3V10A

Crystal structure of the collagen binding domain of erysipelothrix rhusiopathiae surface protein rspb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
318
structure length
310
Chain Sequence
AKDYTNEAIFTQFDVNPKGLINNPSQPIEFNLAFSDMNNGQKVKFKPGDFFDLTLPSNDEVSLRSLRAMGSKMPVLAKKEITLGELTFNGSHIHFEFMEDVLQLENVTGTINLKSVYDNAYRGEDDKIAELPTNLGLGSLDKQMITISQPGTPTSPIFYWKTGTFSTEVHGDMNWWLNINSPKEAVQSDVKVIDTIGEGHKLVDGSIMVDVEANGELKHISAEAFNKEYGTITVEGQVLTVMIPKEKAAKTTFTVTYDTRAFDKKLENYKNSSTIEYKDESGNLVTDTPKHYTDTSVVNMFDDATIGGEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Rhusiopathiae surface protein B
publication title Collagen adhesin-nanoparticle interaction impairs adhesin's ligand binding mechanism
pubmed doi rcsb
source organism Erysipelothrix rhusiopathiae
total genus 67
structure length 310
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A01
4F1ZA 4F24A 2X9XA 4LEEA 3HR6A 5DZ9A 3AT0A 2F6AA 4F27A 4Z1PA 3RPKA 5IHWA 2X9ZA 3V10A 3PF2A 2RALA 2X9YA 4B60A 2XTLA 3QE5A 2YLHA 3ASWA 4IGBB 3HTLX 3QDHA 1AMXA 4IGBA 2X9WA 2WZAA 2Y7NA 2Y7MA 4LEBA 4F20A 2WOYA 4UZGA 2OKMA 2Y7LA 4OFQA 4P0DA 1N67A 1R17A 3IRPX 3IRZA 3KPTA 3OPUA 3IS1X 2WQSA 4IGBC 4MBOA 4JDZB 2Y1VA 4LE8A 2F68X 4JDZA 2VR3A 4MBRA 5CFAA 4Z23A 5DZAA 4IGBD 3IS0X 3RKPA 4JE0A 2Z1PA 3UXFA 3AU0A 1R19A 4HSQA 3PG2A 4B5ZA 2Y7OA 5CF3A
chains in the Genus database with same CATH superfamily
1KDIA 4KTGA 2XQBL 3U7AA 1ZS2A 1RZ7L 3NN8B 2GBUA 2QV2A 2JFCA 4DERA 4XCFH 5IROA 1UATA 4G59C 1RK1B 4X5PA 2VDRL 4MZRA 1G87A 2DI7A 3H55A 2XBZA 1B90A 2XA8H 4JFHD 2CLZB 4AW4A 4R7DB 2AKRA 1M42A 2BJML 2J8UF 2V2TA 5FLVA 3EJRA 3POHA 3MUZ1 1D7CA 2HG0A 1NBVH 2WNWA 3FQTA 3VA2C 2H2SD 5JYLA 4WEUD 4YO0A 3NGBB 3VO0A 1H5BA 1NMAL 1NDGB 3HNSH 5AAPA 4Y5XC 4ENZA 3C8KB 4GRMB 3CZJA 3GQFA 4FNLH 4E5XG 4AI7A 1BZ9A 4E42A 2C3VA 5CEXA 4JK0D 5IWLC 4RSVA 4X5XB 4QYAA 3WNJA 1QFUH 1YSOA 2BSED 3LSOB 2PPCA 4JAMA 3GMPA 2GQHA 3ZXAC 1YEIH 1ZA6B 4B96A 2Y0SA 5EU6A 4HUVB 2QR0B 4KKCC 5C08D 3DX7A 3DV4A 1HHKB 3MPCA 2XXCB 3DX0A 2PO6C 2UYLA 2WXJA 3RU8L 1EXUA 1IC1A 1YQVH 3UJIL 1YN7B 1CICB 2Y36H 2YGPA 1OCWL 2KDYA 1N3NB 3KDPB 4CN4A 4KO5A 3X17A 3LZPA 4C55A 2FRGP 1HQRA 4OY9A 4R7NA 4PJGE 2JQMA 4X98B 5FECA 4MAYA 5I73B 4Q9RH 1NAML 2AJVH 4I4WA 4QAMB 3TN0D 4MS8D 4AQ8A 1I3GH 1MJ7L 4XCCH 4OLYH 2WTRA 1J9QA 4JR9H 4KOBA 2HLEB 5K9OA 5CJBA 2UZIL 2IWGA 3E9TA 3OWRA 4P99A 5DMYA 3IS0X 4KQ3L 4P5KB 1LVEA 4YEEA 4XVOA 1X4YA 1PAMA 5J6GA 2QVFB 4D3CH 2IF7A 2XVGA 4YHIA 5KVGE 1CGXA 4RDBA 1F2XK 2AFNA 2CD0A 1NC4B 3D69B 4BBWA 5H37H 1JG9A 5DUJA 2F8OA 3X1BA 5BOPA 5LGYA 1IAKB 3ZQXA 4POUB 1Z0NA 4NHCH 1CD0A 2EO1A 4BH7B 1XV8A 4PJFE 2R9HC 4MMYA 3KLHC 3PWNA 4NWTH 1ZA3A 4KROD 4PV1C 4P9ML 1GVIA 1MSPA 4ZX5A 2IWEA 2WXHA 3BEVA 5JW4M 3C2SA 4M43L 2MQGA 4M5SA 1MCWM 4Y4FA 1AGEA 2MHAA 1YEEL 5JORB 1T20B 4A2LA 2ATKB 5IV2A 5GS0C 3AGWA 5DS8A 4OV5A 1YEDB 2PR4L 4L37A 1QO3A 3CN1A 3R18A 3JWNH 4NBYB 3VFTB 4LSRH 1GW0A 5GJSH 1A7NH 2OYPA 2J8UE 3FK3A 3L9EA 3MJ9L 3PHQB 1A7QL 4ZO6A 3FPXA 4Y1AB 4LCWA 1B6DA 1EEZA 3FTVA 3BEWA 3NIFB 4UTAA 4PRAB 5FGRA 1ZLVH 4ODTH 5EC1A 3ULUF 2O61B 3EO0B 2C9XA 4NPKA 2JE8A 3GINA 2XWTB 5T1KA 2CHNA 3NAAH 4OLUL 4PJ7F 1IFGA 4E68A 4MNQA 4JPKL 3OLDA 1RXLA 4RA0C 1DO6A 2BNQE 2UUDH 5DQ9B 4WHTB 3WTSA 3IJSB 2FT8A 4KTDH 4XCYA 4AVIA 4HJGB 5DLLA 4NQDB 5BVJA 4UT7L 4D8PA 2IIJA 4KXZI 4U7KA 1XDTT 4DZBB 1FYTB 2YOAA 5HGGS 4Y5XB 2ZG3A 4AV5A 1MELA 1HWWA 3HMXA 3FO1A 1L7IL 4RAHA 3L3DA 1MDAA 5E8EA 3QZWB 4YAQB 3NCXA 3RWFB 3Q3GB 3B9KC 3ULVF 2VDKL 2WXRA 3L2LA 2ZKWA 3H8NA 3BE1H 3GMRB 4R0LA 4UZGA 5HDQH 3F6LA 4S1DC 3LHAA 5LB1A 1U42A 1XGUA 3BZFB 3QFJE 4RISH 1JRHH 1P4IH 1ZSHA 2UY6B 4UIKL 5LBSL 2Y72A 1IGMH 3O0RH 3OAUH 5CJ8A 1T0PB 5F8RC 4TF4A 3CFKB 2VAAB 4MA7L 2DJUA 3E1F1 4WO4C 4OJEH 2YO3A 4BA8A 3CFBB 1BM3L 2QKSA 2DJSA 4AZ8B 1YYLL 2XKUA 2BOCA 4JG5A 4PG2A 2BHYA 1CF1A 1K8DA 3J7HA 2Y1ZA 1MQKH 3L9YA 1QLRB 1BQSA 4R84A 4R7LA 5IVZA 4CGTA 2EYTA 3FMGL 4QDGA 4DP5X 2JKJA 4DEUA 4PJ5B 4X99B 3AADB 1HZHH 4NOBA 1KMGA 1T0OA 1WISA 1RZ8B 3Q5TA 1BLNB 5FYKD 1JPGB 4TOYL 3MLYL 4UQDA 5KYXA 3S0PA 3KBEA 3KCPB 2VZTA 2AQ3A 2BNQD 32C2B 3HAEA 2DQMA 5CJXC 4LSUL 3WN5A 1R3JB 1IBHA 3DHUA 4NQEE 3O45A 1MHPH 1XIWD 2DV6A 2G60L 3C5JB 3RTLA 4TUOA 3LKNB 4AL8L 3CX5K 3M7OA 4DTGL 4IK6A 1SYVA 3NTCL 3OQRA 2Q7AA 4OF5A 4WNQB 4XXWC 2X44D 4IHOA 3U9PL 4F8QA 4HIHB 2F54A 3TVMD 1J05B 1JYXA 3IGUA 4M62L 1KCBA 5IJVA 1SN2A 4HBCH 2CSPA 2HSIA 2BVEA 5CBAA 2EDHA 2EDKA 3BYTA 3FQYA 2XWJB 4OT1L 3Q1EA 3ULUE 4L2YA 4QJ3B 3VFPA 4XZUA 1YNKL 3VD7A 4QHUA 5D7LB 1BX2A 5BZZA 4JPQA 3CN2A 4PJ7E 4YH6A 1SJHB 1CVRA 3G7TA 3FQNB 4Z77B 3NJLA 1M7DA 1DJZA 2XVBA 4H13C 4HH8A 2DZEA 4MJ5A 1HEJC 3N9GH 5DJ6A 3FO0H 2YKLL 5GRYA 1WPCA 2V7NA 4ODSH 5F1IA 1AGBB 5F7BA 5L88H 5BQ7A 2V9TA 2ZT9C 1WC7B 4V1DB 2BS8A 5TPWL 3EDDA 3CSTA 1T04A 4HEPG 1JV2A 2B3RA 2Q7YA 4P06A 1NLBH 3V5DA 2Q0ZX 3QI9D 1L6PA 1LO2L 3BSZH 5FB8A 2X70B 5I16A 1KIUA 2BW4A 3TO2A 4YR6A 3SKJL 5F0MB 2EDFA 4N68A 4G1EB 1L9TA 4GKZB 2X4UB 3ULVE 2YSSA 3DHMA 5KS9F 1BJ8A 4IRZL 4YDJA 5FS5A 3SKOB 3CLWA 1EAQA 2ATPA 2VQ4A 1IC5H 3BW9A 1UCBH 4FLHA 2YJLA 5K9QG 4PAZA 1NCHA 1OM3L 2K3TA 2XTJE 4OF0A 3H9SB 4JJOA 3RUGB 4J3XA 3B34A 2BVOA 4NQED 3I2CL 4X83A 3VWJC 2V8LA 1WGVA 4CNIA 1IJNA 2MKWA 3B9KB 2IC2A 3KPPA 4XWGH 2EIZB 5E8PB 1IL1B 1TZIA 4Z7VA 3BKJH 3VACA 2CRZA 4OKVA 4PJHA 4A7VA 1CDCA 3FHQA 3OWEA 2EIDA 3CUPA 4GAJH 1K3ZA 5AW9B 4L3EE 5TQ2H 4DP0X 2NSMA 2RD0A 4XNZC 1A5FL 3VE0A 4KH2A 2BCMA 3MBEA 2GJ6E 4OCSL 4L8DB 3X1FA 3ULUD 4WO4B 1P1ZA 2AV1A 2COQA 3VXSE 4X80L 2FB4L 1N0XH 2XCMC 3EYOA 3HZKA 4B9YA 4X6CF 1PNDA 5C0RH 2NSXA 15C8L 1OXYA 3NEOA 2VNCA 3NJGA 2HKHH 1INEH 1VFOA 1E9PA 2OMNA 4U1NA 1Q9WB 1S7RB 2EE9A 3FUHA 3EGXA 4DOHE 4FQQA 2HRHA 3EJZD 4JN1L 3L13A 3TASA 2IMMA 1T5WA 4JDTL 1F11A 4QYOA 4QJ5B 3KPOA 4R90L 2OMYA 4GXUN 5F7EL 2WP3O 3UO1H 4E9XA 2NUPB 2YEZB 5IZ7A 3L4CA 1RZJH 3S4SG 4KK8C 1T1ZA 5IKCA 3FOMA 1V7NL 2JF1A 4MKMA 3CDZB 3WGUB 2IOOA 3B9VA 4Y16C 3SDYL 4APQA 3K2KA 2NX5B 5IMLA 3ULVD 2F7RA 4JPIA 4NNXA 4OQTA 4R3SB 3TV3L 4LLWA 3KD4A 2DLFL 4KV5F 1EFQA 1ZRUA 3KPSA 2WB1A 3M6DA 1U8OA 3KW8A 4MNHA 3SBWC 1NEZG 2XTJD 1PG7X 1Z5LB 4PJCF 1ED3A 4MHHI 3TF7C 3WAJA 2ZSVB 4HETA 1JD9A 1OV8A 3IBEA 4PBVC 4OJYA 1KCSH 3GSOB 5ID0A 5JHBA 3IDMB 5ENWB 2H47C 4WWNA 2BHFA 3IK2A 4BRJA 1DEEB 3MROA 3MNWA 3DETD 1AHWC 1SQ2N 3NCWA 3G5XB 3U83A 5H4ZA 5EU6E 2ARJQ 4OLWH 3K81A 5KOVC 4I18A 2ICWB 3QZBA 3K72A 4L3ED 4L23A 3LJ3A 5IQ7H 3KLSA 3GB7A 4HC1L 5FA4B 4RWYL 3WS3A 1G1CA 2LLGA 2GJ6D 1ZHLB 5IW1B 3VXSD 1R24B 2A4EA 2Y1YA 3LOWA 4MKTA 3W9EB 2Y07H 5J4MA 2AP2A 4FA8A 2K3HA 2NY2C 2RR3A 3O9WA 1J11A 3O8XC 3VA6A 2I85A 1H9VA 3IJYA 4WTZG 3WJJA 1LK2A 2VABB 2Y7OA 5LAXB 4F24A 1H5BC 5EF2A 4NT6A 1DFXA 2WQRA 3IAGC 4JCLA 1HJCA 2Y6SC 1A21A 1R5WB 5AVRB 1ONQA 4HUNB 4AMKH 4U1SB 5C0FB 2X9ZA 3H4FA 5I71C 5EO9B 3KR3H 4WFEE 1TETH 1W72H 4P2OC 3NACL 1AH1A 5B22A 5IROD 1IGYB 3BWUF 3GI8H 3IM1A 3VWJB 4TN9A 5FDYA 3REWA 4XOEA 2ZUQC 4FQ2L 4XHJC 4OKDA 4OJDH 5F7YC 3PYCA 2QHLA 1OP3H 3SE4C 1DN0B 3LD8C 5E5RB 3OHXC 5JNYB 1N5YH 3DSFH 2EIBA 4HISA 2L3BA 4DP6X 5E5MA 4UQ9A 3ZRSA 4HA1A 3SE6A 2XQYA 1CQKA 5DK2B 2KZWA 1KJ2H 1PZ5A 4XNZB 1ZGLM 2DAVA 4KRMB 4WY7L 2A6DA 2NY6C 1DQQA 4WWID 1J0KA 5DVNA 2ZICA 2EDDA 4AQ8C 1W8EA 3MRKB 1UJTA 1N7MH 5KVGL 4O51B 3DJSA 3V4VB 3NCJL 5E9AA 1TIUA 1OKEA 2ETWA 4IEFA 1NFKA 5EU6D 4M6ML 1J0YA 1YC8A 1I4FA 1JGLL 1Z9SB 2E75C 1KBBA 3D4CA 4NZDA 4Z3HA 5CCKH 1JCVA 4LCWE 4OZGA 4FQIL 5I1JL 4WU5B 1ZGLB 2C3WA 1IGJB 3B7SA 4OB5L 3JV6B 1G6RH 1JNLL 2YXMA 4OSUL 5CMAB 3N41B 1SXBA 4MAYD 4PJCE 43C9B 1QRNB 2CMRH 1S78D 3MRRB 2H9GA 4ZD3H 1MFBH 1RK0A 3KPRE 5DJXB 2HLFD 4Y16B 3LB6D 3HMWH 3MLSL 1WS8A 4DPBX 4K9EC 4KX8A 5L8JB 1BQUA 2FR4A 2DMCA 3MX0B 4WFED 4WI2A 3QEGH 4UTBA 2AK4A 1E5YA 4FNUA 2PWGA 1G7QA 3FT3A 1XSKA 3NQKA 3WUWG 4HIQA 5FYKL 4XB8A 3EFOB 1F5WA 3QEHB 3L4XA 2BZCA 2J1YA 1B0RB 4LXFA 5FOJA 2FGWL 5C0DA 3MCG1 4MLIA 1URLA 4DOHB 1S9WB 5I1AB 4TSAL 3KPLB 1AHWB 2CRIA 1YEGH 4H26B 5I2IB 3Q8AA 2AXHA 4B9IA 2J1WA 1FO0B 2JLLA 1GHFH 1QNZL 4HK0B 4IRSA 4PP2A 4X7SL 1FNSL 2CK2A 2BRRH 2XKNA 3NUKA 4LVOB 4Y4FD 2DWEA 1PIFA 5TDNA 1ROCA 2FVNA 3K6NA 5DR5L 1C5CL 3UEZA 1X5HA 4BZ2H 2WP3T 3FUEA 1UD6A 1IGFL 2F7PA 2EVHA 3U7YL 2AKRB 2EC9T 3BX7C 2PABA 3D3VB 4J28A 2NY2B 1L0YA 1TTCA 4XNQA 3O8XB 1FL6A 3ESNA 3OSVA 4OM0L 5JR1H 3FFDA 1H5BB 1BQHA 5DZAA 3UZQB 4LL1A 4KRPC 4RA3A 4UV7H 1J0ZA 1TTFA 5AG8A 2HTLC 1WWCA 2X1XR 5I71B 5LO7A 4DUWA 4FYRA 1XF5A 3K46A 2C3VB 5CEXB 2J88H 4X8JA 2ITDA 3SCMC 1KV3A 4TVPE 2RALA 5AENA 4P2OB 1TMQA 2XX0A 3WJMA 3IEAA 3UBGA 3WIFA 2ITFA 3GMPB 2RQ8A 3OAYK 3ZN6A 4DUXA 4HU8A 1FBIH 4N2NA 2ZUQB 2VM3A 3QWOA 3KPRD 3RIKA 5GRJL 2EUVA 3DX7B 3DV4B 3LD8B 2H8PA 3VRIB 5JOPE 3OHXB 4R0LC 3SGJA 5HDOA 2XV3A 1O6TA 5GGVY 2UYLB 4BE6A 1U8PA 4WWPA 3RX8A 2A6JB 3NJKA 2OCFD 1ET5A 3BZEA 1JTTA 3V0AC 5AOJA 3J2PA 4XMZA 3UTPE 2F54E 3HPLA 3SDAD 1OK0A 5KW9H 3DK0A 1T7YA 2D03H 2YHGA 3GMOB 3QRGL 1VZGA 2V5SA 3MACH 2JNZA 4FG0A 5EBWA 5FECB 4I4WB 2NY6B 4M5YH 3PAZA 1FVDA 4FQJH 3WKQA 1BQLH 5EIIB 5JIHA 1KLGB 3ARBA 4C59B 3FS9A 1BJMA 3LKRA 3QHTC 2WTRB 2DH3A 3TYFB 5K9JH 4X8CA 5FUCE 5F6IC 2E74C 4EOWL 5C0GA 4N8CH 1DO5A 3Q9QA 3I85A 1JYNA 3ZTCC 1TJHL 3EBHA 3LEYH 3CXHJ 1UJ3A 3IJ8A 2XQ0A 2LHAA 2BNRB 4ZRGA 1X5JA 4YHIB 2BIOA 1G7IA 3H42L 4JO1L 1PS3A 1PBYA 1EZVY 1HOCA 2W8CA 4BQBA 2CALA 1MHCA 1WBXA 2I5YH 2YPKB 3LZRA 1EO5A 4QMEA 4XBEL 4LPTA 3ULUL 1KENH 4YBLB 4L0ZA 4FHBD 3SDDD 4IRJD 4MMYB 3H9ZA 4R4NC 1RURL 3AROA 2A73A 3PAVA 2PP9A 1A1NB 3HBGA 1KCKA 4A66A 4DP8X 5EZIL 4ZOBA 2AQPA 4H5SA 4GH7B 2F58L 1X3DA 4TVPD 1SEBA 5FR3A 3ZHKA 4KI5C 4OV5B 4S10A 3KPMA 2LLNA 1QO3B 4J4PC 4AZUA 1BG1A 2AC0A 5D4IA 4EZLA 1HEHC 4P2QA 3SBRA 4GIOA 4AYFA 3BSGA 5JOPD 2P42B 1HIMH 3UX9B 3DK2A 1HOEA 3QXDB 4JFYA 1I3UA 4BHUI 5EPMA 2MH4A 5ELIA 3UTPD 3MV9A 3VXMA 4Z7VE 1FZKA 2F54D 3ZKMC 1MCHA 5F3HA 3ULVL 4PJHE 1QACA 1ERNA 2FX8H 2EEXA 2UZXB 5T1KB 3KGSA 4BSWB 5FYJU 5EN2B 5CD5C 1KULA 2CRMA 4MNQB 3C6LD 5JA9A 4IKKA 4C83B 4Z7UF 2Y06H 1ZHBA 4TUJA 5JHAA 1QFHA 2NCMA 2O6PA 3GMQA 2IAMD 5B39G 3I9PA 1AY1H 3MBXH 3QUYC 4XNBA 1AO7A 3CHOA 3V6OA 3RWGA 1NCAL 1NMAH 4G6JL 4KRPB 1NA8A 1MUJA 4GG6F 1RIUL 1T1YB 2V0AA 1IGCH 3ESPA 1CI5A 2GHWB 2VC2L 2JTYA 4HP5A 4MD5A 3SYAA 1TNMA 3SCMB 4UINL 2WLLB 1FHGA 2XXFA 4KJYA 1UA3A 1SHWA 3GBNH 4OZFG 4QRTB 3VUAA 5TH2B 3WIIL 4A2GA 2C8NA 1JZGA 5FM4A 5IQ9A 1QFWL 2FIKA 3D09A 3B2UC 3HS0A 1BDYA 3QO0B 1E8ZA 3HI5L 4P4KC 3GBDA 4R0LB 3U0PB 1H3UA 3WY1A 5FO8A 3ZDZB 1QX1A 2DTSA 2R4RL 3RU8H 5JLZA 4X6EA 2DQDH 4MD4A 2NLJB 1HYSC 3TCLB 3BHBA 1SDAB 4ZX6A 4E2OA 5EG6C 1KCUH 4HS3B 4YHYC 4JM2A 4OGZA 5GRVK 5ESQA 1HKFA 3V4UL 4JRFA 4GI8A 4ZBJA 4L9LA 2EXYC 3KPSE 1OCCB 4HWNA 2NXZC 1PJWA 4HK3J 5IOPB 2RGSA 3IWVA 1ZK5A 3VFOA 4B7IA 5IBTH 5ITBH 1M05A 2KZ1B 2Q7NA 3P4OB 4J3OF 3MRQB 1K8DB 3NJNA 2VDOH 4S2SA 3GJEA 3PDGA 5F6IB 1CFMA 3D6GA 1U6AH 2EYTB 1KB5H 3OKOB 1ND0A 3L3JB 1BHGA 2CDGA 2Y1VA 1SYSA 1CTNA 1UXLA 5KYXB 1ADQA 3OKMA 4N85A 2OZ4A 4P5TA 2WQVA 3HAEB 5LGJA 5F0LB 2IWKA 3WN5B 4A7GA 4L1BA 3LY6A 2VDNB 3MLVL 4DEPC 1ZHKA 2XZQH 1SYVB 3QXAB 3VRJA 1QZ1A 2Z92A 4IS6A 3QQXA 4KVNL 4P9MH 5HHQB 2ZCHL 4M43H 4J3SA 3FTYA 3HC0A 4M8UA 5IJVB 3PGFL 4GUCA 3DVFA 2Z1KA 2R0LL 3OLIA 5CBAB 4GRWF 1Q94B 4GNKB 1YEEH 4JRWA 2DYPA 2X41A 1K8IA 3VFPB 4D7BA 2PR4H 5C0AA 2EE6A 2WK2A 1WS7A 3LIZA 4QHUB 1WCQA 1Y07A 3QUZA 4ES8A 2GYSA 3UTQA 1DLHA 4UQ2B 4M03A 4LOVA 1BYNA 3MJ9H 3KPNA 1S3KH 4FNRA 5DJ6B 4APQD 3VTMA 4LSDA 5C8JA 3UC2A 3IWUA 5F1IB 2V7NB 4WZ9A 2HVJA 4ZO9A 3HIZA 2I9TA 5BQ7B 5LWYL 2EC8A 3Q2LA 4GG6E 5D1ZD 1S46A 5F9WC 2Q7YB 2K4WA 2FX9L 4OLUH 3MRIB 3V5DB 4FI6A 4XCNA 2EH8L 4W68A 1UM5H 5I16B 1KIUB 2XWBB 1UADC 4L2LA 2V5YA 3TO2B 1HHGB 2K78A 1XFPA 4KJQD 5SX4H 4Y88A 5E94A 5L7XH 1NMBL 3QUYB 3F2LA 4MXVF 4HIEB 1GIGL 4K3GA 3VW3H 1JZHA 2CKNA 4NYLA 1S9XA 3WFDL 2ATPB 3BW9B 4GXUM 4ZOEA 3TO4D 2HVKA 2VWEC 2IANA 2F1BA 2ENYA 5CLXA 4Y5VA 3WFCL 1E8WA 3DJTA 4J3BA 4DHLA 4PBDA 3VH8A 5D6CA 4AH2A 3LRHA 1OD7A 4HALA 4M56A 2CKBL 1J0IA 4GPVA 4PYGA 2VDKH 3CZLA 1M1SA 2VXTL 3LXBA 1JD7A 4OD1L 4BCZA 1TZIB 3O9WD 4P4KB 4P48A 2YD7A 3GLAA 2DD8H 1NSNH 3FTWA 5FUZL 5JW4Q 5F89A 4YHYB 3DKHA 5FO7B 1ILUA 4ZW8A 3MBEB 4ZXBA 4MA7H 2NXZB 2DQCH 2VM4A 1P1ZB 1IM9B 4OFVA 1J8SA 2AK4E 3EYOB 4ZMYA 1U9KA 1ZDQA 1EVUA 1YYLH 1MI5E 2B8OT 3ZY7A 3CDGA 4NKIH 1HH6A 3CZUB 4HJ1A 3KVPA 4LP4A 1L0PA 3T4AA 1ZTXL 4S0TD 2PCFA 1XGTB 3ZIMA 3LYRA 3RNQA 3WO4C 2ZOKA 3FMGH 4QYOB 1T5WB 4PJAF 1F11B 3W9DA 1JXFA 3KPOB 1QRKA 2RFXA 2VLJA 1KGWA 3FYIB 1BXXA 5CBEB 2WUCL 1BW8A 1CDJA 3QIUA 3PP3K 1T1ZB 3X3FL 3U6RB 5IKCB 3CQQA 2ZP0T 3FOMB 3INUL 5D8JH 5EU5A 4DEPB 3NPZB 4LLYB 3OR6A 2LFGA 3CG8A 5IMLB 3DXAA 3NTCH 3TBTB 4NNXB 3W2DH 3QNYA 3FQXA 1U92A 1IKOP 4R5TA 3BVVA 4M62H 4N2FA 2R2EB 3HUJA 3SKMA 4MNHB 5DYOA 2FYVA 4CSZA 5I66A 5MEOA 1K4DA 5MP6L 4GAGH 4NZUH 5C0CA 4DZ8A 2EDWA 1VFBA 1FL5B 1NGXA 3E8VA 2W07B 4P46A 3DOHA 3HFML 1YNKH 3L4UA 2ZX7A 1BG9A 1GAFL 3Q06A 4M5TA 1QYGL 3Q44A 5I8EB 2Q5BA 1E4WH 4JN2B 1GC1C 5CCHE 5C6WH 3UO8B 5BRZB 5M7QA 3CVHA 3IDJA 2HT4C 1UC6A 1EHLH 5ETUA 3WTXA 3GHBL 3K72B 5C07B 4MXVE 1R3IL 1U33A 3EIFA 1DVYA 1FQ9C 4U1JA 4WGWB 1PF3A 2R69A 2YXFA 2EKSB 1DUZA 4MJ6A 1IQWH 3CFMA 3V52L 1Z9LA 2WINB 3FHAA 1UUNA 3D33A 3M8OL 2YAEA 4TVPL 1N26A 5DGQA 1MI5D 3WOVA 3ZDYF 1RCYA 2CG9X 2NNCA 4KHTL 2VZSA 2XG4A 2B16A 1NLDH 5TE6H 2OMBA 4AJWA 2WYTA 1ONQB 2X38A 2LV4A 3VNZA 3IGLA 3QB7C 3C5SA 5AVWB 2PUQT 5FA3A 5HHMB 2EO9A 1LXMA 5HJ3A 2G2RA 1LLAA 4ZAKA 1SXSA 2BK8A 4M1CC 3HPJA 2B9AA 4PY8I 3ECWA 1WP6A 4E9SA 1PSKL 4NN7C 3REWB 1RZPA 5HDLA 1QTYT 2OXHA 3ZKXC 2YD3A 4LE8A 4PS7A 2ED6A 4JDZA 3VFMB 3HAEG 4U1KB 5D70H 3ZKQD 4E0RA 2VR4A 4EXKA 1KELH 2Z3FA 5CAYB 3SGJC 1JDDA 1RFDL 5JDJA 5CUSL 2GJRA 3I6GA 5D7JC 4NRYB 3X13B 3MTXA 2IDTA 3IDIA 5EMYA 5AB9A 4AG4L 5KZCD 1UOVA 4KK9D 2P7TA 4XXDA 1JOIA 4F7PA 3VG9C 3MFGB 5EWIL 3QUML 2XX1A 2Z31D 4OCSH 2YFNA 2A6DB 1DQQB 3SE8L 4LB8A 3GKZA 5JPMA 1XCTA 1GS8A 3V55A 2IDCA 3N91A 3AG4B 1NC2A 3N40F 4AGMA 1J8RA 2EC9U 1Q1PA 2VB5A 1MW2A 2AJUH 1CGYA 1EFXB 4KTYA 3AVEA 4P5MB 3WU1A 4XMKH 4P2QE 3GRGA 1NGQL 4JFZL 3WO4B 1I4FB 3VXNA 3ZW3A 4JN1H 4YGAB 5F9OH 1AZRA 1EEYB 1IBDA 4OZGB 4NM4H 1FAIL 4HFWB 4JRYA 3K4AA 4PS4L 4I7ZC 4TSCH 4H8WC 5EO1A 3MV9E 4UNVA 3VD4A 1QHPA 3S7GA 2UY7A 3CE1A 5DO8A 3VXTB 2A9BA 3EYSH 3N1QC 4FMVA 1FC2D 1ZLWH 2JB6B 4YIQA 1AE6H 1XT5A 3WHXB 3ARBD 5CGMA 1QMUA 2HFFA 3S36H 2M8XA 2Z93A 3P2BA 2TSBA 2DLFH 4OLVL 1CCZA 3BWAA 5EA0H 3TWCH 4FXGA 1AO7E 4FZEH 3V6OE 1AXIB 3WLWC 4U1HA 2AK4B 3HBQA 2A2QT 1JPST 1G7QB 3FT3B 5LLIC 2Q20A 3FUNA 1V7MH 3JUZA 3CN4A 4LOEA 3MCKA 3ZDXE 1Y18A 2H26A 2VL5B 3QJVB 4XH2B 3NFSL 4YHMH 5CZXC 5I6KA 2X4NA 3U1SH 3RDJA 3ZDYE 2VXUH 4TRPL 5K39A 2O6CA 3MNZB 4N6RA 3OHMB 4F9LC 5A6IA 5IM7B 4AJYV 3GXFA 3QEQB 5E0FA 2XKNB 4OH2A 5TDNB 4HJJL 2OS7A 5I1HH 5B3JE 3X1GA 3TEWA 1NCCL 1KBKA 4M3KB 3SDXF 4YSSA 1CU4H 1VA9A 3T8MA 3H85A 3O4OC 3QDGA 1CFNB 4ZFGH 3IXAA 1BCIA 4OIBA 3IN2A 5F97E 4X5WA 1FZOB 2E86A 1UVQB 4P2QD 4I88A 4R8WH 5INCA 3VXOA 1BQHB 1Q9KA 4U0QB 4W6WB 3C8DA 2AJ3A 1FFOA 2HFGL 1UXWA 5ICYB 1ZJAA 4KMTL 2X7LB 3VCLA 3ZKNC 4NJAL 1RSFA 1XF5B 4QRSA 4AWJC 1IAIM 1NINA 4N87A 4BUGA 2ITDB 1I1AC 2BINA 3BVUA 1Z0MA 3FN3A 5IGXH 3WJMB 3NACH 3N42B 4N2DA 2WIIA 1SBSL 3ASOB 4NN7B 2WWMD 4YLCA 3FUDA 3EJPA 1RP8A 3QWOB 3ZKXB 1F4XH 1CDBA 3TEXA 4EEEA 1A6ZB 4ZUTB 3HS0C 4JEGB 2EVIA 2CO4A 1XX9C 3ZGHA 1OP9A 4MX7A 3FQUA 5KSBF 5GGQH 2X2IA 3M45A 1C16B 4QTIL 5ESVA 3EDEA 3HE6A 1KFGA 4JM2C 2YD4A 3OKYA 4XVJL 4Z95L 2XJKA 3D18B 4ONFH 3VG9B 5EEVA 2V3FA 2LOEA 3UFIA 2FEEL 1XCQB 1CN4A 4BFRA 4KK5D 4Z7WF 4ZI8A 1QEWA 1UQSB 4A7QA 3MV8A 2HYMA 3QJQB 2DQJH 3JWOC 4UDTA 2V9RA 3CPLB 5C0AE 3MGAA 3ZYOA 3DBXB 5L8LB 5IREA 1P5UA 5AZEL 1EBPA 2JJSA 3H7LA 1K4CA 4AYDC 1GJUA 3N43B 4E41D 5C0GB 2O5ZL 3VSVA 1QUNA 4PLKC 4PUBL 2A38A 1A66A 1JGLH 1NEPA 1UJ3B 4JY6A 1B4JL 5E99H 5I1JH 5D2NA 4FQPA 3OQ3B 4B3VA 4P5TC 1AQ8A 4O02L 1G7IB 3RIFF 5I82A 2P24A 3IJHA 4B41A 1L5GB 4MB1A 4GO9A 4MDJA 1CB4A 4L9DA 1HL9A 1MHCB 4MQXD 5JQHC 2MWCA 1GOFA 2GBVA 1TFHA 4Y8AA 2EKJA 3LS4L 1R5VB 2NY4D 4WTQA 2AZUA 3MRPB 3PP3H 1PEZA 4JHVA 2JKXA 3V0VA 1SOKA 3M88A 2YLKA 2A73B 4UIMB 2AQTA 4BZ1H 2XOTA 4H5SB 4I9WE 3TM6A 4N1CA 2MFNA 3JUYA 4DQOL 1BPVA 4RLDA 4RGOL 1Z3GH 4ORGA 5DMGD 4F1ZA 3ZUCA 2YQGA 2ZCLL 5IQNA 2IANE 4O58L 5GGSB 2AJSL 3TEZA 4G6AD 3SGDH 3U46A 4B5EA 4N2EA 3T0DA 3LPWA 3LEXA 2NUTA 2E9WA 5HPMA 1FH2A 5K69A 4JQIA 4MXQC 3RUGF 3SDXE 1O0VA 4TSAH 3P54A 3QJTB 4PSRA 1O5PA 3BXNB 2H3XC 2ZKXA 1EEUA 5EPMB 3VXMB 2FEDC 4CUCA 1MXGA 3ET9F 4KU1A 1ORSB 1QNZH 4X7SH 4PB0H 1FNSH 2CUAA 2RIKA 3DX4A 1F4WH 3GDBA 3TP4A 1FA4A 3RVTD 5FYLE 4UZUA 2ZP8A 2XQYG 1CIUA 2EEFA 1OT1A 2HVBA 5F72S 3BAIA 1IGFH 2E5EA 1IBGH 3KXFE 1ZHBB 3U7YH 3AXLA 2BWQA 3O4OB 2CM5A 4MJIA 4JPWL 5AW4B 5FKPA 5IB4A 4NQXA 2F1EA 3QUZD 3GPEA 1AZNA 3GGWA 1SY6A 3RWGB 1BOYA 1U3HA 2CJ3A 4M7KL 3L1GA 3L1EA 2R27A 1JNHA 3SE3C 3DGGA 5KSBE 4URTB 4RGNE 4FQ1L 4Y5VC 4DVBB 1I1AB 5AWNL 3PWLB 4KJYB 4DWHA 1S7TA 1KTCA 3L5XH 2FJHA 3SB3A 4AQEB 1FYTD 4ZTEA 3MRFB 1XGRA 1UB6A 5GRJH 2WD0A 1DBKH 3HS0B 3HKZA 4Z7WE 3OJDB 4N24A 2EUZA 3VRLF 2FZ3B 3NA9H 2L7UA 1OM9A 2ESVB 2VXSL 4PU2A 3LN5A 3I50L 3QNFA 3DXAE 4I9WD 2X40A 4JREB 4KJPD 4R5VA 5FCSH 4JM2B 3WV0A 3D51A 2E47A 3TH3T 4JFWA 3HG4A 2CU9A 1AGCB 2Z1PA 2IAND 2PYEB 3HUJE 4ZPVA 2Y2YA 2Z65C 3S5YA 2IG2H 4G5ZH 4W9JC 3ECUA 3B4NA 3DX6A 5C0CE 2ADIB 2PO6D 5E4IA 5EBLB 2O93L 1FE8L 4KXCA 4Z8FH 1P7KA 3VQ1C 3OZ9L 4KOCA 3WIAA 1H6UA 5AW8B 4C47A 3ATBA 3GJEB 5EOCH 3WMSA 4HJEA 2MEJB 3QGVA 3SGKA 5IW6B 1CLYH 5KAQG 1MW0A 4M93C 1T5XB 2CDGB 1A7RL 1SYSB 3QJZA 5FYLD 5G5DB 2JSFA 2VN5A 1HE8A 2A9MH 4P5TB 5IQMA 2B59A 2VDMH 3IYLW 3KXFD 2VQ1A 3RPIA 4EDXB 1YNTA 2EYSA 5KYYA 1MY7A 1ZHKB 4JFXB 5JYMA 5CP3A 1KYFA 3O3DA 4X9BA 3DRQB 6TAAA 1KNOB 4YLQT 2YEQA 1H3GA 3F8UB 4IS6B 2XFGB 2IEPA 2P5EA 1G4RA 1M57B 2HX7A 1QBAA 1X5FA 4JG9A 5HYQA 4X9FA 3WNIA 2XN1A 1O75A 1BQHG 4RGND 3ULSA 5ICZA 1CGSH 2EE2A 1K72A 4JDVA 4JRXA 1KT2B 2F58H 4JPVL 3KWTA 1OAZL 2AGJL 4XVUC 4F7TA 2VQTA 3S3DB 4UNUA 1XF2A 3STLB 1M9WA 4ODVH 5I5JA 1ILSA 2V9UA 4ODUA 1JN6B 3QIUD 3FFCA 4QHKI 1SJVA 2Q3AA 4IOIA 3UTQB 3GMNA 4IBYA 3U2IA 3IKKA 2YRLA 5KYUA 3KPNB 3FB7B 3ILEA 3PHOA 5CHNA 1IILE 3DXAD 3GSNL 3CSPA 4L4VB 2EJ1A 2OZNA 1P7QD 4XC3L 1P7HL 1JK9A 4OD3L 3V4VH 3DROB 4PBWD 1EJ6A 4NKMA 5DHVB 5EFIA 3L3GB 1RJZA 1E30A 2QELA 4TLSA 2ADYA 1CD8A 1NTDA 1OAQL 2WZ6A 4XCNB 4NXKA 5C0CD 4ERSH 3FJTA 3CPUA 4LDEB 4WF7A 4P2YA 1BREA 1LJMA 2Y1AA 4OZFH 4FAAB 1EBAA 2ZAGA 5E94B 4HVBA 4RMRA 4YC2C 1EAOA 5D1XA 4NAQA 1KZYA 3RTQA 1NCAH 1BF8A 3FTGA 4NYLB 4PFEA 2WLHA 4YMPA 4QHLA 2HVKB 3VRLE 5HGBA 2X4OB 3JQOB 4Y5VB 3PRZA 4C8XA 3S5LA 3TIEB 4UINH 4F93B 4K23H 4XCEA 4G8GA 3SDCA 4AH2B 4EVNA 2P8LA 5HI3D 3TWYA 3WIIH 2VLME 4TLKA 4GSRA 1OZUA 2P3YA 1QFWH 5CN3A 2CH8A 4LCYA 5DUML 2DY2A 2YMXL 4ZX4A 1MG2C 2BPBA 4HCRH 3D1MC 2V33A 2XBTA 3HI5H 1ZSDA 5AG9A 3KL0A 2YPLB 1ZE3C 1A6AA 4HCGA 2DDQL 1NGPH 2CHWA 5FGCE 5F89B 4JFEA 4N5UA 3ZPDA 3SYOA 4PRNA 2VYRE 3CBJB 3V4UH 4ZXBB 1ODAA 3X3GH 3FCBA 4Z78B 5ERWB 12E8L 5AZ2H 2X1QA 5H4YA 2GSGA 3MUHL 2XHNA 1Y7VA 3FF7A 3MXWL 4DKFL 2HN7B 1BQRA 3EYVB 4ZZFA 5I9QC 4AUYA 1YC7A 3NT0A 2Z8SA 2PCFB 4GFTB 5F6HJ 1E2VA 5CINH 3KWUA 3L4ZA 2J4WH 2PWEA 3RNQB 3UBFA 4ALAL 3W9DB 2ZSWA 4DKDC 4M93B 2VLJB 5J6HB 3ZE1F 3ROOA 5AEAA 1UWXK 2A0LC 3W0WB 3S88H 5C0BA 3VI3A 5E6IA 3AY4C 3Q8CA 2BSRB 2RB8A 4KPHL 2ZOLB 1YEFL 3NFPA 1FSKC 1JGUH 4XPGL 4DK6A 2YAHA 1XB6A 1NC2D 3OR6B 4CVXA 1A0QH 2NZIA 2ORBH 5FO9A 3QDGE 1FFQA 5AOKA 2VXQL 3FQXB 5DD3L 3UAFA 4AGNA 1S7WA 4KVNH 4CU6A 4MSWA 2ZCHH 4FXGC 1DJXA 4JW3A 1FVEA 3SKMB 1G7HA 5MEOB 2JXMB 1EJOH 4G9FA 5E2TL 2R0LH 2LT9A 2EQDA 3KYAA 3P0YH 1NGXB 5E6YA 5HHOB 4P46B 2VLMD 2ZX6A 1BIIA 1IC0A 4CVUA 2P44B 4P57B 1D5BA 1LEIA 1QTPA 3LPGA 1MF2H 3FU8A 4BSVB 4YHZL 3CVHB 3IDJB 1IEHA 2J5LC 1TZGL 3HFFA 4L4JA 1OP5K 4K3DL 3BN9C 1ETB1 1DUZB 2BVQB 2IGFL 5DJDA 3BH8A 2CRYA 3D30A 3CFDB 3O41A 1G6VK 2PCPA 2RCSH 2Z35A 4NUMA 1WE5A 3MODH 3FSAA 3CFNA 2P5WA 2WCSA 1A4CA 1JAEA 3OC8A 3RVWD 1ZIBA 1ADQL 2LAGB 1T21A 2OZ4L 3QWQB 3RGBA 4YC2B 4AENA 3TT3L 1YNLL 4KTEH 4GQ9H 4HJ0C 3ZTNL 2FJFB 2AV7A 3TGXA 4OTXL 3NJVA 3C5SB 4NDMA 3BP7A 1S9KC 3V0EA 2EZ0D 2W5PA 5HJ3B 4UM8B 4KXAA 4ABUA 3UG5A 3JTTB 3RA7H 6CGTA 2BNUB 4X0NA 4XB3A 1RH8A 3L1OH 5D2NE 1EZLA 3NIDB 4M6NL 1V5JA 3IRZA 1HTYA 2BP3A 3CSYB 2P49B 2F9BT 4Z3FA 1LEKB 4H1LA 1PKQA 4NWUH 4BQ8A 4UBDD 5INDA 1QSEA 5BPPA 3QDGD 1N8ZB 1U3JA 1TKWB 1GPOL 3K1DA 5DHXB 5DJ0A 3DX2A 3H3BC 1CZ8H 3MLXL 1DFBH 2JKIS 5ALBL 5ANMB 5I1KL 1U2HA 4F7PB 3CFIC 4YS4A 3BQUA 1NCBL 5IVNA 5DFVD 1A6WL 2HX8A 3BT2H 1AKJA 5FM5M 1TTUA 4QXTA 4LEOB 4G5AA 2QQQA 1MN4A 3MLRL 3GBEA 2FLBT 3ZE1E 1BBJA 3D7PA 4N8VB 4BKLA 4UTAH 1ETZA 1A4KB 4OZ4B 1TLMA 3HNTL 3WS6A 3SO3C 5HTSA 4TTGA 2B4CL 2H41A 1QPKA 4NLAA 1QVOB 4ZOAA 4HOZA 5I9QB 5I6NA 2X3AA 3FCTB 4OCYH 1BQ5A 4Y19B 5LGHH 2XNAA 1CL7I 2R29A 2R56H 1CGTA 2XG5A 3II1A 4JRYB 2VMFA 4E9YA 3DTDA 3DYOA 3HCVB 5DZOA 3HE6D 1G7PA 1S9YB 1T80A 4F2MA 3SOBL 5IFAL 4MTMA 3GS4A 1XBDA 3HI6H 4IGBA 4GW1A 1DVSA 3R7RA 3KZ8A 2QTEA 4N2AA 1FSKB 3HMXH 3INUH 1DHKA 1RU9L 3NP3A 1E3XA 3V0WL 3X2QB 3I84A 4UYQA 3LS5H 3QHZH 4FERA 2KZKA 5DCCA 4DKEL 2HFFB 1B0IA 5FYJD 4MJIE 2VR9A 3RKPA 1A4JB 5KN5A 3HN5A 1N5AB 1VEPA 2J8HA 4FXGB 3H6JA 3NCFB 4A38A 4DPCX 3CLEH 4IYKA 3JWDL 3CDCA 4XPAL 1QLEB 5MP6H 3QQDA 3QXVA 4ZPTB 5FC9A 2XQYK 1ZLSL 5IHZB 4OFYA 2PTUA 5BZWB 5FYLL 2DKSA 1BJ1H 1INDH 4NNYB 2J72A 1X5LA 3HFMH 3PLYA 4NLHA 3MCKB 1CFVL 1Y18B 4ONGL 1GAFH 4N2MA 2H26B 1F8TH 1QYGH 3VH8G 2X4NB 5MERA 1T2QH 1UM4L 2XRAL 5E1QA 1XGYH 2XETA 5K39B 4QJ4B 3APNA 3V0HA 3GHBH 3NABH 4KK6C 8FABA 4PGCA 1R3IH 2LLLA 2Y2WA 3AXHA 3TBVA 1P2CA 3CMGA 1N6VA 3VD2A 1HINH 1AI1L 1N8OE 4HXAH 4CJ1A 4BK5C 2KDGA 3RX5A 1KXVA 2AJZA 4JG1L 1OAKH 2Q86A 3DO3A 1AGDA 4CBZA 4CMHC 4TVPH 3DECA 4PJIB 3IXAB 4NS0A 1QEXA 1E27A 5DD0L 5J06A 2QVKA 3BO8A 3KS0H 4R5XA 4ANUA 5ECGA 4LKCA 3OD3A 1E40A 4K71C 1FFOB 1UXWB 3FBKA 3HAEH 4TMPA 3TYGL 1J5OH 3EH3B 2VDLL 4ZK8A 2N1KA 4LF3A 3GTVA 4AK1A 4PSPA 5I1IL 2MCAA 3KWWA 1TJIL 3QQ4B 3O8XD 2Q3ZA 1YJDC 3SY6A 1J1XL 2OMVA 5TGBA 1MAKA 4FKEA 1IJ9A 1NDTA 5AVQB 2NY3D 2Y6SD 1YCSA 5CLTA 5A2CA 3QRFM 3S3SA 3L3IA 4X6DA 1DQMH 3MGTA 4CRPA 4GUPA 1AIFA 1RFDH 1MH5B 4F9PC 5MENB 4L0YA 1HT6A 3HC3H 3AU0A 4JO4L 1YYMH 3DHPA 1QR1B 3DV6B 2IO5A 3ELAT 3KL5A 3Q5OA 2P5EE 4Y0GA 2LVEA 3DA0A 1Q4NX 5EWIH 5D7IF 4WUUE 1HZKA 2LFEA 3SE8H 3OG6B 4MMXA 1EV2E 2JI1A 3KL3A 2DI9A 3LXAA 3T8XA 4XMPH 3UJTH 4DW2L 3MV8B 4XAWL 5E56A 4LPCA 4UDTB 4ZO7A 2OMUA 2YGOA 3SJVA 2Z4QB 3HE7A 4NRXA 3Q7JA 3SO3B 1EZUA 3A6OA 3AWGA 3OKKA 4H8HA 4NEHB 4KI5F 4U6HA 4WSJA 4XNXH 3APMA 1K4CB 3RWJB 4A2MA 4AEEA 1T7WA 3FFCE 5G2NA 1QUNB 2Y7SA 3SPCA 4CAGA 3E8UH 4X9YA 2AJXL 4WFHE 5J12C 3RDTA 1FDLL 4JFZH 5CZKA 3U2SA 1OWRM 4JFSA 4N20A 3CZKA 2WKOA 3E3QE 4XP1L 2VITA 4ELMA 3ARYA 2VLLB 2JI2A 1FFNA 4WQOA 1LK3H 3VB8A 3GWJA 4P2RB 3IJHB 4F91B 4HEME 2VSCA 4MDJB 1MKFA 4ZSOE 1UWXH 2N3JA 2ICWJ 2WNGA 3FO2A 4XO4A 3D0VA 3V0VB 3O6FA 4F57L 4FFWC 4OLVH 4B50A 1TDQA 1FZJA 3RWDB 4KFMA 4IMKA 3AS0A 4XP5H 1OGPA 1TYJA 3G6AB 4G11A 3R4RA 4FI8A 3D4GA 2HKFH 5FHBH 2BOBB 4J3TA 1EZSA 2FATL 2G4GA 1PZSA 1FN4A 3U46B 4AMWA 3NESA 1I8AA 1CE1L 35C8L 3LEXB 5E4EC 1B88A 3EXJA 4OCWH 1MRCL 5CP7B 3NFSH 4RQQB 5IBUG 4KQ4L 3ZQ9A 1AZVA 2W38A 4IM8A 5JXEA 4DIXA 1QFOA 2F53E 3MA7B 1SJMA 4ZMNA 3G6JF 4AQAA 1JGDB 2MCPL 2KLRA 2P5ED 3A0OA 3ZLQC 3VGDA 3X14A 1OP5H 2HFTA 1AVAA 1T22B 1TYRA 4KKRA 4WUUD 3IFLL 1L7TL 4I48A 2DMGA 4JFEE 4XB7A 2KQMA 4F15C 1IU1A 5JHLA 4W9HC 2OK0L 1L6ZA 2JQAA 3AXLB 4M3JA 3WFHB 4MJIB 4CDHA 4CMHB 1UURA 3VFVA 3F04A 4NQXB 3T2OA 4FYSA 2X88A 3GHEL 5D1XC 4WFHD 5C09B 2HFGH 2IAAC 4A2DA 4KMTH 4N0UE 1JNHB 2OQJA 2HPTA 3IPFA 4WW2A 1UZ6F 4MJJA 5I17A 1OAXH 3DGGB 2VH5H 1H6TA 3GD1C 3IXTB 4H0GA 4HDIA 3EH4B 3UCQA 4LHUB 3WAKA 5GHWL 2PXYA 2M2DA 3P73B 4OQTH 2J6EA 2FJHB 5I0ZA 1TVHA 4OZHA 3O4LD 3QQ3A 2G9HA 4XODA 2YR3A 3APDA 3FUIA 3UGEA 5D7IE 1RULH 2VDQL 1UB6B 5T1DH 3VI3E 2AK1L 5CILL 4GAFB 4NJ9H 3F65A 3GSQB 3E6HB 3HLAA 4M7LT 5D72L 5F7MC 5GRWA 4FS0A 3RTQD 2E56A 3Q6FA 4P59H 1WD9A 1RD6A 1CFQB 3BWSA 1Q1JH 2BSBA 1VZIA 2H3NB 3FT1A 4U6VL 4XVJH 5DQJB 1USQA 4G7VL 4JO2L 2NY1C 4AXWA 4G9DB 4NB7A 1YMMA 3SDCD 3UC0L 2JELH 4Q56A 4BHUA 4KITB 3DO7A 3FBQA 4FE9A 3HLKA 2W9DL 5AZEH 3S2AA 3F05A 2J5WA 1KC5L 2F53D 4AGOA 4PUBH 5DD6B 3X12A 5DD5H 2DKMA 3ES6A 2WBWB 3G3LA 4L3AA 4QRAA 1B4JH 4JFED 2ZUSA 2VQ1B 5L4IA 5GZOA 4J6RL 1YNTB 1X5AA 4TNGA 3OKEB 5L2KA 4WEBH 4OUUA 2E7LC 1XXFC 1YEKH 3FTUA 4PTTB 2H0PA 3L45A 3O3DB 1MFVA 1L4IA 1B4LA 2P5WE 2ZKHL 1T4KA 3UPAA 5EOQL 1F97A 4NC2B 2VERN 3TTSA 2BO0A 5HYQB 3V8OA 4UQ3B 1JRHI 1TCRA 1EANA 3V0JA 4JRXB 4C56B 2G0LA 4D7PA 4DQOH 3UBXI 3G6JE 3HZYA 4N9OB 5F7LB 4F7TB 3NSDA 4O58H 1QTSA 2WSDA 1GYAA 2AJSH 2Z7UA 4WUKH 4D9LH 1GZPB 5GJTL 4ODUB 4LSTL 3DOSA 5E6ID 5E4EB 5GSVB 4KZEL 3VD3A 2NYYC 4FTVB 5IHUH 3NSCA 2EDJA 1PKQE 4Q9QH 4OVVA 4NP4H 1XTMA 5IJCC 2VIRA 1JK9B 5FYJL 5C6TH 2CJSA 3TXAA 2IBBA 4R96B 2AAVA 3PXJA 5I6MA 2IH1A 3KPTA 4NQSB 3Q8EA 2EDRA 4S1QL 4M4PA 4PJXA 4L8SA 2E7BA 3N44B 4MJ4A 3UDWA 4F15B 1G94A 4TULL 1ETA1 5KTEL 4EI6A 2YA2A 1HHJB 5EC2A 4JPWH 5AW7B 3ZKMD 5D4QA 4EIZC 3SQRA 5D1XB 4FABL 2IH3B 4P9HH 5LUMA 3HBZA 5B1JA 3FTGB 3LQAH 4PS3A 5T1LA 3WDHA 3QIBD 2XZAL 1M7XA 4QHLB 5HGBB 1RI8A 3RAJH 4FQ1H 4XRCA 3UH8A 1KIQA 5AWNH 3S35L 4XO9A 2DQEL 4XCEB 4G8GB 4EVNB 2P8LB 4NCC2 1DQDH 3BVNA 4F2ME 3DIDA 2WBJA 5JHDA 3NDZE 3RBGA 4GBXC 2YPVA 4APXA 1NJ9B 4BGDA 1WAPA 3FO9B 4UTBH 2P5WD 4OCNC 5C3TA 1ZSDB 3B6SA 1BQKA 4PD4K 2HCZX 1XGPA 2VXSH 1A6AB 3I50H 1JXKA 4KMLB 3P77A 3P40A 5D93C 3NCEB 1T0NB 4GLRH 4PGBA 2O6EA 2ZG2A 5F70A 4WTXA 4EI5C 3QCVH 3GO1L 4KO6A 1HQ4A 3TA3A 2CNZA 2NY1B 2GSGB 4N0YH 1PFOA 4FFVD 3L3OA 2ED9A 1W0VB 1OTUC 5EV7A 3ZE2B 5LQBL 4GW4A 2HTKC 2NNFA 1KJMB 5E7BA 3U6XS 4AUUA 4KAQL 5M94B 2EXYD 2HG5B 3EFFA 1PY9A 2ZSWB 3RY6A 5JW5A 1ORQB 2D9QB 2XTLA 2YLHA 3BAEL 2ZOOA 3ROOB 4QRQB 2OJZH 2VJ0A 1SY6L 5I1DB 1KB3A 1EIBA 5C0BB 4IGBC 2Y5TA 3BQUD 1HCZA 3QJHA 4YPGA 1DTUA 1AKJD 1RUAL 4X7TA 5FGBC 3U36A 2XUWA 4UQEA 5I1CL 2WLMA 1KLUA 3PJNA 4UM9A 3HG3A 3W56A 1MJ8L 4G6FD 3T1FA 3ZHNA 2BSTA 4CVXB 5FO9B 2C9RA 5EEWA 2R0WL 2VLKB 4XN2A 2ODHA 5DC2A 3TFKD 3U4BL 3GUFA 5MHSE 3JVGA 3CVBA 1YPZA 2C4FU 4RCAA 1FVEB 2P1YA 1G7HB 3LZFL 4LSSL 4G9FB 3G6DL 3QS2A 3TPUA 1I8IB 3C6SB 3LV3A 5T3XD 5HHNA 2CXKA 2EDEA 2MJWA 4ZS6D 1KJ3L 1D5IL 2H45A 4XP6L 1UWEL 2F0CA 2X87A 5CFHA 1G5GA 5HVFB 4GKSB 1A14H 1IAIH 2ZKMX 2GITA 3B2VL 3OKNA 5D4HA 5DVKA 4LARL 3AUWB 4FD0A 1XF3A 5DWUH 4ZFFA 4ZNEA 1JZ5A 1LEIB 3EJYC 3N42F 3IDUA 3PS6A 4AYSA 2XWRA 4K7PY 5LG1A 4XC3H 4OD3H 5DYFA 3EO1A 3RBSA 3CHRA 1W80A 1G9NL 3BH8B 3STZB 2PCPB 3HR5A 3OF6D 5BXFA 5BRZD 3GSWA 5G55A 4ZMLA 4OFYD 5IMKA 5AKSA 5CD3B 1IQDA 1R3LA 4FTDA 1U8KB 4AENB 3I3BA 4H8WH 1NUFA 5CU9A 3SJVE 4K9EL 1LE9A 4P07A 2BP0A 1UHVA 3T0AA 4JFFA 1O9VA 4NDMB 2FQEA 2ZOTA 2YK1L 4TNFA 1UWGH 5AOMA 2QQLL 4AEIH 2BY1A 3GUTA 2O5YL 2OFQA 3B8YA 4XMWA 3V8CA 3N43F 4QEGA 2B0SL 3K6OA 2ATAA 5AD0A 4PG9A 1FVCB 1XMEB 5DA4A 2NW3A 3ARDA 3RJOA 4JZJA 3LKOA 1F6FB 4GBXB 4H1LB 2VSKB 5INDB 1QSEB 2NDFA 3PXHA 5HI4D 5HGHB 5IFJA 3C60A 1BZDA 1GH7A 5D4JA 2CJTA 3CZNA 5A43C 1UT9A 1MJUH 5DJ0B 3Q2NA 2AANA 1AC6A 2PLTA 2EYRA 3W11D 5D93B 4KUZH 4PH8A 4U2YA 4F2FA 1LWHA 4MWFA 2CPUA 1I7TA 5F9DC 1PLCA 1H8OA 3MHZA 4EI5B 3U9UA 1GCYA 1ZDSA 4OCRL 4MMXC 4QHMA 1U95A 4MCYA 2MPAH 1NCOA 4BKLB 1HI6B 4PVLA 1U2CA 2IDSA 2A77L 5H2BB 1FNGA 1VB9A 2FT6A 2QSQA 2TSAA 4NFDA 4PJDA 2WY3B 3LZNA 1URIA 3OSKA 2AEPL 1P4LA 3BZ4B 1R46A 2BIIA 3SGEI 5EUOA 3L3HA 3RDTC 4AGLA 3N40P 4ALAH 2XG5B 1WAEA 3N55A 3D9AL 4DO4A 2NQDA 3L7EA 4NC1C 5DFAA 4B9FA 2C9VA 3A4AA 4PQXA 3MOAL 1C8PA 3MRHB 4GSDL 2QT6A 4NGHH 4UAOC 3RB7A 4IGBB 4GW1B 4J12A 5JPNA 1A1MB 1JIBA 4Q52A 2VL4A 2UWEB 1WFJA 1Z9NA 3FZUC 4LEBA 4Q0XL 5GISL 5TDOA 3BKYL 3GZPA 1U30A 4OFKA 3M86A 1XCWA 3FT4A 3SJVD 4R26L 3INOA 5D55A 5B4MD 5HYJE 3O6FC 4NUGH 5DD3H 4CADA 1WJ3A 2OULB 4PWKA 3ATFA 1QATA 3QUGA 2W0PA 3DBSA 5C3IA 3PGDB 2LVCA 1HZLA 1PLBA 1BOGA 3S36X 3C5ZC 3GXIA 3R06A 1E9QB 1PYWB 5AYUL 3S5LG 2X9WA 3IFNH 1SZNA 3DMMD 4OZHE 4M6OL 2MOVA 5B1BB 2WJ7A 5MERB 6FABH 1MW3A 3GXMA 3JWNC 4YHZH 1X7SA 4Q2ZA 1I75A 4A1RA 1FFPA 4JKPH 1TZGH 1JGVL 4ZS7L 5I28A 4OJAA 4PGCB 5LXGL 4NM8H 3TBVB 3JWOH 1P2CB 1LP9B 2IV9A 1BV8A 3DUSB 4LFHD 3QDJA 2IGFH 2BC4B 2AJZB 3ZTEA 2VDNL 1AGDB 2X2UA 1RJYB 2HMID 4Y2DA 4PR5B 1F6AB 2WLIA 3ARRA 4WENB 1E27B 3PIQB 4LGRB 4L48A 3OTTA 4FZ8H 1ADQH 3UTZA 1RZFL 2OZ4H 4PRID 4LKCB 4IBVA 2VM9A 3TT3H 3TBWB 4HUXA 2PW2B 4FHKA 4AKPA 4OTXH 3HBPA 5IMOA 5JXED 1BM7A 1NUGA 4QXUH 1OGAA 4BFIB 2GSIA 4TSBL 1T6BX 2OMVB 3FQWA 1M4KA 5TGBB 1AFVH 4M6NH 4G70B 2DM4A 3QORA 2HZHA 4HV8A 4WV1C 1NPJA 3WFBL 3DC0A 4N1EA 4X6DB 1HXYA 1X7QB 2E9GA 3ZDWA 4GUPB 5HYJD 1MFEL 5BMFL 1AMYA 1MAML 2LR4A 2AEWA 5K33A 2VN7A 1WA2X 2WOBA 1J5HA 3F7LA 4LRNL 3LIZH 3RIAF 1HYRC 3MLXH 4QAWA 2IDUA 2V2XA 5IK3B 2F5AL 4XX5A 4YZFE 1PCXA 2YARA 1UKSA 2JK5A 2Y22A 3GRWA 1X9LA 4MMXB 5CJOH 3CZGA 4X6BA 1HSBA 4N1HB 3SPVB 3T8XB 4ZW3A 2PXYD 1UB5B 4AIXA 3N0AA 5D7JD 1CF8L 1SXCA 1WAAE 3DARA 3HE7B 3R4DA 4V33A 5EU7E 3HNTH 4H8QA 4EO5A 2B4CH 4LQFH 4YDIH 2X53A 5KVDH 3WTYA 1OW0C 1NGZB 3RDTB 2W9EH 4IKNA 1WLHA 1KB9J 3VQ2C 3BUQA 3VFSA 2Y3AA 5ITFB 1IM3B 2AEQL 1UWFA 3V79C 2YUVA 4IU3B 3KW7A 4ELMB 5FOBA 2IPKB 2Z64C 4WWKC 4OVUA 4F7MB 1S9VB 4UAOB 5HI5D 5CJQL 4I77L 3ME0B 1U8HA 2EDLA 3RHWF 1RU9H 4YE4L 1PD6A 5JZ7D 3EBAA 3MLZL 1C12B 3WHE1 3NK3A 4DKEH 3K2UL 2MQCA 2W81C 3O6FB 2FBJL 1D5XA 5AYTA 4A55A 5C7XL 4W93A 3L8QA 4D2NA 4XPAH 2APSA 1NCDH 3LCYA 4MA3A 5B3SB 4JX0A 4PEEA 3C5ZB 5FYLH 1F6LL 2IALA 4ZOCA 1WD8A 1WWAX 4ZDHA 3EHBD 3EO9H 3L5WA 4RESB 4DO6A 3NCMA 3IDGA 4GRLC 4QTHA 3HVNA 3WLWD 4YSCA 2XRAH 2H6OA 4H1LG 1KIPA 1KYOJ 4RFEA 4XMLH 2R4SH 1AQKL 3QW9A 4BGLA 4YGVA 5TJWK 1QSFE 4GB9A 5I8OH 2CAKA 4FXLA 4W81A 5AUMA 1JXDA 5LKNA 3FN0L 1JMXA 1AI1H 3O3EB 5D5MB 4M48L 4I48B 1DBMH 1BD2A 3UDWC 3IMTA 4JG1H 3QG6B 1ACCA 3G5ZA 3MLUL 5T3XL 3L08A 4LKXA 3VFVB 3Q1SL 2W60B 1T7XA 3E2HC 3L4YA 3F7QA 4M7ZC 5D7KE 1RLWA 2X89A 4PW9A 1QKZH 1A6UH 3OVUB 2OQJB 3UTOA 5F1OB 1TMCB 1SXNA 2VDLH 5I17B 1AQDA 1WZ1H 3QO1B 1RQ5A 3LQMA 4FFTA 3J27A 4DEWA 3TA4D 1W6WA 2ADJA 4Q6IA 3WCYA 1TVHB 1NFDF 4OZHB 3WNOA 2QGBA 3D4YA 2XI9A 1YECH 3F58L 4WV1B 3QWRD 4YWGH 4OUOA 2B15A 5HGDB 4JHAL 2DWDA 2DIBA 2C7UA 4F27A 3ZKND 4OLZH 4DGVL 4BH8A 1JWSA 2NCEA 1MVYA 4L3CA 1FNFA 3HLAB 4YSEA 4KNTA 3D2UA 1ZS8A 4BRVA 1EHAA 5FW6A 3HI1A 3FU7B 4JO4H 3VFGL 1XH3B 5T1LD 3QCUL 1YPZE 1Q72H 3CZEA 4P5SA 1D5ZB 4LNRB 1PL3A 1MIEH 2FWLB 4U1MA 3CMOL 1OL0A 3KM1A 3CVHH 4EBQH 3MBWA 1WIUA 1CDIA 1DQKA 1YMMB 4DW2H 1BP3B 3N1MC 4XAWH 4EPSA 2A6KA 3HJEA 3DO7B 3UTSA 5DRWB 5DVMA 2R69H 3LPOA 4G80B 2IBGA 3VXPA 3FUKA 4NPYA 3W39A 4XN1A 5EN3A 2VKWA 5DUPH 3MRDA 3X12B 3RY6C 1OANA 1QSFD 4ZNEE 4RFOH 4JGNA 3NIGE 3VDAA 4GOSA 1FH5H 3AM8C 3DX1A 2FO4B 4HG4K 4XP1H 3LVEA 1F2QA 1RUQL 1T83A 2QPDB 3LX9A 3D0LB 3EYFB 1MLBA 1HK6A 4XN5A 5L2KB 2E9JA 4OUUB 5DJ2A 4HGMA 5EEZA 1ZVSA 1XQ4A 2D3LA 4NO5B 3ZZLA 4JM4L 5CU5A 1HHHA 4IMLA 5FW7A 4YSQA 4PPTA 3U9WA 3H54A 4YJZL 3W81A 1HXKA 2BSDA 3H2QA 1TCRB 5HYFA 4AE0A 3FU0A 4W9FC 3GIZL 3GSVA 5SWQA 2ZTBA 1E7UA 5ADOH 4JFFE 1GL4B 1SDDB 1VZHA 3HZYB 2V2WB 3REVA 5DF0A 3K80A 3UTTA 5EB9A 1MCKA 1BIHA 2KHAA 4A7TA 2E27L 1E9OB 2CBPA 1KPRB 1KFAH 4GRLB 5C6PB 3Q6GL 1MRCH 4QRRA 1BEYL 3BJLA 2C9SA 2H6PA 4FCAA 3NIDF 2DQHH 3BPCA 1TQUA 1UZ8A 2YAQA 3MU3A 3PF2A 4LESA 4QOKB 4QRFA 5B1AB 5SWSA 5BV7L 2QQKH 3O6KL 4LU5L 3C9NA 2MCPH 2KPNA 2IH1B 4NI6A 1J5CA 1MCCA 2F5BH 4PJXB 1AD9A 3DIFA 4BZYA 2CBOA 4TQHA 2WV3A 2ZAHA 3UP6A 3ILQC 5CWSB 4EI6B 2OK0H 3MJGX 3RVXD 2FEDD 2OI9C 3A22A 4UOZA 1NFDE 4JKWA 2WKGA 2DQFA 4KNQA 5AVSB 3CHPA 5BZXA 3HNVH 3O2VL 5C0JB 1KGJA 1MWAB 3E2HB 4PJDE 2UZYA 4GINA 1JF5A 4M7ZB 3P2TA 2OXGA 2EAEA 3VTTA 1K6QL 3BD4A 4L5FE 4MMZA 5EUOE 2VCOA 4NIYE 4XRCB 3T3MB 2E59A 1N68A 1OSZA 1KIQB 5HGAA 3P9LB 1JSYA 2WLZA 3BQVA 4ZFOA 3IVKA 1LNUA 3KYOB 3NSJA 4KKZA 1WZAA 5JHDB 2WQUA 3UXFA 4APXB 2VDQH 4FP8L 3A3YB 2VW6A 1COBA 5L8KB 4PP1C 1UA6H 3C60C 3UGXA 2X0UA 4ES9A 4M5ZL 2QLYA 1XGPB 3VX1A 3JTSB 1OB1A 1MZYA 2IVFC 4TTDD 4PGBB 3IE4A 5CSZA 2C9QA 2Z91A 4DN4L 2CUMA 2V17L 1F13A 2APVA 1VGKB 4LFHG 1HQ4B 5LBSA 2YMTA 3FT2A 3QZNA 2E46A 4OAWA 3WSQL 3MLWL 2QPUA 3L3OB 2Y7QA 4Z0XA 5SX4I 3ARDD 1JVLA 1AXTH 2DQGH 3ZYIA 1U8LA 4FFZA 4GW4B 4JY4A 2W9DH 4M61B 1VAHA 4XBGB 3LKSA 3BAXA 4RGMC 1A7OH 3KM2A 4ZQKB 1PGRB 3D39D 4MYWB 1H3PH 4AJVA 1J8HA 4NZRL 2EXTA 3WE6B 2CWRA 4PREA 4WI9A 3HC4L 3PNWB 2ADGA 3IMWA 1E4KA 1X6LA 2D4DA 1S7SB 1CTOA 3U36B 1NDMB 2B1AL 3QDJE 5CZVL 1OP4A 4Z7OB 1JZ3A 4UM9B 3RGVD 2BSTB 4PV8B 3GPSA 3LKPA 5D1QC 1GGBL 4PYHA 4ZTOL 3W0WD 2JCWA 4OCLC 4PJIF 1NCIA 3LEVL 3P0VH 4JFDA 2FWOB 4IKIA 4P4RB 3SKNB 1G4MA 3TPUB 3LPFA 2E6PA 3LV3B 4XBMA 4OLEA 3W38A 4X4KA 1OGAE 3OPUA 3BLBA 1OAYH 1EO8L 3OJVC 2A7BA 3G08B 4LSTH 1N2RA 2GITB 3AREC 1BFOB 4PJ8C 5IJKA 1CDHA 1EDYA 4ZFFB 1FAKT 2KS0A 1D5RA 2RA1A 3HRPA 4KVCL 1VIWA 5IEHA 1N0LA 5C0IA 5GS1C 4ZTPH 1MFAL 4NN5C 3AITA 4X5QA 3IFPA 4HWUA 1XF1A 2IV8A 2WTPA 3EO1B 3MYJB 4PWGA 4D0BA 1N6QL 2JCCA 5DUBB 1FGNL 2JVUA 3Q2VA 3CCHA 4H8VA 1KG0A 3HR5B 1GGYA 4GQPH 1U8MA 5CJ5A 3M7FB 4TULH 2VLRA 4UYPA 4QRPA 5KTEH 3WKML 2OI9B 3DURB 3PL6C 3I6KB 3QUXA 1HVXA 3F7VA 5IMMA 4FABH 2DOCA 1TUPA 4K94H 1UCTA 3KGTA 1S8DB 3L95A 4A6YA 4HLEA 4KKPA 2A4CA 3GUTB 1KBGL 3I9GH 4U1IA 2ZNXA 4J1UA 5HVHC 2O5XL 4UAHA 5F2FA 4IRZA 1L9MA 1C08B 1DQJB 3BKML 3H3PH 3D8MA 1SEQH 3F6IA 3IBOA 1ZT1A 2NW3B 3QDJD 3QORC 2ICCA 1W72B 5JO5A 2ENQA 4M1DL 5DRNB 4UOQA 4JFTA 3TJHC 3V6BR 1JZ6A 3PHSA 4Y2DD 2NR6A 1PEWA 2O6DA 5IFJB 3C60B 5K9KB 4XN9A 4W9LC 4YK4C 2LGNA 3RI5K 3GTNA 5HHXH 5I19L 2ZJSH 1QZNA 1A25A 4EIGB 4BK8A 4YHOH 5B1KA 4JQIH 3NH7L 4MWFB 1GZQA 1TPXC 2R83A 3KVDD 5JMOC 3RIAK 2OCCB 2BDNL 1BLIA 1NBZA 1U95B 3BUYA 4WNSA 1R47A 2ERJC 3CDYA 1FNGB 4NFCA 4PJDB 1X4ZA 1N19A 2UXVA 4GIPD 2HJKA 3FOLA 4H2CA 1PCSA 4J3UA 5DK3A 5DLML 3HZMB 1T4WA 2GIYA 1CR9H 2XIIA 1SJEA 1INQA 4RGMB 3L3HB 2ZCKH 4KAQH 3H53A 2RMNA 4ZUUA 2BSEA 4PB9H 2BWDA 4K3JL 4J5VA 3MXVL 4XNYH 2X2HA 2OL3L 4KKBD 1OEZW 1SY6H 7PCYA 4HZLB 4FL4C 1FL3B 5HY9A 2R0ZL 2G3XA 1TQWA 1RUAH 3TJEL 5TDOB 1YEHL 1A7BA 5DXWA 5I1CH 1BD2E 1KEMH 3AU1A 1FGVL 3AJ7A 4N2BA 3FT4B 3NCYP 5D1QB 1YJDH 1SOQA 5D2LA 1R9FA 4JE4B 1N64H 1YUHB 2W94A 4O2EB 4LSSH 1E50A 2VXVH 4JQXA 1RUKL 4HIXL 4PJEF 3V10A 4U33A 3WEMA 3R06B 4XP6H 4MB3A 1UWEH 3EDJA 1MLCB 4AIZB 1B0GA 3VVVA 3BC9A 4K7FA 5CIPA 5E8OA 3PDOA 3QR1A 3AREB 4PJ8B 4ODXA 4NQVB 4ATWA 4N8PA 4IW4C 5J13C 2WQSA 4LARH 4IBWA 5DVLA 1JMZA 1FFPB 2IXQA 1MNUL 2AMUA 3BP5A 5GS1B 3MJ6A 3OX8A 4L4TE 5B8CA 4NN5B 5AVUB 4BCYA 4JVUA 1G9NH 5KSBA 4WTZA 5KSAA 2KC0A 2HA1A 3DWTA 1HWHB 5CEZD 1I1YA 3PUCA 4N0CD 2YC1A 3UAEA 4HC1A 3ASWA 3FTSA 3UYPB 2A6IB 1OTTC 1KN2L 4HIIB 3PL6B 4RDQF 1M2VB 2CBQA 5IUCA 1I53A 5DURD 2VKXA 4GQQA 4HUXB 3UTSE 3E7JA 3TOPA 4PJBA 3GEWB 4KXZH 5ISZA 1M1XA 4YBHA 1LE5B 2YK1H 1EJ8A 3PCYA 1JPSL 2D73A 3L7FA 5CP3H 3O6LL 5HVHB 3KYKL 2O5YH 1A22B 1XAKA 2P8PB 2GSIB 5H94A 5T3ZE 1MREL 5J9PA 1EA9C 1OB0A 1J86A 1XF4A 3QORB 5AAMC 4NCC1 2XN2A 1A1OA 1JK8A 1BD2D 4IKJA 4FQXC 2QSCL 5BZDA 5B38A 1HXYB 1KEGL 1NOFA 1MRFL 3VXRB 4GYBA 4HOWA 2R1XA 1HEZB 2JKLA 1NANH 1YNTF 1MRDL 4YK4B 3HC2A 3LRMA 3VWKA 3GT6A 2R0KH 1KGIA 3S5ZA 2V2XB 2X89D 4ZJ9A 3QC5X 2JJWA 2ROXA 4Z7NE 1TPXB 1P9MA 4JJ5A 1DZBA 3GNMH 2F19H 1J9CT 5DJCB 1PG7W 2A9DA 2ERJB 1SN0A 4ONHA 3QPQC 3UTTE 2EACA 5DHYA 1GOHA 2WXMA 3T3PB 1WH0A 3EH1A 2OM5A 4JUSA 2HT3D 4KX7A 4OGYL 4KKQA 4QRRE 4L4TD 4GMTL 5T5FA 4GUQA 1VKXB 3PQYB 4PY8J 5SWSE 4N8UA 3NSYA 4ZQTA 5DK0B 2VSDA 4PJFA 4JY5H 2ARWA 4FL4B 2N56A 4O5LL 1A2YB 4HLZG 4Z9KB 1CWVA 1X5IA 1DVFD 3DVNB 4IK7A 3SHSA 1AR1D 4PW3A 4PJEE 3BKYH 4NO2A 4X9HA 1CLOH 4K9JA 2DWSA 4YSTA 3BP6A 3N44F 3ZU8A 5E5LA 5KJ4A 3UTSD 2AJYH 2MNWA 4I0PC 1D5XB 4NRZB 3LN4A 4P2RD 5AAWC 2BWIA 4XNMA 2G5UA 1SXZA 3DX3A 3DPBA 3QSKB 2CR3A 3QJFA 3WI9A 3V5HA 1SVCP 2YBRA 5CXPA 2DWXA 5C0EB 2DQUH 1WTGT 3G5VA 3QA3B 3QFDA 5IBLC 1FUNA 1MHHB 2J8UA 3RYMA 1IEBB 4YNYB 4U6YA 3QZPA 3PV7A 1UKQA 2FH6A 1WIOA 3L5WB 3GSRA 3IDGB 4QTHB 3ARFC 3EFDL 3FQ4A 5J13B 3VFRB 4W6YB 1KUMA 3D4ZA 5E2WL 3T77B 5JOFA 2PNDA 2J73A 2BNQA 4YGVB 3FQRB 3Q8BA 2EDQA 1FZMB 4P23C 1PTZA 4L5FL 2A9AA 1CURA 5I8CA 1F4AA 5C7ZA 4WI6A 2K0RA 2K9FB 4G42A 1U3NA 3G5ZB 3TVMA 3UTTD 4LKXB 5FO2A 3QIWC 2EXWD 3D25A 1VERA 1THAA 2VDRB 3QDMB 2CDEB 2YGQA 5A3IC 1RIVH 3KLQA 4X7FC 3TZVA 5IY5B 1PG7L 5IB2B 1QSVA 2CO2A 5HDBB 3NZ8A 4YHLL 1TYEB 3V2AR 5LCVA 1WV7T 3VSTA 2BXZA 1WZMA 1RKRA 4KY2A 4MMZC 3ZE2F 5E2UL 1VEMA 1J8HE 4HS6A 2L7EA 3D05A 4B97A 5DQDL 4EZJA 1IVLA 5I8KL 4ISVA 3SGDI 3VAEA 2CE6A 2ZWNA 5DZPA 5SWZB 2NW2B 4FQXB 4FGMA 4L3CB 3UZEA 4X4MA 4Z0BL 4YXKH 3OMIB 3D2UB 1ZS8B 4R2GC 5B3NA 2JQZA 3HI1B 1JZFA 1G7MB 3BDYH 3MC0A 3B2XA 5F88A 1MFNA 3VFNA 4FQLL 1CLCA 3OGCA 3V9CA 3RZCD 5I5MA 2ED8A 1C5BL 2D31B 4JFDE 4U1MB 3P4MB 4MDRA 4AX3A 2KQNA 3HN8A 4PRHB 1ZLVK 3U1PA 3S6CA 1U41A 1NAMB 1RPUA 3IU3A 3UCRA 2B39A 1WIPA 5BJTB 1CK0L 4NPYB 4OGXL 4AW7A 2UUDK 3LQZA 3MRDB 2VDOB 1E65A 5AVVB 2MCG1 3OXSB 1IC7L 4D0DA 2OJEA 3MAWA 2GEEA 5J5EA 2WXPA 1YY9C 3ZE0F 2QFRA 5F7NC 2AQ1A 1UD5A 2JCCE 1I1FB 1L3WA 4MA1C 4YSDA 2EEDA 2MIZA 2FLMA 3CH8A 2ENPA 2FE0A 3MA9H 2WM0A 3SBPA 2GHZA 2HT2D 5KSUA 1AP2B 3C09C 3SPGA 4MNGA 1A6TA 2IPTL 2VLRE 1JHTA 1T66C 4QRPE 2QHRL 5DZVA 3B3IA 3L17A 4WI5A 1SFHA 4OGAC 5C7XH 2ZX8A 4QT5A 4H1LH 1V3LA 1J8HD 2OCJA 3GSVB 2GT9A 1NAKH 2I69A 2J56A 3I02A 4M1GH 4PJ7A 4YZWA 5HVWA 4QWWD 1WA1X 4G7SB 2B2XH 2NXYC 1KTBA 4MAUL 1I3VA 4MQ7A 1ID2A 3MRJB 4HOMA 3GK8L 5IJKC 3ARFB 3RWCA 5E03A 2H6PB 4DSYA 1AACA 3IFOA 5DRXB 4XXCC 3S37L 5IVXF 1KJVA 3C9NB 1AQKH 4YDMA 2FYYA 4OF3A 4P23B 4LSVL 5K1JA 3FCGA 4JFDD 3DIFB 4JANA 5I23A 4RBPH 4M48H 3VYPA 1AJ7H 1BBDH 3R8BB 3DNKA 1S7UB 3HVDA 1IEAB 2A83A 4GMSH 1QBML 2R29H 4Z5RA 3V4LA 3T2PA 3QIWB 4HQQL 2FWUA 3P3UA 3Q1SH 4PVNA 4PJ9D 3QUXC 4CMMA 2UX6A 1Q9OA 4U3HA 5KVEE 1CXEA 3RNKB 4CN1A 3CLFH 4QNPE 1KBVA 3MKKA 4ETYA 1CD9B 1EDQA 2OXGB 2ZPKL 2DMHA 2X2JA 4PLJC 3S3CB 1DSWA 5KYWA 1QLEL 4MMZB 4JVWA 3BGMA 3WMQA 5DMIL 1PKOA 5HGAB 5CSBA 5HBBA 5TQ0H 4K3HA 5KSVA 1QSZA 4BDVA 1SFDA 1PLGL 1OHQA 1UG9A 1ZHNA 4NUJA 5HD8D 1NFIA 4CU8A 4OF6A 4L3EA 5CEZL 2VLRD 1VFMA 4QRPD 1U0QA 3RVUC 4DGVH 2UWEF 2A1WL 3RFRA 1HH9A 1OB1B 2VDKB 3E1ZA 4H44C 4JQVA 4R2GB 4UT9L 3VXSA 4LDOB 5BS0E 1IB5A 3GSUB 5D2LE 2VERA 1LO3L 3H9YA 4WI4A 4YSRA 2H2SC 2MNUA 3WNKA 2JKRM 3R0NA 1YZZA 2BERA 3FT2B 2Z34A 3GFUA 1PZAA 4OZIF 4KUCF 1G0DA 4JZNB 4G6KH 4YXLL 4PTUA 4U4BA 3B83A 3EOYG 1AYRA 1U8LB 1DQIA 1GA2A 4PRBB 1CLVA 1IGTB 2NR6D 5J1SC 3M1BB 4FLQA 1ZV2A 3QHFL 3T08A 1TT6A 5EO0A 3W57A 3TBSA 4LLUA 3MGOB 2CDFA 4PREB 3ARGC 1Q0XL 2C9AA 1OSPL 4HCFA 1K2DA 2XZCL 3K91A 4WHDA 1YY8B 3ZHFA 2SEBA 2F08A 4CC4C 2PTTB 4TNEA 1LP9F 4MA1B 3S3PA 4PMEA 4Z7IA 5TFSL 3CFEB 1PJ9A 1XR8B 3C09B 4J8RA 5JUEH 2J55A 3LKPB 3GZOA 4AEHL 3MLPA 4ETQB 2WUBL 5J1TC 5EF1A 5FFOA 1JZEA 3OZKA 2AQNA 5TE4H 5HSFA 3TN0C 4PCSA 5TE7H 4MS8C 2NNAB 2X05A 4A7SA 1SLXA 5IVXE 4HKXB 3MCYA 4PJBE 2XN9A 4NZTH 3BCDA 5JW3H 1EVTC 5ISZE 4FJYA 3N5AA 3A4EA 4LCUA 2VLKD 4JFUA 3CXDH 4R97C 4WK0B 2RJMA 5GGVH 2NXYB 4W9EC 2GTWB 4UILL 1KBPA 1N2RB 4PHXA 5G4NA 3U0WH 2B1HH 2R15A 5KS9A 3EG9B 1F3RB 1V05A 1WFIA 1GZHA 4MVBD 2UXGA 5C0IB 5BS0D 5BV7H 4XNDA 2DL9A 2PYFB 1E8YA 5B8CC 1MIML 3O6KH 3IFPB 4LU5H 3PFUA 1REIA 3MV11 3UJJL 3Q48A 5IB1A 4PRPB 4BK4A 4GW5B 1M6OA 2NYYD 4FI7A 4TPRH 1AXSA 1U8MB 1ZT7A 2I9LA 1A9BB 4AIEA 1RZKL 4LPXA 5DRZA 3CXFA 3U7WL 3K0WA 4IOSD 2FSDA 1QG3A 3WJLC 3QUXB 3CAFA 4O2FA 4FFYL 2WN2A 4KFZC 4NNPL 4Y9GA 2BY2A 3O2VH 5C2BH 3BFQG 2B9BA 1U91A 1TITA 4FKKA 4IJTA 4KI1A 2QADD 2J7LA 4K5MA 4JKMA 4J1UB 4U1IB 1JXGA 1CYGA 1MJJB 1T1WA 1TU2A 5DVOA 4DN3L 3FUJA 4X6CA 2GUOB 5KSAD 3EOTL 1AZUA 1ZT1B 4QHKJ 3KHQA 4Z7QB 1C1EL 2CA3A 3KPQA 2H3KA 4FP8H 5HVGB 3MLTA 2FL5A 1I1RA 4JGJA 4F7CB 1JGIA 4OZIE 2C3GA 2CO7A 2CKBA 4IKLA 1ZWIA 3BD3A 4LAQH 5F21B 3AXIA 1VADA 3W1ZA 3SBQA 3HHRB 1WSST 4W9GC 2A74A 5ISZD 4DN4H 4HK3N 3POCA 1OOAA 3T6QC 5C1MB 3CQFA 3AAZA 3IGAA 3BUYB 3V6FA 1JZDC 3T2LA 9PCYA 3WSQH 3MLWH 1NOLA 1S5HB 3O3AB 4OLXH 4RIRA 4OI7A 3E6FA 2PW1A 1HESA 4ZG1A 2JJTC 3WYRA 3BSHA 4LP8A 3ENEA 4EI5D 5JHLH 2PP7A 3MCLL 3S4SB 2D7TL 5FYKE 3ILDA 3LXCA 4NZRH 5DSCA 5F3BA 4PJCA 2QGDA 3VWKD 5DDHA 1I85C 3ARGB 3AWEA 4B6ZA 5K59F 3ARVA 3KPRA 4WDIA 2NQ3A 3TBCA 1O6SB 5C08B 1TQCC 1O7DE 1CE6A 3WXVH 5C0ND 5EUKA 2B1AH 4BINA 2ZP9A 3AU1B 5E8NA 1RUML 5ADPL 5T3ZD 3PABB 2NY7L 5D5MF 4CVWA 5GSRA 2W0FA 1NEZB 3SDAA 5B7MA 5IEKA 4NO0D 5EOTA 1RUPL 2J6EH 4ZFOL 1GGBH 2GTZA 4ZTOH 3VI4F 3EYUL 1I9IL 1QAWA 3TN0B 1EHKB 1PZUB 4L8CA 4KQ0A 2FIRT 1JGEB 1Z9OA 3LEVH 4UT6A 2NYZA 1OP3K 4G8FA 3B5TA 1A6VL 5IG7A 4XP4L 4C4BA 1CLZL 3C8HA 4H7VA 3W82A 3T1WA 5DJYA 3IMUA 4R97B 1VGEL 4HGWA 4C58B 3HB3D 1B0GB 2K45A 4K7FB 1NH6A 2WLJA 3IJ9A 4ODHL 1D2OA 1OT4A 3KGRA 4ODXB 1E2ZA 4KY1H 2X6MA 1THCA 2IXQB 1TZHA 3BP5B 3TNMB 2K7PA 3HG1E 1GYUA 3F5WA 4G43B 5B8CB 5DEFB 1FLTX 1GGCH 1MFAH 2GUYA 4X4ME 1DBAH 1XIWC 5T5NG 4HT1L 1KTLA 4N2OA 1Y6NR 5KG9A 2V7HB 1RAMA 4FFZL 3TNNA 2OYKA 4OJFL 1VJSA 4A7UA 1UOLA 5CGYD 4IRJA 3SDDA 4I2XA 1N6QH 2MTPA 4F37K 4KROB 3WFEL 2YC1B 3TVMC 4AJ0A 5HHVH 1EX0A 4ANVA 4LOUC 2Z8RA 3V9EA 3WKMH 3K6SB 1DBBL 1U58A 4FXKC 2VMCA 5HHPA 4LLVA 4NI3A 4P0DA 5D7SH 1MFUA 1T03L 4OIIL 4F58H 3CFCL 3MRCB 5KS9E 1FCGA 1BFVH 1M1XB 5EZJA 3PWPE 4W6XB 3O11A 1MCPL 1KBGH 1IGIH 3OGOE 3BKMH 5J9PB 2WSPA 3U4EA 5L2JB 3N85L 4MB5A 1I7UB 4XI5D 5DEGA 3WIHH 5FCUL 1JK8B 1DE4A 5IFHL 4ZUWA 5JQ6L 4QHPA 4FQCL 4M1DH 4N0FA 1OZTG 2R1YA 1GTNA 3CC5A 3RWIA 4FQHA 4PJGB 3U1QA 2R1XB 2VDPL 3OZLA 3QAZC 4FG2A 4OFQA 4Y2OA 2OYMA 5I19H 4MNGE 4CW1B 3TZVD 1I8KA 2D8KA 1BVKA 3C6LA 1H3WM 3NYKA 3QI9C 3ISYA</