3V10A

Crystal structure of the collagen binding domain of erysipelothrix rhusiopathiae surface protein rspb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
318
structure length
310
Chain Sequence
AKDYTNEAIFTQFDVNPKGLINNPSQPIEFNLAFSDMNNGQKVKFKPGDFFDLTLPSNDEVSLRSLRAMGSKMPVLAKKEITLGELTFNGSHIHFEFMEDVLQLENVTGTINLKSVYDNAYRGEDDKIAELPTNLGLGSLDKQMITISQPGTPTSPIFYWKTGTFSTEVHGDMNWWLNINSPKEAVQSDVKVIDTIGEGHKLVDGSIMVDVEANGELKHISAEAFNKEYGTITVEGQVLTVMIPKEKAAKTTFTVTYDTRAFDKKLENYKNSSTIEYKDESGNLVTDTPKHYTDTSVVNMFDDATIGGEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Collagen adhesin-nanoparticle interaction impairs adhesin's ligand binding mechanism
pubmed doi rcsb
source organism Erysipelothrix rhusiopathiae
molecule tags Cell adhesion
molecule keywords Rhusiopathiae surface protein B
total genus 67
structure length 310
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v10A01
2WOYA 2X9YA 2X9XA 4IGBD 1AMXA 3ASWA 4HSQA 3HTLX 3IS1X 4MBRA 5CF3A 3AU0A 4UZGA 5CFAA 3RKPA 4F24A 4IGBB 4LEBA 3IRPX 3QDHA 2WQSA 4JE0A 2X9ZA 4B5ZA 4F1ZA 4OFQA 2XTLA 1R19A 2YLHA 4B60A 2Y7LA 4IGBC 5DZ9A 4P0DA 3OPUA 4Z23A 2F68X 3QE5A 2Y7NA 4LEEA 2WZAA 2Y1VA 2F6AA 2X9WA 3RPKA 1R17A 4LE8A 2OKMA 4JDZA 2Y7OA 5IHWA 3PG2A 4F27A 3UXFA 3HR6A 2Y7MA 3KPTA 4JDZB 4IGBA 3AT0A 2RALA 3IS0X 3IRZA 4F20A 2Z1PA 5DZAA 3V10A 4Z1PA 2VR3A 4MBOA 1N67A 3PF2A
chains in the Genus database with same CATH superfamily
4JN2A 4OD2A 5INCB 2VXTL 3IAQA 3ZDYB 3SBWC 1MW0A 3GKWH 2OXHB 2RR3A 2P5EB 4JB9L 2G2PA 5I1JH 3QQ9C 5T3XH 4KV5E 3BPLC 5BNXD 3GKZA 3E80A 3QE5A 1NCHA 4EUPB 4JO8A 4EQ3A 2GIYA 3K5SA 2EC9U 4HAKA 2V5YA 1SOSA 1M71A 5IB1B 3CV5A 3MRMA 5TH2B 2A6JB 3HI1A 4JCWA 3RWDB 3VFUA 5TE6L 5F6HJ 2ZTBA 5TTRA 3GNML 3MHZA 3VXQB 1NIFA 2V5MA 5CILL 4X5PA 3B2VL 3RWDA 3VFUB 3RIAF 3MLWH 3V7MA 3RVTD 2EDJA 5DJYB 4HJGB 5E2TH 5J9PA 4HFUH 1S78D 1Y0LA 2IGFL 1I1YA 2JQAA 5KYYB 1XH1A 4PEEA 2V0AA 3HKZA 1UZ8B 3VFWB 3B9KD 1QHQA 3F12A 4ZXBD 3WMSA 4C83B 2GTQA 5J0BA 4KQ3L 3ESVF 4RA3A 1J10A 3EBHA 2ZWZA 2OL3A 4HXBL 4MZ3A 3CE1A 1DANU 1RQ5A 5JLZA 4G9FD 1Q38A 5EIIB 2OCJA 5B3NA 3FTZA 4BV1A 4NQUA 3RDTC 4JZNA 2O6FA 5DS2A 3WNPA 4M8QA 4XWOC 4AGQA 1PEWA 3QUYA 2V7HA 4HWNA 3OQRA 3K6DA 3P02A 3SKJL 3H9SE 4GG6E 1EERB 1XGRB 2NYKA 3OJDA 1BFSA 4I0CC 4KJYA 2H8PA 3MBEA 3MYZA 4WNSA 3B43A 1XAUA 2Y2YA 2ZCZA 1P5UA 3V0DA 3MRPA 4NHCL 3FTGB 2QVKA 1MVUB 3BN9D 3GEWB 1X4YA 1AXTH 3KJ4C 4M7ZB 5K9OA 1VACB 4M62H 4IK7A 1DUZA 4HKJA 2QKIC 2WM0A 2WINB 1M3JA 3T6VA 4GG6A 2X2YA 4GKLA 1KJ2A 5DI8A 3SBRA 5CN1A 3BXNA 3CFBA 4Y9FA 5B3JE 1DBJH 4ZUUA 1P6AB 3K46A 3T3PF 5DDHA 3V6ZA 2JE8A 3FKUS 4WUUA 3VFVB 1JHKH 2LFGA 4XNUL 2MPAH 1B6DA 2XYCA 4RVBA 1IL1A 3K2UH 1SXZA 1F3DH 4JJOA 4L5FE 5I8KL 2R51A 3QP3A 1XZ0B 1Z9SB 3LKNB 2VSDA 5IFHH 4A2DA 1SXAA 2HX8A 1ZVYA 4JLRB 4HU2A 5E1AB 3TF4A 4MA7L 5CXPA 1ORSB 1DQJA 4KQ4L 3QEGH 3A4EA 4NO2B 1LEKA 3ZKMC 5BS0B 1WE5A 5F44A 3MREB 1NA8A 4LLDA 5FW7A 2J8HA 3MRFB 2P45B 4GAGL 1FFOB 4WJ5B 3ZO0A 5IBTH 3P4LA 4KZDH 1F4XH 2FE0A 5EZLB 3VB9A 4N2MA 3L3IA 4MTMA 2W9DH 5H94B 4ZFZB 5E0FA 1FLTX 4Y5XC 5L6YL 3ML9A 3RY5A 3QO0B 3BE1H 2VDNL 3MODH 4G43A 4I77L 1DANT 1DJZA 1YNKH 4HUKB 2KKQA 2WTOA 4O2EB 4XMKH 3MOBH 4AZUA 3BDYL 4M5YH 2EDFA 3UABA 2WY3B 3MFGB 3QI9D 2J8OA 5SX5K 4L4TD 2CIIA 1CT8B 5HJ3A 2OYMA 3RVWC 1QNIA 3SGKC 4OCSH 1KENL 2HJKB 3TWYA 2VSKB 2IPTH 5LXGL 5T3XE 3SEPA 4EBQL 4A6YH 1QBLH 3FQ1A 2CDFB 3O2WL 2QGEA 4RWHA 3QARA 3LZLA 2GBAA 4OZFG 3OHXB 1OQXA 2D7QA 1PJ9A 5H4YA 2QFRA 5D7JB 3ULVF 2R8SL 1WQVT 1SVZA 2ITDA 3OR6B 3LV3A 4NKIL 1G9EA 4LDCA 2VITA 4TOYL 3A6CL 2AJXH 2YXFA 4A7GF 4DERA 4KVCH 5EOCL 2G2NA 4KXZH 3IDGB 2XVLA 5L4IA 3FSAA 4AJ0A 1ZLVH 3ZYZA 4PGZA 3LPFA 3WS3B 1ZANH 1EVTC 3KJ6H 2IADB 4PS7A 5FGCE 5HY9B 2Z93A 1QLFB 1SQ2N 2P8PB 2YR3A 4NKMB 4BFBD 1IQWL 4HQQH 1SBSH 2QR0B 5L2JB 4QYOB 3DJ9A 4NPKA 3F3HA 1KCBA 3BFOA 4OLUH 1EFQA 3PABA 3B3IB 4FMKA 2WWOA 2JQZA 4KNQA 2DN7A 2JXMB 1NCGA 4Z7OE 2KZWA 4UV7H 1Z3RA 2UWEE 1LWJA 4RGOL 3D39E 4WUUE 4YPGA 3JZYA 5GGUA 1EXUB 4YSTA 5DWUH 1AS6A 5FM4A 3K1KC 4PIRF 4AYID 5C07D 3RTQD 4S1QL 1J1PH 3X1NA 2ARWA 3FUJA 3I6SA 3QHTC 3AWFA 4N85A 1L4IA 4Y8DC 1YEGL 1MCQA 1D9KD 3US1A 2IDFA 2WSDA 5E2WL 4XAWH 2XG5B 3FUIA 1CE1H 4JRXD 2KLSA 3WHXB 2OS7A 3B7RL 4H4NA 1CBVL 1MW3A 2PO6B 3CXHJ 1TQCB 4M03A 4GFTB 5ACMA 1VESA 4HKBB 4H5SB 4GRMB 2J25A 1THAA 1QFHA 1BQHB 4UI2A 4I3SH 4RGND 5AOJA 2H3NB 1DQQB 3HB3B 4ZODA 3WIAA 3WU1A 4DTGL 1QFOA 3RPIA 1IBBA 3WJLC 2ADIB 4M7JL 2CO4A 4H1LA 4PRHA 1SFHA 3FO1B 1R6VA 4BXSV 1YUHA 4V2CB 2AJSL 2EACA 3REVB 2YRBA 4LU5L 4N4YB 1JPGB 2Y7NA 2VLKB 2DIBA 4QHUA 3FQNA 3BVDB 1P2CA 2GAZB 1U0QA 2ED6A 4M1GH 4HOMA 5D1XA 2DTMH 1IGIL 2FYVA 2K8MA 4MJIB 4RQQB 3ATDA 1PSKL 4Y0GA 1A9EA 2NY3C 4OV6F 5GS3A 2VDOB 1FN4B 3J8F7 3OL2A 3UDWC 2H2SC 3L7EA 4IRSC 1UB5A 4LSSH 1FA4A 1OY3B 2JKRM 4XE5B 2V4LA 3KGTA 4LPYA 4ALAH 4WTZG 2YKLH 3MNVA 2GVYA 4YE0A 3US9A 2R7EA 4NQVA 5MEQA 5E8PA 2BNQE 1GJWA 3P4NA 5EEVA 3QBTB 2X70B 4FE9A 1ILSA 5LGHH 4Q9BA 1EUTA 3TJHD 3RU8H 2PO6A 2BSED 4QR7A 4X6DB 3PDDA 3KGRA 2F1EA 1UD3A 3A67L 3OBAA 3SKNB 4YSQA 2PP9A 4KH2A 4RDQG 4X99B 5CZKA 4IKJA 2WCGA 3ZE0F 5CFAA 3RDTB 4PFEA 4HISA 5E99L 5LGHL 4MNGB 4S1DC 3MLTB 3NMEA 2ESVB 5FDWA 3WKMH 5FYLH 2WC7A 1HOCA 2X88A 3OVUB 1DEEA 4HIEA 3II1A 4WZ9A 3K3QA 5E6UB 4HDIA 4WFHE 4I9WE 4JPWH 2FRGP 4PMEA 5FDWB 2VWEC 3MSPA 3NSCA 5E6SB 2YA1A 2EDLA 3DHUA 1WFOA 2W91A 1GS8A 1YMME 2YSSB 2I5YH 4G9DB 3MLPA 1OCCB 5E6IC 1CICA 2C7FA 2DQFB 1IQWH 3H85A 3MV7E 4MS8D 2ZG2A 4C56B 3DX9A 1FFRA 2R39A 4TQEL 5EUKB 3C60A 2KDYA 4R7VA 5FV1L 1JK8B 1QMUA 5LO7A 5JDJA 1UQSB 3NN8B 1HAWA 3CHQA 2FX9L 2HVKA 1Q8MA 1IILE 3PAUA 2V7NA 4V1DE 2B1OA 4F8OA 1NIEA 2D7MA 3TASA 3IM1A 1NAMB 1KCWA 3SGKA 4DVBB 3ETSA 1D5ZA 4ODWB 1HXYB 3CBJB 4GW1A 4PJBA 2HXAA 3DVNA 2OSWA 4CSSA 2DQIL 4BDVA 4N0UE 2FJHA 5CBAB 1HI6A 1AVAA 2OZ4H 5KANG 4CC0A 3MA9H 3GBEA 1LMKA 3WUWB 1A6UH 2BC4A 5GGRY 1T5KA 1HNYA 2VN4A 3EOAB 4RMVA 5EF2A 3VD1A 5EF0A 5E2WH 5J13C 3MRNA 1U8HB 1YAZA 2BCKB 5EIIA 3FXIC 4UBDC 5MP6L 2XU9A 4Z7UE 3DKHA 4QLWA 4TNEA 4G70B 4U1MB 2OZ4A 1WFNA 1MAKA 1YEDB 5T1DH 3UAJA 4YSCA 5I6MA 5LDSA 4GBXD 5K39B 2I9LA 3VACA 4PJDE 1XCWA 3U4KA 1Q9LB 4JO5A 1PZBA 3ASOB 2HVBA 1KGUA 1NLDL 5F9JB 1UATA 2V5SA 4PJ9D 3S3CB 4X9GA 2R4RH 3CAFA 4HUCA 4CGTA 2VMCA 3IF1A 1SEQL 3X1BA 1YMHB 3ARPA 4UT9H 3V55A 1HL8A 1NWOA 2QTVA 3D1MC 4KDTC 3BWAB 4HUUB 1OT2A 2G9KA 2Q7YA 5E8OB 2FR4B 2J5LC 3RL1A 2JIXD 1SM3H 2G2RA 3ZGHA 3FQXA 4P4RA 1S7TB 2G5BA 4ZMYA 4KX7A 5BZDA 2P52A 1N0LA 2WJ7A 4JZJA 4AEEA 4PP1C 3I9GH 4GKSA 5LN8A 3QVAA 3MR9B 3HLAA 4XO3A 2QLVB 3RJOA 3BVNB 3WDHA 2UYLB 3MLXL 5CJOL 4O51A 4F7CB 1H0DA 1E4XI 1PX3A 4EUPH 4JO1L 4MD5B 1JI1A 1E40A 3BX7C 2EH7L 1AXSB 2V2XB 3PPEA 4RMTA 4LAQH 3FSZA 2WNKA 3GJFB 1CG9B 3RWJB 3DX2A 5IFAL 3TZVD 4ZMQA 1X7QB 2NW2B 2Z31C 3E8VA 2DIEA 5EO1B 1ADQA 4ZFOA 2AKRA 1J8SA 4BQCA 5DRZA 1XR9A 2CSPA 4MWFB 3QC5X 3AREC 2HPTA 8CGTA 4ZFFB 2WKGA 1NEZA 3P77B 2VDNB 3WIHH 4BZ1A 4MB4A 5LUMA 3W2DL 2VAJA 2IFFL 4PUBH 4X7TA 4AYBA 5I15H 3HZVB 1DVUA 4RFNC 3SCMB 4XGZA 3RLSA 3CLWA 1BVLB 2AEQL 4OV5B 1KLFA 1DLHA 1KIUA 1RP8A 3B2XA 3BUTA 1FVEA 2CDEB 4J6RH 2GJRA 3TWCL 3HB3D 4GAGH 2VL5B 4I9WD 3AXHA 3VX1A 4N0CD 4X6CF 4BM7A 2XIIA 5GZOC 2J44A 4P2YA 4PVMA 4UQIM 1TZHB 1FZMA 3I9AA 4POZD 1KXTB 1MWAA 3U9PH 2QQLH 2HVKB 3TT3L 4AH2B 2EEXA 5HI4C 3OKKB 2WWKT 5K9KA 1DVZA 5FYJU 3X3FL 4C4BA 2IBGA 5IW1A 4I2XA 1Q9WB 1T1XA 2JFCA 1OAKH 2KZ1B 2XKNA 3KPNA 4ZFOB 4JVWA 3O0RL 1QLEL 2MTPA 3S96B 1AJ7H 2NTSP 4GQ9H 4HIJB 1AI1H 2WZ5A 4KROD 1MHEB 3BP6B 3V4LA 2F8XC 4Y19D 3UGXA 2R1XA 2IADA 3KH4A 4JE0A 1I7ZB 5CGYD 3FU9A 1S7XB 1IAIM 3HPJB 2BSSB 3LQMA 3TLRA 3NJIA 3E6FA 5HVFB 1V55B 2PLTA 3OZKA 5ESVA 3SQOL 4MJID 4M6OH 1Q0EA 4KROC 5B1BB 5G4MA 2D73A 3LS4L 1YN6A 3SGEH 2BO0A 4PGEA 3NPSB 3HAEH 1H19A 2X2HA 2JTYA 1JNLH 5FHAH 1Y07A 3L4ZA 1IGML 5I76B 1QFPA 1ADQL 5C3TA 1S3KH 2ZWYA 3BKMH 3JWNG 3NCFB 1J5CA 1TJGL 3BGMB 5LVEA 2A1WH 4DQOL 2R69A 2P42B 5SWSB 1X5GA 5ICZA 2OMYB 4XHJD 1IKNC 1HKLL 4GXFA 3L4WA 1PCXA 3NEOA 3V6ZB 3WLBB 1CYGA 3VSQA 4RWYL 5K59F 5I5RA 2CJ3A 1XDTT 3I6GA 3UTTE 1EO8H 1HIMH 1RUKL 4AYSA 4IOIB 1KIRB 3AM8A 2FJGB 4F2MA 2B14A 4KUCF 4X7FC 4APQC 2QADD 4HPHA 2C8NA 1SJEB 3A6OA 4JDZB 3V0IA 5A2KH 1OOWA 1A2YA 4DSYA 4YGAB 1T1ZB 2WWKO 2VDMB 1GGIL 3FQ4A 5I1HH 1SYSA 2FECI 2AXJA 3MFFA 5A3IC 3VI3F 3R06B 4AQAA 4O02A 4PRIE 4UYQA 3HRZC 2OFQA 4OF7A 4G1EB 4Z7OB 1MEXH 4MMXC 2QEJA 3M6DA 3MLWL 1T03L 4NO2A 1EQWA 4G6JL 4BZ1L 1BAFH 4A66A 4D0CA 4KGLA 4YZFF 1QI4A 4V2BA 4L4VD 5CD5D 4MZRA 5DSCA 4X4MA 1UACL 1BVZA 2O93L 3ABKB 3CFIC 3BJLA 1OP9A 1AGDA 1YEEH 3BUIA 3WG7B 3O11B 2VIRB 5J11C 3BD4A 4YSAA 1SXNA 1NFDA 3C5ZC 2MPAL 3N40P 2VT0A 2ZP0T 3LZPA 3QO0A 5CS7A 1HILB 2UWEA 4WDIB 5C0DA 5A3ID 4KFMA 3RUGB 3A6BL 3DJZA 1S9WB 5I17A 2GEQA 1Z5LB 3TS8A 2XLLA 2MSPA 3MBWB 3VXUA 3ZE1B 3PP3K 4WW1B 4APQD 5KSAB 4O02B 1SJXA 3SDAA 1BHGA 2JLLA 1ACXA 3HC3H 2LABA 5C2UB 3V4VH 5DEJA 3CN4A 1AS8A 5LCVL 5E2UL 5DURD 1A7QL 1L7TL 5A43C 3ARTA 3TYGH 4X9YA 4N8CH 4G9FE 5FM8A 5GGTH 4NZDA 2Z1KA 4OLZL 3ZSSA 5DR5L 1IIKA 1T7VA 3HI6L 4RMQA 4ZO8A 1UACH 1P4IL 2ZKHL 2WOBA 4AGLA 3MRRB 5JQ6H 1BLNA 4RGMB 1KELL 1V8HA 3HJEA 1REIA 2OAAA 2VISA 3J27A 1HSAB 5JHLL 2XN9E 1UUSA 2QFPA 4IBTA 4R7LA 4A7QA 3QI9B 4HUNB 5FYKU 2XN2A 5EA0H 4N2NA 3UJIH 3HG1D 4NKDA 3QIUD 1JGLH 3QCVH 2VUOA 1ULVA 4ZS7L 3QJRB 4GUQA 4KTGA 1X5KA 2QPDB 3RDJA 1CYWA 1DN2A 2QQNH 4K7FB 4MXQD 4TNFA 2VQ1B 2NYYD 2CKBA 2OJEA 4NSKB 3WSQL 2W8CA 4HC1L 3NK4A 1ZHLA 3B9AA 5D2LE 5HHNA 4F2ME 3Q01A 2CBMA 4PLOB 1JRHL 1PS3A 4U6YA 2QKSA 3CFMA 3CCHA 2FTAA 1F1GA 1DCEA 4UT7H 1MJJB 4PJAA 4BCYA 5MENA 1FYTA 2A83A 4MAUH 4MB1A 4QCIB 1JCVA 5LCVH 4S1SL 1G0YR 1WCBB 4QT5B 1ZJBA 2VH5H 3CMGA 3GUTA 1A1NB 3O3BB 4M6MH 5ICZB 1JNLL 3ZT7A 3V4PB 1DL7H 1FPTH 1OTSC 1XWVA 2LW3A 1B4RA 5EC1B 4ZAKC 1VZHA 1AMYA 1Q94B 5JIIA 5EB9A 1CB4A 1P4BL 4CKQA 6PCYA 2X38A 1HWHB 1BZQK 2LLLA 2ZUXA 2VLKD 4JFDA 4L37A 4M9PA 3RWCB 3ZKND 1HFUA 1OB1A 4R4FL 1XGYH 3JVGA 1TJIH 2VXSH 4MBRA 4IGBD 2VO5A 4W6WB 4OIFA 4ORZC 3AGWA 4NEHB 1JDDA 1K5NB 2XQYG 3C60D 3ZRSA 3FO1A 3KJ6L 4JE4B 1H8SA 2YPLB 3EDEA 8FABB 3L95A 4OLWL 4FXTA 1FZKB 2HN7A 5AVYB 4X5LA 4KVCL 5EOCH 1CL7L 2PCYA 1EXHA 4CMHC 1MEXL 1OXYA 1EZUA 3EOYG 1QACA 4MJ5B 1ZE3C 1NEUA 4K71B 4PTTB 3UPCA 1GYUA 3S88L 3BRGC 2WXPA 4XTRC 2BDNL 2QVFB 3SPIA 4N0FB 5HYQA 2FL5A 2J1ZA 4UTBA 4ZOBA 1L5GA 3SY6A 3C2AL 5IQOA 1F8TH 1EJOL 1HKFA 5FDYA 5AALA 2VLRB 3FNKA 2XPZA 3CPLB 1GZHA 1XR8A 3QUGA 3JTSA 2CO2A 3EFDH 4OY9A 1MXGA 3QQXA 4XN2A 1ZV9A 4MNGE 3GBMH 5FK9B 1KLUA 1T1YA 1EJ6A 4LSTL 1U91B 4ONGH 2FO4B 1S9XA 3MRJB 2LR4A 1WD8A 4MZIA 3I85A 4GP5B 1FG2A 4M6OL 5CEZE 3TN0D 3KYNA 4PJ9C 2JKLA 4O9HL 4F7EB 5I30L 2EEBA 3KGUA 5E08H 4MLSA 3QQ4B 1ONQA 3QFGA 3HC3L 3W9EB 3G5YA 2R1XB 3AB0B 1TVBB 3IDJB 4X6DE 4JBSA 1FLRH 1XGUB 1OHZA 2EDYA 2Y2WA 1KCSH 5G5DB 4JAMB 4P23C 1KCRH 2C1PB 2XPGA 3CVIL 1WAPA 3RNQA 3ULUH 1IGJA 2A73B 4ZUSA 3QXTA 4CVXB 4KMQA 2GJ6A 4UBDD 1DE4B 4OJEH 1N6QH 3B4NA 4JVUA 5IB2A 2ZE0A 2YPLD 3BFQG 3L3JB 4IDJH 4PJIA 1J9RA 4JM4L 4NQQA 3O0RH 1OE2A 5HHXL 5FECB 4PB0H 2C34A 4XVOA 4WGWB 3S36X 2HYMA 3WFZA 2EECA 5BVPH 5HHQA 2H3KA 2R4SH 2DQDL 4JPVH 1F13A 1FG2B 2IAMB 2JSFA 1KFAH 3WEAA 3GMMB 3MUJA 4PRHD 3TF7C 2WO3B 3OG4B 4OF6A 4XGZB 3AG3B 4UU9A 3U4BL 2J6EA 3MBXH 4HIQA 2XZQL 5E56A 4X9HA 1BXXA 2Y7OA 5F0JB 3UYPB 4XVUD 5DC0A 4CKVX 3VM7A 3RTQC 5J6HA 4LCVA 1NAMA 3E6HB 1E4JA 4JREB 2E75C 2NXZB 3ET9F 4JRYD 1XF3A 3NN8A 5IHHA 3ARUA 5MP6H 3HE6B 4D9LL 2CLVA 4NQEE 2EABA 4PTUB 1WZ1H 3I6KA 1MNUL 3ARDB 3FYIB 4BA0A 5JDSA 4NCC2 1G9NC 5ICYA 5TQ0H 1DQDL 1K2DA 3KLDA 5F3HB 4L8CA 4GT0A 3KYMB 1N59A 1E0OB 5T33H 4WWNA 1MWAL 5KBLA 3SBWA 3OKLA 4XMLL 1VFMA 4KJQC 5EOCJ 4ZW8A 2R56H 1X7SA 3KVQA 1CFQB 4XAKD 5EZOL 1JZEA 3IPBA 2ETWA 2AITA 5C09E 2HA1A 4QNPE 1G4MA 5J3HC 1DQLL 5DVLA 1JF5A 3S3JA 4L37B 4X8GA 1YEHL 1FC1A 3DX4A 3VFSA 4NN5C 4J5VA 4Y2DA 3U4BH 2WZAA 2JB6B 2XFXB 3V5KB 5ITFA 2WTPA 3PWJB 3F83A 4HPOL 4RFOH 1P6FA 2R69L 5DO8A 1CDUA 2B5IC 3F85A 4TKWA 3T8VA 4R8WL 1AS7A 1A6TA 3WY1A 5ADPH 3LNGA 1M2OA 5E9DD 5F9JA 3TEZA 4XP6L 2GK0B 1F3JA 5DMKA 4W9GC 1SJEA 3VWKD 3QUZD 1BJ1H 1HCFX 1HH6B 4ZUTA 3EO1B 1J8HA 3UCRA 3QFJA 1G6RH 3G5ZA 3U1SH 4PWHA 4UINL 1P5VB 3D18A 3HRPA 4DPBX 3WKML 1OP4A 3LX9A 3SCMC 4PRNB 5FYJD 1BDYA 3ZL1A 4BGDA 2BNQA 5HDBE 1G1KA 1UD2A 4ZYKB 3JYCA 5DZPA 4HCRA 4OVUA 3VB8A 1A8ZA 2E9WA 1NGZB 1NCCL 5AAPA 4OLXL 1T7YA 5LWYL 1QA9B 1I7RA 2CHZA 3QXAB 4PI0A 1N5AB 4JY6B 2PUQT 3PJNA 2QV2A 5FGRA 1XH0A 2AXWA 1J5IA 2BOBB 1QNZH 3UTTB 2BINA 3JZ7A 2NX5E 4WNQB 3WCYA 4OVVA 3OKOA 2WPGA 5C08D 1U8CB 4RRPG 1GHFL 2I9TA 2KZKA 1IBGL 2CNYA 1DO6A 4G3YL 3GINA 4GG8B 4RMWA 1RPUA 1K8IA 4UDUB 3RJQB 4WU5A 2F1AA 1U8JA 3EJZC 4DP0X 5G5DA 3LY6A 2NZ9D 3UBFA 2J2ZB 2R15A 2J4WH 4WKZB 3MCKB 3D50A 4YHLH 3MKGA 4H88H 1ITBB 1QQDB 4PJ7A 5DTFB 3IEAA 1YC8A 3QJTB 3DJRA 3T4YA 2VL4A 2Y2TA 1BVKB 2XG5A 3D0LB 4MHHG 3MRMB 1FZMB 4FCAA 2GJJA 4HULB 5GGVY 2AQNA 4TQ8A 3SY0A 4QRSA 4J3OF 2R2HB 2DW5A 3N2JA 4PRPB 2EKSB 3VD3A 5LNEA 4GSDL 3VFRA 5SWSD 1UB6B 3GXDA 5INDB 4ZYKA 1YNTA 4P3DA 3GGWB 5EN2A 1TQBC 4BYHA 2VZTA 4NWTH 4KJWC 5J5EA 4KI5E 1RVFL 5C7ZA 1KG0A 1G9HA 3EOBA 1MCBA 4X4ME 2HZHA 1DQMH 3STLA 2Y7LA 4CN4A 2DQEH 3FK3A 2HAZA 3VH8G 2DYRB 1BG9A 5JORB 5GZOA 2X9WA 1NLDH 3KPSA 2VE6B 1BQUA 3U6RA 4LVOB 1KF9B 2F53A 1F4YL 2ZNXA 3K4ZA 3NSJA 3AS1A 2WYIA 4GI6A 3W1ZA 2PXYA 4OGAC 5I19L 1PG7L 2DDQL 1GL4B 3TV8A 2GSGB 2CDGA 5PAZA 4HKZB 3DMMA 2EDBA 4MCMA 3VXRD 4CAGA 1OAQH 3L1GA 4JK0D 1BF8A 3BP7A 3MRLA 4PQXA 2EH8L 2Y1YA 5A16B 2VDPB 5C2BH 1BZ7A 4DP6X 4ZS6C 1R3HA 2ZAHA 3ZRCC 4JKLA 4U7MA 4F9LA 4DN4L 2PO6D 5FYLD 1KIRA 1T22B 3ML8A 4FI8A 4JDEB 2MNJB 4X83A 1A1OA 1X9LA 1OT1A 1KBGL 5GPRA 2OMYA 4Q6KA 4C55A 1UFGA 2MNWA 3AITA 2NSQA 2UX6A 4GRLA 5CF3A 4N2AA 4N2IA 4JQIL 4Y4FD 4XHQA 3KCWA 3TYFA 2X2UA 4IBQA 1OAUL 3RHWK 1M7DB 5C86A 3BSZL 2A9ML 3D85B 3P9LA 4NS0A 1MCOL 5C08B 2F08A 5DZ9A 4W9IC 5IBLD 2Z8VC 1VSCA 4CJ0A 2HLFD 3PCYA 4XI5D 2VABA 2WYTA 4M1DL 3WGUB 5ALBH 4XP4L 2F1BA 1FFQA 3B9DA 3L9RA 3BW9B 3Q8BA 5CUSL 5DHDA 1BFVL 2GG1A 1B0RB 3OWRA 5GS0C 4GPVA 5J6GB 5IROD 1XF4B 1VGEL 5HY9A 1AGBB 4W4OC 4XPGH 2QZ5A 3HS0A 4JFTA 3OXSB 5T1KD 3UYOD 5GZNA 5ISZB 3L9EA 1HHIB 2WGXA 4WO0A 2WVTA 3TFKC 4G83A 5AOLA 3MRFA 4FRWA 3RVUD 4WW1A 5I75C 2IBBA 1NCAL 5IB1A 2VXVH 5B8CC 5TPWL 2AAAA 5IJCC 3JYBA 1BIHA 3R1GH 4ZSOB 1MFDL 4GRLB 3DV4A 2GY5A 3KMDA 3F58L 2M8XA 1D2PA 2HJKA 2VR4A 2K0RA 2ZSWB 4YPGB 1UM6L 2R0ZH 1FYHB 1OLLA 3JUYA 3NSDA 4ODUB 3RI5K 1A1OB 2CRYA 1JPSH 3CDZA 3BZ4B 4FHBD 1TCRB 4JY5H 4MKTA 1PJWA 2EE6A 2IPUK 2ZSVB 1YAIA 1E6JH 3GSNA 3VXMB 1R3IL 4OR1A 2EYRB 3S8GB 5EF3A 4FZ8L 4ODSH 4JFFB 2CZNA 2GTZA 2D8KA 3HCVB 4TPRH 4YXKL 5C0RH 1MVFA 4D3CH 5B4MC 1U3ZA 2OSLB 4MX7B 4L3FA 5TQ2L 3RILA 4GAAA 1LE9A 2ERJC 3U0WL 4JFXA 1MLCA 3TC9A 3PNRB 5DHVA 2YFNA 2FNBA 2OSLA 4NZ8A 1CXIA 2GUOB 4NBYB 3QWRD 2AJXL 3HW7A 4PJHB 2H6OA 4EI5A 4UNIA 1DSWA 4KKPA 1PSKH 2BNUA 4HIHB 1E9OA 4HP5A 4W9CC 1ZANL 4NFDA 1PD6A 1MNNA 4M6NL 4ZOAA 4RAVA 4E9XA 5KYXA 2ADFH 1NAKH 4Z8FH 4WSKA 2J8UE 4G6AC 1AZBA 4NOFA 1U3HA 1SOKA 4DZ8B 4EEEA 5CCKL 4XP5H 1MREL 2P49B 3FU7B 1R5VA 2J56A 5D8JH 3WTYA 3MV7B 2OK0H 2TSAA 3GC3A 1JDCA 2CM5A 2N01B 5BOPA 5IFAH 3JWNC 3IFPA 3PABB 4YWGH 2R2EB 3IJHA 5KSVB 5H35B 1BECA 1J11A 3MO1B 3WTVA 1WSST 4LASH 4FLRA 1DBAH 4ODTH 3LPPA 5TE7H 5FUCE 4GAYB 3X14A 4LKXB 3QWOA 3VXQA 5DJXA 1E8XA 5H94A 3QS2A 3TO2A 2BIPA 3DK0A 5MEQB 4MA1B 4H1LH 5ESQB 2IAMD 2Y25A 1NDMA 1QRNA 4U4BA 4XNXH 3ZYJA 1AR1B 1O9WA 3FF8A 1DZ0A 1G5AA 4KRPB 3H55A 1O6SA 1AKJB 3NAAH 3D3VA 4XCFL 3V9EA 3INOA 3PGFH 3PGDB 3DROB 3Q8FA 2ICWI 1OB1B 1DQJB 4ANKA 1QAWA 4UM9D 3SE8L 4JFWA 3IXTA 3SDDC 2NNRA 5C7XH 5I73C 1M6OA 3UERA 2F5BH 5ANMA 5AVRB 4ZDHB 3KW8A 3DX8B 3I9IA 4C4KO 5ECJE 3NCYS 4MQTB 2A9BA 5K59E 4JM4H 1WF5A 4FNSA 4QLRA 2NY3B 4JRFA 3QDMB 4P07A 1RV6X 3B6SB 1D7CA 2E27H 3IRCA 3WNLA 1HQRB 2OMXA 5KVEL 5EULV 4HS6B 4NQCA 4IOSD 2DEYX 2DM3A 4PJEB 3NCYP 1V54B 5KWYC 5C71A 4L4TE 4O4YH 2QL1A 4WV1C 2IH9A 5K9OB 4AGOA 1TLMA 4BFNA 3SB3A 5J6GA 3EJJX 4DAGL 1L9QA 3M45A 4FTVE 3QR2A 1W16A 2AZAA 3IU4H 1KB5H 4O9HH 5HD8D 5C6TH 3CQQA 3JWOH 3NIDF 3O6LL 1F5WA 3TP4A 4AVIA 2NNAB 1IC7H 4HFWA 4NQCE 1TT6A 2CMRH 4X4ZA 4DCQA 3AY4C 1TJGH 2FLRT 1W0WA 4CMMB 4QRRB 3GBML 2ADFL 2WLHA 3EYVB 4KVNL 3TO4B 3O3AB 3ESPA 4Z3GA 2PYFB 4PJ5A 1LD9A 3VE0B 1Z9NA 3MCLL 4E9SA 2WXNA 4BH7B 3KHQA 1EJOH 4Z3FA 4OGQC 3LEYL 2IGLA 5D1QC 3SJVA 4XMPH 3W0WE 2VERN 4KKLC 1EIBA 5C0CE 4CC1A 4CMHB 3GLAA 2OXGB 1KV3A 2BMKA 5I1EH 1JYNA 5CBEA 1EJFA 2WUBH 5I5IA 2NY1C 4JFEE 1CU4H 5EBLB 1B0WA 2VR8A 4X6BA 2OR9H 4PJ8D 2QELA 2ZJSL 4PY7B 1Z3GL 1UD6A 2H2SD 4U3SB 3PHQB 4YBLC 4ES9A 4UIMB 5BUPA 4HT1H 4PWEA 1QX1A 3GSXA 3PJLA 5C0CA 3NK3A 3FU3A 3IFNH 1KELH 4XN8A 4OZHF 2VXUL 3WBDA 4L0PB 1ES0B 1CDJA 1VGKB 3TBTA 5F1SA 2VLKE 5DJZA 4G11A 3RX8A 3UFIA 3CFCL 4ZMXA 5IW3A 1IE4A 1R3IH 1NFKA 1PYWA 4N6QA 4W9DC 2EIZB 2VC2B 1JYWA 1VA9A 2E46A 4PYHA 4EN3D 5KOVC 4EZMA 5AL0A 4WI6A 3AS0A 3HG0A 4NYLB 1TEFA 4GEIA 4IDJL 4P46A 1OAYH 4UU9B 3U30B 1JK9A 4FFVC 5T1LD 1GW0A 3NIFF 4OTXH 1WWAX 3HR5A 3MOAH 4UM9B 3EOAA 5BXFB 4BINA 3KPLA 2YZ1A 4YDVB 1I9JH 3D25B 5GRVL 5DS1A 5IF0B 1ZLVK 4KNTA 4NO0A 4YFDB 2Z31A 1NC2B 3HS0B 3CMOL 3OSVA 4KJQD 5D70H 5DVNA 3ASWA 3WFDH 1U8PB 1RSYA 3U9WA 1CG9A 2DQJL 3DX0A 3PAYA 3NYKA 1MREH 1TENA 2F7QA 3QHZL 4NIKB 5JOPD 3QYCA 4Y5YA 4AKOA 3KPRA 3QIWB 4HS3A 1VDGA 3VH8B 1VCAA 1S7QA 3PQYB 1EEUA 3VSTA 2NNFA 4OFIA 4NO0D 1NOLA 1X5XA 2CRZA 1HTYA 1EDHA 4TVPE 1HH9B 1EBPA 3MR9A 5J12B 4R96B 4X7SL 4AYFA 3BAIA 3V9CA 4TLUA 5ID0B 2YRLA 3CH1B 1HOCB 4OCRH 2AK4A 4Y2OB 3T2NL 1N5YH 2AQ2A 5DU7A 1YPZF 1FE8L 5C2BL 4P4RB 3FQXB 2GI7A 1KEML 3HG3A 1H6FA 2AMGA 4PBVC 4ZUWA 1OZUA 3SGDH 1GIGL 1OW0A 4TL5A 3TA4D 2JJUA 1CBVH 4EI6B 1TJHL 1IGTB 2YGOA 4I7ZC 2EVJA 1FRGL 4X5XA 5DVKA 1J8KA 5KYWB 1CL7H 1E8YA 4NIYE 1P9MA 4FG4A 1MH5A 5DJAA 3UBHA 4I18B 3V7AE 4B9GA 3DIFA 2ED7A 4L9DA 5A2CA 1XEUA 3FCTB 3JWDC 3NACL 1JD7A 4GS7C 4ICXA 4OM1H 3ZZ1A 1ZLUK 2VR5A 4HOWA 4BK5A 1DQML 1DVFA 1WJ3A 3I84A 3QQ3A 4JY5L 4Y16C 1A9VA 3OG6B 1T0OA 4XP1L 2JF1A 4F5CA 5ACZA 1JZDC 4U6XA 1I8KA 1ZT7A 2BVQA 3GSRB 2DKMA 5A2JH 3L3DB 1OL0A 3AMLA 3U7WH 2TRHA 1MFDH 3REVA 1WUNT 1CD0A 2M1KA 2OBGA 2N3JA 4Q6IA 3MLVL 2CBPA 4JFQB 5DJ6B 4CBZA 1U8CA 4TVSa 3QRLA 4H1LB 2BMKB 2XV3A 3L1OH 1NGXA 2X1XR 3L3DA 1P2CB 1XT5A 2GAZA 3HR6A 4DUVA 5GGQH 4RGMC 5CZVH 4HPYL 1NJ9B 3WUWA 3H9SB 5H2BB 3EDDA 1T03H 2XX1A 2HWZL 3SCMA 2HH0H 2N7AA 3UG3A 2IG2L 4YSRA 1MKFA 4O2CA 4K23H 5GRUH 5T3ZD 4OW6A 3SQBA 3WXVH 1RUQH 4Q8BA 2D9CA 3DECA 2WLYA 3DIFB 4PLKC 5ALBL 2YC1A 2X42A 5I1HL 5AW3B 1RUML 4DK5A 3QA3A 5EC1A 3SIKA 4PJ8C 4O5LL 1AR1C 3TVMC 4P5RA 2Y7SA 3D69A 4R2GC 5GGSY 4P3CL 3X3GL 3VAEA 2B20A 2NCMA 4R4BA 4DP4X 2JCCF 3FB7B 5JUEL 1OARL 5KVEE 5J11B 4X80H 2MOGA 3A4DA 5EU3A 4YNYA 1G7MB 4LP5A 2GI0A 1FORL 3HRZA 3LEXB 4UQ9A 5D7LE 1KN2L 4YBLB 3S98A 3WFBH 4ZMOA 2CHNA 2XZCH 4GQQA 3Q8CA 1LGVA 1IGFH 3BVUA 1J9TA 2OYLA 2F8OA 1OOAA 3I74A 4FMFA 3UGUA 5AAMC 3IRPX 1IJNA 1KENH 3CFKA 1PIGA 3F64A 1NC4A 3NRFA 4RLDA 1PLGH 2ZXBA 1S7TA 2G5BB 3GRBA 4PGCB 1UXLA 1KXQA 4ENEC 3MUGB 1YPZE 4E36A 3ZLQC 2EH8H 1OWRM 4X4KA 4Y5VB 3CLFH 1KSRA 2FGWL 4KROB 1I9RL 4XZUA 2H4EA 2YUWA 4BZ2A 1FL6A 2MQ0A 5EV7A 3GIZL 3RWGA 3GSNH 4JW3A 4O2CB 3V4VL 1LWRA 4WQOA 1XR8B 4OQ1A 4NAMA 5IF0A 3GHBL 5BCAA 3BMWA 3FFCA 3NP3A 4L1BA 4ZQKB 5JMOC 3O3DA 4JL1A 1F3DJ 2IDUA 2DWDA 3GSWA 4HS3B 2EIEA 5EU6B 5D5MF 1SNRA 4MJ6A 4DKFL 4HWEL 3O6MH 2NRDA 4I5BA 3MNDA 2D0GA 2WAQA 4MMZB 1F1AA 2B3RA 4UT9A 2ICEC 4NQDB 4PVLA 3VXSB 5FO9B 5I8CB 3FB7A 5KVDH 5BVPL 43C9B 1UH2A 4HALA 4PLJD 3TO2B 1I1FA 4MD4B 5K9QI 1NGYB 2J88H 1E9PB 1WZLA 4YLBA 3KWUA 3BRFA 4BD4A 1IAOA 4GKZA 3G6AB 3MGOB 5CD5C 4GMTL 3LIUA 4OFQA 1AO7A 4P2OB 4GKOA 4HSCX 1PEZA 1YEIH 4LMQE 3K2IA 2FT7A 4UUJA 4XH2A 4NC2B 1N8ZA 2KQMA 5FW8A 4FFYH 5C0DB 5DMIH 1AHWB 4R6UA 1HL4A 2X41A 3TOPA 3VXUD 4EI6A 1XF4A 1GY1A 5KS9A 2Y4SA 3MJWA 3QIUC 4HBCL 2CCWA 3NEXA 1JGEB 1BA9A 4UDTB 4R7DB 4I88A 1U33A 3QORC 3Q44A 1C8QA 3OF6A 2X6VA 3MRDB 4KKQA 4ESKA 1KUMA 2YOAA 2R1YB 1U8KA 4EPSA 4AUUA 3GMOB 1J0KA 3IDXH 5D1ZC 1DQDH 3S37H 4IU3B 1L0XA 3KDMB 2DD8L 3Q2CA 3HZMA 1HIML 5DZNA 5I6XB 43CAA 2F19L 1E27B 5F9WC 1ZA6B 1IC4L 3D33A 4IW4C 4P23B 4UT6A 2XXFA 3NJXA 3FUKA 2Y5TA 3FB6B 1FZJA 1M7XA 2WLZA 2BHZA 3IDUA 5KSAC 1OHQA 2Y6TE 3DGCR 4ZSOE 4U7SA 4JPVL 1L7IL 3HHSA 2WVVA 4P05A 2NX5B 1YY9C 2DZEA 4TULH 3JUZA 1NANH 3GMRA 3GLDA 2IAND 1M71B 3Q9PA 3IU3A 2P8LB 1P7BA 3ARGB 3F5WA 3CXFA 4P2QD 1SHXA 4GSRA 1JPST 4XRCA 4YHMH 1XEDA 6CGTA 4QKTA 4J4PA 2IAAC 4OLUL 1W0VB 2NY4D 1CCZA 3JSSA 1D5MB 3G08B 4UILL 3KXFE 3K8KA 2BXYA 4G7QB 1TKWB 5DO2C 3CFJB 4JFZL 3VG0H 2JKNA 4UDTA 4LEXH 4F8NA 4KHTH 1QPXA 5BOZG 2WIIB 3MRCA 4PJAB 1MFCH 5DFWH 1RULL 1P4LA 1N6UA 2EADA 5GRWA 4DNLA 1ETJA 5D7IE 1A4AA 1YYLL 3RGVC 3PWNA 2F53D 3NJHA 4NKIH 3EZ8A 4U6YB 4YDNA 5FYLL 1J5OH 4TSCH 5HD8C 4CADA 1KV7A 2IXQA 3G6JE 1ZXKA 3KGSA 5TE7L 5E99H 3VXRA 4PW9A 1FN4A 3L1FA 3UPRB 4K5PA 3D85D 2UXGA 4NO5A 4ZMWA 1RZKL 4KHXL 3HC0A 4RAUA 3L5IA 1FNGA 4P4KB 1BX2A 1HHKA 1USZA 3FOLB 4AV0A 4BFGA 1XVSA 1Q1PA 1XGRA 1KXHA 5CLTA 4AQ1C 3BLBA 4E9YA 3NDZE 5F1NA 1S7SB 4KJPC 4XWOD 1OEZW 5A6LA 3WKNA 2QT6A 4LSVL 1KTRL 1FJ1A 1NAML 2IPKA 4LHJB 2ITEA 1GGBH 5FYJE 4YSSA 1H3UA 1IGYB 3C8KA 1NKOA 2BSTA 2QQQA 1T4KB 4C8XA 4ZMAT 1RI8A 3RWCA 1MCSA 2FIKB 4U1NB 4Z7NE 1KYOK 4ZD3L 1NCDL 1RZJC 2NX5D 2G3XA 1IGYA 3VGHA 3CC5A 5AYTA 4HKBA 2UXTA 2ICES 5C0BE 5AW8B 2FAUA 1IGIH 1QD0A 2J88L 4RX4A 4N1EA 3VXRB 2GJPA 4UNVA 1WBZB 2ZYSA 4FEMA 4PJ7F 1LK2B 3GMQB 1GMEA 4NJAH 5LAXA 4QXUH 1OAZL 4JFEA 1SOXA 4KXDA 4S2SB 3FN9A 1E7VA 3HC0B 1RUMH 1WWWX 3O81A 2H9GA 1FFPA 4PJ9A 3KD4A 4PP1D 3P73B 4G6KL 3W39B 2NXZC 3V8CA 2DQTL 4ORGB 1BW8A 2XQBH 4KUZL 5GGTL 1XFPA 4UNTA 5T1KA 4NZUL 2CRMA 1AFVH 4Q2ZB 1BBDL 5FM5O 3WLWD 4ZO7A 1KPRA 2A77H 3BVXA 3HE6C 2BOCB 1AC0A 1IVLA 4OBSA 1MHCB 3POHA 2Y3AA 4BFRA 4LEBA 4HF5H 4X8JB 4JQXA 3VTTA 4AL8L 1GJIA 1B2YA 3EYQC 3JT2A 5GSRB 3ZHNA 3NQIA 2BSRB 5FA3B 1ZA3B 3CC5B 2V17L 4DT2A 4QRSB 3SOBL 3LZFH 1JXFA 2OI9C 1CFNA 3L3KA 3M1CA 3V0JA 4PRIB 1JGIA 1GOFA 4AUJA 5I18L 4GP8B 3LQAL 1P7QB 3CFQA 1FNAA 2AVFA 3M17A 1OSEA 4PI2A 1GIGH 3DVIA 2ZONA 4P5MB 3QEQE 2EVFA 2NY2D 4MQXD 3SGJC 1ZLDA 1GS7A 1BVNP 1A2YB 2Z8WC 1WEJL 4RGOH 4L8BA 2OR9L 2EO7A 4Y4HD 4X8CA 5EU5B 3HZKA 4XVJH 2WVVB 3KR3H 2X0VA 1U8NA 3IDIB 1JCKA 1Z0MA 2WBJC 3VMPA 4HXBH 5G2NA 4NUGL 3ZU8A 1F4AA 1DUYA 3B5HA 5T1LB 4FHJA 3RUGE 2XZCL 3CFTA 3QCVL 3T2QA 4ETQB 3U4AA 1VZGA 1JHTB 1B4JH 4H13C 4HGMA 2WIIA 3MRCB 3MCLH 5I1EL 5FYLE 2CDEA 3EXJA 1BQLH 3L9BA 3RVXC 3AM8C 4X2UA 5CLWA 4MHHI 4JZOB 2A83B 2PPCA 5DXWA 1JZ7A 3GTVA 2Z91B 2P44B 5HVWA 5I74C 3QG6B 5BJTB 3PG2A 3LNEA 5IIEB 2Y7MA 4FTVA 5CMAA 3EW3B 2HT4D 5EU6E 1QSFD 2IBZX 4OLZH 2YK1L 1PY0A 1YEJL 3IU4L 1HCVA 1EEYB 1AZNA 1G43A 3ZDZE 3FYEB 2YQ2A 1E9PA 3S8FB 1JNNH 3UPAA 3RZCA 3X14B 1G1CA 2WWNA 3GI9L 4P9HL 5LWYH 1AQHA 4OZ4B 2NOYA 3MJ6A 1KB5L 1CI5A 3IDNA 2JLPA 2XVBA 4L8BB 4KXCA 1QSFA 3ENEA 3ZVVA 3QUHA 1N64L 4OCXH 4F7MA 2WN2A 4LK4A 4GXUN 2WXRA 4GG6F 3KLSA 4NPJA 2NY0D 2IMMA 1VEPA 2RB8A 2BVYA 5AVSB 4TUOA 5I0XA 1PLAA 2A9NL 5LGKA 1J9SA 3T0XA 4YDJB 5FKAB 3QR0A 1F58L 4PBDA 1SZNA 1DDHB 2GTWB 3ZMEA 5DK2A 5ACLA 4LPWA 4XBMA 1JFHA 1M2VB 4XZUB 4IRSB 5CGYC 4DW2H 4JMNA 3MGTA 4QWWC 1A66A 3RWEA 3T1FB 4LBEA 4P49A 3MV7D 2IQ9L 3W9EA 1CPUA 1JIBA 1HOEA 4M8VA 4NHUA 2J71A 4FC3E 4HXAH 3VTMA 1A14H 5ERWB 4DP8X 1MDAA 2C3VB 4FTVB 3DX3A 2QMKA 2GPZA 3KEDA 3U79A 2G9HB 2P24A 3QEQA 2ZJSH 4KZCA 4NNPL 1JPEA 5EOTA 2FO4A 1XB6A 4G3YH 3RIAK 2MH4A 1W72L 4D0DB 1EX0A 1LO4H 3VO0A 4OZHB 5FB8A 4NT6A 3BYYA 3EYOB 1BZOA 4EBQH 5IREA 1NCUA 2ARJB 3ZTDC 1RLBA 3WN5A 1H15A 5DZVA 1W80A 2BVQB 4OU3A 2OSXA 3KPNB 4LASL 3WENA 1GH7A 2P80D 3PJSB 4M7JH 4A7UA 2MHAA 3KLHD 3L4XA 3AS2A 3ZE2F 5FFOA 4RGNC 1LP9A 2VLLB 2W0LA 3IBEA 4WI0B 4CSPA 5CCHE 3BWUF 3A24A 3ECVA 4PJ8B 4I18A 1ZS8B 3EYSH 4NZTL 1FCGA 2GFBA 5CCJA 1XB3A 4PJIB 1KWGA 4WKZA 4H0LC 1AANA 2WO4A 4CDHA 5C6TL 4NQDE 2E27L 1PZUB 2B59B 5DJ6A 2H2PC 1OF0A 5BV7L 3ARDC 2JI2A 3VI4A 3WELA 2MCPH 3EHBD 1EMTL 3FO0L 3L17A 1A6WL 2V3FA 3QSKB 3SODB 4H0GA 3FRUB 3VUAA 3UG4A 1YEEL 5F7FA 5HYSG 3DRTA 2NXYD 4X6DF 2DQDH 3PDGA 5KUKA 3APCA 3MJ9L 3ZPDA 3WN5B 1J1XL 3PWUA 1SY6H 3KCPB 4WFHD 4YN3A 1ZT1B 5I8KH 2F54D 3FU6A 4IMLA 4MKMA 2P7TB 4P2RE 4J3BA 4G5ZH 1OSZA 2RBLA 4Z5RA 2AAVA 3T6XA 4FZ8H 4Q6IC 1MCFA 1QP1A 2FHCA 4G8GA 2EKSA 4PRPA 3N9GH 3RWIB 1SLXA 3CIQA 5C9KA 5HI3C 3IMVA 3ZDYF 1RSFA 2AS5M 4TQHA 2EDTA 4D7BA 5KYUA 3QA3B 5TE6H 3ZZLA 2YPVH 1FLRL 3GGWA 5EN2B 2IFFH 2FBJL 4IHBA 2BOLA 1H3PL 2B1AL 3ULSA 1A7RH 1EZLA 5F88A 2XTSA 3B8SA 4AOFA 5D7LB 4N8UA 4YVNA 4AW7A 4MMZC 5CJ5A 2C4XA 5AUMB 3HRZB 3LEXA 2VNCA 2AQQA 1NCAH 1IM9B 5B8CB 1IAII 1TZOA 4LNRB 1C1EL 3VGAB 3UL4A 4G8EA 4KZ0A 1HHJA 5D7EA 1DBAL 2VR3A 1NAKL 4AI7A 3QZWA 1LO4L 1OW0C 3TONA 1G9ML 3DOSA 1SXBA 1W72B 2A38A 3GS0A 3NFSL 5BO1L 1C8PA 3FSOA 3HNSL 4W9ZA 1A3LL 1ZV2A 5F7EH 4FCHA 2WLLA 1X5YA 1OE1A 4P2RB 5EZJB 1ZJAA 5ABZA 5JW4M 1KCVL 4D9RE 2MQGA 5D71L 1UOVA 1I75A 4KRPD 5HJDA 4WU7A 4Z3JA 4MB3A 5E8NB 1LM8V 4QOKE 4N86A 4NHUB 2NY6D 1RZIA 4LP4A 4F7TB 1N0LB 4JZJB 4H8WH 5E1GA 4LCIL 4E0RB 3OAZH 2GCYA 3Q48A 3OZ9L 1GOHA 4ELMA 4NNPH 5E6RB 1RJYA 2W9DL 3D18B 3NSYA 1YHPA 5F89B 4KO6A 1C5CH 3VXUB 1FIGL 1WBXA 1NH6A 3F7RA 1OB0A 4ONOA 1G1OA 4I13B 2AK4E 4D0DA 2C9QA 3VQLA 1I8AA 3V52H 4ANXA 1AC6A 1NMAL 1NKGA 4HHAB 1NCJA 2ITCA 2L8AA 2DTSA 3TBVA 4FA6A 3K8MA 2DJSA 4W9FC 2W0KA 5HVHB 1V3LA 3JV0A 3J7HA 3RTLA 5CKGA 4WTQA 2B4CH 1TTAA 1CICD 3ARWA 3OMIB 4AJYV 2HFEA 3DNKA 2XN9B 5LGJB 3E2HC 5FO8A 2VR9A 2I07B 3MXWH 5MHSE 1I9EA 4U31A 3GJFK 2YD5A 3ZKSD 5I75B 3ARFB 5D7IA 5IMKB 4XN5A 4PJHA 3P30H 1DBML 2W0FB 2WBKA 3C6SA 3NIGE 1JJUA 1AZVA 4YSDA 5EBWA 2B2XL 1BYNA 5DJ0B 4IKLA 1QLFA 2P8PA 4S1DD 5D7IF 2WNXA 4LSTH 4ONGL 1JRHI 3LPGA 2JQMA 4XBPB 3ASNB 5J1AB 4GSDH 3BJ91 5MHSD 3ECQA 5BJTA 2EIDA 3SDXE 5IVNA 1SDAB 2QSTA 2IV8A 3IJSB 3ZZQA 4LVOC 1KMGA 4RIRB 2FHBA 4DEWA 3KYNB 1W72H 5GRZA 4BQ6A 2EDRA 1M3IA 4A7GA 3S8WA 4YL9A 2G0LA 5MEOB 3MLXH 4X0NA 2OJ1A 3UJIL 5IOKA 1SJHA 3EJYD 3EG9A 4DGUA 1AD0B 4Y4KC 2IH8A 4FQCH 5D7IB 4O2FB 4UT6H 3QPQD 4N90D 1OGTA 3FTGA 3FH7A 3SDDA 1HZHH 2HLAA 4OLEA 1EO7A 1ZOXA 1TJIL 2PPEA 3S5YA 2HWZH 3E1ZA 4K8RH 5HP5A 1G0XA 4BSJA 3OAUL 2VN6A 3VYPA 2N7SA 2XBDA 3H3PH 2AJVH 4ZK8A 4CSZA 1V05A 5B7EA 3WO4B 5IJVA 4MSWB 3KPRD 4TNVK 1Z9MA 1R19A 1IBGH 3TYGL 3RWIA 2QHRL 1Q9OA 3RVTC 4UB0L 4A37A 4Q4IA 4JHZA 3QJQB 4OFKA 3VFNB 4OCXL 2HVJA 5EEWA 1O75A 3DTXA 3Q6FA 5A7EA 3P9LB 3LKOA 5C08A 4ELME 5HPOA 5AWNH 1IARB 4YXHL 1Q1JH 4L4VA 1AOHA 1YYLH 1OWWA 1L5GB 5CP7B 1S5HB 1RK0B 3SDYH 5KOMC 1J88A 2F18A 4UWQB 1PG7H 2DDQH 5CU9A 5EZJA 4BQ9A 2V37A 3FB5B 4QHPA 5F93C 1AG6A 1R5VB 4M5TA 4XTRD 1K8IB 4UDUA 4K7PY 8FABA 2JJWA 4H5SA 3N91A 3BC9A 2XV0A 3V4UL 3QJZA 1P0SE 2KERA 2Q10A 2E9JA 3RFZB 1BWMA 1YG9A 1M6OB 1TTCA 2JKWA 4PY8I 2QPFA 1QBBA 2HG5B 3LD8B 1FBIH 3QIWC 1ODAA 4UNUA 1FNSL 4K2UL 3IGFA 12E8L 4HKJB 3RGHA 1F4WH 4Q0XL 3T3MB 3VXMD 2APVA 5D1QA 3QQ4A 3WDIA 3L3GA 5BRZD 1UURA 4DIXA 1AGFB 1MIML 4HWBA 3B37A 5BMFH 2PYFA 5LDUA 2ATKA 2Q6WA 3L5WB 2P5EA 4LLWB 2HFGL 3SKNA 3MJ7A 1PKOA 5DUBA 4FL4C 2IANA 5JTWA 1KBGH 3AY4A 3FQUB 4L9LA 4QRPA 3KM2A 1T1YB 3U6XS 2RD0A 3QDMA 3DO3A 1G7LB 2ZXWB 3EJTA 2FSEA 2DB8A 4JNXA 3UTZB 1S9YB 5D4IA 4B5ZA 3MNVB 1YO4A 2VDOH 5E51A 1MWAH 4R0LA 3UZQB 2BOCA 5DD3L 1EZSA 4BH8A 4PJXB 4LOFA 1NMCB 3IK2A 2PTUA 3Q05A 4JHAL 3O9WD 5KS9E 1O0VA 4N0FA 1OP3H 3D9AL 3EDJA 1UTDA 3TT1L 1QLEB 5KW9L 5J1AA 3LH9A 5DHMC 4J3UA 4AYDC 4U1IB 3O2DL 4RBPK 5KN5B 5T8IA 1NCWH 3A3YB 3QAZB 4NNXA 5DMIL 1BBJA 1UD8A 3NA9L 1S7UA 2BVPB 3IE9A 1S7WA 5CJXC 3RY6A 4HUUA 5L6YH 1JBJA 2BHUA 1KLUB 1TMQA 1TF4A 4HZLB 2JI3A 3MLSL 3JTTB 1F4XL 4P5MA 1PG7W 1QSVA 2DH2A 4WENB 5JR1L 3ABGA 2K3HA 4QY8A 4RMUA 4Z7WE 3SDAB 3V4PH 2EUWA 2APBA 1BAFL 3MRIA 3IDMB 1QVOB 5L9DL 4JFVA 1OAKL 2VKXA 1JN6B 4MVBC 3OHXA 1RD6A 4X0KA 1GTNA 3EGSB 1EGJH 4B9YA 3EJPA 4IBSA 3HUJF 3L3OA 4KTDL 1MFVA 1HAUA 4XCEB 5GS1C 3MV01 4J3OG 4DFHA 2CLVB 3RBSA 3HMWL 5IP4A 3QUXD 4LCYA 2AXGB 1DTUA 1HINL 3LOWA 1IFHH 2WXGA 3DXAD 3CG8A 1KYOJ 3PRZA 3MRNB 4LCIH 1E4KC 4MSWA 1O7DE 1URIA 4LIQE 5DYFA 1A4JB 1Q9OB 3LPWA 1S7WB 1OP5K 3OHMB 5HVGB 5DMGC 3VDCA 2E7LC 3KLHC 2XWJA 4IIQC 3NAAL 3S35X 1SGKA 2Z91A 4ZNCD 3ZBMA 4L8SA 2UY7B 4XPHH 1YMMA 1NQBA 2XQYA 1KTBA 3QUZB 1MCEA 1I85A 2FDBP 1G9MH 2OMTB 3AVEA 4U2YA 5E1QA 2JB5H 1JPFA 2K6YA 1FGVL 3G6JA 4Y5VC 4Y7OC 2ZG1A 4YZFE 5DQ9B 4LCCC 4U1HB 1IM3B 1N2RA 2Z31D 3BEWA 3MNWA 4IGBB 2XYBA 4G8IA 3G6JF 4OI7A 3MXWL 2XDHA 2CAKA 1I4FB 1XGQA 2CRIA 3FB8B 1UCBH 5D1XC 2QZQA 5E8OA 4KXAA 2Q7YB 2WZPA 2YUZA 5FHBH 2H32B 2E3VA 2AQ3A 3STLB 2AABL 3UADA 4V1DA 1DVFC 1SOQA 1ZHBB 5K33A 1RZJH 2XXMB 3NZUA 1LP9E 3GWJA 2B39A 2VM4A 3L5XH 1S9VB 1OAJA 5SWSE 1F8TL 2OX5A 4TUOB 5IHUH 3TO4D 3SE6A 5I6NA 4QWWD 2Y5EA 4YE4H 4OZ4A 2IC2A 2VR6A 3HNVH 1MFCL 2J8UB 1FIGH 1SDDA 3MUY1 1UJ3B 3SYAA 2JIXA 4B9IA 3APNA 4P5TD 4B53A 3GMOA 4OFVA 5IEHB 3SQRA 3FRPA 4PP2A 5LAXB 2A9DA 5A6IA 1JGVH 4I0PD 3TBSA 3E6FB 4NQXB 3UCQA 2YD0A 4PPTA 2LE9A 4TNGA 1Z1WA 1KPUA 4AENB 3SPJA 2VZ1A 5B21A 1XGPA 4UQ2B 4J3OD 5DJ2B 3MUUA 4AIZB 4HK0B 4L3EA 4JN1L 1WBYA 4GLRH 4PGDB 2XWZA 1ZSDA 2AI0L 2OA9A 1MHCA 1RIUH 4KX9A 1J18A 3FCSA 2QDVA 3QIUB 4ISVB 5J56B 2Q76A 3IYLW 2R7EB 4NQVB 2QJDA 1JZ8A 5ITBL 3SPCA 3MRQA 1G6RB 1M7DA 3D6GA 3QNYA 4ODBD 1EFXD 4AH2A 3Q3GB 4P5KA 3I3BA 2ISDA 2EDOA 4PLNC 1RUPL 1N0XL 4WI0A 4YHKH 4M6ML 4XBGA 1D5BA 2BPBA 3VRLF 4XPAH 3QXWA 4HLJA 2MHAB 5FYKE 4Y1TA 1QO3B 1XIWD 2VDLH 3OMAB 5GISH 1XGTA 2CCVA 5BPPA 2ORBH 1G6VK 3Q7JA 1NJ9A 5IW1B 1F97A 1L3WA 3X12A 3O6FB 3ERXA 4ADJA 1Q9KB 5DHEA 5IVZB 3WFBL 5D9SA 4HBCH 2P5WE 3FQWA 1Z7JA 4LFHG 4BRVA 4Q6IB 1E9QA 2W9EL 1BM3H 1WWCA 3S88H 1TZIA 4WTXA 2ZAGA 3L3HA 4IRJB 2X2IA 2FWSA 3CHOA 1QR1B 3L6FB 1FVEB 2VDQH 3E7JA 1LJMA 3NJLA 2HRHA 5A2LH 5JHLH 4LSRL 1E4WL 3Q0HA 1ETZB 1I3GH 5DZLA 5ABDE 5A16A 2FNWA 3I9PA 3HLKA 4FG6D 4NQCD 3UAAA 1VEMA 2VDKL 3EJRA 3LKRA 4NN6B 5DYOA 4KAQL 1I7UB 3D07A 3IMRA 3T2OA 1E4HA 2G5UA 1A65A 2K4WA 4ABUA 3F7YA 5F0MB 3QEGL 2XA8H 3BKCH 2KUTA 1R5WA 1T21A 4PV8B 3H3BC 4WI3A 3BUDA 4JDZA 1KJVA 3FULA 3HI6H 2CA3A 3BCFA 3GNMH 2GKIA 2CGRH 1I7ZA 1OPOA 3RGVD 2BIMA 2N0MA 4NFBA 2FQEA 3BIKA 1A6VL 1CXFA 1J0HA 2OMZB 3S5LA 3SKMA 4YFLI 5TDNA 4FMVA 4PJAF 1WFTA 2ZXCA 3ZZSA 5JLZB 2VO8A 5F3HA 4L8CB 1UEYA 3RWFA 2QDWA 1LP9F 3AWEA 4ACTA 1GOGA 3GS4A 4ZNEE 4BELD 3ULUL 4YNYB 5HBBA 5DJ8B 2Y3NA 4CUCA 1K9TA 1N7ML 3BSZA 3ZMNA 2ZUVA 2AW2A 2NY0B 5JXAH 1ZT4A 4L3EE 4EVNA 1IEAA 2AFNA 3LNFA 3FW6A 4MAZA 3GSWB 2VZ3A 3VFPB 3QFDA 1IBFA 4YSPA 2X0UA 4MNQA 2ZF8A 5K39A 5HYFA 1I8UA 4K3EL 2DYSB 2LGNA 2L3BA 3GXNA 3T0AA 3WS3A 5EF1A 4WLCA 5IJKC 3HC4L 2JB6A 3WNNA 3NIFE 4TSBH 1JAEA 1EHLH 4WY7L 4ZNEA 1GZQA 2XBTA 3DTXB 3Q6FB 4X9BA 2FLBT 4OH2A 4KXZI 2RACA 5LCVA 1LO5A 5I5MA 4Y2OA 5KSAD 4XXDA 2CIKA 3PDOA 1H8LA 4O58H 5DRZB 1TTRA 3RKDC 4POYA 2HJFB 3WSQH 4X80L 1BPVA 4JFOB 2RGSA 1Q9LA 1NBVH 4KZEL 1B4JL 2W95A 1MAML 3AADB 1GVIA 1FDLH 4P2RA 3ME0B 1FE8H 1HU8A 1CD8A 2BDNH 3BAXA 4K3DH 4OCRL 2OMZA 4P2OC 1SFDA 3IMWA 2KYIA 5DJZB 2VSMB 5T5FA 3RE0A 1FG9C 2NNXA 4OZHA 4J3WA 1HXMA 1BFOB 1A4KA 3PL6A 5F70A 5CGTA 4LPTA 1KXVA 2Y7QB 4N87A 4GXVL 4GH7B 5JQ6L 1FNSH 4K2UH 4FLHA 5GGUB 2ZF9A 3ZKQD 1SXCA 5ETUA 3FU8A 4DO5A 5BQDA 3ROLA 3ELAT 1MPAL 5T5NF 2A9CA 3WO3B 2DAVA 3LH8A 3VFOB 3BKML 3IGKA 4GI9A 4R3SA 3SDAD 3V4UH 1BXVA 2UWEF 3GI9H 2VLRD 4P9HH 1LYQA 1H3GA 3M7FB 2YD1A 1OGAE 3ROLB 2KL6A 1DHKA 1QZ1A 3LQZA 4QXWA 1TTGA 5C70A 4WEMB 2KPWA 1KTKE 2VH5L 2WXHA 1A4BA 3PV6A 3B2MA 2R2BB 4KRMB 2DQEL 3JV6A 3L7FB 1ZAGA 3L3HB 5GGTA 5I1JL 3FUHA 3O6KL 1FPTL 4GY4A 2BIHA 4LPCA 1KCUL 2UY7A 2WN3A 3IJEB 3DOHA 4HF5L 3ZTNL 3LN5B 1MG2C 4W9HC 4X6FA 2O6CA 4YHOL 3KVPA 2BWIA 4Q97A 3FB6A 5BW7C 4L3CB 3X2QB 4G82A 4HZAA 2WQAA 3C8DA 4IU3A 1TJHH 1X5IA 3QZOA 2AV1A 2P5ED 3MCG1 1TETL 3T0EC 3VMNA 4NRZA 1KACB 4HX1B 3H42H 3V0HA 4WI2A 3FFOA 3GB7B 4C59B 1I3GL 2IDCA 4JFPB 4PJ5D 4WNJA 4PGEB 4XP9H 3AQZA 2NLJB 2ZP8A 1MCNA 4R3SB 2CDFA 3QDJD 4ZUVB 3ETTA 5CNHA 1MVUA 4BSWB 5AG8A 3RIKA 1SRDA 3TPUB 4F20A 2ZKMX 5KVGE 2NT1A 5DJDA 2P5EE 1XL6A 3OLEA 1BFTA 4KRPC 3K71A 3THML 2JKSA 4ODHL 2DJMA 5IR1B 4F7PA 1TQVA 3RGVB 4ZW7A 3FN0L 1YNLH 4JKNA 1DJWA 1UH3A 4IDLA 4Y2DD 3ZDXE 4BFEA 5ID1B 2JH2A 2PCPB 1MI5E 2R9HC 1IGMH 4IBZA 2VJ8A 3KAAA 5CEYA 5T33L 4AENA 5AW9B 3L4UA 1BIIB 1QHPA 4LESA 4OCSL 4ZDHA 1AR2A 2EEDA 2O6EA 2XWDA 1HK6A 3N85L 2YA2A 4N0UA 3TVMD 5BOJA 1A7NH 4LCWE 3NABL 3UPRA 1DEEB 3LDBB 3PGDA 4IRSD 4X6CB 1KYFA 3A6BH 2WBWB 4IYKA 1KCKA 4NCC1 3SDCD 4PLKD 2WBJA 4J27A 4KY1H 3SKOA 3WNOA 4CU8A 3SCMD 1DBMH 4IIQB 5H37H 4K9EC 4DGYH 3D08A 2X1QA 1RUAL 2K1MA 5FX3A 5GZND 2ICWB 1QBMH 3PUUA 1AFVL 4DK3A 2XCMC 1QKZH 4OGYH 5IM7B 2HFTA 1B4TA 1R3JB 2HJLB 3WY2A 4H25A 2ID5A 4ABVA 1WZKA 2WB1A 2YA0A 5ANHA 5BXFA 4LKXA 2JKJA 4OCNC 4L4JA 1W0WB 4CMMA 1S5IL 4GRMA 4WEBL 3MBXL 3T09A 1ZXQA 3AXLB 5D96B 3CTTA 4AL8C 2H0EA 4PIBA 1E50A 1ZEAH 1KGCE 3JQOB 3MRJA 3PXLA 5I82A 4X99A 4QJ3B 4AXWB 1U8MB 2AANA 4PS3A 4Z7UB 1I8MB 5AW2B 1GAFH 1WK0A 5E1HB 2OSYA 5DGQA 3WMQA 1H5BC 1X5ZA 3FTYA 3P3SA 5HYQB 4W6YB 3EYFA 1YMMD 2E6QA 1UM6H 2R0ZL 5ENWB 4OSUH 5CJBA 1QLRB 3P2TA 1EFXB 1UD4A 2J1WA 4ZAKA 4L48A 1W9XA 2JKIS 4TULL 4AIOA 3KS0J 2X4NA 5T1KB 5H8DA 1J1OL 4OCWL 5FGCB 5KVDE 4Y19B 5CLXA 4U3SA 1TTUA 3X13A 4MMYA 3L7EB 4XCFH 3DX6A 4ADIA 1M7UA 3VWJB 3LKRB 4P5SA 5DYOB 1RZJL 3JVGC 2DMKA 4LQFL 3KCPA 1VAHA 2ZAIA 2AMUA 4NSKA 5JIPA 3MBWA 4QTIH 5I1AA 1UWEH 5L2JA 1MUJA 2XY1A 2DICA 3DUUB 1BOGA 4MNHA 2XT1B 5D8JL 5CP3H 4ZXBA 1AZZC 4YR6B 4F8PA 3KYKH 1QYGL 7FABL 4PSPA 1PKQB 3SQOH 1D6VH 1URZA 2C9PA 4D0BA 4BGLA 2RCSH 2XXGA 1OCWH 1YC7A 1GKEA 2Z7UA 1FAIL 4NQTA 1X5MA 5B39A 5IB5A 1NL0H 1TZGL 3GF8A 3JXAA 1Z6JT 4NPYB 2DYPB 3KYOB 2FX9H 4RCAA 3LJ3A 1F4WL 4XP5L 4OCWH 1H3XA 5CM1A 4MCNA 1UXSA 4JKKA 2VAAB 4PMFA 1SEQH 3RZWA 4QT5A 4FQQB 4M3KB 5BO0D 4XO8A 4JRXA 1TMCB 5CCGE 3B7SA 1PG7X 4HFUL 4FHKA 4ACPA 3ATAA 1JXGA 4XOEA 4B9PA 1QSEE 4OFYD 4XNUH 2PW1B 3HEIB 1OM9A 1NIAA 3PP3H 2UUDK 1TFHA 5CIPH 3V0GA 4DP7X 4ELMF 4EXPX 4XP1H 1IFGA 1T6BX 1WGVA 2EICA 3BKYL 3EGSA 4U1SA 4OKVB 2L7JA 3MLSH 1I7TB 2FLMA 2MEJB 2YUXA 5C09D 2A74B 3GFUA 4AGPA 3G04B 5IK3A 3AUWB 3CCHB 4K94L 3O0LA 2H5UA 1BCIA 3EGXB 1A3ZA 2HB0A 3LZFL 3QUMA 4G43B 3UXFA 3MXVH 3L4VA 6TAAA 4U1HA 5KYWA 1EPFA 3IDNB 1E6JL 4P2QE 3LNDA 4G80A 1UJ3C 1JP5A 2Q5BA 1MSPA 5EWIH 1SYSB 1CLVA 2G2RB 2F7PA 1FFTB 4E41D 1FVDB 2KDGA 4L8SB 5C3LD 4RGNB 1DQIA 1O6SB 3DDGA 3OZLA 4LGRB 1H3TA 2OYKA 4EZKA 2HP4A 3BAWA 3OTTA 1T83A 4AC4A 5I71C 1ET5A 4Z7WA 4JM2D 4H2AA 2LVCA 5DRNA 1IC5L 4ZMZA 4P2QA 1QSEB 2A0LD 4IJTA 1JL8A 3LV3B 5DJXB 2K3TA 3GMNA 4MAYD 5IVXE 4I18C 1RK7A 5BRZA 3ZGIA 3ETBJ 4NAQA 1EEQA 3IGUA 1MCLA 3L16A 4EAEA 2NR6A 2CNZA 5TFSH 5IQMA 1HILA 2UWEB 4WDIA 1AD9B 4X50A 3KG5A 3LSOA 3F00A 2E8YA 3LZOA 3MRKA 4JEGB 2Y06H 5KVDL 1E5YA 3MRHA 4LVHB 2ZOWA 4CC4C 2C1OB 5KSAA 5BV7B 2APTA 4UQ2A 5DJ2A 5EO9A 1UM4H 4OB5L 3HHRB 3HPJA 3KPPB 4M3HA 4ONHA 4BUHA 1YDPB 1VIWA 4PV9B 1RURL 2BVUA 2EXTA 4Y89A 4QHKJ 4Q0XH 3QXDA 3TZVB 2E9BA 1KBKA 1INEH 2B2XH 4JHUA 3QDME 3DGDA 4PBXA 5EOTB 1MLBB 1VEOA 2BP0B 3MRLB 4X6EB 1U92B 4F80A 4N8CL 5DVPA 1GYCA 1QEWA 4ETYA 4L1TA 2SEBB 4DKAA 1JHLL 3I75A 1M1XA 4K7PH 5DMGD 5IESH 4KQ0A 1PAMA 1AD0A 3R0MA 1AZRA 1AP2B 1BZ9B 1HCYA 4XT1C 1JXDA 3CD4A 5TDOB 3UOAB 3EXLA 1E4KA 3C60B 1BGXL 3VJ6A 2X3AA 2XWEA 1YN7A 4PJXE 3UTQA 1U21A 1JHLH 5A40E 4WK0B 4MYPA 4YFEA 3H9HB 2EXWD 1WISA 4FKEA 3S36L 1PY9A 2XVGA 4TLTA 3A67H 1KG0B 5IOPA 1BQSA 2ALAA 2ZXDA 4EN3A 2BSTB 2OM5A 4YR6A 1XGUA 1H0DB 3MOQA 4YPJA 1Y6MR 3LHPL 4NDMB 5I0VA 2X1PA 1PNDA 1TTFA 2WVSA 1A9BA 1T5XA 3EOTL 4TTDD 4KUZH 4HCRH 1SUJA 1XSJA 1GW6A 4PM1A 1J7VR 1CE6B 3OKDB 5LLIC 4FJ6A 4JRXB 4YHNA 4Y5VA 5EU4B 3T77B 1S46A 2H9GB 4M61B 4PJ9B 4YAQA 3D0AA 2PXYB 4QTHB 3H1ZA 3ARXA 4U3CA 4YDMA 4IM8A 5K1VA 1B2WH 1RMFH 1JGVL 4CILA 3UTPE 3T2NH 1N5YL 3LXBA 4F2FA 3M8OL 3N06B 5JORA 3MUGA 3CUPA 2A3TA 2R29L 3VA2C 5DUPH 2FBOJ 4FGMA 2DLGA 4I85A 4LVEA 5D2LF 4N6RB 5I8EB 3D51A 3V0WH 2O61A 3C6EA 3KPOA 2F68X 3RURA 3CJJA 5CINL 5HI4D 5EORH 3LIZH 3S5ZA 1OIOA 3VX0A 1CE1L 4H0IA 2UX7A 1VHPA 5GZOD 1E8WA 4HD9A 3U46A 1TCRA 1TYJA 4E42A 3UTQB 1HKLH 3QZNA 3EH2A 1JTPA 3W82A 3UTSA 2X3BA 3HG2A 5ITFB 1L6XA 1WIPA 3Q1SL 2FH8A 5TGBB 5JOFB 4TUKL 1D6EA 3RNKA 1NBZA 1SBBA 4APQA 1MJUH 2ZWSA 5LBVA 3WN6A 1EFXA 4X5RA 2HT3C 2ZX7A 2XG4A 4AEIH 4B9ZA 5BVJB 3Q8AA 2OP4H 2H6PA 2FB4H 1YY8B 4H44C 1X9RA 2WVUA 4KTYA 3IVKA 2FEEI 1RIHH 1J8HB 4NNYA 3PUCA 4KITB 5L4MA 5D72L 1QW8A 3MDJA 2Q1EA 1G7PB 4YSOA 1RVFH 1CF1A 4AUYA 3CDCA 4J8QA 3U7AA 1L9PA 2ZXAA 2BOBA 4N3UA 2OTPA 1JZ2A 2WBJD 2BWDA 2W60A 5HGBA 3P3UA 4E42B 4Z7NF 4M7LL 1RK1B 2MWCA 1NGZA 4WJG3 4ALAL 1COBA 1O7DC 2NY4C 3KVDD 3X11B 4XVTL 3X3FH 3KPTA 4M1CC 3EJZD 3LZQA 1AGCB 3DIDA 4MAYC 3IPEA 1D9KB 1C5DB 1ED3B 2DM2A 2XWBA 3V5DB 4Q7DA 4DGYL 3JTTA 4ZMPA 2E56A 3IGAB 5CWSB 3W5NA 4ZFZA 4FX5A 5F9DC 1AXTL 5CIPB 2R56L 3JV4B 1NDGB 1TIUA 2HTKC 3GSNL 3W11C 2LU7A 4IHOB 4UTAL 4MQ7B 1SEBA 1NMCC 4KK5D 4LU5H 4J3TA 5DD6A 3U83A 4WI8A 1L0PA 1ZMYA 4LLMA 5AG9A 3ATFA 5BS0D 1C1EH 2VXQL 4H26A 3UBGA 5HYSA 3DHPA 5KEZA 1GGBL 3AT0A 1MQ8A 3H4FA 3HHMA 3NZHL 3BDYH 4M5YL 5GHWL 3AU1B 2HLAB 3GXIA 2I07A 5B1JA 2KI6A 4FQHA 4AIEA 1DSFH 3TT1H 4N8VA 4Z7IA 3BH9B 3TBVB 3BKJL 2MKLC 3WLWC 4UANA 5HYSB 1ACZA 3MA7A 1F45A 1H5BB 5EWIL 3DIVA 4OKVA 4GRLC 3SPGA 4Y4KA 3TA3D 1YQVL 3E9TA 3MLYH 4RIRA 4G42A 2KMWA 1OSYA 2ATAA 1EHAA 4PJAE 1OD7A 5FW6A 4LCWA 1WH0A 3HBGA 2ZPKL 2GT9A 2VSCA 3NIDE 5JIHA 2XNAA 2BWQA 2P5WA 3N0PB 4KK8D 4JG1H 4GQ9L 1QPKA 3UAFA 1L9RA 1OPGL 5B4MD 3TGXA 4LP8A 3HG1E 4KNSA 3LMJH 3NIGB 3FMGL 4XN9A 1JWUA 1RLWA 2LVEA 4NUQA 3MJ9H 4TTGA 2BVOB 4AIXA 4DETA 5IBTL 1W8OA 3FCBA 4JANA 3V0FA 1DJGA 4NRXB 1ILUA 2NUPB 2MKWA 4BZ2L 2PXYC 4TUJA 4UTBH 3BP4B 3QZLA 2AERT 4L1SA 3UAJC 2R69H 2O6PA 5F7WC 5IB5B 4LKCB 5F96H 4E9QA 5JHDD 1BMGA 4Y4KB 1HESA 4TUJB 2X4OB 2EQDA 3IS1X 1JI2A 2A6DA 2R27A 4MS8C 3GHBH 4NZTH 2CLRA 3P9WB 2CHXA 2RFXB 5E6ID 3FU0A 3ULVC 5E4EC 2YSTA 5TGBA 4DWHA 1BXAA 4KVNH 1NFDF 2CHWA 3GHPA 4NKOA 5HGAB 4GSQA 1IEBB 5E23A 1DN0B 1XO8A 3NABH 3NJKA 3P3TA 3C5ZA 3MFFB 1AKJD 1WBXB 1R47A 2XTJE 3SYCA 5LGYA 3WTXA 4F58L 1MHPL 2AK4D 3QIBC 4N5EC 3RBGA 4J23A 5HGAA 1U36A 1BAWA 3QIWD 4X7DC 3BD3A 5EO0B 2EJ1A 1CIDA 5C0FB 4BA8A 1IGJB 2A73A 3W0WD 2QLYA 4FA8A 4QF1A 3VXOB 2J3SA 1EZVY 4XMKL 2IOIA 2P8MA 2QSCL 4Y88A 4Y4FC 3VRIA 4F33B 2VLRA 4ZFFA 1S5IH 3CU7A 4GW5B 3TEXA 4BQBA 5AB2A 3ARFC 4NGHL 4NUGH 4XODA 4HIXH 2GSGA 4BUQA 3G5XA 1L0QA 2H0JA 5CEXB 3FQYA 2G60L 1PZSA 4AG4H 2VDNH 4F92B 4M7LH 5JNYB 4OFYA 1GAFL 1CLCA 3PS6A 4X6DA 1M56B 3M1BB 4KQ4H 4AGNA 1YY9D 3LRSA 1E28A 1J1XH 1QA9A 3VXSE 1CXHA 3NA4A 4TSBL 4F24A 4RA0C 3N41B 5I1GL 4G7VL 2O5YL 3QUMH 5EPMA 3KWTA 3IJSA 2Z65C 1MN4A 4UIKH 5KAQF 3EO9H 1TVHB 1T5XB 4G72B 1NSNL 5F3BA 2L7UA 5CJXA 3SZ6A 3TNNB 5J13B 3B2VH 1EJ8A 4G6ML 3QDJA 1YNLL 1AGFA 5I6XC 5D1ZD 2P5PA 3TJPA 3WL9A 1KNOA 1JOIA 3V0VB 2ZUYA 4R90L 3AAZA 4CRPA 2E7LA 2Y36L 1JHKL 3K80A 4ODTL 4LLQA 1N59B 5DTFA 1N64H 1I53A 4FN0A 4KPHL 1F42A 4G7YL 4ZQTA 1N68A 3BYTA 5EZIL 1NCBL 1RZ7H 3DOSB 4ONFH 4KXBA 4NP4H 3BMVA 1I9RH 2AK1H 1XD1A 5D2LB 3SJVD 3ZDZF 5D1XB 4YSEA 1ZGLM 2OKMA 2ENQA 1CGUA 3VXNA 2AQ1A 4LCCA 3FTUA 2ITDB 3OR6A 3O4LE 4UQAA 3A23A 5D6CA 1UGNA 4Z1PA 1FRGH 3T6ZA 3BZFB 1PY4A 4NZRH 5E2JA 2NY2B 4M6NH 5BZWA 1ET7A 3BZEA 3C9NA 3NZ8B 3PHOA 5I0WA 4XNYL 4J2QA 2WQRA 1KGXA 3LKOB 1JTTA 4Q74A 3UTSB 2VDPH 4JFPA 2HLEB 1A1MA 4GUPA 4E0RA 3K72A 3QAQA 2RTTA 4X98B 4I1PA 1S4IA 2W9LA 5CHNA 4FQIL 4NN6C 1N3NB 2COQA 1A1NA 2VDQL 3IJHB 3O3BA 4OIIH 5MEPB 1MAMH 5KSVA 2X4UB 3SDXF 3CN3A 3ISWA 5AKSA 2K9FB 3O4OB 1JSYA 1MRFH 1LO3L 1EV2E 1JVLA 4N0YL 1XCQA 3ARBB 4AV4A 3TESA 1JFQL 2CR3A 5KVFL 4NGHH 3ES6B 1J0ZA 3A4FA 2J43A 2O1AA 1MG3C 3FFCD 4XCCH 3GUTB 5IEKB 3CVHB 2PCFA 5C8JA 2CXKA 3CHRA 5MI0B 4C4KT 2Z4QB 4F7MB 2XFGB 2HRPH 3CX2A 4XPFH 4JKPH 3QG7H 3TBTB 1P1ZB 3IBOA 3N44F 3OGCA 4D9QD 2V9QA 4M9OA 3VH8A 4HLEA 5LXVA 4NQDD 4K3JL 3WIFB 3ZE1F 3BEWB 3IAPA 4GFXA 4XZ4A 1MHPH 2F54A 2PR4L 4BXVA 1TSHA 1FZKA 4XPFL 1UT1A 5TF0A 3ZHLA 4QHMB 5KVGL 3T1FA 4W81A 1ET8A 4LOUC 3LQAH 3SE4A 1B0IA 4ODXB 3PQYA 2QGCA 3IGAA 4PJEA 5CWSA 4ATWA 2CUHA 4QXVA 3CFUA 1AXIB 3MNWB 1PZ3A 4XX5A 1C12B 3I3DA 1NPNA 3C5SA 2ZKYA 5CZXC 2YD9A 1ADWA 4X4XB 4PWIA 2Q7NA 4A2GA 5C0GB 1M2VA 4OIAA 1HEHC 2H32A 4WKXA 4CVZB 4EN2A 2XQBL 5IEKA 5IB3A 1T5WA 5F1IA 3CDGB 4HEPA 3I6LE 4IGBA 4PJBE 4Y5XB 3P69A 3M7OA 4DO6A 3ARFD 1EHLL 4NQXA 5EIVA 2X53A 2WXOA 3F7LA 3KZ8A 5B1KA 2XTJD 4HJ0C 1I8KB 1ZT7B 2QHRH 4YDIH 5A7BA 4HWUA 2BH0A 1UJ3A 3FTVA 1CLZH 1O9ZA 4LEOB 3X17A 1KYDA 3VYNA 1AHMA 2WQUA 2XY2A 2OX5B 3TN0C 4P57B 4EIZC 5AKRA 3FS9A 2AQRA 1U91A 4PRPD 4MMXB 4XNAA 2CO3A 2NY5L 3UROR 4LCUB 1G7JA 2B9AA 2WKLA 3MRQB 1HE7A 1YPZA 3OPZL 1JPTH 2QPSA 2ZKXA 4LL9A 2YLHA 5M95B 1JERA 1U8JB 3MLUL 4XO5A 1LE5B 1JDAA 2BSRA 3CXDH 3ZL4H 4Z77A 4RISL 2V7HB 4UM8A 2ZUSA 1EAJA 3B6SA 1KBBA 4XMUA 1CBJA 2CO6B 1GHFH 3GZQA 3N1GC 4AIZA 1MUJB 1KIPB 1MCPL 2AXFA 4PAZA 2LLGA 2WLIA 2X6CA 1O5DT 4JFYB 5EOQL 3TH3T 2NNAA 3UBXI 1L9NA 1UYWH 5E8DL 3DGGB 1T2XA 3ULUD 1N7MH 5CEZD 4NP4L 2I7OA 2WZ0A 4CBPA 2WP3T 2CKBH 4OT1H 1BP3B 2EDWA 2OR7A 3UMNA 4AQZA 3PGCB 2D3LA 2Q9OA 3QJXA 4B6ZA 3BN9C 3HZVA 2H1LM 3MOAL 3U36A 4Z9KB 2IDQA 3ZQXA 4WHTB 5IZ7A 1YEKL 2X9ZA 1WIOA 3D05A 4GW4B 1T04A 3OKEB 3SO5A 3RZCD 2X12A 5FIEA 3S2AA 5E2VL 2PKDA 4N2EA 5HHMD 2ENJA 1ERNA 3TBYA 4MJHA 3O3AA 4KZDL 3P40A 1A7PL 2I24N 3PFUA 1I7UA 5MEND 3CBKB 1U8LA 4MQXC 1WFJA 3NCXA 4BWTA 1BMWA 2GHWB 4HWEH 2VN7A 4IU2B 5IQ9A 4YHML 3O9WB 1DFBH 4N2GA 2ZX5A 3MJ7B 1F56A 3CSGA 4B9KC 4OF8A 4X4YA 3MLZL 3G9AB 1E9QB 3T0WA 1VACA 2QSVA 1SLUA 1OALA 4BZYA 1PAZA 4IRJA 4WWOA 4XVSH 1QR1A