3ASWA

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
320
structure length
320
Chain Sequence
GTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 81
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA02
2Z1PA 3IRZA 5CF3A 3AU0A 4JE0A 4F27A 1N67A 2YLHA 4F20A 4RMBA 2Y7OA 2RALA 4LEEA 3AT0A 4BBWA 1R17A 4B60A 4F24A 5IHWA 5CFAA 2Y7NA 3IS0X 4JDZA 4MBOA 4LE8A 4F1ZA 2Y7MA 4MBRA 2F68X 4B5ZA 3V10A 1R19A 4Q6KA 3IRPX 3IS1X 4FJ6A 2VR3A 4JDZB 2F6AA 2Y7LA 4LEBA 3ASWA
chains in the Genus database with same CATH superfamily
3PHSA 1PZBA 2CDEB 1BX2B 4HQQH 5BO0D 3RDTD 4K71B 4AQ1C 3LS5L 5E6IA 3TH3T 1Q9WB 1SXBA 3GC3A 5D1ZD 3S96A 3T1FA 2QT6A 3MACL 3QYMA 4XBPA 3DK0A 1G4MA 1AS6A 3C6LA 4PLKD 1DEEB 3NFPB 2W92A 3MJ7A 1PQZB 2NY0B 5EU6E 5FO7A 5JLZA 1BLNA 5IVOA 1OE3A 4CC4A 2UZIH 3VDBA 1MWOA 4ALAL 1S7UA 4ZS7L 5KS9F 3MMEA 2GI7A 5F7LB 3GXNA 2VDOH 4O02H 1ZHNB 5GS3A 4BE5A 3FO9A 4WK0B 5JHLL 5IK3B 1JWSB 5TH2A 4BKSC 5DURD 3D08A 1CFQA 3RGVD 4IRSD 4JZNA 2VN5A 4L3EE 3C5JB 2FRGP 2EXWD 2LQRA 2KZWA 1KJMA 4ZOBA 2H6PA 2Z34A 2BWIA 2ED9A 4NQVB 5T1DL 4HIHA 4YHIB 5ANMB 4HUCA 4PJFA 2ZIDA 2FGWL 3BGFB 3DYOA 3KH4A 4DKTA 4EBQL 5HYSA 1SRDA 1QSEE 2C3HA 2YQGA 5EF1A 1OV8A 2Y7MA 4HKZB 4YDVB 3U0WH 1FSKB 2FJGA 1JXGA 2CHNA 2WLNA 5D7IF 5ALCL 5E9DB 1LO5A 3UTPE 4U7SA 1CD1B 3EYVB 3C2AL 1DJXA 4FG2A 5E7BA 3KNBB 5FYJH 4AJVA 3ZO0A 4QLRA 2V9UA 3CAFA 2IPKA 1C7SA 4NQDA 1TJHH 1CXIA 5AW4B 1J5OH 4GBXD 5DJXB 4E41E 3C5SA 3HZKB 3LIZL 2Y7QA 5IJKA 4P57B 4OKVA 4EOWH 2MNJB 4RMVA 2DV6A 4HZ1A 3O41B 1BCIA 2VITA 3REVA 2LU5A 4PB9L 4JMNA 4AQ1B 1F4AA 2X9XA 5DZAA 4U1KA 4P2OC 4PD4K 5GHWL 3VVWA 3MR9A 4QHPA 1DBAH 2IADA 4N2EA 3S2CA 4BH8A 4ZFOL 4D2NA 4MB1A 2DQFB 2GJ6A 2ZOKA 1U8LA 2WSDA 4U7KA 4FTVB 2I7SA 1HAWA 2GEEA 5IFAL 3C87A 4UYPA 4OJFL 4XCNA 3FC8A 3DECA 2ZX7A 1WUNT 1UWFA 2H6UA 1DQMH 1O9VA 4Z0BL 4DAGH 3U0TB 4QMEA 3K6NA 3MV8D 4Y7MA 4TSCL 1LEKB 4D3CH 3RE0A 1M6OB 4AEEA 2QEJA 4JM2D 1UC6A 5TJWK 4GH7B 3DX8A 3SDAD 3TWCL 1FFRA 5DGQA 4PRHA 2M1KA 5H94A 3MNMA 3KWTA 2JKRM 4H8WL 3R7RA 1ACYL 2Y5EA 1DBBL 5I8CA 3ATAA 3Q9QA 4Z7UB 4QHUA 3M8OH 3ZL4L 2O5NA 4EKJA 1CVRA 4PGEB 1NBVL 2BVOA 2AJZA 4YX2L 1QSFA 4LARH 3SYOA 5FYJD 2WYHA 1QEWA 2F1AA 3D9AH 3EO1B 3L3DA 2NZ1A 3ME0B 4FL4C 4Z8FL 1GPOL 1MREH 2QVKA 1SQ2N 3DX0A 3UTTD 4F2ME 4Y1AB 4ES9A 5I1KL 3CHPA 2DQHL 5HPOA 2Y5TA 4W9HC 2X28A 4HJJL 2ITFA 4NS0A 1MKFA 5F3HB 5C07A 3VXPA 4DP8X 3C5ZD 4OM0H 3GMNB 3NSJA 3DUUA 2CJ3A 1XGTA 5IFJB 2AV1B 3DX1A 5E5UB 1JRHL 3CLEH 4KX8A 3RY6A 1NC4B 3VG0H 3JYCA 4WTZA 4KNTA 4CBZA 1UT2A 1OT2A 2NXYC 2XTSA 4IRZA 2X4TA 2FK9A 4PLJC 1G7JB 2IC2A 2BHFA 1S7QA 1ZHKB 3BMWA 4P2OB 5JHLA 3O6LH 1FRGL 4YDNA 2Y23A 4MQXD 2XZAL 2E0PA 2NZIA 3ABMB 1PY0A 1A66A 1MY5A 1I1AC 3MLYH 4EUPG 2LABA 2W65A 1ZSDB 3CN3A 4JFXB 1OM9A 3WBDA 1IGML 1JGLL 2TSAA 1HNGA 2OAAA 2F7PA 3FQRB 3IM1A 1QEXA 4MJ5A 3I9AA 1LP9B 3P69A 4PJDA 1FZKB 2AJVL 5EC1B 1SGKA 1TIUA 2R0WL 2OMXB 3ULVE 3QORD 1FYTB 2YD7A 2C7UB 3TA3D 3GJFK 1HEJC 1KJ3L 4JAMA 1TZOA 2YXWA 1SYVB 1KN2H 1S78C 3W9EB 3I02B 3GSOB 3MSPA 3LIZA 1AZRA 3O11B 3F83A 4MYWB 3ZLQC 2CUHA 1T5WB 2EO9A 4ZX4A 4GKZB 3WKPA 1N3NB 1W8NA 2DWYA 2VC2L 2YA1A 4MJHA 1OF0A 4P2QD 3CPUA 5C7XL 3NESA 5I8KH 3K6SB 1X9LA 4FL4B 3E3QE 4HX1A 1NIAA 4TLKA 5C0GB 3PWUA 3TLRA 2VWEC 3GZKA 4OF0A 3G04A 1JNLL 5FUZL 4ZFOA 4FQXC 3AAZA 3B3IB 2NY2C 3FRUA 1T0NA 3IGUA 2YS4A 2OMYA 1M1XA 2B1AH 1RMFH 1HC1A 5H2BB 2F5AH 5IMMB 2ID5A 1G9MH 2FDBP 2B0SL 4GNKB 3WO4C 4ZRGA 5AFAA 4EQ3A 2FT8A 2NXYB 3O3AB 4C56B 3MRDA 1J11A 1F4YL 4NHCL 1OAXL 2HLFC 5ICZA 3HUJB 5KG9A 1DVUA 4NAMA 1JFQH 2KBGA 4ORGB 2QGBA 3GDCA 5CZXC 4AV5A 3PV6B 5FDWA 2XA8L 1KWGA 4P23C 2X70B 4U05A 1I9IH 3B2UC 1Z9SB 1I1AB 3RJDA 1AIFA 4YHML 3MV11 4KAQL 4M8VA 4C4UA 1WCBB 3WFBH 4IOFD 4K9EC 1CLVA 3WS3A 1EZVY 1PNDA 4D94A 3O45B 1A4KB 1FBIH 3FQ4A 1ZA6A 2X10A 5F7FA 3NPSC 2PUQT 3HFML 2O6FA 4M6AA 1OD7A 1R3HB 1W16A 5FAAA 2HWZH 3VFWB 2GK0B 3T3PE 3AUVA 4FQPA 2AV7A 4P5MA 2AABL 4XO3A 3UGUA 3AQDA 2DQMA 3QXTA 1WGOA 5ABZA 2Y2YA 1MHPL 1N2RA 3CUPB 4UIMB 3QCTL 1H3VA 1GGUA 5C0FB 4R2GD 2ZUTA 3IWUA 3TS8A 3UCRA 4XPFL 3K8LA 5F21B 5C9JA 1T1YA 2VN7A 3MBWB 3QUKB 4OVVA 5I2IA 4P2AA 2LAGB 1WFOA 1X7QB 5SWSD 2P26A 3QHTC 1MFAL 5EEVA 4K7PY 1P69B 3V0FA 2R2BA 2DQJH 5IM7A 1Y6KR 5C0CB 2J4WH 2Q7AA 1ET8A 2P49B 1ND0B 1RZJC 2VABA 3CVHL 4FQXB 5F7HA 1GZHA 1OP5H 2NY2B 2R2EB 1OTSD 1SOKA 2ZWKA 5GGSA 5FECA 1B2WL 5DA4A 4R6UA 1VGKA 2QSCH 3V2AR 2XPGA 2WXLA 5JQHC 3R4RA 1W6WA 3HRZC 3WO4B 3ULVF 4UDTB 1OQOA 4I0CC 4PRID 3LKQB 4OGYL 4DW2H 2E7LA 4HPHA 4OFDA 4I9WE 1CI3M 1NCBH 3QG6A 4HUWA 1F4XH 1RIUH 2BCKB 4N6QA 2R8SH 1MCWW 2DL9A 4JFPB 4TM9A 4LMQE 2EH7H 1DLFL 3TN0C 1GGCH 4P23B 2N56A 2FNWA 2PTTB 1IKNC 4G8FB 4KK8C 4N90E 4BXVA 2AQQA 4X4YB 3LQAL 2VZ1A 3OJDA 2BVPB 4AENA 4OZGE 2H9GA 5DFWH 4BK5A 5DGRA 4U6HB 1MH5B 4LCWA 4H88H 2UVEA 3UZQB 1MFEH 3MRLA 4EDWH 3PE9A 1WICA 3CVCA 3NPSB 4GOSA 3V10A 4KQ4L 1I3RB 1HKFA 1KGWA 3TJEH 3V5HB 2D7PA 4NZFA 3SCMD 3UP1A 1JMXA 3F3HA 3RVXD 2XYCA 3QIBC 5BZDB 1UKQA 2BM3A 3N42F 3FNKA 2VSCA 2MKWA 3P02A 1KNOB 1Z1WA 2YXFA 4RX4D 5DRXB 4PY7A 2PYFA 2MQCA 2ZKHL 1EGJL 4XVJL 3O6FC 2YMTA 4JRYD 2Y1VA 1PIGA 3KJ6L 3STLA 2JFCA 1PG7W 3O6MH 4GO6B 5FCUH 3ZSSA 4BFFA 2A4CA 2AQ2A 2W95A 2BP0A 4GAJH 5IROC 1YY8B 2JNZA 5E8EA 3NIDE 1J8KA 2KZKA 3CZEA 3DX9A 4CBPA 1NBZA 2EYTA 2VSDA 3ESPA 1FHGA 9CGTA 4XHJD 5J6GB 1X3DA 4OGAD 3P9LA 4Z3EA 3NCBB 5GGTA 4KJWC 5D71H 1EA9C 1MLCB 4M1CD 2Y7SA 3DIDA 4A6YH 1GAFL 3NYKA 5AOZA 1A14H 1NFDA 3BFQG 1K8IB 3RAJH 2V3DA 1W72L 3H7BB 4PYGA 3T3PF 5I1HL 3HRZB 2GW5A 2IXQA 2WXHA 1A64A 4PCTA 1BFVL 1E9PA 4MKTA 2WAHA 4RGNE 4JRXB 4S0TD 3H9SA 4M61B 5DJ6A 1OP5K 5FGSA 3Q1SH 1TFHA 3S4SG 3TN0B 4BFIA 3VE0B 3AS3A 4MNGE 4TVPL 4X5RA 2XVGA 4RNRB 2HVJA 3CMOL 3F7YB 1MQ8A 2XV0A 3F64A 4DGYL 1I85A 2BOLA 3L3IB 3GSWB 4WHCA 3EDFA 4WJ5B 4UINH 4CDGC 4EZJA 1E9QB 3MRNB 4JHWL 1F6AA 2WW8A 3NIGE 1TYEB 4KHXH 3VXRE 3E0GA 3MGAA 3WLWC 1P7KA 3Q43A 3UXFA 5E2JA 1Z0MA 2IPTL 2HTLD 4DEPB 2KUTA 2B4CC 2A4ZA 3SBWA 1UB6B 1QLEL 3N9GH 3R18A 4IK6A 2PXYA 2FHFA 5F70A 3QIBB 4HC1H 3MRHA 3PJSB 3W3BA 5C0JA 2X2HA 3CVHA 2IDTA 3ZU8A 3FN0H 1BQ5A 3NH7H 5TE7H 2R29L 3A4EA 3EYFA 3O6FB 2FGZA 5HXMA 1OHQA 3VD7A 4K7PH 3GDBA 3LKPA 4ATWA 2PCFB 4B9ZA 4FS0A 3FQWA 2X6MA 3WMPA 3IXTB 3WIIL 1IC5H 2YEZB 2JCCA 2G2RA 32C2A 3UTOA 4AW4A 4Z0XA 2WLMA 1JZEA 2DMHA 2GY7B 2A9BA 4OKDA 1FFPA 3WE6B 4DN4H 1O75A 4OZGF 2BW4A 2HJLA 4TUOA 5DA0B 5DZLA 3VI4E 4N2NA 3V8OA 4WHTB 3IGAA 5AVQB 2OXGB 3VFSA 3VXUE 3T2NH 5AYUH 1I8IA 2CXKA 4EN3B 1GY1A 4XMXA 4ZFFB 4Z7IA 2EDWA 3OHXC 2CA4A 1AZCA 1NEZA 2MQ0A 4ZYKB 4CSTA 3DV4A 3QI9A 4X8JB 4Q56A 3F7QA 5GGUB 1EERB 4JR9L 5JQ6H 2VZOA 2QHRL 1OY3B 2WXRA 2VDNH 4QF1A 4XNBA 1ZGLP 4J4PD 4UILL 4S1DC 5BCAA 1Q94A 3VXQB 1S7WB 3L1FA 4Q7DA 3NIDF 1XR9B 8CGTA 2JKXA 4AL8H 4WU7A 4L9LA 2YPVA 1E9OA 5EU7C 3WN5A 5HDRA 1U3NA 3FN9A 4UT6L 3KYOA 3GEWB 4NFCA 3V6OA 4ZMLA 1NC2D 4N0YL 1W9XA 1ZA3B 4X6CE 1QLFA 1A6PA 4QRPB 1TEYA 5SWZB 4GEIA 4TL5A 1MZZA 4DGWC 2P44B 2I07B 5KYXB 4HFWA 4I48B 3O4OC 2WXNA 1BVNP 3LQZB 3VSQA 5LBSH 1UZGA 4C4KT 4K07A 5F0LB 5C0AA 1TJGH 1F3JB 3FZUD 5T1LB 2IAMA 4HIPA 2K6ZA 4I3GA 4Y5YC 5DJ0B 2XWRA 4J2XA 1K8DB 1G7LB 4U7MA 5T1KA 2P48B 3IFOB 5CILL 4N87A 1LO0H 4G9FA 2JJTC 1I8MA 3GUFA 3VQLA 1NLDL 2VAJA 3L4ZA 1R3LA 3D87B 2E6QA 2YAHA 3GPEA 1HYSD 2ESVE 3NIGF 2Q0ZX 3VXSD 1NGZB 2BRRH 2WTOA 3FTWA 3IDXL 4B9KC 4YHLL 4KZ0A 3U1SL 2A4EA 3HS9A 1A7PL 3OHXB 3MXVH 4GAYB 4Y5XC 2WUBH 3BIAX 3ZE0F 1OGAE 1R3IL 3BAYA 2BHYA 2ITDB 2Z7ZA 3IJHB 3FB8A 3IDYC 4OH2A 4ETQA 4KPHH 3QUMB 2X88A 3ROOB 3CHOA 1TVBA 3SO5A 1R1CA 2VDPL 4OLZL 1CDUA 3T8XA 4HLZG 3RZWA 2R29A 3DHUA 4AEFA 3FT2B 2V7NB 2Y06H 5ETUA 3L9BA 5AAMA 4CVZB 1I1RA 3IS1X 2GJZA 1UOLA 3GSUB 1MDTA 1QASA 1H6EA 2FX9H 4NHUB 2R1WB 4WI0A 3DSNB 4LEOA 2AJXH 2BVTA 1GIGL 2DWEB 3K4DA 5DHYB 2X09A 4ZO9A 35C8L 3VI4F 3VGEA 3W82A 4Z76A 3WO3B 5DD0H 3UJIH 1HILA 3Q8FA 1J1PL 4HJGA 2PF6A 1PZ5B 2EVFA 1RSYA 1OD9A 3T3MF 5IHLB 3REWB 4IOSD 1A21A 2AXHA 4Y5YB 4N8VG 3KYNB 1M7IA 3W0WB 3ZTNL 5GSVA 3NK4A 4MD0A 2MEJB 3MA9H 4LCCA 1Q38A 4PJIB 4Q52A 1R5VB 1SM3H 1L6PA 1ID2A 3UJTH 1PY9A 2BY0A 1FPTH 4E5XB 5IESL 2F53B 4UV4H 4OUUB 4NQEB 3L13A 1RZ8A 4PV9A 2VJXA 3QXDB 1LWRA 1K4CA 4JPVL 2Z4QB 1R0AH 4N6RB 3ZTCC 1XIWC 1X9RA 2P3YA 4UIKH 5C92A 4Z7VE 4BH7A 2J73A 4WWOA 4NQCA 5FV1L 4MLIA 4X98A 1DJWA 4Y5XB 4M4PA 4Z7OE 3GQFA 4UT6A 4JPWL 4JFZH 1WZMA 2DJSA 3Q6GL 5GZNA 4WZ9A 4BK8A 2VLJA 4NO5A 3SSGA 4XMUA 3IDYB 4LCYB 4Q97A 2XTJD 5DVKA 1P2CA 3UAAA 2DH2A 1BSIA 3HZ3A 4F7TB 3LPGA 4ZD3L 3WXWL 3BWZA 3I2CH 4G6AC 4PB0H 4ZT1A 4GKOA 4G5ZH 3IAQA 3VD0A 3GIZL 2ZAIA 4GRWE 3RNQB 3UTQA 2VT0A 3WIHH 1ETZA 1ET5A 5KSVB 2OJ1A 5AZEH 4AV0A 3C2SA 4KGLA 3U0PA 3IFPB 1S7VA 3QXAB 3DDFA 1F58H 4JO4L 1OAYL 4HLEA 5F96H 1JRHI 5FM8A 2Y2WA 1P7QD 1XV8A 2BVQB 4KX7A 2Y6SC 4XI5C 1DBJH 3FO2A 5BVJB 2WXFA 3V79C 3KPLA 3KLDA 3PHQB 3WFCL 3B9VA 4PRDA 5E5MA 5TDNA 1ZS8A 4PJFE 3LH2L 3CFCL 4KXAA 4XX5A 3L8QA 5FFGA 1CXFA 2CJSA 1I9RH 2ZT9C 4TNWK 5C0BA 1PDKB 1XGZA 4ZPTA 3TEUA 5DHVA 3UO1L 3B2XA 4J23A 4ELDA 2OMNA 1YUKB 5K69A 4LRIC 3VRIA 4IRJC 5J11C 3EOYG 3WFDL 3GMRB 4AM0A 4BQ6A 4L3CA 4JFDD 4OAWB 3WV0A 4NZTH 2WLIA 4HZAA 3S3PA 1MRCL 2XFGB 3N41F 1B9KA 3NJLA 4BFJA 1DQDL 2AJUH 3EJZD 4QYOB 3VD2A 1CCZA 1EJFA 4FYRA 3WY2A 1XIWB 1A1OB 4I0KA 4RAUA 4PLOB 2N1TE 4I2XB 2Z31C 4G7VH 4HK3J 3H3PL 3VFVA 4JG5A 1PZSA 4MAYC 4X0KA 4OFQA 4RFOH 4MCZB 1JF5A 3G5VB 5GRVL 2YOCA 4XWOC 1AXSA 1RU9H 3UBXA 5GQBA 1SBSH 1UKSA 4IIQC 2BNQA 3GKWH 4NCDA 2GJ6E 5HGAB 2ZKMX 4NGHH 1RXLA 1DVZA 1FL3A 5LUMA 2DDQH 1CWVA 1XH1A 1EZLA 4I0PC 5MEQB 3U9WA 2ZWLT 3C9NB 4I77H 1CGSH 2YJLA 4AUJA 2HB0A 3OJMB 4HXAH 1XCTA 3RWEA 3HR6A 2N0KA 1OF2B 4BDVB 2NXZC 4F7MB 2FYYB 2YMOA 3EGXB 3EIFA 4NM4L 2A9NL 3QB7C 1LO4H 5IG7B 5TDOB 3T65A 2PW2A 5HHQA 1SDDB 2FHCA 3AXIA 2V9QA 3BDYH 4Z7VF 5G55A 4P4KD 1JF1B 2I25N 2ZXEB 3AU1A 1NCOA 4PRHE 2M2DA 1F42A 4BSWB 1MFDL 5TPWL 3WHE0 4Z7OF 3D2UA 4KROC 1M2OA 4O2EB 4KKZA 5I66A 4I3RH 3RX5A 4KRPC 1XF4A 2WQXA 2CUAA 3WL9B 1QRNA 3H2WA 4ZS6D 4M7ZB 3I3BA 3PGFL 1BA9A 1VAHA 3BQVA 2FD6L 4OIAA 5E00B 3DJ9A 4PWIA 2SODB 4FQCH 4IRJB 5J11B 1GW6A 1WBXB 3WNOA 3MLTB 2HUEA 3X3GH 4Y2OA 3GK8L 1JZ2A 3NMEA 5C07E 5F3FA 4PJCF 3FB6B 1DUYA 1LQSR 1J1OH 3OQ3B 3AY4C 5KJ4A 1IFHL 2FE0A 2DRUA 5DD3H 1E8YA 2XV2A 1P5VA 2W07A 3U4BH 3SGKC 2H32A 4FZ8L 3QR1A 3KCWA 4MAYB 4OZFH 4XC3H 3KCPA 4GKLA 4D0BB 4F33A 4HULB 1ACXA 1MCLA 1SXAA 4L2LA 5DUMH 3WJLC 4QTIL 1CDCA 2D7TH 3K1KC 1EUTA 4IIQB 3L3HB 4PJFF 5HJDA 4GRWH 3QEGL 3NSFA 1FP5A 2Y7OA 3MRCB 1MOEA 4I0PB 2BNRB 2FIKA 3TJHD 3DPDA 3PHOA 2NR6D 2V2WA 3AWEA 3QUYC 3NCXA 4UM9D 2R0ZH 3L1EA 3OXSA 4KK5C 5EEZA 2X3BA 4PG2C 2NMSA 1RIVH 2NXZB 1BZQK 1IC7L 4XOBA 4Z3HA 5CS7A 1P4IL 2UZYB 3DOSA 4OGXH 5E8NA 2XQYG 1H8OA 1NGYB 3D33A 4JFQA 1KCWA 1OOAA 5DC9B 2YMXL 5FYJU 2Z0BA 4N5ED 5DWUH 1JPEA 3SPGA 3Q2VA 2JKWA 4KROB 4RVBA 3BVVA 2C9RA 4HETA 4KRPB 1YQVH 3T77A 3BH9A 1HH6B 2XG5A 4K0OA 4Z95L 4OTXL 1FAKT 2G9HB 3H0TB 2QV2A 3NJJA 5DK3A 3ML9A 2WQAA 4BE6A 1GL4B 1DO5A 3WFHB 4HT1L 2ZSVA 2A1WL 1GZPB 1QOKA 5BNXD 3UGEA 3UIYA 2QGEA 5I6MA 1LTXA 3U1PA 3GUTB 1QQDB 2D03H 1NKGA 3RVWC 2ADGB 4Q9QL 1SNRA 3FL7A 3K74B 4UQDA 5D7SH 5IB5B 4HF5H 3HG1A 3MRIA 2K6YA 5IOPB 1IUZA 1S7TB 4GMSH 2X3AA 4O9HH 5LVEA 1CGXA 5CBEB 2W94A 3FSWA 3DBXA 3MODL 4UQBA 3MLPA 4F27A 5FO8A 5E6ID 5J12C 3RUGA 1JGUH 4LDLB 2NY3C 4BFRA 1JG9A 1HEHC 5DI8B 2WTRA 4OQTL 1IGCL 5I1LA 4C83B 3GBML 4AEHH 2Q5BA 4G43A 2XCMC 1WGVA 3Q3GB 2DWDB 4TPRH 1L7IH 3QJRB 4GSQA 2N7BA 4WEEA 5CJOL 4HIEB 1OCWL 1UWXH 3VGHA 4LGPB 1XBDA 3D6GA 4HCRL 2VYRE 4Z5RA 3DVIA 4OIBA 4XP1L 5D7JC 1JNNH 2PWDA 5DUPH 3QUYB 1J5CA 1U3HA 5F89B 3VA2C 4UT9A 1L7TH 3H9ZA 1KIQA 3L7FB 1KF9B 2TRYA 4EAEA 3I75B 2WMPB 2WPGA 5GISL 2IQAB 4N68A 2NPLX 2P80D 4PMFA 4OBRA 5CN3A 2N4IA 3FFCA 4NUJB 3BQUC 4XR8C 5JORB 4PJGB 4UMSA 4XWGL 3HE7C 3NFNA 1HHIB 3ZKMC 3RZCA 1FDLL 2ZJSH 1NGPL 3ISYA 4U3HA 5F1IA 4WV1A 4PM1A 3ROLA 3LPFA 3VO0A 4XODA 2V9RA 4XZ4A 3D48R 1TZGL 3CFIC 4NQDD 1PCXA 2X6AA 3LS5H 5F7DA 5IMOB 3VD4A 3LCYA 4C8XA 3U2SB 1SVBA 2YK1L 3MACH 3SZKC 4R97B 4A2HA 2GSGA 1I4FA 2BWQA 5BRQA 3ABLB 3BKJL 2N01B 4K7FA 5JMRA 3LXBA 4YDMA 3T2OA 1OT4A 1V8HA 2PP8A 2I60L 1QR1B 2QPDB 4XPTL 5J12B 4ALAH 1WV7T 2FEDC 3LZLA 3EDKA 4ZS7H 2GT9B 2NY3B 1D7BA 3DMMA 4FFYA 5GGSY 1IBHA 3VD3A 2JJVA 1NMCC 3EYOA 3LZNA 1DZBA 5EIVA 5JHLH 5AW6B 1NDGA 5JXEA 3V0EA 5LQBL 2AQ3A 3LKNA 5IP4A 5ABDE 3R8QA 1CK0L 1EXGA 4CW1B 1TCRB 1HEZA 3MLSL 2X12A 1JZDC 1X4XA 4FG4A 5BQ7B 1UUSA 3FO0H 5I1AA 1JPFA 4FHBD 4CADB 5AOJA 1JHKL 5T1DH 5C3TA 2FGWH 3G6JB 3MLUL 2HPOA 4EBQH 5HPMA 5GPRA 4G82A 1E2VA 4LCWE 2BSRB 3LXAA 4UQ3B 3PWNB 4J1UB 5D7JB 3CE1A 1W8OA 4GW4B 4KH9A 5ALCH 3X1NA 1JTOA 4DVBB 4R4BB 2HG5A 3C2AH 3G9VA 5BJTA 4OF6A 4Y88A 2GYSA 4OI8A 1SUHA 5FS5A 5GS2H 1KIRB 4KJPC 1UWXK 5C6TL 3QH3B 5B1JA 4QRRB 3VQ1C 1QSFD 3BEWB 3LIZH 4V1DA 2RA1A 1TTUA 3MBEC 5DQJB 1AHWA 3EYUL 5FFLA 3HE7B 5J6SA 1BMZA 4KK9D 1YNTA 1N19A 1WD9A 3ELAT 4XCYB 3UBGA 2DEWX 4WU5A 5F8RC 1F13A 5ICYB 1KXQA 1O7VA 4PB9H 3RWIA 4PCSA 3G08B 4OQTA 5GGVL 2DWTA 2NUTB 5GHWH 4CILA 4PTUA 1AP2B 2RFXA 1TKWB 2LVEA 4MXQD 1JGEA 2FHBA 5T3XE 4XZUB 5IFAH 1A6TB 2VSKB 2CXGA 4OJFH 4QJ4B 5IEKB 3DO4A 2A83B 1XZ0A 4D0CA 3M7OA 1NFDE 4HCRA 5GRJL 1A2YB 4WLCA 4Z0BH 1JTTA 3FTSA 4FNSA 4QXTA 4LLQB 4HCIA 1KWKA 4TSCH 4TQEL 1GTFA 4YSPA 3B7YA 4JFFD 1T21A 2VLKB 1NMCB 1G6RL 2IDFA 3X14A 4L9DA 4URTB 1J9TA 3H9SE 3TWCH 3QIWD 3RP1A 1L0PA 2LLNA 3L4YA 4OV5B 2A6KA 1WFNA 3FTYA 4H8WH 2E7MA 3RNKB 4N0UB 1ACYH 5EFIB 5GXBB 4NYLB 1DBBH 2XY1A 4AJYV 2BP5M 3VD1A 2VISB 2D7MA 4LXFA 3ZL4H 4LU5L 1G1OA 1HHGB 1NBVH 3RDTC 4YPJA 4YX2H 5D4HA 3Q5TA 4NQSA 4Q14A 5D1ZC 4FYTA 3EGSA 5L2KD 4YGVA 5HYJB 5GS2D 2WJ7A 4Z8FH 1GPOH 2CNZA 5I1KH 4G72B 4PLKC 2DQHH 3KPSD 5E7FA 3LN4A 5HJ3B 4WNSA 3FS9A 4HJJH 1NIEA 4E9WA 4HWNA 5DHXB 3UC2A 4TNFA 4H5SB 1U93A 1JRHH 3MBEB 5HDQL 1HXMB 5DRZB 3PYCA 4N2HA 5IMKB 2BNUA 2E7BA 4KVCL 2GKIA 4X5WB 3V6BR 3RGVC 1EO5A 2JCCE 4IRSC 4MMZA 2EXWC 1KFAL 5BRZA 5K1VA 3J07A 3ETTA 2QL1A 3IMTA 2E75C 3V5DB 4EPSA 1FRGH 3I50L 2V5YA 5A2FA 2XZAH 1O6SA 4GQZA 4Y8AA 3RY4A 5BV7L 1JGIA 2Q86A 5EB9A 4BM7A 5E1GA 3VFPB 4RH4A 1IM9B 4BQ8A 3ERXA 3KLSA 5T1JA 4S10A 5AUMA 1IGMH 1JGLH 1SHSA 5I9QC 3I6SA 1UD6A 2LT9A 3FU5A 3O4LB 3IJ8A 4UTCA 1AZBA 1RJLB 2AJVH 1VIWA 1ONQB 3GMMB 2R0WH 1MCOH 5EUOA 1HQ4B 1CB4A 1BVLA 3ABZA 4GBXC 3L3GB 1KJ3H 1NIDA 1Q0XL 3D39A 3MUZ1 4ZMQA 4ODHL 5FR3A 3KEHA 1PD6A 1RP8A 4LK4A 2P5WB 2VDRB 2E7CA 3TL5A 3RDTB 3JSSA 3GB7A 3S5LB 1CD0A 5C7XH 2VC2H 3ESNA 5D1ZB 5FOBA 2CH8A 3VCLB 2J8OA 2G3NA 1KFGA 1ITBB 2IPUK 1U8KA 3ES6A 5DQ9A 5AW1B 1NCWL 2R7EA 3V6OE 4JL1A 3NOIA 1JNLH 4GY4A 4NRYB 4ZW6A 1PX4A 2OR7A 2BIQA 5IW6B 3GM8A 3BVUA 2J8HA 2ILLA 3TIEA 1EHLL 2GJJA 4AKPA 5C0AE 1DBML 5KANG 1LE5A 5A2CA 3TVMD 2B0SH 1F8TL 2B14A 3DUSA 3EUUA 4JM2C 4ADIA 2X6BA 3SDAC 5DURB 1TEFA 3RGVB 1F4YH 2HFEB 2VMJA 2ZWNA 1KENL 4IRSB 1OAXH 4NHCH 3SIKA 3UGXA 4FJZA 4G9FE 5CU9A 4YDLC 4X6DB 5AW3B 2XA8H 1M4KA 4Y2DA 4OZIA 2O61A 1FNSL 4YHMH 1HJCA 4TVPE 4KAQH 2VMDA 1D2PA 3QJHA 1ES0A 2DLTA 2AJ3A 4HAFA 4L4TA 2VR5A 4KKQA 4ZXBA 3HFMH 1MXGA 1S9WA 2A9AA 3FO1A 3L2LA 4HS3B 4DO6A 4S1RL 4GSRA 5M7QA 2WANA 3GSVB 43CAA 3IVKB 1BG1A 3C5ZC 4GBXB 2AABH 5C2UB 3VXNA 3UEZA 3A24A 5CEYA 1MHPH 1X4ZA 3QCTH 4IJ3C 4U6XB 4Y1TA 3FQTA 1U0QA 1SF3A 3MLWL 4PJ7A 4WHYG 1XF5B 2WK2A 1S8DA 4XPFH 2JCCF 2WV3A 2WVTA 4PRPD 4E68A 3GEFA 4X2UA 1RZFL 2AVFA 2ZZUT 3QXUA 1O6TA 4AE0A 1IARB 2AZAA 3UTZB 5D72L 1MFAH 4MQXC 4X6EB 3N40F 4OV6F 4FA6A 4KXCA 4M8QA 2MH4A 1ZWIA 1NM4A 5EIIA 4UOW0 1KDJA 3CVHH 5D2LA 3WENA 4K9JA 3MRQB 4NBYB 5EBMA 4IDLA 4YHNB 5ACZB 1Z32X 4O02B 2VDOB 4JCLA 2YR3A 3OB8A 2EKSA 4NQXB 3CDZA 1LK3L 1B2WH 4IMKC 1G0XA 3MV8B 4UBDD 3P4NA 4A55A 5HGBB 2H6OA 4IDJL 2X4NA 4JM2B 4MS6A 5E8PA 3SDAB 1BZEA 3FRPA 2XIBA 3QORC 4OGYH 5DMKA 3QNFA 5EUKB 1L9SA 4JO3H 7PAZA 1OAKL 3FTZA 5EZIL 1AD9A 4YDLB 1DQQA 4W4NA 1DLFH 4JO2L 1QW8A 2V7HA 4U3SA 1JNJA 5ERWB 3LQAH 3PUUA 3DROA 3F7VA 4F5CA 1YMMA 4JDTL 1CC3A 2DEXX 4M48L 3QC5X 3FPXA 3UTTB 1RZPA 2YLKA 4NQCE 4KQ4H 5BUPA 4CSPA 2MJWA 1EEUA 3ORJA 4NKMB 4HWZB 5B39G 3C5ZB 4OD1L 2J12B 4QAMB 2VLJE 3IF1A 3QZMA 5FUCE 4XCEA 2X4QA 2ZKHH 4IJ3B 1EGJH 4XVJH 1TTAA 1PD0A 4RMWA 3KJ6H 1DANU 1HSAB 2P7TA 3MI6A 4HOXA 1A7QH 1K3ZA 4UANA 3TO4D 3BP7A 2PXYD 2OXHB 4MDIA 2E8ZA 2VXQL 2KPNA 1DQJA 5LKNA 2Y5QA 2O72A 4APXB 4FQHA 5IW1A 2K0RA 2ZUUA 4LDOB 2BJML 1SY6L 3U4KA 2ADIB 4N2MA 4IOFC 1TVHB 1A4CA 5J8OA 4WTXA 1GAFH 3LX9A 3UG3A 4KDTA 1TNMA 5CCKL 1W72H 2EDDA 1RJCA 5CJXA 5I1HH 3FOMA 1Z5LA 3KLAB 4Y19A 1BFVH 3MCYA 3QORB 4JPKL 2PO6D 3MLRL 5IB1B 1B4JL 2VAAA 1BZDA 3HZMA 1X5MA 5MENA 1BXVA 2YC1B 1TSHA 4G3YL 2VZTA 4TVPH 2NY5L 3FYEB 1CG9B 1BF8A 3RVUD 2AGJL 3RGHA 4DGYH 2XKNA 4UQIM 4HUKB 2CLZB 3DYMA 4P2QB 3CFDB 4JHWH 4YDZA 4YVUA 1ZT7A 3QQDB 3HJ0A 1I1YB 2EE6A 4R5VA 2IPTH 3ASWA 1QLEH 2K78A 3BLPX 3FAWA 3ZVVA 1J0YA 1V7NL 3CFTA 1G9MC 2QV4A 3WJMB 1VACA 1OTSC 1MI5A 2O4EA 3W9DB 2FZ3B 4GUPB 2DQUL 4RMBA 3LTVA 4F7EB 2JK5A 2BNQE 3PP3H 2CO7B 1B0RB 5F3BA 4G7RB 5AKTA 5BXFA 3KEDA 4FABL 3UPRB 2JKSA 1WO2A 3MRRA 3WIIH 4GP4B 1PLAA 3F6IA 5EU6B 4QJ5B 5C0DB 4JDVA 5INDA 2O5XL 3BAJA 1UXWB 2BY1A 4FXKC 4OF8A 4UM8B 3N1QC 3BX7C 1XFPA 5CGTA 1YPZA 1YNKL 3ZDZB 4WUKL 1LDSA 1Y0LA 3LH8A 2UY6B 3UTSD 1BXUA 3R4DA 2XWJB 2IAMD 4WWNA 4ZFGL 3R1GH 4N85A 1IGTB 4QXWA 3EO9L 3EG9B 3GMOA 4KUCF 1ZV9A 3QS3A 3GSXB 4PJ8D 4HG4J 3W38A 3KVDD 3OXRB 3SCMC 4U2ZA 1QRNE 4U1NB 3US1A 3RVXC 4N2BA 4LGRB 2X9YA 4HD5A 3BC9A 4BCXA 1I75A 2GABA 4JR9H 4TVPD 1JWMB 2QHRH 3D4ZA 3ECVA 2APWA 3DVNB 3QGVA 1NCDL 4PYHA 4LEBA 3KL0A 3M1BA 3LNHA 4UILH 5F88B 1F1GA 2OTWB 3D0VA 4LASL 2Y0SA 3P30L 3P9MA 2J25A 1MIML 1JV2B 2V6HA 1JAEA 5SWSB 2KKQA 5KBKA 5HDOA 4WNJA 3N6YA 3OTTA 3PQYA 4HW6A 1M9SA 4E41B 3F05A 4X4KA 4UT6H 5TE6L 3TJPA 4XHJC 4OGAC 1KLUB 1AAJA 1COBA 4N0YH 2VXQA 4JY6A 2UZXA 4DKAA 2F74A 4IMLA 2EJ1A 4D9RE 4M1CC 4XNMB 1CZ8L 1SY6A 1LWJA 5JOEA 5J1AA 2ZKWA 3JUYA 3RWFA 2DTSA 3D52A 4D7BA 1DVSA 3DTDA 5HSFA 1JK8A 3QZWA 2Z35A 5KOMC 2CIIB 3FB5A 1C16B 3B7UX 4PRIB 1KLGA 2DQEL 3T0WA 1S6NA 4JJ5B 4MD5A 4YSQA 3ZKND 5J1SC 2QDVA 4DP2X 4RETB 1ZGLM 5D93C 1A9BA 4GINA 5JW3H 3ZDXE 5TFSL 1MZYA 5CILH 4Y9BA 1JYXA 1NKRA 3J27A 4FXKB 3WE1A 4G8EA 5EOTA 3X1EA 4P07A 4XOEA 4HJ0D 5CLZA 4ODTL 1N8ZB 3PP3K 4X9BA 3SD2A 5DS1A 2VW4A 2IEPA 3MKGA 1RZGA 1AO7A 3DJTA 4O51A 3QNXB 3CNKA 4GSDL 4PR5A 4GRLD 3NJVA 3IDXH 4YHLH 3U1SH 4YDIL 1XX9C 3SCMB 4LVNC 4W6XB 2GTWB 1GGIL 3FQNA 1R3JB 3U6RA 4IBSA 3VNZA 1DVYA 4HUUB 2X3CA 4XNQB 1R3IH 3GMPB 4HIIA 2VO8A 3OKKB 4JRYB 4PJEB 1FF5A 1HKLL 2FNBA 3QJSB 2VDPH 4OLZH 1JXFA 4QRSA 4F2MB 1YVLA 4HH9B 3DWTA 2H1PL 2COQA 2R1XA 2YN3A 3HG1E 3FHEA 1R46A 4DO4A 4KQ3L 2XN9D 4BKLB 1MJJB 5T5FL 4LP5A 5AB0A 1GIGH 3WHXA 3TIDA 5CAYB 3WYRA 2Z93A 1S7XA 2FL5B 4X4ZA 35C8H 3RUGE 2G4GA 1CU4L 1HNYA 2F7RA 2VDLL 4JVWA 2ZWSA 3OC5A 3ZR6A 1J1PH 3EBHA 4M8RA 2A6DB 1CURA 4MCYA 2VDML 4Q9RL 5JIHA 4MMXA 4U6TA 3UFIA 2VUKA 2VDKL 3G6AB 2CMRL 1E30A 3C8KB 4E36A 4RCAA 1YUHB 1LQBC 4XRCA 5G5DA 1L9MA 4XNXL 5DEGA 4BZ1L 4ONHB 4ZFZB 1Q1PA 1CTOA 1E4WL 4P3DB 4XXDB 2ZONA 2YPKA 3ZTNH 5D93B 5FM5M 3FCSB 3FSOA 2FAUA 4Z78B 5DK0A 1LEGB 2WVVB 5G4NA 2MPAL 4X6BA 4KNQA 4J4PC 2PPCA 2NZ9D 1EEYA 2UYLB 2HX8A 4X6FA 5IESH 1IGYB 2MOQA 4N3UA 3DURB 2HH0L 4UB0H 4M7KL 1EFQA 1WC7B 4HD9A 5F7NC 5GRUL 2DYSB 1CYGA 1RH8A 3FFCE 5BW7C 4DNLA 5LLIC 5C0BD 4N9GB 4FOMA 4L8DB 2O6PA 4PWFA 4WGKA 5DC2A 3N5AA 2GTZB 3MA7B 3GJEB 4V33A 4LVNB 3CSYA 1N9PA 4UUJB 4JPWH 5CD5D 3QWRA 4LOUD 4L23A 1A47A 4WFGE 2EDMA 3D4GA 4HJEA 3CFNA 4GO8A 5T1MB 4N9OB 1A5FL 2ZOUA 3S34L 4HWBA 4NLHA 3FZUC 3AWGA 4IU2B 2UVFA 2X0VA 4JFED 3IDNB 4ZD3H 3WXWH 2CNYA 4XXWA 2GQHA 1ZLUK 3ZDXF 3P4OA 1A6ZA 3GIZH 1SVZA 4K5LA 4JMXA 4K23L 4LLVA 4M7LT 5A2JH 5C6WH 5MHSD 1PAMA 1U8OA 1M9WA 2H32H 3B9DA 4A6YB 3JVGC 1ZT4B 3RFZA 5CWSB 3BZFB 3QVAA 1HYSC 5C9KA 3TCLB 4JO4H 1OAYH 4BHUA 4LSQL 1G87A 5G2NA 4POUB 2CWRA 2N3JA 1UQSA 2CK0L 2C3VB 4L2YA 2HJKA 4Y4KA 4NT6B 4AK2A 4ZUWA 3WFCH 2X2JA 3PWPA 4HMDA 3WS6C 3L5WB 4ELME 1QATA 1X7TA 2OYMA 2XN0A 3CHRA 1EAPA 4K73A 3LH2H 2AF2A 3CFCH 4WTZG 4M9OA 1U58B 4N2IA 1BXXA 1S7RB 5D4QA 3UO1H 3ASOB 1SUJA 3MV7D 1YMHB 4YHOL 2E7DA 4AL8C 1QI3A 5K1JA 1EDHA 4CJ1A 2X4UA 1WIUA 1F41A 4APQA 3WFDH 3ARBD 3D2UD 4N0FB 3JV6A 1G1YA 3UCQA 4D8PA 4NIYE 5DZVA 3T3PB 3LH9A 1E5AA 1QRND 3K4ZA 1MRCH 4XNDA 1ZJAA 4JKLA 1DQDH 3FT4B 4HEPG 3RUGF 5E99L 2BX5A 4V1DE 5E70A 5I6XC 4XVUD 2J55A 2E8YA 1BFOB 1CGVA 3H3PH 5T5FA 3AM8C 4A2LA 4H4NA 3X17A 5EU5B 2CLRB 3VH8B 1GCYA 3ALWA 4QXGL 4HJ1A 1KXQE 3H53A 4JGMA 3D85A 2BOCA 1JPST 5CGYD 2A9ML 4GAGL 3IDGB 5JR1L 1WWBX 1FN4B 1KCRL 1KEGL 4S0HA 5DF0A 1G7PA 1RP9A 4WSKA 3T1WA 1IJ9A 2RR3A 2CGZA 3FUFA 3KDPB 3FCTB 1A7RL 4AH2B 4BZ1A 1AZZC 3HLAA 1EV2E 1YN7A 2BFGA 1KTDB 4U1JB 3O2VL 5E24E 3IJSA 5I8EA 1Z5YD 3IMWA 1S9XB 2ZCZA 5E2VL 5D6CA 4GP5B 4ZQKA 5LNEA 4NM4H 2A9NH 4RGNC 4BELD 4DK5A 5EN2B 4ZMOA 4L8SA 2CRIA 1VENA 1B0WA 1WA2X 4QY8A 5TQ2L 4U1IA 1PFCA 1I8AA 5ITBL 1MFDH 1N5AB 5TPWH 1JPGA 5F9OL 5FYLE 5JW5B 3UZEC 3ESMA 4N26A 3S35L 2VDNB 3QPQD 5E1IA 2WBJA 1ANUA 4QHKJ 5IVXA 2ICES 3OKLA 1KBKA 4RQQB 3PGFH 2XTJC 4Y5VA 1YEWA 4HHWA 2FD6H 2H5UA 4G6KL 2NW2B 3CFUA 3RL2B 1EEZA 2QQLL 2EVIA 2CIKB 1A02N 1UM5L 4UCFA 4ZMPA 4K2UL 5EIQA 1DVFA 3GK8H 3RWJA 4OZ4A 2I26N 2VIRA 3QRFM 1KLFA 4JPSA 3SDCB 1I8LA 3WUWG 2WLLA 1BLIA 2E47A 3QNYB 3CC5A 1FFQA 1IFHH 1U8CB 1HN1A 1QHPA 3OKOA 3C60C 4WRLA 4YL4A 1ADQL 2EIBA 1NGXA 1AGBA 2YBRB 3T0BA 2XXFA 4FZ8H 1A9EB 5FO9A 1KB5A 1T1ZB 1E5BA 5GRXG 4KKNA 6TAAA 3PNRB 4KJYA 1FGVL 4ELMF 4LHUB 5BRZE 3NIDB 4QTIH 3IPEA 1EPFA 3ARED 4QHLB 5E94B 2BP8B 4X5QA 4WQOA 3T4YB 1BD2A 3QEGH 3UYRH 2H26A 4R3SB 4YHPB 3EKCA 2OCJA 2J1KA 1E4KA 4DOHE 2XWBB 2HVKA 4KO5A 2DB8A 1VEOA 2N1KA 5AENA 3MV9A 3L3KB 2YAOA 3ZY7A 2HRHA 3ULUE 5LNDA 2ZOLA 5GRVK 2FUQA 1S5HA 3SE4C 3HB3D 4LL9A 4HGWB 2UY7B 1U8QB 4L48A 4S11A 1IC7H 1P4IH 2R4SL 5EUOE 1C5DB 3I9PA 3EJZC 4RGNB 4NDMB 4YBQD 2YMXH 4W6YB 1FNGA 3HG5A 5CD3A 1BWMA 4MNGB 2OMZA 4WKZB 4N2AA 2JSFA 3C6SB 1R47A 4UMGA 4Z95H 4OTXH 2AERT 3SQBB 1WE5A 2KDYA 1KJVB 2OTUB 4JHBA 5D1XA 2J57A 4HT1H 4ZUTA 2A1WH 2CBOA 1J0KA 5B22A 3CCHA 3DXAA 2OQJA 3VXRB 1DQKA 4ZPVB 2YA2A 2WZPA 2ZNWA 4H2AA 1BZ7B 4Q9QH 2Z4TA 2BC4B 3TEZA 5KSBA 1A1NA 3CSFA 3QEQA 4GIOA 4P99A 4B0MM 2GITA 4E42A 5SWQA 3I9GL 3IJ7A 1Q90A 5JIMA 5GGVY 4GKNB 2Q9OA 4B6ZA 2HSIA 5IIEB 1QI5A 1FAIL 3MODH 5DMGC 3C60B 3FHAA 2W80C 4EUPA 1ZTXE 4JN2A 3U25A 1V27A 2CQVA 1ZLDA 4ZK8A 4TRPL 3QNZB 4OQTH 2RIKA 1IGCH 4P4KC 3VFRA 4ISVA 5SX5H 3GBMH 3B1TA 1QMUA 4MBRA 4WIQA 1Z0NA 1BEYL 4LCUB 5BRPA 1DO6A 4H44C 3PRZA 2CGRH 43C9A 4ZS6C 4OZIE 1VFMA 1ZRUA 2IWFA 4HHAB 1GGTA 5CJOH 2D8KA 3D8MA 3GO1L 1OCWH 3CZFB 5D55A 4H8UA 1MVYA 2WGXA 3BUPA 5DD5L 4AMXA 4HCRH 3P3YA 4PCYA 3N40P 1FVEA 2FYVA 1DUZA 4XP1H 1I8KB 5IJVA 3ULSB 4L4TE 1CMOA 5A7BA 4TULL 4TQPA 4JFDB 3FULA 4F8PA 3TF4A 4KXBA 2EC9T 5GISH 1SYSB 4LCVA 4EXPX 1W0WB 3KWWB 3DOIA 4ONOA 2IV9A 2ZWZA 1DQVA 3L5XL 2OMWB 5JO5B 1MFUA 1GC1L 4PJ7E 4XWGH 3MRBB 4JO1L 2Y22A 2FO1A 1FDLH 2IALA 2BIMA 1NGPH 3SJVA 3SKOB 1ADQA 4QRBA 5GGRA 2L7EA 4ENED 5HYFA 1FGNL 3OPUA 1JGDA 5JDSB 3N06B 1TZGH 1WZKA 3CN4A 4UU9A 5KSAD 2F9BT 3DO7A 1UEYA 4WDIB 3TONA 3IMSA 4RWYL 2NNAB 2HN7A 2YK1H 3A0OA 5EG6C 2H2SD 4X6CB 4G6JL 2PCPA 5D2LE 4NO0A 4PJXE 2FQFA 3ULUF 1MVUB 1JVKA 3IU4L 3TJHC 3BKJH 4Y2LA 3O3DB 2NR6C 4G59C 3QO1A 4HA1A 4Y4HC 5C0EA 5JW4N 4XPTH 1OW0C 1D5BB 3HPLB 3CZNA 3JWNG 2LTQC 2OMBA 2OJEB 4W70A 4ZZKA 1OCCB 4P4KB 2DLGA 1R75A 1G9NL 4HU2A 4N5EC 5LQBH 5HGDB 4DZ8B 1F1DA 1N10A 1PBYA 3N1MC 1CK0H 2CDGB 3DETD 2HFFB 3MLSH 4BWTA 1XD1A 3LHAA 4TNVF 2VDQL 2ZG1A 1JHKH 2HPTA 3VYPA 2B59A 3RHWK 3MLUH 2PWFA 4F5CE 2BS8A 4JDZB 2ESVB 4XCCL 4KVNL 1WBZB 5A6LA 3MJ8B 4KZEL 4OJAA 4MJID 5SX5K 1TQSA 3GD1C 2YGQA 3QQXA 1CF8L 2ALAA 2P8LB 2C4FT 3K72B 4LLMB 5DRNB 5I73C 3FCBA 4QHMA 4ECNA 1FLRL 5C6TH 2XY2A 3KD4A 2E9JA 1SLVA 2Y25A 4NCC1 4QEGA 1MJ7L 2Q7YB 1WP6A 5E6IC 4Z7AA 3DI3B 3GMQA 2PPFA 3HC2A 3EYUH 5A2LH 3TBWB 1CFTB 2CBPA 4I85A 2FJHA 3HR5A 2DQGL 4QT5B 3NJXA 1WQVT 4GP8B 1ZLVH 3IRZA 4HS8L 3SBRA 4J27A 5J06A 2XX0A 4JE0A 2EEFA 2IH3A 3G5YA 1JUFA 2ZXCA 4PRBB 5B1BB 5J13C 2HJFB 1ZANH 3BPCA 5GGVH 4CC4C 1HH9A 4LEEA 1K5NA 5F9JB 3VQMA 2LGNA 2CJUL 3IU3B 1JN6A 3IKCB 1D7DA 4TV3A 5F93C 3KDMA 1JI1A 1CFNA 3V5KA 2ZSWA 4HFUL 5D96C 3DX6A 3OZ9L 3EUDA 4Y4HB 1JERA 1A7NL 5GRJH 1U91B 2FO4A 4WUUA 4MNQA 4TQEH 4Y19E 1WZ1L 4PWGA 4PJHF 1BAGA 2LTQB 1U3YA 4WI7A 1G6RH 4JO5A 3VXMA 3DIFA 1RUKL 2ZNXA 3AROA 1DSYA 5MENE 3L4TA 3VDAA 1I7UA 5ESAB 4S1QL 2RJMA 4J2QA 5DHDA 4BZYA 5D1QD 2JLPA 4OY9A 1XSOA 4KXDA 2APXA 4LU5H 3L5IA 4BHUI 3I6LE 3EYQD 3QULA 1KGCD 4HIJB 1ZIAA 4YS4A 2B15A 2VR3A 1N12A 2ZTBA 3BCFA 5HD8C 2GHWB 2MQ3A 4F3FA 3D39D 2ZP8A 4NRXA 4PJXF 3Q05A 1X6LA 4X7DC 5FYKD 5I73B 3MNZB 3QAQA 1MI5E 4OLXL 4RA3A 4AT6B 4KKCD 1OLZA 5EZJB 3CN0A 4IBYA 4OZFB 2BSBA 5GS1C 5E6IB 3T1FB 3S96B 2EZ0D 4QTHA 5HDQH 3MRGB 2DM7A 1QA9A 3HNTL 2R23B 5KWYC 4KVCH 4EXKA 1TZ8A 3C8HA 4GRWB 4ETYA 5FO7B 4J28A 3A6CH 2APBA 2G9KA 4QHKI 1JBJA 5J13B 4HUNB 1KFAH 3P0YL 4KX9A 3L9RA 4ESKA 4L8CA 3KGRA 4GG6A 1YPZE 5HDBE 2ZPKL 3BP5B 2O6CA 4JFYA 4TNVK 5C0IA 4CL7A 3MMEB 5BV7H 1DSWA 5IBTL 1ZVSB 5TH2B 3VWKA 2B3IA 4XN5A 3AS2A 1D6EB 1O0VA 1KCKA 1ZLEA 3ZXAC 5IV2A 4JZNB 1BIIA 2UXGA 2DMCA 1HE8A 4W9ZA 3G5XA 1JD9A 5D7LA 5J6HA 3CIQA 4XMWA 2H6PB 4NKDB 1V3MA 4XNAA 4M62L 1KYDA 5HYSB 3JTSB 5E8OA 4DP4X 4X7TB 3SPIA 2BRQA 3CX5J 3V4PA 5FKPB 4G8IA 2FJGB 3O9WA 2JJWA 1FFNA 1Q0XH 3GXTA 3V7AG 4HLJA 4WWKA 4KK9C 2ZKYA 1NOAA 3OLDA 1TTFA 4XMVA 5IJBC 5BS0D 2CUIA 3BWUF 3S35X 3DGDA 3T6QC 4BA0A 4FNLL 4WGWB 4NQDB 5B3SB 3T8VA 3PCYA 1JYNA 3GIVA 5HYQA 3C5SB 5DEFB 2Y7QB 3ARFA 4YSCA 4PG9A 4XT1C 4JFOA 4MXQC 1AC0A 1NCWH 4U0RC 5LAXB 2RH0A 2VLRA 2X42A 1OB1A 4ALAC 2VITB 2AKRA 4U1SA 1KJ2H 2K1MA 1EHLH 4IGBA 4ZW8A 1T89C 4U1KB 1CYXA 3K2MC 3MAWA 4ZSOA 3MR9B 1DBMH 2M8XA 1U8NB 1WH0A 1X6NA 2ZOKB 1FFTB 1F8TH 3LAFA 1KXTB 4X5PA 4XE0A 4Y1AD 5I1JL 3BPOC 2B3RA 5AALA 3G9AB 4XCNB 4MBOA 1KENH 3ZGIA 2EIDA 1T83A 3HHRB 4JKNA 1EXHA 3F7RA 3ZDYE 1FNLA 1JJUA 5D5MB 1EBPA 1NC4D 1U9KA 3QW9A 1FNSH 1I7TA 1AO7E 3DX8B 3DYPA 2I5YL 5CN2A 5IVZA 1IQDA 1JZJA 3H9YA 2A9DA 5CFHA 3APNA 3LKSA 4PBXA 2EDLA 3K8KA 3PWVB 4Q74A 5CSZA 4CSZA 4BJLA 5I8CB 1IZKA 1D2OA 3BH8B 4S1RH 2IH1B 4XBEL 2ODHA 1JK9A 1J8HA 4QHUB 2BVOB 2IANA 3L3OC 2AJZB 2XXGA 3FU9A 3KYKL 1AC6A 1QSFB 4FLOA 5DJZB 1TZAA 1HI6A 1YMMD 3T0EA 3L3DB 4LIQH 1BDYA 2VERN 2PYED 3DRQB 2AK4A 3MLWH 5I16A 1HX0A 3PAYA 4FMKA 1WT5A 2Y5TB 1F11B 3NK3A 4I89A 2DPKA 1RZFH 5E51A 4X80L 4QAWA 3VXPB 3GLDA 3LRMA 1UENA 1FYTD 3PP4L 4BK4A 3FTUA 1NBQA 1YPZF 5HDBF 1FVDA 5D72H 1U33A 4WO4A 1BPLB 4U0RB 3LEXA 5K39A 4P46D 5EDSA 2FATL 4LDEB 5KZCD 4KI5E 1DFBL 1L6ZA 1J7VR 3HS8A 2XZQL 3QDME 3TC9A 5C8JA 2GCYA 1ZVYA 2X4TB 2V0AA 5K1NA 3VSTA 1HESA 1W6LA 1EHXA 1LK3H 3UYPA 2APTA 3PFUA 5CEZE 3ARRA 3MJ9L 1M05B 1M71B 3FSVA 4G7QB 4X7SL 4JFFB 3MQIA 1WFIA 4IDJH 1GOHA 2BHUA 3BPOB 2OP4L 3FW6A 4H8WC 5JPMA 5DLML 4YR6A 4FFVD 4EI0A 1OAKH 1MFCL 5EZIH 3TT3L 2XICA 5AD0A 1QLRA 3UBXG 4MJ5B 4EVNA 4JO2H 3CQFA 1XF3A 4UI2A 1OEZW 4PJDB 5JW4Q 1RQ5A 2R2CA 1RVFL 1PGRB 2HX7A 2VUYA 4RMSA 4XP4L 1KTLA 4JDTH 5L2KB 1XGQA 1T4WA 4M48H 4D9QD 5MI0C 5I8OL 4UAOC 1MVFA 2GVYA 3V8CA 1O7DE 5I5MA 3EFOA 5I1DA 3W57A 5JZ7D 5MERA 2XKUA 4KITB 2YRLA 4IHOA 1IO4C 1T80A 4KTDL 4XMZA 1ZGLA 4OD1H 4YIQA 3VX1A 4HDIB 5INCA 1UH3A 3ARDA 4LOFA 4A2MA 4PRAB 1FFOA 4NJ9H 4HX1B 2WNWA 4ZAKA 3TVMC 4G11A 2C26A 3BDBA 2IFFH 5ICUA 1A3RL 4NZJA 5FK9A 4ZFOB 5B38G 4HALA 3ZOAA 1KTKE 3KJ4B 1IZJA 5I0YA 4N2FA 5ACLA 3FRUB 3WNNA 3ZDYF 1T0NB 2ATPB 2YLHA 4FQQA 2OMYB 1M1XB 3KYAA 2C7FA 1R3KA 2NX5D 3OKNA 4HG4K 2BJMH 1SY6H 2ZP0T 1KGIA 4P2YA 4H0IA 1NPJA 1A6VL 1C8QA 1RHFA 4OU3A 1G0DA 4EI6A 5KG9B 3WMSA 1TYJA 5MEOB 4YWGL 3PWPE 5D8JL 5CCKH 4J5VA 3BXNB 4PLNC 4MD4A 5FDYA 4X4XA 4QLWA 1TZHB 4TQ8A 5AVWB 2OTPA 2X4PB 1ZAGA 4JPKH 4BK5C 5IFHL 1HL9A 3MLRH 1XXFC 4J8QA 1B4JH 1CE6A 4AGQA 3WS3B 1D3CA 3VTMA 4G1EA 3L6FB 2NNRA 1U21A 4HKBB 2F19L 3ARXA 4QO1A 5CMAB 3UAJD 4FNPA 1VPOL 4G3YH 4AXWA 2NY5H 2NY1C 2OX5A 2VMFA 1NEUA 1M7DA 5CHNA 5LGYA 2AGJH 2AV7B 4P5MB 5JIDA 5MI0B 2YKLL 1INQB 3V9CA 3VD5A 1N2RB 3HNVL 2DMKA 3JXAA 3N44F 1ODUA 1ET7A 4Z7NF 4OB5L 4KI5F 2E56A 1ORSA 2X41A 5DTFB 1T1YB 4WFHE 1V7NH 1U41A 3ESOA 3KLKA 2K9UA 2DQUH 1AI1L 1F2QA 4HCGA 4UBDC 3MU3A 2P46B 5FUOL 4FI8A 4ZI8A 3V4LA 1T03H 2L7JA 2QPFA 2YPLD 3NAAL 3PQYD 3TVMB 4JN1L 1WAEA 3CFBA 3ZN6A 5IM7B 3K8MA 1DJYA 5F6HJ 2VABB 3VD9A 2CDEA 1BX2A 1H3UA 1AQHA 3MUHL 1HU8A 1Q9WA 3MOBH 1MAKA 5GGSB 2O5XH 1VGKB 2XPGB 2OZ4L 3WGVB 1YNKH 4WUKH 1IAKA 2HYMA 3A47A 2X9WA 1DEEA 1A7OL 1PQZA 2EDNA 4G9DB 3QAZC 4ZFGH 3I84A 4HUWB 3QG6B 3PABA 5DEJA 3RX9A 3EO9H 2VZUA 1NBCA 2ICEC 1YN6A 4IBQA 4TVUA 5K9OB 3G5ZA 1QHOA 5IK3A 3K0YA 5IVXE 4AENB 1S3RA 2H9GB 1I85C 1PKQE 4KO7A 4LCWB 3B8SA 4HXBL 3C5JA 3TBSA 3O0RL 4X8XA 3O3BB 1UZ6F 2XYBA 1NCDH 3MRLB 4KKAD 4NQVA 2VC2B 2X89A 1KPUB 4PRPB 1FJ1B 3V0VB 2NY1B 4LASH 3P30H 3SBWC 1BF2A 1TENA 3TO4C 1MIMH 1AFVH 2PXYC 3OD3A 4JRXD 4DHLA 1XMWA 3DLQR 4PWKA 1CD1A 1XGYL 3HN5A 2IH9A 4W9EC 2DTML 1HDMB 5TE6H 3STLB 3NN8A 2XHNA 1FYHB 4S0SD 1AGEB 4OIIL 3E7JA 5DJXA 4JW3A 4UQAA 2AXGA 1CZ8H 2AK1L 4BWWA 5E8EB 4PJBE 4P57A 3GTNA 5CZRA 3KPMB 1BD2E 5GSRA 1B3IA 2DQEH 1YEEL 3P9LB 5CSBA 3BVNA 3DOHA 2CG9X 2YBGA 2C8NA 3UACA 3V0GA 4AQ1A 1VADB 4QRQB 5TFSH 2FWSA 3LQAC 1GJIA 4F91B 1NFDB 4CU6A 3VTTA 3QWQB 5DEZA 3O6FD 4RLDA 3GHPA 4ODTH 3QDAA 3B37A 2IXQB 3RVUC 1E9PB 1O6VA 4GW1B 3QI9C 3QAZB 1A1MB 5DJ6B 3W56A 1CJYA 3T71A 4GSDH 2ICEB 1LEKA 1I3UA 5DJYB 4BSVB 5CLXA 3A4AA 3WNMA 1PTZA 4YDIH 2WVSA 4KI1A 4IS6A 4PVBA 4TUKL 5DVPA 2HVJB 1GGIH 5JOPE 5MEPA 3WTSA 2I9LA 2YD1A 2WINB 1EEQA 5K9QG 5EF3A 3P54A 3S98A 2IMNA 3OSKA 5B3JE 5E95B 4X7FC 3WN5C 3VFNB 3DXAE 1I31A 1G84A 1AGFA 1HKLH 1P7KB 4A68A 4EN3D 4Z7UA 2L3BA 2RD0A 3TO4B 3MGOA 5I1GL 2H1PH 1TLMA 2PXYB 3QEQE 3T0DA 1N18A 3MRHB 3EO1A 1PJ9A 3RL1B 5C0JB 3CVHB 4PJ9A 3VQ2C 1HL5A 3N2JA 4Y8DC 5T5FH 1WEJL 3P3UA 5H4YA 2YWYA 3EYFB 1RUAL 3SE8L 4MB4A 2YARA 2H4EA 3K6DA 3LKPB 1CU4H 2VDLH 6PCYA 2PNDA 2F7QA 2IAMC 4ADJA 1I9JL 2W59A 2OZ4A 4MDRA 3GMNA 4B5ZA 4R96A 2JCCB 32C2B 2AV1A 5I75C 1AGCB 2VDMH 3BAIA 4Q9RH 1SEBB 4Z0XB 2VDKH 3WLWD 3AXLB 1ZK5A 2CMRH 4QKXB 2DM4A 4Z77B 3PL6D 1FFPB 8FABB 1XCWA 3KPQB 5ECJE 2DY2A 1AR1D 2XFXA 2XQYA 4XNXH 1XSJA 4YNYB 5SWZD 1E4WH 2LV4A 3NIFE 4P2OA 5TE4L 2J5LC 2LHAA 3OJ2C 3MVSA 4WO0A 4Z7WA 3VFSB 1KULA 2MPAH 4CKQA 2APVA 3OLEA 4UTAL 1MW0A 4Y4KD 3GBLA 4OZHA 3QA3A 3D25A 1NEZB 1I3GL 4JFXA 2HH0H 2CKBL 1UA6L 3QI9B 3TNMA 4M7KH 4I18C 1ZLWK 5ISZE 5GRUH 1PL3A 3DUHA 1BZ9A 5JHDA 5A2IH 1H0DA 2CO2A 1BVKA 3JT0A 3VGGA 2UWEB 2W9LA 3D3VA 4AC2A 1LP9A 4JHAL 4L29A 5E1AA 2HCZX 1Q94B 4PS8A 2NCEA 2YRPA 4KTYA 4K3EL 1OGTA 5AAMC 4PJBF 1LEIB 1NANI 2C9PA 1CLZL 1SYVA 5L7XL 3WN5B 3ZHDA 1A5FH 1ZXQA 2R59A 2D73A 2A73B 4IU3A 3KPRE 1ORQB 3KYOB 4IBTA 3ULVL 1R5WA 1HQRA 1QLFB 1T5WA 2NW3A 4GKZA 2HKFL 3DKHA 3L9EA 3LB6D 5ICXA 5L4IA 4HFWB 1RURL 4RGOL 4HJ0C 3IYLW 2EDEA 5FHBH 5H35B 3NDYE 2LLGA 3SE3C 1H6TA 4LSTL 5EWIL 1D5ZA 5JW4M 3N3EA 2IAMB 3CXFA 4A63A 1W72B 2KI6A 4YLBA 3HPJB 3B3IA 3EH5B 4LSQH 2JQAA 2NOYA 1T6BX 5T1KB 4PGDA 2CK0H 5FW7A 5I75B 1MRFL 4GRLC 5H2BA 2NYKA 3FU0A 5C08E 2WXPA 4G9FB 3T2QA 3WTUA 2WNKA 4ANXA 1I8MB 1T0PB 2D31B 5CIPA 4PPTA 4C56A 1HOEA 5HI4D 1R3LB 4JFHD 2WXGA 4LPTA 5F9AC 1NUFA 2WN2A 5B3JF 4JFWA 3VFOB 3WTXA 2WXIA 1JZ5A 2J5LB 2YA0A 1TZIA 4FQJL 3TYFA 4UT7L 3K5SA 1VEPA 3PV6A 2DYRB 4L4JA 4XNUL 5D7KE 4YHOH 3SDXF 1UJ3C 1EO8L 2G30A 3TXAA 2XZCL 1Z9SA 1I1AA 4H2CA 4M4RA 2I27N 3F6LA 1QBML 3QUZA 1NGQL 3W0WD 5C7ZA 3GI8L 5GZNC 5E9NA 3O45A 3US0A 4YUEL 1QLEB 4ETQB 2R15A 2ENYA 3VFWA 1W15A 2GK0A 5IF0B 4WJKB 1Q1JL 2F53D 4CN4A 4BKTC 2O6EA 5ETUB 3FU7B 1UOWA 3PLYA 4QXGH 1NJ9B 3CUPA 4UIMA 3STBA 4FADA 3NA4A 2FUTA 1GTNA 2A9MH 4GAGH 5JR1H 2PR4L 4L05A 4M6OL 1T0OA 5C0FA 1KCRH 3BUTA 4U1HB 1KEGH 5E5LA 1E8XA 2CO3A 1C1EL 4QCIB 4RISL 3I9IA 5DYOB 3SYQA 4Z76B 2HZHA 2Q3XA 2Z3FA 3MBWA 2CALA 1UYWL 1X7QA 2C1OA 3BWAB 1RD6A 1A7RH 2IGFL 3CSBA 4JGNA 3TU6A 4EUPH 4WUUE 3EFFA 3O2VH 5B8CA 5C0CA 2MQGA 4FQXA 2F2HA 2ZYHA 3HAEG 4MQSB 1N0LA 4UTAA 5E2VH 1N26A 4L37B 5FF6A 1M7IB 1INDL 2FSEA 5I1EL 2R2EA 3VW3L 1S4IA 1VGEL 4ZUSA 3VXME 1S2EA 5EZOL 5IB2A 4LCCB 1B0GA 2CKBA 3WNPA 4J3OF 5TQ2H 1XH2A 3EJTA 3MV9D 3O0LA 5ITBH 2G75B 2XXMB 3CSPA 4PAZA 3U30C 4R7VA 4UDTA 5F9OH 3TZVD 1OSZB 2C4XA 2GIXA 1NCIA 3DRTA 3LKQA 1BM7A 4LE8A 3S35H 3NJFA 1RZ8B 3NRPA 4NENA 2BCKA 3OB0H 4NUPA 5F6HI 4HKJB 3RJQB 4G6KH 3I6KA 4W68A 3VSVA 3BIKB 1UJ3B 4P23A 1UM6L 5AB2A 4LBEA 1UT9A 2QQLH 5C3LD 4X98B 2BVPA 4H26A 4XP5L 1IC0A 5FFOA 3DHMA 3TPUB 1UM5H 3P3TA 2HXAA 3QRGL 1AVAA 2AQPA 4L1TA 1MH5A 3MRJA 2XN9B 2JJUA 4ILDA 3UZQA 2VLJB 4NO5B 4YSSA 3MCKB 2ZX5A 4A7GA 3A6OA 4W9JC 5D1XD 1F0LA 1UKTA 3QISA 4RMRA 1OKEA 2ITEA 1MQKL 1ADQH 1BOGA 1LO3H 1QWNA 4KRLB 4LSDA 1U42A 2I85A 5BZDA 1KDIA 1GYAA 3UTQB 4YXHL 1WWWX 4B7LA 4FI6A 5D9SA 1FGVH 1JTPA 4BWUA 5F7YC 3UL4A 1ZSHA 3P4MA 4XNZC 1IBDA 4TMPA 1S7VB 2PW1B 1WAAF 1U8MB 3QJZA 1HHJA 1S5IL 2ARJQ 4JUTA 5C2BL 1NUGA 3NZ8B 3FO2B 3CDCA 4JUSA 5FWQA 5D7LE 4LKCA 1WYJA 3KPLB 3ARBC 4PRDB 4UTBL 1VCAA 5CEXA 4DKFL 1ZS8B 3TT1L 5BOPA 3U36A 3V4UL 2R4SH 1MLCA 2CO6A 5F9WB 2CR6A 1AOZA 3D7PA 2XG4A 4R7DA 5C0BB 2EICA 3WU1A 4FQ2L 3U30B 3VRIB 2J21A 3VXOA 2EH8L 3QHZL 3SBPA 4AM0B 5D6DC 3NCYS 2VDPB 2Y7NA 1CXHA 2OL3L 1DLHA 3FRPG 1HK6A 4EI5A 4PBVC 5CGYC 2A38A 4EZLA 2Y6SD 3KXFA 3TN0A 3DTXA 1IKNA 3F7YA 2B2XL 3ECBB 4N1HB 4N0CC 3AB0C 3K46A 3L3IA 4WJ5A 2VLRE 1B6UA 2B5IC 4GSXA 3MRNA 3SJVD 2OJZL 4ZTOL 3I9GH 4R9HA 3OB0K 2XTLA 1FAIH 3BKYL 2WLHA 3BH4A 2L4OA 1LM8V 2ENJA 1GW0A 3QIBA 2CJTA 4Y9GA 4IQHA 2H0FA 5EU4A 1FL3B 5DS8A 3SOTA 4TRPH 1J8SA 4AQAB 2AXJA 1IL1A 3BIBX 3PIQB 1YYLL 1BBDL 3D0LB 1XCTB 1CGTA 2F08A 2PCFA 2H3NA 1BVZA 1HHKA 3QPQC 4JO8A 4H20L 2AAVA 2HRPL 4YFEA 2D0FA 3IXTA 4WW2F 3EJRA 2YEZA 3GO1H 5ADOL 5HHME 5IROA 1LILA 5DD5H 1U8PA 2PW2B 3P73A 2FR4A 3CFQA 1XGPB 3MV7B 3SKMA 3BJLA 1GVIA 3AU1B 1OGPA 3D5OF 2QADD 3D2UB 4TULH 5F7KC 1DFXA 4KKPA 5I66B 3APCA 5DUBA 3VI3B 4ANVA 1XF4B 4JBSA 4BQBA 1XH0A 3DO3A 1QRNB 3H2QA 1J8HE 3KS0J 3QJQB 1Q9LB 4WHTA 2XPZA 2MCPL 4AYBA 2OXGA 3PWLB 3RU8L 4K8RL 4HOMA 3T0EE 1MCIA 2VKWA 3L5XH 3OQRA 5CP7A 3CSGA 1TXKA 1GC1H 3O81A 2AK4E 4L3AA 2NXZD 4JO1H 3LVEA 1G94A 1FE8L 3TYGL 5B21A 4Y2OB 2VN4A 1I53A 4HBCL 5GGUA 3C8DA 4ZW3A 4JRWA 1FGNH 4DO5A 4LB8A 1DUYB 5GS0L 1WITA 4AWJC 5KEZA 4RWYH 5KBMA 3UERA 3VXQA 1KCBA 1MCRA 3JWOL 1MCEA 1P5VB 1B0IA 2W07B 3AB0B 4MA1C 4G6JH 1XR9A 2H32B 1H9DA 2GJPA 2B5IB 2G0LA 1YCSA 3WFEL 4DEWA 3EH2A 1ZVHA 4KHTL 4F33B 4FFWD 3P77A 3IU4H 4FTDA 4IIZA 4XPGL 3HB3C 3ZZSA 1HL8A 1Y6MR 3N55A 4ZOCA 3CVBA 4ZTEA 4QRPA 3DV6B 3AG4B 2W0FB 1KXVA 4UTBA 3WFZA 5KYXA 4I48A 4N2GA 4YBQC 1XDTT 3LQZA 1BQHG 1G9NH 3VGAB 2FIKB 2QFPA 3UAEA 4MGXA 1AZVA 1U3HC 2WKLA 3OXSB 3OWRA 1HOCA 5T1LA 2VDQH 4C58B 4LLYA 3F7LA 4V2BA 4MNQD 1G7LA 1XAUA 5E8NB 3ZZLA 4E0RA 3IFOA 1K2DB 2XOTA 4JFQB 4XCCH 4XMTA 4KVNH 4LVEA 4BFOA 2OL3A 4FQ1L 5IR1A 4KZEH 3FUIA 2D0HA 3QQ3A 5I0DA 1MLBA 1ROWA 5IWLC 1JV5B 1L3WA 3VMNA 1CF8H 3NGBC 1MHHA 2FLMA 1QBBA 3T77B 3BH9B 4LOVA 2EDXA 4H1LG 2JI1A 5HHOD 3MNVA 1AS7A 3TA4D 3D2TA 2X4OB 3GS7A 4I5BB 4Y2NA 2EDKA 3FT0A 1AACA 3OLGA 1MJ7H 2ADJA 4NQTA 5KBDA 4B53A 2CPUA 1ZS2A 4RFEA 1JZ4A 2DQGH 2BS9A 2ITDA 3IJHA 3LSOA 3HG1B 2VSMB 3MRIB 4HS8H 1TF4A 4CRPA 1AKJD 2F15A 4AQEA 3V0JA 2EUZA 3W11D 1MJ8L 2F7IA 3DBXB 2G4EA 1EIBA 3LPOA 4F80A 5FO8B 4JZOA 2V7NA 4MA1B 2CJUH 3ZE2B 2P8MB 3RUGB 4CVZA 2DBLL 1AKPA 2ADFL 4NHUA 4OLWL 2R1WA 3APMA 5J57B 2NDGA 2WTRB 4JPIA 4ENZA 2ZOTA 4EN2A 5JXEC 5I1LB 2YUXA 4HFUH 5DHYA 2BVEA 3GXDA 3HB3B 2QLYA 3NRQA 5TF0A 3OZ9H 1A7NH 3MLXL 2ZG2A 4WCYL 1ECYA 7FABL 1BYOA 3BUIA 1YEFL 1E7UA 1U30A 1WZ1H 3VGDA 2YGNA 2E27L 1MCKA 3QJVB 2HRGA 2YN5A 3UPCA 2C1PB 2J88L 1J0HA 1RUKH 4Z5RB 3IDJB 3REWA 1BVOA 3DA0A 3K0WA 1U3HB 3VFTA 4WK4B 4YAQB 1NANH 1OCOB 2ZCHL 1KIQB 5D7LD 4Q0XL 3KZ8A 3RIFF 1CXKA 1LDPL 4KMTL 4S1QH 3THML 4XPHH 4OCRL 1ASOA 1JSYA 4ENEC 4PJIA 1ROCA 1RL1A 1R5VA 2KLSA 3DPBA 2JJTA 1B6DA 1UA7A 3FFCB 3U6XS 3S3BB 3O9WD 2H2SC 3HMXL 1AHWC 1TNNA 3NGBB 4KZCA 5DVOA 3RWCA 3NFNB 5DK2A 4WWKD 4MB3A 3F85A 1OARL 3BKML 4P05A 5F1IB 3QDJA 4WEMB 1FL6A 4OLXH 4N6RA 1G7IB 5D7JD 5E0QA 3CDFA 4D7PA 2E76C 4P9HL 3AITA 1KB3A 5F7DB 2XVLA 5CJBA 4Y5XA 5D2NC 3PDOA 3HNTH 2GEQA 1CDHA 1BFSA 5C09D 2X9ZA 4FJ6A 5CO1A 2GSGB 1FIEA 4LCYA 5DD1L 3NEXA 2ATKB 2VLRD 3DETC 1U8JB 4K7FB 2XRAL 5DU7A 3P0YH 1YDPB 3M17A 3RB5A 1X5GA 2WY3B 4AITA 2ZPKH 3K71A 1DJZA 2ZAGA 3WY1A 3DNKA 5I0VA 3CH8A 3EYOB 2Q8AL 5IBTH 1NDGB 3LKNB 5AWNL 5KSVA 4QGTA 1CFBA 3M86A 3SY0B 1EXUB 3AG3B 3VFMA 1CPUA 1P4UA 1GMIA 3IFPA 2ZQKA 1KIPB 4IKKA 4KBPA 4LLAA 2PPEA 1IGIL 1YYCA 4PBDA 3RDJA 4M62H 2BVQA 3L16A 3VA6A 4AQ8C 5EBGA 1KXHA 4ZFQA 5BVJA 4XAKD 1A25A 2EIKB 1DL7L 2IMMA 4FCAA 3VWJA 1VFBB 4XTRC 1G4RA 4OFYD 3B6SA 1TTGA 3CBKB 5L8KB 4OCNC 3K4AA 2XZZA 4AGNA 5FLVA 4FNLH 4HLZH 1J8HD 4PJ5A 4M03A 2IAND 4KNSA 2J6EL 4IKJA 2RB8A 3DX2A 3D12B 1V7ML 1AHWB 3LZPA 1J88A 3ASNB 3CHQA 4F7PA 1QTYT 5CF3A 1A0QH 1YNTB 1KSRA 5I0WA 1DSFL 4WU5B 4XPAL 5TDPA 3P11L 4XGZB 4PVMA 1XIWA 4WFEE 4MMZC 4L0ZA 1D7FA 1A1OA 2ALWA 4UV7L 3RWIB 5FB8A 4FX5A 2ZOOA 4I2XA 1E6OL 3ATFA 1QFOA 5D2NB 4PTUB 4RA0C 2FJFA 1AYRA 5I1JH 1TYRA 1JGEB 2B08A 2R0LL 3G5VA 1FO0L 4KJPD 1J12A 2MIZA 3HC3L 1XZ0B 4D0CB 2F8XC 2WZ6A 5HGAA 1S7SB 3WTYA 4ODVL 4QWWD 4QXTB 3APFA 5D1QC 2E74C 4W9CC 5AVSB 5AVUB 1MPAL 1T21B 3RIFK 3U83A 1J0ZA 5MEQA 3X14B 3EYQC 3E6FA 4ODXB 1WLHA 2I5YH 2ITCA 4OLVL 2UX7A 4MB5A 4XB7A 4CJ0A 2A6KB 4WEBL 4L4VD 2DIEA 1OF2A 4BDVA 4F7MA 5GZOA 4PIBA 3IGLA 3HZVA 2XWCA 3MYJA 4XHQA 1XB8A 4IBZA 4XBEH 5EO9A 1LNUB 3HMXA 4KKCC 4OFIA 4PIRF 4NZ8A 4X9GA 3IGFA 3KYKH 4O2FA 4G7YL 3E1ZA 3KM2A 4NQSB 3EGSB 2EZ0C 5EV7A 1KTBA 4YGVB 5T3ZD 3WL9A 1TU2A 3O4LD 3B43A 3DTUB 1EWHA 2OMTA 4Z7UE 4AIXA 4UOW1 4JJOA 5KVGH 5DJ2A 4RBPH 3LN4B 5KYUB 2C9QA 3CN2A 5I19L 4KDVA 4X80H 4LRIA 3PP4H 4IRJA 3C75A 3IS0X 5ENWA 1W8EA 3ARDD 4P2RA 3MLTA 3HBGA 3O2WL 1KTJA 2YXMA 1PPIA 3N1GC 4FYSA 3N43B 5AAWC 3OGOE 4NXSA 2BNUB 4GS7C 2FATH 2O5YL 1UZ8A 4FKKA 3FB6A 1DFBH 5T5NG 2HT3C 2WLZA 2XZQH 3BKCL 3T0AA 4MMZB 4PH8A 4R4ND 4BFEA 1GCFA 4NNYA 1OB0A 5ILTL 5BRZB 3SYAA 1XHHA 2Z31A 5DR5L 2RHEA 3MJ9H 3IDMA 3UO8B 4N8UA 1WBYB 4N8CL 4X7SH 1O6SB 4G42A 3QE5A 4B95C 4D0BA 3FSAA 1V10A 2OP4H 5DLMH 1H15B 3GI9H 4Z7WE 5E8DL 4RAHA 2EIEA 1MFCH 4PJCA 2EXYC 3TT3H 4S2SB 4WFFE 1Z9MA 4OZHE 5D1QB 7PCYA 4IRZL 1E50A 3FXIC 1G5GA 1JXKA 1ZD6A 1RVFH 4MFHA 4YC2C 3MUJA 5EUOB 2BNRA 4DPBX 2JV6A 1SQMA 4XP4H 5JHDE 4EKXA 1TMCB 3KPNB 5DO8A 3FU8A 2BFVL 5I8OH 5IBLC 5I6LA 2PABA 3D3VE 3D39B 1LP9E 1FNEA 4ODUB 5DD6B 1JNHA 2J6EA 5FLUA 2ZYRA 3EO0B 1EUUA 1VA9A 1G6VK 2P1YA 4FYQA 4KTDH 4LBAA 4P06A 4MVBD 3MX0B 5HVWA 5IHZB 4UYQA 3NACH 3ZUNC 1JDAA 5FOBB 4NB7A 2MNWA 4XOAA 4E9VA 2H47C 3MRKA 1HH6A 5FW8A 1GOFA 1A3RH 2R7EB 4KH2A 3ZTEA 2G9HA 1TG8A 2LU4A 4L3FA 1MEXL 2EIZB 2DM3A 2CHDA 4ZO6A 1GZPA 5FOJA 3MOQA 5HHNA 4P49A 4ACTA 2BSEA 5BV7C 4P4RA 3TIEB 5DO2D 1FO0A 2OULB 3VGFA 1BWWA 1GKEA 1UA3A 4LMQI 4ODSL 2ADGA 4HP5A 4DQOL 5IB5A 4DIXA 4GS7B 2VXSL 5IOPA 2A9CA 2NQ3A 3ZIYA 3MO1A 3F12B 4ZUUA 2WQWA 3HCVA 4RBPK 5KN5B 1A6VH 1A6AB 1G6RB 2XNAA 5KANI 3AT8A 2X6VA 4YWGH 5D8JH 1XQ4A 4RMTA 4OZIB 2O61B 4C56E 1MFBL 4UQ2B 2WQ8A 3GJFH 2X38A 4C83A 1QTPA 1K4DB 5I17A 5IFHH 3MRPA 2LFEA 3QJHB 1ES0B 2ORBL 4Z7UF 3SPVB 1AQDB 4AVJA 2XT1B 2AJ3B 4L4TB 5EZLB 4UOJA 2F19H 5BS0B 3FTGA 5IOKA 1S9WB 1VPOH 2J56A 1C9SA 1T3FB 3QC6X 5A16A 4YC2B 5KVEL 5BVPL 3SKJH 1OO2A 4LSRH 5F7BA 4MNHB 1ILSA 2WIIA 5DMIL 5K9KA 2ED8A 4JCWA 5E2WL 3VXNB 2YKLH 1MFVA 5AKRA 3HNVH 3CZJA 4U6VL 4P46C 2WQUA 1L4IA 4OB5H 2ZOWA 3BISA 4PJ7B 2IQAA 5LGKA 1S8DB 5FWRA 3TV3L 3MOAL 4FMFA 3SKNA 1J1XL 4TSAL 4JPQA 4NUJA 3TASA 1AI1H 1T7YA 3AQYA 5FUOH 3NA9L 4JM4L 4YSOA 1VJSA 4F92B 4P3CL 1CQYA 4ADGA 3NAAH 1HHIA 1CS6A 4JN1H 4CMMB 5IQMA 3PF2A 1ZWIB 5EIIB 4PP2B 2Z91A 5D2LB 3QZPA 4Z7WF 5EBMB 1EMTL 4FFVC 4LVHC 4Z18A 3RVVD 4E2OA 5BV7B 3NCCB 5IMOA 2OW6A 5K33A 2B20A 3CDZB 4OZHF 2VWEE 3U79A 5JIIA 3F00A 2TRHA 2XDHA 4WFED 5C0CE 12E8L 3P4NB 3WIFA 5HGHB 4G8GD 3D0AA 4F57L 2OZ4H 5EBLB 2X4NB 3HG3A 4HIQA 4XMPL 3EH3B 4OCMC 5E8PB 1A7OH 5GGQL 4A67A 5DMKB 3HLKA 1LP9F 2NCMA 3V0WH 1EHNA 2DICA 4URKA 5JZ7C 4DGIL 1AD9B 3GYRA 2ZAHA 4NLAA 4ZZFA 2PTVA 2GT9A 1MCNA 1TEGA 3GLZA 4KK6D 4DWHA 2V7HB 4MWFB 2CPCA 3IJYA 4UNTA 1TTRA 5L88L 3TBCA 3DROB 3F7VB 4V11A 4HEPA 2KYIA 3ZO9A 4CW1A 1YMMB 4LPUA 1X5FA 3LRGA 4K3GA 5BZXA 4HXBH 1FG2A 2VLMD 5BQ7A 5IGXL 1N6VA 3LNGA 1WFMA 2PYEB 5AZ2L 4NBXB 5TK2A 4I3SL 3TCXA 4CADA 4CSSA 5DXWA 1CLCA 1J5HA 1OWWA 2CO4A 1B4LA 1OLLA 2NSXA 2OS7A 1NSNL 2G0KA 2UUDH 4B5EA 1F45A 2JJSA 4J1UA 1TJIL 4HIXL 3IF1B 4GW4A 4DVBA 2B7DT 4R4BA 1T2QL 4Y9CA 3HMWL 2CM5A 4XCEB 1XGYH 1BAFL 2DTMH 1L9OA 1TO4A 4K94L 1Y7VA 2D3LA 1KJ2B 4P46B 4R7NA 2Z9TA 3PGCA 2H8PB 5KZCB 3QEUA 1KZYA 4EO5A 3R8BB 3MCLL 4XVOA 3QR0A 3QH3A 1M42A 1T20A 4OIIH 5ISZA 4QRRA 5FX3A 3BP7B 3BQUA 1YG9A 2AK1H 2A6JA 3IJEA 4MDIB 1F02I 5I6OA 1E65A 2VXVL 3HE7A 4N25A 1WS8A 1YEKL 2GTQA 4W9LC 4FQHB 3HUJF 4F9PC 4J3O