3ASWA

Structural and biochemical characterization of clfb:ligand interactions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
320
structure length
320
Chain Sequence
GTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Structural and biochemical characterization of ClfB:ligand interactions
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 81
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aswA02
4BBWA 4FJ6A 4F24A 3ASWA 3AU0A 4F27A 2Z1PA 4JDZA 3AT0A 4LE8A 2F68X 3IRZA 2VR3A 5CF3A 4B60A 4B5ZA 4RMBA 4LEBA 5IHWA 3IS1X 4Q6KA 3IRPX 4JDZB 3V10A 2F6AA 4LEEA 2RALA 2Y7LA 4F20A 2YLHA 1N67A 4F1ZA 1R17A 2Y7NA 4MBRA 2Y7OA 5CFAA 2Y7MA 3IS0X 4JE0A 1R19A 4MBOA
chains in the Genus database with same CATH superfamily
1TZOA 1NPJA 1QW8A 1XF1A 1QUPA 2H6OA 4GKOA 3LEXA 3TC9A 3U9UA 4NWUL 3G08A 4PJIE 5E99L 4G9FD 3NN8B 5EBMB 2OR9L 4YSUA 3TFKC 4P46B 1BM7A 4UU9B 7TAAA 2G9HA 3L1OH 1YMMD 4N87A 2Y69B 3S3DB 5JPMC 1NBCA 5E08L 3U0WH 3B2VH 4OJFL 3TZVA 2YPLE 4G8AC 4J3OH 4XCCH 1ZHKA 3ELQA 3QUHA 3RUGF 2IPUK 3GIZL 4ISVB 2IG2L 3IBEA 4XNXL 1I9JH 5DO8A 5J12B 1UWEH 4RWYH 1Q9OB 3U4KA 2YXFA 5I26A 1QW9A 4K4KA 4KZ0A 5B39A 3TLRA 1T1WA 2JXMA 2YD2A 3HZYB 4Q9CA 4KHTH 4P5KB 4EF3A 4RFOL 3SKOB 3JV4A 4KTDH 3MACH 4XNMA 1OD7A 3ARFC 1KEMH 2XY2A 2Q7YA 2ADFH 1NINA 3CZJA 3F58H 4D9LH 3TT3L 5GS0C 2R0ZL 4HGWA 4K71B 3I3EA 3DI3B 3SKJL 1LMIA 1PX8A 1L9OA 1XCQB 3L7FB 1P9MA 1WGOA 1WVZA 5LUMA 5JDJA 3IDXL 1IBGL 3QB7C 3CXFA 4G5AA 2CUAA 2FSEB 3DRQB 2Q2LA 3IDJA 1RHHB 4NUGH 3QULA 1FP5A 3V55A 2ZD0A 2CR6A 2ALAA 3GXDA 2CHNA 3J2PA 1U8MB 4AW7A 1GKOA 1OPGH 5D71H 5F0MB 2R0LH 4ZUUB 3ZQXA 1TJIH 1VCBC 1URIA 3QZLA 1FO0L 2BNRD 3V5DB 3GBDA 3KNBA 4BQCA 3A22A 5DJ2B 5HDOA 3DVNA 1JZ3A 3G6DL 4BD4A 3GIVA 3K5SA 3KWWA 1CGVA 4JDZB 1A6ZB 4PLKD 3TIDA 5C0CD 4C55A 3OQ3B 3B9KD 3LPPA 4M61A 4X8JA 5FB8B 3S3SA 1NA8A 2EADA 2R2EB 4G6JL 4EXPX 1HCZA 2IBZY 4X4XA 2X4UA 1G84A 3GBEA 4P06A 1XH3B 5I24A 1HKLH 2D0HA 4KRPB 3ZX1A 5DXWA 4M8RA 1TU2A 5CEZL 1KGUA 3DX3A 2R4SL 1LEGB 5BV7L 4YC2C 4LQFH 3P73A 3QBTB 4JFFA 4EPSA 5BVJB 3BW9A 3NCJL 4U1KA 4PGBA 3RUGE 3VX1A 3O4LE 1PD6A 1ZXKA 3WFCH 5DU7A 3ZDZB 2J4WH 2WMPB 4DK3A 4MJIB 4PG2C 1ZLEA 3CD4A 4PWHA 3STLB 1FG2B 4Y1AD 4B9YA 1NMAH 1T1YA 5T1MA 3O9WB 5F7FA 4DIXA 3HAEA 5GGRY 2AXGB 2DWDA 5EZIH 4HIJA 3UBHA 2BNQE 4UMGA 2K45A 1D5RA 1FAIH 3MTXA 2OMZA 1UCTA 1T89A 2ETWA 1RUKH 3NEOA 3ZDZF 3BKYL 3JYCA 3W37A 5D4JA 2VW4A 3EGSB 2BHUA 4N20A 2BSBA 4UWQB 4Z0BH 5C3TA 3C6SB 5EWIL 3VRLE 1OAZL 2CE6A 4HGKC 3JTTB 5E2VH 4U1SB 2E76C 5J6GA 3Q06A 4QPEA 2IPTL 2NY1B 3H7LA 4FFVC 2FNWA 2YEZA 3SJVB 2R69A 3DDGA 4AEIL 5JOPE 3EF7A 1Y18B 3HZKB 3ERXA 1JHTA 4XO3A 5FDWB 5IHUH 1GOFA 3JUZA 3M45A 3NH7L 3MLWL 3ATFA 4Y4HC 2BHYA 1RUPL 4YH6A 1C12B 4DK6A 3T0AA 5DZOA 3TBSB 1L6ZA 2L4OA 1YAZA 2LTQC 5GGTH 3GSOB 4LMQI 3RKDC 5I1LB 1LK2B 1N7ML 4NQVA 5FYLE 2O61A 1IM3D 1AMYA 2A6DA 3OLGA 5D9SB 2MCAA 1JF6A 2UZPA 3OWRA 4LIQL 5HD8D 4F1ZA 1TYRA 3IMTA 2IGTA 4OB5L 3ECUA 2X05A 3WBDA 1G94A 5CZXC 1GJIA 4I88A 1K85A 3QRBA 2NMSA 1OAKL 5FR3A 4LVOC 1UOWA 1GYCA 5A43C 1K6QL 1C16A 4IKKA 2CHXA 3C8KB 1BQKA 4LSTH 4NYLA 5LGJB 3PIQB 1CR9H 4UQ2A 1Q0XH 3QI9A 5AQ0A 1KBPA 4MJ2A 1OM3L 1SFHA 3N85H 1H3UA 4EJ1C 1JHKL 1MG2C 2N1TE 5DJ0A 4D0BB 3BVDB 1V3LA 4MA8H 1QSZA 3V6ZB 1AGDA 1U3HB 1MRCH 2GW5A 4F7TB 1X5ZA 4LLYB 3OMAB 4RGNC 1QYGH 4R5XA 1JNLL 4PSRA 5CU5A 3EW3B 4IU2A 2IAMC 4IDLA 3ZYOA 5E24E 1GY1A 1P4IH 1L9QA 3E7JA 5HYFA 3WTTA 2H2PD 2DICA 1BJMA 1A2YA 1N64H 5CBEA 5DR5L 2VOTA 3MNDA 3NPSB 3QT2A 4FXKC 3GLEA 4OFVA 3ABMB 3ZDZE 5G5DA 3HZVB 4XMVA 2FLRT 3A6OA 3I6KA 1QWHA 4MJIE 4IOIB 4DUVA 3O8XB 3TO4A 5CF3A 1S5HB 1D9KA 4EI5D 5E7BA 4MCZB 2CGRH 2X2HA 3HFMH 3SKMB 3LKPA 1F4WL 3K8LA 5GISL 3QFJB 4L29A 4P57B 3EDDA 1G7HB 3D8MA 3I02B 4HWNA 4EN3B 1K2DB 3DX2A 5E5MA 3RWJB 1ZANH 2I26N 4XCFH 2PCPA 1GGUA 3AREA 3PL6B 3QS3A 4IJTA 4P3CH 3UADA 5LCVL 5EA0L 4XNDA 2FJHA 4R5TA 1M6UA 1DUYA 4EIGB 2VO5A 3NYKA 1LO3H 1UQSB 1S3RA 5L8JB 1WH0A 4UDTA 1MAJA 1T3FB 1XR9A 2FR4A 2OYLA 3SJVE 1CFVH 4IGBC 4XXWA 5BUGA 5D1ZC 1PCXA 3T8XB 2B77A 1RZGA 5KBMA 4EZMA 3D25A 4AQ1A 3FCBA 1QZNA 3QDJB 4LLVA 5A3IC 1A22B 1BD2A 5CIPB 4G8EA 4UI2A 5DEFA 4EBQH 4MMZA 1IM9B 2J12B 1XF4A 3BZDA 1CLZL 3GSNH 4ILDA 5IESH 2CK2A 4AYID 1YEWA 1AS7A 1B2YA 4GBXB 4N28A 4UTAL 1DFXA 1ZV2A 1FPTH 4GEJA 5E70A 5L8KB 3ABGA 4PHZA 2VO8A 3QZMA 4LRNL 2R1WA 4O9HH 4WWKC 1XFPA 2KUTA 2A6IA 5CZVH 1CFQB 4RX4D 1T7XA 4Y5VB 3QCVH 1I7TB 2E9WA 1FG9C 3BSZL 4XNZB 5F6HJ 1DLHB 2VZ1A 3GB7A 5LJYH 2CLRA 2Z35B 3BZFA 1IE4A 5I74C 4OM0L 5BOPA 1EEQA 2Y7MA 3MYJA 1V8HA 3TN0B 3LKNA 4D8PB 2V7NA 4PJFB 1YQ2A 2NSXA 3HC3H 3PWNB 1PZ3A 2P48B 5C6WH 1F13A 1R3IH 1W6LA 2EDYA 2OZNA 4NQDA 4UQAA 5H8DA 4ZW6A 3UZVB 4C4KT 2WLIA 4F37F 5J11C 3D85B 4QO1A 1FAKT 1MWAL 2XA8H 3FH7A 4Y89A 4JFFD 1ZT1A 1LEKA 2DKMA 4Z1PA 1U8JA 4TVPD 1YY9C 2EDQA 4UAOB 5E0QA 3P4OB 3V6OC 1CI3M 3L3HB 1CDJA 1H8SA 2Y3AA 4FC3E 4PJFF 3FRPA 1QFHA 2EECA 2YFOA 1X4ZA 4ZOAA 4R97B 2IBBA 4F2FA 2EDEA 4G8IB 1D5ZB 5CP7B 1RK0B 4DN4L 4PTUA 3FUEA 2PWEA 3IDIA 4QRUB 5C6PB 5C9KA 3PAZA 3D18B 1QLEB 3FO2B 3L7EB 1Q94B 3CQQA 2YD7A 1NEZB 4TSCL 4M6AA 1C08B 4OGYH 4YL9A 5AAMC 3WY1A 4K94L 4M1DH 3CN1A 3APMA 5E8NB 5PCYA 3ATBA 2D31B 2CNYA 2C3HA 5IT2L 2K6WA 1R3JA 3RWFA 1T22B 1WJ3A 2A1WH 3T71A 1FZJA 1KJ3H 4WI6A 3I3BA 1R5WB 4GAJL 5D7SH 1I85C 2X9ZA 1I8IB 3DO7A 3ZDXB 4L1SA 4C56B 2A6JA 1RP9A 2P45B 1AHMA 1XH2A 3L9EA 1AIFA 3VSQA 3II3A 3PAVA 4BIKA 4GUPB 1AKJA 1XGYH 4GQQA 5DJYB 3VGAB 4F9PA 1I8MB 4ZUVA 3IGFA 3K0WA 3H2PA 3CX5K 2WUCL 3OVUB 3VXRB 1AI1L 1BBDL 1WD8A 2IANA 2DBJA 4JK0D 4JPWL 2D2OA 3P4NB 4KI5F 3ESVF 3EJTA 4DKFH 4GO9A 4OGZA 1GHFL 1W72H 5ESQA 3WN6A 5IQ9A 3TH4T 4YDKL 1GS8A 3PP4L 3BQUA 4WDIB 4HUVB 3MXWL 4YHPB 1PKQB 4M29A 5AUMA 2UUDH 3QI9D 4HG4J 2HFFA 1JDAA 1EEUA 3FB7B 4BH8B 2QADB 4OTXH 2VDPB 2Z64C 4PJHA 3CFKA 2YMXH 2D4FA 5DA4A 1EO8H 4KKLC 4DCQB 4E9XA 1JDCA 4JRXB 3QEQA 4OLZL 5JW4M 2DZEA 5JPNB 1E65A 5JYLA 1CU4L 4L1TA 4MNQB 5JXAH 5CD3B 4JN1H 4U1LA 3UGUA 3BKJH 4F58H 4F5CE 5F1NA 4FFYL 2Z7WA 3NCFB 4OZGA 2EH8L 4YSRA 4UT9L 2HFGL 4YHYB 3ULVL 5I6NA 1MJ8L 3MGTA 2FL5A 4RCAA 1RIVH 1OAUH 3V6FA 2TSBA 4BV1A 4DGYH 4U3SA 3NSDA 1YNLL 4P9HH 2JIXB 3TO4D 4ORGB 1D9KD 4KV5F 3TP4A 1JCKA 5I8KH 3ETSA 4N25A 2APTA 4QHLB 1AQKH 1A25A 3EJRA 1FL6A 1RURH 1KJVA 3BUQA 3DUSB 4QHNB 1JJUA 2DPKA 2F1AA 2WAHA 1TTCA 1J05A 4X8CA 4MDJA 5JDSA 4M7KL 1DFBL 2A73A 2UVFA 3ARED 3ZYJA 4NWTL 1N5AB 5EZJB 3D0LB 2UWEA 5ABDE 1KIRB 4JKPL 2AV7A 5CU9A 1JGVH 1JMZA 3JXAA 3F7YB 1OCOB 4P99A 2CGYA 3FUMA 1DBJH 5B3SB 2EICA 3L3KA 3ZKSD 4I1NB 2R4RL 4WU7A 7PAZA 4KI5E 5GHWH 1RFDL 3RGVC 1WS7A 1YMHB 2F7IA 5JR1L 1JYWA 4MJ4A 1Q4NX 2E8ZA 3EO1B 1J5DA 2K1MA 1IAKB 2V8MA 3FSWA 3QR1A 1K3ZA 1VEMA 1MAML 2OTWA 3EJQA 3GGWA 2Q8BH 3ZRSA 3P2BA 5FO2A 5FM4A 2HUEA 2EDNA 3CXHK 3N1MC 4JG1H 4WIQA 4D9RD 2B1HH 3PPSA 3BAEH 3VXRE 3G6AB 2V9TA 3L5XH 5ICUA 1DJWA 3PABB 5AYTA 1N10A 4UV7H 4CL7A 2AQNA 1BJ1J 4W9JC 1H8OA 2CMRL 5DJ8B 5LQBL 4FJZA 4APXA 3V5HB 2Y6SD 2ADYA 3IFNL 1OZTG 3VTAA 1PKQE 1PDKB 1T7WA 1XGQA 3GXPA 3QHFH 1EXHA 4GIPD 3RKPA 5JMRA 3Q9PA 2J88H 5KYNA 2NXZD 1WIUA 1QRNA 3KXFB 3LN5B 5DFWH 1SBBA 4M6ML 1BAFH 1MXGA 2BM3A 2D7TH 3BPLB 2ZXAA 1RZJC 2ZWNA 4HMEA 1X5JA 2AQ2A 1CE1H 4KV5E 4D7BA 5BQ7A 1SFDA 2ARJB 1JV5A 4NQDD 3H2WA 4MZ2A 4GSDL 5I0WA 1QLFB 1C5BH 2EH7L 4KXBA 4IMLA 3M1BB 3AROA 3UTZA 4PTTA 1SOQA 4BSVB 3KG5A 2OMXB 4Y2OB 1QATA 4TF4A 4G6FD 4JGUA 2RBLA 2R23A 5HHPA 3DIFB 2ICEB 4KJQD 4W1TA 2AANA 5DWUL 1K8DA 2UX6A 5IF0B 4M6NL 3QYCA 4KJWD 1A7NL 5E56A 5J6HA 1LE9B 4BWWA 3JTSA 1MI5B 5ICZB 2ITCB 3I50L 3LN4A 4PCYA 4QGYA 4TRPL 4WY7H 2ODHA 5CCHE 1GYAA 1TOXA 1FC1A 2VRAA 4DGIH 1OOWA 2CO2A 2GCYA 1GYVA 2K9UA 5HY9A 4YFLF 1WBXA 1DEDA 3S34H 1CT8B 3PQYA 1X6LA 3AQXA 3KPRE 5IEHA 2DQHL 2AEWA 3IU4L 4XI5C 3HE6B 3RJOA 2Y2WA 1QTSA 5IROA 3H3KA 4DN3H 4DP0X 4EMZA 4K23H 5LG1A 1PY9A 1TZGH 1A0QH 3PP3H 1K4DB 2YD4A 1ROCA 1WWAX 4RGNB 4ZOBA 1V54B 5F7NC 1OT2A 2IAMB 1S5IL 3UZQA 3L13A 3OXSB 5T1LB 4FG0A 3FU8A 4NC0B 1D7CA 4IRSB 4AH2B 3PXHA 1GGYA 3ZKMC 1TQVA 1BVKA 2HJLA 3QGVA 4KWUA 3SD5A 1AKJD 2EIMB 2Q86B 3CFTA 3HS8A 3O0LA 1TSRA 5IBUG 5TDNA 4Q2ZB 5D2LB 4P2RE 3R7RA 2IAND 2X6AA 5IVXA 5E00B 3RE0A 3OX8A 1PLGL 3Q8AA 4ODUA 4Q9QH 4L9LA 2GBTA 1TVHA 2ZONA 4Q89A 4XN5A 5TH2B 1YUHB 3C60C 4FL4C 4YNYB 2G30A 3MNZA 4BFRA 1CDUA 4R7LA 1NBYB 2EC9U 3WTWA 3BQUD 4PS7A 2JJTA 2DIBA 1HHJA 2DI7A 5EULV 5L0QC 3ALXA 4FX5A 4GS7B 2VUKA 5D2LF 5DK2B 1ES0B 1M05A 1TYEB 1JTTA 3O0RL 3ULUL 5CUSH 5C0FA 2KDGA 2QSTA 2GYSA 3KXFE 1GOGA 3CE1A 5IFJB 3HNTL 3BUTA 3QEQD 5EPMB 2P28B 3DIDA 3OKKA 3WXVL 3UPRA 1R3LB 4G9DA 3CSYB 3WSQL 4AC4A 1DZ0A 1HCVA 3HG1B 4Q56A 1SYVB 3WIHH 2UX7A 1G9EA 2VDQL 1W0WA 1BW8A 1Q1JH 2JE8A 5DEGA 1EJOH 2WCPA 4OGXH 5C08A 5MP6L 3D2TA 1KPRB 5I66A 3NZUA 2V37A 3RWEA 5DJZA 2HT4C 4ZO7A 5ACZA 1R6VA 3EOBB 2XU9A 4Y16A 1JZFA 4Q6KA 3QFDA 5T3ZE 4UIKL 1GVIA 3V4PB 2KLSA 2QKIA 3M6DA 4X80L 3R8QA 2WQVA 1ZT4B 4ZO6A 4FHKA 3OB0H 1MI5E 5EU6A 3S7GA 3UAEA 4YDIL 4XMPH 3HPJA 4CKQA 2BIPA 1TFPA 4YIQA 1RHFA 4UUJA 1TPXC 5I5MA 2CLVB 2BFGA 4PB9H 3QWOB 4CMHC 4BQ6A 3FTGB 1OXYA 4HWZB 3AU0A 3MR9A 1LQBC 5F7MC 5F7HA 1W15A 2WSPA 2NLJA 3W39A 2VAAA 1B0GB 2XVBA 4XPTH 1DSWA 3DBXB 1DN0B 1YPZB 1TT6A 3GMQA 4OH2A 4RGNE 1MVYA 1P7HL 4JGMA 2H0EA 1DR9A 4K7FB 5I8CB 4LARH 3LRSA 4KTGA 4H8HA 3BH9A 3JV0A 1W91A 4NO5B 3O6FB 4U6XB 4OCXH 1DQVA 2DWTA 2HJKA 2UXVA 2X4TB 2BFVH 2WANA 4ANUA 5F6HI 4LLMB 2FT6A 1X5FA 2X09A 3D39E 5DK3A 2VLLB 1YPZF 4RLDA 3NA9L 1I7RA 1FO0B 2PCFB 5D2LE 1QTYT 5AB2A 2C7UA 1S8DA 2VDOH 4HUNB 5IW1B 2NY6C 4EVNA 5EEYA 4FG2A 1KEGL 5FW6A 2OMTB 3KBHE 1QR1A 4OLVL 1V3MA 1GZQA 2MRYA 3AFLA 3LQAL 4LSPL 4WGVB 2JCCA 1DBKH 1G0YR 1OM9A 1FUNA 4OGAC 5FS5A 2G3ZA 2YLKA 4HETA 3TCLA 3VXOB 3QUXA 2YSSA 3RBSA 1OCWH 2QV2A 3OHXB 5C0EA 1DVYA 1S3KL 1WEJH 5IB5B 1QRND 1URZA 5D1QA 5LAXA 4TQEH 1M7DA 1OF2B 1SY6A 3Q2NA 1W2KT 2HKHH 3HG1E 4Q74A 4TTDC 2ID5A 3FS9A 3V4VL 2O6PA 2BS9A 3QQ3A 1EBPA 4LFHD 1QLRB 1MRFL 3VQLA 1JHLL 4UYQA 1KGWA 4JHAH 3RFZB 3RHWF 3QUZB 4YSPA 1EEYA 1Z3GH 2IDQA 3U36B 4TVPH 3H7BB 1AO7E 1PNDA 3KDMB 4X7TA 3T65B 4LHJB 4KK5D 3VW3H 1E9PB 1QBBA 4FFTA 3CHOA 1DE4B 2BRRL 1EHLL 1QSFA 3HAEH 3EYOB 2I32A 1MVUB 1IBFA 3BPOC 5CSZB 2X1QA 3V7MA 5KJRH 1T21B 2WWOA 1ZXQA 2BVOA 5FKAB 4TXVB 2VL5A 5EOTA 1QVOB 4AKQA 3F12B 2F58H 3ILPB 3JUYA 2AKRB 3QZNA 5ELIA 2C3WA 3PQYD 5B1JC 1QNZL 4BH7B 5DQJB 3QP3A 4OT1H 3ZKQD 3B1TA 4MJJA 3AS0A 5MEQB 3R18A 5CKAA 4ODSL 4CC0A 3BAKA 3N1FC 4KRMB 3KPTA 2R69H 2GVYA 1FNSH 1M7IA 2IFGA 4LCUA 4XO4A 5EORH 1M56B 3WFHB 3OG4B 5IOKA 4G1EA 3V6OE 3H6AA 3SQRA 3U2IA 1GSKA 1G1CA 5B3JF 2VC2H 1J88A 3IDGA 3MBWA 2EVIA 3UABA 4CVZA 4UT6L 2WGNB 4UCFA 4WWPA 2DWYA 1KMGA 5D1XA 2XUWA 4MSWA 3DECA 3CG8A 2AEIT 4TV3A 3QJFB 1JPSH 5EC1A 2E7BA 2YPKA 3SDAB 5K1VA 1MFBH 4FFZL 3L9RA 4QRFA 3BMWA 4FNLH 2J55A 3NP4A 3OQRA 4HKJA 3TBTB 1WIPA 3ATDA 4JAMB 4ALAL 4CC1A 3FDWA 2EUXA 1KB3A 3MRJB 4XR8C 3U9PL 4L5FL 4OZFA 1LP9B 2CO7B 3FB8A 4PPTA 4XH2B 4RRPA 4DUXA 3OXRB 1AQMA 3RPIB 2JB6B 1OWWA 5ICXA 1Y7VA 3RGVB 5A16B 2I27N 3UTPD 4EZLA 3LS4H 4PJEA 3MLYL 4W4OA 2PO6A 4ABQA 4O5LL 1SJHB 2BHZA 5DF0A 1QBMH 3M1CA 3IN2A 4M3JA 2BVYA 4W6WB 5C08D 3UC0H 1G5AA 2F7PA 1FN4A 1A7RL 4NN5C 4YBLC 4ZK8A 2VLRA 5L4JA 1H5BB 3FFOA 4ERSL 4QDGA 4FOMA 4TNWK 5CGYC 5KTEH 1DYZA 1ZS8B 4O51A 4NP4L 2KYIA 4Y16D 4AT6B 2CR0A 2PN5A 1KPVB 4UBDC 1OP5K 4XBGB 4BHUA 1FRGH 5EU6D 4L0ZA 2XX1A 4I0PA 4U0RC 4N90E 4XMTA 3RL2A 4XPHH 3ZO9A 3CIQA 2ZXWB 5KVEL 1S7WA 4Z7WB 3KYMB 3DGCR 2PYEA 1J8HE 4G5ZL 1A4AA 1FV1B 2ORBH 3W38A 5SWZA 1FSKC 4MMXA 3NZ8A 1RXLA 3FT4A 3KCPA 5IV2A 5B3JE 3WTUA 2YJQA 4LLWA 5D5MA 3UBXG 4OZHB 3BWUC 2GITA 1P4BL 4G6AD 4DGVH 3MUZ1 4YDJB 4OQ1A 3CFEB 1J48A 1K8IA 3HRZA 5JO5B 2ENQA 2R29H 3QK0A 2IH1B 5FO8B 4PBXA 1MEXL 3MV7E 1NOLA 4N2DA 1P1VA 2ESVA 3QJSB 2ZJSH 5E6IC 2W0PA 4NZFA 4WKZA 4OCSH 1T03H 1CK0L 4GKLA 1TJHL 2EVJA 3MREA 3E9UA 2YPVL 1TCRA 3PF2A 4HDIB 2WXHA 1TIUA 3WJLA 4EUPA 3VG0L 4FQPA 3T4YB 3LQZB 5FM8A 4FHJA 5KSUB 1NFDB 2XC8A 3FQTA 4E9RA 3DVGA 1GGTA 3VD4A 1DVUA 1M42A 2WWKO 3QUXD 1QI3A 4QEGA 3FTXA 1PY0A 4PG9B 1XR8B 2YQBA 2EE2A 1IEAA 3G6JB 4NRXB 3GZKA 4W9LC 2D3VA 3P9LA 4KY2A 2UZXA 5D1QD 4Y5XC 1MWAB 2RCSH 5DZLA 4DP2X 2F1EA 1CTNA 4ELKB 1BFSA 1BHGA 3BT0A 4GUQA 1GR7A 2EXSA 1NFDF 3BVNB 5DJXB 5C0JB 1HHIB 4OLWH 5C09D 5CEYB 5K5YA 2XYBA 2AABL 4NNXB 2NCEA 3ZTJG 2YOAA 1Q1PA 2CZNA 5BMFH 4DKEH 3E6FB 3REVA 1JZ7A 3CFCL 1RLBA 4JHVA 4YHZL 4CVWA 1YEKL 5L7XH 1EAPA 1MHPH 5EC2A 4JANA 4NZJA 2OJ1A 4IU3B 2NY3B 1UCBH 3UDWA 1GMIA 1SLVA 4HKZA 4XP6L 2F74A 3AT9A 3C60B 4FL4B 4I18A 2MPAH 5E5RB 5TDPB 3VSVA 3MZGB 2YA2A 1HSBB 4MS8C 3FT9A 4GP5B 4PHXA 4R8WH 4MXWH 2VDRL 2Q6WB 1HL9A 1HKFA 4PWJA 1E90A 3EJJX 1AANA 3UJJL 1IE5A 2NYKA 3WE1A 4U7SA 5FM5M 4KKBD 5H37A 4AV4A 5JHDB 5GS1B 4QTFA 3S98A 5EBMA 1MCJA 4P46A 2YGOA 3EYSL 4ZMYA 3QWNA 1EH9A 4UU9A 1LNUB 1SEQH 2NUPB 2XFGB 2YWZA 3ARRA 3QCUH 5E9DE 4A04A 3D0AA 2GQHA 4RFNB 1J0KA 2BSCA 2VN5A 1B3IA 3NP3A 4RA3A 5K9OB 2ZG1A 1IU1A 4XZ4A 3X12B 1ADQA 35C8L 4FZ8H 5DQDH 3TJPA 1Q8MA 3HB3C 4OCRL 4ISVA 2DM4A 2EXYD 3DSNB 1UXWB 4L3FA 5FHBH 3U7YL 1HYRC 3QXUA 1Q90A 4JDVB 5J0BA 4DVRL 3ASOB 3FYEB 4HALA 3HZYA 1KFAH 3TPUB 2C4FU 3W9EB 5D7LA 3S36L 4HOXA 3JT2A 3FU5A 5D1XD 1L7TH 1QFWL 1PKOA 2OAAA 2XVKA 1GGBL 4PRIB 3BZEB 4JQVC 5E2TH 4C4UA 2B15A 1U3JA 4NM8H 5EF0A 4WENB 5DD1L 4KUCD 1NFDE 5E4OA 4Q9RH 1XCQA 3L7FA 4QHUA 3V52L 2ZWZA 2O93L 4FI8A 5TFSH 3KWUA 3P2TA 4WZ9A 4B96A 4BQBA 2FSEA 1MCSA 3DRQA 3G7TA 3QDME 4I89A 3BO8B 3UGEA 1RHHA 2XKSA 1PNCA 3KPQB 1PPIA 1J9RA 3MGOB 2HVKB 1U8MA 1ZVHA 4DOHB 4FNUA 4QF1B 3CVHL 4MMYA 4ZUUA 6PAZA 3CCHB 5IJBC 3V5DA 4DTGH 2KT6A 5DJ2A 4GSQA 3B43A 4DPAX 1XT5A 2BWQA 3EJPA 4JDZA 4NKOB 4BCXA 1YYCA 3SN6N 4DEUA 4P5TC 5D6DA 2TAAA 5BCAA 2VLRD 2YRZA 4S0SD 2CJUH 1EFQA 4JZJB 4YR6B 3P02A 4LL4A 3SGDI 5FB8A 2FBRA 1A1NA 2NY6B 2R2EA 5I1KL 4PJ5E 1XH3A 2DIEA 3ULVF 1DQQB 4FQCL 4HS8H 3P0VH 2WTRB 4E41B 1J1XL 1QBLL 4I0PD 3K2IA 3BIKA 4DZ8B 2V5MA 5EBLB 1KIQB 1OTUC 1LEGA 4GRLC 3WNIA 4HISA 1SXNA 2DI9A 4PCTA 1QI5A 1G7JB 1WHOA 2PYED 1WFOA 4HS6B 2YGQA 5SWZD 1JF5A 2J6EA 5EUKB 2WMPA 1QP1A 5JHDE 4XMUA 3WEXA 3F6JA 3STLA 1FG2A 2C8NA 3AG1B 1T04B 4QXGL 4HZ1A 4M1CD 1M4KA 3AY4C 3O9WA 3P0YL 1G9ML 4OKDA 4KKCD 1IC5L 3KD4A 4ZQTA 3DMMC 2AXGA 3F7RA 5AWNL 3QUYB 3MZTA 4HEMA 1KIUB 5FIEA 1OSZB 2I60L 1B2WH 4NCDA 3OM3B 3ZTCC 3H56A 3QW9A 2EXWC 2JLPA 3EGSA 3BCDA 2F54E 2ESVD 3I9GH 3SE3C 3KL3A 1MFVA 3C6SA 4LCIH 4EO5A 3WTYA 2VTFA 4YHMH 3JTTA 1NIDA 2BSSB 1EX0A 4U1SA 4ZUWA 3JVGA 3SGDH 3CN2A 4NIYE 5C0AE 2XTJB 3ZR6A 3BPOB 1A9EB 4M4PA 2DYPB 2VDML 4PRIE 3SJVA 2BSRA 2F53E 4R7DB 3VB9A 1Y18A 1G43A 3GMOB 3HZKA 5HGGS 5FDWA 4Z95H 3GHPA 4PVNA 1EZVY 3UTTB 3IDNB 4XP9L 1C12A 1KF9B 5AL0A 5I76A 5FYJD 3TBSA 3K6IA 1KB5A 3GSOA 1KTLB 3NSFA 4M00A 1LK2A 1T0NB 1UH2A 2FVNA 4X6EB 3X1NA 5I9QB 1HEHC 4U49A 5D9SA 3MUY1 3AT8A 3O3BB 4FYRA 5DVMA 5DEZA 4HCRL 4YXHH 2ZWSA 3OLEA 4I9WD 4OZIE 4IKIA 1CXIA 1CZ8H 1E2VA 3L2MA 4PU2A 4Z0XB 2OP4L 3MVSA 3C8KA 4Z7VA 1E4XI 3BSGA 3PIQA 4W68A 1P6FA 2PPDA 1UWYA 1XBDA 1JNNL 3E8VA 1G0DA 4NRZA 4P48A 5K1NA 4D0BA 4JPSA 3TEXA 5FGBA 3ZKND 3V6ZA 1LO2H 3CHPA 1U3HA 4LLYA 1CFSB 4NQCD 1XH1A 1IC7L 2M8XA 2RFXB 3UG3A 5J13B 1G0XA 2HVBA 3UZEC 1HOCB 4LCYB 1ONQB 1JGUH 4P9MH 3BYYA 1JZEA 1SYSB 3WS6A 2J71A 43C9B 3DXAE 3HZVA 4IOIA 3O8XA 1S5HA 2DQUL 1K3IA 2NY2B 4P46D 2RB8A 4TM9A 3AXHA 4MCZA 1GZHA 4JZOA 1DQDL 4MAYC 4K8RD 3T2QA 2AXFB 4A37A 4AV0A 3LEVH 4HXAH 4NFDA 3SKMA 2IXQA 3QFJA 1TTBA 3DSFL 4P2QB 3FZUC 4P57A 8CGTA 1YJDC 3PUUA 1VHPA 1OCZB 4EN3A 3M86A 3KYNA 2ZX6A 3FSVA 3RWJA 3S4SB 1P0SE 1IGTA 3PL6A 3A6CH 4ES8A 1A5FH 2I7OA 2H9GA 3GMMB 2GHZA 1E4XH 3AUWB 3ZL4L 3GS0A 3CDGB 5D7LD 3WKNA 1DBAH 1UQSA 1O7SA 5IFAH 4H1LG 4PH8A 3H3PH 2XRAL 1PAMA 4OU3A 4G59C 5FYKL 1T3FA 4DEWA 1O75A 1FNAA 2YARA 4L37B 1G1YA 2NXYB 5JOPD 3L3IB 5KVGH 2OKMA 3T8XA 3UTTE 2PR9A 3GSRA 3BXNB 2R56L 3QDJA 2C34A 1FSKB 4K2UL 4AJWA 4TMPA 5CIPA 1CTOA 5C0RH 3ZGIA 4ATWA 4J3OC 4E5XB 4YLCA 4PRHB 3NEEA 4TQPA 5FYLD 4AVKA 1LTXA 2GTQA 1LO5B 2VDQB 4N6QA 5T5FA 3WEOA 2VR9A 2XCMC 3WI9A 5I1GL 1FIEA 1T2JA 3EBGA 4NBXB 3ULUF 2OK0L 4FMFA 1OARL 4PGEB 4Y5VA 3SPIA 1I7TA 3LOWA 5E6IB 5JIPA 5HYIA 3BWUF 1ADWA 1DLHA 4K3JH 3FT1A 4HZLB 2Z35A 3RNKB 3IS1X 1OE3A 1QD0A 3BZ4B 3UBGA 3DYMA 1NGQL 2XVGA 4BDVB 3PFUA 4PJFA 4D8PA 4WVRA 3PWNA 2VXTL 4HIQA 4KRPD 4M03A 4MFHA 3UZVA 3G5VB 2AJUH 4KJYB 2JELH 2PUQT 3VQMA 5JQHC 1WICA 5GGQH 2BWDA 2NR6C 3H85A 4IDJL 3CNKA 2FAUA 2CKBL 4JO3L 3GHBH 5BVPL 4HJJL 1T6BX 1UA7A 5F3FA 3PJSB 1NGPL 3P4OA 4AG4H 1A7PH 5AOMA 2ZUUA 4N86A 5SWSE 2HTKD 4F33A 1CIUA 3IE9A 4GI6A 3MLXL 1H3TA 3O9WD 2VQ1B 4WI2A 1MZZA 4GRWB 4X9HA 4ZMPA 1OB0A 2YD9A 1G1KA 2NNRA 2N56A 3C5ZC 3NIGB 3Q2CA 1EJFA 3FB5B 4G8IA 1D5ZA 4M48H 1ET8A 5GJSH 4MA7L 5C8JB 3MRCB 2VH5L 3IPEA 3QCTL 3HC2A 2W92A 3D18A 2DQIL 2YRPA 3FO2A 1MW1A 3GHEL 1Q94A 3IJ7A 1JVLA 3L7EA 4FQJL 3KPSB 4W9FC 1HHGB 4ZPVB 1NEZA 3BWAB 1TETL 1Y07A 2ZX9A 4PGJA 1INQA 1C08A 3FQWB 4MKMA 3JWOL 5KN5B 5BRQA 3WU1A 5HHVL 4J3UA 3UPCA 4GRWF 1D7DA 2D31A 1MOEA 2VM3A 5C0ND 3NIGF 1KBWA 1YC8A 2NY1D 4NGHL 3SJVD 3QJRB 3QJOA 3VWJC 4RRPG 1R5WA 1T5XA 1I8KB 1I8IA 2VZ3A 4C56A 4R0LC 4WSJA 3PWUB 1IQDB 2AEPH 1D3CA 3IEAA 1BX2B 3T04D 4OCYH 3FAWA 5KSAC 1OP9A 4GUPA 5DJYA 1I8MA 3MQIA 2HP4A 1R9FA 3HBPA 2OCFD 5KAQG 1UHVA 2WN2A 5C92A 1NIAA 4XWGL 1SY6H 2X12A 1WAAA 1NKRA 1QO3B 2FX9H 3FQ4A 5F71A 3TESA 2EACA 1XD1A 3O3UN 5CLWA 1PZ2A 2A2QT 2BK8A 4WDIA 4HUVA 2V2WB 2YWYA 3HS0B 4YHPA 4ZD3L 1PKQA 2W80C 4TS6A 1AZZC 3U79A 1CG9B 1MJ7H 3FB7A 3LTVA 3SDXB 4DCQA 3IMWA 2KZ1B 5DT1H 4JRXA 1U3HD 4JFYB 3WFEH 5JPNA 4PJ6A 3ECWA 1QKZL 4MNQA 3ETTA 3VFNB 1XL4A 2VLKE 1LO0L 5CD3A 1RU9L 5E4EC 3TBVB 4M7ZB 2H0PA 2CRYA 5TE7L 1OLZA 2DQCL 4KPHL 4LVHC 4X5WB 1HNFA 1WAPA 4FZEH 2HT2D 3O8XD 5JW3L 4ORGA 1JTOA 1J86A 2AJSH 2D9CA 2DH3A 4TNFA 2WVVB 4NUQA 4Y9CA 3HN8A 3MRRB 5C07E 3H42H 5I73B 4GG8A 4DPRA 4BFJA 4I85A 4YL4A 4FQLL 4KK9C 4PUBH 3QFJD 1N0LA 1USQA 2DBLH 3CLFH 3DUSA 4P5TB 1HDMB 3STBA 1S78D 3DV6B 4EN3D 3NABH 1N59A 1TQSA 2XJKA 3TEUA 4HH9B 4PGCA 5IMMB 2XYCA 1N5AA 3D0LA 4U7MA 2OSWA 2JI2A 2BY2A 1L0QA 3F7YA 1VERA 4HZAA 1DLFL 2J8UF 4J3WA 4BHUI 1WBYA 3AS3A 4N8VG 3WGVB 4JFEB 3T1FB 2CRIA 5T3XE 2Q3XA 3MO1A 5ID1B 1NAMB 5JZ7C 2D7PA 1JPTL 3Q2WA 5TDOB 3CN4A 1QUNB 2P5WB 2XZZA 1SOKA 1JZ4A 3QDJD 3O2VH 5MEOB 1JK8B 2ADIB 4RDQG 1IAKA 1ODUA 1B4RA 1Z1WA 1N0XH 5DDHB 3CU1A 3HG2A 2E6JA 3DLQR 1X9UA 3SE6A 1MCBA 1O6TA 1PL3A 2M83A 3PU7A 4OZFH 3GMPB 1E67A 1SHSA 3QJTB 4WI0B 3VFVA 3ZT7A 1VPOH 1R19A 3BESR 4MBOA 3VFSB 2MNJB 4NQED 3VG9C 32C2B 1SLUA 3DARA 4GJTB 2G0KA 1BF5A 2MSPA 1CD1B 4UYPA 4WI9A 4NNYB 4N5ED 3FONB 5FFOA 5HHMB 5HJ3B 4B9JA 5DJ8A 4LCCC 1FH2A 4S1RH 5FO9A 1UH4A 3RY6A 3V5HA 1FGNH 1PDKA 3HHSB 4KU1A 2FWOA 1G9NC 4JKKA 4Q4EA 4N68A 9CGTA 4KQ4L 4ZW7A 1IGFL 2B0SL 2ZSWB 3KXFA 3LN5A 4YHKH 5I1EH 2YAQA 4RMTA 1JK9B 3FO9B 1FLTX 3LVTA 3ZHDA 4BFEA 4YSAA 2FGWH 3I3DA 3IS0X 2ARJA 2Z8RA 4JR9L 1E7VA 2PKDA 3NFSH 3OG6B 1F1GA 5HYSB 1AZRA 3QORC 1OTTC 1ASOA 3M1BA 2AJYH 1X44A 4BSVA 2CKNA 5ITFB 2CR3A 4UDUB 5ENWB 3RPKA 2OMXA 3DX6B 4Y2OA 5CCKH 3IWVA 3UBFA 3B7RL 5HYQA 3U4EA 4UTBA 4OV6F 4R2GC 1T2QL 3P3UA 1OP4A 2ICEA 3K6FA 3VDCA 4DKTA 4WW2B 1SJEB 2GJRA 5IF0A 1LE9A 5DUJA 4HWBL 4WFHE 1DUZB 1KBBA 2IH8A 3MRMB 4I1PA 2J8UE 5ICZA 1O6VA 2ITCA 3RI5K 2I7SA 4GQ9L 1IC4L 2VLJB 4R90H 5EIIB 1FJ1B 2FJUB 1KENH 4KRNA 2ZKWA 3RDTD 5EDSA 5E6UB 1CICC 3IXAB 3MOQA 4B3VA 5DD0L 1AFVH 1CT8A 1LXMA 3SD2A 2FJGB 4ODXB 5AYUL 1GTFA 2HRPL 4WEUD 5IREA 3EH3B 3HE6A 4JFXB 2E9BA 1YCSA 3HMXA 4KVNH 1K4DA 4L4TB 4JFEE 1F97A 4EUPH 3IFLH 3OXSA 1Q9WB 2NTFB 3DDFA 2YMOA 5T1LA 1CD9B 2AMUA 2VQUA 4C56D 4QKXB 4IRSA 4OJAA 4AH2A 1HEZB 4N2KA 5C6TL 3BKMH 3GUTB 1DBBL 2NOYA 1U8QB 1MKFA 2Q86A 5FWQA 2IIJA 3U25A 4Y4FD 5CLYA 4IIQC 1LDSA 1K5WA 1FF5A 5E00A 1NCNA 1YEIH 5FOBB 2VXVL 1KCRL 3T2LA 3QQ4B 2XA3A 1ZLSH 3BVUA 1P5VB 3QDAA 1EUTA 4WNQB 5TH2A 1YUHA 3VI3B 3W81A 4YNYA 2DLFH 2UYLB 5BUPA 3ESNA 3WUWB 1D5BB 2YXWA 4F7CB 4K3GA 4NZTH 5HHME 3CMOH 2CHDA 1DL7L 1C7TA 3GEWB 3H9HB 1ZGLP 3APNA 3DO4A 2GTZB 3SO5A 5DK2A 4QXUH 4HWEL 1ZCRA 1ES0A 3KJ6L 2ZCKH 5E0FA 4JHUA 4DZBB 1MHCB 1N5YL 2QADD 3OSVA 2VDRB 5FAAA 1VGKB 5IFJA 3VI3F 4JRXD 2WNGA 1TQTA 3DOIA 4Z7UF 3H2QA 2LU3A 4MNQD 4QCIB 3CSYA 1PZAA 2W88A 4PB0H 1SYVA 1N12A 1A14H 4XVTL 1UD4A 2EDOA 2E74C 5AKSA 5AKVA 3U1SH 2ZG3A 4QR7A 1XZ0B 4DJMA 1KPRA 4MD4A 4WSGA 5I75C 4YPJA 4HC1L 2ZOKB 3KL5A 2F5BH 2H47C 3A0OA 4PJGF 5H37H 3RWCB 4YO0B 3EOBA 1G9HA 2DY2A 4N9OB 2O6CA 4CKVX 3ROLB 3L3DB 4KROB 4K8RH 4N8UA 2R9HC 2Y7QB 1AVAA 5GRZA 3SOBH 4M5YL 2KLRA 3IAPA 4J3OF 4MQSB 1E42A 1TO4A 2VLJE 1O7VA 2ZIDA 5D2NB 1ADQH 4A7GA 4EXKA 3QWOA 2XX0A 3MJWA 1X6NA 3FTGA 3KLLA 4DP9X 4HWZA 4XOEA 5JOEA 4YJZL 1KIPB 1B0GA 2ATPB 4KAQH 3B5HA 2I24N 2XWDA 3DBXA 1DN0A 1YPZA 1UOLA 1ZTXL 5GGRB 4L4TE 1MCWM 1CLOL 2NW2B 2WINB 4P3WA 4K7FA 5I8CA 4P9HC 1I1CA 5TTRA 1VFAB 3W9DB 2X44D 4NO5A 3HNVL 4PRAB 3L81A 4U6XA 3FUHA 1AHKA 1Q0YL 2BW4A 2MQCA 2MCMA 2Y25A 2OI9B 2J3SA 5I8OH 1KXVA 3RTQB 4PJAB 4PD4J 4AUUA 1MLCB 3WAKA 2C1OB 3CVHB 2VLLA 1HQ4B 1FO0A 2ZOLB 1OEZW 1AGEB 4N0FB 5FYLH 3C5ZB 5D96B 5IW1A 1NWOA 2WO4A 3OC8A 2XWJB 3WAJA 2YSTA 2OMTA 2GK0B 3B6SA 3QAQA 1IMHC 4KGJA 5JUEH 4Z7UE 5F7UA 1H3XA 4PJAF 4PW3A 1CGTA 3FUNA 3GBMH 4BINA 1T5KA 5TQ0H 3U1PA 3KM1A 1WP6A 1T2XA 4XOCA 3VXOA 1OALA 1OANA 1D5MB 3OHXA 1PIGA 3BDXA 2OCJA 1GYWA 3TTYA 1OVZA 5IB5A 3IMVA 2YR3A 4PJGE 2DWEB 1OF2A 4GAFB 2P1YA 4BRVA 4PJ9C 1QASA 4FLQA 1SQMA 1MCOH 2FX7L 4DAGH 4NZ8A 4GXUN 2IDTA 1QLRA 5B1BB 2VQTA 3BPNC 3GXTA 3CFMA 3RFZA 5I30L 1QFWM 5DJAB 4FAAB 1DCLA 1NBQA 2A74C 3H7BA 4URTB 3U36A 5AENA 4I77H 4D0CA 4PLKC 3P54A 1E9PA 3BGFC 3C8HA 3LIZL 3B9KC 5KBKA 1DE4A 1FE8L 2QVKA 3NSYA 3N42F 1T80A 3EYOA 1MVUA 4FNSA 4AL8L 3O81A 3O3AB 1T21A 3GZQA 1PS3A 4R4ND 5FKAA 1QVOA 2DEWX 5D2NE 2VSMB 3UJTH 1A6TA 4A63A 3ILPA 2AKRA 1KUMA 1EZLA 4KO6A 4BH7A 2DQDL 5DQJA 2NW3B 2XZAL 2ARJQ 2WWMC 4EIUA 3HE6D 4QRRB 2D8KA 5MEQA 3L16A 3OTTA 2WYIA 3S35X 2NY0D 2WY3B 3L4TA 3NTCL 1UGKA 3FQUB 3F2LA 2B9AA 2VZUA 2FUQA 5G4MA 4IRSD 4MB5A 5D70L 3D48R 4PJAE 4G7YL 2WZPA 4PN6A 1F4YL 2W9LA 1X7TA 2NYYD 4PIBA 3NRFA 3HA0A 3LNFA 4M7LL 2W59A 3SKNB 3MCLL 1YNTB 2A6KB 4KQ3L 3MTRA 1UUSA 1UWXK 2IFFH 1F90H 4AVJA 1B0WA 1YEHL 3WNMA 2GTWB 4JJHA 2ED7A 4R96A 1SHWA 5D8JH 3SDAA 4IBYA 1HXKA 4W70A 1R3HB 4NERA 4KZCA 5DZPA 3TBTA 3AB0B 4JAMA 1UM5L 1F58H 1WISA 4L1LA 3DROB 1LP9A 2CO7A 4GMTH 4I5BB 4XH2A 4AKOA 1WT5A 3OXRA 4I48B 4LO9A 2H0JA 1PG7L 3RPIA 1H3PL 2JB6A 5A16A 4J2XA 4X9BA 3SDYH 3LJ3A 1U93B 3NSXA 3HLKA 3N9GH 4F2MB 3IJHB 2HXAA 1LLAA 3WV0A 1IBYA 1O6SA 5HD8C 3HS9A 1I3RB 2ATKB 2XN9B 1CFTB 4MCMA 4XE5B 3X1EA 3A67L 3K71B 3MPCA 1H5BA 1Z66A 2DAVA 3ZO0A 5JYMA 1NEZG 2AK4A 2CLZB 4KFMA 2H32B 4AT6A 5J1SC 1DEEB 3S3PA 2CNZA 2UXGA 4OF0A 4XBGA 3L2NA 4UILL 3KMDA 3CZEA 4Z3IA 5LCVA 1HIML 1JFQL 4JRYB 4Z7WA 1KLGB 3KYMA 4HUUA 3D51A 2ZOOA 1RULH 4NCC1 5IHLB 1IGCH 1LDPL 3HCVA 5FW7A 4DP4X 3NIFB 4APQA 4JKMA 3VXQB 1F3JB 1TQCC 2ZUVA 3INUL 3FSAA 3G5XB 5I0ZA 2H2PC 4XNUL 3O4OC 1B90A 2FEJA 3J7HA 4OZHA 2EDWA 2W65B 3IGAA 4YDJA 1U4EA 2FQFA 3OKLB 3CFEA 4GMSH 3K2MC 3DPDA 4IK6A 4QI3A 3QPXL 3SY6A 1A9VA 4KK8D 3FQNB 3VFWB 5JO5A 2HLFC 3VM5A 2IH1A 5IQNA 5FO8A 1CF8L 5DYOB 1V7NL 3NIFF 5LN4A 4AK1A 5CIPH 4UTAA 3TZVC 4HIIB 3BDYL 5ERWB 1RZIB 2X53A 3EJCA 3FYIB 3RAJL 3C2AL 5IWLA 1R5IB 1IAII 4GY4A 5F1OB 3BKCH 5T5FH 1EQWA 4HDIA 3RL1B 3BSZA 3ZZLA 2YRLA 4TYUA 4ZMTA 1E4HA 1EHKB 2BXYA 3BD5A 4L8CA 5KSUA 3Q0HA 1NFDA 1INDL 5F7BA 2FECI 3KLSA 2E9GA 4JB9H 4DFHA 4XHJD 2WP3T 5D93C 5ADPL 4ENED 1UWFA 1CBJA 2DMBA 4BFNA 1B4JL 1YAIA 4B9PA 4HS3A 4PG9A 3MBED 1P9MC 2QSQA 2YAFA 3ABZA 1Z9PA 3G6JA 3NJNA 5CEZD 2QEJA 4JO4H 3EGDB 2CIIA 2A9NH 4P23B 3ROOA 4KX8A 3QXWA 1MWAA 5JQ6L 4LMQE 1J87A 4ELKA 4GUOA 5KYYB 3GSXB 5C0JA 3BVNA 1CDIA 5DJXA 2XPYA 5CEYA 2WW8A 4F2ME 4WNSA 2ENSA 3GLZA 4NNXA 1EEZB 3LS5H 3PWLA 4G72B 5KANG 3G9VA 2WSKA 3E6FA 2AQSA 2XN9E 3A4EA 4MAZA 3PJNA 3BOVA 4H20L 3SZKC 1F8TH 4ZW5A 2VJ0A 2XWTB 4K5OA 5KYWA 4HPYH 1HS6A 3OPZH 4TSBL 2PTTB 3OKDB 3NGBC 1BV8A 1RUQH 3T3MB 1IAIH 1FVEA 2WXJA 3LRMA 1BBJB 1HSBA 1MFDH 2XV6B 1Z5YD 4HIXL 4JRYE 2Q6WA 1Q9LB 3NG5A 1QLEH 3J07A 2P24A 3DGDA 3ARDB 4PJBB 4IBSA 4QXWA 4JFZL 1ECZA 3UP1A 3QWQB 1EAQA 2Q20A 4OSUH 3KM2A 4P8QA 4G8GB 3T3MF 4K3EH 3NCXA 3N1GC 1LNUA 1TMQA 2NSMA 2NUPA 3M46A 2YUXA 4R7XA 1XGUB 2N0KA 2EC9T 3OJMB 1JE6A 4S1DD 4X0NA 3ZBMA 5IJDC 5GRJH 4FEMA 4PS4H 2HMID 1HC1A 1KY6A 3LZNA 4PJBF 2J44A 1UEMA 3SO3C 3LHAA 4MKTA 2NQCA 3F01A 1CYWA 3DSNA 1UXWA 2GSIB 4ANWA 3WTVA 2WZPD 4JDVA 2DTML 2FIRT 5I19L 4CUCA 4MVBD 1KCUL 5BRPA 3TPUA 1T89C 1M9WA 4WUKL 3R1GL 3W9EA 2F8IA 5KANI 1TDQA 2CBPA 4HK0B 4PRIA 4LCWB 1SUJA 3B2MA 5F1SA 3FPXA 3KPOA 4PWFA 3F7PC 3MUJA 2DQEL 5GRVK 3SDAD 3GBNH 3D05A 1RJCA 2N0MA 1PSKL 4XMLH 3FC8A 4N2FA 3K4ZA 1HH6B 4FI6A 4PJXF 4YK4C 1UURA 3U4BH 4P3DB 5DK0B 2LFGA 3MGOA 1VFUA 3OKNA 3MLSL 4JX0A 4S0TD 4YSTA 1MCPH 4AENB 4YWGH 2HVKA 2VDPH 1AC0A 4G9FB 4FFYA 2DMGA 4J7RA 4QF1A 4UT9A 4Y7OC 1YMMB 3RGHA 2AK1L 1FHNA 1ZLVK 1BF8A 2CHWA 2DI8A 1MCNA 3VXUB 3JV6A 1MFUA 1EDHA 2CIKB 4PV1C 1UWGH 4WJ5B 4P5MA 3FCGA 3LZPA 1FL5B 4JZJA 4YR6A 2P9RA 1HINH 3H4HA 5GXBB 3FUKA 5C9JB 4M6OH 5HJGA 2AK4D 4X9YA 1IARB 1IZKA 1ET7A 1KCKA 2VMJA 2ZP8A 5EU4B 2WTRA 3COOA 4NPKA 3QI9C 4WTZG 1CGSL 4E41A 8FABA 2F18A 5F89A 4A67A 5INCB 3FMGL 5DHVB 4QRAA 1KIQA 5EBLA 4U6HB 3BD3A 8PAZA 3QRGL 4OLYH 5HI4D 3CFJB 3ZU8A 1UUNA 3FQXB 4PJBE 3B2XA 1G7JA 4E42B 3X13B 1O9WA 2L7UA 2NDGA 4HS6A 1EXUB 2BZ7A 4W9CC 5DHXB 3TM6A 5EUKA 3T2OA 4APQD 3FULA 1MDAA 4N2OA 1T04A 1GZPB 4FLRA 4G8GE 4E9LA 1LE5B 4BQ9A 1NCWH 3LH8A 5D7JA 2XV3A 3QUYA 4JPQA 1D9KC 4FQHB 1KCSH 3LDBB 1H6FA 1KIUA 2BNRB 3V0DA 2AJ3B 3PG2A 4RISL 2ZWYA 4PJ8A 1OSZA 2A74B 2HAZA 2KBGA 5CJQH 1UD8A 4HKBB 2K9FB 1S7UA 2CM5A 1OZUA 1UADC 2AAAA 2C9UA 2BSSA 4PJXE 2Y36L 3EJUA 4H0GA 4Y8DC 5FW8A 3AREC 2Z1PA 1RZQA 1A9EA 1WCBB 4LCWE 4R7DA 1KGXA 2VMDA 2HYMA 2KL6A 3N44B 3GMOA 2EVHA 2VLMD 3NJLA 4HD9A 4HQQH 1VZIA 3UTTA 3ARZA 2AC0A 3IDNA 3K2UH 1FNEB 1SDDB 3PHSA 2XVLA 4IJ3C 1XB6A 3LXCA 4W6XB 3X3FH 4E0RB 4XXWC 5DZAA 2DOCA 5J7CC 1IKOP 1TQBB 2VRKA 1KTLA 1KYDA 1T0NA 3QFGA 2WLYA 1DQLH 4X6EA 2ZUQC 5FEBA 3ALWA 4Y1AB 4G9FE 4MMZC 3ZE2B 1BGXH 3O3BA 4JZNB 4OLUL 4HG4K 2WLLB 1J8KA 3BLBA 1YMME 4HFUL 3ZMEA 1IGMH 1FNLA 5ILTL 2XQ0A 1XF2B 4YBQD 4H0IA 4Z0XA 2O5XL 3OKEB 2A77L 1QHQA 4ZAKD 3ZSTA 3NIDB 4NM4H 4UTBH 1KYFA 4RH4A 3CK0H 2GC7C 2NY3D 1KYOK 3ZE2F 3EOTH 1XTMA 2Y6SC 2EEXA 3K4AA 3VFPA 1N26A 1XB3A 2NX5B 3N91A 4JM4L 1UZGA 2YKLH 1CFSA 2JQZA 2NXZC 2RFXA 3MRHB 5A40E 4KY1L 5C2UB 3CVDA 4OLXH 2F0CA 2WYHA 5EO0B 1UT9A 4XAWH 5EN3A 3FTWA 1HOCA 2E75C 2EEAA 1KY7A 1ONQA 2IC2A 2AJXL 3NIDF 1JOIA 1QWNA 3AUVA 1SYSA 1FLRL 1MF2L 4QRBA 2FQGA 3ME0A 4HP5A 5EBGA 4Z5RB 3HKZA 4QYOB 5FKPB 3OKMB 5CLTA 3HMXH 5IFHH 3Q1SH 1JZ6A 2AXFA 1RVFL 4KJQC 1IGIH 4OD1L 4P2QA 3CZKA 5C0BA 2I9TB 1BQLL 3LCYA 4KJWC 2BNRE 5C71A 1NCBH 3SDCB 4UNVA 4X42A 2J5LC 4XXDB 3S4SA 2H2SD 5LBSL 5IGXL 4N3UA 5C0CE 5HP5A 3GMMA 3LEYH 3NQKA 2HT3D 1A7QH 3EHBB 4DUWA 1RJLA 1NDGB 4DETA 1H3VA 4PRID 3BAXA 5KUKA 4L37A 2RMNA 1MIEL 1CDCA 4JFQA 2NPLX 4OQTL 3W0WB 1E5ZA 4LK4A 3BXNA 4XP4H 4CN6A 3HVDA 3RWGB 2ROXA 3IPFA 4OD2B 2P3YA 3O4OB 5AZ2L 3IMRA 3LPOA 4PRHA 5B1AB 1Z3RA 1KZQA 3ZYIA 1LO5A 3IYLW 1F6FB 5ESAB 4Y1AE 4XVOA 4F9PC 4X5RA 3ZE2E 2W38A 3HEIB 4EI5B 3DJSA 3ARWA 3ULVD 4I0CC 1BQSA 1BFVL 3PNWB 4ANVA 4PGEA 4NWUH 4LSSL 2EDFA 4HJSA 5E99H 3QUML 5EEWA 2C3GA 3BAYA 2OR9H 4ZTOH 4H2CA 3GSQA 4HZLA 3RNKA 5F6IB 3NIDE 4XP5L 1DSFH 1HH9B 2H1XA 2R2HB 3BZ4A 3A6BL 5J06A 5E08H 2OXHB 3BQUC 1JAEA 4OJFH 5EB9A 2JXMB 3KR3H 4BDVA 2VKWA 4BZYA 5AVYB 2XNAB 3GIZH 4QRQB 1H0DB 3RQ3A 2IG2H 4E41D 2HN7A 4UQBA 3G5VA 4KJYA 3U30B 3MRFB 2XG5B 1KEML 3ZT6A 4JDEB 3HI6L 3F58L 5K93A 2RJMA 5L4IA 2SODB 4PREB 4LHUG 3V0WH 5E8DH 3WS3B 2MNWA 3WTSA 1WFMA 1GS7A 1ERNA 3PJSA 15C8H 1F3RB 3EFOB 4TUKH 5DLLA 4W9ZA 3IDJB 5GSRA 2WQ8A 4HJGB 4RMVA 2B8OT 1AS6A 3SKJH 4G1MB 4TN9A 5CAYB 5D7JD 3FB5A 3IDXH 4L3EB 1AQDB 4U2YA 1IBGH 3QUYD 1OPGL 5D71L 3MRCA 4LF3B 1TJIL 3IXTB 3FKUS 2PPCA 2YK1L 3UMTA 1J1OL 4PJ8D 1ZA3A 3KPSA 1HZKA 3RP1A 1HHGA 2MEJB 2QTEA 3BWAA 1KN2L 2EIZB 1R5VA 3FQWA 3LHPL 4POUB 4IEFB 1TZAA 5I18L 2V17L 5KN5A 4FLSA 1NCTA 1GAFL 1FO0H 3DGGB 1VFBB 4X9IA 4AYFA 1LGVA 2Y07H 2XTJD 4NQXB 2DM7A 1TTUA 3KBEA 1WTGT 3BT2H 4PVMA 2IO5A 2YFNA 2O30A 1I8KA 1JMXA 4JKLA 3ISRA 4KXCA 5DI8A 5FXCH 1FNGB 4A7SA 2E86A 2C9SA 3PWUA 1IQDA 3LVEA 2WIMA 1BX2A 4G6JH 2YC1A 3D07A 3NJJA 3FQRB 1GPOH 3P73B 2YXVA 3T4AB 3BW9B 1QFPA 3DVFA 4NX0A 5GGSY 4OCLC 3T77B 3WFCL 5CEZH 2QFRA 5FCSH 3DRTB 3V4VA 5CN1A 4BGLA 4CILA 4FTVA 4BK5A 3UTQB 5J4MA 1K4CB 4PBWD 5CJXA 3QARA 1QO3A 2ZXCA 2DWDB 4HIJB 1BYOA 4FYSA 4NKQB 4NZRL 1ITBB 2XTSA 2OMZB 2V2WA 3HS0A 3QIUB 4RA0C 1S7TB 1CG9A 1PZUB 2RQEA 1OPOA 2XXGA 4KOCA 3WD5L 3OSKA 3SDXA 1REIA 4A2LA 2H3KA 4NCC2 1ZIAA 4ZZFA 4JFYA 5FLUA 2N59A 3VFNA 4L0YA 5J3HD 3BKYH 3AABA 2EABA 4CGTA 1OAZH 4XWOD 4NEHB 3CHRA 2C4FT 3JYBA 4I0KA 4YK4B 5IHUL 1XCWA 1YQVL 5I15L 4U4IA 5I6XB 5LN8A 3QNZB 2IPTH 4PAZA 4LCVA 3V0IA 5IM7B 3Q7JA 3V7AE 2EZ0C 5EZPA 4AEIH 2NY2D 5GGTL 2WVVA 1OD9A 2K3TA 4HIPA 3MRRA 2E4TA 3NH7H 4NQVB 5JORB 2NZ9C 2P46B 2GY5A 3DJZA 3MLWH 4CW1B 1N6UA 1W80A 2A6DB 5J1TC 3TWYA 3MNWB 3GF8A 4KK5C 4P2QD 5HSFA 2B20A 5HHNA 2B14A 2ZNXA 5C0BD 1T6WA 5DC4B 5KJ4A 4DESA 3NRQA 3DV6A 5K33A 4UT6A 4AQZA 3OAYH 3DHUA 2WN3A 3BVWA 3NT0A 3Q8BA 1N7MH 4MQTB 4HH9A 5IMMA 5I16A 4F2EA 3LNGA 3MROB 3GMNA 3QXVA 5AW0B 2ZQKA 2QQKL 4ZW3A 4NYLB 3J8F7 1AZUA 4JM2A 2EILB 3QI9B 1CR9L 1PLAA 1Q0XL 1YN7B 4UQ2B 3SE9L 4HCFA 5JIMA 1OAKH 3NSJA 5KVFL 2YQ3A 1GOHA 3DA0A 1NQBA 4JFEA 3CLEL 2KERA 4UNIA 2HLAA 4FFZA 5K9QG 1AGDB 5IROC 5ID1A 1K6QH 1XXFC 1WV7T 5TDOA 1OM3H 1QUNA 1QYGL 2P5WA 3OKYA 4RQQB 3ULUD 2B4CH 5MEOA 1I9RL 1JK8A 2ADIA 2CA3A 4IU2B 4XO5A 1JHKH 5LAPA 4L8SB 2YAHA 4JFFE 2QDWA 1DVZA 2XPZA 5CBEB 1A2YB 1I75A 3FCSA 1N64L 5DDHA 3UAAA 1NFIA 2JKIS 4PRHD 2FBJH 4GW4B 4TVPE 4WI0A 3GMPA 1JNLH 1ZAGA 1DCEA 1MRDH 3TO4B 3IMSA 1FORL 4K9EL 3VFSA 32C2A 3DX1A 4Y88A 1C5DA 1S7QB 4GAGL 1T7ZA 2WXKA 3HFML 1CD1A 5DR5H 4NNYA 3FONA 5HJ3A 2CCLA 4L9LC 1B9ZA 3DK0A 4HH8A 3VA6A 1NGXB 3BAJA 3FK3A 2VMCA 2PWDA 3HHSA 1ZANL 2PCPB 3CC5B 2DDQL 1F4WH 2L7QA 4KMLB 5GISH 2J43A 2ZSWA 3GMLB 2JJTC 5DRZB 1JK9A 3BP6B 4LP8A 3VD3A 3VVWA 1LO3L 4C54A 1ET5A 3VD1A 1GS6X 3IFPB 2VUOA 4WKXA 1NICA 4UDTB 5HYSA 1JUFA 2K0RA 5EA0H 5LCVH 2FR4B 2WQUA 3UACA 2VUYA 1CFVL 4PFEA 4Y2DC 5ITFA 5ENWA 2D03H 3DX6A 4AQ1B 1QPPA 2G4EA 2FD6L 2FWUA 4XCYB 4G8EB 2XG4B 4JHWL 2VCOA 5CLXA 4WW2A 3T8VA 1MCCA 1SJEA 1TZ8A 3MA7B 1IAOB 1PEWA 3QWRA 3S8FB 4QHKI 3GSNL 1EK3A 1DUZA 3CGTA 3T0EB 3MDJA 3I6LD 1KJMB 5FOJA 1BSIA 1XIWB 4Y16C 2BC4A 2VDLL 3CLWA 1PIFA 5EIIA 2JV6A 1UYWL 1Z6JT 2B5IC 1TJMA 2VITB 3KPSD 4DGUA 2QKIC 1CLZH 3IXAA 4Z3HA 5CZVL 1Y1UA 5JLZB 3NZHL 5CWSA 4UTAH 2FJGA 3CDYA 3NK4A 1YEGL 2R8SH 1TENA 4JFXA 5DRWA 3D9AL 1NMCB 4LRNH 2QQQA 4LDLB 1JF1A 2WVSA 4B60A 4RAHA 3MRIB 3BSZH 5DD5H 1Q9WA 2NTFA 4G6AC 4GB9A 4OM0H 4R6UA 3GUTA 1UKQA 3SSGA 5C86A 1U8QA 5AW1B 3TO2A 1UB5A 1VGEL 2AW2A 4YPGB 4PWGA 4I3RL 2BY1A 2X41A 5LLIC 1U8JB 4P07A 2ITFA 1BEYL 5FOBA 3ZE1E 4FTVD 3QQ4A 1MWAH 5IMOB 1OIOA 5DVNA 1P5VA 1VESA 4WNQA 2R0WL 3VI3A 1CURA 2UYLA 1JXDA 4P05A 3E38A 1D5BA 3U9WA 3VFMB 3WUWA 4F7CA 4RWHA 2VZOA 3IDIB 3LZLA 3LAFA 3GI8L 3HE7A 2AERT 3H9HA 1ZGLB 2HG0A 2GTZA 1E9QB 4HT1L 1WC7B 4DZBA 4OI7A 4TULL 4DN4H 4OGYL 3L1FA 1D7FA 1RLWA 4M1DL 3BN3B 3ZE0B 3QUXC 5HHQB 1VGKA 1N2RB 3JWDL 1QZ1A 2X2UA 2BLFA 2E7MA 2COVD 5GRWA 3BVXA 2Y1ZA 4QCIA 4TSCH 4KQ0A 2C3XA 2KQNA 3RWFB 3F04A 4L3CB 4N0RA 5D1QC 1FZJB 2EDMA 2C9QA 1KJ3L 2EO9A 1PJ9A 1A6UH 4K94H 1XZ0A 3L8QA 5AOLA 4LNVA 1R47A 4BKTC 2PR4L 5IT2H 1AIFB 3RWCA 2J1ZA 1FYHB 4YO0A 5IP4A 2IV9A 2FSDA 2PW2B 2QZQA 3OMZA 4PJ7B 1SMOA 5GSVB 2JJSA 3ROLA 3L3DA 2YD1A 1L9NA 4D9RE 1BQRA 4K7PX 2Y7QA 3ULSB 1OP3H 2Q5BA 4YS4A 3KPMB 1DVQA 4JCLA 1WF5A 5ESQB 2WTPA 3SY0A 3K91A 4X7EC 2WUCH 1AAJA 1AI1H 1BBDH 2C1PA 2ATAA 2V3EA 4KH9A 5JPMA 3NJFA 4Y2LA 3ZJAA 4PJ7F 3EKCA 1KIPA 3X2QB 5AUMB 4JM2D 2JTYA 1GHFH 3L5JA 2HFFB 5GGRA 2WKGA 5DVPA 4KKBC 4LSRL 4RAUB 2WINA 3K8MA 3PP4H 5EU5B 1RIUL 3CFKB 4YDKH 1SJMA 3W9DA 1EO8L 5IEKA 4PRAA 3LN9A 1ZVNA 1HWGB 3EJYD 3HC0B 2NNAA 4ONHA 3FUFA 4NQDE 1CGYA 2P5WD 3RTQA 3BKJL 3E3QC 1ZGLM 4QRTB 2EYSB 1MLCA 1BZ7B 1WWWX 1NKGA 2C1OA 3CVHA 4OLZH 3CFNA 1HQ4A 3R06B 3QYNA 2EXYC 1CU4H 3PS6A 1AGEA 3S3BB 3FO1B 1RIVL 3TIEB 4DGYL 4PJHF 2VDKL 1SF5A 2XWJA 4P9HL 4FFYH 5I28A 1ID2A 2EH8H 3U82B 4DEPB 3FU9A 2GK0A 5E2UL 5I8KL 2HFGH 3WDIA 3ULVH 3BSHA 2OPCA 1CPUA 2FRGP 4HUWB 3L4XA 1AGBB 5D1XC 4KOBA 1FL6B 2VR5A 2XLLA 1D6EB 1RIHL 1YNLH 4XPGL 3Q01A 3MRDB 2KC0A 2Y5EA 1D5MA 4H4NA 1ND0B 3FCTB 3AM8A 3T0DA 1J0YA 1AYOA 3QDGB 5AOKA 2AV7B 5DMJB 3U7WL 2DWEA 1JGVL 1AR2A 1GY2A 1Y0LB 1NCAL 1MLBB 3GSVB 3PWVB 4TQ8A 4M7KH 3T5WA 3CFUA 4KKAD 4NWTH 4R4BB 3NAAL 4OI8A 3C87A 1LWHA 2ED8A 4JKPH 4KMTL 5GHWL 43CAA 2ZAIA 3MLVL 1OAQL 1XEUA 4BUQA 2X6CA 3LQMA 1AG6A 2PO6C 1AGCA 1ETB1 4W4OC 2PCXA 5DJAA 5DFTA 2UWEF 3IETB 4HEPG 4ZSOA 5F8QC 3HI5L 1GCFA 2R4RH 1LD9B 4PJ7E 4K9JA 1RFDH 3ES6B 3LX9A 3QWRD 5J89A 5JR1H 2DV6A 2B1HL 1X5KA 1WFIA 2IANE 1WFUA 1L4IA 2WIIB 1CCZA 4PCSA 2A4CA 3EO0A 3FHAA 1XZWA 4UV7L 5KVDL 3W56A 5CGMA 1M6OB 3TT1L 4I0PC 4B9CA 2BDNL 4AMKL 3B3IB 3HLAB 4APXB 3I2CH 4FFWD 4QRRA 2X3AA 2MHAA 3LKQB 2WZAA 4E5XG 4RMSA 4FKKA 3C09C 3E8UH 4Q14A 3ZMRA 4O58L 2J88L 2CMRH 4MMXC 5LQBH 4HX1B 2VN3A 2NT0A 4PBDA 4PJHE 2D7TL 2RGSA 3VU2A 5DO2D 3VE0B 2SEBB 3DTUB 1DANT 3QEQE 3S5LB 5BQ7B 3IFNH 1JV5B 1T7YA 4M1CC 5ALBH 1C5BL 3FU0A 4IMLB 4PTTB 1AE6L 4M6MH 1A02N 1A3LL 1BAGA 5IR1B 4HUXA 4N0YL 4LAJH 2CDEB 4GSDH 4HCRA 2ZNWA 3SKNA 2EH7H 4JCWA 2OTPA 4PJCB 1YNTA 4AWJC 1BREA 1I8LA 5J6HB 5LWYL 4L1HA 4XX1E 2CAKA 4ZG1A 2GTWA 3JTSB 5LKNA 5I0DA 3IAGC 1PZDA 1U8NA 1UM6L 5DWUH 3WJLC 3WJMB 4FKEA 3HE7D 4NXKA 5AVTB 3EJZD 1R3HA 4JREB 2JKLA 1G7IB 2GCYB 4M6NH 4JFSA 2JQAA 3HUJB 2VXUL 2UWEE 3DROA 4PJCF 4I5BA 1JP5A 4A6YB 2PPFA 1ZTMA 2OMWB 2OSXA 3P4LA 4I48A 1FZOA 1NCIA 4DN3L 1O9ZA 1TZGL 4WFED 5L6YL 1P6WA 1U93A 4F2MA 3IJHA 1TYJA 3UZQB 2DQHH 4A7QA 5CXPA 3IU4H 2G2PA 1GL4B 1MNUL 4XC1L 2ATKA 3FU3A 5LNEA 3K71A 4WJKB 1RPKA 3BPCB 4H8WL 4OIIH 3ET9F 3K8KA 2HJLB 5ECJE 4TLKA 1S5IH 2CLZA 4ZTPH 2VSCA 2BS71 2H32A 4M7LT 2W0FB 1DEEA 1KGCE 2HZHA 4KROD 4TQIA 2AEOA 3C6LB 4Q9QL 1AMXA 3UDWC 3CHSA 2FO4B 1UGNA 1KLGA 1AP2B 4I18C 5DJ6B 1MSPA 3O45A 4GXVH 2B3IA 3VXQA 3WXWL 1HHJB 4LAQL 2HB0A 3G5XA 5FA4B 1JD9A 5IVXF 1BVZA 4HHWA 2W65A 4UM9A 1WQVT 4X6DB 4JG9A 3DPBB 1QRNE 3OKLA 1ZVSB 5CUSL 3KLHD 3P0GB 3HKFA 1E3ZA 1PG7W 1ACCA 2Y1AA 1Z7JA 4P46C 3U7AA 3VFWA 4Y19B 4NZDA 5I1AA 4K8RC 5DYOA 3NCEB 3WIHL 3P1VA 3RTQD 3ULUH 1UZ8B 2ZX7A 3CFBB 3GQFA 5IBLC 5C08B 1BXAA 3GM8A 3WGUB 3RWEB 3WXVH 2Z31B 4H2AA 1R5IA 4JM0A 2VDQH 4NQQA 4KKLD 3RL1A 1MJUL 3QUMB 5MP6H 5GRUL 2YJLA 4B9IA 5EU6B 1F5WA 5EG6C 4EIZC 1E4KA 4UUJB 1DJYA 1JGEB 4PB9L 4UIKH 4K71C 3QZBA 5EF1A 4H8UA 3EFDH 1IFHL 3QXAB 1CWVA 2QGBA 3PQYE 4X80H 3SGJA 2D3NA 3L95B 3W39B 4GP8B 2D3JA 3EGDA 4YDIH 4OD3L 4P23A 4WHYG 2TSAA 1A7OL 4GIAA 4JDTH 3WDHA 4XC3L 4XN9A 3VI4B 1NJ9A 4M5SA 2ZXBA 4UB0H 5KYYA 3GSXA 1SPDA 1ZWIB 4AZ8B 5IJCC 1A4KA 1KDIA 4ZMWA 1JXGA 3LRSB 5B8CB 1EEZA 2EDJA 4K3DL 2K4AA 3AACA 4OAWA 2MH4A 2ZUTA 4HK3N 2D2CC 2R1YB 2J5WA 2IBZX 2XBDA 2XWTA 2E59A 5FCUH 3TYFB 1D6VL 2XWEA 3VI4F 2PTTA 2A9BA 3HG4A 3OKDA 1FCGA 4LOFA 4GRWH 1JZJA 4XCEB 2NSQA 5DVLA 5IVXE 3WFDL 4QRPA 1ZLUK 3MFFB 3IKKA 2JK5B 1BBJA 4HU8A 1EHXA 1R24B 5KVGE 1Q9KB 4IRZH 4KRPC 3NA9H 5GZOA 3ARDA 1JBJA 2VERA 3S36X 1ML0A 4ZMAT 2OTUB 4FS0A 1JGIA 3WLBB 2Q1EA 4QRRD 1UACL 4OLVH 5SWQB 3LQAH 3FU7B 2X28A 2VN7A 5D1QB 4OV5A 1MCHA 5GRVL 2HTKC 4DO6A 4TKWA 4WO4A 3UTPE 4J6IA 5DGRA 2R2BB 4N2HA 3O9WC 5HVWA 2O4EA 5AD0B 5C09B 5G55A 2GSIA 4WSKA 5C08E 4GG6B 1TVBB 1TR7A 4YX2H 1EEYB 3IJEB 2UVEA 4B5EA 1U0QA 1ZHLB 2ALWA 3QSKB 4Y4HD 4X7TB 4BA0A 1A1MB 4HK0A 3RIAK 5I23A 4LCWA 1YLBB 2YZ1A 3QRFM 3JVGC 2OSYA 3RKDD 3WN5B 3FBKA 4GFTB 5EU6E 5C0NC 1T4WA 2Y7LA 2NY1C 2BVOB 5KJRL 4KKQA 4JL2A 3TNMB 3SQOH 5HYSG 5IJKA 1T6VN 4BK8A 4GG6F 5BXFB 2F58L 4KH2A 2BRRH 1EHLH 1LEIA 3UG4A 5DK0A 4POYA 4CC4A 4EOWH 3BIAX 4FJ6A 4AENA 4OT1L 4AQOA 4BFKA 4FJYA 1CD0A 5EU7C 4U1MB 3K74B 4JFDA 2DL2A 1L9PA 1YMMA 4Y9EA 1Z32X 4YDZA 2FZ3B 1QNZH 4XNAA 1BQHG 3VXUA 4XBPA 1EANA 4A7TA 5EORL 4MCYB 3WMQA 1Y1DA 3AS1A 4WJ5A 1U58A 1FL5A 4ODSH 3EH1A 5C9JA 2OFQA 3KYAA 1TQUA 4JVPA 4MA3B 3ZRCC 1I1AB 3C08L 5EU4A 2WXFA 2DQMA 3MJ9A 2V5YA 5D1XB 2Y72A 4MSWB 4KKPA 4KK6D 2LOEA 5DHVA 3UYPB 4U6HA 4KO9A 2ZTBA 5FGBC 1I3UA 1U3HC 4UT6H 3CFJA 3FQXA 1PLCA 4E42A 3X13A 2KHAA 2JCCE 1EXUA 5FYKD 4Q52A 4CBPA 5L2KD 4XXCA 2R1XB 1M9SA 1BA9A 1RZ7L 3QUKB 4HKJB 1MCFA 1GZPA 2VSDA 2XXMB 2Q87A 4UM9D 1KDJA 3NPSC 4AEHL 2GC4C 5EFIA 3WS6C 1LE5A 3BHBB 3FQ2A 5DMKB 5D1QE 1U21A 5AW8B 2HT2C 1LYQA 1UD6A 2FUTA 3O8XC 4FFZH 5IBTH 1NAMH 4ZDHB 4HUMB 4FQHA 3LMJL 4PJEB 2BNRA 1GZHC 2BX5A 4KUCF 3PHQB 5C09E 4F91B 1KG0B 4CBZA 2AMGA 4UV4L 4AE1A 4F15B 4FLOA 1P4LA 4XVJL 2EVFA 1S78C 5I6OA 4EN3C 4JY6B 1ID5I 3MLYH 2RR3A 4O5LH 5IVZA 2YLHA 3PL6C 4WI5A 4NAQA 4JG5A 2X9WA 3GDCA 1WCBA 2G3NA 4J5VA 1T66D 1QNIA 3HPLB 2IPUG 3BC9A 2DH2A 4PJEF 3SPVB 1A7RH 1SMDA 4R7NA 2BXZA 2EIBA 1NMBL 4FE9A 2AJVH 4ERSH 1FNEA 2Z8SA 1SDDA 5JHLL 2QPSA 3RL2B 2OR7A 2HA1A 1T4KB 1XO8A 4XPHL 4NP4H 1BF2A 3L4VA 4LPWA 1KACB 1FYTB 3F62A 3KH3A 2PW1B 4J3OG 3W5MA 1SNRA 4WWKD 2IADB 5SWZB 3NZ8B 3WFZA 1U8KB 4ZRGA 4JJOA 1YEFL 5HPMB 2OSLA 4N3TA 4JZNA 2RACA 5SV3A 2WLLA 1G7MB 3L48A 1NUNB 2JKTM 4GBXC 3E3QE 1E6JL 3HRZB 4YDNA 2VM4A 4J8QA 2WAQA 5MEND 2R29L 3OKEA 1ORSA 1QMUA 2I07B 5DUBB 1P4BH 5D55A 4HWBA 1IO4C 4N5EC 3S96A 4Y5VC 5HVGB 4P2OA 3SKUD 2ZJSL 4XNZC 5M94B 2VDLB 4OCSL 1EJ6A 1XVSA 3FQYA 2LAGB 1T03L 1VEPA 2NX5A 4AZUA 1TCRB 5D1XE 4N2AA 4QRPD 1C8QA 5CFAA 4QD2E 4CU6A 5EO0A 5GZOD 3TGXA 3ARDD 1LK3H 1TJHH 3PNRB 2NY4D 4U6TA 1OHZA 4HJTA 1K5NA 3BI9X 5C3LD 3VG0H 2Q7AA 2DM2A 4QYOA 3OKMA 4KUZL 3KZ8A 1AOHA 4UAOC 2WXRA 1H15B 2KZKA 3BIBX 4WO4D 5FGCE 3V95A 4PJEE 3BFWA 3SDCA 4OLWL 3MKGA 4XXDA 3RG1C 1FDLL 1AR1B 5BMFL 5LGHH 4F37K 2VLRE 5GJTH 1U6AL 1ZLWK 4XMWA 2DQGL 1MHPL 3MUUA 4JANB 3NACH 2OMYA 5AW3B 1KGJA 2AABH 1NGWB 3FF7A 1NDGA 4UOZA 4X4KA 1UCBL 3LD8B 3FO0L 4HKZB 3SB3A 3QG7L 1EAOA 3IRPX 5CHNB 5D7KD 5EOQH 3CFCH 4YHZH 3W0WA 4NQCB 2X6BA 4UQDA 3TV3H 3RWGA 1N67A 2CBMA 3LH2L 1QFWI 4DT2A 3N40F 4W9DC 4KITB 5CINL 4XP6H 5I17A 4G6ML 3TONA 2PYEE 3H53A 3WY2A 3AQZA 4LQ1A 5SWZE 1SHXA 2H7WA 1XAKA 2MTPA 4LLQB 5ESAA 3VGAC 1JWSB 2VDRH 5D5ME 5EEXA 4JHBA 4EI5A 2A3TA 3Q48A 5EMYA 4JFDD 3H9SB 3VH8A 3ZDWA 3CXHJ 3FH5A 2V2TB 3PNWA 4HC1A 3UJJH 4BWTA 2X9XA 2HG5B 3VGBA 1BG9A 3LZFL 4L8BB 3VXUD 4XN1A 1QSVA 3M88A 3WIIL 2FB4H 2P5EA 4G82A 1DBMH 3FT3A 1WD9A 2HCZX 3CUPB 3MRBB 4XNBA 2EJ1A 1HH9A 2R2HA 2FE0A 5FHBL 1NAKL 3P3RA 1FH5L 2OXHA 4WJG3 2ESVE 5FO7B 4UQEA 3MRPA 1MVFA 4J4PA 4LGPB 2XNAA 1KFAL 2IMNA 2W07B 5D7LB 4OCRH 4QRQA 1H0DA 5E1AB 2H3XC 4TL4A 5EF3A 3U7YH 4HYTB 5EHFA 3MRFA 5GGVL 2RH0A 3WHE1 2N01B 2QADC 2XG5A 2M2DA 1F42A 1H3GA 4AGNA 4JDEA 3UOAB 3CH8A 1DVFA 5DHEA 4DVRH 3T0XA 3EOAB 4PREA 3VD5A 3P2DA 4NM8L 3WS3A 4DQAA 5JPNC 3K6SB 3GWJA 3FHEA 3S36H 4ELMA 5D72L 4Q9RL 4QHUB 1QFWH 4QUOA 3EFOA 5TFSL 3VFUB 1GGBH 3CQFA 5FYJE 2Y6TE 1XF5B 4HJGA 4YHYC 4Y8AA 1KPUB 4X8GA 5DD1H 4G1MA 2UY7B 3V52H 1NUDA 4L3EA 1AQDA 3O11A 3ARGA 5FV2A 3ISWA 4MMYB 4KRLB 3TA3B 3ILEA 1THCA 2D7MA 4LF3A 2CRMA 3IXTA 4LKXB 2XZCH 1IVTA 4DTGL 3HZMA 4I9WE 2ZP0T 3VMPA 1HEJC 4RX4A 5E4IA 2EIZA 2F5AL 2VDKB 5B4MD 4IEFA 1L9RA 4MASA 4WK2B 2EEDA 5HXMA 1VJSA 4Y1TA 3CVHH 5BPPA 3DKHA 1SJXA 3DGGA 1VFBA 1R3KB 1R33A 1A1NB 1DO6A 2Q3ZA 4QGTA 4ONFL 4NQXA 5T8IA 1WK0A 2Q2EB 5LNGA 3GI9L 5ANMB 5A2FA 4G3YH 4ADIA 3NBNA 5ETUA 1JRHL 4HS8L 3P0VL 4S2SB 3M7OA 4TQHA 4V2BA 3WEAA 4Z18A 2DN7A 1FNGA 4A2HA 3BIKB 4NQCE 4X5QA 1WS8A 4C83A 3PREA 2EXTA 3MV8B 5F21B 1BLNB 1WITA 5I1KH 3PAYA 1FFOB 3FQRA 4BCZA 3T4AA 2GJZB 3F7LA 2ZXEB 4IBWA 4NO0D 4U6YB 1CVSC 2DW5A 4FQCH 2FX8H 4QOKB 5ECGA 1CC3A 4X5PA 2ZKMX 3T77A 1KCBA 3B1UA 3QQNA 4UINL 3WEXB 2BP3A 4NN6C 2FO1A 3DRTA 1HHHA 3UTQA 1PZCA 3BVVA 1K4CA 4Q6IA 2ZCZA 1IILE 1AG0A 4PS8A 1KCWA 1MUJB 1MNNA 5DD6B 5FV1L 5I6MA 4MB1A 2WKLA 4S11A 4QXGH 3PGFL 3LIZA 3QIUA 2ZP9A 3P0YH 4U31A 1G9MH 1S7TA 4NN7B 1I1FB 4WEMB 3SBRA 1T83A 1IC5H 3E2HC 2Y2TA 4AQAB 1YEDB 1OTSD 5AWNH 2J56A 4P2OD 3RY6C 1A66A 2K4WA 4ZUWB 5FDYA 1E30A 5D7LE 2NX5D 4PRNB 2I60H 5ANHA 4ZX4A 1A6WL 3LB6D 5ALCL 1P53A 5H2BB 4NOBA 4PM1A 4G7VL 2BSRB 3BPLC 3HNSL 1O5DT 3EH2A 5DLML 3GLAA 4HV8B 4Z95L 4W81A 3H3BC 3NJIA 1CO1A 4UZUA 2Z91B 4URKA 1SHMA 1PYWA 3QNZA 1T0MA 3APDA 2XBZA 5MERB 5I76B 2J2ZB 3RX8A 3VXSB 5IM7A 1KB5B 1G7QB 1INEL 1U92B 3NJXA 1R0AL 1NM9A 2GJ6D 1IVLA 5JORA 4CW1A 1BECA 3QG6B 1U2YA 1YNKH 3B7SA 4Q8BA 4XP9H 2ICEC 3APCA 3MNWA 4F20A 4PMEA 5IB3B 1M7UA 1FA4A 1ZRUA 3SDCD 3POHA 3VD7A 3WCYA 3BCFA 4UMSA 1BZEA 2YGNA 3MROA 3VXMB 3X1BA 4R4NC 4PGZA 3L45A 3KJ4B 2LAAA 4GT0A 3RVXD 4Z7VB 1PFCA 4NC1C 1RZKL 2C3VA 2XV2A 2IVFC 3FU6A 3O41B 5BRZB 1UFUA 4M56A 3QJUB 1YN7A 1NCJA 1E4WL 2LABA 4HCRH 3EHBD 4PD4K 5CJOL 5DMIL 5KBNC 3OR7B 3VSUA 3UYRL 3ZKXB 4NRZB 5GIRA 1S9KC 3HE6C 2OP4H 4CU7A 4PWKA 3S88L 1VLXA 3W0WD 5AW9B 4RQQA 1XGZA 1ZEAL 2IEPA 4K5NA 4L8SA 2FJFB 3EUDA 4Z7VF 2JKNA 4LSUH 1JI1A 2JLLA 4IRS