 2VZSA 5FYJL 3FUIA 4X6CA 3DX4A 4ZNEA 3UFIA 2IQAA 1DQMH 2VABA 1OD9A 4HGMA 4M6NL 5EFIB 2GUYA 1UCTA 3DOIA 2YFOA 4NRXB 5F97E 3RIFK 3UPCA 4C59B 3VRLE 4KKPA 4LSUL 2X05A 1DQQA 5ICZB 4AG4H 2WXRA 4G6KL 4V1DD 4YC2C 1JZIA 4W68A 2EYRB 2X6VA 4Z9KB 2GFBA 4F37K 4OJEH 4UZUA 4R90L 3Q5YA 3COOA 3V5HA 5FGCE 1IVLA 4IKNA 3UJIH 4C83A 2VTFA 3L4TA 2UY7A 4GG6A 1AZUA 3F01A 1GGCL 1ZVHA 1FCCA 2HKHL 4P5TA 1DVFB 3B8SA 1BFVL 4WO4D 1B0WA 3AQZA 3ESOA 3QNZA 1OAJA 2VMJA 4LDOB 1QACA 3A24A 4S0HA 5CJQL 2WPGA 4PP2A 4G80B 1NLDL 3BIBX 5D2LE 3QJXA 4HKZB 3OLGA 4ELME 2D7MA 4PY8I 1RY7B 3TEUA 4B60A 1NL0L 2BSCA 5LBSL 4D8OA 2YAOA 2YOAA 3WGVB 3NRQA 1AE6L 1KJ3H 5D7HA 4ZW7A 4YXKL 3UH8A 3II3A 1IM3D 7FABH 3KGUA 2G9KA 3NT0A 2NQ3A 2JI3A 2LU3A 3O41B 4LSSL 5EDXA 4PW9A 1BVNP 5LJYH 4ICWA 1LM8V 1P6AB 3KLDA 3W0WE 5FKPB 4AIZA 3OHXB 4F33A 4Q6IC 3SCMD 1WBZA 1MFBL 2O5ZH 1FG2A 2XTJE 4IRJB 5EZJA 2D7QA 2DIBA 2ADIB 1JTPA 4HJ1A 4JPQA 4TSAH 2C3XA 1IKNC 1N70A 2R2EA 3FT2A 2VR3A 4X98A 2DJ4A 2EIKB 2EDRA 4XP5H 5FW8A 3VJ6B 3WIAA 4L8CA 5E6IC 4HUXA 3FUKA 4FI7A 4EZJA 1V27A 2XRAL 3LIZL 3MZTA 2V3FA 4FQXB 4TNVK 4WTZA 3I02A 4P3DB 4Z95L 2FE0A 5FKAA 4BEIA 5C7XH 1QP1A 2AEPH 5JOFA 3UZEC 1FG9C 2CO6A 3DIFB 3OR6B 4G1MB 4Z7UF 4BFFA 4UNTA 3N41B 3P9MA 3QHTC 4KXZI 4OZGF 4BQ8A 1KB5B 3L7EA 4KHXL 2W94A 3VG0L 1OHQA 3FUJA 3O4LB 3PP4L 3TCXA 4Z3GA 1R17A 5AVUB 4KKAC 3WIIH 4YNYB 4W1TA 1W0WA 4FXLA 2VAAA 4NUJA 4QRTA 1DLHA 3CQQA 4HCRL 3EAKA 1ZRUA 4FQ2H 3SDAC 4J3XA 3KBPA 3BH8A 3T0EB 2VN3A 2V5TA 3MO1B 1HQ4A 2ZF9A 3S36X 3V6OE 3S3SA 3FO9B 4A2DA 1U3HC 4K3GA 4JRXA 5T5FH 3S48A 4JFOB 2DDQH 2XG4B 3W57A 5FV2A 1LD9A 4BKLB 2ZF8A 2MPAL 4ELKB 5F9WB 2MFNA 3UC0H 3WN5B 1X6LA 3V4VB 3BJLA 5MI0C 1XGTB 4MQ7A 1R3KB 1CBVH 2W9DH 3LN4A 3O6ML 1P1ZB 2YD7A 5BPPA 4OLZL 4D0DB 2X4PA 2ZOTA 4LBEA 4XCNB 2KDYA 3KPMA 4YSPA 4NQDE 2TSBA 4YAQA 2IADA 1MVUB 4M8VA 4BD4A 4M7JL 2OYKA 3RL2A 1B9KA 2VUOA 2E7LC 2ZX6A 2FGWH 1P4BL 2EXWD 5D1ZC 4AQ1B 4MAYC 5CCKH 2JI2A 2WXJA 3TOPA 3M88A 3WIFA 2IBZY 2W38A 2B08A 2QSVA 4UBDD 2ICWB 1G9MC 2PKDA 3CBKB 2XWBA 4NJ9L 4P2QD 2CBPA 3MNDA 5E70A 3Q13A 5KJRH 2R4RL 4YHYC 2LLLA 1V10A 3FXIC 3WEOA 5DYOA 4PSPA 3X11B 3WLBB 4YSRA 3WD5H 4EUPB 5LNEA 2Q8AH 3KLQA 2RIKA 2QR0B 4BZYA 1ITBB 4PJGA 3MREA 2X6UA 5KS9E 2MCMA 3KPSB 1LK2B 1B88A 4ODTL 4Y2DC 3GBNL 1T4WA 1M7IA 5DUPL 1A6UL 3OPUA 1WRFA 4HQQH 1XMWA 2ZYHA 2CUMA 3WIHH 1C7SA 3JTBA 4GP4B 7FABL 1G9NL 1MHHA 1MJUL 1BXAA 3L3GB 4KZEH 4D94A 4WFFD 4JO1H 3D2UD 1OCRB 4GO8A 5IJKA 3BEWB 1E6OH 4XPBL 5AL0A 5E2UL 2CK0H 4BZ2A 4UOW0 1MW0A 3K4ZA 3F2LA 3N44F 4WJ5B 3FSZA 4OV6F 2HH0L 4ATTA 2F7QA 3FN0L 3NYKA 5KN5A 4J3WA 4N8CL 2P7TB 1INEL 1TZGH 4FJ6A 4L3CA 35C8H 3HC4L 1SUJA 3QFDA 3RTQD 4XPTL 3MOAH 4HU2A 1TQTA 3HR6A 4PJAF 3MJ7B 4JQIH 2F6AA 4I0PD 4V2CB 5TPWL 1FIGH 4HIXH 2XXMB 1KCBA 3NCBB 4TL4A 2NUTB 5HHXL 3ULSA 1CLOH 3GZKA 3ZHNA 5C08E 3LNEA 1KIRA 2DN7A 1GGYA 4TF4A 5I0YA 5KBLA 3H7BA 3S98A 1MPAL 1V8HA 3MBXH 3QDMD 3BFQG 2HTLD 3ZLQC 4MA1C 5F7DA 2Z1PA 5IF0A 1XGYH 3BVXA 4FFZH 5D7JC 1ZLUH 4EAEA 2HFEB 3EJRA 4R26L 3V0IA 3SGKA 2Q0ZX 3SDXF 4C56D 1JK9A 2RGSA 3GRBA 4PRAA 4G9DA 2HT3D 3FO2A 1AZRA 3LZPA 2J4WL 2OJZH 3F7VB 4FQ2L 4DAGH 4P59L 4XVSL 2EE6A 5I1JL 4OAWA 2P4AB 2IPUG 4FQCH 2ZX7A 4NQCA 4ODBD 2I27N 4EIBA 4RAHA 2GI0A 2W0FB 2EIEA 5SX5K 3ROLA 6FABL 1N0XH 3DSNA 2FD6H 4JDZA 3VG9B 3FO1B 3NH7L 1XMEB 4LRNH 4HUUB 4EUPG 3RHWF 2ETWA 1H5BC 2H2PD 2NY0B 4B96A 4EOWH 2IANA 2GJ6E 2OM5A 3OKKA 5DQ9B 4NFDA 5DD1L 1D5MB 5E23A 4QXTB 4LEXL 3CZKA 4YHML 4X5QA 1YEGH 2XPZA 4AUUA 4KQ3L 2Q76A 4GO9A 4PJDF 1ECYA 1ZVSA 5I8CB 5I66A 5KYUB 4U1NB 4E0RA 2VOTA 5KTEL 2FL5A 2PPFA 3KJ6H 12E8H 2PCFA 1I8MA 5KVGH 2Z31C 5MEOB 1KENL 1DVZA 1RPKA 2X28A 3ECWA 1TKWB 3K7UA 5C0IB 1KTDA 1F2XK 4BZ1H 4LLDA 5FO7A 4FLHA 4JHAL 5D7SL 3MBEA 2EIMB 3FB7B 5AOIA 3MACH 2E76C 2XIDA 1R5IB 3WXVL 1MHEA 4OR1A 2Y0SA 4WHYG 2NW3A 5T1KA 1QSEA 1AHWA 2W95A 2C9SA 1R19A 5ANHA 1ZWIB 2NXZB 4PJXE 3TJHC 4OI7A 1LO5A 5IESH 2WBJA 2AFNA 3RPKA 1AIFA 1AR1B 2MQ0A 5FM5O 5C09D 2X2JA 3ZDZB 4JHVA 1RZFL 5E9DE 1XGZA 1Z5YD 4KDTC 4XPAH 2YJLA 2ZXCA 3T4AB 4NENA 4B7IA 3QWOB 1NGXA 3ARFB 1OF2B 5JMRA 1QHPA 4J3OH 1ZA3A 2YXFA 1HINH 1BVLB 2NW2B 3I9GL 3H53A 3ISWA 1JP5A 3E0GA 2DQFB 2R7EB 2CK0L 1F1AA 3MRNB 5F6HJ 1WCQA 4M4PA 4P5KA 3SDYL 3BJ91 1I8LC 4LKCA 1DBAL 2MOVA 4MHHI 2H2SC 1ZA6B 2DQCH 1PY9A 3LH9A 1I31A 5ITFA 1F6FB 5CWSA 4NO0D 5DMJB 4MQXC 3UROR 3WENA 43CAA 5LGJA 4NO3B 1CDGA 2JKTM 5B4MC 3QI9C 2YRZA 4YSUA 3L3HA 1Q4NX 1AFVH 3LXCA 1UQSB 2AVFA 1E9QA 4TNFA 5BZDA 2AJ3A 4PJFE 3D06A 3HHSA 3JWDL 3M8OH 3OLEA 5HYJB 1S9YA 1UOKA 3KWVA 1NIAA 4KZDL 1VFBB 3RA7H 3L4WA 1Z7JA 2WO3B 2ZYSA 3OQ3B 3PV7A 4DPCX 1MVFA 1G7PA 2B20A 3E9TA 4ABVA 4WHCA 1J8HB 3ZL1A 1DVQA 4G43A 1A4KA 1VPOL 2BNRE 3LPGA 3OSKA 3CN4A 4JFFE 3FT3A 4IDJL 4M9OA 3BAJA 4Y5XC 3FU0A 1FPTL 1U3JA 5T5NF 1MH5B 2JCCF 1XZ0B 2PETA 3Q5OA 1XF5B 4OGQC 1B0RB 1B4LA 3P0YL 5I6PA 2PPDA 2E7MA 3OC8A 1WVZA 1URIA 1ZV2A 4DP1X 1KG0A 1FFPA 4H44C 4B5ZA 4ZFGH 1GL4B 4L48A 4YHZH 5IHUH 2X0WA 3CFQA 5FHAL 1LILA 3NACH 1KELL 4YDLB 2V3EA 1WPCA 4PAZA 3BKML 3BWUF 3NJLA 3WTUA 4OSUL 1FBIL 1OPGL 1H8NA 2FD6L 2I26N 3QFJD 2ZWNA 3GHEH 2PXYD 3TZVB 1FQ9C 1BM7A 3HNVH 2RFXB 5I1EH 4IRSD 1JBJA 5F3HA 4AI7A 3D18A 4Y4FA 3D0LA 1CXLA 3Q7JA 3LQZB 4KJYB 1IT9L 2NX5B 3FTYA 1J1XL 4XP6H 1OIOA 3GMQB 3CVIL 4YHLH 1N0LB 5L8JB 15C8L 4APQA 1WZKA 4BH8B 3BSGA 5IB4B 4L8DA 3IDMB 3TYGL 1HYSD 3LN5B 4YSTA 5E6SB 4MA8H 3GJEB 1CDCA 1UYWL 3WNJA 2VDRB 2KBGA 1BFOA 3BI9X 3EYOB 5FM5M 5HGGS 3V0HA 1P53A 4OZFA 3MJ9L 1CS6A 4LVOC 2KMWA 1WD8A 4EN3D 4U3XA 2Z65C 2DLGA 2FBJH 3IK2A 2NY6D 2P8PA 3L4VA 2XG5B 2NY2B 3MLWL 1UJTA 2EH8L 1YYCA 2B0SH 3GXMA 1YNTF 2ZKWA 1T0NA 1R6VA 2QMJA 3FUEA 4R83A 2AXGA 4AH2A 3MU3A 4OLUH 5DK0B 2VMFA 1JZ3A 1E4WL 2Y23A 4NN7C 5I16B 1TETL 3I9PA 2XYBA 3UTTA 3G5ZA 1EMTH 3VD3A 2BVEA 4JFTA 4X2UA 2BLFA 1VB9A 4HPHA 5JHLL 3ZKQD 1RU9L 1KV7A 1L3WA 3GRWL 3QZPA 4NM4L 1HEJC 2BK8A 1P69B 5CFAA 2DY2A 3RILA 3TT1H 2W0PA 3AB0C 3V8OA 2J5LC 3GI8L 2P8LB 2F5AH 1QFUL 4G6ML 4ABQA 3TO2A 1ROCA 1FVCA 2VW6A 5T1LB 5KG9B 4KNTA 5E51A 3UEZA 4MCYA 4KJQD 1CZ8L 4I9WE 3MNMA 1PJWA 1DO6A 2AQTA 4Q8BA 4U6HB 3WFHB 4BFKA 4F5CA 4XNUL 3X3FL 1N12A 1IC5H 4N3TA 5HDRA 1JHKH 5LLIC 3FH8A 3FRUA 3ARGA 1YLBB 1HAUA 1JYWA 3LRSA 4DP8X 3X12A 1F86A 3BP5A 3L16A 1VACA 4JFEE 1FV1B 4R7DB 5K39A 2J57A 1IQDA 1I8KA 3VXSA 3N1FC 3JBG7 3TH4T 2NQCA 3JZ7A 4UT6L 5IKCA 3DSFL 2FWOA 3LTVA 5BV7H 2Z6FA 3L5WB 2V8LA 2VXQH 3CC5A 3AXHA 4OCYL 1LQBC 1KCVL 2YD6A 4AW7A 4BWTA 3SGDI 1D3CA 4KKLD 4HUWB 2Q20A 2XFXA 5ELIA 2Z0BA 5CN3A 4AE0A 1HXYA 1CCZA 4PWKA 3HZYA 2M8XA 3D85D 5IB5A 5JNYA 4UQ2B 3VXMD 1NM4A 2X09A 5DJYB 2PWEA 5LN4A 5D7IA 4P05A 4G70B 3MLUL 3BZ4B 2N59A 4L4TB 5CD5D 1KXTB 4O2EB 2VZVA 1A9BA 1ANUA 4PRHB 2HUEA 4K3EL 2CLRB 4Q9RL 5DFVD 4Z0BH 3OAYK 5AVXB 1LTXA 4PRBA 4J3UA 5DD5H 3IWUA 3ARPA 2MJWA 2JELH 1YUKB 1KLGB 2C1OA 2I7OA 2JKXA 5E2TL 3ILPA 4H8WC 1I7ZA 1EO5A 4P5MA 4PJEA 2DIJA 4NO5A 1N5AA 2GB2A 4FLOA 4Y1TA 2LLNA 5GS3A 1N26A 1XGRA 2YD9A 5SV3A 1VADB 4YDMA 3DOSB 3A6BL 4F7PA 4JUTA 3ESVF 1QHQA 1R5VB 1U8LA 1UT1A 3RKPA 1DO5A 1UM4H 2XXCB 3VW3H 5MEPA 3RJQB 5AZUA 4WK2B 2LE9A 2X4NB 4OGXL 4OZIE 4FAAB 3F83A 4GAAA 2QQQA 4K07A 2RA1A 4HXAL 2D03H 2HJLA 2HLAB 1P7KA 2R1YB 2Z3FA 32C2B 3B9EA 4U2YA 1F8TL 2AITA 3MLTB 1KPRB 4G3YL 3GJFA 5EC2B 3MGAA 3BKJH 2FBJL 3C6LC 3LSOB 3SE4C 2LU5A 3ZE1F 4GRLD 3CHQA 1I7RA 2HX8A 2XN9A 4HPOL 5DWUH 4XN7A 5FYJU 4DTGL 5GGTL 5ITBL 3H4HA 3ML9A 1JZ2A 3BXNB 1V54B 5C0JB 2AXFA 3CDFA 1W72L 4RCAA 4W70A 2GJJA 3SO5A 3UAJA 5C0RH 4LEEA 5IMOB 5CLZA 1ODUA 3TVMC 3AWFA 3VFOB 1HL9A 3PL6B 2EH7L 5HD8D 4XPGL 1IC4L 5AVZB 5JW4M 2ZOUA 1IGIH 3C9NB 1K8IA 4M61B 3ZDXB 3ZIYA 2WXGA 4MRCA 4PU2A 1YYMH 2R4SH 2VDNL 3EJYC 3FN9A 4UAOB 1BJ8A 1AQDA 3EGDA 4KTGA 1HCZA 1W8EA 4ZXBB 4F58L 2E56A 1JVOA 4P46B 5FYKH 4KV5F 5AW1B 3RWJA 5I19H 5IP4A 2YD8A 1N6VA 4LXFA 3HJ0A 3SE6A 1CVRA 5FX3A 2Z4QB 3TV3L 3UG3A 3G6AA 4RFOH 1AGEB 4AYDC 1HVXA 3T6VA 3ZL4H 4XP4H 3N1QC 4M7KL 1QBAA 3QWRA 4F57L 4OM1L 3TH3T 2B4CH 2Z93B 3SY6A 2IH3B 5EZLA 3W5NA 1J1OH 2J7LA 3H3PL 5EZIL 3OX8A 1NFIA 3EHBB 4UINH 4ODHH 4F2ME 4I4WA 4NM8L 3Q8CA 2Q86A 4ANXA 1HYRC 4IJTA 2Y36H 1NBQA 3VU1A 3AITA 2C9PA 1ZT1A 5KSAC 1ORSA 2FH6A 4R9HA 4XWOD 4MD5B 3U1SH 1BLIA 3FOMB 1ETB1 3LX9A 3FQRA 5D8JL 1HXKA 4IQHA 4IU2A 1YPZB 1AGBB 4DK5A 1E9PB 1Q1PA 3TBVB 1EAOA 3B2UC 1YYLL 3W9EB 4U1IB 3GLAA 3FU6A 1Q9WB 4FQHB 4XVJH 3FTSA 5CMAB 3VGAB 1UWFA 4A37A 4K9EH 5K69A 5B3JF 2YS4A 4P2OB 4BQBA 4ODSL 3A4AA 1G7JB 4CDHA 2Q87A 3EOTH 5JTWA 1TR7A 4PRAB 2CRZA 5B1JA 2A4EA 2GSIB 4PB9L 2V2TA 3VCLB 1KJ2H 4KI5F 3MV8A 4YH6A 2Q10A 2W9EL 5EOCL 1IAOA 1ADQL 3RIKA 1TVBA 1J18A 2BJML 1F41A 1EXGA 4PM1A 3CCHA 5IG7B 4CNIA 5A40E 3W39A 1UHVA 3GINA 1CO1A 4WF7A 4V1DB 3FH5A 2R0LL 3MJ8B 3KL5A 2A4CA 2DWEA 1ZGLM 4AJWA 4AY0A 1UXSB 3PE9A 2A6DA 2VDLB 1XGPB 4GSXA 5GISH 4J4PD 4QWWC 3RY6C 5LCVL 5ADOL 4GMTH 1K4CB 3N85L 5DMYA 4D0CB 4UU9B 3D33A 1QEWB 1DANT 4PS4H 4ACPA 4RH4A 2VL5A 4WO4B 4ZFQA 3B9DA 4MCMA 3S2AA 1IL1B 5F7BA 3W2DL 1CQKA 5KW9L 3HUJF 5DUJA 5C0CA 5K9JL 4UT7H 2DI7A 3E6HA 3MCLH 1X4XA 2R29H 1M56B 3AY2A 5EEYA 4DGIH 4P9MH 4L0ZA 4HLEA 3GMLB 3SDDA 3KVDD 2XLLA 3G3LA 1KGXA 5G4NA 3S4SB 1FZOA 2CHXA 4Z7QF 3F04A 4XN8A 1RHFA 3D4CA 4Z18A 3BPNC 4PBWD 1P9MC 3VE0B 5E4EC 2WYIA 5EDSA 1M1XB 1CDUA 4Z7UE 1WZ1H 3CFDA 4PWIA 4FA8A 3L1EA 5HHQB 5I75B 3T0WA 2GBTA 3TEWA 4OZGE 2BIOA 1IM3B 3QUMA 3BSZL 1A4AA 1KCUH 2H45A 1KFAH 3QP3A 2YQGA 4MNGE 3HB3C 2WXMA 4Q9BA 4QTIL 5ISZE 4FQLL 5IFHH 1JPTH 3SCMB 4BBWA 2EDWA 3SBWA 3WLWD 3IRZA 3FB8A 1IKFL 1IGIL 5D7LD 2CIIA 1UWYA 4WNQB 4GBXA 2ZUVA 4PTUA 3BMVA 4RMVA 5FYKL 2P8MA 5EG6C 5CBAB 4P49A 4U05A 3B6SA 1T21A 4NQEE 5L2JA 3GBEA 4NYLA 1RUMH 5GZOA 1NKRA 2FTAA 1EHAA 3WE6B 3QQNA 5D1QD 4YK4C 2WQWA 1KB5L 4ZQTA 3SKOB 5MHSD 4ETYA 1B90A 5H94B 3QQ9D 5DJCA 3MA7A 5EU7E 5ADPH 1SY6L 4O4YH 5FOJA 2NYYC 2QLVB 3QDJA 1MFNA 1PY0A 5EUOF 3VXRD 4YPGA 2Q7AA 4HIIA 4V2BA 4KK6C 4MASA 5D93B 1NBVH 2WVUA 1KNOA 1MNNA 1TJXA 4Q58C 2ED9A 3CPUA 5IUCA 1YECL 3BP4B 2H32A 4LPTA 1CLVA 4MD4B 5BOPA 4JZJA 4YHKL 1MI5E 1JHLL 3U7YH 1QBMH 1HSAB 4PJ5E 4NBYB 3ALXA 4KKCD 1C8QA 5BO0D 5JW4Q 4RGMC 3IXTA 4CBZA 4R3SA 3V4VL 2WYZA 3V6FA 1JDDA 3RNKA 3GSVA 4LCIL 5E8PA 3CXFA 5HXMA 2WLJA 3K72B 5HJGA 5CEZL 4K9EL 1B0GB 1RP9A 9CGTA 3D0VB 5AZEL 2EDBA 3C5SB 4RMTA 2QSQA 1KZQA 5L2KE 4IDLA 1T2QL 3BPCA 4D9QD 3ZZLA 1U8OA 3ORJA 2F8XC 1G9NC 1BZ7A 1QW9A 1NCBH 4P5TD 1BLNA 3S4SG 5FDWB 2K4AA 2WGNB 4PWEA 4O51B 2Y7QB 4PCSA 3ROOA 5CJXA 3QEQE 1PZBA 2A74B 2VXSH 2X89A 4J12A 2X6MA 1DBJH 3MGTA 3HAEB 1QPXA 4XODA 1HIMH 4TLTA 2IXQA 3D05A 4NN6C 4ZTEA 2IJ0C 3TIDB 1I1AC 4NNPH 1GXEA 3EFFA 4ZMWA 3JTTB 4AK2A 3O3BB 4WU5A 3BFOA 4WUUA 4X6CF 2NSXA 2ZWYA 3VFTA 2QDWA 3B2VH 2YMOA 3QIWA 5MENA 1PGRB 4UB0H 3WN6A 3L9YA 4EVNB 4TNWK 5CGYC 5C0DA 3X3GH 4G42B 1A4CA 3C5JA 5DA0B 4PJAE 3P73A 1LDSA 1ZDSA 1I82A 1JGVL 3D69A 4G59C 1DFBH 1H3PL 4JKKA 3U6XA 2QQLL 5I0XA 3HW7A 1XCWA 4GG6F 1JNLH 1CL7L 3DARA 4AKPA 4FL4C 4AYSA 2AANA 2Y69B 4LLVB 1BEYL 2R1XB 1OW0C 3H2PA 5F21B 4F7EA 4AGPA 4H25A 5EBWB 5HVHB 4X6BB 1AS7A 3TEZA 2BCKA 4KK9D 1I1FA 3EBIA 1V7MH 3D2UB 3P54A 4FNLH 4CADA 1FP5A 4NP4H 3NZ8B 3O8XC 4U0RB 3SDXE 1XWVA 1MFAL 1GYWA 4YDIH 4GW1A 1JG9A 4RGOH 1JPFB 4KO7A 2E6QA 3BEVB 4L05A 1TITA 1OT1A 5DK3A 5H35A 3TGXA 1CT8B 5F7KC 5AB9A 4L29B 4NKQB 4XH2B 4U6XB 4K9JA 4I0PB 4UQ3B 5GGVY 4Q9QL 3IKCB 5FXCH 4RFEA 2CIKA 1RIUL 5ANME 4O02H 3WKML 1FL3B 1KC5H 3QORA 2RALA 1MRFL 4KX8A 3HN8A 4Y4HA 3SGEH 4Z7WB 3MUJA 1QKZL 4RLDA 1QLEH 2XKNA 3QDMB 5CN1A 5F9JA 2YD1A 4JO3L 3AUVA 2NNAA 4MB3A 4YWGH 4XXDB 1TEYA 1OAQL 2ENPA 1UCBL 3F58H 3IRCA 3WTTA 4MJ5A 1XCQB 3KGSA 1AD9B 4NIYE 1GAFH 4PJDE 4Y9CA 2R8SL 4C56B 3OKLA 5L6YH 1OZTG 3Q06A 4FERA 5F0PB 5C92A 1BZ9A 4UDTB 3ABMB 3ESUF 3K1KC 1X5MA 1I7UA 2ZP0T 3HAEG 2YUXA 2Z92A 1F5WA 4ZI8A 2YAPA 5AW3B 2WVVB 4XCEB 8FABA 2G5RA 3CX5K 1CE1H 1P2CA 2ZJSL 2JTDA 2XZQL 3N2JA 2GEEA 4HDIB 2CO4A 4NHUA 4OIAA 1TZHB 4IRZL 4Y5VC 2LTQC 3ZPDA 3PWUA 1QABA 3UADA 4N68A 5LXGL 2KLSA 5HHOA 1U8CA 1WZLA 4Y4KA 2C7FA 2Z4TA 1RK0B 4KJWD 3JWNE 4KUCD 4D7PA 2MCPH 3V95A 1T5XA 2FK9A 1OEZW 1WC7A 4KROD 1D5BA 2VXTL 1Q72L 5E2VL 4IKKA 2WSKA 4WW2C 1WA2X 4DCQA 1FO0H 3CVDA 1UH4A 4JRLA 1BD2A 5E08L 2E0PA 4L8SC 5D72H 2V6HA 5I1DA 2CZNA 3MRHB 4PGBA 1QLRB 4EZMA 4C54A 1GGBL 4ONHB 3SQBA 4GT0A 4H5SB 1VERA 5DU7A 3R8QA 3IWVA 1EJ6A 4JMNA 5H8DA 4K5NA 2BDNL 5JORB 2A9BA 4GFXA 1SNRA 1GOGA 3A23A 4PUBH 1HHKA 4AEHH 2FX8H 2ZUSA 1T6VN 3DJZA 2WBWB 3KYKH 1SXAA 5J1AA 5BW7C 3B2VL 1JZ6A 4OH2A 2VQ1A 3KWWA 1OSPL 3JWDC 4JO2L 2OMVB 4HIEB 4F7TB 1Q0XH 1JV5A 2OP4L 5GGUB 2ATKB 2ID5A 5EOQL 5C6TL 2ADJA 4N5ED 3LIUA 5DJ8A 3BUYB 3AGWA 1S7RA 1MCSA 3L5XH 4UYPA 1J9RA 2F08A 3SYCA 4QNPE 3ARVA 4NQXB 1IFHH 1EAPB 1ZLSH 2X1XR 3HE6C 3MCKB 5HSFA 3KJ4B 1I9RL 1VFAA 2BZCA 3POCA 1GSKA 1SHXA 2WQ8A 3BP7A 4ZOBA 5IW1B 4XOCA 1E4KA 3QXTA 1HOEA 3J8F7 4CJ1A 4APXB 3RGHA 4PJ7A 2CGZA 1P0SE 4PJGF 2AXWA 1HI6A 1KIQB 2JCCE 2GTQA 3WNOA 5AVSB 2ZKHH 1F56A 5C0BE 2WXQA 1SDAB 3X13A 2J5WA 4XNMA 4M8UA 4YHNA 1GGIH 2DQEH 2D0FA 3LHPH 1QRND 4NO0B 2XPGA 4IS6B 5T3ZD 2D4DA 4DEWA 3BUIA 3MLZH 2BCMA 4DEPB 2GJZA 5EU6A 4UIMB 4Z7VA 2O61B 3JUZA 3IJHA 5DUML 5IQ9B 5E8OA 4JM2C 1EDQA 3FSOA 1UOWA 1UT9A 4F9LA 1WGOA 4HKXA 5EBGA 3ZDYF 2YFNA 3PAZA 4KTDH 1F2QA 3NCCB 2WMPA 3BFWA 5F93C 3K0YA 4MX7A 2GTZB 3DRTA 1NIFA 2F54A 3C5ZC 3T3PB 1FNSH 2IPTH 4S1QH 3BH9A 3MGOA 4PRID 3L9EA 3HG0A 4GAGH 3BZFB 4PJCA 5D1XE 2NY3C 3J2PA 1Z9OA 1MWAB 1GAFL 1J9SA 4YFLI 1OE3A 3VA2C 2ITDB 5DMKB 4PJ9A 1ACYL 4GSDH 3G6DH 4PMEA 2CLZB 3EJQA 3EJTA 5E5UB 4JPKL 4MAZA 1EAQA 5F7HA 5L88H 3VVVA 4PY8J 4OY9A 3LRMA 4HSCX 4I2XB 1CFQB 3JYBA 3US9A 1N5YL 1QUNB 1VGKB 4XVTH 3PGDA 5IB1B 2AQ1A 1D6EB 3OKDB 4OM0L 1A0QL 2YRBA 5GSRA 2ESVE 3VI3A 3VTAA 5IROD 1ZLUK 2FSDA 1ZS8A 3QFJB 4JUSA 1SXCA 1C7TA 4HWEL 2PXYB 2OTWA 3GSUB 4PLOB 2DQDL 1PLBA 1RUAL 1CDHA 3IFOB 4FFVD 4CN6A 2XBDA 4OV5A 4HPYH 1WZMA 4J3OC 4NPJA 3CQPA 3QC6X 2VLKD 4GSUA 1REIA 3VNZA 1WFNA 3WY1A 5IIEB 2DW5A 2VDRL 1IO4C 3EOAA 1J5OL 1ZIBA 3TTYA 3SDCA 2YQBA 4O5LH 3WCYA 1CFNB 1X5IA 4LP4A 4OTXH 1FVEA 1N4XL 3C8HA 5INCB 1NC4D 3RWEB 2I9LA 4PJBA 3MMEA 4JG5A 4L2LA 3GXIA 1Z9MA 1T5WB 1NEZB 2UUDH 1UB6B 4M5ZL 2CNYA 4FN0A 4EN3B 3R7RA 3C60A 1FNAA 1USQA 3CXDH 5L7XH 4N2LA 2NY6B 1Y6NR 4ZPVA 4A2MA 4UIKL 5T5FA 4CKQA 4DWHA 2VJXA 1F1GA 4BV1A 1HXMB 4LDCA 3WO3B 1HH6A 1JWMB 1AJ7L 1P7BA 2BW4A 2WINB 1OZUA 7CGTA 1MJ8H 4DP2X 5I1HL 5TF1L 4Z23A 1BIHA 2AV7A 4F91B 2EDKA 1HDMA 4X7SH 4YFDB 4QJ3B 5B38B 1BQLH 4HEMA 3C09B 3LS5L 5JXED 3X17A 3GZQA 5SWSE 5AD0A 2DTML 4GP8B 4P4RA 1T4KA 3US0A 3DX0A 3QEUB 3DYOA 3PUUA 1QFWM 1M9WA 1R3IH 1GTNA 2FR4B 1A6VL 3QWQB 1L9MA 4OD1L 4FQJH 4JKPH 3LEYH 2V2XA 3N1MC 1S9WA 1UZGA 3T3MF 3U2SB 3HPJA 3FCSB 3RB5A 1AKJD 4YHPA 4JY6A 5AQ0A 4E42B 2AJVH 3SZ6A 2YA1A 1FLRH 5DHEA 5HGBA 4HG4K 4P2RA 3UAFA 5MP6H 3B37A 3AT0A 1CTMA 2DKMA 3TN0B 5I73C 3HZMB 2WLMA 5I6XB 3CK0L 2PYEE 4Z3IA 5FECB 4NZUH 4CVZA 2CCWA 2HCZX 4L1HA 3RI5F 3STBA 1QSFD 4KI1A 3X2QB 4GXUM 3RGVC 2Y1VA 43C9A 4PJ8A 2NUPB 5PCYA 3L3DB 2KUTA 2IALB 1DVUA 5D2NA 4F20A 4HHWA 4HLZH 1YMMD 5DLLA 1VGEH 2OULB 4R4BB 3TFBA 2NZIA 1WISA 3H56A 5JPNA 4WWKC 2ZOKA 2J8OA 3DDFA 2ITCA 1ZVYA 3OJDA 3II2A 3NQKA 4Z3FA 5D5MB 3U0WH 1PG7L 4PQXA 1CDBA 3SGEI 1NAMB 3D85B 4UANA 3STLB 3VXMB 4GSDL 3ZDWA 3PNWA 3NIFF 3WNPA 2HLEB 2ZICA 3RX5A 4Y4FD 3NA4A 3O3UN 5TE6L 3WY2A 5I2IB 4HJEA 2V5MA 3D9AL 3C6SB 1C16A 5F88B 2ZYIA 4NRZA 1NEZG 1T66C 4XOAA 4UQDA 4JQIA 1R5WA 3RX7A 3ZE1E 4APQD 2IDUA 4GSQA 3IT8D 3GF8A 1D9KD 4ZS7L 5JW4R 2UZIH 1WA1X 4HGWA 4Y1AA 1OB1B 4LLQB 1RK7A 1K2DB 4LEOB 4CDGC 3NCXA 1SDDB 4XAKE 5E2WH 2BSSB 4IGBA 1CLYL 2V37A 4AIEA 3HS0A 1A9VA 4NN5B 4EN2A 4OLXH 3Q48A 5ERWB 2EIBA 4FFZA 4QI3A 4A7TA 5B38G 4I0CC 5IBUB 3DX6A 4PW3A 2OMTA 3QUXD 3F3HA 4OGAC 2OMBA 4BFBD 1ZHLA 4N8VB 2GYSA 4QTHA 4TUUA 2XWEA 2B59A 1SVBA 3BAXA 5DZPA 4BELD 3MUGA 1CXEA 4KK8D 3UABA 1FAKT 2G5BA 1SJXA 4XB8A 3Q8AA 3VQ1C 4KV5E 5FO8B 3UTQA 4XVUD 3UTTD 5E99L 4Y7OC 4M1GL 1EZLA 3DHUA 4P3WA 1GKOA 2OZ4H 3RWHB 1X5LA 5I9QB 1V5JA 4GRLB 4ERSH 3NFPB 4PPTA 2YPLE 2XXFA 4KNQA 3LKPB 3QZLA 5IOPA 1KN4H 1DDHB 3FTXA 3MV11 4OZHB 5BV7C 2VR9A 4MJ6A 1MQKH 1KBVA 4HBCL 4YEEA 7PAZA 3SKMB 2B9AA 3AU1A 1LO2L 3O9WA 4S1SL 3IF1A 1QPKA 1P7HL 4LHUD 4NAJA 4LF3A 1QFWH 1UACL 2DQIH 3NZHH 1UWEH 3VGEA 1F4WL 3O4LE 2P5WD 1HOCB 2BP8A 3LNGA 1P5UB 4ZMVA 4HU8A 5L4JA 4PMFA 1BREA 4DFIA 2IDQA 1I53A 4ODWB 4X5PA 1NBZA 4O00A 3BD5A 5IVXB 4OF5A 2B7DT 5I6OA 4M8QB 5FYLL 5GJSL 2I9TA 2BOLA 3EFOB 4OVUA 2LAAA 3T77A 3QPXH 1ZIAA 2DD8H 1J0HA 4XNYH 3WTYA 1CGTA 2CJUH 5CILL 1E8WA 3O3DA 4AM0B 3RY4A 4KI5E 2VLRA 4N86A 2YC1B 3CD4A 4QMEA 4Y5YC 5CLXA 2DQJH 4MMZB 4UQIM 4UQBA 4ZO6A 3EH1A 4YIQA 1E8XA 4M4RA 1ZOXA 5EF0A 4AW4A 3RFZB 3EJPA 3I6GA 1DL7L 1DQVA 5JHDD 1VGEL 3FFCE 1F58H 1KJMB 4JHWH 1RFDL 3FMGH 3BDXA 4HUVA 4LOVA 5IBUG 3WXWL 4UI2A 5CZVH 1NDGB 3FQWB 1OAKH 1W2KT 3FU9A 2B1HH 3GSQA 5AZ2H 3KPNB 4HUNB 4N8VG 4QOKB 3CMOL 3ZY7A 3H2WA 4X4XB 4JZOA 4AEEA 5IJDC 4URTB 1A1NB 1R47A 2N4IA 1OAZH 3HUJE 1FRGH 4GFTB 4ONGH 4UTCA 4XP1H 1CGUA 1HL4A 2F0CA 2X1QA 4FZ8L 5DQJB 2IWKA 2KYIA 3OHXC 4GMSH 1U4FA 1Q9OA 1NA8A 3SHSA 1S7QB 3N9GL 5HYSA 2WB1A 3FO0L 3JT2A 5F2FA 1GJWA 5EN2A 4Z7QE 4IRJC 2EDTA 3JV6B 4OF6A 5IJVA 3OLDA 2IH1A 5HJ3B 1BIIA 2BIHA 4R5VA 3MRMB 4QDGA 2N0MA 3WJMB 2VDLL 3HNTH 2WTPA 1M6OA 4FMKA 4WKZA 3E3QC 5D7IF 1ES0A 4PTTB 5BO1L 5HVWA 3SGJA 1IBHA 1H15B 1MW3A 1S7XA 1Y18B 2DLIA 3OKNB 3M1BA 3PFUA 4FQXC 2XN9D 4JFSA 5CEXB 4PG9B 3L7FB 1SEBB 1JFQH 1OSEA 2FATL 3CZFB 3FT4B 3EO1B 3OKOA 4PVLA 1R3JB 1T7YA 1OOWA 1T83C 3G5VB 3IKKA 3L95A 1CFMA 4MJID 2ORBH 3NEXA 3QI9D 2DMBA 3EYFB 5HYQA 5HDQH 1RVFL 3AFLA 1YAZA 4KXBA 4A38A 1F1DA 1W0YT 1A2YB 4PJEF 2H6OA 4HV8B 3ZT7A 4DKEH 5D96C 1NCAL 3KPRD 4EQ2A 1XR8A 3V6OC 1JZ8A 1FL5A 3I84A 5BRQA 1PKOA 3NA9H 2HT2D 3QW9A 2L0DA 5C0AD 1NICA 2IPKA 4OFPA 1JZJA 4LRIC 2F8IA 5DZJA 5EUOE 3HI1A 3CSYB 3KPOB 1TVHB 3DO7A 1G9EA 5EU5B 3K2UH 1G7QA 2PR4L 4JN1L 2VLJD 2OSLB 3DXAE 3VD5A 4H20L 4DVBA 2XDHA 2JFCA 1SF5A 4ZUWA 4L4VE 2YXMA 3PG2A 4M29A 2J6EL 1AG0A 4U1SA 5C3TA 5F9WC 1X4YA 3WN5C 2YKLH 3I74A 2R2CA 4FXKA 1F90H 1FFOB 3ZW3A 5C07E 2XC8A 4GAJH 4LLUA 5CAYB 1TUPA 1KUMA 1VZHA 4JM4H 4XPFH 3LCYA 4RGNE 1J05B 2QT6A 1P5VA 1C1EL 3QIUB 4K9EC 5CSZA 5FCSH 2F19L 3WJLC 2DAVA 5SV4A 3B7RL 4LCUB 3APCA 1JV2B 1NAKH 1XL6A 4U1KA 5D1QB 4Z3EA 4JM0A 3F65A 2OXGA 4QRUA 4N0UA 3UERA 4DF9A 1OSZA 2ZNXA 1WH0A 4AYBA 2JKRM 4K3JH 1CD9B 2XX0A 4UDUB 3U30B 5C9KA 1JZHA 4HS3B 3VXRB 4GRWF 2JB5L 1FNFA 3HMWL 4XXWC 1F4XH 3R0MA 5K9QI 3K6DA 3TJPA 4FFYL 1AP2A 2KZBA 2VDPB 4A67A 4FYSA 2ERJC 1A6WH 1W6LA 2NY5L 2V2WA 4TQEL 3FB6B 2PWFA 3EGXB 1GKEA 2M26A 1NGZA 3MRIB 2R56L 3JTSB 3MV8D 1J0ZA 5KWYC 2VABB 4F1ZA 4Z78B 3K4AA 4Q6IA 1C5DB 1ESOA 5KANI 3WS3B 5EORH 4X6CE 3VM5A 3TA3D 1A3RL 3TPUB 1T03H 2GAZA 3GIVA 3IJSA 4RNRB 4N28A 5F96L 3DI3B 3KYNB 1IKNA 3T4YB 1GZQA 4Y9EA 2GI7A 3V10A 3QEHB 3W9DA 4YSQA 4MXQD 1WWBX 5E6IA 3SE3C 3BQUC 2YN3A 4R4FH 1XEDA 4MCZA 4PLJC 5CLTA 5F7MC 2VZ3A 3HRZA 4EI5C 4F80A 5HI4C 1ACZA 4J8QA 1Q9KB 2B1AL 2J1YA 4NNXB 2ZUUA 1DEEA 3AREC 3BPLB 4PR5B 2IMNA 1L7TL 2VM9A 4IHOB 1EO7A 4WSJA 3FFDA 1RHHA 2UWEF 3CMGA 4LOFA 1JXKA 5F44A 2XIIA 3ZT5A 1HJCA 1MJ7H 3RFRA 5E6RB 2F68X 5FF6B 4EIGB 4GS7B 4O2CA 3W1ZA 4AEIH 1JTTA 1MCLA 1WBYA 4NNYB 4CMMA 5IEKB 3C6EA 1PSKL 1U58A 4JPSA 3INOA 5AWNL 4JDVA 1ZAGA 3QJOA 4QHNA 5DEZA 1TVDA 1QZ1A 2Y24A 3SDAA 3EW3B 4F33B 3UL4A 4IM8A 3PWNB 1LNUA 1WBZB 4I5BA 5FC9A 5EC1A 1DTUA 4YSEA 1G9HA 2QMKA 3GSNB 5HGHA 1LE5B 4ZNCD 4GBXD 2CM6A 1PVHA 1AZCA 1UH3A 1A7NL 2EDYA 1UWGL 4NXSA 4LCWD 3SY0B 3PIQA 1OP5H 3MRPA 2E27H 3QO1B 2AJZB 4Y8DC 1YNKH 4XOEA 2IVFC 1JVKA 1ASOA 3VG9C 5D2LA 5DJAB 2WOBA 4C58B 2Y72A 4KO9A 1FC1A 3GNMH 4R4ND 4L5FL 2K1MA 1Y7VA 4D8PA 3FT1A 5D1ZA 4BKSC 4MAYA 3RE0A 3VXUA 3EXLA 1ZTXL 2APXA 3HZVB 2P42B 4EIUA 4Z7NB 2ICEA 3FTUA 1PDKA 3C12A 1AR2A 3KLSA 2X9YA 1W0WB 2UZXB 4GI8A 4XCFH 2RCSL 4E9VA 4UM9A 4Y7MA 4ZYKB 3W0WA 3ZO9A 3CPLB 3PHQA 2XVLA 2YARA 4KU1A 5I1GH 5F9OL 2E7BA 4YHIA 3UMNA 4BKTC 4P5SA 1JWSB 2AV1A 2DH2A 1A1OB 1A14H 2WTRA 2GCYA 4XBEH 2C1PB 1JWUA 3BVNA 4ETQA 4NC2B 5I0ZA 1F3DH 1NINA 3FAWA 3VI4A 4PP1D 1VEMA 1DQJA 1F4XL 1LD9B 1SQ2N 4GEJA 4Y2DA 5ABAA 5C86A 1QBLL 2N56A 4JRXE 4YZFE 3BAEH 5HHMD 1KEGL 5JQ6H 4JKNA 3HFML 4M93B 1IJ9A 4Y9FA 2DL2A 2NXZC 5KSBA 1B3JA 3KG5A 4FX5A 2ZX9A 3P11H 1UD2A 4AX3A 1E5CA 5AAMA 1EEUA 3BCDA 3C5XA 1FSKB 3VFVA 1B4TA 4PGCA 4FXTA 4EDWL 4UTAL 3WFZA 3BVWA 1NKGA 4NZFA 1BJMA 1WAAA 3T4AC 2Z91A 1BG9A 2JK5B 4ONFH 1RXLA 3IU4L 4OLVH 2KL6A 1S4IA 3KLAB 3KWTA 1IC7H 3GS7A 1HWGB 3TVMD 5L9DH 1OWRM 4OKDA 3WFEL 1GOHA 4L0PB 5A6MA 3ILEA 3BWAB 4PWFA 4KROB 1IBGH 2XWBB 1MRCH 5C2BH 3MR9B 4PRNB 1XCTA 5FFLA 3AQYA 4XN4A 4WUUD 2BP3A 2VISA 2WUCH 3V6ZB 3MLSH 1RURL 5GGVL 3L2LA 3DETD 4DGWC 1UATA 5FM4A 3X1BA 1AGDB 5L4FA 3QR0A 4Z6AT 2QSCH 3QPKA 2BOBA 4OB5L 5D7JA 5FPIA 3D3VD 4OQTH 4PJGE 2RACA 4TSBL 5D4JA 5KYXA 1MIEH 3WSQL 1NMCB 3B7YA 2NT0A 4WHTB 1OQOA 4FG6C 1AZBA 1ZT4B 1TZIB 4A6YH 3RWCB 2WNWA 4ZUUB 4NQDA 1LDPL 1E6JH 2J8UF 3V7AE 2Z1KA 3KYOA 3BQVA 2I07A 4RAUA 5DF0A 1YY8A 3H9SD 5I1CL 2DBLL 2OI9C 4L37A 5EUKA 1TZAA 3EF7A 3IFLH 3ZDYE 4AIXA 5AAWC 1BBDL 2PCXA 5ALCH 4LOUD 1Z5LB 1H5BA 1RIVL 1X5FA 3RWFB 1EGJH 2XXGA 4YDLC 5EO0B 5DD0H 1KGCE 4YO0B 5J56B 2CDFA 2VE6A 3IETA 4ZX5A 3WFCL 3TESA 1YO4A 4ZZKA 5JPMB 3KWUA 1ZDQA 1ZVNA 3L1OL 4FDWA 3TZVC 3O3EA 4J3VA 4PV8A 4XO9A 4YBQD 2VDQB 4L3EE 2OX5A 5CU5A 3OKMB 5F0MB 3TBTB 3Q1SH 1QRNB 3CUPA 5DLMH 5E8EA 2Z31A 1ICTA 4AL8L 5IY5B 1UXMA 2F58L 1V3KA 4G8GD 2R69A 1P84K 4BWWA 4OCWH 2YBRA 1TYRA 2EEAA 1QYGH 3KPLB 5DJXA 1A6PA 5SX4H 3V52L 2AK4A 3VXPA 2JVUA 5GGSY 3UTZA 2BC4B 1NFDB 4U1MB 4ZAKA 4YQXH 4PRHE 2J55A 3MRQB 4XMVA 3PJSA 1B3IA 5F71A 2VJ0A 5GHWL 3I3EA 2A83A 4N2IA 2P80A 3IMBA 2VLLA 3MV9E 4JJHA 4PRIB 4QXVA 4U31A 3H54A 3HI5H 5CZRA 4I77L 4J6RL 3M6DA 4RQQB 4NQCE 4PGZA 1T1ZB 3B9KD 3DSNB 3KR3H 4O2FA 2YGPA 1AO7D 4OW6A 4AXWA 1CI5A 1QI5A 1BVKB 4CVXA 5C0FA 3KCPA 4KMQA 4HT1H 3P77B 1MHPL 4H1LH 1KLUA 4HFUL 5FFOA 5C08A 3JV4B 2RHEA 4D9RD 3GSRA 2WLIB 4PVNA 2MOGA 4ZODA 4AV5A 1NKOA 3QUZA 3GUFA 4NKMA 2AJUL 3GT6A 4JPWL 4XBMA 4K94H 1ZVSB 5I66B 2YEVB 5TQ0L 1GMEA 2B9BA 3P4LA 1XSKA 4IHBA 1UURA 2CUHA 2A6IA 4HJ0D 3VMPA 4WK4B 3BX7C 1IC7L 5L9DL 4N2MA 3TLRA 3CH1B 2FO4B 2H0EA 2WZAA 1DE4A 3DURA 3EUDA 3QR2A 4Y16C 5F0JB 3RAJL 3CDGB 4JB9L 2OL3H 4D2NA 1FZJA 2VLKB 5L4IA 3BKCH 1ECZA 4W6WB 2BOCB 1IFGA 2HUHA 3MROB 3LEVL 4U4IA 5IMMB 1FORL 4X0KA 2ZOOA 3A4EA 4RMSA 3ZE0F 3WFBH 4A66A 3IDXL 3EUUA 4HHGA 1OWWA 5CIPA 1NC4B 2VIRA 1QSEE 3T3ME 1X5HA 5CCGE 1N19A 1TYJA 2J72A 1MNUH 4PG2C 2ICCA 2OR9H 5FB8B 4QRRD 5K9OB 4EF3A 4FEMA 4A7GA 4L9LB 3WEXB 2ZTBA 2X7LA 4L3FA 4Y5XA 5CR8A 4NENB 1FYTD 3FONA 3B9VA 1I3RA 3J07A 4JFYA 5GGSB 5JIKA 3O11A 4KK6D 3RDTC 4DO4A 1SYSB 4NJAL 1H3GA 4J8RA 1CTOA 4JDTL 4M1DL 1WK0A 4B9KC 1UTDA 1M1SA 3V4PB 1PZAA 4TMPA 2F8VA 2D7NA 1M3IA 4IEFB 2A9DA 5ITFB 3B43A 4YSSA 4FI8A 5G2NA 4JRYD 4OLYH 5FYLE 1TU2A 2EVIA 4P06A 1ILUA 2I60L 1NOLA 2UZPA 5CJOL 5I8KL 1PZ5A 1FGNH 1WEJL 3GLZA 3P3YA 2EECA 2H9GB 3PQYA 2NR6C 5ETUB 3ZMNA 1M3JA 1JNHA 2P43B 3GI9L 4HJJL 2AJ3B 1AKJB 1FWXA 1USZA 1FGVH 2APSA 2MWCA 3GMRB 1N8ZA 4HW6A 4NO2B 4PJXA 4PRPD 4YPJA 5MI0B 1U8KA 3OZKA 1AY1L 3NIFE 5K33A 3AROA 3P0VH 1EXUA 2J88L 2PO6D 4FFTA 1A4KB 4XRCA 2D3NA 4AZ8A 1F97A 3MRLB 1T2XA 3HBPA 4NT6A 1AZZC 1A6TB 2F74B 1MEXH 1MXDA 1PKQE 1LO3L 2XOTA 3CDCA 4FHKA 4IMLB 4PJ7F 4ZZFA 4PJ9D 5GRYA 3WFDL 1QSFB 4IOFD 1OL0A 1OAYH 1JZ5A 3DRQA 5FOBA 3M7OA 4UNIA 2HVJA 3AABA 1YMMB 1I1AD 1Q1JH 4RRPA 4ZK8A 5EZOH 5LG6A 3LH2H 1NAML 2W07A 4YHYB 3BVVA 1IGMH 2CE6A 3HMXL 3U79A 1LGVA 3I6LD 2GK0B 1GYUA 1N7ML 1F4YH 4IOIB 1S3KH 1A6AB 3KH4A 5CGYD 5DT1L 5TD4A 2QQKH 2MTAA 3ME0B 5DS1A 4LQFH 4HT1L 1DSFL 4QXWA 3BO8B 4DZ8A 3O2DA 4QPEA 2O30A 2EZ0D 3MNWB 3MTXA 5EZPA 1IAKA 1HH9B 4YGVB 5HDOA 1OXYA 3DX8B 4H2CA 4QO1A 4TNEA 1ZEAH 4EDXA 1NBYA 5EOTB 3DBXA 4ODUB 4PJCF 3Q6FB 3SDCD 1T22A 4AM0Q 4X7TA 2BNRA 3REVB 3QZOA 5CP7B 3A6OA 1D9KB 4JFFA 2YOCA 4LSVH 1D6VH 5CBEA 3C75A 4UAOC 4BH7B 4ZXBC 4XX5A 2P5ED 3EYSH 2V9RA 5FA3B 1CFSB 4HS6B 4XZ4A 5FEBA 4TOYH 5FR3A 2WYHA 4NZ8A 4Z3HA 5GIRB 4WI4A 2COVD 1UD8A 3MV7A 1EH9A 1NSNL 1T0NB 2BS71 3QUXB 1O5PA 3LZOA 3QYCA 4KRNA 2YRLA 1JGLL 4W6XB 4ZMQA 4QJ4B 3VI3F 4LCVA 1GZPA 2L4OA 1F18A 3INUL 1MNUL 2EDLA 3EHBC 1MCPH 3UTTB 5D71H 1EO8L 2O5YL 1U6AH 3FSVA 3U7WH 1RZQA 1UT2A 4XP9H 1OP3H 3S35H 4A7SA 1AI1L 3QCVL 1KYAA 3V5DB 4TXVB 3QZWA 4GI9A 4E41D 2FJFB 3WOVA 5T33L 3GSXA 4JGJA 3AM8A 4LK4A 2OMNA 4CRPA 1ORQA 2XTLA 4XAWL 3S7GA 4AYID 5C1MB 1XAUA 1DJZA 3BSHA 3QRBA 3TIEB 2KZ1B 1GVIA 4LVHC 4NCDA 4ES8A 2FRGP 4PJBF 3PUCA 1G5AA 2Q7YB 1E4XH 2BVOB 3ETTA 4WEMB 4YDZA 2A38A 4NKIH 4QYOB 3M17A 5H2BB 4LHUB 1IFRA 2UUDK 3CFEA 4LLWB 4YX2L 1XSIA 3DHMA 2CKBB 4X5WB 3K8KA 2P5WB 5HDBB 3LRSB 3S96A 2WXKA 4FNTA 4UV7L 4Y19D 3V9FA 1G1CA 5GGRY 3EJZC 5HPMA 1KIPB 1I8KB 4HZ1A 1GY2A 3IXAA 4NKOA 4PJ8D 1B2WH 1NQBA 5EBLA 3VXSE 3CXHK 4R7NB 3N6YA 4HC1H 1XXDC 4LLMB 4ZTOL 5I15L 1U8IB 2VO8A 1EFXA 4B9CA 4BRJA 3PWPD 3IJ8A 4F92B 3HTLX 3MBWB 4OCNC 4OLWL 1FJ1B 5IB5B 3NIDF 3KBEA 2F2HA 1C08B 3C6LA 1KDIA 3PWLB 4QRBA 1GR7A 1MFEH 1M2VB 3L5JA 5D7IE 3ECBB 4Q4IA 2OK0H 3SYPA 2AQSA 4K15A 3VU2A 1A9BB 3AC0A 4N2DA 3FTZA 5JHDB 2DLTA 1PAZA 2PTTB 3M7FB 4WU7A 1U36A 3JVGC 2Z8SA 5IV2A 1SOQA 3OAWA 2PP8A 3Q1EA 1XD0A 2HKAA 5SX4I 4IBYA 2XWXA 5JLZB 3BT2L 4ZPTB 3TX4A 3WAJA 4X6FA 3EBAA 4JFEA 1NGWA 2C1OB 5I75C 1XD1A 2B1OA 5E94B 2FX7H 4I1PA 1YZZA 3EG9A 1LK3L 1LQSR 5GSVB 3HG4A 3QDGD 4UUJA 3S34H 4PJEE 2XJLA 1R3HB 2QVMA 3DVGB 3GXDA 3IDGB 3OGCB 4M1CD 2RMNA 3PJNA 4LHJB 4WGVB 1BQHB 5CEYB 2OLDA 4JG1H 2HP4A 2X4TA 4XHJD 2OXHB 1ZE3C 5BUAA 4AQ8C 2C3VB 2J73A 4Y2NA 4QLWA 3QJHA 2Q3XA 4ZQKB 1RD6A 1OAXL 2XZAH 2OTUA 5A2LH 3BGMB 2B39A 3NSDA 5EF3A 2FIKB 1PZDA 3CZLA 3UP1A 2YQ3A 5GGRB 3UDWC 4IIQA 1I7RB 2XN9B 3RPBA 5EU7C 4Q97A 3QQ4B 1QA9B 5DR5H 4ZO7A 4ZBJA 5KZCD 4KVPA 4LHUG 4FLSA 3VGHA 2X42A 3DX9B 4MJIB 3QI9B 1YEIL 3VGGA 1DUZA 3UTSD 5KSAA 2ED8A 4P04A 4AV0A 4JM2D 5EWIL 1D5ZA 1EEYB 5F1IB 2EKSA 5D93C 4FRWA 4NXKA 3U7WL 1WFJA 3MLXL 1N67A 5I17B 3TASA 3TYFB 1S7UB 4UWQB 2CRYA 2VLMD 3KPRB 5I1KH 5GS1C 7TAAA 4QHLB 2V17H 3UP6A 1U3ZA 3T0AA 4L5FE 3PHOB 5LBSA 3PAYA 4FQ1H 3U46A 1Z9LA 1G7HA 5C0AB 4WUKH 2MPVA 1J10A 2NY5C 3PDDA 4GRWE 2QPSA 1CXKA 1U9KA 2AQRA 4OZIA 2VLJB 1ZANL 4LAQL 5AW7B 2EC8A 5C3LD 1YEJH 3IDIA 3VX0A 1HS6A 4U3HA 3ILQD 4MZ2A 4YJZL 3WNLA 4XX1E 3HJEA 4OKVA 3NFNB 5EZLB 2XQYK 3ETSA 3Q43A 2Y22A 4ZFZB 4Z77A 4DVRL 1A7RL 5CZKA 1CBJA 2HA1A 5TE4H 1TJIL 3GTTA 4OGYH 4YDJB 5E1AA 4FOMA 3O6FA 2AGJL 5PAZA 3H0TB 1TCRB 3RWIA 3ABZA 4JR9H 1ZT1B 3LIZA 3VSVA 2HJKB 2EXWC 4HJSA 2W88A 4L1TA 5D7EA 5FUCC 4U1JA 4B95C 1EZVY 4UBDC 3FSAA 2VXUL 1Z32X 2OMUA 4FTVD 4G1EB 1PW3A 1BQHG 4GKZB 4OT1H 2ZNWA 3U0TA 1J1PL 3MRFB 1QX1A 4NUQA 1L6XA 4XMLL 4AQAB 3NRPA 4HOMA 3QXAB 3ESPA 1OGTB 1X3DA 5AVQB 2DYRB 3QO0A 3H3KA 4HUCA 1JMXA 1H6FA 2DB8A 3QULB 5T1DL 1Q0YL 2DZEA 2ZAGA 1RPUA 3GKWL 3LKRB 1SJMA 2WZPD 2UWEE 5HI5D 1DEDA 2L3BA 3MV8B 3DROB 2OR7A 4NQTA 4JJ5A 1E7VA 2K9FB 2M83A 4A39A 3TNMA 4N2EA 3H8NA 3TA3B 5HVHC 1X44A 3OMNB 1V7NL 4F2MA 2ZXDA 3I75B 4AT6A 2ICWI 2R9HD 4LP5A 4UT9H 2DWEB 5TDNA 1CR9L 3FH7A 4LSPL 2OMWA 2A6DB 3HPLA 2F5BH 2HKFL 2QELA 1CB4A 5GQBA 1AVAA 4FI6A 4BE5A 4ZX6A 1I1YB 2WWMD 3CN2A 4WWPA 4ZJ9A 5I6KA 1IJNA 3KW8A 3APNA 1NLBL 4N6RA 5DHYB 2ZCHL 4HHAB 3FHQA 1HU8A 2O6CA 3MN8A 1I85C 1FDLL 2QADC 3RTQC 2HVKA 4NB7A 2JE8A 1N10A 4K7PY 3K6SA 1F4HA 3T1WA 5C0CE 1AXTL 4I0PC 4GKLA 3LKOB 1RSFA 1GC1L 5F8QC 1XIWA 1FFRA 2CHZA 1JUFB 4JBSA 3AQXA 1F11A 5BXFB 3I6KA 5D4HA 3MNZA 3N55A 4BZ2H 1GIGL 3UOAB 2VKXA 3QUMB 4JFDA 2HTLC 1SMDA 2GK2A 1HHJA 4U1LB 3ZJAA 3OMAB 3GSNL 4XHQA 4KGJA 3LKQB 1EEZA 3QQDB 2V5RA 4U6VL 5EA0L 3OXRB 2YSSB 1A5FH 2CD0A 3QRGL 4XNQA 3CVHB 4YN3A 3SJVA 3V0EA 3SOBL 2HT3C 5TH2B 4TRPH 1K8DA 4YR6A 4IOSA 2IQ9L 3QCUH 5JXAL 4J3SA 5E00A 4EI6B 5CJ8A 1A7PH 3O3AB 3QEGH 2EUXA 4LCWB 1GZHA 2APFA 3RZCC 2PYFB 3ZMEA 2HMID 4R8WL 3MXWL 3MRKB 1OP4A 1CICA 1M71B 1S7SB 4L1BA 2JJTC 1CGSL 4TPRH 5ESVA 1EERB 3PDOA 1U8MB 2XNAB 5EH1A 3MRJB 3OKEB 2IG2L 3F5WA 5CP3A 3TBWB 2H2PC 3T0XA 3CFBA 2QSTA 4AMKL 4GXUN 4N6QA 3THMH 4IBVA 4YPGB 3NK4A 4U0QB 1YEDB 4LCCA 3VXTB 3QDJE 1OARH 3DTUB 1E4XI 4ZMYA 3F7YB 1NDMA 4NC1E 2HRPH 2DLFL 3DGCR 1MCOH 5TDOA 1HWHB 1I1CA 1ONQB 5A2AA 2YIHA 3Q0HA 3ZSTA 1JIBA 5IVZA 1L0PA 3AVEA 3UJTL 3SODB 1X5XA 1IIIA 4B9FA 3QQ3B 3IXTB 2NY7L 2IOMA 3WI9A 2D7TH 3U48A 3AAZB 3GSVB 4OT1L 1E5BA 4QHUA 1EJOH 4AITA 3MRCB 2NSMA 5FAAA 3KBHE 2ZG2A 3RHWK 4NQEA 3U9UA 4NQVB 5GRVL 5HHMB 1G7MA 3G04A 2IC2A 4HLJA 4I3RL 1G6RB 2B2XH 3RU8L 2EXYD 1RJYB 3MFFA 4L4JA 2BVUA 3BLKA 4IBWA 2ZAHA 3GQFA 4GYBA 5BUGA 4K7FA 5DQDL 3ULVL 4B9GA 3TO4D 3O8XA 5T3ZE 4W6YB 5EEUA 1INDH 1IVTA 3T65B 3DA0A 4GKNB 3WMQA 2V4LA 4B7LA 4HOXA 3JV5A 4BK4A 4HUKB 2J8UE 3KS0J 2IXQB 4FQIH 4JQVC 1T7VA 3TVMB 4ZD3H 2IBBA 1J9TA 4UMSA 5F6IB 1H3UA 4E9RA 3ULUF 5C0EB 2A9ML 5I1AA 2DV6A 3SE8L 3V79C 3IGUA 3P0GB 1YMHA 1FN4A 3ZKXC 4IBUA 1N2RB 2GC4C 3BKYL 4OCRH 3S97C 3ZKMD 2QDVA 2ZWZA 3VFTB 3IFNH 3QNYA 4PJ5A 5JIPA 3TT3H 3QH3B 5HHPA 2M1KA 3VXNA 4DJMA 5IJBC 4N26A 3CFIC 5MENE 4WTXA 2BHYA 2VWEE 3KAAA 3BWUC 1SM3L 4KXDA 1FE8L 1C8PA 4HJGA 1SJHB 5A3IC 2ADGA 1I9EA 4QGTA 5TDPA 4AL8C 3D3VB 4PY7B 1U42A 4YHOL 4F24A 1C5BH 3D52A 1LP9B 1IGJA 3D09A 1MDTA 2V9UA 5DHVA 1ACCA 5J1TC 3BE1H 3NFSL 4GP5B 3WKNA 2IAMC 4OD2A 4HAFA 1I1FB 4HBQA 5DEGA 4QRSA 1AACA 2BVPA 2X4QB 3B1UA 4RETB 1XF3B 1KLFA 1CF8H 4LARH 4MFHA 4Q52A 3X14A 3PGCB 1LLAA 2H47C 4JFPA 3H9SB 1FNHA 5TFSH 4YS4A 1G4MA 3CZNA 4N1EA 4G8IA 4Y5VA 3LDBC 3BAWA 5KEZA 1S9VB 3FQXB 6TAAA 1B4JH 1T04A 3E8UL 5CLYA 1KJVB 3GMPA 4TUKH 4GINA 1NWOA 4M48L 5LAPA 2WTOA 4P23A 4FQPA 1Z0NA 3IFPA 3VB8A 3NTCL 5HHNA 2JV6A 5F7UA 3SPVB 3WDIA 4NUGL 2XV0A 4KKRA 3HCVB 5K1NA 1EIBA 2VDQL 4FNQA 4UM9D 2AEOA 1NANH 1UXWA 2IFFL 1A7OL 4L8SA 3SKUD 3S35X 5D70H 4I3SL 2J1XA 1U93A 5IOKA 3BDYH 1KB9K 5F9JB 1AKPA 2XTJD 2PTUA 3LH8A 5B21A 4IRSC 1PZSA 2FNBA 2KZKA 5D5ME 1OCWL 1YEKL 1YN7A 4DN4H 2IBZX 4G8GB 3FOLB 2GIYA 2YGVA 1A9EB 3GSOB 1WIOA 3KXFA 2MHAB 1U8JB 1Z5HA 2AQPA 2HFTA 5JIDA 5H37G 3S5LB 1IGYA 1OP5K 1J0YA 3QBTB 2CKNA 1HYSC 5BW7A 1I7UB 3WJJC 3LV3B 5D2LF 3LXBA 1DBBL 4HIQA 2EUZA 3DHPA 8FABB 4G7VL 4DGYH 4N9GB 2R39A 1L9QA 1P2CB 1TLMA 5A7EA 3EOBB 4BSVB 4EN3C 2P28B 5I0VA 1QATA 4OCXH 3F84A 4KKZA 4MVBD 3B9KB 1KTCA 2F53B 1XQ4A 3NCJH 2DYPD 4KMTH 1AO7B 3RVTC 3UBXI 1OPOA 3ZE0E 5J11B 5HHOE 1VEPA 1C5CH 4X5XA 1TO5A 2DM4A 5KOVC 5JIHA 2GTWA 1NCWL 4M00A 3BRDA 4DCQB 3ZQWA 3HNSH 2L7JA 2WP3O 3C09C 2YZ8A 5I76A 3R8BB 4HS8L 4DGVL 2GHWB 1ND0A 2HN7A 3AT9A 3KGRA 3H85A 1BD2E 4OZFH 3ZBMA 3VI4F 2IWEA 1R24A 4IKIA 4FHBD 4Q6KA 4P3CH 4PJDA 1HILB 1YNLH 4K8RH 3BIKB 2ZSVA 5KSBF 4G6FD 3DVFA 1KEMH 4K5MA 4E2OA 2DWDA 3TV8A 4KJQC 3RUGB 3A67L 1I7TA 2ZWKA 3FRPB 3FSWA 3O6LL 3UZVB 2C34A 2C5DC 2VQ1B 1FFNA 1KULA 1WAAF 1AMYA 2NPLX 1JV5B 4LL1A 3X1EA 3QG6A 4M6ML 5I6XC 4KAQH 1PX3A 1TJMA 3UACA 3C5ZA 3B56A 3WG7B 1NGYA 1M9SA 3LB6D 4YK4B 5SWQB 1VKXA 4Z0XA 5SWZA 3TM6A 1GCFA 3UO1H 2VL4A 2EO1A 4QRRB 1NZRA 2CUAA 1JPGA 2VDMH 1VFAB 1WICA 1NH6A 2HWZH 3ZX1A 2UZYA 4QXGH 3LAFA 3PFQA 2BNUB 2FZ3B 3DJSA 1FYTB 2YPVL 2CPCA 3BP7B 4YDVA 5FUZL 3V4PL 4UQAA 4NRYA 2HJFB 4WJG3 3ZE2F 3RX9A 5IVXE 4PREB 1OTSC 4Y1SA 3OGOE 1QWHA 4KKLC 5DDHB 2CHNA 1KTLA 2Q7NA 4F3FA 5IQOA 2IBGA 3BYTA 3B5TA 5D7KE 3V55A 5LQBH 3EFDH 4PJ7E 2Y2TA 5JO5B 3ISYA 3X13B 5DJ6B 4KVCL 1KWKA 4H13C 1X7QA 4NHCL 3RYMA 5EEZA 4D7BA 4L1LA 4JRYB 2PCPA 3ZXAC 4Q6YA 2AQ3A 5DJZB 4HZLA 3QA3B 4TUJA 4Z7VB 1OAUH 5JHLA 4WI6A 4ZMTA 2JXMB 1B6DA 3KPPB 3GRWA 1KIUA 5EIIA 3G6JB 2EE3A 4LSTH 2VXVH 5DFVC 4PI0A 2YMXH 3H3BC 5E5MB 4CVWA 3L5IA 4ZAKD 2QJDA 4PRPB 3UYPB 2DRUA 3LVEA 1U30A 1U92A 1UKTA 2CU9A 1D5IH 1U0QA 3BQUD 4MX7B 2K3HA 4JG0H 1FZMB 3G9VA 2PO6B 4QOKE 1XR9A 2F54E 4G5ZL 4ZNEE 2XKSA 3SKNB 3MYJA 1E42A 4LSQH 4TVPE 1MCEA 2ZOLB 1NCIA 4J2QA 3UJJL 3DGGB 4PJCE 2DQHL 4O9HH 3Q01A 3ARED 2OMXA 2PABA 5C08D 2EDNA 1ZK5A 3FHAA 3V5KA 3VD4A 4NN6B 3QB7C 4GUCA 3TCTA 2FSEA 3Q8FA 1IEHA 3IAPA 5F9DC 1F3JA 4LNRB 1I1AB 1J8RA 4K2UH 3QUZD 1TZOA 4UT6A 5HY9B 1KTJA 4HMEA 3VWJA 1KACB 1KCLA 5LKNA 5I9QC 1IGFH 4GRLC 3DTXB 1A3LH 2OCCB 2OV0A 3FRPG 3CFCH 2BFVL 1TJGL 3GUTA 2E8ZA 1NGQL 3VI3E 2ZUXA 1J11A 5DS8A 5IMKA 4BJLA 1MREH 4DFHA 2R23A 1KYFA 1A1MB 5LXVA 3W38A 1KPUA