3ASWA

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
320
structure length
320
Chain Sequence
GTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Clumping factor B
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
total genus 81
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA02
3ASWA 1R17A 2YLHA 2Y7OA 2Y7MA 4LE8A 2RALA 3IRPX 4LEEA 3IRZA 4LEBA 4JDZB 4F1ZA 3AU0A 4F27A 3IS0X 5CF3A 5CFAA 4F20A 2F6AA 4RMBA 1N67A 2Y7NA 5IHWA 3AT0A 4Q6KA 2Z1PA 1R19A 3IS1X 4JDZA 4BBWA 4B60A 4F24A 4JE0A 4MBOA 3V10A 4B5ZA 4FJ6A 2VR3A 4MBRA 2F68X 2Y7LA
chains in the Genus database with same CATH superfamily
1SPDA 1E4XI 4XPBL 4U1KB 3RL2B 1H6EA 3K8LA 2BPBA 2WQSA 3GSOB 4PRBB 2NXZC 1E9OA 3K8MA 4GAYB 3MJ9L 4S1DD 1OP9A 3HMXA 1JZHA 1TSRA 4QRPB 2ZE0A 1A66A 5I16A 1T21B 3LEYH 1ILUA 1HH9A 2PR4L 1IGTA 4XP5H 2IQAB 5DUJA 1HH6B 2B9AA 4JQVA 2P43B 1BJMA 5HYSA 1PY4A 4N90E 5KW9L 1WAAA 3MOAL 4OZHE 4H7VA 2KPNA 4M7ZC 4WWKD 3BH9A 2OCJA 4EZLA 1IM9D 1F11A 4XAKE 3FZUD 4FQIL 4K2UL 4M61B 2XRAL 1ERNA 5J13B 3CV5A 2PXYB 2PWHA 3MV7D 3QUYD 2P1YA 3BUPA 4NT6A 2QGCA 2R29L 3LNDA 4JHBA 4JFVA 3WN5C 1DVZA 5DC2A 3UBXB 3ILQD 3MJ7A 2FO4A 4I2XE 3K1KC 4N1CA 4ADIA 3VXUE 3FQXB 2J2ZA 3P11L 4AQOA 5F89B 1DQDH 3BZFA 3FT4B 5CD5C 2ZPKH 4HHAB 4HVBA 4FP8L 3H2PA 3D39E 4QAWA 2VR9A 1B0RA 3MOBH 3DSNA 3U36A 4AZ8A 3LNIA 3VMOA 1J1XL 1OGAB 3GZQA 4H40A 1ZEAL 2DM3A 3IXTB 2MMXA 3HPLA 2V2TB 3A6CH 3PWLB 1DN0A 3JV4B 2WTPA 4TNEA 3RVWC 4A6YB 1LO0H 3FT2B 3RBSA 4DGWC 1WAPA 1DJGA 3QQ4A 1I9JL 4NDMB 4ALAH 1IE4A 1V8HA 2OZ4H 3ESOA 5CSBA 3DOIA 3HUJB 1ROWA 4ZS7L 2YWZA 5I0VA 2OSLB 2A1WH 5F7NC 1JF1B 2JQMA 5DXWA 2IVFC 1HAUA 1R3LB 3DMMA 4QF1B 3QQ9C 2Y7SA 5J89A 4WZ9A 2CCVA 2WZAA 2FEEI 4HEME 3ULUD 2PW2B 3FUIA 5DMJB 3NJKA 4AYGA 4OLWH 5CF3A 3OGOE 3S48A 3BAXA 3MZTA 3QQ3A 4TNVF 5CEYB 4KV5F 4U1MA 5E03A 32C2B 3FSAA 5LAXA 2K0RA 1AANA 1SDAB 3TXAA 3CK0H 2PCXA 3LSOA 4JFDB 3IETB 3VU2A 4E5XB 4JL1A 1PYWB 4GQRA 3STZA 3MGOB 5TTRA 2VL5A 4IK7A 5IQNA 1SM3L 4G9FD 2ZCKH 3QH3A 1AZNA 2OAAA 3P4MA 3B3BA 1D9KC 4HIJB 1CFTB 4GQ9H 4PP1C 4ANUA 3FB7A 4DGVL 1JHLL 5D2NE 4G1EA 4WNQA 1NL0H 5BZWB 1O6SA 2OP4H 4BJLA 3LXCA 2PCYA 4CUCA 2X4UB 1MY5A 2FBJL 2AJUL 3QBTB 3X13A 1MCEA 3TBYB 2OI9C 3GPSA 5FV1L 1KF9B 1M2OA 2NW3B 1A7NL 3BHBA 3SZ6A 1OAZH 3FT3A 2Y06H 1PG7X 1L5GB 3F12A 4HGMA 3IGKA 1HEJC 2YEVB 5EZJA 2YGQA 2JJTC 4LCYB 3ZLQC 1TEFA 2DL9A 2WKOA 4UINL 5B38B 4KUZL 4M43L 2OXGB 2F19L 3HI6H 1ASPA 3MR9A 4R9HA 2VDOB 5A2BA 5I1EL 1UA7A 1P5UA 1T1ZA 3X1BA 5LLIC 4XVTH 1IGIH 2FWSA 4KHTH 2AKRB 5T1LA 3L1EA 5K9QI 3I75A 4IBUA 1I4FA 5GGSB 5I6PA 5IQOA 3KM2A 4ZOCA 3AY2A 5SWSE 4XMKH 3E8UH 2W91A 3BP7A 3MRGB 1EXUA 1WC7B 1HQRB 3C87A 5G5DA 5BO1H 4PS4L 4R4BB 5AALA 3J07A 2I07A 4Y4HD 3RKDD 5C7XH 3HI5H 4AH2B 1JUFA 3OB0H 4N5EC 5BS0E 3FOMB 5LQBH 3QHTC 3MV9B 1EV2E 4EUPG 3OLGA 4X8JA 4J8RA 5HTSA 3LD8B 4RGOL 5HI4C 3U1SH 2RACA 3QXDB 3UGUA 4GS7C 1CFSA 5CJQL 1FORH 1XBDA 3PIQA 4NZUL 1A4KA 2OFQA 2HN7A 4Z9KB 2DD8H 3EFOB 1IQDB 3FUFA 3IMSA 1BZEA 4PRNA 4WFEE 2H0JA 1T1YB 4UI2A 1WG3A 3UOAB 2Q3XA 4GI8A 5LB1A 5L9DH 3QHZH 1NGPH 3VRJA 3ES6A 4MJ5A 3G6AB 1CQKA 1W72B 4PJCB 1I8KB 2WXGA 3WHXA 2LW3A 2P49B 1ZLUH 4XT1C 2BMKB 2HVKA 1F1AA 4YSSA 2BLFA 4RISL 3RPKA 4MJIA 3F5WB 4UTAA 3ZZ1A 5EG6C 4MQXC 3DOSB 4ODXB 4X6EB 5T1KA 2EZ0C 4UT6H 2P5ED 2A9ML 2GTWA 4HXAH 3K74B 5EOCL 4YAQB 5KSBF 2WWOA 3N40P 4W70A 3BFOA 3VXME 5ALCH 3QIUC 4F27A 4PVBA 2XZCL 4PRIE 5JQ6H 3FQNB 4C4KT 2WKLA 3OKOA 1P53A 2J21A 3WJMB 5SV3A 4KZ0A 2ZWLT 3F58H 4LPVA 2JELL 4U1HB 4H26A 1HXKA 3T0AA 4HAFA 3Q1SH 2Y6TE 5EIIG 5I6NA 1UWGL 2BW4A 3JTSB 3K7UA 2AQPA 1MG3C 3IAGC 1VFUA 3A47A 1A4BA 4P9HC 2G0KA 1RULH 4FZEL 3UPAA 2WV3A 4ZUTB 4AQEA 1MQKL 3GRWA 4X0KA 2O5NA 1EEZA 2YKLL 3OWEA 3Q6FB 1U8LA 4Z7WB 3OGCA 1NOFA 3OMAB 3VRIB 4RETB 4CRPA 4WFHD 5IQMA 3MCG1 4NXSA 3UTSA 3O6FD 5DRNB 5LN8A 4ZUSB 3D34A 3FL7A 1M7DB 4WI0A 4HLZH 3ATAA 4OCLC 4HJSA 3RFZB 1V3LA 3GMQA 4LSUL 1KT2A 4PRPA 1HIMH 5DRZA 3QDMD 5FIEA 3LVEA 3FCTB 5CHNB 4UDUB 5ICZA 2ENYA 1W9XA 5KANI 1I8LA 2KLSA 2W9LA 1IC7L 3OF6A 4A67A 1UEYA 1H6FA 4O2CB 4OTXH 4ETYA 4PGDB 4ODHL 1AYOA 3EYSH 4IMLA 2JTDA 1G9NH 1K4DA 1S7UB 4Y2OB 5I82A 3HFML 1NANH 4ZAKD 4JR9H 2UY6B 3QG6B 3HVNA 3ZRSA 1YQ2A 1V5JA 1X5HA 4FFTA 2VQTA 4U1IA 3SBWC 2HCZX 3H4HA 4TN9A 4D2NA 4F3FB 2IPTL 5A2AA 4FNUA 2DB8A 1QEXA 3GMOA 4AQ8A 4ZFOL 3LIUA 2XZAH 3LY6A 2BCKA 1HHJB 5E8PA 4FQQB 4Z7WF 5J3HD 2FWOB 4PRAA 5KSVB 3HLAA 1FQ9C 3NFPA 2CA3A 1OT2A 3BSHA 3L45A 4ONHB 4TRPL 5LBSL 4JAMB 2WBWB 5J1TC 4LCWA 4UU9A 4N90D 3UTPE 2NY4B 2F7QA 3ZQ9A 1FPTH 4CC4C 4QRSA 1MCFA 3HG1B 4PJBB 2E59A 3AY4A 3X3GH 4XAKD 4XHQA 1A9EB 3FHEA 1ZT7B 2ZOWA 4LLMB 4Q2ZA 5AAPA 4NAJA 5A7EA 4HAGA 3FUHA 1TO4A 4GXUM 1OP3H 4RRPG 4HCIA 1PZAA 1IAKB 4AM0A 2CM6A 4QHKJ 1UA6H 4XXWA 5AW4B 3EJYC 2EE2A 3VXUD 3DXAB 4GI6A 3QJFB 4J3VA 2ZPKL 3PGDB 3T77B 1J18A 4MXQD 2Q3AA 3MOBL 3ABKB 3KMDA 3MRJB 1OCRB 1ZPLA 1PD6A 4Y4FC 2L7UA 3D39D 5BV7C 1XD1A 3GSOA 2H2SD 1PZ5B 3S8FB 1R46A 3GK8L 3HVDA 1Z9PA 4YSTA 1A6WL 3VGFA 4R7XA 4X9BA 4QRPA 5JPNB 1E30A 3ZMRA 2F7IA 3TFBA 4XWGH 3UBXI 1T21A 3UP1A 5D4IA 3O2WH 4AC4A 3B1UA 2IQAA 1LO0L 3OKNB 5GRWA 2OZ4L 2ED7A 1ORSA 2Q7AA 3K6FA 4PJGE 4UV4L 4MMXC 3PL6C 1ZHBB 1MREH 2XICA 2A1WL 4W4NA 4MXVE 2PXYA 1NCTA 4PJBF 3S6CA 5I24A 5LBGA 5FGRA 2CUAA 2JI1A 3CVIL 4PJ9A 1MCRA 4GSDH 4XZ4A 1GOFA 3FQXA 3A4AA 4R8WH 5F89A 5J6SA 1G9EA 4OLWL 2IG2L 5DLML 3I50L 1KN4H 2LAAA 2MPVA 3FT4A 3EJUA 4HHAA 3ZYOA 4W9ZA 2KC0A 2MQ0A 3WLBB 4JRYB 1GJUA 1OGAA 3FCGA 1B6DA 1HINH 2BSRA 4ZX5A 1V3MA 3VB8A 4ADJA 2V2TA 2MH4A 1H8SA 1TMCB 2UX6A 3GIZH 3PWLA 5ERWB 2UXTA 3ARDD 3QO0B 3FF8A 2XIDA 3WJJC 2ZCKL 3MV8E 4MBOA 4M48L 1S7RB 2VDQB 3ASOB 3FT2A 4M6MH 1KCWA 4HISA 2ZOLB 2LLNA 1GPOH 3SBRA 4L29B 2YRPA 3A6BL 1CGTA 4P4KD 3HUJA 4WEMB 4ZOAA 2ADFH 3OHXB 1KENH 2OSLA 2X41A 4WWKB 3KWWB 3MNVB 1JF1A 1IM9B 1RK0B 2WQWA 4QT5B 1R3LA 4QF1A 4FNPA 3MV7B 3QUYB 3BPOB 3FW6A 3F7QA 1SYVB 1ZHNB 2YR3A 4APQD 1X5XA 1OAZL 2A74B 5FUCC 1MVUB 3G9VA 2Y06L 2BP8B 3FT9A 3NCYS 4U1GB 3WEXB 2G9KA 2PW2A 3SKNB 1JSYA 1NMCC 2GUOB 4HKXB 4YSOA 4DPCX 4GBXD 1YPZE 1N5AB 1XGRA 5AVVB 3HI6L 3L7FB 5CEYA 4E2OA 2XWXA 3HZ3A 1A4AA 4YFLI 3LNGA 1IC1A 32C2A 1A6ZB 1IGIL 1Q0YH 4F1ZA 5J0BA 2VXVH 2ZAGA 4NQQA 4JFDA 4NZJA 3QZPA 1K3IA 2XFXA 3ARPA 4E5XA 4X83A 3MGOA 1IRAY 5SWSD 4Q52A 1FVCB 3MLXH 3RDTC 2PUQT 1BOGB 3T04D 3K3QA 3IWVA 4HIJA 2B39A 2WTRB 4N0YH 3M8OL 3LJ3A 1UH2A 4GPVA 3FRUB 4QR7A 4S0SD 3GSNB 2VAAB 4ZOEA 5C7XL 2VZOA 3KLKA 4LHQB 5BZWA 5GXBB 3HI5L 5GZND 3BPCB 1KY7A 1ZY9A 5LQBL 4FQ2H 1GZQB 3LNEA 5BS0D 1HVXA 2VLJE 3U1SL 2X12A 3LB6C 3IKKA 2NW3A 4FI7A 4JPWH 2IOMA 2D7TH 4N68A 3SO5A 4A2DA 1JDCA 3LVTA 2VWEC 4MA3B 2DD8L 1H6UA 5EBMA 4N2DA 2OXGA 5DZPA 4UT6A 2GTZB 1PG7H 3D12B 3GSRB 3KLAB 1JWSB 1XEUA 2Q0ZX 4MCZA 5L9DL 1ZV9A 3VA6A 1NGPL 4LBEA 1F6AB 5CIPB 5MENE 3E2HC 3DYMA 2Y6SD 1CK0H 2AKRA 3LOWA 5GJSL 3T3PB 5GGSA 4QKXB 1QR1B 4MVBC 3O6MH 1LK3H 1BEYH 1BVNP 4TNWF 3MRGA 3OKMB 1OE2A 4XC3H 1J5HA 3H2QA 5F7YC 1HQRA 1ZVNA 5E6IC 4R4BA 1M53A 2BFVH 1LMKA 4F2FA 4G9FB 2Y22A 5DF0A 4HXAL 3CZFB 5D7IE 4PAZA 4XMLL 1BQHB 1P4LB 3FOMA 3ZE1B 1DQTA 5JQ6L 1TQCC 3NSDA 1N59B 4RFEB 1O0VA 3N9GH 4Y5XB 3IYLW 4NZTH 2AJXH 4PRID 4TLTA 2P26A 3GGWB 4OBSA 4WTWA 5E2TH 5TK4A 1XIWD 1MFMA 2OX5B 1U8MB 3F58L 3QXDA 5B1JC 3Q1SL 2BVEA 2JB5L 4JDZB 4ZUVB 2Y5QA 4GIOA 2ZUQC 4P5TC 3TH3T 2J88H 3U82B 1QO3B 1T0PB 2KLTA 4L1TA 5D71L 3EFOA 1LK2B 1OTSC 3ULUF 5I9QB 4NC1C 3UYPB 4PCKA 3ZT5A 5IJKA 2DQUH 5IW6B 3SGKA 5FR3A 1E3ZA 2ITCA 3TJHD 3DVIA 4G8FB 4AJWA 2BVPB 4PJCA 3O4LA 2WXFA 3HBPA 3CLFL 1DE4B 3IPBA 3T3PF 2BMKA 4X9FA 3FB5A 5FO9A 2FEJA 1FZJB 4ILDA 1S78D 4ODWA 2H1PL 3F5WA 5E8OB 3RIFF 3CUPB 2R69H 3DOSA 2M2DA 4ODXA 4X6EA 5CLXA 4U3SA 4YAQA 2CXGA 4Y4HB 3IMRA 5CIPH 1QSFE 4I9XA 2NR6D 2FRGP 2AZUA 2B4CC 1YLBB 3PUCA 4KRMB 5ADOL 4DPBX 4OTXL 3FQNA 3GDCA 3HA0A 3Q8FA 5F7KC 3TBBA 3EYSL 4WNSA 3WJMA 4F9PA 3ZE1F 5A2IH 5BOZG 1YNTA 2BWDA 4ABQA 4U1HA 2NW2B 1Y0LB 1F3RB 4PB0H 1AXTL 3JTSA 2IH8A 1MHEA 2PPFA 3UJIH 5HVWA 3EHBC 1QVOA 1UFUA 2APWA 1JD7A 3I3EA 1WIOA 2DLFH 3HLKA 3FTUA 3NDZE 3Q8EA 4LASH 4YL4A 4ZUTA 1I9IH 3HKFA 2IFGA 1ZTXL 5F8QC 1YYMH 3PWNB 4EI5C 1Z9NA 4KPHH 3MU3A 2XZAL 4M7JH 3NFNA 2BSBA 2R15A 4IHOA 3SOBL 4RBPK 5JPMB 3S88L 4DVBB 1M7DA 4QYOA 3U9UA 2Z8RA 3RFZA 5KVFL 3DX8B 4GFXA 2NY0D 4K8RH 4BD4A 2WCPA 4XOCA 3WNJA 1T03H 2E9WA 4FNQA 3ZR6A 1FPTL 1P0SE 1KACB 2DYSB 3UTPD 4BUGA 3FCTA 4DERA 5CHNA 3L5HA 4OZ4B 4AJVA 2P7TB 4ZO7A 2P5EB 3N0PB 3X3GL 2FR4B 3KVDD 4P23A 1KULA 3PS6A 1FJ1A 5DRWB 3QG7H 4AL8H 4PGDA 3NJXA 4P2QD 3S3SA 3CSGA 4E9SA 5JOPE 4G83A 2MWCA 3ECQA 2UY6A 4KRPC 3HC3H 4BSVA 4KXDA 1MIML 3VWKD 3Q0HA 5DURD 5A3IC 4LLUA 4KO7A 2EO1A 3ZE0F 1Z1WA 5IHUL 4OUOA 5DJAB 1T83C 4F3FA 1J10A 2I9LB 5C3LD 1DZBA 3RA7H 3NSJA 5D7SL 4XWGL 4HT1H 3DIFB 5JW5A 4FQQA 3O2WL 2D03H 2FWOA 2ZAIA 3RILA 5KSVA 1N2RA 1YYCA 2QQQA 1IC0A 1YN6B 3BUQA 3O6FB 4OI8A 1VGKB 4KKBC 4ONHA 4JAMA 1FL5B 2AJ3B 3RFRA 3SY6A 1F58H 1ETA1 1RIHH 3LRLA 1MREL 1L9MA 3PAUA 4TQEH 3IDYC 5CJ5A 2O6EA 3QDMB 1YVLA 1A9EA 4OVVA 1E5BA 1ZT7A 2YPLE 3FQ2A 2CLZB 4KO6A 4LSPL 4GSDL 4UF7C 5IBTH 1E43A 3FN3A 2OK0H 1CC3A 1FVEB 3FN0H 5IESL 2FJGA 4JDVB 1V3KA 3E80A 2OQJB 3CBRA 1KN4L 1RFDL 3DXAA 4ZAKB 3R7RA 4D3CL 5JLZB 3EGDB 4LPTA 3PGDA 2HG5B 3T77A 4BFRA 2R2EB 1MCBA 4MNQE 3MRJA 4OR1A 3SPVB 3DX7B 3DX0A 4GNKB 1DVTA 2E6PA 2DMCA 3TFKC 2P5PA 1HINL 3GHEH 3KJ4C 3ZDYF 3ATDA 4PJ5E 2OYKA 1ZTXE 3SPIA 5E24E 5JPNA 2XQ0A 1ZPUA 1BREA 5EEVA 3CHXA 4EKJA 1WO2A 4FXGB 5DVLA 2A7BA 5F72S 4M6ML 1EDYA 3RNQA 2JQZA 1N6VA 3OKNA 5B22A 3MV8D 2X6MA 1GGBL 3IFNH 4WY7L 4U49A 1RL1A 2FJHB 3EOYG 4DN4L 3VRLE 1ZHBA 5DI8B 1P5VB 3AVEA 1C08B 2VQ1B 3DNKA 4OZHB 3EJZD 3KR3H 4UQEA 4ZX3A 1OW0C 2W81C 5FYLE 2WLLB 3IJEB 3MX0B 4PHXA 4CILA 3S37X 1M3IA 1KB5H 1EZVY 3BIKB 3MXWL 2PKDA 3JWDC 4NQCE 4I2XB 1OZUA 2CALA 5CGTA 5ACLA 5HGBB 3VXUB 3T1FA 2CO7B 3SPCA 4DN3L 4JB9L 4CW1B 4Y2NA 3NCFB 2VRKA 3Q5YA 3HIZA 4M62H 2CRMA 4KGLA 4R2GD 3WLBA 4JRYA 4MLSA 3B5HA 2DIAA 3D39B 3QWQB 4MA1B 1KCRH 4GKZB 1JCVA 4WSKA 1JRHH 3VDAA 4QHMB 15C8H 2QJDA 3QO0A 3BRGC 1EHLL 5K9JH 1S7RA 1HI6B 5B3NA 1NM4A 1EVTC 1JWMB 2ZOLA 2F8IA 4W6YB 4XN8A 1XZ0A 1FI8C 2WWKO 5A40E 1PGRB 3ARGC 3QARA 3OHXA 3KWWA 3LRKA 3MNVA 4F2EA 1IM9A 4LNVA 4RSYA 4OZHF 2DMBA 1RK0A 3O3BB 4R7NA 2NY1C 4QT5A 1XR9B 5TQ0H 3I6LE 2VLJD 1B2WL 3QUYA 1SYVA 1ZHNA 4JPWL 3LQZA 2A74A 4P0DA 4TUJA 1DUYA 5DQDL 3T0EE 1MVUA 1PSKL 3WEXA 2BP8A 5DFTA 1P7BA 3SKNA 2GUOA 4HKXA 3SE8H 1UWXH 3L7FA 3GMPB 1PG7L 3PAYA 2MIZA 4GMSH 2DLEA 4JLRB 2CNYA 2CKBB 4BK4A 5I1KH 5AW2B 1AIFB 1CK0L 3UGXA 3WFHB 5MEND 3SCMC 2PR9A 2A9AA 4WTQA 2CK0H 2CCLA 3O6ML 5F3FA 1PX4A 1L9TA 1LK3L 1TZHB 4UTCA 3MA7A 3EOBB 4UANA 2UVFA 5E4EC 1BOGA 1CIDA 3ARDB 4K5OA 1JVOA 4TQ8A 3QZWB 2WTRA 1N64H 3MROB 5E1HB 3FRUA 3GSNA 2VAAA 4H0HB 2WXMA 3GWJA 3KWVA 3MNWB 5E8NB 2E8YA 1AR1D 4P4KB 1GZQA 4W9GC 5TH2A 1UB5A 1DN2A 1HXYB 1NGWB 5E2TL 3BJ91 1AFVH 5E8DH 3PDGA 3WIFB 4J6RH 2AFNA 3W2DH 2PO6D 4APQB 3IGFA 2J88L 4OLVH 1J1OH 1KXTB 1UWFA 3RWDA 3V9EA 2GTZA 4GBXB 3KLAA 2JLPA 3V0FA 3V4LA 1YSOA 1JWSA 4XNZB 2DQUL 1KUMA 3JUYA 4FNRA 4UOQA 1VFBA 4PR5B 4PJHE 3O9WA 3QFJE 1F6AA 1I75A 2E74C 2PTTB 2VDLL 2ZAHA 2YD0A 4LRNH 2FYYA 5CIPA 5KBKA 5CJBA 4ZQTA 1QLEH 2F8OA 4S1SH 2ETWA 4GO9A 3V6FB 2EADA 4UNTA 4JMXA 1DCEA 1QR1A 3K80A 5FYKU 3MRDB 1IJ9A 1XV8A 2VM3A 2CO2A 3NZHL 4NQED 4PVMA 1OAUH 1MQ8A 2BZDA 3OKMA 2WIMA 5GRUH 4L9LB 4MQ7B 5L4IA 3MUHL 3MCLH 5SWSB 4KNQA 2R69L 2K3HA 4G9FA 1R4XA 3W0WE 4G6FD 2Y9RT 4F58H 4J3XA 4LCCB 1F0LA 1BG9A 5I6MA 4EN3C 3CZFA 5TGBB 2CKBH 4F7PB 1E5ZA 1NAKL 1BQHA 1TCRB 1P4LA 3WIIH 4WW2A 1O7SA 4MB3A 5E5RB 2V5MA 3DJTA 5EO9A 1QSFD 1N59A 5ISZA 3V9FA 3VO0A 5FDYA 4Y5YC 2MOGA 4NPKA 3GGWA 4KMTL 5BS0B 3GJFK 1GY2A 5IJBC 2OX5A 2HSIA 4Z0XB 4JS7A 4LOEA 4ZUVA 4JDZA 3E1F1 3P3RA 1BGXL 3AITA 3UJIL 5FW6A 3CH1A 3R1GL 1NBCA 4BZ1A 1NQBA 2VERA 4IEFB 1JYVA 2Z92B 3O4OB 4LCVA 2VN6A 3MRMA 2PLTA 2WWMD 1C9SA 1TZIB 3QA3B 4KPHL 1LVEA 4PS8A 1UTDA 4OJCA 4G8FA 1BF2A 3WUWA 1XZWA 2EIJB 2B5IC 4AENB 2E47A 3OJMB 5IV2B 3W39B 4DPAX 3FUMA 4JGNA 1DE4A 3B8YA 4X98A 5ITFB 2YC1B 2ZP9A 4NSKA 3VXRE 4MZRA 4XN2A 3D69A 1FZJA 4K8RL 3MREB 3LZLA 2OMNA 4NQTA 4FCHA 3T6XA 1NCHA 4ZW3A 1V7MH 3CUPA 1WFJA 1OAXH 4AKQA 3NJJA 5CSZB 4DWHA 1VADB 1PZ2A 4Y4HA 1H3XA 2M83A 4GJTB 4I0KA 5L4MA 2UZXB 4AL8L 1KLFB 3FUJA 1A0QL 2R7EB 3LKSB 1TFHA 3G6DH 1I1AD 5JOPD 1MFBH 4JQIL 4PRIB 2NW2A 1XIWB 3RZCD 3HC3L 5H37G 1MG2C 3HR5B 4NQUA 4JZNB 1CFQB 1BMZA 4NN6C 1VACB 4JM2D 3VWJA 5KYUB 4LEXH 3RA7L 2HKAA 2NXYC 1KCUL 3QCTH 1Y6NR 4PGBB 4XMUA 3POHA 1GW0A 4C83B 1BP3B 4JPQA 3ZXAC 4P5SA 4PJ8C 2R4RL 1MLCB 4DVBA 5BUGA 2K4AA 3MPCA 5C86A 1PKQE 1MFUA 1UM5L 2IFFH 2VLKE 1F58L 5IUCA 2E9GA 1RIHL 3UAEA 2GY5A 1JJUA 1QATA 3T1WA 4OZ4A 3ZTCC 2P7TA 1A3LH 2V9TA 4YDVB 2FR4A 1AS8A 2UXVA 3AMLA 4NJ9H 2MRYA 2HLFD 3ULAB 4OKDA 2BJMH 2W92A 5IHLB 1OB1B 4NERA 1AJ7H 2OK0L 4G7RB 3KGSA 3CFCL 4HZAA 2HMIC 1U2YA 3ECBB 2I85A 4FMVA 4PWKA 4MMZA 5A1AA 2FECI 4KTYA 2J8UF 2X2JA 1MH5B 3TH2T 4H5SB 1S9YB 4HS8H 2LGNA 4D0CA 1N67A 5DJAA 2XG5B 4MNQD 3DSFH 3TZVC 3GHEL 2I9LA 3PWUA 4JO8A 4TF4A 4F93B 4ZMNA 1ZWIB 1KJ2L 7PAZA 4IOIB 4QI3A 5F7FA 2Q8AH 3DIFA 3LZFL 2X4QB 1AAJA 3DHUA 1T66C 2WUBH 3APDA 3L7EB 4XHJD 1CE1H 3O6FA 1VGKA 1GMEA 3F7RA 1FL5A 2AJ3A 3TU6A 5AOKA 3Q2VA 2NY0B 4G3YL 3F8UB 3TV3H 5HYJA 3KR3L 3L4UA 5FHAH 4XCFL 1DEEB 2X87A 5FYLD 2CLZA 1LLAA 4KI5E 2KZWA 2AK1H 3KH3A 2HP4A 3MLVH 1FVEA 3QR0A 4P2QB 1IARB 1KB5L 3IJ8A 5LXVA 2ZUWA 4AG4H 4JDVA 4L23A 1HHGB 3ARRA 3ZZQA 2OQJA 4ZAKA 4YDJB 5LGJB 2XWTB 3EGDA 2X4PB 4NQCD 5JLZA 4M4PA 2W0PA 2DLTA 1CD9B 2DIEA 3LS5L 3VWKB 3ATFA 3JVFC 5DURB 1IAII 3SPVA 3VD2A 3DX7A 4JPVH 1KXQE 5FYJU 4KKRA 5DUPL 1AZRA 4ZX4A 1KCRL 4RAUB 5C2UB 5LWYL 1JRHL 4XVUD 1J5OH 3RYMA 1WCBA 1UT9A 1XD0A 15C8L 1JYWA 4U3HA 1IGYB 3CC1A 5FUOL 1XMEB 4C56E 1E6OH 1ZHLB 3DGGB 4BSWB 4OGZA 3VW3H 4G8GE 4JFTA 4LLVB 5I6XB 1ZKAA 5D1XC 3WTTA 4N87A 2C1PB 2ZZUT 4IU3A 1FO0H 3I02A 2VJ0A 1INQB 2XN1A 5DI8A 5HHXH 2IGFH 1X5KA 2NT0A 1C08A 1PF3A 2VQ1A 4GP8B 4OZHA 2ZXGA 4PJGB 4W9IC 5IVXF 2X7LB 1RZJC 3CH8A 3SO3B 5EBWB 1DLHB 3MX0A 4OZIA 1GIGH 2BOBB 3I6LD 2FJFB 3T0ED 1JXKA 2RHEA 1NDGB 5DHVH 5TQ2L 3SE8L 1QFOA 2Z7ZA 3DUHA 4Q14A 5EA0L 3MRIB 3RY6A 5HGBA 3HNTH 4CW1A 1GYAA 3S37H 4GMSL 4HMCA 3OZLA 4NOBA 3QQDB 3TO4B 3KG5A 2DMGA 2VCOA 3L08A 5EFIB 2V3FA 4X6DE 4FFWD 2F5AH 5J12C 1L4IA 4B9GA 5I1KL 1WZKA 2Y1AA 3D39A 1DJSA 2AEPH 5F70A 4GKZA 2DPKA 2CK0L 4HDIB 3RVVD 2JLLA 1T20B 4QHMA 5GS1A 2KZKA 4OFQA 5E2WL 3NRQA 3IS1X 1HI6A 3ZTJG 2K9FB 3RJOA 1JWMA 2PTUA 4EIGB 1EHAA 2DI9A 1N64L 3CDZB 5JW4N 3JZ7A 2X88A 1D5MB 3MV8B 4U6TA 2Z7UA 5CWSB 5ILTH 4RWYH 5D93C 1K72A 3WMQA 3BP4A 5EF2A 1YRKA 3GBML 3MRRB 4KFZC 3K71B 2JCWA 4BELD 5D1QE 4YEEA 4WO4D 1AFVL 1J1PL 3NFSL 3PQYE 4LRIA 1XR9A 3L4YA 4PJGF 2X28A 4L8SC 2X10A 4UB0L 3W2DL 4DVRH 3QIBC 4MXVF 2ICEA 1LDPL 2Y1YA 1AQHA 2WZ0A 2AERT 4OLVL 2WKGA 5DEGB 2FCBA 2J6WA 5C0NC 5DSCB 4HEMA 3DDFA 5F6HI 1T89C 4L8CB 1L9NA 3GMPA 5SX4I 1TVBA 4MD0B 4EE2A 4GUQA 2AI0L 3MRLA 3IJSB 4JLRA 4NO2A 5C71A 1U8KB 4DSYA 5J11B 1TQBC 2CKBA 1V05A 3DOHA 4R2GB 1P1ZB 1BQLH 1QLEL 2DQ6A 3QFJD 3TT3H 3WFHA 1INDH 3KLDA 5CINH 4HJEA 3WGVB 1T6BX 4PCTA 1EUTA 2N0MA 4URTB 3TA3C 1IFRA 2I60L 5FECB 1RUMH 3QO1A 3CFNA 1K8DB 3UCRA 1IMHC 5GRUL 2Z64C 1I7UA 1TJIL 2RFXB 3EOBA 4FCAA 5E5UB 2W9EH 5IEKB 2ICCA 3MCLL 5F8RC 2B14A 3EGXB 3QZWA 4X8CA 4BFNA 4AMXA 3MROA 1MCQA 3VI3E 5HJDA 3ZHLA 2GI0A 2VSCA 2D7NA 4KUCF 3WIIL 4P4KA 4EZMA 2ATKA 4XVOA 4N24A 1XB6A 4ODSH 3HBQA 4IRSC 5EUOE 2VLJB 4APQA 1BVZA 5FW8A 2Y2TA 2PMZA 1J88A 2E7BA 4PG2C 1PAMA 2YD9A 4GBXA 3S4SA 2LABA 1KTCA 1Z9LA 4L5FL 1FZOB 3NH7H 5DQ9A 4N9GB 2ZOKA 4HKZB 1YPZF 2VH5H 3BKYH 4FG6C 4IJTA 4PP1D 1B90A 5EU6E 3V6FA 4HZ1A 4HFWA 4A7GA 1G0YR 3V0AC 5MENB 4KVCH 3MRDA 4JN2B 2YXMA 4KTEL 4QOKD 1U92A 4AJ0A 1NCJA 4L9LA 4MQ7A 3U9WA 3VXRD 5SWSA 3HS9A 3F6JA 3KPQB 3UDWA 2H3NA 1DVXA 5D7JC 4LCCA 5FOBA 2KS0A 4BA8A 2Q2LA 5TGBA 2NYYD 5ELIA 3B1TA 4NAMA 1M6OB 1VZGA 1XR8B 3S2AA 2LV4A 1JGLL 1TCRA 1XDTT 2H41A 5GRYA 3RUGB 3T4YB 2P3YA 3EDDA 2X05A 4EZJA 1JGDB 5DO8A 5D7IB 4QWWC 1AR1B 5HHQB 2A0LC 3CAFA 4NWTH 3BGFC 1DVFC 1SVBA 4Y7MA 4YXLH 5IF0B 2PO6B 3AXIA 5C6TH 2CZNA 3EJPA 2AVGA 2I5YH 4X4ZA 1LEKB 1J48A 3MRBB 3SQOH 2WQUA 1OSYA 4UV7L 4LEXL 1TZIA 2PN5A 3QS2A 4HXBL 3QCTL 4NCC1 4YBHA 3G5WA 2A9CA 5IV2A 1E8ZA 5ITFA 2YC1A 2I24N 1YMHB 3PPSA 4LSDA 1UYWH 4PJAA 1QNIA 2IFFL 3MREA 3BWUC 3QPQC 4N1HB 4NQEB 5AVRB 3HRZC 1MW1A 2WLMA 2VLKD 4UBDD 3V0VA 5HI4D 3OC8A 3RVUD 3KPMB 4Y1AA 5CSZA 4G6FB 2PCPB 1VADA 1BYPA 4Q97A 3H3PH 3KWXA 2UZXA 4Z7VB 4DGIH 3UGEA 3N44B 2BJML 3FF7A 2Z3FA 5MERB 3LKSA 1QSFB 1FAKT 1AHKA 5D7IF 4R7DB 3VFVA 4PRIA 1C8QA 1OD7A 1MRCL 1XIWA 4AYFA 3CE1A 4HHGA 3HCVA 3NGBB 3PGCB 1AS7A 3VNYA 1UXSA 2VGLM 1U9KA 3OAYH 4JZNA 1AHWB 1CFQA 4POZD 5HGDA 2VZ3A 4K3HA 3FPXA 2QSCH 1RK7A 2XG4B 3MJ8B 2WC7A 5IK3B 4L5FE 2YMOA 2XY1A 2Q8AL 4PGBA 3RG1C 1R0AH 2PPEA 2RTTA 3ABGA 1CE1L 1DDTA 1T5KA 1CDUA 3TTSA 1K6QL 2IGLA 4LMQE 3FQ4A 4RRPM 5JIQA 2XDHA 2J3SA 4MKTA 3VTTA 1JBJA 3TV3L 3UO8B 1CI5A 3VH8G 3POCA 1JOIA 4PWIA 3A21A 4OCNC 3WNOA 4UM9D 2UV3A 2NR6A 3FS9A 4QXWA 5C0CE 5K59E 1OB1A 4FNTA 4YBLC 1P7KB 3MLVL 4KI5D 4W1TA 3N44F 4EUPB 3UJJL 4AG4L 4NZ8A 3SE4A 1I1AB 2YD5A 4UWQB 5TE4H 2NNFA 5HDBB 1FIEA 2V2XA 3VD1A 1A1MB 3RZCB 1DBKH 4H5SA 2DQGH 1RURH 4Z95L 2W94A 4PGEA 1CGSH 1FO0A 1S9YA 3IGAB 5F6IC 4O5LL 4JPVL 2XG5A 5JOEA 4PLNC 1IGJB 3RWIB 4OAWB 2VR7A 4LGPB 4JM2B 3RX8A 3GKZA 3AU1B 2AEOA 3I9IA 1J5OL 4FI6A 3DI2B 4IOIA 1SRDA 1SBSL 3STBA 5A7BA 2X4QA 3F04A 5EEUA 4GG6F 4B9IA 1I9RL 1BEXA 3GC3A 3L7EA 5H35B 4LOVA 4AQ1B 3HG0A 4C56D 4GMTL 3NJLA 4G8GD 3MDJA 2D31A 6PCYA 3U0TB 1DBJH 4L37B 3LNHA 3VTMA 5E9AA 2O5ZL 5HPOA 4OFYD 3BH8B 3AS2A 1QZ1A 1PNDA 2AW2A 1AXSB 1A4CA 1GIGL 3KXFA 2VR8A 1NIAA 4H0IA 1U8HB 2WY3B 4P2QA 3ZT6A 3B6SB 4JBSA 2JF1A 4JGJA 1HHGA 4PGCB 3O6KH 1A2YA 2YPVH 1EZVX 1DQIA 4YDJA 2ZX7A 5LGJA 3JWOC 1QNZL 2XZZA 5EIIB 3VWKA 3WD5L 4F5CA 4JKLA 2ERJB 1CR9L 4H25B 1NICA 3SDXE 1RMFH 1W0WB 1JE6A 1N0XH 4MNQB 4OQTA 2AEPL 4IOSD 3S97C 3ISYA 4RAUA 1OSPH 2BNRA 4BWUA 1KLUB 5F1IA 4JM2F 1MFNA 2FNBA 1TJMA 1WWCA 4QRAA 2F9BT 2MPAH 4G80B 5BJTA 4DP6X 5F7DA 3US1A 1ZHLA 3SGJC 3DGGA 2WTOA 4LLVA 3TN0D 1EJOH 4EIZC 2X0UA 3UO1H 3WE1A 3GZKA 1OLLA 5ILTL 1WUNT 4RWYL 5HDQL 3IDXL 1GGTA 1INQA 4WF7A 1F8TH 2IO5A 3GQFA 1DP0A 3PCYA 1DQMH 2X7LA 5F2FA 4DP8X 3V5HB 4JFXA 2EDYA 1U33A 5EBWA 3L5IA 3NIDE 4PJXA 5D1QD 4DVRL 4K94H 3OMIB 3PQYD 2BOBA 3U4EB 4Y4FD 2YRLA 1FL6B 5C0EA 3MRNB 1NDGA 4XZUB 3QP3A 5SWQB 3MRIA 5EHFA 3ZN6A 1I8LC 2LFEA 4QRUB 3VSUA 1Q72L 4NQCB 3K6SB 1DBBH 3QQDA 2CR6A 3TO4A 4WSGA 3TM6A 5EFIA 4NUMA 2VN7A 4G1MA 4XX1G 4M5ZL 4UQDA 4N26A 5GS0H 1BQLL 5E56A 1INDL 2W8CA 3NT0A 3WKQA 4WNJA 3M1OA 4WTZG 4HDIA 5HHNB 3FFCE 4U6XB 3QNYB 1T20A 2OMZA 3S35X 2R0ZH 3QDJE 2ICES 2W9EL 4C58B 3BUTA 2J43A 4JL2A 4E9LA 2EKSB 1T2JA 2FX7H 3QQNA 3WDIA 4A2MA 2AQ1A 3CDZA 4YVUA 4I9WE 5FM5M 1D5MA 4PWHA 2APTA 1NDMA 4I3RL 4IS6B 4LAJH 5CWSA 1IV8A 3PV7A 2A6KB 2E86A 2E4FA 2E76C 5E6YA 2Y69B 1KN2H 1ZE3C 3K71A 4TQIA 2NRDA 2LAGB 1ZSHA 2V5YA 1PIFA 2VZTA 3J2PA 1GC1C 4PG9A 1AGDA 3VRLF 3IN2A 5M94B 2YA1A 1QUNA 5HD8C 1NGQH 2HRHA 5C70A 1G6VK 4JM4H 3D0VB 1AHMA 5DEGA 4J6IA 5TFSH 1S46A 3K6NA 3BZEB 3KPLB 3T0EB 2F1BA 2ZUSA 5DSCA 4LSSL 2C3HA 5F96H 3WLWC 1WFTA 4W4OC 2SEBA 4KMLB 5AUMB 3NN8B 3T2NL 1T04B 3SPGA 3AAZA 1U8KA 3N91A 4X7EC 1KJVB 3BO8B 3FSWA 1P1ZA 1GCYA 3T2LA 4DP0X 3ZX1A 2X38A 43C9B 5EU6D 3SE9H 1K8DA 3LX9A 2VXSL 3IDNB 5DHXB 1ACYH 1UD3A 2DQEH 3FCUB 4HPYL 4PSPA 5IEKA 1WVZA 3EGXA 3HBZA 4JM0A 4PJFE 4DKTA 4HCFA 1FHNA 4PBVC 1YG9A 1MIEH 5H4ZA 1UB6B 1JTTA 4TTDD 5FGBC 5IFHH 4Z7NE 5CFAA 1U0QA 2DI7A 1MJ7H 2NSMA 3M17B 4OVUA 4NWTL 1JTPA 5CGYD 5IFJB 2ZKWA 2QR0B 2WM0A 4WO4B 5FX3A 4XNBA 1G7MB 5F0PB 2VLJA 1G7IB 1UG9A 4N2HA 1CLCA 3ERXA 2IWGA 2QZ5A 4O2FB 5DHDA 3EUDA 4AY0A 5J13C 1T6WA 2PXYC 2JKNA 4CA4A 3WY3A 4FKEA 5DDHA 4BUQA 1HU8A 4LARH 2ZOTA 3VD3A 1FZOA 5DJ2B 3F6IA 2W0FA 1JV5B 2VB5A 5KVDE 4HKZA 3MLPA 1CG9B 1C5DB 1WA2X 1YEHH 4LP5A 1MJJB 1TUPA 3QFJB 1QTYT 3U7WH 1VZIA 2DQTH 2R83A 3DETD 1H6TA 3GMNA 4EOWH 2IWKA 2HLEB 4DGUA 2ARJQ 3L9YA 4NC0B 2BCMA 3PG2A 5B8CB 3KPQA 5K33A 4XOAA 4IBVA 3LB6D 3DX1A 2ZG2A 3PP4H 4K0OA 4WJ5A 1WBZB 1D2OA 1A47A 1UM4H 3V52L 1OHQA 3T4YA 3UAJD 2C5DC 4XXCA 1SJEB 3RUGA 4YDIL 4Z7UF 4ELDA 3B43A 2Q9OA 4PRHE 5T3XH 2BVYA 1NFDE 4XCEB 3KYMB 1OAQL 3F62A 5AZ2L 4AVKA 5HHQA 3QPKA 5G4NA 2DWTA 1R3JA 4LL4A 5TE7H 1V55B 2YD2A 3SE3C 3B3IB 2PO6A 4S1RH 4XO4A 1RVFL 3HG4A 5DGRA 1JGUH 2CLVA 1LEKA 3BZDA 1FIGH 1ECYA 2ZCZA 5CR8A 3MLSH 3RGVD 2OL3H 3MRBA 2OMUB 2FIKB 3WIHL 5I8OL 1NPUA 1M05B 1RZKL 4PH8A 5AW5B 1EMTL 1Y1DA 5I1AA 2VERN 2VDNB 4HUNB 2RIKA 4PJDA 4ENEC 3V4PH 4PJHF 4Y16D 1ILSA 2J73A 3P0YH 4NQEA 1AO7E 4QOKB 1EGJH 5B3JF 5I0WA 3MLUL 1OARH 5ACMA 3VXRB 3VVVA 3ZGHA 3KPMA 1QPKA 3VFGH 2OW7A 4QHUB 2H1XA 2EXYC 1JPTH 3OAZH 3WXWH 4WIQA 4CKQA 4P5TD 4Z7VA 1BSIA 2EDRA 1JD9A 3N43B 4N8VG 1D7DA 2QKIB 2V3DA 5FXCH 5MERA 1QSFA 2CBMA 5C0CD 1BV8A 5CEZD 4NZRL 1NCBH 1C8PA 5TE4L 3D05A 1ACZA 1RZPA 2KPWA 1Z5HA 1DBKL 3L3HB 3PGCA 1RURL 2WOYA 2IXQA 1CGSL 3L4WA 3O2DH 2HUHA 4EBQH 1AHWA 1FGVL 2P5WE 3L3DA 4LDLB 4DTGL 3EXLA 3S5LG 1IGMH 1NH6A 1P2CB 3WAJA 3BEWA 3ARZA 3P69A 4FLRA 5IK3A 3OX8A 1T1XA 1G87A 2B15A 1X6NA 3RWCB 5GQBA 4GRMA 3X14B 4EDWL 5DHYB 1UM6L 5E95B 4L0YA 2XI9A 4E41E 2JWYA 4GEIA 3MUZ1 1SOKA 1ADWA 2VDLB 1JHKL 3GNMH 2R1XA 2YPVA 1P4IH 4CMMA 4TM9A 1DBJL 5D5MB 3FTVA 4XNXL 1PKQB 4GAJL 2IQ9H 3FK3A 4NZFA 2Y7NA 4YLBA 5IOPB 5KUKA 2VLKB 3GSWA 4PBWD 4JUSA 3OWRA 3F85A 4HETA 2F54A 1T5WA 2XACC 4GS7B 4J4PC 1NINA 1H8LA 1YEGH 3EHBD 3QNFA 1HZHH 1D5IL 4LDEB 3B2UC 1P7KA 2VXTH 4GW1B 5B7FA 2ILLA 3N43F 4OU3A 4EI5D 3LH2L 5KYWB 5JZ7C 4MZ3A 3S2CA 1I1AA 5EH1A 4BFOA 4WHDA 1A1MA 3RZCA 4NUGH 5MEOB 1OF0A 3BUDA 1QP1A 1JGIA 3MLTB 3ZDXE 5FB8B 1QFWH 1TEGA 3LD8C 4X8GA 1RMFL 3RWIA 4OAWA 1KIQB 3TPUA 1N0XL 4GT7A 2CBPA 2GC7C 2WANA 3AU1A 4I4WB 4X9IA 5GGUB 2VSDA 4ZMZA 2MPAL 4CN1A 1LYQA 4ZT1A 4ZMYA 3NSFA 2LU4A 5IB2B 3MGAA 5H35A 4AQ1A 1JDDA 3UZQB 4MD4B 4IGBA 2UUDH 3II3A 4GW5B 1RZ7H 2ZXEB 3N85H 2H9GB 3BOVA 3Q06A 1BWMA 1DQML 2DM4A 2R23A 3DTDA 3BH8A 3KCWA 4LIQL 3PHOA 4HIPA 3DX4A 4PW4A 3WBDA 4YSPA 1MFCH 4HC1H 2X4OB 4V1DE 5A3ID 5FO8B 5D9SB 4WENB 4DPRA 1RLWA 2XETA 1MCWM 4UM9B 1U8HA 4WRLA 1YY8B 2ID5A 2ADIA 4D9QE 1FFPB 4C47A 3B6SA 1PS3A 2N7SA 4Z18A 3GS4A 3AGVA 4PGCA 5CCGE 1KGXA 3IMBA 4OF0A 3CXDH 3OZKA 3VFPB 5EIIA 2ADYA 5BQDA 4C4KO 2N01B 5DEFB 4H25A 4Z0BH 2YSSB 3INUH 3BVXA 4FQCH 3CSFA 1W0WA 5I6OA 3CPLB 3MRHB 5FUZL 3TT1L 1FNAA 4XRCA 5GRJL 1KLUA 3M88A 1KNOA 1NLBH 4PBDA 2R0ZL 3FFCD 4JW3A 5KYNA 4ECNA 2GITB 4OSUL 5HJBA 1F13A 1JNNH 3QDJD 3UIZA 4N0CD 2XXMB 2PWDA 1I1FB 4G5ZL 4C56B 4WDIB 1XHHA 2X9ZA 1JZFA 4OGXH 2P80D 5LVEA 4G8GB 4IYKA 4OZGE 1MWAB 3UG4A 3F83A 1KN2L 2CU9A 3B2XA 3FBQA 1VJSA 4Y0GA 3IDIB 1C5CL 3GXMA 5E0QA 3SJVA 5FYJE 5DJYB 3RFZC 3OB8A 2XPGB 4ORGB 3U4EA 1NGQL 2MJWA 4G6KH 5HDLA 4JM4L 5IP4A 2NCMA 4Q6YA 1RI8A 5IJCC 1QEWB 3CFIC 3ROLA 4XZUA 2C3GA 2R51A 2I27N 1ZANL 2NYZA 2R2HB 3D51A 5DWPA 5F96L 5SWQA 2GBAA 1HYSD 2ENJA 5AWNL 4LOUC 4QRUA 5CMAB 4KZCA 2VJXA 3T71A 1J9TA 2YLHA 4L3EE 4NQCA 4F2ME 3MBXH 4IRJC 1SFHA 4KTGA 2CLRB 1U93B 3M6DA 3ARUA 3QXUA 1RIVL 1MCKA 4GRWE 3DRTB 3M1BA 1G7JB 4LSTH 5HHNA 1MHCB 5EEYA 4X6DB 1MELA 1KXVA 3ARSA 4BWWA 3QNYA 4PCSA 4P9HH 3OSKA 2Z0BA 1ACYL 1Z0NA 4X5RA 4U4IA 1G9MC 1KJ2B 2QLVB 2EKSA 1YNKL 4X4ME 5EEWA 12E8H 1AGFB 3S35H 4Z7AA 5HHVH 4IS6A 3TN0B 1MIEL 3KCPB 1DO5A 5IGXH 2F68X 3WY1A 5IFHL 2C9XA 1EA9C 2FUQA 5E6ZA 1ICTA 4U7MA 1MJ7L 4XPGL 5JQHC 1AD0B 1KBWA 5FKPA 4LIQE 1GVIA 5T1JA 2AQQA 2XTLA 4X6CA 4WO0A 3W11D 3NPSB 2PF6A 5D1QB 2NY4C 4LPCA 3PQYB 3SB3A 2VMFA 4Y4FB 1SF3A 4NNPH 4M5SA 4JHAH 2VZUA 3BZEA 3KPLA 4P2CG 3MO1B 4XPHH 5DEZA 2YD3A 1XAUA 1DSYA 1MWAH 4LARL 3NN8A 1H0DB 4XPTH 2ZWYA 3LAFA 1QKZH 5KBPA 3ENEA 1OE1A 3BO8A 4YL9A 5D1XE 2CDFB 1YEHL 3ETBJ 5DZ9A 4YQXL 3QUML 4JE4B 1W0VB 5A2CA 3DYPA 4KKNA 3IDNA 1Z3GH 3S3DB 2C4XA 4X6DF 4MMXB 4UAHA 4JKWA 3ZT7A 3ROOB 3TF4A 5C07A 4RMBA 5JUEH 3P9MB 2DYRB 3PP4L 1QTSA 4N6RB 1YA5A 3RIAF 2H0PA 2EUXA 3RAJH 2OL3A 5IMOB 2DEYX 5JYMA 1CF1A 1UB6A 3S36L 3CFDA 4WLCA 5T3XL 2B8OT 5FM8A 2AXJA 4PRHD 3M17A 2WGNB 2WLZA 1CLOL 5TE7L 4YFEA 2QR0A 4P5MB 4DKFL 1E2VA 1NSNL 4KZEH 5I1JH 2F0CA 1G7MA 1S7WA 5C0GB 1G7IA 4FFVC 3TNNB 3PHSA 1ZV5A 4O2FA 5INCB 3L1OL 4FYTA 5DFVD 1EGJA 1JGUL 2VDPH 3MCKB 1L0PA 5EUOB 4N2BA 1KDIA 1FIGL 4ETQA 1IAMA 2XY2A 5JO5B 4B96A 5BXFA 1Q1PA 1N8ZB 3TONA 3RWFA 3H9SE 4QIRA 3L4TA 1G0XA 4XX1E 3D2UD 1U3HC 2CBTA 4FXKB 1CG9A 3NJNA 1C5DA 4F7KA 5I15L 1CGXA 1MJJA 4UZSA 3TEYA 1PJ9A 3QFJA 3H42H 4WGVB 4URKA 3V4PL 4KJYB 3QJXA 2D4DA 4PLJD 4YDZA 3TBVB 4Y8AA 3VI4A 3KW8A 5BV7H 2OYLA 3GI8H 5B8CA 1AO7D 4XB8A 2E7HA 3O2DA 1IKFL 3OKDA 1WWBX 2BY3A 3MBWB 1WBZA 4S1DC 4O02L 1NMBL 5KSAC 4B9FA 1SJEA 1PZSA 3CFTA 4Y2DD 1MW3A 5CNHA 3KYMA 4BV1A 1A9VA 4BQCA 3VI3F 2VLRA 2BIOA 3NTCL 1R5VB 1NCBL 4HKJB 4P07A 2VUOA 5CZXC 4OLUH 5CJOH 2B59A 3GKWL 4WWKC 4YGVB 3LMJH 3AFLA 3HS8A 4KFMA 5DC4B 2FD6H 4GFTB 1IGML 5EUOF 1ZS8B 2P5WD 3BPOC 1I7RA 4RQQA 3WFCL 2OMVA 1RJLB 3DROB 4U1GC 1M05A 2ICWJ 2VR4A 1FC1A 1W15A 3HN8A 1WIPA 3DLQR 3LIZH 2WQVA 4M02A 2YRBA 3E3QE 1PZBA 3WTSA 1HESA 3P2DA 2FAUA 3B9KC 5B39A 4WGKA 3GNML 4E41D 1AZZC 4I1RA 4QOKA 1WV7T 2WXQA 4X6FB 1WPCA 2KZBA 5E1AB 3IRZA 3SKMB 5IW1B 4I0PD 1GOHA 3FQRB 4G7YH 3JTTA 1MRDH 1M4KA 4I13B 3WE6B 2BIPA 3GBLA 3PWVA 5FF6B 2JJTA 3BEVB 4G42B 4UQIM 3VXOB 4B9ZA 3EO1B 3KW7A 1RLBA 2R27A 4RX4A 4CNIB 1IM3D 2HJKB 3L3HA 4ZDHB 3WDJA 2VC2B 4ERSH 5CLWA 4YXHH 1MCJA 4WW1A 1QFWL 5I76B 5EIVA 1YEKH 1P2CA 4YSDA 3JWNC 4KQ3H 5I30L 3U7YH 1DFBL 3RGVB 4AMKL 5DD1H 3IAPA 4CMHC 4ZFGL 4H1LH 3RWCA 3U83A 4HC1A 3JSSA 1YEDB 4AUYA 4F33B 3CFUA 5I2IB 3ULUC 2PETA 5CZVH 5DHYA 1UZ6F 2CHXA 3QHFH 3DKHA 4FZ8H 3EOAB 5I5JA 2IDFA 4HP5A 4BCXA 1JZJA 3UC0L 4Y16B 1FNHA 2FZ3B 5D5MA 4ZMVA 3MCYA 5DUBB 3HNSH 4MZ2A 5IOPA 2DMHA 3NJIA 5AW3B 2VW4A 2F7OA 4HJTA 1AOHA 1NA8A 2JJSC 4Q56A 5HI5C 2EH8L 2X4RB 1WHPA 1RZ8B 1E65A 1KB3A 4LL1A 4DUWA 1OSZB 1VB9A 3ZTDC 4NNYB 5D7HA 3PFQA 4V1DD 4P5TB 1A65A 4HUKB 4GW1A 1A3RH 5KYWA 2BZCA 5C0CB 3HMWH 4WHTB 4D9QD 4PRDB 2NXYD 5ABZA 4OUUB 2G3NA 4NQSB 1WZLA 3IEAA 3CXDL 3QUKB 4LSQL 5MEOA 4Y5XC 3KYNB 4KVNL 1J87A 5FB8A 4Z0BL 1IGCL 4CU6A 4M7LH 1B6UA 1EK3A 4N25A 1KIQA 2D4FA 4XMVA 5DJCB 1VSCA 3VGBA 3WSQH 4PWFA 4I4WA 5GGUA 2X53A 3KVQA 1NLBL 2QVFB 2AVFA 3R0MA 4BSJA 4WUKL 5IB2A 3ZL4H 1JNNL 5EC1B 5DD6B 1RZFH 1YEFH 5I9QC 3SQBA 3UZQA 2EEDA 1MHPH 2G3XA 4MD4A 2FSEB 1NWPA 3OQRA 4FF9A 1BMWA 1O5PA 4GW5A 5J8OA 1PCXA 3S5YA 3QIUA 4NN7B 2BHZA 1ODUA 2H9GA 3RJQB 1XL4A 2D0GA 1AQKH 3EH5B 4OIIL 4MJ6B 4PJ7E 1MKFA 1W0YT 1M3JA 4IBLT 2Q6WB 4LLWA 2VIRB 1X5GA 3IM1A 2X4OA 5FO8A 5D9SA 1AACA 5FYJD 5DK3A 4G6KL 3EHBB 1KPRB 3QRGH 4HX1B 2BW5A 1YY8A 3U1QA 2F1EA 4AI7A 5AKSA 1X6LA 4EI5B 1FZKB 2OA9A 3DX6B 4GB9A 5K59F 2LTQC 3VFPA 4DFIA 4RFNB 3MBXL 5DEFA 2EDXA 4TLSA 4L3ED 5FFLA 4LO9A 5DD5H 1BZ7B 2GJPA 4ZD3L 3K4DA 4Z3TA 3H1ZA 3CPLA 1JK9B 4KKPA 3DV4B 1GY1A 4NLHA 3SDXB 2Y5TA 2QQLL 4TSBH 2H32H 4YE4H 2WN3A 2AITA 2GITA 3N5AA 3V6OE 1FFOB 2XBZA 5CEZH 2ESVE 3LPFA 2JNZA 2R1YB 5JHLA 4C56A 2J5WA 1UENA 4DHLA 2W65B 5IGXL 4G8GA 2GJZB 3WJLA 1MWAA 2NUTB 4LPUA 5IROD 3TX4A 5JPMC 3H6JA 3IDIA 5FV2A 4PN6A 3PWJB 4OLXH 5DJYA 2O5YL 4HK0A 2OMTB 3AM8C 2Y07H 2EDKA 3BSZA 2XPGA 1EBPA 4IDJH 1G7PB 3SBWA 5C0FB 1TTBA 4CBPA 3NIDB 3ZUCA 1QEWA 3ELQA 1BM3L 4PYGA 2QGEA 4XPHL 4G43B 2R2HA 4I7ZC 2I25N 3NA9H 2B4CH 4OF5A 2VN5A 4MA8H 2YAEA 5ANMB 1G9HA 1XGUA 4ZZFA 2WXLA 3V0GA 2A9NH 2YAFA 5LCVH 2ZCHL 4NUJB 4IQHA 5D1XD 2WJ7A 4FABH 1G7JA 3CSBA 4HKBB 2WYZA 4IOSA 1S7TB 4ZMWA 3V4VH 3NK4A 1JGEB 3SDXF 4IHBA 1MFDH 1EJFA 3FFCB 5E4OA 4CC4A 5CGMA 1I3RB 4R6UA 3BT2H 4LSVL 5DCCA 5JUEL 3QDJB 4Y4KD 1TJHH 4WU5A 5D72H 5DVKA 5CBAB 3S8GB 3BP6B 1QUPA 3WDHA 3KBPA 1BWWA 2YBRB 3KCPA 2O6CA 1IB5A 1J0HA 3OJDB 5C09E 1YC8A 2JXMB 4QEGA 1AR2A 4JCWA 5BRQA 5I1JL 2QQNH 3N6YA 3DO7A 5D1QA 3MRPA 1UZ8B 1A7RH 4Y4FA 3BDYL 2WMPB 1JRHI 1YQVH 2A77H 2VDPL 5CN3A 3IGUA 3GRGA 1H5BB 2V5TA 3BH4A 1U8JB 4X5PA 2QVMA 4FFZH 5LAPA 2LQRA 1H0DA 3NCXA 2IDUA 1BF5A 1GYUA 2XTJE 1W6LA 3KD4A 4QHKI 2ZOUA 2CDFA 2X44D 3H9SD 2B7DT 3J8F7 3F6LA 2EDOA 3NMEA 1CF8L 3RY5A 2G5BB 4N2KA 3FQWB 4ZAKC 1W0VA 3CFBA 4LCIL 3L3JB 4FLSA 1UEMA 4K71B 4MMXA 3PL6A 5L4FA 4CGUB 2Z31D 5BV7L 3OZ9H 4UT9H 3WKPA 5F9JB 1T0MB 3O41B 4F8LA 3P9MA 4PJEE 2J12B 4N6RA 1RJYB 4PJFB 3CZLA 5IMOA 2ZUVA 1OEZW 4FXGC 3DTXA 4KX7A 4O51A 2Y2WA 5J3HC 3VGEA 1TF4A 2F5BH 5C0ND 1HL8A 3MYJB 1MFAH 3LIZA 4B9PA 4Z7NB 5BW7A 1OGTB 3B2MA 5F7EH 4AGNA 5C0GA 1RUPH 1VFAA 2OTWA 3TNNA 1LILA 1UGNA 4KI1A 4X80H 3V6ZB 2ZUTA 5INCA 1KTLB 4JFYB 1CYXA 2FD6L 3LKPB 5EU5B 3TA3D 3A67H 1WZ1L 2YQ2A 1EO8H 1NDTA 2BRRH 1LXMA 4RIRB 5JO5A 2A99A 1FH5H 5INDB 4I48A 1DZ0A 1E50A 1N8ZA 2X4TA 3Q2CA 1H3WM 4FXKA 4XXDB 3WJJA 3QWOB 4FULA 1ES0B 4LPXA 5JIDA 4KJYA 3OKLA 2WWKT 1K3ZA 3BIBX 3P4OB 5DA4A 3LPWA 3TBWB 1AZBA 1BZ9B 1ID2A 3TBVA 4X6BB 4GUOA 2WSDA 2WYIA 2O5XH 2OMXB 4MA1C 2H2SC 3O45B 4R5TA 1WJ3A 3WY2A 3MBWA 4IRSD 3WEAA 1QMUA 4HLEA 4PJFF 3VSVA 4OFDA 4X7SH 3ZSSA 4H1LA 4LEEA 4YHLL 2XBDA 4DO6A 2OMYB 1R5VA 2KKQA 4NQVA 4IM8A 4PRHB 3S5ZA 3T0XA 1NFDB 4GIPD 4ZTOL 3L2LA 1NCWL 4X7TB 4JG9A 4YGVA 5D7KE 4ERSL 5DZVA 3V55A 3UTOA 3EJCA 2B1AL 3Q5OA 3HAEG 1YEKL 2OCCB 4LRIC 4DQOL 2FLMA 1DJHA 1ZS8A 4F80A 4UUJB 5DT1H 3DX2A 3DROA 1RJLA 5DD1L 3PP3H 4F92B 3RDTA 3JWDH 5D7JD 4PS7A 3D2UB 3ULSB 1N8OE 2H8PB 3QWNA 4DP1X 4FZ8L 3AQXA 4LSRH 2VITB 4NIKB 3Q9PA 4HG4J 1DUZA 4PUBH 1JNHB 4RAVB 1TSHA 1S9XA 1HYRC 5FA3B 3Q05A 3CCHA 2A0LD 1AD9A 3HNSL 4B9KC 1AO7B 3HHSB 1TNNA 1F90H 1N0LB 1EBAA 3ZOAA 3L9RB 4UTBH 3FQRA 4IIQB 3CSYA 4N2LA 1DJIA 4ZS6C 3ARDC 1IQWL 5C8JB 2ZX5A 1CFMA 4OT1L 5FF6A 1SLVA 2IPKB 4Y2DB 4BH8B 5IMMB 1JZEA 3NA4A 4G42A 1F3DJ 4LVOC 1A3RL 3TBTB 5JIIA 2YAMA 2EKJA 2ZNXA 1IBBA 3WG7B 5IW3A 3HMWL 4YHKH 4HUXB 2HJKA 1FYTE 3L4ZA 3MFFB 1QG3A 3DTUB 3BRDA 3HG5A 2XWJA 1NFDF 3EAKA 4P4KC 5D2NC 3VXPA 4YHNB 3I9PA 4FNLH 3EYFB 3P4NB 4LMQI 4HBCH 2IWFA 3FCBA 4M7LL 1J8SA 5DUMH 1MAJA 3A24A 3QPQD 5AYUH 2P5WB 2YAHA 4HF5H 4GW4B 4HUUB 4F33A 3EXJA 2GIYA 4KKCC 3GUFA 3QR2A 4OJDH 5I2IA 5AFAA 4EIBA 4XN7A 1EFXA 4OFIA 2NX5E 3NJGA 4KU1A 4GBXC 2GHZA 3C60C 2Y3NA 5K1JA 4NI6A 1Z0MA 5E6RB 4JFSA 3FT0A 1QBLL 1WIUA 5FYKH 4E41B 2FZ3A 4BQ8A 3VTAA 2IPUK 3AGWA 2H6PB 5E5MA 1QHPA 1O6TA 4HMEA 2X4RA 1FCCA 1RZ8A 5B1JA 4I0PB 1OSZA 1ZXQA 1FDLH 3KDPB 1MCPL 3ZHFA 4NNYA 4YWGL 3HZVB 1PLBA 1TZ8A 4P5TA 2JTYA 3UDWC 3QRGL 4LQFH 2H32A 2IDSA 2AV1B 3NIFE 3CMOL 4HS6B 4WUUA 5LN4A 5I5IA 1O7DE 2E9IA 4KO5A 4WHTA 4PRDA 1U8OB 2A73B 3BQVA 1IM3B 1R75A 2YD6A 3QUKA 2BDNH 2HVBA 1XAKA 5GZNC 1JZ4A 5DZLA 3KYNA 5DVMA 3WCYA 3TEWA 1ODAA 3BE1L 4U31A 1KFAH 5DJCA 1FE8H 3VGDA 4M03A 1VESA 3ZDXB 4ONGH 1DJXA 1OTTC 4E0RA 7FABH 4B95C 4TSBL 4YE4L 5G5DB 1WBYB 3ZKMD 2VLLA 3BD3A 4HSCX 5DD6A 5EC1A 4M1GL 3GBNL 3ZTNH 3O4OC 1CDJA 4AJYV 1NM9A 2ESVD 2FSEA 1S9KC 3ARFD 3RI5K 1JERA 3D2TA 2LHAA 5LGKA 1OAKL 1TOXA 4DP7X 1U6AH 3V0WL 4UQ2B 4MJ6A 4CC1A 2V33A 1IBHA 3T4AC 1I3GH 1ORQB 4NRYA 2C3XA 3LHPL 5LCVA 2Q6WA 2VIRA 3S98A 3VXNB 3FFDB 4HH9A 2EDQA 1M2VA 5EZOL 4Y5VB 4IDJL 1AOZA 1FWXA 1RV6X 1TZGL 3V4VA 4L8BB 4UOZA 5B3SB 4U1SB 2VXQL 4EI5A 3NA9L 3SGDI 1BW8A 4OQ1A 1YUHB 2QQKL 5EORH 3CDGA 2EE9A 4RGNE 5I74B 2B1HL 2NXYB 4QTHB 3NCWA 3IDMB 1D6EB 1K4CA 1DL7L 5DMKB 4OCSH 4A2LA 2EABA 4WEBH 4XP1H 3L4CA 3OB0K 2A83B 1BIIB 3SDXA 3ZDXF 2DTML 2QDWA 4QRRE 4WGWB 4AUJA 1CL7L 1O5DT 1KEGL 2DQFB 4FMKA 1FFOA 5AZUA 3KL3A 4UMGA 2F74A 3BT2L 4B60A 3BESR 1QAWA 4K9EL 1TMQA 1TJHL 3EJQA 1C7TA 1FLRL 5KSBE 2K78A 1L9QA 5DWUH 2GJJA 3GMRB 3ISRA 2NUTA 4KKQA 3SKJH 1L7IL 1EEYB 1DO6A 1MN4A 3NABH 2O93L 4MS6A 1UGKA 1GJWA 5C09D 4D7PA 5KYYA 3PWJA 4OZGB 3VH8B 4LHUG 2OMTA 2VDRH 1BYOA 4M8VA 2IADB 3UADA 4Y2LA 4PV1C 2FIRT 1G7PA 1S78C 2A6IB 2NNCA 4P3DA 5C0FA 4E42B 1A8JH 3NZ8A 5CD3B 1ZLUK 4ZTEA 1NPJA 5T5FA 4EQ2A 2A77L 3PJSB 3L3GB 2HG0A 3L1GA 4G43A 4UT9A 3VQMA 4CADB 2D8KA 2IALB 1A1NA 3P30L 5GGVH 5IBUG 4HU8A 3LN5B 4FFZL 4B7IA 3KYOA 2NR6C 1TYJA 1CU4L 4KY2A 5ANMA 3O3DB 4EKXA 1N6QH 1E90A 1AG0A 1ACCA 4PW9A 4J3OG 25C8H 2JVUA 3L4VA 4L3EB 4NUJA 4F2MB 2DJSA 2QLYA 5SX5H 2OYPA 5ACZA 4HKBA 1S7TA 1A7PL 1TFPA 4L4TA 4LDOB 2GPZA 4GRWB 4YIQA 1INEL 4K15A 3OZ9L 4XNYL 4NWUH 1I3RA 3L8QA 3BW9A 3PUUA 5TE6H 4JKPH 5CBAA 1LO4H 1MCOH 3PAZA 4H20H 3BP6A 4NBXB 4LLYA 5K93A 2HRPL 5E6UB 2CBOA 4P46D 2P80A 3OJDA 4Q0XH 3D18A 3V0IA 2AQTA 3QR1A 1T3FB 4CSTA 2BOLA 5F7EL 4OZGF 3U9PL 3BT0A 4AW4A 4R26L 2NY0C 1UZ8A 2K45A 3OLEA 3B2VL 2OR9H 3BPNB 1S3RA 4WI2A 2FT7A 2FJUB 1D5RA 3A67L 1U8JA 1EO8L 2BRRL 1X5MA 1FH5L 2QHLA 5IFAH 2EC9U 2X2YA 3S34L 4J3OH 4TVUA 2V7NB 1QYGH 3IE9A 1J8HE 3TNMB 4P2RA 4XCNB 2WNKA 1UXWB 3FRPB 1DQQB 1KGCE 1Q90A 1QBAA 4PB9H 2KMWA 4PMFA 1R3IH 5CKAA 3BCDA 1BBJA 2EO7A 1ZGLM 5D1XB 3QC5X 2EVIA 2VNCA 1WK0A 2UWEF 3VWKC 4BE6A 2O5XL 4P49A 1T0MA 4IKJA 4N2OA 1OW0A 5EOQH 1KTRL 1E9QB 1RJYA 4Y4KB 1R5IB 4UIKL 3WTUA 2TRHA 3ZPDA 4M6AA 3KHQA 1NAML 4R5VA 3CDCA 5KOVC 4J1UB 1I82A 4RLDA 3LKOB 4NENB 1ZCRA 3TCLA 2DLGA 1YYLH 3WLWD 4K7PY 1HZLA 5I6XC 4MMYA 3MYJA 1F6LL 3VYOA 1OGTA 4GRWH 4X4YA 4IMKC 3V6ZA 2ZXQA 1A6UH 1SY6H 2HPTA 2HJFB 4WFGE 1KTLA 1Z32X 5J12B 1WEJH 3LKPA 3PF2A 5EU5A 5D7KD 3ARBD 3SO3C 3U6XS 1TTGA 2F7PA 4RIRA 1UASA 1CVSC 4KK8C 5JIPA 4ELME 1NCCL 1ZVSB 4XXDA 5F7MC 3JT2A 2EDEA 3QWOA 3HR6A 1XGQB 4U1JA 3H9SB 2IBBA 1ES0A 2MNUA 5D7LA 2RCSH 2CG9X 3ZU8A 4AIOA 2GBUA 5KBLA 3P4OA 3TBWA 4PUBL 1OP3K 2AHIA 3ARGA 4X6BA 1ZOXA 4YHMH 4ZFQA 3HE7D 4HJUA 1PFOA 3C8DA 2Z31B 3ME0B 3PV6B 3FN9A 4CC0A 5K5YA 5DA0B 4J39A 1F90L 1KZQA 1YECL 4UTBL 4UOW1 2VO5A 3BDBA 2WXRA 2MQCA 3MLRH 4MNGE 3ZQWA 3F7YA 1LE5A 2IV9A 2FQFA 2L8AA 5GGTL 5HP5A 4H2CA 3SPHA 4Q9BA 4IRZA 4JFQB 4FDWA 4Z78B 4DZBB 3E9TA 4GQPH 1QZNA 1FYTD 4FNLL 4AYID 3UBGA 3EJZC 5DYOB 5EO1A 2PW1B 1RHHA 3TA3B 3ABMB 4HUCA 4UUJA 3AACA 3MLZL 5AYUL 4ISVB 3MV11 3CVHH 2WSKA 5C7ZA 2Y72A 3RU8L 3C6EA 4JDEA 3ULSA 4BCZA 5IB4A 8CGTA 1JCKA 2HH0L 3LH8A 1XGTA 2VITA 4YR6B 2NX5D 4FERA 1LP9E 4KNSA 5L2JB 1JNHA 5J11C 1GA2A 5FA3A 4DW2H 3QUMB 3ATBA 4R2GC 5FDWB 3RVXD 4WK0B 2ADJB 5KBDA 1FG2B 3QUXC 4ANVA 4RGMC 1SLXA 1AO7A 1KFGA 3HHSA 4KJPD 1V10A 1N0LA 4N0UB 1GCFA 2R0KH 3L9RA 3N50A 3BWSA 2VTFA 2M26A 2HTLD 4IRSB 1FDLL 3RIKA 4AGPA 5C8JA 5JR1H 2APVA 2D2OA 4E9QA 4Y2DA 4BH8A 5IMMA 2ZP8A 3WNIA 1HCFX 3TBTA 1BPVA 3FQTB 3PABB 1GHFH 4G8IB 2ZJSL 3VYNA 4OIBA 1A1OB 4R0LB 1IVLA 4QLWA 4ZFZB 1UKQA 3WO3B 2NNAA 4N28A 4ENED 5HYSG 1NC4D 4ONGL 4KNTA 2ZICA 4GW4A 1XF4B 2XWRA 4GQZA 5EMYA 4HUUA 1KBGH 3FKUS 3T8VA 35C8L 1UHVA 4ZG1A 5KS9A 5D7JB 1D5ZB 4X4XB 3ZTNL 4CVZB 2EXYD 1WDAA 1E2WA 3N1FC 1W8EA 3QE5A 3T3MB 4JY5H 4AYEC 5D2LE 4YDLC 1WA0X 2I7OA 2J1KA 2GFBA 4JFOB 4AIZB 2YMXL 1RUAH 1U6AL 1ETZB 2JCCE 1AI1H 1LD9B 2H6PA 1L0XA 3GJFB 3MVSA 2FX9H 5AB1A 1FL3A 2NY2C 1I3GL 4OKVB 4G7QB 2H47C 1SN2A 5I19L 1X5JA 4OGYH 3HZVA 1JI2A 2HFGH 4K3DH 1PMYA 1F4HA 4D0BB 3GHBL 1E4KA 4HS6A 3UAAA 2QV4A 1JK8A 4A55A 4BRJA 4Q6KA 5EPMB 5EORL 5DJ6B 1U8OA 2A73A 4JHWL 4DKEH 5EULV 1QI3A 2WZ6A 2XIBA 4JRWA 1AR1C 1XCXA 2L7EA 4RGND 3G6JA 2N1TE 2NPLX 3QJOA 1GTNA 2OJZL 1JV2B 3IJHB 3O8XD 3STLB 2IAMC 3GD1C 1E4XH 5GSVB 2AZAA 4XODA 5FK9B 1WBYA 2OXHB 3HRZB 2MQ3A 3H3KA 3QULB 4G6AC 4IU2A 4QRRD 4ZSOE 4HOZA 4B5EA 1SHSA 2ROXA 1S8DB 4HD9A 4J4PD 4WSJA 3JBG7 3QJHA 4PEEA 2X4NB 2EDWA 4BFEA 5TF1H 2XPYA 2MTAA 2Z1KA 3FH7A 3TESA 5SV4A 4JZOB 1M56B 4KNUA 3LS4L 1F4YH 1O6VA 5IB5B 2GW5A 1EANA 3TTYA 3NABL 5JZ7D 1L9SA 3L17A 2VLMD 1ORQA 2FLBT 2WSPA 4N4YB 4WEEA 5D70H 1QHQA 1KJMB 2VDRL 3L5WB 5PCYA 3VXNA 3FFDA 1FF5A 2CJUL 4UQ9A 4Y1TA 3X1GA 3MUGA 1S5IL 3HN3A 2YUZA 3R06B 5C2BL 5IWLC 5EN3A 2YD7A 4ZMXA 1BLNB 3IKCB 4Q9RL 2SODB 1WF5A 2Z93A 5GGVL 1NJ9A 4W9CC 3LN4B 4QTHA 2DS4A 3V4UH 1N6QL 4BFKA 3WHE1 3ESNA 5DMKA 2F58L 1UOKA 1QRNE 4QXGL 4TOYH 3HFFA 4PJ8A 5I6KA 4D9LH 3QEUA 3S5LB 3QZOA 2A83A 1BIIA 3FHAA 3NGBC 5C3IA 3VFNA 3P0VL 4PREB 4XMPH 5IJVA 4B7LA 3EZJB 1GZHC 1LO5B 4J3BA 4OZFH 5TE6L 4JKPL 1MCOL 4H20L 2EDFA 2LE9A 3QUZD 1JMZA 3P4LA 2ESVB 2IDTA 2NTSP 3GMRA 5CP7B 3ARFB 4AZUA 4GUCA 1S5HB 1EEYA 1IFHH 3Q5TA 3S96A 4AIEA 2WAQA 3BYTA 4OZGA 2G5RA 1KTDB 3KPRE 3BMWA 2IADA 2VZ1A 1NUFA 4G6JH 2HX7A 1E28B 2WGXA 4XO9A 2BP0B 2ALWA 4E42A 4PJ7F 1D5XB 5CD3A 2DWYA 1M1XB 3C8HA 4XP9H 4I87A 4RH4A 3TZVA 3L3GA 1UWEL 1P84K 1TPXB 4CADA 1S9WB 3HNVH 2ZTBA 3LN5A 4HJ1A 5IFAL 3VDBA 4UAOB 1IILE 5I1DB 2QMJA 2ED6A 4HWEL 4YSEA 1QYGL 1I8IB 1U8NB 2XIIA 3HC0B 1WGOA 4PB9L 4HUWA 4F2MA 1I1AC 1J8HD 4YHYB 4HIEB 2XOTA 5EU4B 4ZOBA 1KGCD 4BHUI 1TZOA 3NEOA 2IBZY 2RQEA 1YN7B 2C7UB 4M3HA 5FAAA 3UTTE 5CEXB 2NTFB 3C09B 3DO3A 1MEXL 2C4FU 5KEZA 2Z8WC 3FUNA 4JM2C 5EOQL 2W0LA 4X9GA 1KYDA 1HJBC 1DLFL 4TL5A 5F9WB 1SHWA 1XB8A 4X4MA 4CDGC 2G0LA 4FQ1L 3E6FB 3SDDD 4Z8FL 5LXGH 3QGVA 4NM8L 3GEWB 1YYLL 3ECWA 4AQ1C 2QPUA 4QTIH 2AMGA 2WBJC 4M56A 2RMNA 1MOEA 4LOUD 5C09B 2XVKA 3DRQA 3NACL 4IRJD 1E27A 5IM7B 1V7NL 1SY6L 2PTVA 1WEJL 1VKXB 4WFGD 1EHKB 1COBA 1EJ6A 1MNUH 1OIOA 4OI7A 1WFMA 1RAMA 1U3JA 4B50A 3QUHA 1IBFA 3Q2NA 2HKFH 2X6UA 4NFCA 2HLFC 2OV0A 2D73A 4NN5B 8PAZA 4JFWA 2EDTA 3QNXA 1JXJA 2GSIA 4XCNA 4G72B 4X5LA 3AXLA 2A6DB 3FRPA 1UXWA 2J20A 1DQQA 3MODL 4HS3B 3VACA 5D1XA 4EXPX 4DZ8B 2L04A 1PZCA 4U0RC 3ZJAA 5FCUH 1I1RA 2QADD 1ZVYA 3GTNA 4YHML 3VFMB 4WFFE 1BIHA 3QYNA 4ZNEA 3PDOB 4Y9CA 1YMMD 4Y4KA 1R5IA 3K72B 3EH2A 1LO2L 4PJEB 2GJ6D 5AVUB 3MLRL 4J1UA 3TCTA 1SDYA 2VQUA 3CVHA 4P46B 4NENA 2J5LB 5KVGL 1KIRA 4XHJC 3CX2A 4XPAL 3PGFL 5C0JA 4YHZH 5DD0L 1PPIA 1JPST 5HY9A 1OT4A 1QACA 5C0BD 4WAFA 4JGUA 1T0NA 5ESQB 4BBWA 5C1MB 5F44A 2WYTA 4RESB 3MBED 5I17B 3ZDYE 4HWBH 1Z6JT 1XXDC 4R4ND 4NRXB 1JNLH 1ZVSA 2D7MA 4AV0A 2QSTA 4ZPTB 1XGQA 3D48R 4P3CL 3H9SA 3AMKA 3JWOH 1DQLH 3FC8A 2V5RA 2YFOA 5AVWB 4JFHE 2GAZA 3ME0A 5GZOC 3B7SA 4HIXL 2X42A 4CAGA 4MAUH 4DESA 5E1QA 4L8SA 4HV8A 4I77H 4XVUC 5LJYH 3QDGE 3QIBA 4A7VA 5JMOC 1AH1A 5EU7E 2BNUB 3G5YB 5JR1L 4PJEF 3CZNA 5EN2B 1OTUD 2GABA 3LNFA 1TXKA 1BVKB 3RIAK 1GZPA 1Q94A 1T89A 2G9HB 4AM0Q 3Q43A 1GHFL 1KB9K 3WKMH 2ZONA 1DSFL 4X4KA 4Z78A 4HIHB 1U3HD 3FAXA 4BGDA 4TVPH 4LHJB 2AV7B 2BP3A 2VZSA 5DYOA 4RAHA 3TA3A 2WIIB 4GY4A 1DJWA 2X40A 4ISVA 3KL0A 3UYOD 2J4WH 3FTGB 1KBGL 4JRXE 3CX5K 3D0LB 4YHIB 2WLHA 3NIGE 3T0EC 1OHZA 4DK3A 1NBYA 2A2QT 4JY5L 3ULVH 2NY3C 5KSAD 4XCCH 5ANHA 5L2JA 4JHUA 4TTGA 4FI8A 1YJDC 3GLZA 4L1BA 3D0AA 1JS4A 4HZLA 1RUAL 5FDWA 2ADJA 3HE7B 1FG2A 2MQGA 3W57A 4FFWC 3GTTA 4BCYA 1KGYE 4G6MH 1IEAA 4N0UA 3KPSE 5D4HA 3VD0A 3RVVC 5CZXD 1JZIA 3NAAH 4IRSA 2AXGB 2H5UA 5G4OA 1ZIAA 4GKNB 3BGMB 2HFGL 4CVUA 2VDMH 3DURB 4K3DL 4OLYH 4GSXA 4ZO9A 3HMXL 2DJUA 3VE0B 4ZYKA 3KPTA 4PG2A 5KVGE 2XKNA 5H94B 3FQTA 2WXPA 4L8DB 3PABA 2ATPB 3MLYH 5E8EB 1XF2B 3QISA 2K3TA 3BFWA 4XTRD 3IGLA 1VCAA 1MLBB 2CDEB 3RRQA 1ZE3H 1A1OA 1CYGA 3BXNB 4FRWA 4R0LA 3VA2C 4D8PB 1AKPA 1JAEA 1T2QL 4ZFZA 1GC1H 1FYTB 2LOEA 3B4NA 1YZZA 3G3LA 4YUEL 5MEPA 1CTMA 3P77A 3B9KD 4WO4C 3VXSE 4KGJA 2IPUG 2QTEA 1E4XL 3MA9H 2V2WA 5JW4Q 3D85A 2ZCLL 4N2IA 1L3WA 3HEIB 3RX5A 5D7JA 1D5ZA 4CVZA 3WY4A 5I75B 2VABB 5DJ8B 3IPFA 5AW9B 3LHAA 1YO4A 2V7HA 4L3CB 4RWHA 5TF1L 1U8QB 2QGDA 3K0WA 2NX5B 4JFOA 3GSVA 4ODBD 2VXUL 3VFUA 4AIZA 5T1DH 2AK4E 1ETZA 1UWXK 1EAPB 3GJFA 5BRZD 1YDPB 4I5BA 4DK6A 2K6WA 1I3VA 5C9KA 3JV5A 5D70L 3HRPA 1DVFA 1P7HL 2R8SH 1A64A 3IVKB 1E3FA 2R56H 5HVGB 3TIEB 1XGYL 5B8CC 2EDHA 4D0BA 2W5PA 2E7LA 2J25A 2OMWB 4YS4A 2FL5B 4QRFA 4G70B 5L0QC 2BS8A 3BKMH 1NBVL 4OZFA 5EPMA 3WFEH 4ZZKA 3CJJA 2WVVB 3NIFB 5CZRA 5IY5B 1PIGA 1F4XH 3AG2B 1S7QB 4F7CB 3LRHA 5CP3H 1BD2E 3PXJA 3HE6D 3IJHA 1JV2A 4XVJH 5EZIL 3STLA 3RGBA 1NC4B 1QRND 1K5WA 1M7XA 5BUPA 4JCLA 1VFOA 3GJEB 2WUCH 4P4RB 4ODVL 1MCNA 2WW8A 2NQCA 2OXHA 2P8LA 3HRZA 5CCKH 1EX0A 4APXB 5HI5D 3ZY7A 2EJ1A 1S8DA 3IXAB 4NS0A 4PJIA 1MFVA 4NP4L 4U7SA 4XBPA 4FN0A 4W68A 5LDSA 1LEGB 2Q87A 2AS5M 1U8PB 5IB5A 1P1VA 5F7AA 1IFHL 2XV0A 3IPEA 3C9NB 1A3ZA 3MLWH 5GGQL 1X5YA 1XH3B 1SN5A 5BVJB 3L5WA 3VD4A 1QFWI 4YPGA 1UZGA 3KPRD 2GHWB 4K9JA 1SQMA 4M1DH 4G6JL 4M8UA 3WL9B 1PKOA 3R06A 2EUWA 1FNEA 3QYMA 5IVOA 1G0DA 3MACH 4ZTPH 1BLNA 4B6ZA 2XWBA 4E5XG 5I8EB 2LR4A 1P84J 1X9UA 1WBXB 2A9DA 4YHPB 3X17A 2NYYC 4A6YH 2ZSVA 1J0JA 2GK2A 2JH2A 2QKIC 3NIFF 4MNHB 4IKNA 3AS0A 4B0MM 4RGNB 1WAAE 3ML9A 3RNKA 2F7RA 5J1AB 3S5LA 5GISH 3O8XB 2H6OA 4GINA 3GMMB 3M1CA 3BAIA 3BVVA 5DK2B 4AIXA 2Y1VA 3UTTD 1TR7A 3KLLA 5KG9B 2XZQL 4QRRB 3F2LA 2JK5A 2R39A 5E7FA 5E99H 2BSEA 1MUJA 1NGXB 4Z7QF 3X12B 3ZL4L 5EDSA 4JNXA 1URLA 1ET8A 2ESVA 1TEYA 5CP7A 3ARFA 4M5YH 4KQ4H 3CIAA 3NEEA 4MKMA 4ZQKB 4OF6A 1H3PL 4JVWA 1S5HA 3B9AA 5KSBB 3JYCA 6PAZA 4K4KA 2KUTA 2BY1A 3MJGX 3R0NA 4LEBA 2BWQA 1M42A 3EO0B 1E28A 4W9FC 3B34A 2CPCA 5K1VA 5I1HH 4YSRA 1D5XA 1OM9A 1KPVB 3AT9A 1M1XA 3IFPA 3MNZB 4UBDC 5CBEB 3RVUC 1EIBA 2OTUB 3NG5A 1Z7JA 2QFPA 1S9WA 2WBXA 2JB6A 3E9UA 2K7QA 5I1DA 3TYFB 1WHOA 1HILB 4OCWH 1I8IA 1U8NA 3HC0A 4OV5A 3BIAX 5EU4A 4AEHH 3WIAA 1F4WH 3DUUB 5GJTL 5CEXA 1YN7A 2C7UA 2X6VA 4J5VA 2NTFA 2VQ4A 5AKVA 1KIUA 4WI9A 4POZC 1XB3A 4QCIB 4NHCH 1O9VA 4H8QA 1ET7A 4FS0A 4WFFD 4ZW7A 4NPJA 2B0SL 2APSA 4NO0D 3E6FA 3N41B 4HLZG 3QUZB