4N8CL

Three-dimensional structure of the extracellular domain of matrix protein 2 of influenza a virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSVGEKVSMSCKSSQSLFYSSYQKDLLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYFCQQYYTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody
publication title Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 219
sequence length 219
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cL01
5GIRA 3EYQD 4MAUH 5D2LF 2Y1VA 3GSQA 1FRGL 4LCIH 4OZFB 5F6IC 1PVHA 4LKXA 43CAB 2R4RH 2Q8AH 3S5LG 3JV4B 1BZ7B 3IDIB 4JCLA 2FSEA 4K9EL 1FZMB 5EUKB 5J6GA 1XH3B 4XC3L 3RL2B 2VDNH 4NHCL 3IETB 3WLWC 1LO5B 3BPLB 2DLGA 4XCYB 4XNZC 1JZ3A 5EO1B 5HDQH 2E9IA 2NTFA 5H2BB 2H3NA 1RULH 1MJ8L 1V7NH 12E8H 4JPIA 4HKJA 1A1MB 1YZZA 1FCGA 1ZT4B 2EYRA 4NWTH 4FQHA 4I5BB 4ZFGL 2AQ1A 4KHTL 5C0EB 2Q76A 3G5YA 2XI9A 5JW5A 3S35H 5CP7B 2EXYD 1KCKA 1SBSL 5JXAH 4XI5C 3BVNB 3OJDA 1Q9LA 3AREA 2NYYC 1OTSC 4PGCA 2NCMA 2A77H 2XOTA 1F4HA 3BWAB 2C4FU 3GSNL 1UM5L 2LE9A 4N0UB 4NQVB 4F2MA 1X6NA 3SJVE 3MJ9H 1MHPH 1LO2H 3NFPB 2HT2D 1FN4A 5HHVH 1X4XA 3C5SA 4EN3D 3OL2A 4NFCA 1CD8A 1IGJA 3WLBA 2BNQD 4QF1B 5HHQA 2CJUL 4PUBH 4U3HA 1MNUL 4XAKE 4HLJA 1MELA 1GZQB 5BRZB 1TENA 4H26B 1NUDA 4UDUB 5C0FA 4W4OC 4ZAKB 5EU5B 3VXUA 5C0JB 5C0AE 3LN4B 4WY7H 3H3KA 5CILH 5MI0B 4UV4H 2HVJA 4RMVA 3FT2A 4MXVE 5AZEL 3MX0A 4U1MA 5F89B 3NACH 4ZQKB 4RISH 5C86A 4IDJL 3SKOB 1CK0L 3QRGH 1OD9A 2IAND 1CICD 3RRQA 5ESVA 4KTEL 4UQ3B 5DD3L 3TP4A 1CXKA 2X1OA 3HUJE 3GKWL 1HCVA 2A83A 3BHBA 2YKLH 1FCCA 1QFHA 3WD5L 4F9LA 4OQTH 3RU8L 2EE6A 3ROLA 3NCEB 3UYRL 2IF7A 4PGBA 1AO7E 4ELKA 1A1NA 1AR1D 1WVZA 2A6DB 4NN7B 5GXBB 4D9RD 3VWJC 3JUZA 4G6KH 1VSCA 2K7QA 4TUJB 3C8DA 1WCQA 4X80L 1F3RB 1MCOL 2I9LB 4BQ9A 3IAPA 4KKCD 4RIRB 2EH7L 2KBGA 3T0ED 4B0MM 3O81A 5GGVL 4N0FB 1U3HA 1JPFA 1BFVL 5I30H 5L8LB 3VFGL 3TEUA 4LHUB 5I71C 2NY5L 5J8OA 2HT3D 2NY1B 5KSAB 2AV1A 2FLBT 5C0GB 5IROC 4XCEA 5FYKD 3KG5A 2E6JA 1RJZB 1Z5LA 3IKCA 4Y1AD 3RWHB 1J1OL 4JFED 4WW1A 3VFNB 2YUVA 3VFVB 1QFOA 2FDBP 2PW2A 5I1JL 2OZ4H 1SM3H 2DBLH 3P0YH 2ICEB 4M6AA 1NANI 3EGSB 4LIQH 2ORBL 4JN2A 1KULA 5T1KD 1VHPA 2YRLA 3EOTL 1JGEB 1TJIL 1A3RH 2R23B 5TE6L 3GNML 5EA0L 5SX5K 1FYTA 3O3BA 2YN3A 2FJFA 4JM4L 3CC5A 4NOFA 4P48A 4CVUA 3PE9A 1EUTA 5DC0A 5DMIL 1M7XA 2Q76B 2VLME 5E08H 5ICZA 1NCCH 4C83A 1Q9LB 2JCCA 1NC2D 1RD6A 4ODHL 3VXSB 5HYFA 4K3JH 3BRFA 4XNXH 3FO9B 1E6OH 1S7TA 1WFOA 4JHAL 1P4BL 2APFA 5GGTA 2BVQA 3L7FA 4NKDA 3U0PA 4HMDA 4BFIB 1T7WA 4QRRB 4PRPD 3KJ4B 1N3NA 4G6FD 4Q6IA 1IC4L 1R3LA 1CE6A 4MXWH 2Y7QA 4M1DH 3WLBB 2Q3AA 4Z7VE 4G9FA 5DQ9B 4M48H 1JGVH 1K85A 4YBLC 3O45A 3ARQA 1DUZB 2YPKB 4JGJA 3NFNB 3RIAF 4C56E 1NBQA 3AFLA 1E6JL 1A7QL 3B9KC 1YMMD 3BGFB 3FQUB 5IBUB 4BQ8A 5C0CA 2J7LA 1L0QA 3ARUA 3CFCL 2Z92A 2I9TA 4N0CC 3WXVH 3NA9L 5DRXA 3RDTD 1GGBL 4EDXA 4E9LA 4JZJB 1QACA 4Y5XC 1Z3GL 2YEZA 1JNHB 2R15A 1OAQL 3GMNA 4UOJA 5D6DC 3DVNA 1QBAA 4MS8C 1O0VA 3MACL 3KLAA 3LKOA 4LLUB 4QRSA 4DGYH 3IU3A 4NUJA 2R56H 5L7XL 1ZHLB 1RIVL 5F7YC 4KI5C 1WAAF 2CIKA 2DQUH 3LKSB 5JORB 4KXZH 2W9EL 2LABA 2XFXA 4Y88A 4JKPH 1ZGLB 3B5GA 3WDHA 2XZQH 1UM4L 2VOTA 1EHAA 4NO3A 4A6YA 1MOEA 5FYLD 1TIUA 4UNUA 1UVQB 4OFYA 1NCDL 1S7UB 1JWUA 3PHQB 1MF2L 4YZFF 4MNGB 3NH7H 4FFVD 4N0YL 4F3FA 1NLBL 5EFIA 2D7TL 1HILA 1I1CA 1MEXL 4H20H 3REWA 2YA1A 4GXVL 4XCEB 1RUKL 3QEUB 3IKCB 1UB6A 1SEQH 4JRYD 4HIIB 4WCYH 2YC1A 2WP3O 1GC1C 4NJ9L 2HYMA 4Z7WF 3DX9B 1XR9B 2PW2B 3MRPA 1DE4B 1L7TL 1FV1B 5L6YH 4AT6B 3QQ3A 3I75A 2JJUA 4RMTA 2IH1A 3WS3A 4JFHE 2IAMC 2YSSA 1OGTA 4AIZA 1R5IA 1ZXQA 3QQ4B 4HWEH 4HBCL 1DN0A 3T4AA 1ED3A 5FKAA 3CSYB 5LJYH 1W8OA 4NSKB 1U2HA 1MIML 1ZS8A 1W0VA 3OAYH 4ZDHB 5CJOH 4NZRH 3VA2C 4AMKL 1MFAH 4WI7A 2R1WB 5HD8C 5HDLA 3BX7C 5AYQA 3UBXB 4L8DB 5D1XA 1ZHKA 3LN5B 1AHWC 3CU1A 3IXTB 2V7HA 4LPTA 4MJ5A 2B1HH 1KTKE 1T5XB 1HSAA 1GIGL 3TNNB 1JE6A 4OAWA 3S36H 1S7TB 2WUBL 3P30H 3VMNA 4DZBA 2O93L 4OLXL 4YHKL 4KVNL 3OKLB 3MLVL 4Y5VC 3OX8A 1A9EB 3DXAD 1ZHBA 3QEQA 4AZ8A 4Q6IB 2DM4A 3R1GL 3FN0H 2A1WH 3UTQA 2A6JB 2Y7QB 1QVOB 4MXQD 4PJFE 4IRJA 3RJQB 3BZEA 1OTTC 3DMMD 3KXFA 4R96A 5DD0H 1T1XA 3DYPA 1LQSR 5JQHC 3G6JF 2P7TA 1C5BL 3TN0C 1BVKA 4K71C 1KJ2B 4MD5A 2HFGH 3W39A 5HYSA 4WUKH 1I7TA 3DVGA 1MRFL 2HA1A 4UDTA 1FNEB 2A6IA 2F54E 1T3FB 4LVHB 5DGRA 5C2BH 4HUMB 2IH3A 4PB9L 3WNKA 2GJZB 4G3YH 3O0RL 4F37K 4YH6A 3Q1SH 3HE7A 4JO2L 1EBAA 3K4ZA 4KV5E 3O9WC 4U05A 3T77B 4LPWA 3MRMA 3BKYH 3BPOB 4YDIH 4KFZC 1QLEL 1B4JL 2Y06L 3P3YA 4KJYA 2VDRH 2H9GB 4CN1A 2D4FA 3N1QC 3RFZC 1J0JA 4PJHB 3GSUB 2UZIL 2ID5A 1IQWL 2DWDA 3FRUA 3LVEA 3HRPA 1CTNA 4P9MH 1GGUA 3C8KA 1IFHL 2ESVB 1NEZG 1OAXL 1EJ6A 1E4KC 5E2TL 2PYED 4CAGA 2OTWB 3VFRA 1Y0LA 4LBEB 1TJHH 4HPYL 5HHNB 1JGUH 1HHKB 4OT1H 2XA8L 1F8TH 5GGQH 4JFXA 1KC5H 4PJ8D 5INCA 4MXVF 3LDBB 3NZHL 3CGTA 5D71H 5F1IB 3TH4T 4JN1H 4CW1B 3MLRL 2AXFA 4U49A 2F19H 4D0BB 5J13C 3SKJL 1MFCH 3L3OA 5ENWB 1FG2A 5JXED 1Q9KB 4U1KB 2YC1B 3WNMA 3BKML 1OB1A 3BW9B 1P7QD 2D0FA 5CZVL 2IQ9L 3OR6B 5B38B 1MI5E 3V52L 3HUJF 5A2IH 5C6WH 2HLAA 3RTQD 3QQ3B 3VDAA 5DR5L 2YSSB 3CVIH 1CBVL 4CJ0A 1YNLL 1DN0B 4DK3A 1ED3B 5FKAB 1OPGL 2M1KA 4Y4KD 3X13A 3I3DA 2FEDD 2DJUA 5FO7A 2KQMA 2FCBA 3TPUB 1MCNA 5J56B 4M6ML 1S9VA 1SJXA 1DN2A 5BZDA 3MYZA 1UKTA 3HG1B 1G84A 2GTWB 1QR4A 2IFFH 1VKXA 1RIUH 2IBZX 4MJ5B 3BH8A 3GO1L 3GJEA 2BSTA 2WBJB 3MO1A 3DVIA 1UWXH 1EO7A 5CHNA 2W0FB 4KRMB 3GMOB 4PRHE 4DGIH 3W11C 1KJ2H 3QEQB 2VC2L 3KJ6H 2GJ6E 5IMMA 3P11H 2HFEA 2ERJB 1T0NA 3BPLC 1EZVX 5I73B 2EXWC 4ZS7H 1NKOA 1MCCA 3P9MA 5DUBA 2PTUA 4NQDA 4KDTC 4OLZH 4GAGH 5JW3L 1YN6A 2X7LA 2P7TB 1VGEH 3VXME 3ES6B 4ELMA 3WFBH 3EOBA 3CDGB 4D94A 2VQ1B 5ACLA 5HYSB 1I7TB 4K2UH 1ZT1B 3BOVA 3QUZC 1BM3L 2DQEL 2QKIB 4Q9RL 1YEFL 5EO9B 1ERNA 1QBML 2X4UB 4XBGA 2FJHB 1DBAL 5JDSB 2V2XB 1BECA 3ARGD 4DCQB 3HE7B 3VXNA 4KKLC 3RI5F 1YEIH 3ARSA 5FYJH 3MRMB 5DHVB 5EU6E 1N5AB 5ISZD 3EDEA 3L5HA 3TFKD 3T04D 1JL8A 2NY0B 1R24B 3HI5H 4LSTH 4TNWF 1WUNT 1G9ML 4ODUA 3NIFE 4PJ7E 1ZLUK 4QT5A 1R3IH 2FL5A 2DQIL 3U7YL 1VACA 1RJYA 3VFRB 3D85A 5DJ2A 3U1SL 5E6IB 1BLNB 4ZAKC 4JY4A 4XAWH 5E00A 5TQ2H 5MI0C 3OR7A 1ORQB 4AEIL 4JFXB 3SDCC 3ZYIA 4RCAA 2ARJQ 5ERWA 4L29A 2C7UA 1C5CL 2W0PA 3F7RA 5DUPL 2YZ1A 2X4QA 3QWQB 1N2RB 4U1IB 3GBML 3MQIA 3TVMA 1G7QA 4ZYKB 5J0BA 2BXYA 3DBXB 2GK2A 1NLDL 2ITCA 3KPRB 2ADGB 1XF1A 4HC1L 2WINA 3ZTJH 1X5LA 1SJEB 1UB5A 2ICCA 5HI5D 1I85A 5TH2B 3PGDB 4NN7C 2ZKHH 1LMKA 1PQZA 1CLZH 3RVWC 1TJGL 2I26N 4J3OC 3EJJX 5DMGD 4I8DA 4YWGL 4YDJA 5E8PB 4NO0D 4BKLB 1QFUL 2VQUA 4Z76A 2QHRL 3TH3T 2R4SH 1NGZA 3ZDYE 2NY1C 5CEZE 1KBGL 5KSAC 3BH8B 3U6RA 3FFCD 3QZWG 3VJ6B 2X9WA 3OJ2C 3HE6A 5A1AA 5C8JB 1XGPA 5I16B 5D7LB 5MEOA 3EYSL 4QY8B 1MH5B 4JR9L 4LQFL 1GGCL 1S78C 4O2CA 4V1DD 4YXHL 2NW2B 2XNAA 1LK2B 2XWJA 1UJ3A 4CMHC 5CGYD 1D5MB 3LD8C 2CR3A 1E28A 1T2XA 3QHZL 2D7PA 1JV5B 4AM0A 1A02N 1FVDB 4XPBL 4HW6A 4IOSD 4NQDB 3QP3A 2X7LB 3THMH 2NPLX 1MIEL 4NNYB 4LCWB 2R39A 1MUJB 4ONGL 3FT4A 5JIKA 5IB1B 1NFDE 2DD8H 4LPUA 3EYFA 5DHVH 5I1CL 2ATPB 4WUUD 4C56D 4WVRA 3RIAK 4PGJA 1YNKL 1DANU 1NAML 5DUMH 5C09B 3MOAL 1T04B 1ND0A 3HC0A 1K4DB 4MJ4A 5EC1A 4WI3A 2SEBA 5DS8A 1B3JA 3PGCB 3IVKB 4PY7B 1HWHB 1PZ5A 4K94C 1IL1B 1SY6A 3EFFB 3U4EA 5HYEA 3AUVA 1YPZA 1CT8B 5E2VL 1TZGL 4G8GB 5K9QG 4NZTH 3W9EA 1LDSA 2YRPA 4PJFF 3VXPB 2QADD 4POUB 4S1QL 1KIRB 3QNXA 2F53B 3I6GB 1A4KA 2WIIB 2NXYC 1HI6A 5C9JB 1MCWM 4EJ1C 3EJYC 3I02B 1P7KA 3DV6A 4YHIA 2XZCL 3D85B 2RCSH 4OM1H 3ZE2E 4BQCA 4OLUH 1FC2D 1JUFA 3O3UN 1D6EB 1PEWA 4TVPD 5AAWA 3QSKB 3BGFC 2G2RA 4GT7A 5CEZL 3NZ8A 4JZJC 1NCBL 3I6KA 1Q38A 2J6EA 2R2CA 3ILPB 5KG9A 5M7QA 1B2WH 1MLBA 3V6FA 4KV5F 1G7QB 2FH8A 3VWKA 1HHGA 1RHHB 3EAKA 2FX9H 4NM4H 4NPYB 4OV5B 4PJDE 1IQDA 3MGOA 2W9LA 3OGCA 1WV7T 1FZOA 3VW3L 1AY1H 4MJIB 3GZKA 3FFDB 3PQYA 1GHFL 3QUML 3K4DA 1K2DA 3AROA 4MA8L 4RDQF 3DO3A 4MX7B 3VG9B 3RWDA 2C4FT 1CE1L 5FGCE 8FABA 5DSCB 4OFDA 3ZYJA 1RU9L 1KIQB 3SHSA 4IS6B 3MCLH 1RVFL 1K4CB 3UPRA 3GRWA 5DRWA 5FFLA 2HMID 1NGZB 4HXAH 4OGYL 2IPKA 1X7QA 4M93B 4CGTA 1H3WM 3BEVA 3ARBD 3FQXB 3JVGC 5GRZA 4OZHA 5L9DL 4PJBA 4NNPH 4QHLA 1FAIH 3HE6B 3OKOA 4M7KL 1NBVL 1BBDH 1QSEB 3VFTA 4PJGE 1PYWA 4J3WA 2HJFA 5CJBA 4O2CB 3RBSA 4CDHA 3LQAL 3PWNA 3SGJC 2R29L 2BC4A 4FQXD 3WSQH 1HEZA 1XF5B 3TA3A 1CIUA 1U3ZA 1KV3A 3OXSB 3NABL 3F12A 2AVGA 5TF1L 3FRPA 5L2KA 1FVCA 3L3KA 3L3DB 2PUQT 4H5SB 1QR1B 4HPOL 4RAHA 5F6HJ 5D9SA 4EXKA 1F4WL 2Z0BA 5HPMB 3EO9H 4BFBD 1KB5B 3T2OA 4K3EH 3N85H 4KHXH 3E6FA 1L6ZA 1XF4B 2X2YA 3CSBA 4TVSa 1OGAB 5B22A 3B6SA 1G7IA 5AWNL 5CS7A 4UILH 2CIIA 2R2EA 1JWSA 2WW8A 1Q1JH 2BNUA 1MRDL 4JO1H 5DYOB 2EC8A 5EC1B 4MWFA 3GMRA 1IE5A 5DS8B 4GW4A 4TSCH 3QRFM 1RSFA 3U4EB 3G04A 5CP3A 1MLCA 4K55A 1CIDA 5E9DB 1FGNL 3WN5A 1FFNB 3W9EB 3FQWA 1RUPH 4FQLH 4CN6A 3CIQA 5HYJE 1A4KB 4WGVB 5GSVB 3FAWA 4L8BA 1K8IB 3MRKA 5ALCL 2NY2B 5DJCB 3TIEA 2DMBA 2J2ZA 4P2YA 3UEZA 3AAZB 3QJFA 5EU4B 4ODXA 3IKKA 4DN4H 1HXYB 5KOMC 3MRIB 4KRLB 5HSFA 1IC7L 5C7XL 3NZ8B 4P23D 5J12C 5FA3B 5CSGA 3B8SA 3IAQA 4OTXH 4D8PB 3MBEB 3WIHA 1E27A 1G9NH 1KJ3L 3BPOC 3QNZA 1QKZH 3QB7C 3OKEB 1HNFA 1ULVA 1PKQA 2DTMH 4M00A 3OPZH 1MCWW 4S0TD 4DGVH 4UNTA 2IMMA 3C9NA 3NIFF 5AD0A 3VXOA 4KPHH 1MI5D 3PQYB 5I1LA 1MCHA 3RA7H 4JZOA 2ZSVB 4AY0A 2Q7YA 4NQXB 4HXBL 4L9DA 1EO5A 3D2UD 4ODVL 2FB4H 5EOQL 4G6MH 4MHHG 1JRHI 1LP9A 4GMSH 4MJ6B 3KLSA 3UPRB 3CSGA 1F90L 2YD6A 2BFVL 3GIVA 4WHYH 3RWJB 4OZIA 1IAMA 3LDBC 2J5LB 4IOFD 4JFZH 5FDWB 1T80A 1A4JA 4E5XA 4TYUA 3CVHA 5JA9A 5FOBA 1BZ9B 3VH8A 3MJ8B 4LVEA 1MRCL 4E41B 1VFBA 4JDZB 5E7BA 2HJFB 4UT7L 2NQCA 5EOTA 1RUAH 3W0WD 2BVUA 1WTGT 5SWZB 1IKNC 4GRLD 4PB0L 1KB5H 2VXUL 4UQ2A 4ENED 1MAMH 4YNYB 3QI9A 5FHBL 5LAXA 1J8HE 2D7QA 3V5KA 1VA9A 3NGBB 1U3HD 5F7DB 3T1FA 2GJ6D 3R06B 1LILA 3P9LB 4XH2A 3MFFA 4P59H 4HUXB 2VR4A 3JTTA 2OLDA 5IBTL 4B53A 2XV6B 5I1HL 2JJTA 2XN9E 3IFLH 4KTDH 4WFFD 1R3KB 3HLAA 3ZYOA 5DFWH 4MDIA 3BP4A 4Z9KB 2HJKB 5CWSA 1MFNA 4P9HL 1SYVB 1OLZA 2L0DA 3ESUF 3C2AH 3ZDYF 3FB6A 4GMTL 3WL9A 4ZFOL 4J8RB 3L5WB 4P2RA 1P9MC 2WBJC 3BD3A 2C3HA 1GAFL 2LU4A 4WJ5B 5FUOL 3UJIH 5I1DB 4R2GB 3KWWA 2BMKA 5D1ZC 3MRRA 2Y25A 1NBZB 3DO7A 2UZXB 1AE6L 2Q8BH 4W6XB 5TGBA 3ROOB 1I1YB 1DBJH 3D18A 2D2OA 3PWPE 3DRQA 3RI5K 2OK0H 3H0TB 3JZ7A 1CFVH 1QFWM 4YPGB 1LO4H 2QHLA 3F7PC 5I73C 1S7WA 2CDEB 1UFUA 4JQIL 5FV2A 3GHBL 1T66C 4TNWK 1RJLB 4KZEL 5J3HD 1LVEA 1Z9OA 2KZ1B 1SEBB 3MRKB 2FBOJ 5KSBA 1CU4H 4WO4D 4Y2DD 2PXYD 4JRXD 1VADA 3GHEL 4Y4HA 4BH7A 3K4AA 3FOLA 3FQRB 4X5WB 5DI8B 4ODXB 1QO3A 1V05A 3VXTA 1T2QL 3PV7A 3OWEA 3ULUE 1NAKL 1X5JA 2C3GA 3SPVA 4S1DD 4ZTOL 2JELH 5MENE 1Q9WB 2OQJB 1AQKH 5DZLA 4CADB 3EOYG 4HJJH 3D39A 4FTVD 1O7SA 1QQDA 3P73A 1OP3K 4KZDL 4PLKD 2NY0C 3U79A 4FQJL 2RB8A 1RZJC 5D8JL 4HAFA 1NFIA 2XXCB 4WHCA 5DQJB 4R0LA 1A7NL 3MROB 4EZMA 4U3CA 2V5YA 3AXLB 1NBYB 4HG4K 4HF5H 3GRWH 5A43C 1NL0L 4LMQE 5I1IH 2BJMH 4KI5E 4JZOB 2APVA 2BSSB 2LAAA 4JVPA 2YXFA 2ENSA 1YA5A 2H2PD 1A7RH 3MBXH 4NQCE 1G7MB 2NLJA 3BMVA 3L5IA 4XMLL 1RURH 4PJXE 2DQJH 5E6IC 4O4YH 4GG6F 2HP4A 4LSUL 1N26A 1XAUA 3UJJH 3KPOA 3HC4H 3U82B 3F6LA 4GRWB 4X99A 1EEUA 4OLVH 4P4KA 2OL3A 3STLA 4LP5A 4Y16B 1L4IA 1CFTB 1JYXA 3QBTB 5CEZD 1FE8L 2JIXB 2FYYB 1NEUA 4H88L 2AW2A 4OFKA 1DQMH 4PJDF 2Z93B 4YDVB 3MLZH 3MXVL 4MMXC 3QZWB 1XF3B 1OARH 3QI9B 1U8JA 3VFWB 3UDWA 3QFDA 5JHDD 3QR2A 4FABL 3MFGB 4MNQA 2B2XH 3JTTB 1S7VB 5I8EA 4KVCH 5JOFB 2ICES 5DD5H 2EE3A 2J8UA 2RFXA 4GBXD 4OGAD 3T09A 4G5ZL 1X6LA 3PHOA 2XICA 2VRAA 2NY3D 3QAZB 4WI4A 1ZLSL 4DAGL 3ZE0E 5CWSB 4CVZA 5F72S 3SDAD 3ULUL 3UZQA 2BVTA 1I7UB 4N8CH 3FO2A 5B3NA 1TTUA 3O2DL 3TJHD 4X6CE 1W0YT 2YD7A 3RGVA 2VUOA 2Z91A 3MMEA 3HPLA 4QWWC 1AIFB 1CQYA 1M1SA 1QNZL 1BD2B 4ZXBA 5SWQB 1UCBL 4XWGL 4PJGF 4AQOA 3D18B 3S88H 3NCBB 3IDXL 1AQDB 3SKMA 2VLKD 5SX4I 2E7MA 4KRPB 1CFQB 4QGTA 4U6YA 5DT1L 4GSDH 1FGVH 2DQDL 3MCKB 3VD9A 1J1XH 3D3VD 4R8WH 4UTBL 3T4YB 3LZFH 1D5BA 1DBKL 1LWRA 5EZJA 2ZWLT 3BGMB 5IFHH 3K46A 4XCCL 1MJJB 4CU8A 4HS8L 2AJYL 2VXSH 1YYML 1R3JB 5C6TL 2AS5M 3VXTB 3WIHH 4X4YA 2BNRE 4MCYA 3O8XD 5LXGH 1UGNA 3SPVB 1TQCB 2BVOB 4QTIL 2X10A 5DEGA 1DZBA 2ADIA 2DIAA 4OF0A 5DJZA 3V0VB 2HH0L 2DKUA 3SE9L 3BP6B 4LSRL 3MNWB 3CFKA 5EBWA 2XKNA 4Y19A 3VGEA 1FYHB 4X4XA 3TBWA 5CZKA 4EI5B 3DIFA 5E4EB 3RX8A 4Z7UB 1KCSH 4ODBD 4R0LB 1U92A 1FORH 4ALAL 1DBML 3RWIA 1RIHH 1I8IA 4RFOH 1F6FB 2BHZA 1S9KC 5FECA 2MCPL 4Z77B 4P2QB 3KPSD 4JFFA 1OCWL 3SBWA 2CKNA 4M62H 5GHWH 5J11B 1M6OA 4R97B 5DTFA 2VMFA 3UTSD 4XP4H 4KH2A 5ESQB 3S4SB 3CU7A 2EDTA 3NN8A 3VGFA 4OIAA 1DQLL 1I1FB 4WFEE 4ZMAT 1I8LC 3FKUS 1I7ZA 3ZMRA 3MLYL 2HN7B 4Y8AA 2VZTA 1KFAH 4PJCE 2N7BA 4ERSH 3VDCA 3QDHA 4XNYH 2XZAL 4M8QA 4PJEB 5C0IA 1J8KA 4PRBA 4H8WH 4JFDA 2XZZA 3DX6B 3MOBL 5IEKA 4X6DE 4EUPG 3VDBA 4MAUL 2OTUA 4LCIL 4TSAL 1IAII 1ZKAA 3QFDB 1J86A 3TO4B 3F6IA 1S9YB 2VR9A 4JG1H 4NDMB 1G9NC 4TPRH 2DLFH 2YPLB 2R4RL 3WLWD 1AD0A 3LIZL 2Q8AL 1DL7H 4BSVB 1IGTB 5C08A 4HIEA 1JZ8A 2NY7L 1K8DB 4B7IA 3CMOH 3QDJA 5F7FA 1IM3B 1U6AH 1A0QH 1B6UA 4KKBC 4M5ZL 4WU5A 3SDXE 3FO2B 4L3CA 15C8H 3K80A 4EQ2A 5HI4C 4JFOA 4YHNA 4M93C 1QRNA 3O3EB 1RULL 3QPXH 1FDLH 1V7NL 12E8L 4AEHH 3V95A 3KYAA 2ADJA 1DQJB 1EV2E 5D6CA 4H0GA 5I0DA 4XI5D 2NW3A 4RFEA 4NWTL 3KDMA 1ZWIA 2NYYD 1YEHH 1OTSD 5D2NA 4JDVB 1FNSH 1UQSA 1W72A 3CFDB 3S35L 3SKMB 2I07B 4GAJH 2E27L 3MLSH 4NT6A 4XXDB 5JXAL 4QRPA 2G9HA 2JJVA 4XPGH 3GM0A 2A77L 3BYYA 2HG5A 1BWWA 5HHOA 5HYJD 2UY6A 5EZJB 3WXWH 1QSZA 5GGRA 3MLTB 3L1OH 2V5TA 2X4OA 3MJ9L 1EAJA 1MHPL 3I6LE 1U8OB 4M6OL 5HHVL 3FB8A 5LQBH 3I9GH 4PPTA 1WF5A 2C3VB 3L7EA 4E42B 3I84A 1KT2A 3D0VB 2WBKA 1J88A 4M9PA 3GSXB 4FN0A 4PUBL 5DEGB 2MTPA 2ADIB 1RZIB 4IRZH 3H9SB 4LPVA 1D9KA 2IPTH 3E3QC 3KYNA 4HKZA 4UBDC 2XKNB 4GW5A 3TBWB 1HKFA 1G7LB 3KAAA 4S1RH 4JHWH 5CILL 2GSIA 3AB0B 3D9AH 4UV4L 2CO7B 1U92B 1N59A 1N7MH 4N0UE 3HI1B 4FHBD 5EUOE 2QQLH 3NACL 5EZIH 2FR4B 3O6LL 2CXGA 4RISL 4RWYL 1N8ZA 5FECB 1BMGA 1PX4A 4HWNA 2DB8A 3QRGL 5C6PB 2HKHH 1OW0C 4OB5L 1Z9SA 1P4LB 2CDFA 3MV8D 2P8LB 3KS0H 1KB9K 2BOCB 1BEYH 3MRDB 2IPUG 3MUZ1 5DVMA 3QHFH 3DV4A 3K8KA 3VWJD 4DUWA 3ULUF 4OQTL 1S5IH 3TESA 1OF2A 1J10A 1S7RA 2P5WB 3GSNB 4X6BA 3S3PA 3OKNA 4RDQG 4G6KL 1ZVHA 2AAVA 4PJAB 4WTZG 3O3AB 4U1JA 5D7IB 4PV9A 4I9WE 5DURB 1CDBA 1REIA 3OKMA 4ODTH 1J5OL 5E8EB 2MOVA 1FNFA 3QULB 2LTQB 1PY4A 1C12B 3VG0H 4KQ4L 4M8QB 5I30L 3BQUB 4PRBB 3UTTA 1CDIA 4AEFA 5I15H 2BRRH 5AZ2L 3U9UA 4QGYA 4RAVB 3IFOB 2IALA 5HPOA 3NA4A 5I1GH 4NQTA 4KI5F 1MFDH 4O51B 4OIIL 1J8HD 2UY7A 2B5IB 4GH7B 1GZPB 3S98A 1QA9A 1IGML 4OKVA 2HRPH 4HIEB 3VGAB 2COQA 2OZ4L 3HNVH 3M1BA 5T3XL 1KIUA 3G08A 4DVRH 1U93B 3KR3H 3L3IA 2DBLL 3MJ6A 3P0YL 4WU5B 2J5LC 5IF0A 2JK5A 4XNQA 1QFWI 4F7CA 1BBJA 5ILTH 5FGBA 4JFFE 1QHPA 5IESH 4I48A 1ZVSA 4QOKA 3MV7D 4PBVC 2ENYA 1JPGB 3SCMC 1CXHA 3X11A 2DQTH 4X5XA 1MWAL 1S9WB 1DP0A 2QLVB 3B9DA 1CFBA 4IRSA 5T1DH 4JQVC 3MRGA 1NMBH 3NGBC 3TZVA 1KPRA 3O4LA 3D48R 4K3JL 4MGXA 4XNXL 5CJXC 4YE4H 1U8HB 2ILLA 1GL4B 3Q3GA 3WEXA 3IFPA 3G6DL 3SGEH 4UINH 4JJ5A 5I18H 3ZE0F 3GSRB 4MA7L 4XC3H 5F9OH 4PYGA 1FFPA 4M1DL 1HQ4A 5EBMB 5BOZG 4M48L 4RBPH 1JGVL 2YWZA 3MJGX 3B9KD 3SJVB 3ULSB 2ZCKH 2VISA 3VXSE 4HKZB 4N0CD 4GW5B 2BK8A 2VWEC 2AKRA 2FBJH 1U3JA 4F9PC 4QRRE 4LLVA 4Q9QH 2UZYB 5IUSA 2IADA 4QCIA 1LDPH 5KZCD 4MS8D 1CDJA 3CH8A 5FYJU 5C0AB 3LHPL 2AGJL 5INDB 3E1F1 4KI5D 4KGJA 4L4TA 4DGYL 1FAKT 7FABL 2I24N 1LE5B 5KSVB 1IEAA 3RPIA 1LEGB 3OBAA 1S7RB 3OF6A 2D7MA 5KANG 4LLYB 5DLML 2F15A 3PUCA 4ZSOB 2B39A 2UWEB 2CJUH 1KCVL 3OKKB 3CPLA 2JJSA 1KLGA 2XZQL 3HUJB 5BS0B 4P2OA 4U1NB 1J0YA 4S10A 5IG7B 1IAKA 1AO7B 1QSFD 3HZKB 4HLZH 2VL4A 5E5MB 5F88A 3MRLB 4U6XA 2GJJA 3IJYB 4KQ3H 4D9LH 2YUZA 2X4RB 3B8YA 3RHWK 1I9JL 1T6WA 4JM2A 1FL3B 5ACZB 5JIIA 4WCYL 5DJDA 3QIUB 5GSRA 2GSGA 1JF1B 2IAMD 1INDH 2DWEA 3HRZA 1WISA 3C5JA 4FQ1L 1Q0XL 3CH1A 5L6YL 3RU8H 3GUTB 4LGRB 3MUGB 2VABA 3UYRH 3PP3H 4HWEL 3S96B 5HD8D 2F8XC 4Y16C 3EUUA 2CKBB 4MNGE 5B3JE 1CXEA 1ZVSB 4X8JA 2WUCL 3GM8A 4QOKB 5EU3B 1OHQA 3EJZC 4NZRL 5CJOL 3MV9A 1F4YL 4PJCF 3DI2B 3VGBA 2D0GA 4HS6B 5GGVH 4OF3A 1ZA6B 2C3WA 4L9LB 5CBAB 2YRZA 1A3LL 4X6DF 5BW7A 1WCBB 3MRGB 2B1HL 3Q5YA 3BKJH 3TBYB 3IJHA 3QFJD 4ZFFB 1F13A 3S36L 3P30L 1AXSA 2OJEA 3PDOB 1NMCB 1J1OH 4N9GA 1OTTD 4I3SH 3CXDH 1FYTE 3QAZC 5JTWA 3S3SA 3FN0L 1D5IL 2EDNA 2YWYA 1YC8A 5IW1B 4Z0XA 3QDMB 1BWMA 3TN0D 3SDXF 1IILE 1EVUA 1RZGB 2BNRD 3BESR 1XGUB 3EOTH 4LHQB 5DHYA 2D4DA 1M7IB 4U1HB 1TJIH 3RZCA 1YY9C 1EJOH 5TF0A 3GNMH 2VISB 1QBBA 4R7DA 5B8CB 5I8CB 4JM4H 4WUKL 3E2HB 2IMNA 2VXVH 4PTUA 4MB3A 1R5WA 1XGYL 3INUH 5IFAH 2NY4B 4Z7VB 5IEHB 3U46A 2GY7B 4IHOA 4KRPC 4L3ED 4NCC2 3O9WD 4KK9C 4LK4A 3DGGA 3DPBA 4WNQB 3WHXB 4ODHH 3Q1SL 4P5KB 3P4MB 3WIIH 3U36B 1F11A 5IIEB 2R2HA 4Y89A 2Z31A 3BKYL 3WNLA 2VDRL 3QNYA 3ARDA 4RGOH 3TO2B 1IC4H 2AXHA 4HUVA 2X4PA 4NN5B 3RPIB 3VFUB 4NO2A 5IHUL 1TQCC 5DJ0A 5C0CE 2NNAB 3MREB 3PWLB 2XQBL 1I1RA 1VPOH 1S3KH 4XNMA 4JY6A 5HBBA 1TQBC 1FSKC 2J8OA 3MYJB 3MRFB 4WFED 5ICYB 4GKZA 4EI5C 4KMTH 4OT1L 1R3HA 5IOPB 1A7QH 5GGQL 1KC5L 1N6UA 2W59A 5EUOF 5F88B 5CMAA 2I60L 3HR5A 5D71L 1AP2B 1GGBH 4U6XB 4JN1L 4XP9H 4PJHE 4NP4H 1ONQB 2X1WL 2F19L 2EEDA 5B4MC 1OAQH 5FYJE 4ZUSA 4OLWH 2CKBH 4KROB 4QRQA 2FATL 3MACH 4L8SA 5IB5A 4MNHA 1KACB 4R97C 5E8NA 3QUKA 4TTDC 4RA0C 4WWKA 3L95B 3CVIL 3LKNA 3NCMA 3MODH 4L5FH 2E9JA 2EE2A 1OSPH 3LS4H 3NFSH 2W9EH 1IRAY 5I17B 4G43A 5GJSL 1FL5A 1UZ8B 2DJSA 4XVJH 4F7EB 2HTKC 4OQ1A 4BZ2H 1XMWA 1ITBB 2DQHH 1NCDH 4FG6C 1MF2H 1EGJA 1FHGA 2APBA 4N0YH 5K59E 1NGWB 3K8MA 2D7TH 1JI1A 4IOIB 3TO4C 4GXVH 3W11D 1RUKH 4XP6L 4XPFH 3QUYB 3T3ME 2EXWD 4WFGE 3TIDA 4CU6A 4UAOB 2G60L 4DGIL 4JPVH 3UTOA 3KJ6L 4Q2ZA 1I9IH 2WLYA 3P11L 1YDPA 1OOAA 1KTLB 1YEDB 2C3XA 2H1PL 1UKSA 5FCUH 1UZ6E 3HG1E 4JZNA 4OLZL 5DHYB 1GGYA 2UYLB 4XBEH 1VGEL 2BOBB 3RZCB 3WYRA 2VLRD 3QUZD 5GZOC 2A73B 3WFBL 1IVLA 3DWTA 4GUPA 3JV6B 4HIJB 4AMKH 4K2UL 3IDGB 2RQ8A 3W81A 4PP2A 3B2VH 4KY1H 3VI4E 4G8EA 4KKLD 3QEQE 4RFNB 4TOYL 1U41A 3V5DA 1UXSA 1GJIA 1MCBA 3AMLA 2AEWA 3GSOA 4XZUA 4FXLA 1VGKA 4NYLA 4MVBC 3T3PE 3RVVC 1NEZA 2HAZA 1FBIL 3KXFE 4EVNB 2WUBH 4R7NB 1YEIL 5FYJL 1EMTH 4WEBH 4O2EA 2P5EA 4U7MA 3HI5L 4N90D 1N4XH 5KVDH 5DJXA 5BXFA 1CL7I 3U4BH 3QXWA 1I1AB 4I18B 5BRZD 1NUFA 2EYSB 3TF7C 1R3IL 5IQ9A 5IB2B 4P3WA 4DQOH 4ZAKD 1JK8A 4NRZA 3BZ4B 4Z95H 3SE3C 1R5VB 3AMKA 1EHXA 3SDCD 4K9EC 4LLMA 1JTPA 1PKOA 3G5XA 3AS0A 1E4XI 3V8CA 1MHHA 3CDFA 1BGXH 4XAWL 2XPGA 5F9DC 5TQ2L 4I9WD 2MQ0A 3QIWA 3SDDA 3TBTB 1DLHA 4I3RH 5CMAB 4HGWA 2DYPB 2OS7A 1BX2A 4DKFL 3BJLA 4LSPH 1PAMA 1U58B 3C6LA 2OR8A 3ARFB 1FP5A 1VFOA 1NC4A 4NM8H 3DROB 5TDPA 2VR5A 1V3JA 5D72H 1H5BB 3JV5A 5B39A 1QLEH 4P3DA 2YUWA 3K2UH 1EFXB 3SCMA 3QUKB 3KPNB 3AM8C 1QG3A 2AP2A 3RVWD 4WWKB 5IB3B 1IQWH 4JO3H 1K3ZA 3HAEB 4X0KA 2WWMC 5FM5O 1T83C 1ES0A 1CLZL 3G5VA 3H9HA 4YR6B 1GYAA 4LHUD 2NY1D 5KSAD 2VAAB 4HPYH 1HHHB 2LTQC 1FO0A 2R69L 5FA4B 3BQUC 1P69B 1X4YA 1IGCH 3W5MA 2R4SL 5J1SC 5HVFB 1IGYB 3M17A 1C7SA 1U3YA 3KNBA 3WUZA 4GKNB 1DR9A 2KQNA 5K33A 1S78D 3M45A 1F3JB 2BY2A 5DC9B 4G7YH 5DD1H 5CGTA 2B5IC 3FCTA 3SKJH 1Y6KR 4DZ8A 3TBSB 5CZVH 4Q2ZB 3VGAC 3S36X 4GO6B 3V9FA 5DR5H 1Z0NA 2FEEL 1P1ZB 5I1EH 5ETUA 4TUOB 4PJ9B 4F7PB 5IVXA 1CBVH 1YNLH 4JZNB 1HH9B 1MCDA 1OPGH 5B3JF 1FIGH 4PRHB 1I8KA 2NMSA 2CRIA 5FKPA 2PW1A 5C0BB 4X83A 5IQ7L 2DD8L 2YD5A 4UMGA 4M6MH 2VNCA 4KKAC 4X98B 3CUPB 3VXSD 2DLTA 1P4IL 3DARA 4BM7A 3C5ZB 4O5LH 1ZT7A 4QRRD 3GSOB 2VLLB 1VGKB 4NYLB 4PR5A 3D0LB 1HOCA 5JA8B 3GSWB 4MAYC 1RK1A 1SJVA 3BI9X 2WMPA 3O2VH 4NUGH 4EQ3A 4NQDE 3HCVA 3R4DA 1OD7A 4ZPVA 3QCTH 4CNIA 4LCWE 4ORGB 4EN3A 5EPMA 1AJ7H 2NY5C 2MCG1 2NXYD 1BIIB 2BNQA 1F6AA 4MMZC 3RL1B 3LRGA 4EI6A 2CMRH 1K3IA 4NZTL 4PFEA 3EJYD 4JJHA 4QHNA 2QBWA 1MQKH 3U7WL 2K3TA 1X44A 3DI3B 4MA1B 3CZFA 5JW3H 2FHFA 4X9BA 4YHPB 5C09E 1AD9B 1BQHB 5CEXB 4LLMB 2RCSL 4OM1L 3O6KH 4WI8A 5E56A 3UPCA 4PJ7B 4W6WB 4PYHA 4LOUC 5E8OA 5HJ3A 4JQXC 4Z78A 2PCPA 1T20A 4G8GE 3GBNL 4RQQB 2EKSA 3EW3B 2IANA 1CICA 5HHXH 4NQED 1B2WL 5SX5H 2F53E 3I2CL 4ZNCD 3HAEH 1KIPA 2E7BA 5TDPB 2FX9L 4I13B 4NM4L 1FLTX 1AY1L 1R6VA 3I85A 5CUSL 1U8LA 4NRXB 4P57B 4NN6C 1G9MH 1S9XB 5CIPB 1Z9LA 1TITA 1IAOA 3CXHJ 5J1AB 2FD6H 3VFOA 3TM6A 3PF2A 1EGJH 3H3BC 3B9VA 3T0EA 4O2FB 3H9HB 4CMMB 5F21B 3U1SH 5DJAA 4NZDA 3NPZB 3SE8L 4HKBB 3MCLL 1NKRA 3H7BA 2V5RA 4D0DA 3SGKC 1I7RA 1T21B 1C5CH 5DUPH 3T0DA 4PJHF 4Y1AA 4JFEA 1A1OB 4NNPL 5D7KD 3TNMB 1FAIL 1R0AL 3C60B 4Q7DA 4H1LA 1NGPH 5F96H 3QIUC 3RUGA 4DZ8B 4HC1H 1B9ZA 2VSCA 2HWZH 4Z5RB 3V6ZA 5T1KA 3WSQL 2DL2A 2O61B 3HZVA 5D7JC 1KJVB 1NGXB 2A0LC 1BOYA 3LSOA 4ZPTA 1IM9B 4MJ2A 5IVXB 4XC1L 2HJLA 2GIYA 5L2JB 3OXRB 2EYTA 5HGDA 3EO1B 2XWTB 3PWVA 2AJ3B 3EO9L 5EWIL 2PW1B 3IXAA 4YWGH 4YBQC 4KHXL 4B41A 4F33A 1M7DA 3QDGD 5HTSA 5SV4A 1HH6A 3JBG7 4L9LC 1ZA3B 4L4VD 1NC2A 2QHRH 4UILL 1U8PA 1OAYL 5K59F 4FP8H 1Q1JL 2JJWA 4PRPA 1NFDB 3X12A 1R0AH 4TSCL 1T5WB 1NMCC 1UH2A 3T3MF 1DQQA 3O3DB 4MQTB 1FNLA 4Q74A 3VE0A 4EI6B 3OHXA 1KLUA 4DEPB 4JANA 1YNTA 1RUPL 1OGAE 1UZ6F 3HZYA 4HFWB 4XPBH 3GB7A 4GKSA 4MQ7B 1RJCA 3FQTB 3WUWG 1SVCP 5DRZA 1QPXA 5L88H 1YMMA 5B8CC 1KGCD 2AQ3A 2JE8A 3P4OA 5CLTA 5T3ZH 5CD5C 3RDTA 3CLEL 2NY4C 4DN4L 5I1CH 4YAQA 2YD1A 5F3BA 2VO5A 1YNKH 3EBAA 1C08B 4CRPA 3HS0A 1YUHA 2IANB 2E7LC 1CICB 3T3PF 5CIPH 2X4SB 3KPPA 5K9JH 2X41A 5IWLA 4N8VA 1YEEH 2WWKT 5IKCA 2ZUSA 4K07A 2N7AA 1QKZL 1TZGH 2DTML 3OPZL 2I5YH 5FYJD 2AK4D 2GKIA 1U8LB 4DGVL 2ESVD 43C9A 1S7QA 1FO0H 2JB5H 4KPHL 1DDHB 4S1QH 1V3MA 3DETC 5DJ6B 4L8CA 4QXUH 4PLJC 3LKRB 3DTXA 1A6TA 4ONHB 1E4JA 1XIWC 1NCAH 2FB4L 1C5DB 5IW6B 1RK0A 1EHLH 4G6ML 3VXRB 5J6HB 4HUWA 3CSPA 3RKDC 3TJEL 3H9YA 4GMSL 3RWFB 2H32A 2D03H 4JFZL 4U1SA 1AGEA 1NCBH 4JRYA 4N9OB 4J3VA 3PQYE 5DZOA 4Y2OA 1U8KA 3LOWA 4H1LB 3WFDL 5F9AC 2V9RA 4MSWB 4KROC 1RUAL 5JQ6H 25C8L 3T2PA 1CVRA 3P77B 4NNXA 3VW3H 2R0ZL 3V6ZB 1WZKA 3QHTC 3HZVB 3VFMB 1G7HB 1CZ8H 1ZLWH 4HH9B 1DLFL 4P59L 1NGYA 1PFCA 5HVHC 3HG1D 3JWOH 3IFLL 4KTDL 3QUXB 4NRYB 2NX5A 5C0DA 4F33B 4OI8A 4RWHA 5D93B 4NO5B 4Q97A 2WBJD 4DOHE 1I4FB 1KENL 3JTSB 2GW5A 4JE4B 1F97A 2H2SC 3C2AL 3EYOA 2HTLC 5SWZE 3TCXA 4KAQL 3ZT5A 5D1ZD 4OGYH 4Q9BA 2J8HA 3WIFA 2ZSWA 1VESA 5EC2B 3UCRA 3UJIL 1IKFL 4R26H 3FTGA 4HUUB 3DXAA 3QUYC 5FUZL 4OZFG 2X4TA 2Q8BL 3SE3A 1DQQB 4UAOC 1DBJL 1T66D 2YS4A 4OF7A 3VE0B 3DMMA 1EUUA 2FO4A 1CFVL 4JANB 3MUHL 1LO4L 5CBEA 1WAAA 4JFQA 4CN4A 1QUNA 4K3HA 1U8QB 3O4LD 4HPOH 4HWBA 5DRZB 5IMOA 3BT2H 2J6EL 1YMMB 5I2IA 1HXMB 1HYRC 3W5NA 1A7BA 2QQKH 3L3JA 4LL9A 1JYNA 2WM0A 3B43A 2JELL 2OXGA 2LFGA 1HSBB 4RFNC 4HWUA 1AQKL 1QYGL 1YUHB 2NY0D 3HNTL 5H35A 4PG2C 1T1YA 2DLIA 1MRDH 4LKCB 2MPAH 2PR4L 1NCUA 1L7IH 2ZOKB 3K0WA 1LHZA 5IKCB 2M8XA 2W65B 4CBPA 1BVLA 1LK3H 2R1YA 4TSBH 4Z7WA 4XT1C 4U6TA 4ZFOB 4WV1A 1I1AC 4I18C 4LSVH 2Q20A 4HF5L 1J05A 3GRWL 5I1IL 5E6ID 2PYEA 2BJML 3F62A 5ALCH 3MBXL 1A6WH 5EZLB 3TBVA 1YMHA 2DQJL 4ZUTA 2EDHA 4PJ8A 1KCUH 5EZOH 2QQNL 4H1LH 4P4RB 5D96B 5JHLH 1RZ8A 3HC4L 3KVQA 4YDLB 4FZEH 4NHUB 4OLVL 1WBZA 3V79C 4OBSA 4M7JH 5C7XH 4JFPB 3KPRD 5FO9B 1AGEB 4NC1C 3SQBA 5JXEA 4M3KB 1OWRM 3ARFC 1U8KB 2DIJA 4HFUH 1P7QA 5BO1L 5EU7C 1H0DB 3VGHA 1H5BC 1DQML 3AS2A 2D9QB 1KTDA 3EYUH 3RTQA 1CS6A 3MLZL 3RVTC 4NNXB 1FJ1B 2HVKA 2YPVL 4RGNE 3O4OC 5JR1H 2DQCH 1JZ6A 3LEYH 1RMFH 2DN7A 3RY6C 3QISA 3WS6C 2B2XL 3G6JA 4OZIE 5DD5L 1SQ2N 4X6FA 4MB4A 4PREA 1JJUA 4ODVH 5EOQH 1G9MC 4MAYA 2BRQA 4GG8B 3OQ3B 3M8OH 1PEZA 1ZLUH 2W1NA 4N8CL 4QWWD 3HN3A 4HIHA 4QRUB 5D7LD 1ETZB 1EX0A 4QKXB 1MREL 4IIQC 2Z4QA 1F5WA 2EIZA 5JPMA 4LHUG 1AC6A 4K7FB 4D3CH 2EZ0C 2FIRT 2MWCA 3DXAB 2V2WA 1JHLL 3V7MA 3ULVE 4UT7H 3UTZB 3S88L 1MJ7H 4U7KA 3ZYZA 5DK2A 5HYQB 3DMMB 5I76A 4Y5YA 5HXMA 2F74B 3RNKB 1WLHA 3PWUB 1FGVL 4JFQB 5ADPH 1FNGA 4PJ9C 1DVFB 4HWZA 4I4WB 1J1XL 5D5MB 4JDTL 3VRJA 4R8WL 2QSVA 5CSZB 1MCRA 3ZZ1A 1CLYL 4HEPG 4UTAH 5C3TA 4APQB 4J3TA 4P2RE 5I1HH 2WANA 5BZWB 1EEYB 2EH8L 1NCNA 3PWPB 4ORZC 5IFHL 5C09D 2EICA 2VXSL 1BD2E 3WIHL 1SJHA 1DJSA 3L3JB 5MEPA 3KYKH 3D25B 1T4KB 3ARGA 2GFBB 3DX7A 4XP1L 3C5ZC 3QQ9C 3TLRA 1RZ7L 1XGTA 5ISZA 5D1QB 2BVYA 3GMLB 1GAFH 1CFNA 1U95A 3TH2T 1ZV5A 4HCRH 1BVLB 4F80A 5EBLA 4M5YH 3MRBA 2F53D 4XCNB 1NJ9B 5KSBE 2VL5A 5FYLH 4BH8B 5K9KB 1KCSL 3VD7A 5KS9B 1FORL 2CLZA 2R8SL 1RIHL 4H0IA 4Y4FB 1JGDB 1FZKA 3GHBH 4MA1C 4KZEH 4IMKC 1NGQH 1MCLA 3L6FA 3HPJA 3DECA 3D39E 3GHEH 4M62L 2Z35A 4U1GC 5GHWL 1H8OA 2HLFC 4WI9A 2A6KA 1GGTA 3DURA 1WBZB 2DDQH 4XP4L 5GGRY 5E24E 2V2TA 5T1LA 4KK8C 4NQCB 5IBUG 5D7JA 2Q86A 3F7QA 2AXGA 2NR6C 4PJXB 3IDNB 4DKEH 1JYWA 2Z8RA 2VE6A 1CLOH 3O11A 1P7QB 3PNWA 4N1CA 4MJID 2P8PB 3E8UH 3BUYA 4MA3B 4P2QE 3ULVL 1W0WB 1KFAL 4KZDH 4H25A 4ERSL 3PDDA 4FQJH 4F7TB 4Q58C 4HUNB 5JPNA 3UP1A 2EDQA 3A6BH 4H8WL 2H6PB 4PBXA 4Y4KB 3MA9H 1MHEB 1DQDL 4X9FA 3MLXL 3QXDA 2DLFL 3SKNB 3SE4A 3VGDA 4NO0A 4M7ZB 1X5FA 1B0GA 4KKBD 32C2B 1ZSDA 3NPSC 5HI4D 5IHZB 1AFVH 3KGRA 3X14B 1NDMA 3CMOL 1U6AL 3FFCA 5F9JB 1MCKA 3PWJA 4G9DA 1QSED 4PJEE 4AEHL 1FDLL 4OUUA 5HDBE 3ZKXB 3GI9H 2BVEA 3BIBX 5T1MB 4V1DA 3RWEA 5BQ7A 3C60C 2V2WB 3DUUA 1FE8H 1F4AA 1PDKA 4HWBH 1TZHA 3Q6GH 1FNSL 2J8UE 4GAJL 3L3HB 3MLSL 4X6CB 3UPAA 3OSKA 2FIKB 1YQ2A 3PDGA 4XPGL 1FNGB 4CUCA 4UIMA 3P0VH 3DJ9A 2PTVA 1OGAD 2FJGA 1OSZA 1TZIA 1S5HB 3PL6C 3L1OL 4WUUA 5EBGA 4C56A 2CUIA 5EH1A 4HHAA 4M02A 5LQBL 2EDDA 1WC7B 3I9GL 1SJHB 3G5ZA 2XIDA 2IJ0C 3WUWB 1FL6A 3DX7B 5C07D 5JUEH 3UBXG 2Z8SA 4UBDD 5L0QB 5IB4B 4LAQL 2Y5TB 5DK0B 4IRZL 4G8FA 5E9DD 2IPTL 3V6OA 4F7MA 4I0PB 2H8PA 2BSED 4PRAA 4XWGH 3RWGA 3ECBB 4S1RL 1T2JA 5F71A 3D9AL 2VL5B 2GTZA 1XIWA 2OP4H 2ITDA 1N7ML 2VN7A 2CLZB 4MD0B 5T33H 4DEPC 5HYIA 2QQLL 4JO4L 5EZIL 3BP5B 5IM7B 5DT1H 5A3IC 3AGVA 3BP7A 3MNZA 3EOAB 1AXTL 4L3AA 2G5BA 1HHIB 3DRTA 2HKHL 1W2KT 1G0XA 5F1NB 5ABDE 1BEYL 4XCCH 3GMMB 1HWGB 2D7NA 4HS8H 3P4NA 1EERB 4Y19E 4YO0A 5C6TH 4EUPA 2AJSL 2AJZA 3MRCB 1FIEA 3CDYA 1M05A 4X6EA 2V2TB 1UEYA 2X89D 4G42B 1JHTA 3A0OA 5F3HA 3F5WB 1NDGB 4LSRH 4ODTL 2AEPH 3BUYB 5EG6C 1JNLH 3VG0L 4ZD3H 5GRJL 2DOCA 4OI9A 1KLFA 3MRQB 5I15L 2BRRL 3OKYA 2Z8VC 4DVBB 4LU5H 3QIBB 2PNDA 4JB9H 5LBSH 3U0WL 3QEHA 4LHJB 1ZEAH 3IF1A 4RMRA 1JWMB 4UU9B 5LKNA 3LH2H 5D70L 5SWSD 2ZP0T 1UXWA 1OCWH 1S7SA 4HDIB 1XGRB 1ZSDB 4PJAE 2HRPL 1NDMB 2HKFL 3HNVL 3UYPA 1I8MB 2VLJB 3AC0A 4DVRL 3KR3L 1ZLVH 1CF8H 3IRPX 3ARBA 3QPQC 1A6ZB 3U4AA 3Q5TA 4G9DB 4M61B 5TDNA 1D5XA 2DICA 1XT5A 4HV8B 4E41D 3SCMD 4JFYB 4JFDE 4P46C 2P24A 5E5UB 5SWZD 4RZCA 3VXUD 3D69B 4OCRH 5LWYH 1DQLH 5GISL 1OAUH 2MHAB 3DUUB 4R3SA 4FQXA 3MLYH 1JZ2A 2ZJSL 1PJ9A 4Z7QE 2XZAH 4AK1A 5IMLA 3EYVB 2QSCH 5T1DL 5A40E 3CX5K 1NMBL 1EIBA 3ALPA 2Q87A 5B38G 1OQOA 4NCC1 4TSAH 3QDJE 1XCQB 3WDIA 1JRHH 2EDBA 4YE4L 1NCTA 4GRWF 5JDJA 4QTHA 2IBBA 2FJGB 1G7JA 3O41A 4O02L 1QRNE 3O6FC 1MCJA 4LEOB 4UINL 2R2BA 3LIZH 3N1FC 5I18L 4P5TC 2F5BL 4XGZB 5D93C 2NY7H 1FVEA 5HGAB 5F9OL 3ZTJG 2F54A 3GGWB 2V5MA 4YPJA 4LNRB 4M5ZH 1PD6A 3MA7A 3CFEB 3LKQA 4G6AC 5M94B 4W70A 4ONFH 2CPCA 4ZO7A 4HK0B 4GAYA 2ZCKL 1EEZA 1WWBX 4OD1H 1ZE3C 2OX5A 4FFZH 5HHOE 5MERB 4K8RL 4IM8A 2QADB 2FBJL 4Q9QL 4UUJB 2ITDB 3TYGH 3BKCH 1NFKA 2E27H 2XG5A 1AGCA 5AYUL 1RZKH 2CLRA 2P49B 1LDPL 5I74B 4D9QD 1CCZA 3FONA 1KXTB 2EE9A 4HS3A 4U31A 4UNVA 1H15A 1IGFH 2FRGP 2WV3A 4OCYL 1MWAB 5F7WC 5TJWK 5IR1B 4JLRA 5EUOB 4MCZA 3JUYA 4M6OH 4OZ4B 5DQDH 3WO3B 4D2NA 2E8ZA 4OI7A 4OCLC 5HHMB 5HYSG 4P23A 1IMHC 1BF2A 3IGAB 1M05B 1P84K 5AG8A 2ZUUA 3DYMA 2ATKB 4PRIB 4Q6YA 3WJLA 1H3TA 1TVBA 2VDPL 1JN6A 1KJMB 1KG0B 4YLQT 1XF2A 1T1ZB 2OMBA 1JHTB 3SEPA 5F3HB 5IMKA 3JSSA 1AKJB 3PP4L 3MPCA 4PRDA 4WW2A 1CDYA 1WFNA 4P9HC 3U0TB 5KSBF 1MI5A 5ANMB 1CG9B 1F4XH 1X5GA 3B4NA 3TCLA 1A5FH 3KYOB 1KPUB 1M71A 4KQ3L 4D9LL 5LGKA 1Q72L 3O6LH 5FXCH 1A7OH 3LV3A 3D2UA 4LCUA 4RWYH 4AQ1B 2AXJA 2DS4A 5ID0A 4U6HA 3QO1A 1QPPA 4ZSOE 2UWEE 1LD9A 4OB5H 1INDL 4G8IA 4Y16D 2MSPA 5D96C 4E0RB 3RWCA 5DVNA 5DJ8B 1PSKL 5BS0E 4YDLC 3DX8A 1T1WB 5TDNB 5EOCH 4Z7UF 3RX5A 1U8NA 1W72L 2JIXD 3EJZD 5CCKH 1U8IB 3VFSA 1H3GA 3UTTE 4OGXL 5CINL 5DWUH 4BA8A 3IDMA 1DUYB 3W0WA 2P42B 1LE9A 4HX1B 2B0SH 4GRLA 2PO6B 5DRNA 1J5OH 1T89A 1MVUA 5GS1A 1GRWA 3H6JA 1CTOA 4KQ4H 2GJ6A 1U91A 3QA3B 4KI1A 4N5EC 1G6RA 4YXKH 1NGYB 4CJ1A 3BKJL 4DW2L 4JFFB 3VFSB 5GIRB 2K9UA 5AZ2H 3GSQB 2HFFA 3OMZA 3E6HA 3CCHA 3R8BB 3DLQR 4M1CC 4OIIH 1HN1A 2VZUA 1JTOA 4LKXB 4HJGA 1IGMH 4I3SL 3CXDL 2FSEB 3MUY1 5C2UB 4QOKE 5J6GB 1FVEB 5T3XH 1YY9D 4WFHD 2MQ3A 4OD2A 3LPWA 3MA7B 1EXUA 1OAZH 1BD2D 4PJEF 2X5PA 2NTFB 3LKQB 2H3NB 5F7UA 3GI8H 3JV0A 5HDBF 3SO5A 4J6RH 1EJOL 4JPIB 4HKJB 3BEWA 4QYOA 1HDMA 3OJVC 2P8MA 4KRPD 4KK9D 4GJTB 2NZ9C 1G7PA 3BZFA 2VXVL 2EYRB 2Y23A 4FQHB 3INUL 1MWAH 5IFAL 5JW5B 3G5YB 1X5YA 3F7YA 1TXKA 1UENA 1FZJA 4MLSA 5DDHA 2FX8H 4HD9A 3OJDB 2BX5A 3AREB 1DVFC 3QDME 4PGCB 4EUPH 4WO4A 4Y2DA 3WIIL 2PXYA 4JRXA 4WRLA 1RFDH 4HS3B 1H15B 1FFQA 3PJSA 2DQFA 3REVA 2VAJA 3D6GA 4APQC 3G6DH 3LCYA 4F2MB 4JLRB 3QXTA 4RGOL 3WO4B 2FWOA 3FHAA 1AXIB 1FN4B 2VDLH 1JPSH 4MA7H 3C5SB 5E1AA 2G75A 2P45B 4XNUL 1IGJB 4I1NB 5HHQB 1NAMA 5CZXC 3CFBA 4FTVA 1VPOL 1S3KL 5SX4H 4EI5D 1F58H 5D1QC 1DBBH 1S7XA 5HHPA 5C0FB 2YD4A 1CGXA 4LEXH 4IBLT 4OCSH 4PRDB 1UWEH 4LDEB 3VXUB 3ULUC 2VZOA 4KMTL 1WTLA 4WI5A 2HVJB 5I8OH 3EO0A 4R6UA 3FT2B 3KPMA 5B4MD 4U1MB 5GS0L 1HYSC 4Y4FC 4XP9L 4F8TA 4NP4L 3MRNA 2KKQA 2VYRE 1CD1A 4LCUB 3F7VA 5ID0B 4TTDD 4U6HB 3QO1B 1WT5A 3LHPH 2AGJH 2GAZA 2EIBA 1P6AB 4OLWL 2CKBL 5ESVB 2EDRA 4LCCA 7FABH 2A83B 5IFJA 2EECA 3BHBB 4GKOA 4HSQA 4PLNC 2FGWH 3QCVH 2VDQH 3ROLB 2Q6WA 3MODL 4PGBB 3WJJC 4L5FL 4ELKB 1A1NB 3UMTA 5DLMH 3R8QA 1OSPL 3LS4L 3NFSL 2VZSA 1KCVH 2HTKD 4AENA 1LEIA 2V17H 4FG6D 3NCCB 4GRLB 2LV4A 5ICXA 4XVJL 4IJ3B 1YQVH 3VGGA 4HZLA 3TO4D 4BZ2L 3PL6A 2DQHL 1U3HB 1JPFB 4PJ5D 4LSSH 5JHDA 4HMEA 5E99H 2YPLD 5JLZA 3BSZH 4RNRA 3QUMA 2AV1B 3CCHB 4GBXA 1BJ1J 2QQQA 4RA3A 1Z5LB 3SY0A 4XPFL 1I9JH 4BSJA 3TPKA 4OCXL 4WW1B 2VJXA 4HJGB 4PJAF 3SDAA 5BVPH 3IDYC 4R4BA 5D7IF 4JPVL 4HKXA 1I9IL 4FQ1H 1Q0XH 5GZOD 1YY8A 4JHBA 5FCUL 4JN2B 3ZKMC 4XVTH 4XBEL 3ZKXC 2AK1H 5KTEL 2B4CL 5HY9A 1RPQA 2FO1A 1FYTB 1Z9MA 3BEWB 3O3BB 2WUCH 1IAIH 2J1KA 2FJFB 4LVOB 3CC5B 2VLKA 1G7PB 1HHJA 3KYMA 3OZ9H 3D87B 1F4YH 2AEQL 3P40A 5I19L 5I1AA 4MVBD 3LEXA 1WIPA 3B2VL 4KY1L 4OF8A 3RVVD 2UVEA 2NX5D 4LLQA 1A3LH 3D3VA 4NQSA 4WHYG 3VRIA 5ICZB 4C83B 2JCCB 5JIPA 2PXYB 3FB7A 1RHFA 2BVQB 1EMTL 3L7FB 4NKDB 4WEBL 3U0PB 2C1PA 5HVGB 5EOCJ 5FUCE 1N4XL 3O8XA 1N3NB 5KVDL 4GG6A 2GQHA 3PABA 3U4BL 1D5IH 1R3LB 1CE6B 3IB4A 1LNUA 2BY3A 3H9SD 4FXGA 1GVIA 3G6AA 1E0OB 4DQOL 4G9FB 5LCVH 4Z95L 4EIGB 3O45B 2UUDH 5IJKC 4I0PC 2ZUVA 4FQPA 1E4WH 1VENA 4ZUUA 3J8F7 1BGXL 4J4PC 4PJDA 2BSRA 1XGYH 3ISWA 5C0CB 1EHNA 2KPNA 4I3RL 2Z92B 2I9TB 3FQNA 5DRXB 1X5KA 2GI7A 4EDXB 3KPSA 4LSPL 2O5ZL 1T22A 4W68A 1IBGH 1FFOA 1RUMH 4YIQA 2WQRA 1MHCA 3F7VB 2YEZB 4NM8L 3GMNB 3CJJA 5ID1A 4HG4J 1ACYH 5D72L 3DVNB 5TFSL 2P5WD 4LCCB 4R9HA 2WWMD 3KLAB 3LKOB 4QRSB 3K2UL 5E7FA 3UTSA 2AEIT 3IU3B 5IFJB 4NUJB 1QLRA 2FLRT 4HAGA 4JO3L 2CIKB 5IHUH 4CVWA 3PGFH 5DURD 5LG1A 3IDJA 1DQTA 4TN9A 2XQBH 3R0MA 1HINH 4AENB 3UZEA 1FPTH 2XFXB 3BQUD 3AU1A 4NC1E 4PJIA 4NO3B 4PJGA 4N5UA 4A6YB 4UT9H 2Y9RT 4QXTA 5EU7E 1C8PA 5GRVK 1JWUB 1IGCL 3H3PL 4XX1E 1A9BA 4P5TA 2I60H 4F3FB 5I6XB 2MFNA 1SYSA 4CU7A 5EFIB 4RNRB 1HILB 3REWB 5GRYA 2X70A 3QIBC 4G7YL 5DD1L 4M7LL 2HT4C 1UB6B 5HGBA 2NY3B 5C1MB 2UWEF 1GGIL 1WZLA 4XXCC 3MJ7A 2FATH 4XP5L 1LEKA 3MRPB 5IHBA 3I75B 3WS3B 2IH1B 5I1EL 1KNOA 2G5RA 4AIZB 1OGTB 3ZDZE 1R5IB 3T4AB 2Y6SC 4FNLH 2IFGA 1Q94A 3BO8A 4KKAD 1FIGL 4OZGA 4B7LA 1BAFL 4YHLH 3LMJH 4FQQA 4GOSA 4W6YB 1ZS8B 2BCKA 4HULB 1W0VB 2N4IA 2L4OA 2VLKB 3L5JA 5GJSH 1BOGA 3BDYH 3OAZH 4X5LA 5D1XB 5GGTH 5I1AB 1ZHKB 5HGGS 2V7HB 3QWOA 5I8KL 4BUHA 1IEBA 4F8QA 4MAYD 1ZANL 3VRIB 1F02I 4O5LL 5HYJA 1HSAB 5DMKA 4OAWB 1CQKA 2OXHA 3CFIC 3UO1L 5JOPE 4DZBB 4XP6H 4NUGL 3O2VL 1QFWH 1VEPA 3QCTL 3BZDA 3CZJA 3B9AA 4Z0BH 5KW9H 1AJ7L 3OX8B 2G60H 1ZHBB 4W4OA 1DSFH 2CMRL 5C0BE 3SGDI 3UTQB 2H1PH 3SJVD 1MQKL 2MKWA 4IRJB 3BZEB 3G6AB 3KXFB 4R96B 4LP4A 2BP3A 1T1XB 5FGRA 4LOUD 4BQBA 1BVKB 3LRSA 2R0KH 4MD5B 4JEGB 5DZNA 1TMCB 3O6KL 4XAKD 4ZUUB 4NKOA 3W39B 4KU1A 4NJAL 3DVGB 4F58H 5GGSA 2WZPD 4P0DA 3LEVH 4YHOL 5FB8A 4UDTB 2P5EE 2A6IB 1EPFA 5A2LH 5C0AD 2E6PA 2ZUYA 2EDFA 4WEMB 2IH3B 4TOYH 5I74C 5HHXL 3GMPA 3BIKA 3KPQA 3MV8A 3V5HA 4N8PA 2QR0A 1FBIH 4YEEA 5ID1B 3VWJA 3BD5A 4YDKH 4KJYB 4Q0XH 2O5YH 4Z7NE 3T08A 4NKMA 5A16A 4A6YH 1WICA 2DWDB 4S2SA 3FRUB 5CJ5A 1PLGL 4Z7VF 2FD6L 5BS0D 5FYKU 3C8KB 1EGJL 3BJ91 1AO7D 3NAAH 3ALWA 1Y0LB 1TETH 5IROA 5T3ZE 5EN2A 4UZGA 4KJQC 4QXTB 5K9QI 4WENB 4UV7L 5INCB 1TCRA 3STBA 4PRNA 1J8HA 2P47B 4DKFH 2Q1EA 4PD4K 3QIUD 4AH2A 5MHSE 2AXFB 5T1LD 1QLFA 5D7JD 3L3OB 1D7FA 1NGPL 5F96L 1FG2B 3F58H 1ACZA 2A0LD 2XN9A 2WWKO 4C4KT 3OTTA 1OB1B 2HWZL 1JGLH 4J1UA 1SHMA 2HLAB 2DJ4A 2H41A 1KNOB 4LLDA 3ARRA 4OGZA 4YBQD 3MV7A 2NY6B 3RZWA 3EDFA 3X13B 1JMZA 2AJXL 3GJFK 3QG6A 5DJYA 1RV6X 2APWA 3GIZH 5FO7B 3DUSA 2PO6C 1KYOK 1S9VB 2C1OA 5BZDB 5T5NF 2R69H 2GEEA 1JF6A 4PGDA 1Q9OA 1VKXB 1IEBB 2OYPA 4FP8L 5IVZA 2E5EA 4NKIH 3TGXA 2VLMD 3GJEB 2BSTB 1T6VN 3MO1B 2CGRH 5IVXE 4YJZL 3QDMD 5CHNB 5JNYA 1AGBA 1U8MA 4LF3A 4M6NL 7CGTA 2D0HA 1WIOA 5IMMB 4OM0H 2HFEB 1T0NB 4FQ2H 2VIRA 3B9KA 3P9MB 5DUBB 2FX7H 5CD5D 1YN6B 3T0XA 4FXKA 1RZFH 4ELMB 2NY4D 5L88L 3EOBB 4Y5XA 5T3ZL 5IQ7H 3MC0A 2ZOLA 1NSNL 1INQA 4HQQL 1QP1A 5D6DA 1P4IH 3A67H 3ARYA 4I2XA 4ZOAA 5EIQA 5CEYA 5EO0A 4GRMA 2BNQE 1P2CA 4XBGB 3AREC 2W92A 3GMPB 1XR8A 5K9JL 4PTTA 1C16A 3VXNB 1YEEL 1KF9B 2DLHA 1F2XK 4RMUA 3HZMA 3WO4C 3KJ4C 3DETD 2I5YL 4PLJD 4ZFZA 4UIKH 5E70A 1FO0L 2JB5L 4ODUB 3HTLX 4BSWA 4QT5B 1KB9J 1XIWD 1QEWA 2XQYK 2YD2A 3L9RA 3U7WH 2FL5B 3RKDD 4QXUL 5GS2D 4QXWA 2Y07H 2ARJA 3QJHA 3U9PH 1VACB 1RJYB 2H26A 1NCAL 2IANE 2QSQA 3V7AE 3WFHA 1EEQA 1QSFA 1EHLL 3OV6A 5DJ2B 4JY4B 5E00B 4WTXA 3OR7B 1DEDA 2D03L 1OY3B 1TCRB 5ERWB 4L29B 2C7UB 3GBNH 1OM3L 2X4NA 4U7SA 2X4QB 1AGDA 1A6VL 4KROD 4AH2B 3TVMB 4D9RE 3CX2A 5E03A 2IAMA 3I2CH 3SGEI 3ARWA 5IJVA 1BP3B 2ITCB 2Y4SA 4KJWC 2ZG3A 3T0EE 5JQ6L 2RBLA 2WINB 5TE7H 1KELH 2PETA 4J1UB 5CUSH 3VXRE 1DEEA 4F9LC 1CZ8L 1UB5B 5KN5A 1AHWA 3W9DA 2ICWA 3ABZA 3ELAT 5FYKE 1PQZB 4JFHD 4Y1AE 3JWOL 5DJYB 3BPCA 2VXTH 5ESAA 3DSNA 2H2SD 3S4SG 5I9QB 2HTLD 4YDJB 2BHUA 2C1OB 4IJ3C 4Z76B 1B0RA 3SE8H 2NXZB 5H37H 3RUGE 3T65A 2VDMH 4Y5VA 1A8JH 3QFJA 4HK3J 1PG7W 1OTUC 1JNNH 3QUYD 3H8NA 3U6RB 2BVPA 4ZTPH 4R26L 1XCTA 5MEOB 1D5ZA 1XGPB 3B3IA 2CDGA 2Z8WC 4MHHI 5J9PA 3TN0A 2XNAB 2XWJB 4GW1A 3FO1A 1UJ3B 2BNRA 4JAMA 4N68A 2ZPKL 4WIQA 1E28B 1JFQH 3MR9A 4LLWA 3ZDZF 3B9KB 4AM0B 4MQXC 5K9OA 4XC1H 3RY4A 5TDOA 4S0SD 1AGFA 2IBGA 3BT2L 1TNMA 3FT4B 5EWIH 2CLVA 2W9DH 4LVOC 4L3EA 4PRPE 5IGXH 3O9WA 2YMXH 2QQKL 3EYFB 2ZOLB 1U9KA 4ZUVA 2AJUL 1WBXA 4RX4D 1IAIM 2V7NA 4I2XB 3HMXA 1OAYH 3T2QA 4QEGA 4U1LA 2Y36H 2F54D 5MEQA 1ND0B 3HC0B 2MPAL 3SOBH 1YJDH 2SEBB 4XMKL 1L7IL 3K1DA 3GSVA 3NCYS 1PZ5B 1I1AD 4POYA 1A6AA 2E6QA 5CD3A 1LK3L 2GT9A 2RJMA 1YPZB 4TSBL 1E4KA 3QG7H 3MJ9A 4FMFA 3OB0K 4Q6IC 1YMME 5DD6A 1YEJL 4LSVL 2ZCLH 3LKPA 2AI0H 3QNXB 4LPXA 3C6SA 1S8DA 1A64A 4CVXA 4M7LT 4U4BA 5FYKL 1HI6B 2L7UA 5IK3A 5I66A 2WIMA 1WWWX 1A6WL 1P7KB 3DV6B 4YHIB 3Q6FA 5F1KC 2DYPD 3RAJH 1KCUL 1JUFB 5EZOL 4PJCA 2XQYG 4WU7A 5JHLL 4X7DC 3CLEH 4G80A 3ARFD 4FZEL 4X7CC 3TV3H 2XY1A 4X6DA 4LVHC 1I3RA 2G2RB 4Z18A 4M7JL 3MTRA 1CD0A 4AEEA 2ADFH 2IQAA 3C08H 3I6KB 1CL7H 5KG9B 4P3CH 3RVTD 1VFAA 1MLBB 2X9YA 4HFUL 3V6FB 5A2JH 3VWKB 1HHGB 1EFXD 1WWCA 1ZHNA 1KN4H 3EYUL 2EDLA 4Y0GA 4MD4A 1IQDB 3MGOB 3LQZA 5LGJA 3OGCB 1OP5K 5FYLE 1FZOB 4J2XA 5ITFA 5JMOC 4P49A 5JR1L 1HKLH 3L3GA 1E4XH 2DQCL 4PJ7F 3MNVA 3SDXA 5KN5B 3VXQA 4XWOC 1FLRH 2GITA 1K2DB 3QXAA 3LEYL 4Z6AT 1RMFL 1HQRA 3RWDB 1QZ1A 3UJTH 3ZL4H 3BPCB 8FABB 3UZVB 2CUMA 4OZFA 2DM2A 3TJEH 43CAA 4Y8DC 3M8OL 1BZ7A 4Y5VB 3IDIA 5DRWB 2EZ0D 3QFJB 1ZMYA 1FZMA 5EUKA 5I6XC 2IPKB 1XH3A 4JY5H 1X7QB 5IBLC 2PYFA 3BEVB 3RL2A 2P4AB 3IETA 4OZHB 1LO5A 4Z7OE 4XCYA 4BQ6A 4PJBB 4QHLB 4D3CL 5EO1A 3OKOB 5H2BA 4KDTA 5FIEA 3VFTB 3WFDH 2EO1A 3SQOL 2F5AH 1PYWB 2YD9A 1VFMA 4DOHB 5JOPD 4PJ9D 25C8H 1MJ7L 3PWNB 1A1MA 3RX7A 2BC4B 2R0ZH 4AG4L 1QD0A 1HEZB 1I3GL 4ZO8A 4HLZG 4PRHD 3TA3B 4I5BA 1I9EA 2VLRA 3QUZA 4LLWB 5ADPL 3F12B 5C0BD 5L2KB 1FVCB 2J4WL 1DLFH 3L3KB 1NUGA 2DQGH 5D9SB 1TPXB 2EDXA 4UTAL 1AGFB 2VKXA 3BVNA 3FT3A 3C5ZD 3EDKA 3QQ9D 4L3EB 3BWAA 3VXMD 6FABL 3E6FB 5D1XC 3DXAE 4ZUVB 3B6SB 4X9GA 1G7IB 3KYKL 1SY6H 1V8HA 1KENH 4NQVA 3UTPE 2CIIB 2R2EB 1JWSB 3NFPA 3B83A 4KAQH 5GJTH 1BQLH 2BNUB 1F2QA 3PHSA 4MWFB 3GMRB 3GSVB 5TQ0L 1TDQA 4GW4B 4QF1A 5IVXF 1IKFH 5D5ME 4GLRI 4NCDA 5FUZH 4HCRL 5CD3B 4M5YL 3G04B 1HZHH 1GZQA 3BMWA 5BRZA 2E7HA 4YFDB 1MLCB 5FYLL 1F3DJ 4UDUA 3WN5B 5EU6D 4ZAKA 5EU5A 3V4VL 5C0JA 2ERJC 3FQWB 4IRJC 3LN4A 2JKXA 3Q0HA 5FAAA 4F37F 3SDCA 1S8DB 2HLFD 5E8DH 4L8BB 1NGQL 5F89A 2BERA 4ZQKA 3TIEB 2D3VA 2J6EH 4M43H 1NFDF 3SKOA 4GFTB 4KK8D 3QJFB 3N9GL 2NR6D 4X4ME 4UQ3A 3WE6A 2DDQL 4NKQB 5KS9E 3EKCA 3NTCH 1QYGH 3HNTH 4DKEL 2PR4H 3HE7C 3N50A 1CLOL 2A6DA 5MHSD 3E8UL 3TYFA 3ZT7A 1E27B 3QNZB 4TUJA 3LQZB 5DVKA 2A38A 1PKQB 3A6BL 5ITFB 2OBGA 4RIRA 3C9NB 5AD0B 3MNVB 4FQIL 3VXOB 3MA9L 1MQ8A 2GITB 5I1LB 3L5XH 4N0FA 3QXAB 1JCKA 1UA6H 5D4QA 4LHUA 5F8RC 2Q7YB 5KSAA 1D6VL 5C0GA 3HA0A 3ZE2F 4RGNB 1AFVL 3RWHA 1RJZA 2VDKH 3JWDL 1DFBH 1LP9B 1BFSA 2QQNH 3VFNA 3GIVB 3C60D 3VFVA 3LB6C 4OZIB 1WWAX 2PYFB 1A4JB 4E5XB 3GI9L 2GY5A 2ICEA 3CVHB 3EGSA 4LCYA 5FOBB 3VH8B 1TCMA 5BO1H 1JGEA 1VFBB 3X3FH 2R23A 3G6JE 4JGUA 4HWBL 5EOTB 1IM9D 4LRIC 3Q6GL 2Z9TA 2DM7A 1KUMA 4UQ2B 2YPVH 5LAXB 3V5KB 1A6UH 5EORL 3PL6D 5JO5A 2VLRB 1JP5A 3QUZB 3T1FB 1WK0A 3VMPA 4XH2B 1LO0H 3MFFB 3P0VL 4RSVA 2NY6C 5MP6H 1UACH 1TVHA 3HMXH 4W4NA 3ALXA 3FT3B 1ADQA 3VXSA 3UC0H 1P53A 3FO9A 3HLAB 1PBYA 3KLDA 4MDIB 4PV8A 3BP4B 4BFIA 3V4UH 3RUGF 1T7VA 4QRRA 4F15B 3B2UC 5CP3H 5JUEL 4KDVA 3FB6B 2IWGA 1N5YH 3WL9B 1MREH 2F9BT 4P2RB 2GUOA 5IW3A 3CLFH 1A21A 5DQ9A 4DN3H 3KWWB 4O00A 2BMKB 3MRRB 4IMLA 1JHLH 3DO7B 5TGBB 5A3ID 1DUZA 2OP4L 2YPKA 3DRQB 3NFNA 5T33L 3TWCH 3IYLW 4ETYA 1S7WB 4W81A 3FQUA 3SDCB 1I9RL 4JDTH 1OL0A 4O58H 2ED8A 2ZUWA 5KSBB 1CLYH 3FJTA 4JZJA 5ISZE 1VADB 2EH8H 4Y4HB 4BH7B 3MLWH 2FH6A 3FOLB 3HMWH 1JNHA 4TRPL 1A47A 2OJZL 1QO3B 1T0MA 5CAYB 1OAKH 1MFEH 4NQEA 3WE6B 3WBDA 4XP1H 4LLUA 5E2UH 5BMFL 1RZ7H 1ZHLA 1IJ9A 5I0ZA 3D39B 1MPAH 3LKSA 1WZ1H 3TYFB 2AEPL 5JORA 1QQDB 1CDHA 3P73B 1JNLL 1ZGLA 4ZD3L 4NZUH 4OZFH 1NFIB 2WSKA 5LGHH 2R8SH 3KPLA 1YJDC 2IPUK 4LU5L 1UVQA 1S7UA 3ILQC 3VXRD 4JB9L 3PHQA 5LBSL 5JZ7C 4MNGA 1ZEAL 3LH2L 3QPQD 3JVGA 3RVUC 2NLJB 3S37H 3CVHH 3QEUA 2KDGA 4P46D 2DKMA 4RMSA 1LO3H 4HIIA 1CF8L 3KPOB 3PV6A 5ELIA 4X99B 3ARVA 2LU3A 4P4KB 2OL3B 3SGJA 3DX9A 1XR9A 3STLB 4XTRC 1DE4A 4S11A 1FV1A 4LDOB 4CMHB 4AT6A 3TVMC 3LD8B 2YK1H 4LCYB 4OCRL 5LWYL 3BXNA 5ITBL 3QQ4A 3ZHLA 1OAUL 5FV1L 4OIBA 3CSYA 3SDYH 3ULVH 4NSKA 4OJFH 1JBJA 5T5NG 4C57C 6CGTA 4ZDHA 2QSCL 2R1WA 4I0CC 1U8JB 3O6FD 1K9TA 4L8DA 3UBXA 4OCWH 5JO5B 2VLJE 2YA0A 1DQDH 1I85C 1JRHL 3LN5A 3QUXD 1O5DT 3FFCE 3IXTA 5C3LD 3MLXH 4P5TD 1TVHB 3VG9C 4MNQB 5HGHA 1T5XA 3QDGA 5I8EB 2J8UB 2RFXB 3SO3B 3TNNA 5FM4A 5I9QC 1L9NA 4L4VA 3PHOB 4V1DE 4G6AD 5CKGA 4PV8B 3HB3C 4CVZB 2NXZC 3OKLA 3A6CH 2ICWJ 1A9EA 2JF1A 3ZHDA 2A6JA 4ONFL 2GUOB 1QVOA 3RGVB 4Z7OF 2Z91B 3N1PC 3MMEB 3HPLB 3HE6C 4OD1L 1N0XL 4ZXBB 4X7FC 2NXYB 4FFZL 4IMLB 1FNHA 2YZ8A 1KJ2A 4ZO9A 1V7MH 3TYGL 3BKCL 4WUUE 1KCLA 1UJ3C 1MSPA 3RJDA 2W38A 1RZKL 4U6YB 1IGIH 1MJUH 1FNEA 4GXUM 1T3FA 3TT1H 4LGPB 1IGFL 4P5MA 5E95B 1D5BB 3FMGH 2GJZA 3S6CA 3QXUA 5I75B 4KGLA 3MXWL 1JZ7A 3V6OE 5J57B 2CRMA 5L8JB 2YOCA 8CGTA 3T77A 4LLAA 3QYCA 5DQDL 4UT6H 5T3XE 1T0MB 4X4YB 4MCYB 1JYVA 3DNKA 4NQEB 2GCYA 2H9GA 1URLA 5EIIA 4ZOBA 2IGFL 5AG9A 1YEKL 4PJHA 4M9OA 3GSUA 4LAQH 4C54A 1HCFX 5DJZB 3EFDH 2V6HA 5D5MF 3CFKB 5EBWB 2AK4A 4U2ZA 4Y19B 4X4XB 2ESVA 4R4FL 3DIFB 3GDBA 1F4XL 4TVPE 2OTWA 4A2LA 2YA2A 4LBEA 5HHNA 3RWIB 1A5FL 3KPLB 1I8IB 4ODWA 4JO4H 1HHKA 1PG7L 2LU7A 1A7OL 5HHME 1MCPH 2OL3H 4MZ2A 1AXTH 2NY2C 4PRIE 5F1IA 4ONOA 4CW1A 3K74B 1F42A 2VZ1A 4D0BA 4L1DA 1M6OB 4XMPH 5ENWA 5DTFB 1Q9KA 4U1KA 3PV6B 1C1EL 3HHRB 1CYGA 2IEPA 3BW9A 2AJSH 1B6DA 3OR6A 5B38A 5EOCL 5ANME 5CCKL 1IKNA 5KS9F 5DWUL 3NN8B 1MY7A 3BXNB 3S8WA 1NMAL 4TQEH 3VWKC 4N5ED 1I7ZB 2B0SL 3MBEC 4P2CG 3S5LA 1CXLA 5CFHA 4KK6C 4XPHH 1J12A 2B8OT 2PTTA 2EEAA 1ADQH 2VXQH 3RP1A 5DEZA 4M1CD 2PN5A 3TPUA 5C0IB 4JFDB 3QH3A 5GRJH 4YXKL 5IEKB 5KANI 4XX1G 2OI9B 1DANT 1K6QL 4OD3H 2OTUB 1N6QH 4K94H 3HG1A 2OMNA 1X5HA 2GTWA 3U0WH 5JW4N 3KLHC 4XPAL 5HGHB 3QDGB 1A2YA 3HAEG 5D70H 1AD0B 1P9MA 2WBJA 4PJXF 4L4VB 5C08B 2HKFH 4X7TA 2CK0H 5D1ZA 5ECJE 3QDJB 2XN9D 2W0FA 4ETQA 5C92A 1SMAA 3GMOA 4IEFB 2A74A 4L3CB 1OAZL 3BYTA 4JFOB 2NZ9D 4YHNB 2BHYA 3GI8L 1QRNB 1X4ZA 1WEJL 4J6RL 3UTPD 3W82A 2ADJB 5D6CB 5GISH 1EO8H 3MZGB 2NW3B 4RFEB 5DFTA 3ES6A 3KDMB 1ZWIB 2EKJA 2JLLA 2ZJSH 1DVFD 4X9IA 4TVPL 5D2NB 3CDGA 1UQSB 1W72B 4KMQA 2VQ1A 5C0RH 4NT6B 3X17A 3AS3A 1ZT1A 2WBWB 3TA3C 1D3CA 1IC5L 2FX8L 4APQD 1A6PA 4BFEA 4QRPB 2G9HB 3PWPD 3QT2A 3PXHA 3BRDA 4YFLF 2QKIA 1RFDL 2HG5B 4P5MB 5HHOB 1TPXC 5EO9A 1WSST 2X4UA 4O02H 5GGRB 1ZLWK 5DGQA 2FJHA 5JDSA 5J12B 2V2XA 4K3GA 4DCQA 2X4OB 5BVJA