3ASWA

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
320
structure length
320
Chain Sequence
b'GTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 81
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA02
4B60A 4MBOA 4F24A 2Y7MA 3IS0X 4LE8A 1R19A 4LEBA 3IRPX 4MBRA 2RALA 4F20A 5CF3A 2Y7OA 5IHWA 4F1ZA 2F6AA 3V10A 2VR3A 1N67A 2Y7NA 4F27A 4JDZA 4B5ZA 2YLHA 4FJ6A 3IS1X 4JE0A 4JDZB 3IRZA 4LEEA 3ASWA 2Y7LA 2F68X 3AT0A 3AU0A 1R17A 4BBWA 4RMBA 2Z1PA 4Q6KA 5CFAA
chains in the Genus database with same CATH superfamily
1T6BX 3GKWL 3HC3H 3LEXA 1Q1JL 1ZPLA 2YFOA 3L3GA 4OF8A 4W1TA 5LXGL 1AQ8A 5L6YH 1EDYA 3S88H 2QZQA 3NIDE 1LXMA 2NY0C 1L5GA 4WRLA 1X5LA 1OGAB 1DQQB 1B2WL 2R9HC 4QNPE 4NC1C 2IQAA 5DVLA 3CIQA 5EEYA 2XFXB 4B97A 4ERSH 3RIAK 3WN5B 3LJ3A 1NGWB 3MV9D 1BD2E 2FH6A 1HSAA 4YNYA 3BVNB 3FB6A 4DTGL 2C9SA 3P73A 2VLKB 2FSDA 4OKVB 3KEDA 1RZKH 3WFDL 3UC0H 1U33A 2ZF8A 3D5OF 1FH5H 4OV5A 1NCNA 2WTPA 2E7DA 4D0BA 1GZPB 4H8WC 2ZP8A 4PJIA 3TWCL 3ULAB 1GA2A 1XB3A 4B41A 1CT8A 4M7JL 5ECJE 3GMRB 1KCVL 4RQQB 1EMTH 3Q2WA 4OLWL 1AOZA 3B9EA 1MHPH 1KIPB 2QFRA 5I1EH 5DLMH 3TBYA 4PR5A 1CIUA 2QQNL 3PWUB 5KBMA 1QBLL 4AH2B 3MCKB 4NNYB 3NCJH 4G8EA 5I6NA 3QDME 3U2SB 5GS1B 4NNXA 2WBJA 4JM2B 1TKWB 4JVPA 2ZONA 2DRUA 4PCSA 3K2IA 1X7SA 3IFNH 4DJMA 5F1IA 3ZRFC 5IY5B 4X4ZA 3ZN6A 1D6VH 1NIBA 3DX3A 3EOTH 4YVUA 1DQLH 3EYFB 4YUEH 2GIMA 4NB7A 4Y19E 1YEFH 2RBLA 3G3LA 4M9PA 2VMDA 2WXMA 3SKUD 3VYNA 4NUGL 3FFDA 1SN2A 2OTUA 2VISA 4JANB 4TRPL 3CZFB 4E9RA 3FUMA 5BZWB 5I1GH 1AR1B 3DRTB 4LDEB 1KYFA 2XC8A 4QI3A 4L8SA 4JPWH 3KEHA 3CPLB 1RUKL 5F0PB 4PJDE 4HS8H 25C8H 1WFUA 1XB6A 5D7KE 4ZAKB 1PIFA 2J8UE 5I74C 1XR9B 4BXSV 3DGGB 4MXQC 3V0JA 5CEZD 1J1OH 1PG7X 3AADB 5EA0H 1I8IB 1HKLL 3IJ9A 4N8UA 3D85D 1PKQE 3F7LA 3TT3H 4HIXH 1KUMA 3IM1A 3CXDL 5KOVC 5KJ4A 1QNZH 4L3EB 2CDGA 4LPVA 1VGEL 3SGDH 4GUOA 4YBQC 1YC8A 1ZVNA 5CMAB 2IFFH 2J7LA 4G1MA 2R2CA 3LRSA 4NGHH 3N41B 4ZUUA 1DQJA 3QIWC 4WUUB 3BH8B 2E0PA 3WGUB 2NX5B 4KK9C 3QI9C 4YLQT 1EXGA 5KS9F 4PJCF 2ZG3A 2P7TB 1A0QL 3FB7A 5DMJB 1IC1A 3WMSA 4XC1H 1TENA 3Q1SH 4MXQD 3V52L 4DAGH 1LEKA 5F3BB 4FE9A 2OMUB 4F7EA 4AM0B 5C07D 5DVMA 2HJLB 1QSED 2JVUA 5DRXA 2F53D 4GG6E 4IBWA 4I1NB 1DVXA 5J1TC 3OAWA 3SKMA 4NKIL 1F6LL 1IUZA 3DO7A 4U0QB 1RJLA 3SBQA 2YBRA 5BRQA 1NCOA 4ZSOA 4DNLA 2PP9A 4ES8A 4YBQD 5I26A 5SX4I 1QFUL 1B6UA 1QRNB 3VXRE 2PO6B 4BZ1H 3QIWD 2X4PA 1WUNT 2FX9H 3LHAA 3GWJA 4JPIB 1AHMA 3PHAA 3FRUB 3QI9D 2R0ZL 4KK9D 4U1GC 3SBRA 2AI0L 3V6OA 4BYHA 5IHUL 5AB9A 2P1YA 3FO0H 2X0VA 3B6SB 4ZODA 4XPBL 2JQZA 2G2RB 5CIPH 3OG6B 1MFCL 5BS0B 4WK2B 4PJHB 2HN7B 4XRCB 5EG6C 3E2HC 4IU2B 2FWSA 5FAAA 2EVJA 2E27H 4X4XA 3WKQA 5K93A 4UOW1 4ICWA 3ZY7A 5DJCA 2AHIA 3U9WA 5DJAA 3ZHDA 2EYRA 1KACB 4XP9L 1DCEA 2CE6A 5LAXA 3QQ9C 1XB8A 1UA6H 1MHCB 3CN4A 3LRKA 3WS6C 1MFBL 4M6AA 3WY2A 3M1BA 1U91A 5I1AB 1RK0A 2DQJH 5FO8B 2VDKL 5LO7A 5JW3L 3A47A 3GIVB 3E9TA 1PKOA 4G6FD 3U36B 3CV5A 4GP8B 1KLFB 2ROYA 4FFZA 3TZVC 5B7EA 1SYVA 1JK9A 1WRFA 5EF3A 3KPNB 3QUGA 4XZ4A 4Q9RH 1N3NA 1VZGA 4XVSL 2QKIC 3PDGA 3ZDXB 1ZGLM 1RKRA 1N59A 4F7PB 1G9MH 2VDNL 3ARSA 3NJVA 4BM7A 4WU7B 3MRIA 4NZTH 4U0RC 1C5CH 4RAUA 2IWKA 4XC3H 5C0CB 5ICYB 1NDGB 2HFGL 5DURB 1KXQA 4FHKA 3BFWA 4OF0A 3VXPA 2OL3L 4URKA 3IXAA 4PMEA 5TPWH 2YPKB 3EZJB 1NJ9A 1UOWA 5T1LB 4OFDA 4N2FA 5HY9A 5D7IE 4IJ3B 5IB2B 1T7VA 3D6GA 5I76A 3DBSA 2KL6A 3L4ZA 1VSCA 4Q0XL 3EYUH 5IK3B 3TPUB 3AQZA 4R0LB 3GMPA 5AZ2H 2A9MH 1YYLH 2JF1A 3CSYB 1PLAA 1WTGT 3GQFA 1RZ7H 4M1DL 3TZVD 2K3TA 5EDSA 1NCBH 4UYPA 1L3NA 3KVDD 4RDQG 4EI5B 2YEZB 4Q4IA 1HS6A 3PL6B 4GRWF 2JKIS 1YUKB 4JRXE 3T3PE 3TURA 3L3OB 2VXQH 7FABH 1BLNA 1YEIL 4JLRA 4TVPH 1YVLA 4KRPB 2FWOB 3OAUH 4CU8A 3AU0A 5I8EB 4WDIA 4Z7OF 1IGCL 1CIDA 4DOHE 3I6KA 1QEWB 2VE6A 2ITCB 5BZZA 1HINH 1EH9A 4KV5F 1Q94A 2Y5TA 5AAWC 4B95C 5DMGC 3HB3B 3FCTA 3FXIC 3MLRL 4NQVA 2HFEB 1ZT7B 5JPMA 3MRBA 1ECZA 4G7RB 4P4RA 3D69B 3EJSA 3IJSA 3OPZH 3UZVB 2ZYSA 4M8QA 5DJXA 1C5DB 1JGEA 1QBBA 1S7XB 1B4TA 3NJHA 3MJ8A 4ZMYA 4BFIB 1JFHA 3PGCA 3H8NA 3LQAH 3D25A 4H0GA 4LMQI 1ZHLB 1ZTMA 3UIYA 4OQTL 3ILEA 2C9XA 2CZNA 4UQIM 3ZKSD 3OAYH 3WMPA 3DVIA 1ZDQA 3EJTA 3GMMB 3UBXA 3IE4A 1UUSA 5K9QI 3O3AA 1HH6B 4L23A 1Q0YL 3DTXB 3L4VA 4Z7WA 2R4RL 3A22A 1KIUA 5DMGD 1TZHA 1FO0B 4WW2F 4WI6A 3HZKA 5C0EA 1Y7VA 2IH3A 2ZXGA 4Y5XA 5CS7A 2N7BA 1Y6MR 4HUVA 5KSAA 3RTQC 2C3XA 4AEFA 3QFJA 4LVOC 1BZQK 3DTUB 1JZFA 3IDYC 1XEDA 5C6TH 4DO5A 4C56A 4NI3A 4RWYH 4LSQH 3EYOB 3AXIA 3CHRA 1NEZA 5D71H 2M83A 3Q3GB 4GUCA 4YGAB 1T2XA 1NBYA 4I18B 2ZIDA 2I7OA 2VLJA 2H4EA 3ROLB 1BM3L 4OT1L 2M2DA 4PJAE 2CJUH 2IJ0C 4HUUA 1DJSA 1U6AH 1WBZA 2CK0H 1UCBL 4C4KT 1XCXA 4LLAA 1RJZB 5D1QB 1ACYL 2W91A 4PQXA 4OM0L 5I19L 3WKNA 3TEWA 4ZZKA 1ZV9A 5F7AA 2LLNA 4LLDB 2YJQA 3HAEA 3TBSA 4RESB 4BZYA 3D87B 5BXFB 3FU7A 1C12A 4WFHE 3ECBB 2WSDA 4D9QD 1JYNA 4HSQA 4PGEB 3WHE0 4IW4C 5E4EC 2O61A 3CZNA 3GPEA 3WY3A 3HN3A 1I7UB 1R5WB 2CGYA 4H26B 1E9PA 3BKML 5IFHH 3PS6A 1EJOL 4ELMF 4TQIA 1P6WA 4FTDA 1ZS8A 3D0VA 4X7FC 5TTRA 3V0EA 5GGSY 2BW5A 3NPZB 1F13A 3VXME 4AUJA 3O9WC 2AGJL 1TJMA 1XCQA 3L9YA 4DKEL 3ETBF 4BRJA 3LYRA 3SPHA 6TAAA 5DGQA 2AV7B 4AYGA 2ZJSH 1S3KH 3AXLA 4ONOA 1N6QH 1P7QD 4RNRA 2QEJA 2X3AA 4L8DB 1HL4A 2CIKB 2Z1KA 3BYTA 3MJ9H 4G5ZH 4ZOBA 5KAQG 4HLZH 3BUIA 3BHBA 1ZLWK 3GZPA 1U8MA 3SO3C 2OA9A 4A68A 4E41D 1XF2A 2X6AA 4G9FB 2PW1B 4M03A 2OM5A 3D0AA 1F3JB 1CICC 1JCVA 2GC4C 3QXAA 1TNMA 4J3UA 4ZO9A 4X7DC 1GYCA 4Q6KA 5IM7B 4YAQA 1AD9B 1FZKA 1KC5L 2CGZA 2OCCB 1ERNA 3B2VH 3BN9C 3QHZL 3RJQB 3OF6A 5I15H 3QUMH 3MOAH 1IAII 3O9WD 5ANME 4M6NH 4NT6B 1FBIL 1IT9H 3NJLA 5C08D 5JQ6H 1CK0L 5HHVL 3CZGA 4MJIA 2NY3C 3R06B 2ZX6A 3JVFC 5FYJL 1RZ8A 5GXBB 2R39A 2AMUA 3GNMH 5CILL 1GPOL 1WFJA 1DO6A 1XH2A 1EUTA 3S8WA 1DDHA 4O2FB 1P7HL 4BUGA 1T89C 3T2OA 2OW7A 4L4VB 1CICD 1H3VA 1N70A 3GBNH 4YZFE 5GGVY 2VDLB 4KI1A 4Z7WF 4NIYE 1C9SA 4NPYA 4AQOA 1JHTB 4EXKA 3BN9D 3KH4A 2JKNA 2X4OB 1KTDA 2BIMA 3MRCB 2G4GA 1XZ0A 2P5EB 4FQ2H 4OBRA 3H55A 2OP4H 2VDMB 12E8H 4JO2H 1MNUL 1OTSC 2CG9X 4RGNB 2Q6WB 3QULA 1QLFB 2UUDH 4FZEL 3LIUA 4OQ1A 1X5JA 3OG4B 5B8CC 2OK0L 5GGRB 5T8IA 1TEFA 2LHAA 1YECL 4BBWA 1BXAA 3HNTL 3DVNA 1WAEA 1Z3GH 3U6RB 5HHMD 2ZOKB 4AMKH 3SDAA 4B53A 1UCTA 1IAIL 1G84A 2MKWA 4M6OL 3SE8H 3U0WH 1ZHKA 4Y7OC 5EOTB 2WLLB 4H20L 3BH4A 1S3RA 3PP3H 3L9RA 5ERWA 2K4WA 4S10A 4NUPA 1F6AB 2VLRB 1YQVH 1RUML 3RX9A 1IKOP 1MCBA 3GHBH 3MV8E 4WV1A 1F4XL 4MQTB 3MMEB 3RX8A 2JMRA 4NERA 2BC4B 2WQVA 5KYYB 1PL3A 1OTSD 4XCNA 3W37A 5KW9H 4BHUA 4KXCA 3FT2B 1G1OA 3PWPA 4MAYB 4G7SB 3T0EC 5AVQB 2CO2A 3FFOA 3DHPA 2MQGA 1IGJA 2BP5M 1UJ3C 3IU3A 1KJ2A 4TL4A 4NQCA 3Q01A 2JKWA 4OI7A 2BMKB 1JNLH 2UXTA 2L04A 1HCFX 1XL4A 2VQUA 4G8GD 3ZUCA 5I6MA 3CDFA 4EBQL 5AVVB 5AVRB 1YPZF 2P48B 5AZEL 4ONHA 3BZEB 4LNRA 1BFOB 2CRMA 1KPUB 3ECQA 4PRHB 1OP5H 3VDAA 4Y8AA 3DX6B 4X8CA 4L37A 4WF7A 2YRLA 2ZPKL 2AK1H 4L9LA 2VKWA 3T2QA 2MNWA 3JWDL 4X4YA 1ZIBA 3QORB 4HF5H 3U4BL 5FUOH 2HUEA 4TUJB 3VACA 1AAJA 1KZYA 3PHOA 4XMPH 3T0ED 1E43A 1V7NL 2GJZA 3MNZB 1XGPA 4JFXB 2XVGA 4PRBB 4U49A 4KQ0A 1PPIA 4FLSA 1PLCA 4E5XG 4U1KB 3SJVE 4LCYB 5C09B 1B0RB 5T1JA 5I6KA 1RIUH 5AB1A 3HOGA 2WLYA 3ARWA 2AJ3B 3I3EA 1P9MC 3ULVE 2ZUSA 5JNYA 2VXSL 1PNCA 2BY1A 1GMIA 2EJ1A 4OGYL 1U2HA 3L3JA 3EYSL 4HW6A 5ESVA 5HHXL 3WFHA 3FQWA 5L88H 1RZGA 2A6IA 3G08A 4DQOH 3G9VA 4DZ8A 3RGVA 1QA9A 2CU9A 4HCRA 3RWCA 1IEHA 3PXJA 2W94A 2X5PA 3CBRA 4AKPA 3GSWB 3MRGA 4QJ5B 3QJFA 3D4CA 2K4AA 4ZMXA 1Y0LA 4M4RA 2D7PA 1XV8A 2R0KH 2AXFA 4CA4A 5GZOC 3FT1A 2CNZA 1IGMH 2NYYC 1NZRA 5A7EA 4WEBL 3QBTB 5HYJD 4M61A 1ZANH 2DEYX 2VW7A 5GZNA 4N0RA 4U1MB 4LSUH 5L9DH 1KJVB 4HKBB 2GB2A 4WTZA 2E9IA 2P24A 2DS4A 2NSQA 4WVRA 3VFMB 3GLDA 2XTJE 2N01B 1MCOL 1ULVA 3GSVB 1VPOH 2Q2EB 3MRPA 3CDCA 4FQ1L 4GSQA 2DYRB 5DR5L 5DA4A 1IL1B 3HR6A 1RJCA 3W57A 2DWEB 4KVCH 4HWBH 5B1BB 2BDNH 1JGLL 3N44F 1JERA 1TQCC 1RXLA 3DIFA 5GZOD 4XI5C 2VRAA 2NYYD 5KBPA 2CKBH 1TLKA 2BSRA 2VAAB 4UT6L 3QZWB 4EUPG 4M5YL 3D18B 1CLOL 2BRRL 1ZHBB 1F90H 2DBLL 3R18A 2HP4A 4GMSH 3RVVC 4U6HA 5FCUH 1RZJL 3BO8A 1N0LB 2FIKA 1T3FB 5E9DE 3LQAC 4H2CA 1UWEH 4TVPD 5KS9B 1DVTA 3CHOA 3FU0A 3GMQB 4IOIA 1BBDL 4TKWA 5HDWA 3V4PH 2B2XL 4MB1A 2AVFA 5DHXB 4PG9B 2UZYA 3I3DA 3Q8AA 2VZUA 3TL5A 1T1XB 2IPUG 4WY7L 3LEXB 4NKDA 3L3GB 3H4FA 3TBTB 1SQ2N 2VGLM 4XI5D 4F2EA 2GKIA 5C07E 4BFOA 1FO0L 4C59B 2F53E 1GC1H 4WLCA 2WXPA 2NR6A 3VMNA 2YD8A 3CVIH 4Z76A 1O9WA 4OSUH 3BEVB 1S7SA 4S1DC 5EO1A 1XMEB 4HBQA 2VN7A 3K2UL 1AGBB 1YMMA 3VXOB 4HJIA 4YNYB 3FB6B 2WWKO 3DX9B 4U4BA 1AGCA 3P73B 3LQZA 4OTXH 4GXFA 1NMBL 3LZFH 3MNWA 2NLJB 4OV5B 4ZTPL 4IBLT 5ES4B 3VI3F 1QP1A 3ZTNH 3VWKB 1NOAA 5B7MA 5L4MA 2CLZA 3C08H 4UQEA 4PJIB 2R4SH 3ESOA 4UT7H 1XXFC 4V1DA 2DQDH 4LQ1A 2E9JA 3HS0C 3CUPA 1HNGA 2DIJA 2Y24A 2YA1A 3DXAB 1ITCA 4JN1H 2JIXB 2EVGA 2HT2C 2XWJA 5GS0H 4XNUL 3TBYB 4Y5YB 1R17A 1EAPA 3FN0L 4S1DD 2H6PA 4YPGA 5IV2A 3IKCB 3MGOA 5I6OA 1R46A 1H5BC 1UD6A 4YE4H 3H6JA 4PVMA 1YSOA 4OM1L 4X5WA 4NNXB 1ZTXL 2WBJB 5K59E 3CN1A 2AZAA 4ZFFA 1S9WA 4Z3HA 4L9DA 2ZX8A 1IX2A 3KGRA 1A14H 2ICWA 1GSKA 3DARA 4M56A 3GMNA 3T09A 3HC4H 4HPYL 4PJEF 5TF0A 1UT2A 3QUHA 1B0GA 2VISB 1KCKA 3BWUC 5J89A 1OE2A 1QWHA 3GFUA 2QSCL 3OHXA 1RVFH 2OMVA 2D03H 1UM4L 3V6BR 2HVKB 4LHUG 3GSNA 3L81A 3ZQXA 1JXKA 1KEML 5C86A 3RIAF 2VWEE 3NJJA 4I89A 3VX1A 4M7KH 4R5TA 3L48A 4S1RH 5D7LA 5E5UB 5E5LA 2IANB 5CJQH 2FB4H 4L29B 3EDDA 5EORH 1G7IB 1AG6A 3II2A 2CHZA 2FL5A 2OMTA 2FGWH 3T4YB 3Q9QA 4B9IA 2RTTA 3BQVA 3TYFA 1KCBA 4GRWB 4G6AD 4PWHA 1EWHA 4LU5L 4PTUA 5DVKA 3VJ6A 3H2QA 2CDGB 1ETJA 1YNLL 2DICA 2DLFL 1YAIA 1KJ3H 4J2QA 5EU4A 1Z7JA 4G1MB 3K5SA 2K78A 3LRSB 4P9HL 1DQJB 2IBZX 3V8OA 3JSSA 4GKLA 1XGRA 3CFDA 3LPGA 3GRWL 1AXTH 1KBBA 1KCLA 2ENPA 3FB7B 4LP8A 5EZIL 2XU9A 3RP1A 1IBYA 4S0TD 1MCSA 5DJ6B 4NJ9H 3LEYL 4UM8A 4Y4HA 3ECUA 4HIJB 1UENA 2J4WH 4F7CB 4F7EB 4XMLL 2ARWA 4K3JH 3BPLC 5DRXB 1JZ5A 2VDLL 4UTBA 5DWUH 1OPGH 1KGXA 3SKMB 1EFXD 1PYWA 4RRPM 4YX2L 4ACPA 1USQA 2OBGA 3DO7B 1RJLB 2MOGA 2YBRB 5IQ9A 1DSFH 5JW4N 4ISVA 3VWJC 4ZSOB 1QRKA 2VDML 3OXSB 4PCKA 5AOIA 5EIIG 5CCHE 3S5LA 5CAYB 1YY9C 3UPCA 4DUXA 1U2YA 5CCGE 2X4PB 2BCKB 2I32A 4HCFA 5ISZB 3UTSE 4WW2B 5H37A 1MELA 1I7TA 1KXTA 2MH4A 5FHBL 1B4RA 3QCVL 2X40A 3U1QA 1BZEA 2X87A 4D94A 4HGKC 4E68A 5BVJB 2PABA 3MV7E 1AACA 2OYPA 1D5BA 1KB9J 4ATTA 5DJZA 1WCBA 4R97C 3G5YA 4BD4A 4X4XB 3P3SA 4HOZA 4HU8A 4ADGA 2OMNA 5DJAB 1AANA 3DV4A 3BZ4A 3VWJD 5LAXB 1AQDB 4WHDA 1P7KB 4H8HA 1RUAL 1JXGA 3G7TA 3S2CA 1DL7H 4QJ3B 1IGIH 2YUZA 1RK0B 1KLGA 1N8OE 1YY9D 3HE6A 1NCUA 2WQRA 3G6JF 3O0RH 5T3XL 4A2DA 3QS2A 2TSAA 4NO3B 4X98A 4BK8A 3K6IA 1N3NB 2XN9A 4S11A 5ACMA 1JGUL 1N59B 5HYSG 3Q06A 4OD3L 2BIQA 5KSVA 5JIQA 4PJBF 1JF5A 4RAUB 3L95B 1CFSA 1MWOA 3BN3B 1TSHA 3NTCL 1NJ9B 2AQ3A 5AAMA 4L8CA 5E6RB 3N0PB 2WNKA 1P5VB 2FECI 5HY9B 3NCMA 3RA7L 3TU6A 4ELMB 5I76B 4OZFA 1A4JA 2NXZC 2BVUA 2YQ2A 5FGBC 4GMTL 3GMPB 5IVXE 2ARJB 3IAPA 1L9TA 3Q7JA 3OJDB 4U1HA 5D7EA 1QPPA 1WLHA 3K1DA 3NABH 4M8VA 1X7TA 1BOGB 1IV8A 5ANHA 4TPRH 1B6DA 1IM9A 3QNXA 4HAFA 2QMKA 1BLNB 1RUQL 3WIIH 3ZOAA 5IT2H 4QXGL 2QT6A 3MODL 4OY9A 3P0VL 3BDYH 2OS7A 4WDIB 4L2YA 5GSRA 4WK0B 4OJEH 4DQAA 4K8RH 2VE6B 1MIMH 3EHBB 2D9CA 2E6JA 4OFVA 3MN8A 4YXKH 2A99A 5T5NF 2Y5TB 2VUOA 4LVHC 4LFHG 2NXZD 1ZT1B 3FCTB 4K3EH 4NQVB 4JY6A 2BFVL 4ANXA 2ZCHL 3MRBB 5CUSL 4P4RB 1CL7I 3D09A 3HNSL 3N1GC 4YBHA 2ZP9A 3K71A 4PU2A 4M8QB 1B2YA 4KRMB 1D6EB 5DJXB 1JGEB 4EN2A 2DYPD 3U4KA 5SWSD 2FECL 4J3BA 3MUUA 5LNGA 3PGCB 4F37K 3H3BC 3O4OC 1BG9A 5C08E 3D25B 4PJGF 1HWWA 3IPEA 4JFFA 2X2IA 5TH2A 3UBXB 4CW1A 3MRJB 2MIZA 5AUMA 3SZ6A 1VF5C 4HOWA 3O3AB 1OLLA 2NY7L 4Z7WB 2IAMA 3E8UL 1KIUB 3GK8H 2LAGB 2YXVA 1MY5A 4JPVL 1FFPB 3HTLX 5E9NA 1FNGB 3AFLA 5C0EB 2DQIH 2JKTM 5B1KA 1JPGA 3SGJA 4WJ5A 2ZSWA 5KSAB 2I7SA 5AYUL 1HZLA 3CC5A 1MCFA 2YXMA 5E5MA 1HE7A 5ACLA 3WIHL 1DCLA 3KR3H 3J27A 3QFJB 1JIBA 3ALWA 2NY4D 3EGDA 3P3RA 3QC6X 3QNYB 4GNKB 3KJ4B 4QRPD 4HS3A 5E2WH 4C56B 4ZFGL 4OIIH 3UTTB 3HS9A 1GIGH 2DJMA 4NWTH 4ETYA 3ILDA 4HPHA 1NEZB 1CL7L 2ICEC 5HHME 1R33A 2VLJB 4RZCA 1U8JA 4NKMB 3W5NA 4ANUA 2IMNA 2PYFA 4E9TA 2AK4B 3CVDA 3TBWB 32C2A 5G5DA 3G04A 4QF1A 1D5IL 3IGLA 3TN0A 4YC2C 2F18A 1EQWA 3RRQA 1A7PH 2H32A 2D73A 2EECA 5A1AA 3KXFE 1QTYT 2P44B 4IGBB 4PTTA 1J8HE 3FU7B 4G72B 1C12B 2EC9U 4LNVA 5JHMA 3W0WA 3FN3A 4GQ9L 3QDJD 2OCFD 5CZKA 2HZHA 3P2TA 4FOMA 4X9YA 2O61B 3UJJL 4AQAB 1Y07A 5F6IC 3PAYA 4XP6H 5DYOA 2GJ6A 4AIZA 2CMRL 5J12B 1YPZB 4NO2A 4RFOH 3RWDB 4HU2A 4F92B 2HRGA 1ZS8B 5DD0L 3D0VB 5D1XA 1A8ZA 3BLKA 3DPBA 4BFRA 5I5MA 3DMMC 4OJFH 5AW7B 3LNFA 4XCFH 4I0PA 2A0LC 4R4BA 4JCMA 2HKFL 4IIQC 2D3JA 3QWRD 4P23A 1TJGH 4XNQA 3AXLB 3NIFB 5HI4C 1UM5H 3KHQA 2W65B 2ILLA 5GS0C 4OD1L 5IWLC 4LCWE 1Z5HA 2E7BA 2IMMA 1QX1A 1JZEA 1RPKA 4KITB 5I1LA 5KG9A 2XN2A 3FF7A 5KJRL 4HD9A 3WTTA 1QHPA 1XF2B 1KULA 1E4WL 4DKFH 5DQ9A 4FZ8L 1FDLH 2YPLB 3MNMA 2YMXH 4RMBA 3QXAB 4HWEL 1SPDA 4H1LG 3FHAA 3FSZA 1ZSDA 5A16B 5CN3A 1TO4A 3AJ7A 2ZT9C 1KXHA 4U05A 4YAQB 3MXWL 3K7UA 1OARL 2VABA 4GBXC 3U9UB 4CBPA 3DMMD 3SGKA 2UY7A 3ATEA 3B56A 4FLRA 5DTFB 2O72A 2EE6A 3DI2B 4Z3EA 2WZAA 1FF5A 3GBML 2XT1B 4ORZC 4LL9A 4I13B 3ZUNC 2P5PA 1LEGA 2PYEE 4NO0D 3H9SA 1T20B 5HI4D 5GS0D 1FGVH 3GRBA 3RBGA 4WFGD 4OLXL 5TQ0H 5IW6B 1TU2B 4UB0H 3SYOA 3V95A 3LV3B 4IRZH 1KCRH 2B5IC 1UXWA 3VTTA 4ZO8A 2ZUYA 5C0AA 3O3EB 4BRVA 1NPUA 3EH4B 1DDHB 5L8KB 3G9AB 1CBVL 3NSCA 5IB1A 5C0BD 4PRPD 4TSAL 2MHAB 3QW9A 4KXZI 4NPYB 3LXCA 2OR7A 3C6LC 5HYJE 1NMCB 1KTDB 4I85A 1OAYL 1XZ0B 4M5TA 3PQYD 4XO4A 2D31A 3LS4L 2HCZX 3QULB 4FQLL 4GYBA 1FNFA 5ALBL 4ONGH 5IESH 5F6HI 4PVNA 3SDXE 2XQ0A 1U9KA 3EFOA 1IJ9A 1WZKA 1MFDL 3DVNB 3EJCA 2EDFA 3OHMB 4RA3A 4XWOC 4EUPH 1HHIA 4MDJA 5DD3L 4ZXBA 3FTYA 1EX0A 3ZTCC 1Z9LA 2H3NA 4BH7A 3QSKB 4I0KA 3VFWB 2J73A 2ZWZA 3X14B 3C6LD 2WNXA 4F7TB 1DJHA 5D2NC 2YWZA 3LS5H 4Z78B 1LDPH 3U79A 1S7RA 4XAKD 4HPOH 1RL1A 5JHDA 3DC0A 3IMUA 4JQIL 3PWPB 3VXUA 5CD5C 2GCYA 2WWNA 2QGEA 1J0YA 2Z3FA 2N0MA 4U6YB 1M3JA 1KY7A 5LGJA 5E8PA 4MMZC 5H2BB 1QR4A 2I07B 4H8VA 2FEEI 5KVDH 4XWOD 2WNGA 3UERA 1A1OA 2CO7B 4LDOB 4PRDB 4RX4D 5IZ7A 3V9CA 1T04A 4P4KC 1CC3A 4ONHB 2EEAA 4WNJA 3IAQA 5E8EA 3P30H 4B9ZA 35C8H 1YEDB 4L37B 3NCYP 3NRFA 4X4KA 3CX5J 5IMKA 4J8QA 4L9LB 3VRIA 5GGTH 1EHLL 1MLBA 2LU5A 2ZCLL 4XODA 5LB1A 3KPQA 1H15A 2FVNA 1PNDA 3LRMA 2EH7L 5ECGA 4GKSB 3PHOB 3BSZL 3SPJA 5CD5D 2CPCA 3I9IA 3RKPA 3N6YA 5IVZA 4CJ0A 4Q14A 2F0CA 3WOVA 3CQPA 5FKPB 2JELL 2C3WA 1CDYA 2VMJA 1S7TB 3L3HA 4KUZH 4KY1L 1OM3L 2ATPA 2XJKA 3T5WA 3HG5A 1AC0A 1BZ9A 5TFSL 4P4KD 1G0XA 3HC2A 3MUJA 4UQ2A 1IGFH 2J88H 4J3OF 3ECWA 3WNOA 4R90H 3UYPB 2WLZA 5F7UA 5CSGA 2DKUA 2ZXCA 4HQQL 4K5OA 1J5DA 3WFHB 1E8ZA 2PN5A 2BSED 4CC4A 2VMFA 2Y3NA 1RZGB 2A6IB 3RGVB 1QA9B 3E7JA 1MCPL 3RWCB 3BPCB 3MV01 4UUJB 5DC4B 2FGZA 5HYIA 5IFAL 1KYOJ 1U8CA 2W60A 3MRGB 1FLRH 3QJFB 1A5FH 1I1FA 1Y0LB 4M4RB 4PBVC 4XB8A 3GKWH 2EDBA 1Q1JH 4UANA 5JOFA 4IS6A 4B9PA 4LMQE 2CUHA 4PJEB 2PWHA 4NP9A 4ECNA 5BUPA 4Q7DA 3DDGA 2CIIA 4M61B 5KN5A 3IJ8A 1YO4A 1SBSL 2A74C 5EPMA 5I0DA 3UBXI 1NBCA 5E1AA 4DP9X 1TZOA 5HHQA 5JPNC 3GJEA 2P24B 2PTTB 5L4FA 3VI4A 3HFML 3LPWA 5IFJA 2OULB 3O8XB 1QFHA 3EH3B 1IC5H 1AY1L 4DERA 3TTSA 3KDMA 4L3CA 5CR8A 1ZLEA 3D0LA 3U7WH 3WFDH 1UZ8B 2DMBA 3D2UA 3ATDA 2OFQA 5GGRY 3B9KA 1EZUA 3QHFL 4YH6A 2WXOA 2QVFB 4OZIA 3S37X 3WDJA 3H56A 1RZPA 4KPHL 1AIZA 1NAMH 4M7JH 4LO9A 3AY4A 3DIFB 4KY2A 3D08A 3TEZA 4R96B 2GVYA 1KCVH 1UB6B 3TOPA 4OLWH 3EJPA 3WY4A 2BSRB 2R0WL 5BOPA 3KGUA 4Z7VA 3QZMA 3MLTB 3EO1A 1I75A 5E1QA 5TDOB 3LVEA 4U6HB 4RRPA 3KJ6H 2QQLL 4HGWB 3BO8B 3EDKA 5DUPH 3QUKA 2VITA 3QE5A 3TNNA 1P2CA 3RPIA 5CCKL 1VFOA 5D5MA 3AQDA 2HSIA 1WH0A 3FK3A 3VRLE 1AHWC 4PRIA 5JXEA 3O4LD 4FTVB 2LV4A 2JLPA 4AQEB 4PJ6A 4K8RD 1IAKA 4YSSA 2BHFA 4PBDA 1DQML 2UZYB 3IBEA 2EE9A 2RALA 3A67H 3PGDA 3C2AL 4OGXL 4YHKL 5HJ3A 4GIOA 5BUAA 3ARBA 4NKDB 5DU7A 2XPYA 4Z5RB 4TRPH 1WITA 3DTDA 1FC2D 4GT0A 1KJMB 2XV2A 5C0RL 4Z0XA 3BPNC 1RSFA 4RAHA 5E4OA 3B9DA 3BAKA 4Z76B 5IBUB 1REIA 1BZ7A 1IKNA 1S7SB 4WI8A 5AG9A 2J72A 5EO1B 1RUKH 3UJIL 2ZWLT 1YMMB 4ODVL 4NO5B 4PJ8C 3ZGIA 3TH3T 5EV7A 1AGCB 4WFFD 2APWA 4BSVB 4Y19A 3LQZB 1VHPA 3MNWB 2N4IA 3NZ8A 4ODSL 3N43F 5HYFA 1HKLH 2ZUVA 2WCPA 2NXYB 1FNEA 2CLZB 1WO2A 3KDPB 4JW3A 4NFCA 5E8OA 4EZJA 4JDZA 1NCCL 2E76C 3T8XB 5INCB 3CXDH 4HK3J 2QL1A 3B1TA 4M02A 2VM4A 4LSVL 3ZL4L 2E7LA 4AE0A 1SXCA 2NZIA 3CUPB 4S1SL 2BNQE 3SCMC 4HIIA 4MZIA 1X9QA 5C8JA 2YKKA 1EO5A 2NY6B 3KM1A 2FHCA 4LGSB 3FFCD 3QWQB 4DKTA 2ZX5A 4HG4J 1JXFA 1NAKL 3ABKB 1EAPB 3A6OA 5EO9B 2H6PB 4YPGB 3F3HA 1AKJD 2AEPL 5AW1B 3U4EA 3JYCA 4D9LH 1J05A 1N8ZB 4X5WB 4Y1AB 3QG6A 1PKQA 3TJPA 5LJYH 4TNEA 3AAZA 3Q6FA 1S9WB 1RCYA 4YJZL 2ZOLA 5LVEA 4P2CG 4GXVH 3R0NA 4JDEB 4Y9CA 3KGSA 2JK5A 4PJXE 5GRJL 3MLUL 1FZOB 3BQUC 5T5FL 4PJBB 3RNKA 3CMOL 5D7JC 3WFBL 4KROB 4GG8A 1B0GB 4OCRL 4LSTL 4OLUL 3ZIMA 3OHXB 1NKRA 5LNDA 1WEJL 1A6WH 2YMTA 4YHZL 5CEXA 5DRZA 5CEYB 2FUQA 1J5IA 1QFUH 1OHZA 2CGRH 2NYZA 4OCXL 3X11A 3F64A 1M57B 4OZHE 4YSPA 3O2DL 3VI4F 5I8KH 4HIHA 3P1VA 1URZA 3VFOA 1HI6A 5IHUH 4DVBA 2Q76A 2XA8L 4QRBA 1QSFA 1QRNE 3CE1A 4U3HA 4YFLF 3QJZA 5F96L 1HHJA 4XPBH 5JLZA 1W72B 2R8SL 2FCBA 3UCRA 3L3IA 3PV6A 1MFCH 2CAKA 4Y9FA 4XHQA 5DJ2A 4G6JH 4QNPF 1WISA 1SOSA 2XJLA 4I1PA 3TYFB 3BQUD 2AEWA 5B38A 2X38A 4PB0L 5I66A 1DEDA 1FYTE 2WO3B 1JVKA 1W6WA 1YNKL 2PUQT 3C12A 1I85C 1MFBH 5EU4B 5CP7A 2WIIA 3C5ZC 2LABA 1TQWA 3BFQG 1MFUA 4NXSA 2VDKH 1NCWH 1J18A 2VJ0A 4Y16C 1MSPA 3CFDB 2ZSVA 4DUVA 5EUOF 4BXVA 2R69A 2B9BA 1MI5D 4JFDD 2YD2A 2QVIA 5MEOA 4Y0GA 4XVSH 4L3FA 2HH0L 4BHUI 2NZ9C 4AL8L 4Y4HB 3PNRB 2VDNH 1I1AC 4J6IA 1LP9E 5FFOA 3D3VB 4HSAC 3ZDYE 1MIEL 4WENB 3V4UL 4H40A 2F5AH 2OL3H 3JVGA 5SWSE 4CC0A 2WWMC 1PSKH 2Q8BL 2YKLL 3MROB 5IQ9B 2LLLA 2ALAA 4FERA 5F3HA 1EHAA 2JKJA 5LUMA 4A38A 2SODB 2BNRB 3C5ZD 5MENA 3QEQB 3ARDA 2Y06L 1F45A 1TYRA 4Y16D 2WNWA 1IEBA 2FQGA 1BVNT 2QPSA 4OFIA 3EJZC 1JZ4A 3OKLB 1PLBA 4M1DH 5DRNB 4PBXA 3FPYA 4YSDA 1QVOB 3BAIA 2NZ9D 1HILA 5T1KA 2OSYA 3GXTA 1SN5A 1I1AD 3CTTA 4QXUL 1L0YA 5I16A 3FUEA 3OBAA 1WCBB 3CWGA 5CP3H 5DJZB 2KZBA 5KVFH 1SYSB 1GY2A 1YEIH 3VVVA 2CHDA 4UWQB 2O6EA 4PJDF 2WWMD 1U8KA 3P40A 4H0LC 2G5UA 1IGCH 3DV4B 3BZ4B 2J8UF 2XX0A 4DP5X 2X1QA 4X8XA 3KS0J 5MHSD 4PS7A 4RISL 4EOWL 1KTJA 2J6EL 4BQ8A 3VQLA 3HE6B 1UWXH 3MLRH 4DEPC 1FUNA 1NANH 3BGFB 2BJMH 4N2HA 2F5BL 1JPST 1BREA 3EJZD 1YN7A 3KPRD 2VXUL 1MEXL 5FS5A 2ADIA 4H0HB 1AYRA 2UVFA 3GXNA 2OZ4H 5H35A 2XN9B 4F15C 5HDLA 3LD8C 1ETZA 2H1LM 4QOKD 2QZ5A 5KSVB 1AZBA 3GZOA 5A2JH 4Z7QE 3RZWA 3PNWA 1CFSB 1L6ZA 4PB9L 4MNQD 5A40E 4NN5B 1H8NA 2FQEA 5T1MA 3UABA 1AQKH 2XV6B 3AABA 1KEGL 2ZTBA 4ZMWA 3BH9B 1Q0YH 1GW6A 3MRFB 3QDJE 3BUTA 1QSVA 2R4RH 2V2TA 1FV1A 4OZFB 5KANI 2XVKA 5BOJA 8CGTA 4GG6F 3ZL2A 1UWYA 2PWDA 5EOQL 4AZ8A 3DV6A 3M8OH 4HUCA 1A4KA 4NSKB 4ZX6A 1H3WM 5FDYA 4G43A 4PWIA 1OXYA 5MI0B 5ICXA 2BPBA 2HJFA 3MLVH 3DJTA 2KYIA 1J48A 3RY6A 2AEOA 2CBPA 2UYLA 3KYAA 4H1LH 4H25A 4ODXA 4OGQC 2YD4A 3GM8A 4R8WL 1XMWA 5GSRB 1ADQA 1RHHA 1TQBC 5D7HA 4X6DE 1BM3H 3HG1E 4HCRL 3B37A 4J3SA 2XFGB 3Q8CA 1CXEA 4UDUA 3ZE2E 3S3PA 2JSFA 2MTPA 1URIA 1EEZA 4B50A 2GIYA 2YQBA 4ELDA 2CO6A 1JXJA 1CLYL 1ACYH 1PG7L 5IEKB 3O45A 4NC2B 3APDA 3RILA 5J6HA 2B1OA 2DQTL 3D4YA 1FHGA 1E2VA 2EE3A 3RPBA 2F9BT 1OOAA 4UM9D 4DH2A 4HA1A 1R3IL 2AP2A 3F7PC 3KCPB 4P49A 3TTYA 3DJ9A 2XXFA 4R2GC 5HI3C 3HR5A 1E5CA 2Y7QA 3WKML 3BAEL 1DSWA 3LEVL 1H0DB 4JFFB 4CSPA 1ID2A 4OGAC 5IB4A 2FTAA 3UJTH 2HLAA 2HT4C 4WFGE 2Z64C 4OZGE 1WWCA 3BKMH 4PRNA 4ZO6A 4CW1B 4WTQA 4A6YA 2A2QT 5CD3A 2Q0ZX 1HCYA 1NLBH 3BLBA 2XN0A 4CVZA 1BBJA 1ZRUA 3CFKA 2IAMB 2QKSA 3LKRA 3TVMA 3ZSTA 1IBZA 1P4IL 3N55A 4RWHA 3O2WL 1XBRA 4UNVA 2AGJH 4LHUD 4CSZA 4DKEH 4FXKA 5FW6A 4X5LA 1JPGB 3MA9H 4QTIL 4WJ5B 1CXHA 2ZSWB 2BK8A 3QQDA 3AUVA 1JZ8A 3SZKC 5ID0B 3SKJL 3HBPA 1JPFA 1THAA 3CC5B 3PQYE 1SDDA 5FOBB 4I2XA 4FYQA 3CFJB 4UIMA 3SYQA 5IOKA 4WFEE 3HE7B 2IGFL 4FKKA 4I9WD 5D7IF 5HI3D 3Q8FA 4R2GD 4CSTA 5GS2H 1EAOA 4P5RA 2KDYA 4H13C 4OGAD 1JTOA 1VFBA 4CILA 2HT4D 43CAB 3TBBA 1UD8A 3ETBJ 3OZ9L 2D0GA 1TZIB 1KBKA 3POCA 4MCZA 4RZCB 4U2ZA 3WJLC 4F8NA 3C75A 4NN7C 4N6RA 4N8CL 1KC5H 4YWGL 5G4NA 3QHZH 2HTLC 3HMXH 5IKCB 1A3ZA 2PETA 4V2CB 4HAKA 5E08L 3E38A 4IBSA 3GUTA 32C2B 3T3PF 2VZSA 1FBIH 4QF1B 2QQQA 1UURA 2ZICA 3PE9A 4F5CA 5E1GA 3TN0B 3UPAA 4AGQA 4XT1C 3UAEA 5HHVH 3KMDA 1G9HA 4F37F 5FYJH 3L2LA 5FM5O 4KNQA 3WAKA 2AJVL 2ICWI 4PTTB 4X6EA 2HTKC 3FO9A 1CXKA 4FULA 2HLEB 1GPOH 3W0WB 4AUYA 4HJJH 1BJ1J 4Y4KA 2IG2L 4XNXL 1U8HA 5I1CL 4DPRA 1NQBA 3FQYA 1GYUA 4JGJA 4XAWL 5E56A 2F54D 2C9AA 4FXGC 1MF2L 4NO2B 2DQCL 1KNOA 5D1XB 1MW1A 1BWWA 2HTLD 4L4VE 4XN2A 4KVNH 1HSBA 4I0PB 1S7WB 3R4DA 2D9QB 2EDRA 2AJZB 2OK0H 2P5EE 3LKNB 4JM4H 4PCTA 4XMKL 3MBWB 3ASWA 2RCSL 1NMAL 3S6CA 2C3VA 3HNTH 3WSQH 1PJWA 2YD5A 1CD1A 1JAEA 1C1EH 2EDWA 4G7YL 2HTKD 4QIRA 5KG9B 1BG1A 2ZNWA 1TVHB 1BA9A 1N2RA 4PJ5B 3U46B 3GMLA 1IAIH 5F2FA 4WGKA 5DQ9B 3NG5A 4JEGB 5I82A 5E24E 4P2QD 4H20H 3I9PA 1N0XL 2RFXA 1MW3A 4J1UB 4UOQA 4EDWH 2HMIC 1ZSDB 2VLLB 1ZA3A 3N42F 3Q48A 2Y36L 1RUMH 2BOCA 3VFTB 4X7EC 1CTMA 2VABB 4QPEA 4CAGA 3BGMA 1D3CA 4IRSC 3SPCA 4PM1A 2UY7B 2VSKB 1M6UA 4OF7A 3WEBA 4LIQE 5C1MB 1OP9A 4HJTA 3J7HA 3BJLA 1XF4A 1J1PH 1LEGB 1E50A 3BWZA 1B88A 3B9VA 3AS2A 1AXIB 1E27A 1T83C 1TFHA 4XXWA 4ZBJA 1Q72H 4PJAF 1YNTF 3F84A 5C0AB 1JHLL 4JG5A 4A7GF 4JFVA 5J13B 1XH3A 1FH2A 5E00B 5CJXC 5AZEH 3DURA 3MLZL 5IB1B 3OKDA 2XQBH 2V2WA 4HP5A 3UAJC 3WMQA 1H3PH 1W72L 2H2PC 2OMBA 2ZPKH 5A6MA 1DANU 1G7LB 1U58B 3EO0B 1A7OL 3VFVB 2YUVA 2JJVA 4JFEE 3JWDH 4AIXA 2MFNA 2AXGB 4AJ0A 1KPRB 2D31B 2FUTA 2IALA 3FQRA 3KLSA 4IRSD 3U4BH 2KMWA 3TASA 3PUCA 3GKZA 3Q44A 2HX8A 2AVGA 2X4RA 1UXSA 4HFWA 3L3KA 4NC0B 5F7HA 1V7NH 2BS8A 3EFOB 4XN9A 2DJSA 3GDCA 4XH2A 5DS2A 4QYAA 4KUCD 2AJSL 2YRBA 3QEGH 2DV6A 2PPFA 1HHIB 2Y7NA 3U7YL 1F86A 2OI9C 2XG4A 4ZXBB 2H3NB 4BH7B 3FU6A 5J3HC 4AW7A 1XGYL 2ED9A 2MPVA 3O3BA 3PJSA 3UAJD 5JXAL 2VXSH 2H2PD 3MV9A 2VLMD 3LB6C 4G6MH 4OGYH 3SBWC 4GI8A 4Z8FH 1XXDC 3FONB 2OSXA 3OAZH 2XI9A 5HHXH 2CRZA 3ZXAC 4AEEA 2PWEA 4TQEH 5ETUB 1L9MA 5EU6D 1G1YA 4A63A 4YQXL 3VXUB 2J57A 4D8OA 2GCYB 4YSEA 1PW3A 4LFHD 1HJBC 4JHUA 4YDKL 5BVPL 5BNXD 1YEEL 5DC2A 3U0TB 3O6ML 4N3TA 3QUYD 3Q5OA 4LKXA 1SJMA 3O4LE 1C08A 1F41A 4N4YB 3WTVA 4PS4L 2GPZA 1A1OB 3A6CH 1MREL 4WEBH 3GSRB 4LOVA 4Z1PA 2NY5H 5KSBE 1T04B 1GXEA 4HC1A 3CU1A 5J3HD 4BFNA 4WWKB 4K7PL 5FECB 1FVCA 4FNTA 5IMKB 3VRIB 4FNRA 4OI8A 5TE4L 3K46A 3EF4A 4ZYKB 1MLBB 2A77L 1H15B 2GYSA 3RTLA 3VTAA 1QYGL 4JCWA 5DR5H 3UDWC 3OLDA 2FX7L 5TDPA 4YZFF 3SE9H 3MLSL 4JNXA 4PW3A 3N43B 4QO1A 5IVZB 1JGLH 3D8MA 4BUHA 4AYFB 3SDYH 4MCNA 1S9YA 1PEWA 4KK6D 5ITFB 2ATPB 4LOEA 4MHHG 4UT6H 1L9NA 3NDYE 1BZ9B 1P4BH 2VAJA 3KPSD 1CLOH 2BRRH 3IDIA 2JI1A 3PF2A 3MCLH 4LLVA 3UGEA 4UQ2B 4DP6X 2X53A 3OKKA 4PLNC 3OX8A 2DLGA 2YPVA 5FFGA 3ZQ9A 1JWUA 4DGIH 5K9OA 1Q9LA 2WZ6A 4O2CA 1MAKA 5SWZD 5C0IA 2F15A 1BBDH 1U4EA 2MNJB 3ZE0E 3KBHE 2B2XH 1CTOA 4LSPL 5DQDL 1U8CB 1R75A 1YEGL 3D85A 5F9OL 5I6XB 5LKNA 3PU7A 5MP6L 3ULUF 1I1FB 3CCHA 3VW3H 5CJ8A 3FB8B 4HUWA 5JOFB 3ML9A 1FO0H 2XXMB 2Z35A 1OP4A 4NJAL 4C55A 1CGUA 1JZHA 5IHWA 2GQHA 1ORQA 5EPMB 2R1XB 4B9JA 4AG4L 4ZUSB 1X5FA 1ZA6B 4NZFA 3T2PA 5HHQB 3K2UH 3VI4B 4TULL 4JKNA 2CJ3A 3X12A 4BE6A 3BKJL 1ZLUK 4ZNCD 3WJJC 2DWDA 3DUSA 2E8ZA 1WGOA 3MLYH 4NWUL 3SDDA 3D2UB 4ZTPH 1YEJH 1G1KA 3FBKA 3NIDB 5C07A 1QSEA 3QFDB 3B9KB 2F53A 4HH9A 1QNIA 3DNKA 4OAWB 1N19A 4XGZB 4R6UA 4A2LA 4B7IA 3I02A 4P5SA 4LASH 1DBKH 1TTAA 1Z5LA 1BD2B 3QJHA 4Z7VB 4YL9A 1WGVA 4XNUH 3SODB 3G5XA 4PYHA 1RH8A 1V3JA 1T7YA 2VDPB 2H9GA 3KWWB 3QIWA 4PSRA 3VB9A 2FHBA 1KCSH 1MHHA 3QI9A 3RU8L 3QUKB 4CNIA 2VITB 1DVUA 3DX8A 3TNNB 3W2DL 1ZTXH 2Z31B 3RPIB 4QWWC 1AZVA 5D5MB 3TA4D 2WXLA 1TYEB 3OKEB 4NFBA 2R1YA 2WLMA 3NAAH 3VCLA 1OW0A 2FJUB 1A7NL 1J1XL 5KYXB 4B5EA 1WT5C 4JZJA 3RDTB 3ULVF 1OV8A 5HJ3B 4KAQH 5E6ID 1LMIA 4A2EA 1IQWL 4HPYH 1QBML 3ARBB 3LXBA 1R3LA 2X10A 3QAZB 4MX7A 4QXTA 4ACTA 4BKLA 1PD6A 2Z92B 4GW5A 1R3KA 1UM4H 1N26A 3FHQA 3QDMB 4ATWA 5IJDC 1BJ8A 2GAZA 3VRJB 5BW7C 4L4TD 1CGVA 2ZOWA 1BZ7B 1OGAD 4KJPC 5D6CB 2WOBA 2W8CA 4NNPH 2CXKA 3D4ZA 5J1SC 3LXUX 4JY5L 2FLBT 4FQQA 4QWWD 5FF6B 4Y19B 4LZKA 5GS1C 3NZ8B 4JM2C 5LN4A 2DM7A 4N6QA 4I7ZC 1FNEB 1E0OB 5DEJA 5E8OB 1IBDA 1Q90A 3L5XH 1B3JA 5LBVA 1YNLH 3GJFK 3NN8A 2DLFH 3STZB 4PJDB 4BH8A 3MRLA 2IADA 3K74B 4PS8A 3WS6A 1T2QL 1UFUA 2J8UB 4M7LH 4KKBC 4UNUA 4L1DA 4KJPD 3LIZA 4IMKC 5FV1L 3U4EB 2J44A 3FQNB 5IOPA 5C3IA 1U8QB 5GS2D 1PKQB 3TZVA 2VL5A 1DBMH 1BEYL 2WKLA 3AAZB 5C0GB 3GHEL 2QKIA 4TUKL 2KZWA 5EBLA 1FFOB 4JM2D 3RUGE 1W0WA 2A5UA 3VNZA 2XIBA 5E2JA 1IGYA 3ZKXB 4MCMA 3T4AC 4Y8DC 4YX2H 4UOW0 2JNZA 2V0AA 4KXDA 2UUDK 4BZ2A 4CN1A 5CZVH 4XNDA 5CEXB 8FABB 3VD5A 4K23L 2Z4TA 1HL8A 4WWOA 2YD9A 2CHXA 3ARFC 4KKBD 4MNQE 1D5MB 4IOFC 3X11B 3Q9PA 5FYJD 3NH7H 3RWHB 2IGLA 3CSBA 3VFOB 1HI6B 3V0FA 2L7JA 2N7AA 4NZ8A 2Q76B 1FJ1B 2PCPB 4XZUA 4TYUA 4E2OA 4GG6B 2X6UA 4DGYL 1HHJB 1N9PA 3ARGC 5JLZB 3QCVH 2FO8A 3PV6B 4N0YL 4NQTA 1ZLVH 3X3FL 5KYUB 2F74A 5DJ2B 1CYWA 2VQ1B 2BS71 4X8GA 3X1FA 4GLRI 4JQVC 5CBAA 2ZF9A 4HHGA 3S3CB 1V7MH 1A1NA 1UVQB 1G4RA 1ZVSA 5I66B 3VXRB 5IQNA 1F18A 1L0PA 2RMNA 3MNVA 4MLSA 1K4DA 2XQYG 4GQZA 1RUAH 5EF1A 4F58L 3H0TA 2WIIB 5CP7B 5L7XL 3ARFD 5AAWA 5DZJA 2EDOA 2VSCA 3TO2A 1F8TH 2ZSVB 3SKNB 1FVEB 5T3XH 1GTFA 2PO6C 4YXHL 1IIIA 5DVNA 4HKJA 2VW6A 2XZCH 5E8DL 3ARGD 5MEOB 4W6YB 1TG8A 4A7TA 5E5RB 1JGUH 3VU2A 4Z3FA 5SV3A 3HUJA 3N85L 2CO3A 2D2CC 4R7XA 3CBKB 3STLA 1LO3L 1TJHL 3AMLA 3JWDC 1O9VA 3ZLQC 2QGDA 4HJ1A 4JHVA 2BS9A 4B27A 1EZSA 3NSXA 3OJMB 3PRZA 4QRAA 5K59F 1F2QA 1R5IA 2PW2B 4N2CA 5F3HB 4B3EA 1KXQE 3MYJA 1Z0MA 5E99L 4GS7B 5EU5A 4JFYA 5HGHA 3ZO0A 3Q5TA 5MENB 3O3UN 2WHVA 4GMTH 4L48A 4XNZB 3FMGH 3FTSA 3HJ0A 3EH1A 4E9VA 2FNWA 3FSOA 4WO4B 1JD7A 1A2YB 1O6TA 3AQYA 1DEEA 1EVUA 3MR9A 3UTZA 3IGKA 1UOVA 3GT6A 4Z7UA 5IQ7L 3B83A 2IWGA 3QQ3B 2L3BA 4E36A 3TXAA 2VH5H 5E51A 5BS0D 1VENA 5D7IB 3MLWL 1Y6KR 1RUQH 3ULSA 2FSEA 4QXGH 3MODH 1NGQL 2QVKA 3EFFA 4I9WE 5IVXA 1CXLA 2DTML 4WUKL 4X50A 4DP8X 4KTDL 2X6MA 3T0AA 4EMZA 3CN0A 4AK1A 3S2AA 3DBXB 3TA3D 4HALA 3B4NA 4IJ3C 3IJHA 2BFVH 2ZCHH 1YN7B 2DEWX 3HNSH 4JRXB 1MRCL 5D9SA 3SYAA 4M1GL 3T3PB 4EDXB 5F71A 2Y1VA 1P7QA 2NY5C 1KGWA 5H35B 4J7RA 5IGXL 1R3HA 1Z9NA 2IPKB 4X0NA 1ETZB 3L5HA 4DOHB 2W0FB 3NZHH 1PY9A 2AJUL 2D7TL 5EFIB 4E41A 3PNWB 4EI5C 1DE4A 5BOZG 4DP2X 3PL6C 5IJVA 2VW4A 2K1MA 1MRDL 3ZMNA 3M45A 5CXPA 5T1MB 1MUJB 3FU3A 2JI3A 5DURD 4KHTH 4GW4B 2GHWB 5ABDE 4PLOB 4AQZA 5IP4A 1MXGA 4GRLC 2NY7H 3B8YA 5HHOD 4L0ZA 3AREB 1C5BL 3ZX1A 4XCCH 3NEXA 3TIDB 4JPVH 3O9WA 1KIRA 1HEJC 1N5AA 2H1PL 1ILSA 3MC0A 2EDEA 4FHBD 4JQXC 4G59C 4MD0A 5C08A 5KSUB 3FB5A 1DUYB 3I84A 3WS3A 4I88A 2AAAA 5AYUH 3RI5K 1MHEB 3PIQB 4PJ9D 3WKYA 1TSRA 3RJOA 1CXFA 2HJFB 3PYCA 1MJ8L 3LY6A 4MDIA 3RIFK 1XZWA 3I6LD 3JV4A 4UTCA 2Q20A 1AG0A 1IZJA 2UYLB 4EI5D 3PL6D 4I1RA 3NSJA 1XCTA 4J4PC 1L0QA 3IWVA 1CICA 4Z95L 1HE8A 1U2CA 2APVA 4C56E 1RHHB 6PAZA 2JB6B 1XIWB 2W07A 3K6SA 4GRLD 4FXTA 5JHAA 1L9OA 5AVSB 4DIXA 3IPFA 2KQNA 2HVJB 3RQ3A 3FOMA 2CO6B 2Y0SA 1XWVA 2BVOA 5FO7B 2EDHA 1FL5A 3O45B 2XWDA 5HVWA 1E6OL 1MVFA 3KE0A 5J6HB 2E9GA 3C9NA 3B5TA 4BWTA 5AVWB 2B1AH 4IRJC 4LEXL 2D7MA 2Y7QB 1OSZB 2F6AA 1MJUL 4GQ9H 3UMTA 2AQSA 3WL9A 2BHZA 3PV7A 3UJJH 4LKCA 3NVQA 2HLAB 4J4PD 1YNTB 4PJAB 1T89A 5GIRA 5H4YA 4APQC 4PRNB 2CMRH 1BGXH 1N18A 3AS3A 1K72A 2X89D 4A6YB 5CD3B 2QADD 4FNLL 4NP4L 1QACA 1BBJB 4LGPB 3GD1C 1E5AA 3TVMB 5DGRA 1NCJA 3V0VA 4TLUA 3UO1L 4NYLA 4X9IA 1QWUA 5EZOL 3NJMA 4EXPX 4K7PY 3QQDB 5B8CA 4GB9A 5FKAB 5D1QC 4I0CC 2WZPD 1G6RH 1QATA 2EYSA 1SDDB 3UX9B 5KVEH 4PW9A 4UIMB 3LKQA 2Y2WA 4QAWA 4UMGA 4IRJD 2VDPL 4G8GA 5ESAA 2JXMB 2OX5A 1CF1A 4FZ8H 1JV5B 5I30L 3ZDZE 3P2BA 4RMUA 4APQD 5TQ2L 1DBBL 3S5ZA 1FGNL 4MCZB 2QQKL 4FFTA 3L7EA 1ROWA 4N6RB 4M6ML 3A21A 3MXWH 2AJXL 1ZLSL 3WGVB 3X2QB 2J56A 5JA9A 1WFNA 2EXYC 4YHNA 1TETL 2FEDC 2VT0A 5D7SL 4JG1H 4IQHA 2NMSA 2OTPA 3R1GH 2FX8L 3T0EA 1A3RL 3GBDA 5EZJB 3F5WA 3MFGB 5D1QD 1UJ3A 3ZYZA 3JWOL 4E9XA 5C3LD 4RGOL 4BZ1A 5CJOH 2W81C 4OLXH 4GH7B 3NA4A 4XNMB 5EU6E 4Y4FC 4EO5A 4X6EB 3FO9B 4F7MB 5F7DA 3LZRA 2E7CA 5GRVK 4MJIE 1R6VA 5KUKA 4GUPB 4Y4KB 5EN2A 5GHWH 3FUHA 3KPMA 5T33L 1XDTT 5CIPA 1CBVH 5ANMB 4TSAH 3OB0H 4FABL 2VSMB 5DK0A 1ZSHA 4RH4A 1KNOB 1EBAA 2WN2A 2OAAA 1KN4L 4F33B 3KS0H 1OAYH 5J0BA 2EVFA 3IJEA 3GXDA 3LS4H 3B2MA 2EXYD 4QHMA 4W9KC 2BIOA 2FEDD 2P8PA 1L9SA 5F70A 5ABZA 4E9YA 3VXTA 5ALBH 2OSLB 4JHZA 4K73A 3BZFA 4YDIH 4QKXB 3V6FB 3ZW3A 3I6GA 3KYMA 4OCMC 2J43A 4P9HC 3S36X 4G42A 2C3VB 4OCNC 1C7SA 2M26A 3QEUA 4FKEA 4Y4FD 1D5XA 1CD1B 1XFPA 3JZ7A 2F19L 4Z7NB 1R3JB 3HI5H 3L1OH 1GY1A 1HQ4B 4UDTA 5HYJA 3ZMEA 4X7TA 2F8XC 2Y07L 4FLOA 3Q6GH 1BWMA 7PCYA 2WMPA 1OP3K 1HFUA 2YAMA 3MCG1 1CLVA 3RWEA 4UBDC 1V5JA 1P9MA 4N0FA 5LWYL 1ZA3B 1GYWA 4GO6B 5A2CA 3QT2A 1VRSA 2WYHA 2EXSA 3KPSE 3BGMB 2X09A 4Z3TA 1RPQA 3PWVB 4TS6A 1AFVH 4RSVA 4JQIH 3NQKA 4RGNC 4EIGB 5KVFE 1F4WH 1HEZA 1PVHA 4Q6IB 1NGZA 2XTSA 4LBAA 5SWZE 3L7FA 1E27B 5GZOA 1SUHA 4NQCE 4OUUA 1OAZL 5I75C 4JFWA 1SVBA 5IBUG 1Q9WA 5DSCB 3DURB 2ZG1A 4UBDD 2XWTA 3UBGA 2V2WB 4BK5C 2JE8A 3UG3A 3NEEA 4IKJA 4QXVA 1HAUA 1E9OA 1NKOA 1S9XA 4K4KA 3JTTA 2VXQA 1ROCA 2CDFB 2ZCLH 2IALB 3PWJA 3BP7A 2IH1A 3H42L 1ZV5A 1ETA1 3FF8A 4LAQH 4XPHL 1S5IL 3EAKA 2X4RB 3QZBA 3BSZH 4HFWB 4I8DA 1WA2X 1JVLA 2E6QA 2WVUA 1S7UA 1XTMA 4BFEA 4MAYC 4CVWA 3QXDA 4KNUA 2V9UA 1MAML 2I5YL 1Z66A 3CSPA 1I3VA 4JFZH 2C9RA 2YLHA 4KY1H 3N40F 4JREB 1B4JL 2G60L 4X6CA 1SN0A 2R69L 1ED3A 1CU4H 5TFSH 1YDPA 3MKKA 4U6XA 5HGAA 3O3BB 2BVEA 2WOYA 2X42A 3EO9L 1A6UL 4U1JA 2AEIT 5HPMA 4F1SA 2V7HB 2VLRD 5M7QA 5AD0A 3EDEA 1EV2E 1OSYA 1RIHH 1T66C 1BYOA 1TVDA 3VSQA 3T1WA 1U41A 3QORC 3WUWB 2ZYIA 3SJVB 3VXSD 2QPUA 4P59L 1A6VL 3VD7A 5C0JA 2Q3AA 4MAYD 3K8MA 5LLIC 4XX1E 3JTBA 4LKXB 3HLAA 1T5XB 3QCTH 1C08B 5T3XD 5IEHA 1JNJA 3JWNC 5A6LA 2AF2A 2DWYA 4OF5A 4MDRA 4BCZA 5KTEL 1A6AB 1OEZW 5BZDA 5AALA 3T04D 4OLVL 1JUFA 3QO1A 1XSOA 4IDJL 2NY1B 3WFCL 3JXAA 3C09B 4AOFA 3D9AH 5CN1A 3PWNA 4G71B 4G6KL 1HH9A 4ZMOA 1PDKA 4L4TE 5TK4A 3HC0B 1T66D 3L5WA 1AY1H 1CD8A 4KXAA 4M3HA 1VFMA 2DQFA 3QORD 5LCVL 3WV0A 4C58B 1KCUL 4PEEA 4N20A 3BD4A 2C4FU 2D8KA 5TDPB 3QHFH 2O6FA 3UPRA 2BSTB 1P4LA 1B0IA 4IMLA 1MY7A 1S9YB 3HS0A 2QHRH 2JJWA 4NCDA 4B9KC 4Y2OA 4DWHA 4G11A 2XTJB 3ZYIA 3QG7L 1LE5A 3TCXA 4JHWL 2E75C 2VDRH 5T5NG 3OKKB 3IJYA 3OX8B 1XR8B 3GGWA 3PDOA 3IKKA 2IDSA 1FORH 4XWGH 1RK1B 3SDXF 5JTWA 1JFQL 1BYNA 1I9EA 2X1WL 5K9OB 1Q9LB 2EIKB 2QVMA 2E4FA 2E56A 2ZWYA 4FYRA 1WTLA 1ZT4A 2VZOA 5CJBA 3X1BA 4MZ2A 3CAFA 4W9FC 3GSXA 3TF4A 1UWFA 1DQMH 5DFVC 1IU1A 3FQ2A 3CCHB 2WKGA 3NCCB 4UQCA 1AS6A 5E9DB 2Z35B 3RY5A 5HI5C 1KOAA 1ORQB 3SQBA 1U93A 3NEOA 2DH2A 5FLUA 2C3GA 2AERT 3MJ9A 3F6LA 4TLKA 4KZEH 2FT7A 4O58L 1JWSA 3LPPA 5I74B 1L0XA 5ALCH 1NBVH 3DUSB 4PIRF 1NL0L 5CGMA 2EVHA 3SDDB 4ODSH 5I1DB 2CO1A 1XGQB 5C07B 2F53B 2P28B 2V8LA 4FADA 2NDFA 1ADQL 3BAYA 3FL7A 1NCCH 1BQHA 4MS6A 1UB5A 1EFXA 2CDEA 2VR3A 3QUMA 1ZHNA 4LXFA 4NM4L 2Q86A 3QR0A 4WI7A 5I17A 4WKZA 4S1SH 3U2JA 5FGRA 5HI5D 3T3ME 1Z5LB 5B1JC 1KWKA 1JPTH 1GOHA 3QJHB 5JZ7C 1CFQA 4V1DE 3QAQA 4D0DA 3G5XB 1J88A 2APXA 1NAKH 1YJDL 3CFNA 4JDTL 3QIWB 4MNGE 2AEPH 1WQVT 1J5OL 4NPJA 1MHHB 2Y6TE 3ZT5A 4M5ZH 4CNIB 2GG1A 15C8H 2JCCA 1NOFA 3G6DH 4PP2A 3O6FC 1DYZA 3P4LA 1SM3L 2IDQA 1ET7A 3H2PA 4NQQA 2WVSA 2R1YB 1MCLA 3JT2A 2VERN 2Y1ZA 1P7BA 3CFTA 4JZJB 4X99A 5GRJH 3U82B 1AE6L 1RHFA 1YEKL 3BIBX 5T5FH 4A6YL 4ZD3H 3PAVA 3VWKC 3WFBH 4U6VL 3WY1A 1R3LB 4MX7B 2G9KA 4OCRH 4LSTH 4XVUC 4OLUH 4BKLB 4DP0X 3VWJA 4GW5B 4H8QA 4B0MM 1R3KB 1WEJH 4YHZH 4HH8A 3UBFA 1LO2L 2GAZB 3FO2A 1NTDA 2EE2A 4K5MA 4F2ME 1JZ6A 4PW4A 5LG1A 1FI8C 2OXGA 2NW2A 4OCXH 4BIKA 2FJHB 3O2DH 4G6FB 2ZCKL 3D51A 3CFQA 3FQXA 4RSYA 3L4WA 4Y5YC 2GT9B 2FNBA 2WN3A 2XA8H 2Y9RT 4FDWA 4AT6B 4Y2NA 2XHNA 5GGQL 3INUH 5F96H 3I75B 4FQQB 3O6FD 3B3IA 4FI8A 3AXHA 2R8SH 3EOBA 3SPVB 1V3KA 2W9LA 5D7LE 1P1ZA 3AG3B 4JKLA 1UWGL 2YAPA 5DD5L 5B1CA 1I7RA 5ITBH 5B3JE 1R5VA 5EEZA 1AR2A 2P47B 2Q2LA 4N9GB 4PB0H 3VWKD 5AYQA 1SGKA 3DROB 3KPLB 5C0DA 4XVUD 4EQ3A 4CN6A 1IEAB 3NN8B 3MRLB 1UH2A 2IADB 4TUOA 4W9EC 4U4IA 4W9IC 4YIQA 1LYQA 1U8OA 2Y7OA 3DXAD 5TD4A 3DUUA 4K9JA 1IBHA 2C1PA 2JIXD 1OD9A 3CK0L 5AL0A 4NRZB 1MFEH 5HSFA 4OCYH 4RVBA 4YXLL 1DVFD 2VL5B 2DM4A 4B9GA 4KNTA 4QT5A 4AYID 2ID5A 3S7GA 5EBLB 1JTTA 1WD8A 3O3DA 4AL8H 3QRLA 3F7KA 3GSQB 1W0WB 4I4WA 5CHNA 4U0RB 1FIGL 3IFOA 1UM6L 4O02B 5J06A 1S7VB 3SB3A 1J9QA 1IGYB 1NIAA 3L08A 2VN6A 4JFSA 1GYAA 2V9RA 4YHOL 1F42A 3MREB 4UTAL 2YKLH 2Q8BH 3VSTA 4JVWA 4WI0B 2V5YA 4OB5H 3QUXC 1ONQA 4HWNA 1EANA 2XYBA 1J10A 3VRLF 3ZR5A 4MD5A 2LTQB 2XKUA 2DMKA 2JV6A 3ETTA 2XWBA 1EXUA 1LP9A 3RWIA 1QKZL 3L9EA 2IBZY 4KQ3L 5HHOE 4G7VL 3KYOB 4XXDA 3M86A 4N90D 5DC0A 1GGUA 3BC9A 2DYPA 5SWSA 4NZRL 2IAND 2F74B 5TDNA 3UMNA 3KAAA 3DOSA 1A1NB 4UAHA 3LDBB 1ZVSB 3FULA 2KLRA 3TYGH 4L1TA 7TAAA 4NRXB 2VMCA 3MNVB 1K4DB 2N1TE 3D30A 1VKXA 3UTSB 2KPWA 1CGSL 1ACXA 3QUXD 2OTWA 1CQKA 2IPUK 3BPOB 1PY4A 3H0TB 4AVKA 4ZMZA 3VD1A 4RISH 4EOWH 2J6EH 4AYMC 1AP2B 4PUBL 3TO2B 4A39A 4OZ4A 2J55A 2C1OA 1FL3A 3EIFA 4GO9A 4AUUA 1GCYA 5FFLA 5FYLE 1HQRA 3TT1H 4WW2C 2E4TA 3FTVA 3ARXA 4OH2A 1KBGH 3SBPA 4D7PA 4GEIA 1I8AA 4QRPA 3STLB 2E9BA 2MMXA 3NPSB 4KX7A 5F1NA 5CBEB 1BZDA 4PB9H 1IVTA 4HEME 3CNKA 3NSFA 4ALAL 5ACZB 3W38A 4J6RH 4P46B 4AY0A 2B8OT 3MBED 3N41F 1R5IB 1YYCA 3MYJB 5EU5B 4R5VA 4Y2DB 4HWBA 4N28A 3FU8A 5EU7C 1GJIA 4PJXF 3P77B 4LEOB 5EOQH 3MI6A 4YLBA 3VSUA 3NYKA 5DJ8A 2CKBA 2A4ZA 5HXMA 1QQDA 5ISZD 3NCYS 4L8BA 4YS4A 1DEEB 2VJ8A 1KT2A 3KWVA 1G5AA 1GHFL 1DBJL 1KIQB 5INDA 1J0ZA 4HEPG 5KVGE 4FFYL 4MQXC 4IKKA 3QO0A 1CE1L 4OZHF 4FNUA 3QDJA 4W70A 1V10A 3GSOA 3W9DA 4PREB 2BNUA 1BAFL 1TPXC 1A7RL 2ICEA 2NNAB 2W9DH 4MKTA 3T6VA 3V4PA 4ZPTA 1T1ZB 5IVXB 4W81A 3WE1A 4J3OG 5F97E 1GJUA 3GF8A 3CN2A 5C0NC 1CFVL 3G6AA 4BSJA 4JO1L 2X6CA 4QYOB 3D34A 4MA3B 4CVUA 3IJHB 3V4LA 4F27A 3VFGL 2I24N 5DDHB 3TCLB 3TV3H 1Y1DA 4GAJL 1AGEA 1D7FA 3QWRA 3ULVL 4LSRL 1P7QB 1Q38A 1JF1A 2DQTH 5F7EH 1R3HB 5HVFB 1LVEA 4IBTA 4HC1L 1R3IH 1Q8MA 3UROR 4X6DA 3TX4A 2CM5A 5ICZB 1BJMA 3LEVH 4E41B 1L9PA 5FUZL 1DE4B 5IJVB 1GH7A 2WTRB 1BCIA 1BOYA 1VADA 4G1EA 2E7HA 4HKZA 4PV9A 2Z4QA 5SV4A 4DCQA 4ESKA 5AYTA 3WIFA 1IBBA 5CLWA 1AI1H 3DA0A 4N2DA 3VFUA 5IIEB 4G7QB 5C0ND 2DOCA 4QRFA 2ZAGA 3DMMA 1P4IH 2OMYA 2Z8SA 3D48R 3O2WH 1LNUB 3BT2L 3LSOA 3O9WB 2P46B 3V5HB 1KIRB 2VJXA 3DHMA 3ZDYF 4YFEA 1CFTA 4AGNA 5EBMA 4MSWA 5TE7H 3ZDXF 3OC5A 2X7LB 4IIQA 2RQ8A 4R4FH 5C08B 3WFEH 3VM5A 2WKOA 1LO0L 5L8JB 3CZKA 1YLBB 1PZ5A 4NO0A 2WGXA 3S96A 4Q9BA 5IWLA 4FQCH 5T3ZH 5FA4B 2BVPB 1DN0B 4MMXC 1R19A 2VXVH 3IRCA 5DXWA 3BUYA 3JV4B 3SO3B 4JN2B 3KPOA 2X4NA 1AJ7L 4CU7A 1XCTB 1NDMB 1CICB 2Z65C 4XMZA 3AMKA 4ZFZA 5C0BA 4AGLA 4PRPA 4QTHA 3WD5L 4P06A 3U9PH 3K6SB 2W07B 1CB4A 1JI2A 1QLRA 4N8CH 4YWGH 5D8JL 1KXVA 4KMLB 5EBWA 1O7DC 3PQYA 5E08H 1I3RA 4NX0A 2YRPA 2ZUXA 2R29L 3ZRSA 2CCWA 3OXRA 4LCCC 5AW0B 1ZOXA 4QHKI 1AZCA 1FL5B 2WUBL 4QRQA 4XOAA 1Z0NA 3CFIC 4PGCA 1OZTG 2PTVA 3BLPX 3ARVA 5HHMB 2EILB 2QTVA 4HK0A 4R9HA 2KI6A 3C8KB 3FTGA 3MLXL 4BFGA 2P80D 3QWOA 3WL9B 2IG2H 2IVFC 2EACA 4LKCB 4XAWH 1LO4L 3ZHNA 3W0WE 1VAHA 1MF2H 1HHKA 4UT9L 2AITA 4A04A 1C8PA 1FC1A 3GEFA 3OMAB 3C6LA 3U4AA 4C4UA 5FYKH 4K9EL 4M62H 2GJ6E 4DN3L 3PGFL 3V0VB 1A6PA 1WBYA 3KHOA 3VGFA 3VA2C 3VYPA 3IMSA 3KXFB 3JV5A 4Z7QF 3IFLL 3LPOA 4NQED 4X80H 1J8HB 2NUPA 3RI5F 2C4XA 1BHGA 1WIOA 1EEQA 4XMKH 1NM4A 3BW9A 2BZDA 3RYMA 3RIFF 2YJLA 4LRIC 3LKQB 3P0YL 1LGVA 1FSKB 4G7YH 2R56L 1AO7D 2AEQH 1DFBL 2YMOA 4G8GB 4K3HA 4XN8A 4U1LB 4IGBC 4RX4A 5HDQL 3KLAA 5B7FA 3IMVA 4GSRA 1YUHB 1M7DB 1KLUB 1KGJA 3GI8L 1N0XH 3NJIA 3UTTD 1LEIA 3K2KA 1BF8A 2B0SL 3US0A 5D2NA 2HG0A 1K4CA 3DX4A 3M1OA 4ELKA 5IQOA 4MYPA 2K6YA 4JO5A 4LCWB 3HZYA 4YHNB 1TXKA 2AK4D 5IBTL 2R23A 1MLCB 2E47A 2W80C 5HVHB 4Q56A 5ENWA 4HKXB 3F5WB 3QVAA 4MMZA 5HGBA 3F2LA 5J9PB 3FW6A 3ZE2F 1BZ8A 5F7DB 3F7VA 1N5YL 3DSNA 3H9SE 3Q2CA 3VXSE 2J2ZB 5KJ7E 3BVVA 4IGBD 2MJWA 2KBGA 3QFGA 5IHHA 3KPMB 4P4KA 3TV8A 3HG2A 3BD3A 5AW4B 1JV2A 4PWKA 5J6SA 2FO4A 1D5RA 3PABB 5DK0B 1W72H 1WCQA 1M2VB 2XIDA 3L4XA 3RZCB 4O5LL 3VDCA 1F00I 3REWA 3MBXL 1A7OH 2PYEB 3IJEB 2BSEA 3OR7B 4LCIL 4X9FA 4UIKL 5J4MA 3L3DA 4BFFA 4EVNB 2P8PB 3V5KA 2WKOF 4M29A 2ZUTA 1XH1A 4Y89A 2O5XH 3AGWA 3KLHC 1WD9A 4OZGF 4DPBX 3OVUB 3KLKA 4JCLA 1BQLH 1FN4A 2ITDA 1FPTL 4G42B 1JDCA 3QEUB 3V4VH 2AJSH 3QUZB 4O4YH 1OTUC 4HFUH 4UDTB 2QSTA 4UZGA 4XP1L 5HYJB 4X7TB 3P9MB 5I1HH 3QISA 2WLKA 3R8QA 2NNCA 2YA0A 3SDCB 3IDNA 2WMPB 4POZC 1XGYH 1VEOA 3RWEB 5LBSL 2JWYA 5JHLL 4AL8C 1O6SA 2LOEA 4YHML 2YPLD 3OSVA 3IETA 3KW7A 4YPJA 5JXAH 1PCXA 1T1WA 3QRBA 1SEBB 4RMQA 4NUMA 4BUQA 4WSJA 3ZKQD 5HJBA 2YGQA 1S8DA 4O02L 1QABA 5FW8A 1E9QA 3SDXB 3UCQA 5DZNA 1NMCC 1C16A 3BP5A 1QFWI 3HPLA 1CDCA 1FCGA 4AYBA 2WGNB 4BQ9A 2JQMA 3KLHD 1KG0B 2IEPA 5BVPH 2MCAA 5JHDE 4LVNB 1NGZB 3K6FA 3O6MH 4U1SA 1CYXA 3QPXH 4FXLA 3L7FB 3WEXB 4KMTH 3BUPA 1OE3A 3S3SA 1MREH 3EBAA 3KLQA 4OUUB 4NZUL 6PCYA 2A74A 4JZOB 2ADJA 4POZD 3WI9A 1OGPA 4HX1B 1MCCA 2L8AA 4H44C 1T4KA 4IKIA 1U95A 4WK4B 2X4UA 1CBJA 3T0VA 5IB5A 5JPNA 4R5XA 1S9XB 5C2BL 3JTTB 1NM9A 4P3CH 3LCYA 1TTUA 3VFPA 2A77H 4R4ND 3PWJB 3BP7B 2IH1B 1OM9A 1OVZA 2OMZA 3SIKA 5GJSL 3O4LA 4MQ7B 4XPTH 1QYGH 1I9IL 2IF7A 5DMYA 2FX7H 2ZX9A 3S35H 1Z9OA 4CVXA 5E1IA 3MLSH 3WJMB 2YK1L 1F4HA 1YN6A 1E4HA 1UWXK 2A6KA 2V2XA 3MXVL 2TAAA 1ED3B 3L13A 1WHOA 1QFWL 1MDAA 3T77B 4UILL 5HGAB 4IIZA 3SE6A 1OF2A 4BFKA 1OL0A 2WV3A 1IB5A 3P4MA 4M1CC 4U1JB 5HPMB 2C8NA 4TSCL 1A66A 2CBMA 3A4EA 5CF3A 2YZ8A 1KGCD 5AWNL 3ZZQA 1UHVA 5IMOA 1F97A 5AD0B 3OJ2C 1RZIA 2BP3A 4L9LC 4WJG3 1AHWA 1BV8A 4W6WB 1TEGA 2YXWA 2CHWA 1BX2A 3EYQC 1CPUA 1BFVH 4HZLB 1AIFB 3IVKA 4JFQA 3EFDL 1YEGH 2K3HA 5C0JB 5MP6H 3VQ1C 5TGBA 3N0AA 5DUML 4WHCA 1GMEA 1QLEB 5J11C 2WYIA 3BP6A 4KQ4L 2Y4SA 4JKPH 3ZJAA 5IEHB 4PJCE 4GFXA 4NJAH 2I25N 2GUOB 1AMYA 4JFHD 3FFCA 4FL4B 2Z8VC 1NCAH 2WXHA 1JUFB 1AKJA 1AKPA 1JN6B 1G7HA 1PY0A 1VEPA 3LH2L 4BQ6A 4M1CD 5LDSA 3PWNB 4TULH 3I85A 1V3MA 1XD0A 4K5LA 1PDKB 1JOIA 4WWNA 3L5WB 3AWGA 3EYQD 1QUPA 2DQFB 3NSDA 4NWUH 4FRWA 1X4XA 3ML8A 1R24B 5I9QB 3RGVC 2J1YA 3ZTEA 2AABL 1M7IA 1O7VA 3BWSA 4ZFQA 1MJJB 4P2RD 3W9EB 4YVNA 1DJYA 2R2EB 3HS0B 1D9KC 1PLGL 4PVLA 4OZIE 3HC3L 2V8MA 4Y2OB 1CDGA 5E8NA 1LE5B 2IO5A 3EJYC 5ADOH 3RVWC 4ANWA 4AI7A 3S88L 2ETWA 3TEUA 4XP4L 3IJYB 3GIZL 3HI1A 3EOAA 1J8SA 2D7QA 2FZ3A 3DYOA 4Z7VE 2PKDA 3MJ7B 4GPVA 3V0WH 3W2DH 5DFWH 1BQRA 1PZSA 2FJFA 5KVEE 4MJ6A 3UXFA 1ZT4B 4PY7A 3TIEA 3P2DA 3GB7A 3O8XC 1LDSA 2DQMA 5LGYA 1A7NH 3GSXB 3BEWA 1J1XH 5D5ME 1RZKL 2BY3A 5K9JH 2NCMA 3BQUA 4PRIE 3NT0A 1ZGLP 3NK4A 2CR0A 1IQWH 4G8IA 5E6UB 4V2BA 1HXKA 2NY0D 1UYWH 1D9KD 1U8PB 3QXUA 2DBJA 5GRWA 1QFPA 2R9HD 1E28A 1TDQA 2WYZA 3RWJB 4B6ZA 5BJTA 4XP5H 3EJYD 3B2DC 3RVWD 1U93B 1B3IA 4E5XA 2ZZUT 4C4BA 1ZVYA 1XF1A 1UG9A 3RURA 5K9KA 1MFAH 5DLML 5I1EL 2GTZA 4Z7AA 5BPPA 4CKQA 2CJTA 4O51B 2DQGL 1MI5A 1JWSB 2XY1A 2YSSB 3LKOB 4JFDA 5JIDA 4HV8A 3REVA 1OQXA 3SGDI 2J8OA 2WXKA 4NBXB 3APMA 1V3LA 3O8XD 4X5XA 5KSBF 2L7QA 1XL6A 3D7PA 3IFNL 3ZYJA 1F4AA 4LPUA 2A6DA 1BQHB 1YMHA 1UB5B 1EFXB 2CDEB 2X4QB 1E5ZA 3QS3A 1W16A 5EO0A 5DWPA 4U3XA 3OWEA 4YUEL 1A02N 5D4IA 2CCVA 2Q86B 3ES6A 1U3NA 4WKZB 3GJFB 2JCWA 1BYPA 1K6QH 3KGTA 1I85A 1Q9OB 1CFQB 3C5ZA 4D0DB 5GRUH 5I1GL 2IV8A 4Y16A 5T3ZD 1GJWA 1TJIL 2NR6C 3I50H 4IRZA 3GI9L 4FP8H 4M8UA 1K8IA 3MLPA 5PAZA 1OY3B 5E2TH 2XKNA 1G7QA 1CVRA 25C8L 3APNA 5C71A 4Z7OE 3GHEH 3OZKA 1VZHA 1UEYA 1OGSA 4PLKC 4QTFA 1I1AA 3WG7B 2BNQB 3BPLB 1J1OL 4X99B 2X28A 5ADPL 3RFZC 4FTVD 4BFJA 5G4MA 1LO5B 4FFWC 4ZOEA 3LKPA 2NXYC 4OCLC 4AK2A 2B4CL 4HIXL 5L2KD 3VWJB 1N7MH 1KCWA 4IK6A 4JHAL 3FO2B 2PP7A 2EP6A 3CFCH 4N5EC 3US1A 4KOBA 3UYRH 2OXGB 3ZE0F 1L4IA 1O5PA 2IFFL 4OFYD 3BP4B 2HJKB 3F12A 3RUGA 3RL2B 4NGHL 4EUPA 1TNNA 3KPRA 3OM3B 4I5BB 1X44A 4PJXB 5IHZB 1YMMD 2H6OA 2A9BA 3EOBB 3CH8A 1MW0A 1P1ZB 3X3FH 1QSFE 1CFNA 1SMAA 4QOKA 4PLKD 4TM9A 4YDLC 2EVIA 1I7RB 1OAQH 5MERA 5FYKD 3B43A 4FFWD 4MNQA 4J3OH 2NXYD 1J0KA 4OZHB 5EWIH 5C0DB 2OSWA 1GZQA 2HFFB 3C6EA 4MLIA 4TUOB 1N4XL 4N5ED 4ZMPA 5L7XH 4UNTA 1L7TL 3DUUB 3CJJA 2DIBA 2PCFA 5E23A 3MRKA 4P07A 3IXTA 4BZ1L 1I8KB 5FR3A 1CLZL 1Q9KB 1AXSA 2FX9L 3BMWA 5A2BA 4QT5B 4XBGA 3MRDA 4Y1AD 3O3DB 2KHAA 1SLVA 2LVEA 4PJIF 4I4WB 5CHNB 3QRFM 1FYTB 3N85H 2WW8A 1FE8L 1K2DB 3EUDA 5GGTA 4Q9QH 2ZUQC 3PAZA 4MA1B 4NAQA 2D4DA 4FG2A 3SGEH 2E27L 5IF0A 4ZS6C 1OB0A 2MQCA 2XSKA 5LGKA 4TVUA 5LGHL 4XBPA 2Q8AL 1E8WA 3L6FB 8PAZA 1NFDE 2P26A 1NOLA 4MD5B 1CD9B 2NXZB 4ABVA 1OE1A 4NENB 4MQSB 2YD0A 5MENE 1LP9B 1F1DA 3ZDYB 3RAJL 1I1YA 3RFZA 3LRHA 2XZAL 3FT9A 4XXDB 5ABAA 2XBTA 3MRRA 5SWSB 4IBVA 4ABUA 5TDNB 3NFNB 3OSKA 4CADB 1ZMYA 4Y4HC 1UXMA 5HDRA 1G9ML 5L2JA 4P5TB 1D7BA 3E6FB 5KUMA 4NZTL 3IMTA 1C5CL 2WWOA 3QRGH 1XF3B 3VXQA 5IQMA 4XC3L 4ZS6D 3QQ9D 4ABWA 1NFIB 2GBVA 1VKXB </