3V10A

Crystal structure of the collagen binding domain of erysipelothrix rhusiopathiae surface protein rspb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
318
structure length
310
Chain Sequence
AKDYTNEAIFTQFDVNPKGLINNPSQPIEFNLAFSDMNNGQKVKFKPGDFFDLTLPSNDEVSLRSLRAMGSKMPVLAKKEITLGELTFNGSHIHFEFMEDVLQLENVTGTINLKSVYDNAYRGEDDKIAELPTNLGLGSLDKQMITISQPGTPTSPIFYWKTGTFSTEVHGDMNWWLNINSPKEAVQSDVKVIDTIGEGHKLVDGSIMVDVEANGELKHISAEAFNKEYGTITVEGQVLTVMIPKEKAAKTTFTVTYDTRAFDKKLENYKNSSTIEYKDESGNLVTDTPKHYTDTSVVNMFDDATIGGEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Collagen adhesin-nanoparticle interaction impairs adhesin's ligand binding mechanism
pubmed doi rcsb
source organism Erysipelothrix rhusiopathiae
molecule tags Cell adhesion
molecule keywords Rhusiopathiae surface protein B
total genus 67
structure length 310
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A01
1AMXA 4LE8A 3PG2A 4F24A 4JDZB 4HSQA 4JE0A 5DZAA 4MBRA 4P0DA 2F6AA 1R17A 3RPKA 3UXFA 2RALA 4MBOA 3OPUA 4LEEA 3RKPA 4IGBD 5IHWA 2X9ZA 2Y1VA 4IGBC 2Y7MA 2X9XA 3AT0A 2WOYA 2WZAA 3ASWA 4B5ZA 2XTLA 3QE5A 2Y7LA 3IRZA 2OKMA 3IS0X 4LEBA 4F1ZA 2WQSA 3KPTA 2Y7OA 2F68X 4OFQA 5DZ9A 4B60A 5CFAA 2X9YA 2Z1PA 3V10A 4Z23A 3AU0A 4IGBA 5CF3A 1N67A 2VR3A 2YLHA 2X9WA 3HTLX 4F20A 3PF2A 4IGBB 1R19A 3QDHA 3IS1X 3IRPX 4JDZA 3HR6A 2Y7NA 4F27A 4UZGA 4Z1PA
chains in the Genus database with same CATH superfamily
1WEJL 1RJLB 3DJZA 3T9WA 1CQKA 5FM4A 1BVZA 4ZOBA 4NO0D 2X1QA 3ET9F 4X6DA 3HS0B 1GIGH 1ICTA 3GTNA 5EPMB 3WFEL 3EGDB 4FP8L 3ZOAA 4HJUA 4B9PA 4AQ1B 1A7OH 3IJEA 3V8OA 3G6JA 1D9KB 1T2QH 3VA2C 1THCA 4PRPE 4WEBH 1L7IL 2FJHA 3M1CA 3S2CA 2VH5L 5I6NA 1SHXA 2A0LD 1VFMA 2VLKB 4CVZB 4QD2E 3RBSA 1CS6A 3ZXAC 1AQMA 2NZ1A 1LEIB 1KYUA 3QORA 1WPCA 1YPZE 2NY4C 5B3JE 3GSWA 3W0WA 1IGJB 1SVZA 2V2XB 4G8GD 1UKTA 4D0CA 4Y5XC 2P5EB 2DQEL 2P7TA 4DFHA 4LSRL 4NDMA 1RY7B 3OGOE 1N68A 4XHJD 2EC9U 4LPWA 3IS0X 5JIHA 2HFFB 3FMGH 2F1EA 1B0GA 4DUVA 5IMLA 1V3LA 5F7UA 1UVQB 4J2XA 4DEPC 1RZ8A 1ZSDA 3IDJB 2K9UA 2VZTA 3FRUA 2OXHA 3AG1B 2VABB 2O1AA 3BSZA 1NJ9B 3C09C 4OJEH 1BOYA 1PZSA 3R06A 3QUZC 3FTXA 1U8MB 4GNKB 4WFEE 3AY2A 5EZOL 2JCCA 3VGHA 1OM3L 3QZWA 1NZRA 2JELH 2UWEA 4MB4A 4WWKA 5BZWB 5I23A 3ZRFC 4F33B 3GRBA 1V7ML 3C08L 4X0NA 1NCIA 2DWXA 1AACA 3RFRA 4AM0Q 1NBZB 2VMEA 3LS4H 3SDDA 1LE9B 1OT4A 4AGLA 1KGJA 3RWIA 4FN0A 3C6LD 3FSAA 5DRXB 2E7LC 3MRPB 1E8WA 1YNKL 3ULAB 4AGMA 5CCKL 4FABL 3NRFA 1EAOA 2A1WL 3AW5A 4H88L 3HE6A 3NYKA 5SWQB 1PNDA 4AT6A 2YUVA 3S36X 1TCMA 2AJZB 1DEDA 4GSDH 5C0AA 4S0HA 5E9NA 4QRRB 3TH4T 4MLSA 3GFUA 1JS4A 2JI1A 4M7LL 3RVWD 3QVAA 4PJ5E 4X8CA 4ZNEE 2G9KA 1F3JA 3EYVB 1MRFL 3P3TA 2DEXX 4L1TA 4XZ4A 4AC4A 4BHUI 5IFJB 4LO9A 4UCFA 1QRND 5DMGD 4HCRL 3HAEH 1OGSA 4LK4A 4QWWC 1MAML 2GUOA 4KOBA 4WUUB 4NKOB 2FBJL 3W11C 1AOHA 2VN4A 5L7XH 1WISA 3GSXB 1H8SA 2P8MB 2XWTB 4WK0B 3SQOL 5LQBL 3NIFE 1JFQH 1UC6A 3QUML 4MJ6A 1QFUL 4KZEL 2VQTA 5FUZL 2GBUA 4X42A 4WWOA 1KB3A 4NWUL 1MAMH 4CRPA 3UPRA 1U9KA 3OKEB 3SZ6A 3BFWA 4TNGA 5HYJE 1YY9D 4WNSA 4R90H 3KBHE 2R8SH 3NIGE 3H9ZA 4AEFA 1BD2A 1I7ZB 3LB6D 1EHAA 3DYMA 1G9MC 1T20B 2IAMC 3CXFA 3KPNA 4JRLA 1WD9A 4TF4A 1QR4A 1IBGH 3IDIB 2LT9A 3KL3A 2VN6A 4C55A 3TVMC 1QZNA 4NT6A 3FO1B 4HQQH 1T21A 3IRZA 4NERA 1TZIA 4D8PA 1EHLH 1BZEA 1YMMA 3N85L 3I50H 1MIEL 2L0DA 1KC5H 4LGRB 2DWDB 5GJTH 3ZE0E 2B1AL 1JZIA 4Z95L 2EECA 3GD1C 4XPFH 4EZLA 4WI3A 5KZCD 2EDBA 1VADA 4KY1H 5IBUG 3MN8A 3CU1A 4OU3A 5DXWA 1TZGH 2GAZB 2B4CH 4JMNA 1JPGB 1Y1DA 4GSRA 4G80A 2ROYA 5DEFB 2V33A 4UU9A 3DUUB 3OKMA 1A7RH 4EUPA 2WLYA 4HAFA 5KBKA 3KLHD 2X0UA 2XPYA 2AJSL 4F1SA 5IMMB 4XMVA 1UM5L 2HJKA 5GIRB 2CQVA 1RQ5A 4G8FA 4IKKA 2NXYC 5D1XB 2WBJB 4IOSA 1ZGLB 1K85A 3MBEC 3TZVB 1P4IL 3C6SA 1EAJA 1JXDA 1NANH 1GVIA 4FE9A 4M93B 3WMPA 3J8F7 3SOTA 4MDJA 4B9CA 1UD3A 3DXAD 5I66A 2JI2A 3PL6D 4O9HL 2WKGA 3EJQA 2C9PA 3JZYA 4WWKB 2J20A 1S9WA 1CN4A 2AC0A 5EZIL 5AVWB 2A83A 3EJTA 1P69B 2ODIA 4JKPL 3UBFA 2O61B 4RRPM 4NUQA 4Z23A 1L9MA 3WNMA 4Y4HB 3CAFA 4S1DC 3UGUA 4D9RD 1D7DA 3LN4A 1DFXA 1WF5A 2VLKD 3NJXA 4GQZA 4LZKA 4PRHB 5E2UL 4TLKA 2Z8WC 2P9RA 2MCMA 3LZRA 1OAUL 3P0YL 2VAAA 3DKHA 4GS7C 3VFSA 4AYMC 3NRQA 3QEGH 1PU0A 2B59B 3WUWA 1ZHNA 4TLTA 1QTYT 2V9UA 4DJMA 2DLIA 5GGRB 3MV9D 5F7NC 1MREH 2BJMH 1IKNA 1Y07A 4FQXC 3FQNA 3IDGA 2ZNWA 3BPCA 3FC8A 4URTB 2DTML 3WIIH 1A0QH 1DQLH 3JV0A 2OAAA 2KLSA 4Q9CA 4AQEB 4P59L 1RP9A 2NY6C 3STBA 1NTDA 3UAJA 3QRGL 3Q2WA 3WFDL 4KRMB 4JFEA 4JW3A 3BIKB 3GXMA 3IN2A 4X5XB 1MAJA 3MCLL 3CBJB 3QNYA 3ES6A 3IPEA 4E42A 1PIFA 3FT9A 2VDOB 2WMPB 2M26A 3L5HA 3LPPA 1JZFA 3DGGB 1NLDL 5AUMB 1KYAA 4JFZL 2BVOB 2X7LA 3OHMB 4RGNC 3TJEH 1ZLVK 3GBNH 3MXWH 2ZYSA 1ASQA 5FW8A 5T1KA 4A37A 2GBAA 2DYRB 1BQHG 1AD0B 3VD0A 2AQPA 3V7AE 4PHZA 3SKUD 1QSFD 1L9NA 3TT3H 3U7WL 3H9SB 1B2YA 1NCAL 1JHKH 3MUGB 1G43A 3V0HA 1UJTA 2G3ZA 4NUPA 3H4FA 3T3MB 4XTRD 2O6FA 1U92A 4QO1A 4JM2C 5I8OH 3WY2A 3RWGB 4F5CE 2NRDA 2DQUH 3II2A 4LVNB 1PF3A 4I9WE 2CMRH 4PJ9B 4MLIA 4MZRA 4R0LB 2JJWA 1FLTX 1AGBA 2X4OB 1B4JL 4FD0A 5EO0A 3IAGC 2ZG2A 2X4TB 4LPVA 3AQZA 4HGWB 3SJVE 3S5LG 2IV9A 1V54B 2VLRB 4NAJA 4AIEA 3Q43A 6CGTA 2WWNA 1U8JB 3LNFA 3D0LB 5AL8A 2IANE 1DN0B 2HLFD 1JERA 2X4OA 2H6UA 3LIZL 3VFUA 1MRCL 1ZXQA 3WO4C 4AQAB 2PYEB 4XMZA 3FRPA 3W39B 2CAKA 3WFZA 5JHDE 1JZHA 3W0WE 4PRPD 4LMQI 1OGTB 3VDCA 2Z4TA 1JZEA 1T83A 2AEQL 2APWA 2GITA 2JXMB 3MLTB 4K71B 3VQMA 3IJSB 1G7PB 1QI5A 1MVUA 3H2PA 1D5XB 2P48B 3DMMA 2GK0A 4QJ3B 5KOMC 3VG9B 3PJLA 1EX0A 4BQBA 4PY8J 5FYLH 1JPST 2ADFL 5DD0H 3CVDA 5LNEA 2O5XL 3MO1A 5T1DH 3TBYA 5CHNB 4ZTPH 2ADGB 3OKNB 2R0WH 1QMUA 3ZHLA 1E4JA 1M7UA 1XL6A 4OKVB 4ODBD 4TSCH 4P5TC 4U3XA 5TTRA 3FTYA 4OM0H 1UT2A 3BE1H 2ZCHH 3KLQA 3LVTA 1LLAA 3BUDA 3MO1B 4PLKD 4HUCA 5GGSY 3HAEG 5I18H 5FOJA 4P5TA 4K9EH 1OAXH 4PJFF 4KMTL 2Z8RA 1DL7L 1T7YA 1DANU 3NJLA 1O7DE 2UVEA 4XOAA 5E4IA 2HMIC 1WBZA 4YBQC 3NP3A 1C1EH 1J0ZA 4HEPA 4PI2A 1A6AB 4UOW1 3BSHA 3JUZA 4UIKH 4D3CL 4ZUVA 4KUCF 5ESQA 4FTDA 4KVCH 4JG9A 5H37G 1J5HA 4M4RA 4NP4L 3OR7A 4GQ9L 4AEIH 4JMXA 3E1F1 1OSEA 4N90D 3O2DA 2SEBA 4FMKA 1C7TA 4GBXC 1D6VL 3EO9L 5IVZB 1BLNB 1IAIM 1KJVA 1EO5A 1HINL 1OPGH 4GRWF 4BZ1A 1JRHH 4MYPA 1LE5A 1W16A 4KVNH 3JZ7A 2WXLA 4AZ8B 2AK4D 4ZUWA 3TO4A 5AVVB 4EDWL 3IMBA 1IC4H 3KGUA 4FFVD 4AJWA 2OX5B 2OMNA 4MB3A 3W1ZA 1KYFA 4W4NA 1EDQA 3CN3A 3ARDD 5C0BE 5F9OH 3RYMA 5D2LB 1V7NH 4DCQA 4HJJL 2P80A 5BRZA 4FP8H 5IEHB 1UA6L 4DO5A 1NFDF 1C5DB 2G2PA 3B3IB 5L9DL 5I1AB 1OSYA 1U3HD 3LRLA 3B83A 4MTMA 2OLDA 1J88A 1EPFA 1XGYH 2OYKA 1ZHKA 1OTUD 1RUQL 4KITB 4TOYL 3ZR5A 4WU7A 3CLFH 2XUWA 4G72B 3G5ZB 4P06A 1UOLA 3PUUA 4ZYKB 1H6UA 1IQDB 4JY5H 4JKPH 3VRLF 2WD0A 4WW1B 2V37A 2W88A 3ZJAA 2ZJSH 3X2QB 2DI7A 4JCWA 5DWPA 3Q06A 5EU7C 4OD3H 1LQSR 4HMDA 4KK8D 1GC1C 3VGAC 4PJAF 4UILH 1FIGL 4ATWA 4BFIB 2HKAA 1NC2B 4NPYB 3QJSB 4POZC 3FO0L 3ASWA 3LV3B 4FG0A 4PS3A 5DVKA 1FIGH 5E9DA 4QOKE 4DN3L 2J5LB 3VGFA 1EBPA 4Y16D 2X3AA 4PJ5D 2F68X 3QCUH 5ADOH 3OBAA 1HYRC 1VGKB 1SOSA 3QZNA 3ZHNA 3AGVA 1BSIA 3O4LA 4P46A 5MENA 3QXUA 4UF7C 1TETH 3EBIA 4XC3H 3SY0B 1AC0A 2NNAB 3T1WA 3W37A 1YAIA 2H32A 5DFAA 3SGEH 4WI2A 4N8UA 4XPAH 3U2IA 5BQDA 4AUUA 3PPSA 4UT6A 5C0DB 4KZDL 3SBWC 3CMOH 2QFPA 3FQUB 5FO7A 4PREB 3Q2CA 3VM5A 2LABA 2XN9E 1S7VB 5K1VA 1ANUA 1BVLB 4Z5RA 1L0PA 1PIGA 1KYOJ 2VR7A 2FZ3B 4YUEL 3LMJL 3BAWA 2YMOA 2IANB 1YZZA 1KGXA 4O58L 4XPTH 1ZLWH 3WIFB 4ERSH 3VDBA 1CT8B 2VDML 1THAA 2QDWA 2L3BA 4A7QA 4KHTL 2ICWI 4MASA 4W9LC 2GJJA 4UDTA 4Z5RB 1TTBA 2NXZD 5FWQA 4OZ4B 2YKLL 5IESH 3JT0A 3C6LC 2PO6C 5KBPA 5LNGA 3IGUA 4CMMB 4RAHA 4XP6L 3LN5A 3WN6A 4DH2A 5C8JB 2DQIL 4JLRA 5CZRA 1BAFH 1WWWX 1RPKA 2GW5A 3Q3GB 1TPXB 5C2UB 3FU9A 3O6MH 5MENB 4KNQA 2ENYA 4QRRA 3SGJA 1E28B 1T22B 3EOTH 3HG2A 2Q2EB 4M7JL 5F7KC 4FMFA 3MV7E 4IRZA 6TAAA 2ZAHA 1SDDB 2QBWA 4F9PA 1QZ1A 4U1IA 2FSEB 1N8OE 4PRPB 1E30A 2P5PA 2RFXB 1UG9A 4MA7L 2MKWA 5E00B 1KN4H 5E23A 4ACPA 3H0TB 1U6AL 3SPJA 4PJGA 3TGXA 1Z5LB 4RZCB 3M7FB 1Q9KA 4XMUA 4GQQA 3SDAD 3WE6B 4O5LH 3CG8A 4KNTA 1YEGL 2PYEA 3A5VA 4OJDH 5IWLC 1EANA 3HZVA 3TBBA 1BGXH 3WJJA 3ARUA 5AOIA 5DR5H 4S0SD 2YMTA 5B3NA 2JKNA 1XGRB 3BW9B 3EOAA 4G6JH 4KAQL 3A23A 2R9HC 1L9PA 2E9IA 3OAWA 5IG7A 4PVNA 4R96A 3T4YA 3SKJH 4X7CC 1SUJA 3I9IA 2BMKB 1X5LA 2PTTA 4YK4B 2ZXCA 2JKRM 4YL9A 3TWCL 4DN4H 3S2AA 4Y4HD 2FD6H 3MV8A 3W2DH 5CJOH 1WITA 1UT1A 3H9SA 4U6XA 3MLVL 2NSQA 1FLRH 2H32H 4MMZB 1PX4A 2LAAA 5HYIA 5KYYB 2OI9C 1HSBB 5LN4A 2VLME 4QTHB 4XR8C 4P9HH 5T3XL 1U2YA 3I9GL 5C0BA 2EVFA 3VXRA 1TVBA 2BP0A 1GZQB 3MA9L 1A1NB 1CIUA 4M8VA 4YDKL 4LKXA 1AJ7L 2ZUVA 3MRPA 4HU8A 4PW4A 4UBDC 2VDLB 5IW1A 4LF3A 4PH8A 5E2WL 4N0YH 2I7SA 3STLA 5DZ9A 5EN2B 5C07A 1SMDA 1RZQA 3ESUF 2ZKYA 2HRGA 3MLRL 1UEYA 5AKSA 1R3HB 5BNXD 4WK4B 3WNKA 4JM4L 5DMGC 5CCJA 1IEAA 5D1ZB 3JTTA 4NO2B 4EZJA 1BYOA 5C3TA 2ZCZA 4D8OA 4MS8C 4U0RC 3VI4B 4WENB 5CD3B 1NCOA 3IU4H 2FUTA 3D3VD 1XGUB 3QUXC 2MOVA 4NN5B 2NY0B 1IAKA 4UM8B 3LH9A 5CP7B 2ICEC 3P69A 4D9RE 2WUBL 2O26U 4XWGL 5TE4H 3P2TA 2BLFA 2AAAA 2F53B 3PIQA 5CN3A 2LQRA 3VSUA 2FUQA 4NN7C 5CFAA 5JYLA 4DK6A 5CLXA 3GXFA 4YN3A 4G9FB 4TQIA 1GC1L 2MTAA 2Y36H 4V33A 5DA0B 1X9RA 4V11A 3VXMB 2BSDA 5DLLA 3ZDWA 2ZXEB 5GGSB 4BGLA 4BZ2L 1UWEH 3PG2A 1A6PA 5DJYB 1OP3H 2DTMH 1RULH 4XVTH 5HHXH 3L5WB 2NX5A 4PRIB 5E8NB 1E40A 2AERT 4OZ4A 4JO1L 5C0IA 1F58H 3BZ4A 3GXDA 1X5GA 1XCQA 4PB0H 5DQ9B 1DLHB 2I26N 1FAKT 4KJQD 1AOZA 3UBGA 4N2MA 2I07A 2DYPD 4BQ8A 5B4MD 1FUNA 1T6VN 1SLXA 3CFDB 5JHDD 2CBTA 4F8OA 2WTRB 4TNWK 4M3HA 4B3VA 3F6LA 4AYSA 1K4DA 1SYVA 3ECQA 3T0EA 4QAWA 2X4SA 1IC4L 3CN0A 4XXWA 4PJ8C 1FNGB 1F6AA 4I2XE 3UTTA 1UURA 4JZOB 3VD9A 1JG9A 4OTXH 1LO2H 4RISH 1OARH 2NNAA 2WANA 4FQXD 1QA9A 5ICZA 1LEGA 4K5NA 4TSAH 1ZWIA 4W4OC 2XYCA 2B3IA 4N5ED 1J1OL 3K5SA 4CC0A 4E0RA 3D48R 1XAUA 1KYDA 2DI9A 1HH9A 3V0DA 2QKIC 4LBEB 2NUPB 3MJ9L 4QRRE 1BG1A 5FKAA 2NX5D 4L4VD 5T3XE 1AFVL 2E74C 2KBGA 4N4YB 1CI5A 4JDZB 3U1PA 1XGYL 2DKMA 2E0PA 1BAGA 2A5UA 1E67A 1MRDL 4X5QA 1RPUA 3WNNA 5BMFH 2ZUQC 4LKCB 5TF0A 3N9GL 2CDGB 3G5ZA 3DIVA 3RA7H 5JIIA 3OSVA 1JF5A 4MKTA 4AJ0A 1BVOA 2CBMA 3HE7C 4DP5X 4HK0A 4N68A 1NCCH 1VFBB 1OGAA 3TO2A 3GUTA 4XN2A 1K4DB 3BKCH 1N4XL 3MJ7B 4ADIA 1MUJB 3D3VA 4NP9A 1Q94B 1K72A 2WZ5A 3C60A 4QEGA 4F24A 3KDMA 1Z0NA 4XNYH 5T1DL 1A1MB 3M17B 1IO4C 2ED9A 4Y1AD 3UZEC 1MFDH 4Z7UE 3FB8B 3WLWD 4GW1A 4F8PA 1G6RA 1Z9PA 4E0RB 3SDYL 1QASA 4GMSH 1YO4A 1JL8A 1X5HA 1KCVL 5FHAH 2LTQB 4OQTL 9CGTA 4K3JL 2V7HB 3VG0L 5PCYA 4AC2A 4QHPA 4AQZA 1BHGA 4CW1A 4YXKL 1AH1A 1MCNA 4LQFL 3BX7C 3FUIA 2WTPA 4LAQL 3UTZB 1UCBL 3ESOA 3FHEA 4AV4A 3N42F 1LDPH 1BQKA 4AVHA 1M05B 4ZXBB 5A40E 1R3KA 1PD0A 3KYKL 3PIQB 1F02I 1RKRA 2X3BA 2QELA 3QDJA 3HRZA 3I6KB 8CGTA 3W38A 5HJ3A 2X4NA 1MHPH 5HYFA 1YDPA 3PWLA 1YMHB 1YUHB 5IVXF 3MV7A 3RWJA 3DXAE 2H3XC 2EXTA 3N04A 1A7NL 4ADGA 3MV8D 3KM1A 5DJDB 2EUXA 2KZWA 2PXYA 1E8ZA 2HXAA 1CL7H 2EIZB 2F7PA 1GZHC 4Y1AE 1ZTXE 3BEVB 2FQFA 2EYRA 3K91A 3LTVA 2IDUA 4LRIC 3MYJB 1A6AA 3GQFA 1AIZA 3AWFA 3U46B 1C7SA 4YQXH 5K9KB 3CVIH 2FO1A 3QFGA 3MODL 4RWYL 1JYNA 1JSYA 1OK8A 2JJSC 3CCHA 3PV6B 1KTLA 4AM0A 4ZMZA 2N1TE 4DERA 1C08A 1A1NA 3DSNA 1MRCH 4WWNA 4IHOA 2MPVA 5IROA 5C0BB 2XG5A 5K9KA 2DWEA 2ZP8A 3SPHA 4R8WL 3EYOA 3WG7B 5ADPH 5IEKA 1WGOA 3ABZA 5ABZA 4HJGB 2NQ3A 4ZFFA 4H0HB 4LMQE 1IGYB 5IHUL 1WIPA 1OO2A 1MFUA 4ACTA 3EBHA 4K7PH 4FQQB 2PXYB 3ZQWA 3ULVH 3D4CA 1U8JA 3OAYH 5IF0A 3LSOB 4HXAH 3HR5A 2EUZA 1MIML 4JZJB 4HVBA 3OVUB 4MXWH 5AAMC 5E6IA 1EVTC 2GTZB 1I8IB 2GTQA 2J71A 1R3KB 3HG1A 3HMXL 1E5ZA 1LGVA 3TBTA 3CK0H 2YGQA 4UTBL 3OLDA 3DBXA 3GT6A 3BESR 4YHML 1FVEA 5E5LA 1A3QA 2P8MA 2XWTA 5KVEE 3C12A 1NEZG 2ZKWA 5AVZB 1E4XL 4Z3HA 1SBSL 3T3ME 5GSVB 1KV7A 2VUKA 1JVOA 1WBZB 2WO4A 4KO9A 1LP9F 2R4SH 1MCOH 2GPZA 3QXVA 3M8OH 5E99H 2V2WA 4YAQA 2J56A 5M95B 2CCLA 3FFOA 4U05A 3VFGL 2Y9RT 4E9LA 2L7EA 4R5TA 1Z9OA 1R4XA 4JHWH 1TQUA 4W9HC 3O9WA 2OZ4L 3FHAA 4PJ8A 2FSEA 1BCIA 3EG9B 4HG4J 1U8IA 1LWRA 3VMPA 5ID0A 4WV1A 5D1ZD 1M42A 4NC0B 5AOZA 1X5AA 3C5ZA 1CXEA 3OG4B 1RZ7H 1VDGA 3FUKA 4OV5A 3QHFL 1ZLDA 3MREA 4L9DA 3T08A 1MZYA 3FYEB 3O8XD 4XN1A 4J1UB 4F7PA 1Q9LB 2GT9B 4XRCB 1FN4B 2W1NA 2CK2A 4HU2A 3HA0A 3BP5B 4NZ8A 1J1OH 2XBZA 2I69A 3V6OA 1WAAE 4ZUTB 3PV7A 5EDXA 3VFUB 4NQCE 3P4NB 3OC5A 1EHLL 4FLSA 1M7XA 2IMNA 3OKKB 4Y16B 1OT2A 3KS0J 2E9GA 3VWJD 1JRHL 3WIFA 2Y1AA 2NUPA 1J1XL 5CZKA 5CU5A 5B7EA 2R0LH 1ADQL 4OLZL 2FQDA 4XMLH 3SGKA 1IE5A 4YSSA 3AGWA 4LOFA 1QO3B 4QLRA 3FFDB 5KYXA 2QVFB 2ICEA 2MNUA 4QT5A 4XP5H 2ZNXA 4WIQA 1INEH 3QDGD 4DKEH 4PBXA 3L1FA 2ATKA 4OJAA 2GSGA 1AQ8A 1FO0B 3BSGA 5F9AC 3MRRA 3MUGA 2R1YB 1OTTD 4S10A 1DQQB 1LD9A 1NEZA 4QGYA 4XPGH 5L8KB 3MNDA 2ZX8A 2EJ1A 5FM5M 3X1BA 4CJ0A 5J11B 2R69A 1JFQL 5DHYB 5F1IB 3V6OC 1KENL 4QNPE 4BCXA 2GCYA 2VKWA 1YMME 3K3QA 3PGDB 5F1OB 3VQLA 4F2EA 3BKYL 4KMQA 2CJUH 4A2FA 3BZEA 4GUOA 2DWTA 3KDMB 4NWTH 4DGIL 2XPGB 5JOPD 1HCYA 3M17A 5EBGA 4DTGL 4U1MA 2GJ6A 5FYLD 3FTGA 4V1DB 1J8HE 3ULUF 3FRPG 1KTDA 1WGVA 1CTMA 5A2LH 4AZUA 2KUTA 3DO4A 2YRPA 2LU7A 3OMNB 4PJIA 4AEEA 1QSED 1OLLA 1CLVA 2GAZA 4GSDL 2UY6A 4H26B 4OW6A 3VTAA 1JPGA 1IQWL 1G1YA 1PLGH 3RPIA 3TFKC 4PJDE 2AGJL 2RR3A 3L8QA 1J5OL 4L0PB 4ZFQA 4AEIL 3IDUA 1VGKA 2J2ZA 3NPSC 4KQ4H 4P2CG 1CGYA 2P43B 4JDZA 1KTCA 1E4KC 5CUSL 4H8UA 4NO0B 4TULH 3U4AA 4CMHC 2MFNA 2H3NB 3WKPA 2ZOTA 1XBRA 1CIDA 5MEPB 4N0YL 3D18B 1IGCL 1U4FA 3CSBA 1TLMA 4ELMF 4BH7B 4NWUH 2APXA 5HVHC 4XP9L 1NCGA 5F2FA 4LLUA 4O2FB 5EFIA 5CBAB 1BD2B 3KPNB 2LFGA 2N56A 2HAZA 2VXSH 4GI8A 4YDMA 5D5MF 3VFPA 4JLRB 5ICYA 4J6RL 1IGCH 1LK2B 2D7MA 1OZTG 3T0WA 3N44F 5I6OA 3QG6B 4GXFA 4U33A 4W9KC 3MXVL 3WD5L 3GI9L 2L4OA 5BJTB 2P28B 5DJAA 4H1LH 1B3JA 1FORL 3I6GA 2ARWA 2N3JA 2V9TA 3L5IA 4HQQL 3H2WA 2Z7ZA 2FK9A 1T5XB 5HGHB 2V5RA 3ZVVA 2WUCL 3HUJA 5GJSL 2VXVL 1QVOB 3HN8A 1V3MA 4X9BA 2A1WH 4H88H 3ALWA 3FOLA 3MBEA 1F3JB 3EYVA 1Y6NR 1BPVA 1ZT7A 1A22B 5IFJA 1HILB 1S7TA 2IMMA 4RBPK 2F58H 1S7WB 1H5BC 3TA3B 2ZD0A 1FBIL 4H0IA 4NNPL 1XR9B 1ZT1B 3QJUB 5HHQA 3DTDA 3BUBA 4G9FA 4AOFA 3L16A 1MHPL 1TQBB 4MA3A 3TBSB 1YSOA 2QQKH 3KGSA 3FT0A 1JGEB 1EEZA 5F88B 1NPUA 2F61A 2Q86A 5D7HA 4CVUA 4GRWE 1JDAA 1QSFA 3MLUH 4GRLB 1FRGH 1LL1A 4GQRA 1ZVSA 4C59B 4JKKA 1MQKL 3BVWA 4YHOH 2QT6A 4A7GF 4BA8A 1Q1JH 3CFKB 3LRMA 3CZUB 5CGYC 5GISH 4K94H 2XG4B 4R84A 5INDB 1JNLL 1IFHH 3BI9X 1W72H 2ICCA 2HPOA 2ROXA 3ULVF 1IAMA 3H9HA 3WTWA 1OCWH 2N7BA 4YBLB 5GJSH 1IBDA 3L3JB 2FWLB 4OZFH 1EZLA 1KBGL 4C56D 4EZMA 4MAZA 3ULSA 1SOKA 2VJ8A 1QFWL 1VEMA 4DGUA 4JFHE 4DP1X 4E9SA 1C5CH 3RUGF 4KKCD 3EIFA 3C5ZB 5I1JL 3CBKB 2IC2A 2G75A 5HHQB 3ILQD 1HSBA 1GGBL 2GUOB 1OM9A 3QUMA 3LZLA 4XX1E 2AVGA 4MDIA 2N0MA 4NDMB 2MNJB 1MREL 1I85C 3FQTA 2DQJH 4JN2A 1RXLA 4KUZH 2YBRA 3GRGA 3IJ7A 2A6DA 3QUXD 2Y69B 2WO2B 4KXCA 3T77A 3UBXI 1LEIA 5IFAH 3QQDB 1YC7A 3KW7A 2VLKA 4CVZA 4F8NA 5J57B 4QRUA 5FDWB 1QKZL 3MRDB 5KSBF 4L1SA 3HE6B 2BRRL 4ZMXA 1AXIB 3UACA 4ZW5A 2WWMC 5E2TL 2VZSA 4HEMA 2DQCH 5FA3B 1O6SB 4ZSOE 1INEL 5JIMA 3PL6A 4CA4A 2OTPA 3DXAA 4MQ7B 1I1FB 5EULV 4NM8L 4GLRH 4YHYB 4W68A 5B8CA 1WBXB 1CBJA 1C5CL 1LWHA 1SY6L 3GJFA 1OCOB 1U8QB 1XGTB 1PCSA 2F1BA 5CN2A 3STZB 4HV8A 4JFZH 1LWJA 4ELDA 4CUCA 1KBWA 1KPRB 3MROB 2LLNA 4LSTL 4OZHA 3A6BH 5ELIA 1RD6A 1BFOA 1AS7A 1D5ZA 3M1BB 4NN5C 2J5WA 3AQDA 4PJFA 2RFXA 3HI6H 3DVNA 3H0TA 5ALBL 3K4DA 5HDBE 4X6CE 2I5YH 4MCYA 2QQLH 3RZCD 5JUEH 1XCTB 4IHOB 4JFVA 5HVGB 3U0TB 5D72L 5D2NE 1IEBB 4E68A 5HYEA 1CICA 2GG1A 3LKNA 1FGNL 3QA3A 2X6AA 1E4XI 1FGNH 1AIFB 1A2YB 3FPYA 1O9ZA 2DTSA 3D50A 4JFEB 5EO9B 2XN0A 2RMNA 1OXYA 2OMXA 3QUYB 4N85A 5T1LA 2Y07L 4KFMA 3IJSA 1BEXA 3RDJA 1Z66A 1FZOB 4DEWA 3VM7A 5CJQH 3PWUA 1DE4B 1IAOA 2YQGA 4TQ8A 4KKQA 4LCWA 5DJXB 1IGMH 1HI6A 1I1CA 3RX5A 4NQCA 4Y5VA 5KBDA 1T6WA 4YVNA 3BRDA 3DURA 4HS6A 2K78A 4EDXA 1BD2D 4LLWB 5MEQA 4Z0BL 2W91A 3WIHA 4GW5B 1KDJA 1DVXA 1UXWA 2FIKA 2OV0A 5K1JA 4JL1A 2J1KA 3BDYL 4WAFA 2Y7SA 3TBVB 4NC1E 1Z5YD 4XNDA 4BSWB 5DD5H 3QORC 1T0OA 3IPBA 3FJTA 1XF4B 1BZ9A 1FHNA 3QIBC 5HHOD 2ORBH 5D71H 5DYOA 2WB1A 3FUDA 4JRXE 3KLHC 4L37A 3HC0B 5DJZB 3T65A 3BPNB 5D7IF 2XVLA 4UM9B 3LEXB 1YYCA 2BC4A 1UYWH 3LAFA 4OF7A 2L7QA 1INDH 3N1FC 4OI8A 1QRNA 4P23B 2Y1VA 4C4UA 1HAUA 1EEYB 2XN1A 5LGHH 4NRYA 2D8KA 3A47A 1XH3A 4NQED 4Y4KB 4RVBA 1WVZA 4XO3A 5F97E 4KGJA 3F12B 3P77A 2GABA 4Q2ZA 5AW6B 1BBJB 2AK4E 5IWLA 3D3VB 2J1YA 4LEXH 3DROA 3ZMRA 1G6RH 3IGAA 4I0PD 1F3RB 3N85H 1T04A 2YJQA 4PU2A 3HIZA 3L7EA 3N1MC 1GW0A 4HDIA 3LKPA 4OBSA 1XEDA 4DQOL 1XVSA 2AJXL 2OYPA 5SX5H 5DLMH 2WXIA 4DUWA 3RWFA 2YWYA 3UBHA 2O5YL 3D9AL 4RMRA 4A38A 3FNKA 3QFJB 2LE9A 4M7KL 1KPUA 3TNMA 4JR9H 3OKYA 1T1XA 5EEVA 2YXWA 2R8SL 3MRQA 2XTJB 4KQ3H 4R4BB 2DS4A 4H25A 4WWKD 2HP4A 3BKCL 4FMVA 4U7MA 4YO0A 3SEPA 5DK0A 1HL5A 3HC4L 4QRPB 1HH9B 3I6LD 5IQOA 2WTOA 4KHXL 1RAMA 3UX9B 5M94B 2WLNA 3JV4A 4GG6F 5DZPA 3TA4D 1I8LC 1CI3M 3U36B 3EGSA 1VPOH 5B7MA 3UAJC 5J6GA 5BUAA 1W72A 3B8SA 4F3FA 4R4FL 3VVVA 1G7IA 4JRYA 5E5UB 5B39B 4NLHA 5IVNA 1KLGB 2Y7LA 3E8UL 3PS6A 1J8SA 4EN3B 3BLBA 3ARGB 4YH6A 1DYZA 5HJBA 1ZEAH 3NCYP 1INQA 1C12B 3GMLA 4ENEC 4HXBL 5CF3A 5JLZA 1H3VA 4OJCA 2R29L 3O3EB 3L4WA 1GGCL 2W0LA 3WSQL 5GS0L 4F92B 1I1AA 1JGVH 4GMTH 4NKIL 2UZYB 3QULB 5F3BA 1DQDH 2VLJB 5EZLB 3W0WD 4IU3B 1R17A 3GTVA 3ARQA 4P57A 2V3FA 5IB2A 3GC3A 4I85A 4ZS7H 5IMMA 4PY7A 5AOLA 5F6HJ 1ONQB 4X5RA 2IDCA 2H2PD 4YGVB 5DGQA 3VGAB 4Y4KD 5F0PB 4R3SB 4BFFA 4KKAD 3AB0C 5JIDA 3JUYA 2IPTH 5TDPB 4ZO8A 2C8NA 4EBQH 5KSUB 4PN6A 1AZCA 4UNTA 3QDHA 4L3EA 3P73A 3D87B 1A0QL 4WDIB 1IGIH 2D3VA 2BVOA 2X7LB 3FRUB 2PWDA 3UZEA 4IHBA 2DQHH 3OKOB 2FTAA 5HGAA 2QV2A 1JOIA 3GS4A 1K3IA 1G1OA 2Z35A 2AK1L 2UWEF 3F62A 2BNRA 5D55A 4XWOD 2H6OA 1BZ7B 1RUKL 4LDCA 3DMMB 4YXKH 4P2OB 4N22A 3QG6A 3FU3A 3D4ZA 5CZVL 3B9AA 4JFHD 4NQUA 2OMVB 3CH8A 5E5RB 5H2BB 5ISZB 2B1HH 2ENJA 3AITA 2F7QA 4R2GB 5LGKA 1IE4A 3V5HB 2WK2A 4ZMYA 3WIHL 1SM3L 3WGVB 1L5GA 4Z7WF 3MOAL 1U8KB 2CE6A 2IBZX 1X5IA 4H2AA 4JDEA 4HGWA 3L5JA 1CXKA 4X7FC 4N8VA 3CVHB 4GIOA 4XHJC 1P6FA 2HVKB 4PLKC 3RNQB 2W9DH 4QRPE 5DHEA 2DIJA 1GZQA 1TZAA 4YDLB 5GRVL 3HPJB 4ZW3A 5J9PB 3DUSA 4UTBH 3VFMB 2APFA 2F7IA 3TO4C 4LHUD 3X1FA 3U0PA 1ODUA 5HY9B 1VCAA 3HLKA 3KPSE 5JOFB 2FJFB 1IC7H 1AS6A 1LXMA 4ELKA 5BCAA 4PGCA 4POYA 1VAHA 4Y16C 4IRJB 3ZK0A 2P5EA 1ESOA 1KIPB 4ZT1A 1TLKA 1HXMB 2R1XB 2V8MA 2J4WL 2V2XA 3V4VH 3VFTB 4B7IA 2NQCA 1CGUA 2IOIA 3D39B 5CJBA 5KSAB 3E6FA 1RUML 2X4UA 2UUDK 1FG9C 2YQ3A 2FJSA 1C5BL 1G9NC 5D2NA 4M6OL 4MZ3A 2IGFH 3QPQD 1KN2L 4Z7NF 2Y2WA 4FCAA 1TQBC 5GIRA 1FFNA 2ICWB 4JHWL 3EYUL 5FYKE 3GHEL 1N2RB 2E86A 1NBYA 4PJHB 4JG0H 3WFBL 2OSXA 4ZQTA 2CUMA 2ZXQA 4M1DH 3NJGA 1BFSA 2YPVA 4WFED 1F13A 1XH2A 1AYRA 2FRGP 1JNNH 5ERWA 5C0AE 1NGQL 2FD6L 3GSQA 3T8MA 2I25N 1D6EA 4P23C 2BY0A 2PW2B 3M7OA 5TE4L 3VG9C 5IW6B 1NL0L 2J44A 5GGRA 2V17H 3Q9QA 3QG7H 4PYHA 3BT2L 3QEQD 1UQSB 3OWEA 1KBVA 1F3DJ 3QJHB 4DZBA 5DQDH 2VAAB 3BH4A 5DFWH 3ZDZB 3FU0A 4JG5A 5GGVL 3K72A 1UZ8B 2UXTA 4N8VB 3OXRA 1RJZB 5KVGL 5KSBB 2OK0H 5L4FA 4W81A 1XGZA 3DO3A 1UHVA 1A7BA 1RHFA 2YMXH 3L1OH 4NZTH 2FVNA 5EU7E 5J0BA 3GMOA 5CEZH 4ZX3A 3UTPD 4ZRGA 2ZX6A 3AJ7A 5CZXC 1N6VA 5E2JA 3QC5X 1P7QD 3ZYZA 4HJ0C 4QOKD 2VXUH 4QCIB 2WINA 2BSSB 1S5HB 4PJDF 4CVWA 3FZUD 1DE4A 1VHPA 3ARFA 1OZUA 1PZBA 5EUOA 3B7TA 1LO0L 3MJGX 3RTQA 4OGZA 1BAWA 3M8OL 4XAWL 3EFFA 4JFSA 3CLWA 4OZGE 1KLFA 1K8DB 4P9MH 1F00I 1KJ3L 3IKCB 4OLXH 4U0QB 1Y0LA 2Q86B 2WXNA 4KROB 3QG7L 2OP4H 4LOVA 2W60A 2HJKB 1NL0H 3TVMD 5H94B 3OJDA 4LRNL 1GZPA 1A3LH 1XAKA 3MRLA 5GS1A 2HFGH 1DJYA 5DUML 1AHWA 4NNYA 1SGKA 1UB6B 4PR5B 5LXVA 2Q7AA 4ZAKC 3W82A 1G9ML 35C8H 5B1BB 4Y5XA 3OR6A 3ZDYE 4BFEA 3QWOB 1G7HA 4W9ZA 2Q3AA 4UQ2B 3B7SA 3HS9A 4LEOA 4LHUB 4TNVK 1CGTA 4HSAC 5JDSB 5I1GH 5KTEH 1E7UA 2EYSA 2X44D 4TUJA 2XZQH 3OB8A 4XP9H 5DJ6B 3HCVA 4AENA 3DO7A 4RIRB 5J3HC 5C3LD 3F85A 3FO1A 1T7WA 1RZKC 1SZNA 3AQXA 2LVCA 1MLBB 1JGLH 3N41B 3O3EA 1M56B 1SVBA 1N5AA 1GL4B 3ZU8A 2BSTA 1OCRB 4D0DB 1G7QB 4IU2A 4BD4A 4S2SB 1NGWA 4HIIB 1ITBB 1HH6B 4OH2A 4ZNEA 3S88H 1KXVC 4ZTEA 2ZWSA 3AT8A 5DD6A 1T89A 2CA3A 5T3ZL 2WWKT 5HSFA 3CVIL 4X2UA 3VTMA 2FEJA 5IJDC 4Z7QB 1BXUA 4WEEA 2EEBA 4D0DA 1NM4A 5BVPL 5DA4A 2XQBL 4NUGH 2NY3D 5EEXA 2VABA 3CJJA 2KLTA 2N1KA 3UYOD 3VYOA 5IHZB 4BEIA 3DV4B 5HI4D 5FK9B 3ROLB 5DI8B 4GRMB 4JPVH 3KPRE 2OJEB 3ZKXC 3MRQB 4R4BA 2WQRA 2ZJSL 3NCJH 2CRMA 3CU7A 3EYSH 3JVGC 2CD0A 3ECBB 4PJAB 4N1CA 4JY5L 4X7TB 1RZKL 5CJXA 2B20A 2A4EA 3LIZA 2YRZA 2CPCA 1OW0A 3MRBB 4QAMB 3MACH 3TURA 1FF5A 1SDAB 1OAKH 2KLRA 1QFHA 5KVGE 5A3IC 5I1CH 3BHBA 4U6XB 1U3NA 3B1UA 25C8L 3WEXA 2CDEA 3NH7H 4NKQB 2F53D 1SY6A 4JFEE 2EYRB 1MHEA 4H44C 3GHBH 3K5RA 4I0KA 3T1FA 3SYPA 2DWSA 3UJTH 4WEUD 3S36L 1SN5A 5EEZA 4YDVA 1N67A 5I82A 2DKUA 1BBJA 2DQFA 2XPGA 4TQEH 4EVNB 1IC5L 2EXYD 3VNYA 4D7BA 2RHEA 4Y8AA 4EBQL 1NFDE 3TN0C 4UT9L 2XZCH 3CFBB 5L2KA 1J5IA 3SYAA 3QNXA 3CLEL 4NAMA 4KJQC 1OAZL 3TOPA 1OARL 2AJVH 4ELMA 1NCUA 1JPFB 3O6FD 3WTYA 5F0LB 4YXHL 3II1A 1QI4A 5BVPH 4N0FB 5E8EB 4IDJL 1HHJA 4YWGL 4GSXA 2Q76B 3BPNC 4CU8A 3G7TA 5L88H 4WI0B 3RL2B 4A2GA 5KG9B 1FZMA 3CVBA 4ALAL 3POHA 3TN0A 2FIKB 5KSBE 2FT7A 3WEXB 4L18A 3QIBB 2PUQT 5TGBA 2WVVA 3JV4B 2DBJA 4JFOA 5IMOA 4QRPA 4Y4FC 5D7LA 3ULUE 4MJID 5MI0C 3V0IA 1NMCB 4ZMOA 5J5EA 1XGPA 2XTSA 1L9TA 3TU6A 1UGNA 1UJ3B 1MRDH 4JHBA 3RZCB 5EEYA 5HJGA 3WTXA 3NJMA 3I6GB 4IMKC 3A4DA 5HGDB 2P52A 3LKSB 1YY8A 4HIJA 1MF2L 3GBMH 4XC3L 1MJ7L 3MGTA 4KJWD 3Q6GH 1AI1H 3DX8A 1I7TB 3ZQ9A 2HLFC 5JTWA 3LD8C 5AW3B 1M7DB 1EZVY 1QG3A 1TO4A 4XGZA 5T3ZE 1CLOL 4J3UA 3DROB 3RIFK 3G5VA 1RJCA 5CP3H 2JJTA 2SODB 4PCKA 5C09B 1KCRH 1R0AH 4IMLA 2MPAL 3NCXA 4PGEB 3DPDA 1HHGB 2AJVL 3P77B 4XVSH 5AOJA 5EPMA 3K72B 3PP4H 4PREA 4PWEA 2P5WD 4L8BA 1FNEA 4PJEE 4XP1H 5LBSL 1CDCA 5MERB 5ID1B 4MCYB 3UO1H 3G08B 3DVNB 4ZD3H 5BS0A 4UAHA 3QCTL 1MCBA 3MJ8B 3GRWL 1FC2D 1KT2A 5AL0A 1XL4A 3WLBB 5D9SB 3G9AB 3VJ6B 3FUMA 4MAYC 3V6OE 3NCCB 1HE8A 4NQDD 5K9QG 5E56A 3GJFB 5JPMB 2HMID 4U3SA 3PAYA 1GCFA 2CJSA 4S1QH 4GAAA 1FHGA 4FQ1L 4FI8A 5HYQA 4GW5A 1KEML 3CFNA 4ODWB 1FFOA 4FYRA 2ICWA 4XXWC 1R3IL 3QQ9C 2CLZA 4DP9X 3BE1L 1QP1A 4FAAB 1QEWA 1KFAH 1BM7A 4LOUC 3FU5A 1NAMB 2O6DA 4IDLA 3TXAA 1MFVA 5CJOL 4LCWB 5DJXA 5DQDL 1W72B 4UT6L 3A24A 4PJ7F 3WS3A 4YQXL 3SGEI 5JPNA 2H9GA 3K71A 1EQWA 1U3YA 2BRQA 4TVPL 4K3GA 2V17L 4F7TA 5FYLL 4X9HA 1FFQA 5D7JA 4DIXA 2R1YA 4YFLI 4MDIB 2J3SA 2GVYA 1ETZB 3QT2A 4Z7WA 1NA8A 3QJFA 3S35H 2EQDA 3D4YA 1E5YA 1KV3A 3P3SA 4LLQB 3IBOA 1LMIA 5B3JF 1MN4A 2R2HA 3I02B 5C9JB 4DW2H 4KZ0A 4GINA 4NQVB 3F7VA 3FSOA 4GB9A 3ROOA 1J8HA 3JTSB 3NQKA 1TYRA 3SDXA 2H1XA 4ZG1A 1EDHA 3IXTA 5KBNC 4XCYA 1RVFL 3SOBL 4Q58C 3RP1A 1FZJB 1TCRB 3KCWA 4JQIH 5EU6E 1HWWA 5KVFH 4NC1C 4PBDA 1KLUB 4YEFA 5D72H 4ZX5A 5D8JL 4B50A 3OD3A 3BAXA 5A2AA 3CPUA 5D71L 1WO2A 2FGWH 1R5IB 5I0ZA 4U4IA 3D12B 3U7WH 5HJ3B 2RQ8A 4XBGA 5ALBH 2HFGL 1OP5H 2E4TA 1BREA 3VWKD 4APXA 1LO5B 3ZL1A 2QVKA 4B7LA 3TBSA 2DL9A 1J5OH 5DRNA 4XCCL 1EEZB 2BH0A 4PJGE 4XN8A 4M5ZL 4UDUB 3TA3C 4ELME 4N9GA 5AW4B 2F5AH 2IDSA 4NAQA 5BXFB 1AANA 1RL1A 3RGVB 1SY6H 1CDUA 3APCA 4MAYD 4PJ8B 1ZAGA 4UZUA 5BO1H 2OTUA 4K3EL 1HZKA 4QXWA 4X6DE 2FQEA 4OCWL 1KGYE 1OSZB 3LN9A 1BQHA 1PQZA 4K71C 4LCUA 2RTTA 4QF1B 1E43A 3OKDA 2IH8A 4NWTL 3T6ZA 1DQJA 3LZFH 1T4KA 5KW9H 2NZIA 2HKFH 5DJAB 2NY0D 3O9WC 1FG2A 3SPCA 1URLA 3KPSD 2P46B 3MJ7A 2EH8H 1U8PA 3CFJB 2OMXB 1GAFH 1ZKAA 1LP9E 4XCFL 1HOCB 5A2JH 3QXWA 1SFHA 3D0VA 1VKXB 4YDIL 4LSPH 5IF0B 3NEOA 1KC5L 3QDMD 4IDJH 4NQEE 4H5SB 3MTRA 1FFTB 4XX1G 4TVPE 4UTCA 5FIEA 4NHCH 1A14H 5JPMC 1PDKA 3H7LA 2O4EA 1L3WA 5CNHA 4MVBC 3RNKA 4KK6C 3GSXA 3NJVA 2G0KA 4LBEA 1HEZB 4GAYB 4RZKA 5DVOA 2V7NB 4IBTA 1MY5A 2R56H 3T2LA 4O02L 5AVRB 1A3RL 3ISYA 3MR9B 2KDYA 3KPQB 3SDCA 5CJQL 3O4LE 3CLFL 2MJWA 4U3CA 2YD5A 3US9A 3UH8A 2EEXA 4A6YB 4OCXL 1FO0H 5DYOB 3WAKA 2KZKA 1F4AA 1HU8A 1WBXA 4CMMA 3FTUA 4BV1A 3UCQA 1J1PH 1P6AB 1F6AB 3GSVB 2Q3XA 3IGAB 4LXFA 4V1DA 1PAMA 1C16B 1WICA 3G6JE 5FYKL 5KVMC 2YC1A 5AG8A 2AQ2A 3C75A 1WZKA 3FTGB 1L9OA 3G5VB 5KS9E 1WZAA 3BRFA 3F12A 2VUOA 4M5TA 4PP1C 3LXUX 5C08D 3KPOA 2VDKL 2X2UA 5EUOB 1ADQA 43C9B 4LVHC 1NCWL 5DT1L 4U6HB 3UAEA 4OIAA 1N19A 2K4AA 2B9BA 3ZLQC 5FX3A 2BSSA 2C3VA 3V4VA 1A4JA 5AZ2H 1E0OB 5TF1L 1CMOA 5C6WH 4QT5B 3MRKB 3VFMA 1Q9OB 4ZAKD 5J6GB 2JJUA 1DEEA 2W8CA 1P7BA 5PAZA 4C83B 2OR9L 1GSMA 2DQGL 3QHZH 3D18A 1AD9A 4IK7A 5CEYB 2ZE0A 2EDNA 3BISA 1PYWA 1KCWA 2VXTL 5AAWA 5I28A 1JK9B 1WC7B 1PGRB 2KQNA 4LNRB 3EH5B 1JV2B 1E5UI 2PR4H 4HLZH 3JWNC 5C0CD 3MA9H 2EDXA 2YPVH 5F71A 1PZ3A 3DHMA 4GG8B 5C1MB 5IJCC 4JB9L 1B4RA 2DKSA 4P2QE 1J7VR 5BV7B 5I66B 5K59E 2AJUL 4CILA 1XB3A 3GUTB 3KEHA 5EU6A 4OBRA 5CJ8A 4ZW6A 1Z9SB 1BVKB 4OD1H 4LFHG 5EG6C 4XN4A 3ZE1B 5A1AA 5G4NA 1U8LA 1W6LA 3UTSA 3OKLB 3RGVC 2VJXA 4L8CA 1YEIH 2X4RB 3Q5TA 3QUYD 4IIQA 5L8JB 1QNZL 3N1QC 1OW0C 4KTGA 4OF8A 5JYMA 1EGJH 3FTSA 3ARXA 3TWCH 1IEBA 4LKXB 3KS0H 4EQ3A 4F91B 2G4EA 5CZXD 1OB0A 3JVGA 3MUHL 1FL6A 4MXVF 2WYIA 3EG9A 4X9IA 3X1NA 5KYWA 5ID0B 1WV7T 5D2LA 4DCQB 2UX7A 3RI5F 1NIFA 2Z7YA 2WJ7A 3C6LB 1IL1A 1MPAH 4XI5D 4Y1AB 5K5YA 4U1JB 1LO0H 3D34A 1PZUB 3PU7A 1ORQB 5D9SA 3QARA 4K3DL 3V0EA 4KOCA 2NY1D 4IS6A 4E9YA 4X7TA 3QYCA 3GXPA 2PP9A 2FJFA 4IYKA 5T3ZD 1CG9A 4CVXA 4JNXA 2HSIA 2MQCA 2W0KA 3BZFA 5DI8A 1U93B 2P8PB 3VRJA 1PKQB 4Q4EA 3S4SA 2DWYA 2VDOH 4L9LB 3RX9A 2IQ9L 3MRCB 4WI6A 4NFCA 4GBXA 4G8GE 4B60A 5LKNA 5HYSB 1BPLB 5LN8A 4W6WB 2FEDD 3GMNA 2BIMA 2C9XA 1L5GB 15C8H 1O6VA 3ZE2E 4EI5B 1AAJA 5B4MC 3H9SE 3KCPA 5HYJA 1OP4A 3Q2LA 4AL8C 1TVHA 4JPIA 5E8NA 3DI3B 4OGAC 4NRXB 3BIBX 2R29A 4Y2DC 1S9KC 1B3IA 3SQRA 3ABGA 4TNEA 2W07B 5E00A 3BEWB 3WN5B 1BWMA 2EDWA 3DO7B 5DUJA 4XC1L 3D1MC 2ZAGA 1MW1A 3DSNB 5JIPA 3G5WA 3HBZA 1ZGLM 2NY1B 1UOVA 4X6BB 5EOCL 3HI1B 2ZSVB 4N5EC 5AW5B 1PY9A 1T2XA 1WTLA 2A6IB 4JGMA 4M5YL 4G1MB 2CDFB 1N5YL 2MWCA 3TBYB 3VXSA 3HG4A 3K6NA 1D9KD 2OS7A 4MZIA 1AQDA 3QUKB 1BFTA 3WFHB 3FONB 1SLVA 3D39E 3IMRA 4GIAA 5EWIL 2PF6A 1S9VB 4X0KB 4PY7B 2GJ6B 3EXJA 3MMEA 5GZNA 3RTLA 4IBUA 4HYTB 2ZSWA 3LRSA 4IBLT 4XXDA 4PRID 4TL5A 4EI5A 3QXDB 4WI5A 3STZA 4XBGB 1JI2A 4KQ4L 1TOXA 2O30A 2XY1A 4MCZA 4ZXBC 2P42B 4NJAL 1ZHBB 4EAEA 3QUZB 4ZXBA 2IG2L 4ALAC 1F4XL 3MRCA 3VCLB 1U0QA 4XZUA 1K3ZA 5E99L 2YD2A 4UOW0 5F44A 4AYFB 4N0RA 3DIFB 2VN3A 3LRHA 4JY4B 4PP2B 1BW8A 3P0GB 1RMFH 1WZMA 1ZV5A 4DAGL 5JQ6L 2DQTH 3UP6A 4FCHA 5E8PA 1F2XK 3EGSB 3ARGC 4WFGD 1OD7A 5GPRA 3ZDXF 3P9MB 1ACCA 1T5WA 4U6YB 3TEWA 3W9DB 3BP4B 5AG9A 4XCFH 3W5MA 5D4QA 1YEEH 2NY4B 4ODXB 2EH8L 3KDPB 3ATFA 2EACA 3TZVC 3CSPA 2DDQH 1F4WH 4LASH 3O6FC 4L4VB 3ATBA 1GCYA 3AWEA 3V9CA 5CGYD 5A2BA 3F05A 5BJTA 2E7MA 3GNMH 2KS0A 5A2CA 3U4BH 2HT2D 5HHXL 3SE4A 2VWEE 3LQAH 2Z1KA 1NDGA 1YEEL 3PWUB 43CAB 3JWOC 1NCHA 2CR0A 2JSFA 1KCKA 1CCZA 3HNVH 5KSVA 4JJ5B 1MCIA 4UWQB 1A64A 4W6XB 1DQKA 2B1AH 5HDOA 1E65A 3EJYD 3HNSL 3LEVH 3PDGA 3NCYS 4ZMPA 2VZOA 4YSTA 1UOKA 1M6UA 4MCNA 4F8LA 1NDGB 4K3EH 4R4ND 1A6VL 1FAIL 4JE0A 1FGVH 2ZXGA 2F54E 4PWFA 2ESVD 5JQ6H 3GZKA 3LY6A 2E27H 5ISZD 3RQ3A 4F2MA 4BE6A 3QDJB 7TAAA 3IE9A 2XKNB 2D4DA 5TD4A 1X9LA 3CFEB 3QIUB 3NJJA 1M2VA 3FUHA 5IBTH 2ZG3A 5CEZE 5F88A 1T5WB 5JW3L 4I3GA 2BNRE 3RU8L 4KJWC 3T65B 3WNJA 4LOUD 3MGOA 1IGTA 3VB8A 3OR6B 1OWWA 3FH7A 3OLEA 4E41B 1Y18B 3C08H 4PJDB 3ZO0A 4TNFA 1C1EL 2NNXA 3SE6A 1N6QL 5AB1A 5LQBH 3FFCA 3T0EB 4G8IB 3CV5A 4FGMA 4G7YH 4P2RD 4WO4C 1TYEB 4F80A 1S7SB 5IHUH 2BZCA 4IMLB 4PGEA 3SJVA 4I18B 1JXKA 3FB8A 4JZJC 3VFVA 1F90H 1ECZA 3G6AB 4JM2D 5D6DA 3Q13A 4GW4A 1HOEA 2VDRB 4N0UE 3VGGA 4ESKA 4YX2H 4XGZB 5DZOA 4N2IA 1A9BB 2FZ3A 2D7OA 1LO3L 4OZIB 4KDTA 2A6DB 4QKXB 1LHZA 2BK8A 1CYXA 4M8QA 4UU9B 2H8PB 1IVLA 1TU2B 5AVUB 3SBRA 5AZ2L 3QAZB 3GXNA 4KK5D 1JNHB 2VWEC 1EJOH 3ZL2A 3U6RA 4MDRA 1AP2A 4JHZA 1U2CA 3OKOA 1KCUH 1CLOH 5GISL 1UTDA 3ZDZF 3KLAA 1QNIA 1CR9H 2MIZA 2D03L 3B7YA 4MAYB 5JR1L 5TGBB 1FRGL 2FWSA 2APSA 4Y8DC 4Z7NB 4GUQA 1RSYA 3QH3B 3ZQXA 2I85A 1WWAX 2YIHA 3V6FA 1F4HA 1IAKB 4Q4IA 4I3RH 1HESA 5DEJA 4N8PA 1HDMA 4HWNA 1NBQA 4AKQA 4PJFB 1MH5B 2PCFA 3T2NH 2I7OA 3MJWA 2PW2A 3SGDH 4TNWF 5ADPL 3FO2A 1IQDA 3IGFA 5DURD 1MW3A 1YUHA 4FL4C 3EF4A 1NINA 3RY6A 4JDVB 3DX0A 3NCMA 4JBSA 4LLVA 1T1YB 2P8LA 1MPAL 4LCCB 1K4CB 3RX8A 1MG2C 1PLAA 4L3CB 2IH1B 1UKQA 3ZTJH 2DQFB 4EVNA 3OGCB 5JXEC 5LG1A 4YDVB 4L05A 3SE3A 5I8CA 1TEFA 5F7DA 4O02B 1TVBB 4AL8H 2BHUA 3JVFC 2D0GA 2QZQA 3OZKA 2XX0A 3BO8B 1ZHLB 3QIBD 4ABQA 1ZTXL 2LVEA 1UWYA 2JLPA 3FHQA 3L2LA 4JN1H 1UD4A 3PPEA 4XVSL 3C60C 1DHKA 1JAEA 2AMGA 2EH7H 2V5TA 4P4RA 5CSBA 5I1DB 4JAMA 5ESVB 2FO8A 2BY1A 3BIAX 4AJYV 4KV5E 5IESL 1YPZB 2ZAIA 4F9LC 4ES9A 4NZUH 2H0EA 4M6AA 1N4XH 4OFYA 4UQCA 4YK4C 3JQOB 3O41A 3Q1EA 4HUKB 2C7UA 1RIVL 2G60L 1RJYB 4M02A 1CGSL 2NYYD 1UUSA 5T1KB 2Z7WA 2R2BA 5FYKH 4Q14A 3WFEH 3N1GC 4OZGF 2QLVB 3WDIA 3DBXB 2QMJA 3REWA 1XF2A 4RGOL 3IFOA 3H7BB 1QO3A 4DVRH 4CSPA 2CXKA 5ACZA 4EKXA 1ML0A 1JWUA 2IH1A 5DYFA 1M9SA 3H3PL 5AB9A 1IIKA 3QI9D 1Z9SA 1UM6L 2XWJA 4FQHB 3S98A 5I75C 3IDNB 4K7FB 2EABA 3JWOH 1Z32X 3MX0A 4Z1PA 3APMA 1Z5LA 2F08A 4FA6A 2UWEB 1TT6A 3IU3A 1CLYL 1Q9KB 4IKJA 1WFIA 1F4YL 2Z31A 2ZYHA 4O2CB 1MJJB 2WPGA 2AEWA 2FX7H 3SIKA 4X4MA 2X4PB 2Y06L 1OSPL 3HCVB 4AENB 4NRZB 2NW3B 3C5JA 3QDMB 3WTVA 3DDFA 3CXDH 1NCNA 2YOCA 2HTKD 4NQSA 1PAZA 5E1IA 4TLSA 3QJFB 4WDIA 1OOWA 2G5BB 2NY5H 4JRXB 5DRZB 5DUPH 3WE1A 3IGKA 1S5IH 4LIQH 3EGXB 1AHWC 3NFPB 2PO6B 3LHPL 4UIMA 1QKZH 4H26A 2ZWZA 2VLJD 1P7KB 4LNVA 2DQDH 4XODA 2CBOA 3EDDA 2BW4A 3BQUD 1ZA6B 2I60H 3KPRA 2A9AA 2WNWA 1BBDL 3NRPA 2ZCKL 4PTTA 1JD9A 1YMHA 4YXLH 2YAPA 5AVXB 3WFCL 4RAVB 2BIOA 3FAXA 1KACB 2FB4L 2CUAA 1I3UA 2HB0A 4JGJA 5C0IB 5IOPA 4N2KA 4PFEA 1FFOB 2M83A 5EOCH 1T0PB 1M1XA 1XGQA 1DLFL 2XQ0A 4LPUA 2YFNA 3RWCA 2JQZA 3O0LA 4EN3A 1WFOA 3ZMNA 3NCFB 1J5CA 4JE4B 4K73A 4D7PA 4MJIB 5CBAA 5I74C 1IGTB 5BW7A 1YNLH 3VFPB 5DRZA 4M7LT 4E41A 4OZFA 3N43F 4JQXC 3RDTA 3SKOB 3JWNE 5I0XA 4RMBA 3K6OA 1HDMB 4G9FE 4NQQA 1MLCA 1YYML 1RJZA 1SXAA 2VERA 4HCFA 1XF5A 3SDCB 2P1YA 3BP7A 5JMRA 4ZMQA 5FO9B 4HEME 2X4PA 3IPFA 3KWXA 3QUXB 3EYOB 5JW4Q 5MERA 1HK6A 1Z9NA 5JA8B 1IM3D 1T21B 2GC7C 4JX0A 4ZQKB 4I5BA 1RK0B 3QUMH 5GRUL 1CE1H 1MLCB 2XFXA 5K69A 3TNMB 4CC4A 1H15B 4EI0A 3B2XA 4S0TD 1M3IA 5I0WA 3BZDA 3CCHB 2YGOA 4YDKH 4JREC 4TLUA 1RPQA 3KBEA 2Z34A 3RAJH 1AZBA 1MCQA 5CINL 4YJZL 1AR1C 2P24A 1YEFL 1RI8A 4LL1A 3BDXA 4Y89A 4FFWC 3OL2A 2NY1C 2AFNA 2VC2L 4HJ0D 1S7XB 4J7RA 2FR4A 3PHQB 1QBMH 4ONOA 5F89A 3T3PE 3GSNB 5KWYC 3FQNB 4KXBA 4IRSD 5GS2D 3NDZE 4Q89A 1PX8A 3DYPA 1FFNB 1FPTL 5F3FA 1A1OB 3EO1B 3KLDA 3VXTB 3UO1L 2VXVH 1CGVA 3MRDA 2GQHA 1ZY9A 1A3LL 4RAVA 5F7EL 1HWGB 1V10A 1GYWA 4MRCA 1TJMA 2OL3H 4BGDA 1CDJA 1RZPA 2X10A 4HMEA 3S88L 1SJHB 4WW2B 1HL8A 2Y1ZA 3HC0A 5DJZA 3F04A 3L4ZA 4K8RH 1MEXH 4AMKH 5KAQF 3CZKA 4BWWA 1CU4L 1SJVA 2BM3A 3K8LA 4LVEA 1NCCL 4PRBB 3QPQC 2A83B 2PWFA 3FCSB 3OWRA 4S1QL 4UMGA 3HHMA 3UJIH 4E9QA 3NAAL 1D9KC 1LE5B 3RNQA 5IQLA 2ZG1A 2NW2B 2Q87A 1QBLH 3FT4B 2EUVA 2YA1A 1OPOA 4XMPH 5FAAA 1G1KA 3GM0A 3VNZA 1RIUL 4B97A 4BWTA 3EFDH 1F1DA 4AIZB 1BQLL 4RFEA 4ZSOA 2JQAA 4Z7AA 4XPAL 4QRFA 4N2LA 2BNQE 2H26A 1BZOA 1NGPL 1ZE3H 1IM3A 3SDYH 1NLBH 2MRYA 3RU8H 3WFHA 2LU4A 4Y19D 4GRLC 3WCYA 3K81A 4WKZA 4X0KA 3VU1A 5GS0D 5AD0B 1KCRL 2F8VA 2PPFA 2XZAH 3SDXB 4U1IB 2DL2A 4P5TB 3UZVA 4KGLA 2PO6A 4UIMB 3AS2A 1NCWH 5DT1H 5FYJL 4GEJA 4TYUA 1NLDH 5B1JC 1CXFA 2FH8A 3KLAB 4BA0A 3WIHH 2RAMA 2ZUQB 4KKPA 4MJ4A 4TS6A 2OTWB 5LWYH 4IOIA 3U9WA 1ZT1A 2NSMA 3KYOB 5CBEB 2F8OA 2M8XA 2V8LA 3TPKA 4QHNB 4TOYH 1YEGH 1DVFD 1X4YA 2RGSA 3LMJH 4MMZA 2Q7YA 3OF6D 1YPZF 2DJSA 4OSUL 5JPNB 2WIIB 3IDIA 4OZHB 4KROD 3IMSA 3V6ZB 4AV5A 1AR1B 3HUJB 4IKLA 4HC1A 5GSVA 4IRSC 4OV6F 3IDNA 1EFQA 4LSVH 3EYQD 5K39A 4JL2A 4QKTA 4IU2B 3BQUA 1OP3K 3BRGC 2X4SB 3D2TA 1TETL 3KLLA 4NUJA 1XDTT 3GS0A 5D1QD 2QADD 4FTVB 4N0UA 1LILA 1LYQA 3GKWL 4R2GC 4Y2LA 1OV8A 1A66A 4YXHH 3OZLA 2RB8A 4BK4A 3HS0A 1JHTA 2WZ0A 3J7HA 4E2OA 4DKAA 1PSKL 5JDSA 5I15H 3OB0H 4NKOA 4LDEB 2CIKB 2DF3A 4WJKB 3O0RL 2COVD 4XNMB 5DDHB 3F6IA 3GUFA 5I71B 2I9TB 4HJGA 3DX9A 2FECI 4JM2B 3K4ZA 3NZHL 1URIA 4G2AA 4IOIB 2FT6A 2D0HA 4U1JA 5CBEA 5AYUL 4YXLL 4YPGB 3C5XA 1XZWA 2WCSA 1I9IL 2NY5C 1YRKA 5FECA 2PTTB 2E46A 5D96C 1RZJC 3H3PH 1B88A 5DD3L 4GUPB 1U8HA 1CQYA 5F89B 2WXRA 3L3JA 4I3SH 1I7RA 5C0GB 1M7DA 1T1ZB 3K1DA 4BH8A 5F8RC 2Y72A 3GSRA 1GSKA 6PCYA 2CKBH 4FI7A 1N5YH 4DGYL 3FT2A 4L1HA 1O5PA 1VIWA 2HG0A 3BKML 5HYJB 2XCMC 3BXNA 2CJTA 2KYIA 4LU5L 3W2DL 3GZPA 5KYUA 3RG1C 2BOBA 2JCCB 4X6FA 1S2EA 1WAEA 2O5XH 2FX9L 3OG6B 5LGJA 4Z3JA 1LQBC 4KK5C 2AQQA 5EO0B 2MH4A 4MD0B 4B9GA 1S7VA 1CGWA 1JN6A 5IQNA 5IQMA 3P9MA 2RACA 3QIBA 4UUJA 3ETBF 4PTUB 3BZFB 3QFJD 4JRYE 2I24N 1ZLEA 4MJ5B 5C0DA 3QNZA 1QA9B 3F2LA 3EJCA 4F2FA 3KBPA 2FHCA 4WFFE 2CNZA 4TKWA 4PJ5B 1S7TB 3DVIA 3KGRA 4K7PL 4Y2OB 3ZT7A 4BK5C 5EIIB 2YS4A 2ZOOA 4RAUB 4AEHL 3K7UA 4KUCD 1ORSB 1HX0A 2GYSA 2R7EB 5C0FA 2XSKA 3GSNA 3OKKA 3AU0A 4L48A 3T4AC 2ZWLT 2FJGA 3MBXH 2WBJC 2ITCA 3ZE1F 3C5ZC 4MXQD 1TSRA 1CK0H 2KQMA 1MRFH 4EI6A 3VXUB 1YYMH 4OZHF 1ZMYA 1VGEL 4MMXB 4G83A 5D70L 3B5GA 4KVNL 4BCZA 5CLYA 3CC1A 4F7PB 4JO5A 3SKNA 1OY3B 1YNLL 4HK0B 2ARJA 4M7KH 4DOHB 4OF5A 1W2KT 4PLJC 1PCXA 1O5DT 3NCEB 2C34A 3WE6A 1MCHA 1QBML 3N55A 1I3RB 1HKFA 3IDMA 1G0YR 5F0JB 1TZIB 4D8PB 3E8VA 4ZQKA 5E8DH 1CUOA 3NCWA 2EIBA 2YSSA 2WQXA 1NC2A 3PFQA 3EFDL 4QOKB 1RUAH 2NYYC 4NUMA 3UPAA 4P9HC 2C3GA 1ZD6A 1J48A 1N70A 2E5EA 5HVFB 1QLRA 2GHZA 4LDOB 5IJVB 1AY1L 3TO4B 2W65A 1INDL 4AZ8A 3D08A 5BRPA 2DLTA 3EHBD 4KZDH 5FLVA 2C3VB 1QLEH 2I32A 1DCLA 3X3FH 2HA1A 3MFFB 1GHFL 4P2RA 2HUHA 4MMXA 1B0RA 5IBLD 3VXUA 1D5MB 2FEEL 4CDHA 1CDIA 1EZUA 1NFIB 4S1SH 2AXGB 3CDCA 5ALCH 2B39A 4EIUA 4JDTH 2AQRA 4GI9A 5DQJB 5AOKA 1DDHA 2A0LC 2AJXH 3HZKB 1AKJD 2COQA 2CM6A 1OB1B 1PG7L 3APNA 4N20A 5KVDL 1IM9A 1AXTL 3IRCA 5K59F 4FQIL 4QHNA 1FE8H 5JXEA 4PJCA 1AI1L 4N6RA 2VN5A 3QO0B 5E8PB 1CFBA 3HN3A 3RAJL 2ICWJ 2J88H 1N0LB 5T5FH 2ZOLB 2YRLA 3PRZA 3E2HC 3PQYB 2XBTA 2CO6B 3MRFA 2EVIA 5HDLA 1TKWB 3C5JB 1RSFA 1HL4A 2Y5TB 3GSNH 1XCWA 3OKLA 4N1HB 1FYTA 2VDQB 5L9DH 5JDJA 5IB3A 3KYMB 3Q9PA 3D25B 4XPGL 4J3SA 3TEYA 5KEZA 2BOBB 1NCDH 1K6QH 3MGAA 2CHNA 4NO2A 3MRGA 2QVIA 1BP3B 3NSFA 3P3YA 1OE2A 1BEYL 4KFZC 4FHJA 4XNAA 4XNBA 2WLIB 2WVUA 3FRPB 3W39A 5G5DA 4EOWH 1ZHNB 2F15A 2PNDA 4L3EE 5EN2A 2FAUA 1MWAA 2E6QA 2NLJB 3JTBA 3HRZB 3I6KA 5C9JA 3U36A 4XBPB 4BXVA 5I6XB 3G5YA 2NNCA 2HN7A 1LEKB 4N2DA 4G6FD 4L8SC 3VH8A 4A2MA 2KMWA 3S35X 1H9DA 1PMYA 1DBAL 3TEXA 2KI6A 1GKEA 3UTZA 3FTVA 5LBGA 3UERA 4HZAA 2R2BB 3LEYL 3O41B 4HJTA 1LP9B 1RJYA 2CLRA 4ZMNA 1EAPA 1A3ZA 4MVBD 3UJTL 4AGPA 5C0JB 3RHWF 5L2JA 1XH0A 1VA9A 2BJML 1Q4NX 2GSIB 1AGEB 1SQ2N 4J3OG 3MBEB 2F74B 1NIEA 2XJKA 1XBDA 1D7BA 3HC3L 3VGEA 2DQDL 4UQ3A 4MMXC 4KXAA 1TDQA 5IJKC 4UDUA 4YDJB 4JFXB 3QB7C 5FM8A 2NY5L 4P8QA 1DVTA 4FTVA 4N0UB 1E2VA 4CSZA 3B9KA 4P5SA 4EUPB 2JKLA 1D9KA 1XGRA 3BW9A 3EOAB 1PPIA 2IAND 3EGDA 1T1YA 3HI6L 2CBPA 1ND0A 3WDHA 4G1EA 4L3CA 1CGXA 4BSVB 4JQVA 3D30A 2BNQA 3LSOA 4WI7A 3D39A 5KSAA 1YVLA 4WHCA 3TYFB 1SM3H 2CGRH 3BAEH 1ED3B 3INOA 1TJGL 3HMWL 2DMHA 4IS6B 4X4KA 5D93C 3S97C 4PV9A 4ATTA 5LLIC 4JFFD 4NZJA 1FVDA 2IF7A 2X6BA 1AG0A 3MR9A 2C9QA 4W70A 1EV2E 4HUMB 5HY9A 3QGVA 3A6CH 3UMTA 1WC7A 4WTZG 1MHHB 5I1EH 2CGYA 2O6CA 1D3CA 1GOHA 4LPXA 1HN1A 4G42A 4MSWA 1UVQA 4Q9BA 4HXAL 3ZHDA 3FSVA 1OAXL 4HUUA 3ALPA 1XIWC 4GAJH 1PKOA 3I9GH 4OLVL 3IDXL 4MMYA 4BZYA 4IJTA 3ZZLA 1S9WB 4G6MH 1DDHB 1S3KH 1JWMA 3EOBA 3S3JA 3EJPA 3DX8B 1XGQB 1IGJA 4D0CB 1C8QA 1B9ZA 5EU3A 4F7KA 4DZ8A 3NGBC 2YGPA 3C9NB 5F8QC 2XTJE 5DD5L 3VFVB 3WKQA 4R7DB 3OX8A 2EINB 2DV6A 2QPDB 4FYTA 4A2EA 5B38A 3BZEB 5ITFB 1TTFA 1HQ4B 1HINH 3ECVA 1NUGA 1TJGH 3HMWH 2VTFA 3SE8L 3V52H 4YFEA 3RDTC 1M05A 3QE5A 4HKXB 4I18A 4LEBA 1KGCD 3WHXB 1OANA 3QUYC 5ITBL 2UVFA 2J8UB 2VXQH 4HS3B 2DM2A 4PG2C 5DWUH 2YUWA 3FQUA 3WV0A 1VGEH 3K8KA 2EUWA 2Q76A 2PW1A 5HVWA 3H2QA 4KRPB 3GI9H 4JO3H 2ZOWA 2DLHA 2Z3FA 2G5BA 4F37F 4HBQA 4XNZC 3BGMB 2FT8A 1KYOK 3T6QC 5JHAA 3FB5A 1I31A 3TEUA 5IOKA 3HHSB 4RQQA 1AD0A 4ETYA 3GNML 3QUZA 1ULVA 4F15C 3NPSB 1WCBB 1ZHBA 2XBDA 1I1FA 4MQXD 2WBJA 1ZDQA 4HUXA 4U0RB 5I8OL 8FABB 4MAUH 4YHLH 5JXAL 1YN7B 5CWSB 3NFSL 3QAQA 4PW3A 5ANHA 3NZ8B 4IBZA 5FUOL 3H8NA 4KV5F 5CUSH 3EZJB 4YHPB 4ZYKA 3KJ6L 1N3NB 2WY3B 3GMQB 1Y6KR 1MCDA 4U2YA 4XP5L 3KWWB 4WTWA 4KKBD 2R56L 2C1OB 1R3LB 4B41A 1LK3H 5DZAA 5I9QB 1U8CA 2O5YH 3D9AH 3Q2VA 3T09A 4PJEB 2WQAA 4J1UA 5LAXB 4HIJB 1J1XH 1BZ8A 3OB0K 2VDQH 1FAIH 3LZNA 2PCPB 5G4MA 3GXTA 4ZOEA 3P9WB 7FABL 1OAYH 1I8KA 4UTAL 5IKCA 1IILE 2IPKB 4GI6A 3GGWB 4Q6IC 5DVLA 5J11C 2V4LA 4IOFC 5CEZD 2ENQA 2OR8A 5ESAA 1W80A 3WENA 3ZE2F 4A7VA 1W15A 2XWZA 1YPZA 4PGZA 4HFWA 3D07A 2KKQA 1K5NB 2W95A 4XBEH 3LPFA 5DDHA 4LASL 2JCWA 3LNGA 2DQUL 2F54D 1U8OB 4KKRA 4APQA 1AS8A 3LKPB 4AWJC 4N0FA 1KJVB 4G5ZL 4W6YB 1RK1A 3V0AC 4X4YB 5IB4B 3B2UC 2VSKB 2VLKE 2VDRH 2IFFH 4W9EC 2GSMB 3VU2A 1AGFB 2NT0A 1DANT 4XAKE 1GJWA 1LO5A 1I8IA 3L17A 5GZOC 1FE8L 4FQIH 4Z3EA 2RH0A 4PJ9A 4URKA 1KEGH 4ZUVB 1ZGLP 1IUZA 1QBAA 3QS3A 1YQVL 4ZK8A 1IQWH 4JG1L 4PJ9D 2HT3D 4H2CA 4GRWH 3DVGA 2APVA 3EJJX 3B4NA 2WIIA 5E24E 2Z0BA 1OAZH 1I85A 1IBGL 1NC4A 1CFSB 2GFBB 3UL4A 2A4CA 4LSPL 3KYOA 2L8AA 5FC9A 2F54A 3CN1A 4DGVH 2XIIA 1BEYH 1ILUA 4JFDD 4FLQA 4FG6C 3IJHB 2ZSVA 1JBJA 1NCDL 1GYVA 1NGZB 4JFWA 2IV8A 1MNNA 5I16B 4FFTA 2KZ1B 3VI4F 1NCBL 3NABL 4RMQA 1Y7VA 5EOQH 1BVKA 4IRJC 1KLFB 2X89D 5D7IB 5IHZA 3LH2L 3NSYA 2H8PA 3D6GA 3VI4A 5CD3A 3BEWA 5G55A 1W8EA 2W0FA 2Y1YA 4N2OA 3VX0A 3BPCB 1IC0A 4X83A 5I9QC 1WH0A 3IM1A 4F57H 1ZLSL 3FFCE 2F58L 1HWHB 1KIQA 3V0WH 3MLPA 4PGBB 4I9XA 5GGVY 3S4SB 4JK0D 4AUYA 4DUXA 3R06B 2F6AA 4JPKH 1XXDC 3MODH 4RWYH 3AFLA 4B9YA 1GGYA 3MSPA 2TAAA 3FF8A 3LS5H 2WZAA 3IDJA 1QFWM 1U58B 3H7BA 3UG3A 3V6ZA 3TESA 5D7KD 4L1DA 1A7PL 5KJ7E 1DFBL 2ADIB 2W5PA 4JHVA 3WGUB 2OYMA 3A4AA 3H55A 1R24B 2WBJD 3L5XH 3LZQA 3IF1A 1MNUL 3CSYA 3DOSA 1O9VA 3RVTD 3QRLA 2N0KA 5DO8A 1DBML 4NNXA 1RURL 2ESVB 3U0WL 3UJJL 2PPCA 4F7TB 3B9DA 2OR7A 3FK3A 2Z4QB 2IAAC 2ZWYA 2DIAA 3WO3B 2YUXA 3GSQB 3HB3C 3BP6A 3BVDB 4KRPC 4U1LA 3OC8A 4MJ2A 4X4ME 5ERWB 3M6DA 3WEBA 4CN6A 3DGDA 3VXPB 2X6MA 2BP8B 5EC2B 1FNEB 3ARDC 1LVEA 4FQJH 3LDBB 1I7UB 3DPBB 4O02A 4J5VA 3B9KB 4NEHB 4W9JC 2YLKA 4Z95H 5BZZA 2X4RA 1JUFA 5GZOA 4J3OH 4PRDB 4J12A 3RVUC 2IGLA 4K8RL 2B77A 1EH9A 3PHAA 3BN9D 2DD8H 1JGDB 4X6CB 5DEFA 3WEMA 1ZPUA 2GCYB 3PGDA 3PP3H 4OUOA 2AAVA 4HP5A 2WWKO 1B9KA 5CR8A 4JPSA 1CYGA 4YSAA 1J9CT 1F97A 4QRTB 1HXMA 4DN4L 4QTFA 5GRJL 3DOSB 5E7FA 4NQDE 3K0YA 5EBMB 3PWPD 3ETTA 4PJBB 4QY8B 1UJ3A 5EIIG 2WXQA 1BA9A 4LEXL 3DWTA 1E9PB 1JCKA 1DEEB 2CALA 2CIIA 3DC0A 4MXWL 4LSSH 4Y1TA 3D0AA 3CHOA 2X0VA 1G0XA 2QQQA 1JK9A 3JWDH 5F7WC 5CEYA 4G6ML 2KHAA 1KFAL 4HKBB 5SX5K 3W56A 4B95C 1PYWB 2DIEA 1QHQA 2AMUA 3C09B 4FNPA 4JDEB 4EN3C 3Q8AA 2HLEB 5BRZB 4ZO6A 4MXVE 5FA4B 5DFVC 1RVFH 1B0GB 1BZDA 4JO8A 4WWKC 3LRKA 4UAOC 3B9VA 3B5HA 4HCIA 5FFOA 1ACZA 5C86A 1YECL 1G1CA 5H35A 5GSRB 4DW2L 1YEWA 3ZGHA 2EZ0C 2CRYA 1AXSB 5E8OA 2J72A 2F0CA 2WXFA 3GDCA 3ZYIA 1ZTMA 2FECL 3KYNB 1JPFA 1TXKA 3PXJA 4RGMC 1SOXA 3UZQB 3V4PA 3O2DH 2RD0A 3CFDA 3IFNL 4I4WA 1Z9MA 3ZDZE 3GRWH 4LESA 1KDIA 2H2PC 2I07B 3RUGB 1GOGA 1C16A 1CDYA 2H2SD 5J13B 2CUIA 2YQBA 3GBNL 4FFVC 4X8JB 3SE8H 4ENED 1MG3C 4GFXA 1ADQH 3AS0A 4K55A 1SJEA 3MMEB 4KI5D 4OLZH 4XMLL 5JPMA 3D8MA 4IM8A 4U49A 4KJPC 3HPLB 1SXSA 4NHCL 4AQ1A 1S7QB 3ARFC 4HHGA 3VTTA 5HDQL 1H15A 1FC1A 2F7RA 3BKMH 4RFNB 2C9AA 4X7SL 4FC3E 4WHTA 3GJEA 3GMRB 5C08B 1JK8B 2XY2A 3HPLA 2NTSP 3ESMA 1JF6A 1X5JA 4X5WA 5AW2B 4JM0A 3HBGA 4AE1A 2XA3A 1HXYA 4ELMB 4MNQE 4W1TA 5CHNA 4M6OH 2BWIA 4I13B 2B14A 2XKNA 2NZ9C 3MKGA 4UV7L 5A16B 4XCEB 2W07A 1KULA 5FK9A 3ROLA 1XGUA 1PD6A 3DK2A 1I8UA 4TSBH 1BV8A 3A67L 5LDSA 3OAYK 2EDOA 2VO8A 1Q9WA 4Z7QF 2I5YL 1CXIA 2X9WA 3O81A 1QQDA 1UM4L 3TEZA 3TVMB 3PNWA 2MOQA 2VERN 4HC1L 5B39A 4XNXL 4KTEH 2DQTL 5AVQB 4H8VA 3ILEA 5D7JC 1UWXH 4O2FA 5TQ2L 1A14L 1Q9WB 3F7VB 1RK7A 4OJYA 2YOAA 1TQCB 4R0LC 5IHWA 2R2HB 4QHMB 2VR6A 2R9HD 2R15A 1FG2B 2EADA 4DK5A 1U21A 3F7PC 1J87A 4PRHE 5TDNA 3G04A 1Z3RA 2QFRA 2EDEA 4WHTB 4OI9A 5H37H 2IXQA 4A1RA 5KANG 3BH9A 1P7KA 5IVXE 1BX2A 3L1EA 5DHDA 1ZVHA 5KN5A 1K2DA 2C1PA 5L2KD 4Y9FA 1D2OA 3RWFB 3ZTEA 4ONFH 1S7UB 4MJHA 4BKTC 2N7AA 2FWOB 3A67H 1J5DA 5KSUA 3S9DB 1F58L 1JE6A 3DETC 2V9RA 5IB1B 4QHKJ 4PQXA 3GZOA 3L4TA 3POCA 4APXB 4AYGA 1A4KA 1FO0L 1VFAB 4NI3A 5C09E 3FQRA 2WYTA 1KIRA 5DRNB 1E9OB 2HX7A 2WMPA 2CLZB 2W60B 3DVFA 3PF2A 4P23D 1A3RH 2NYZA 1UWFA 5CIPA 1OAYL 3QJXA 3RWHB 2K0RA 3ISRA 1N59A 3LEXA 1LO2L 2EKSB 2ZQKA 3F64A 5AB0A 1ILSA 5I19L 3FO2B 3O6KH 5FOBB 4JFDE 3BQVA 4LDLB 1DQQA 1LD9B 5GHWL 4C54A 3NFNB 3BVXA 3QIWA 4XN5A 3L3IA 1R24A 1VB9A 1IFHL 3V6FB 3O3DA 5JHBA 2XN9A 4YSQA 4CN4A 4R90L 5BOJA 4HIHB 1F0LA 2PABA 3WHXA 2D2OA 3TJHD 5BRZE 4GQ9H 3US0A 5LB1A 1FNHA 2Y7NA 4YNYA 1TEYA 5DS8A 4G1MA 4EF3A 3PWVB 3QQ3B 4KI1A 4KTYA 3UFIA 4MD0A 3DRQA 5F1NB 2YA0A 5HHMD 1A02N 4JPWL 5K93A 4Y5VB 4YLCA 5BZDB 4FXKB 3HJEA 1AP2B 4OSUH 1NC2D 1RULL 4XVTL 4YIQB 5FXCH 5CLZA 5CM1A 3EW3B 2ED7A 2X6UA 3AADB 1WSST 1C9SA 4P2QA 1S8DB 1QABA 2A74B 2E7CA 5JOPE 3T3MF 3BO8A 4HAKA 4GAGL 3SDAB 3N0PB 4ICWA 3EOTL 3SODB 4J3OC 4LSSL 3QCTH 4RNRA 5TH2A 4LE8A 3BD5A 4G6KL 3MRHA 2J21A 1SBBA 1CURA 3WL9A 3H4HA 1EFXA 4ORGB 4PWKA 5D4HA 2XZAL 1U8HB 1CD1A 1DO5A 2H0FA 3O6KL 4JFUA 4HBCH 2YKLH 3ZE1E 3IF1B 3B7RL 2HYMA 2XWBA 2XDHA 3CHXA 3HW7A 4UM9A 4JG0L 1Y1UA 4IOFD 3MGOB 1RJLA 3CC5B 4JEGB 2ICES 5IB2B 3INUH 1E4KA 4KWUA 1QSEB 1U3ZA 4L1BA 1KN2H 3RTQD 2FLRT 1BOGB 2QGDA 2BVQA 1EAQA 4IEFB 4LARL 3EDJA 2OL3B 2DJMA 3HPJA 4MYWB 1DUYB 4ENZA 1YC8A 1FL6B 3NK4A 4LAQH 5IQ9A 3Q8CA 4WSKA 2B16A 2WTRA 1L9QA 3PWPB