4N8CL

Three-dimensional structure of the extracellular domain of matrix protein 2 of influenza a virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
b'DIVMSQSPSSLAVSVGEKVSMSCKSSQSLFYSSYQKDLLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYFCQQYYTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody
molecule tags Immune system
publication title Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
pubmed doi rcsb
total genus 50
structure length 219
sequence length 219
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cL01
4RGMB 1T1YA 2ADGA 3ZT6A 1P53A 3KHOA 3R1GH 1A21A 4I9WD 1ZHLA 4DOHB 3NH7L 1QLFB 2EDDA 4HBCL 2APFA 5C0JA 1WBYA 5D96C 1NMCC 5IB5A 4XAWL 4LLDB 3RNQB 4TYUA 3RY6C 5EUOA 3B9AA 3AGVA 3BZFB 5LGHH 4YQXL 4ONHA 5E0QA 1X4YA 5T33H 1VA9A 3C5SA 5GS0H 4HWUA 4NJ9H 3RZCB 4JFZL 1BZ7B 1LWRA 3SE8L 2DF3A 4FFWC 5E9DA 4OLXL 4AM0B 4DFHA 1QFUH 2FO4A 1T89C 3B5TA 4YE4L 3B2UC 4E41D 2DN7A 2GTZA 3QIBA 4KRPD 1ETZB 4KRMB 4MS8C 3VXRA 1TNNA 1OWRM 3MQIA 2P8LA 1N0XL 3SDAC 4WFGE 2P45B 4C83B 1JHKH 4YAQB 5I9QB 1VFMA 4LSPL 3GBMH 1HCFX 1CFQB 2VLLB 3SGKC 4PJ9B 1ZHBB 3GEWB 3RWJA 3IDGB 2Z8WC 3DX8A 4CVZA 4C54A 1M7IB 4HS3B 5DHYA 4JKPH 4FQJH 3UPAA 1FRGH 4HULB 3HB3D 4Y16C 4NNYA 4FZEL 3HG1D 3UZEA 4JRYA 2PXYC 1BWMA 3DIFA 1RJYB 1FNSL 4NRYA 4RQQB 4HHAB 2ZG2A 2EIZA 4L9LB 4PG2A 1DLFL 1FNGB 3EO9H 3MLRL 3QIUD 1G7MB 3RVWC 3LPWA 1ITBB 2MCPH 3G6DL 3UBXA 2H9GB 5FYJL 3A0OA 4LPVA 5FDYA 4ZFOB 1ZA6A 1OQXA 4AIXA 5CCKL 1RUQL 2X7LB 4ZUWA 1C5CH 4R4ND 2FJFA 3C08H 4QHLB 4LARL 2EEAA 4NQSB 5JXAL 4EI6B 1DBAL 3KLAA 4EI5D 2QQNL 4CN6A 1J1PH 2X4OB 5DJAB 5I6XB 1BIHA 4NKDA 4UIMB 15C8L 3GRWH 3DVGB 4N0FA 3T3ME 4QRTB 3P9LA 4U6TA 3TIDB 2ZG3A 3FCTA 5JHDD 5E08L 3QI9B 3V6ZB 4F33A 5CD5D 3P0YH 5C86A 3HZKB 5TGBB 4CAGA 2LU7A 3ZDYE 1U8PA 4LEXH 1RURH 1CFTA 1YMMD 4OD2B 5GIRB 4FQCL 1FPTH 4NHCH 5IB4A 1E28B 4L3EA 3EAKA 1GAFL 5DUBB 2FL5B 4X9HA 3PP3K 4R96A 1ZMYA 3PQYE 3QNYB 1F6AA 2QR0A 5C0IA 4H88L 3I6KA 1R3JB 3OKLA 5HHMD 2Q86B 1EEYA 5H94A 3DXAE 2OXGA 4Y0GA 1E4WH 2YMXL 1NC4B 3D69A 4EDWL 1J0JA 3OJDB 3QXDA 3T0WA 3UTSA 2ADGB 3VWJD 1T3FA 2W0FB 3V4PL 5IFAH 4TTDD 1I7RA 1K5NB 3RAJH 4NRZB 1EUTA 1U8OA 3VXQA 1P7QB 3JV5A 3P30L 3AS3A 4JFFD 5IK3A 5CAYB 5FDWA 1FVDA 3M17B 4YHLL 1XIWC 3C9NB 1ES0B 2AJ3B 4HUUB 5HYJA 4G7VH 1DBMH 3CU1A 4G9FB 1QFWI 5D5MF 4NM4H 2CDEA 5FYJD 2YXMA 3ARBC 4RIRB 5EZIH 3S3SA 5C08B 1AY1H 1MRDH 1OGTA 3PWVA 2L7JA 3LEXB 5IG7B 2DLEA 1JNHA 1MJ8L 3PDDA 4LSUL 2GTWB 4RRPG 1ZGLA 5A16A 2H6PA 5FF6B 3SDYH 3E1F1 4K94H 5DLMH 4X7TA 3HUJA 4EQ2A 4JFXA 2Z9TA 1KB5H 2XQBH 3U0TB 2YPLE 2R15A 2C1OB 2WBWB 4N1EA 4HG4K 3EHBC 4M5YH 4OIBA 2WQ8A 3O11A 3X3GL 4ZS7H 3VI4F 3D85B 4KU1A 2PTVA 5T3ZH 4YX2L 5DRNB 4K71C 4KK5D 1Q9LB 4KKBC 1DUZA 4J8RA 3CLFH 1UACL 1FNHA 5E00B 1KXTB 3NCEB 2DDQL 1I3GH 1F4AA 2O26U 2WUCL 5D7IB 2E6PA 2B0SL 4LSSH 4QXGL 2R8SH 4KK9C 4X0KB 5C07B 5EBLA 5DD1H 3ARDA 4Z5RA 3EDEA 3WFDL 1GC1H 1DANT 1WITA 2EH7L 2ZOLB 1M6OA 4LAQH 5ITFB 5FYJH 2AS5M 3MRFA 3JTTA 1KTRL 4QY8A 1IAIH 5SX5H 5BRZD 1F8TH 2A74A 3BP5B 3KPSD 4EVNA 5DD3L 1JGLH 4TUOB 4JZOA 1IZJA 3PWLA 3CZFA 3BDBA 1DQTA 5IOPB 4XVSL 5JXAH 1SY6H 5SWQB 4GKSA 3QUXC 4MQXC 1P7HL 3AB0C 1H8OA 3HUJF 1CICC 4PRPB 5T5NF 3G6JE 3DGGA 3Q1SL 1CR9L 2W0PA 5HPMB 1L9MA 2AI0L 4FRWA 1AIFB 3U4EB 2E8YA 1I9JL 3OAYK 5EU4A 3IJHA 2HN7B 4XH2B 2HYMA 3BPLB 3LIZH 5HHPB 3DO7A 1ORSA 4J3SA 2Y5TA 2VC2H 1CXHA 4NUJA 3VXUA 1DTUA 4LEXL 2OCFD 5HGHA 1AR2A 5IQ9A 4FP8H 3D85D 3W11C 4MAUL 4NQVB 5D2LB 5HDOA 3CX2A 3MR9A 2OJZL 4U1NB 2FLBT 2ITDB 3V6ZA 5KN5B 4WJ5A 2BVUA 2GUOB 4L9DA 3QCUL 4UBDD 1IT9H 3JZ7A 2XZAH 2P5WB 5LGHL 3P0VL 5B21A 2F54B 2PN5A 1BBJA 4Z6AT 4Y5VC 4MCZB 5ID1A 4OLWL 2R9HC 3S4SB 2VDNL 3FT4A 5T3XD 3VI3F 4CKVX 4JAMB 5DRWB 3PF2A 3RI5K 3SKOA 4PJ8C 2DM7A 1YDPA 4LVOB 2RFXB 3RVWD 1EMTL 3LRGA 1QFUL 5F9WB 4JANB 3VFPA 4S0TD 4UINL 2NCMA 4XPHH 4BSJA 8FABA 1G7QA 4NM8H 4WFHE 4DZBB 3M45A 3R06B 1S9WB 3WIHA 5C8JB 4R7NA 1MFAL 1MOEA 3NGBC 3QQNA 4XP4L 4KQ4H 4K23L 3BESR 4NPYB 1FL5A 2FB4L 3U36B 1NCDH 1W72B 3ILQC 4XRCB 4LSUH 5J6GB 5C2BH 4D0BB 1JN6A 2QJDA 5GGVL 5CJOL 5ENWB 4YHKL 4WUKL 3Q2CA 3MACL 5J89A 1I8IA 5KANG 5IVXE 1XF3B 1MHEA 1R3HA 4M4PA 4GUPA 3HZYA 5E7BA 1CGWA 1WC7B 2PYFA 3AREA 4ODWB 4HKZA 3GSNL 4MNQD 2IAMB 4X98A 3DYOA 4LP4A 3O8XB 4DVBB 3RUGA 3K4DA 1MCNA 3WE6B 1S5HB 4PV8B 3S88L 2IQAA 1Q1JH 1YNTB 5HGAA 1F58L 4Z7VE 5F1KC 5JOPE 3GSXA 2ATKA 1M4KA 1V3JA 2NY3C 2BSSA 1H9VA 4EN3A 1DDHA 3HRZB 5JORB 4BZYA 1PEWA 5BOPA 5DHVB 5FO8B 1U91A 1JUFB 2WNGA 4JN1H 1CE6A 3ZYZA 4M62L 2IGFH 2E6QA 3HNSL 1JGLL 1J18A 4LLMB 3X14B 4TSCH 1N26A 3VMPA 3CUPB 4LF3A 3UJTH 5A3ID 4E5XA 1KGCD 4WHYH 1SJEA 2QKIB 5F7KC 3WS3B 5J12C 2E9WA 3MXVH 4AK1A 4S11A 4ETYA 1YECL 2ZOLA 5E6ID 4BK4A 3W0WB 1SYVB 4H26B 1VEPA 2DKUA 3EDKA 3LV3A 3QIWD 4JY5H 4X7FC 5ETUA 4OLYL 1NCAL 2AKRA 3W39B 3DTXA 2WWMC 4P9ML 5E8DL 4WFFD 3LSOA 3HG1B 5IUSA 2HVJB 3CX5J 1IAKA 2X10A 2V5RA 3RPKA 3HS0A 3TN0D 1EH9A 3GNMH 4X6FA 5CKAA 5KSUB 4XVJH 2J8UA 3JTSB 4PJDE 5TFSH 3STBA 3QDGB 5T3ZE 4Z95H 2BCKB 1GVIA 2FJHB 2XFXA 1B6UA 4LIQE 1IT9L 1RJZA 1BECA 3PGFH 4JFYB 3GJFA 1I1FA 1XF2A 4RMSA 1KYOK 3DWTA 3HPJB 5HVGB 5ALBL 4LLDA 4ZFGH 5FYLL 4QXTA 4Q6IC 4PY8I 5GSRB 3SJVE 4OZGB 3RJQB 4ZTOL 5K59E 4Z7UA 2HMID 2WUBL 3MR9B 5JO5B 3MODH 3O2WL 5C6PB 5FHBH 4G8EA 4MJID 2IALA 3RUGF 3D39D 3EYFB 3AS0A 3OKNA 4Y8DC 4L4TA 3LKOA 5F9AC 1JMZA 1BGXH 4MCYB 4OTXH 4PBXA 2WBJA 1CF8L 4N0UA 4Z78B 5EBWA 3WUZA 2DRUA 1URLA 4QHMA 3T0AA 3UYRL 1RIVH 3MBED 1AGBB 4LCIH 1FFOA 1GGBL 2NX5E 3FFDA 4HKXB 4ZDHB 3VXRB 2RB8A 3GSQB 2A9NL 4ZTPL 3BW9B 3EO0A 2QQKL 5HPOA 1WEJH 5ALCH 5DK2B 3ZHDA 2ENYA 3L3IB 3V8OA 2OR9L 1AH1A 4TRPL 1CXFA 1VDGA 3O4LA 4JGMA 3QQ4A 1Z9SA 4HK3N 4UUJA 5D1ZD 2F5AH 3CK0L 3DRQB 2OR8A 3EYSH 3TIEA 3D5OF 4XP1H 3CMOL 4OD3H 4NCC2 1EJ6A 2L7UA 5IW3A 4Q9QH 4YHYC 1WZLA 2AK4E 3OMZA 4NZTL 4ACPA 1U2CA 3MRKA 1JTOA 1LD9A 2A6JA 5HHNB 4MAYA 3NCYP 4M3KB 3MOBL 5J1TC 3UZQA 3D18A 5HD8D 3ARDD 1T5WA 2XY1A 1QLRB 1NC2D 3T4AA 4CNIB 2XA3A 4MDJA 2W9LA 2VAAB 2BZDA 3QFDA 2EIDA 5D2NB 3I75B 4M62H 3TO4A 1KIPA 1EX0A 2E6JA 1NKRA 4P2OB 4Y5XC 4UNVA 5B38B 1S7SB 3W5NA 4Y19A 3BYYA 3WJLC 2XN9B 5T3XE 3BEWB 2BSSB 5CSBA 3ZDZE 1PEZA 1NEZB 1P4LA 4M61A 1HNFA 4X9BA 4I18B 1UM6H 1PFCA 5L6YH 4MNGA 4WHDA 1K4DB 1U93B 3V95A 1N5YL 1D5BB 3L3HA 2CKBA 1F6FB 4TNWK 4YK4B 3QDHA 5T1LD 3QUMH 3QNXB 3INUL 1DUYB 2X6MA 4LGRB 4N0FB 2OL3A 4HUWB 1KSRA 3HNTL 2OSLB 4PLNC 1T22B 4WVRA 5F9OL 4M7KL 4XVJL 1UKTA 3K1DA 3GGWB 4HD9A 1U9KA 2BSRA 2HKHL 4XXDB 1FNLA 1HIMH 1RZ8B 5I1AA 2Z31B 1KJMA 5DJ8A 3NVQA 3RZWA 2ADJB 1MHHB 2AXFA 1RULH 3I84A 1DBJL 2I9TB 1LEIB 4U1GB 1R3JA 2IFFL 4ZTOH 5I66B 1AP2A 4R97B 5FYLD 5T1DL 4IHOB 5I8CB 1JGDA 1MRFH 2P24A 4OGAD 3EFDL 4ODVH 4WWKB 3FMGH 4KRLB 5I8EB 4GMSH 4HH8A 1WCBA 4PRIB 4PD4J 1ZS8A 3PABA 4FQ1L 1JPFA 3GDBA 4WUUD 3CMGA 4XP4H 1VFBA 2CLVB 5DRXA 3V5HB 4NFDA 2VR5A 4X7DC 2FB4H 4H5SA 3QULA 3BRDA 4U0QB 1KENL 2M2DA 3E6FB 2MTPA 4LCIL 4P5MA 1ONQB 3P77A 1ES0A 3VE0B 5IW6A 1K3ZA 3O3BA 4N8VA 5F8QC 5ICZB 5ALCL 1OP5K 1MCOL 1A7NH 1SVZA 4P46D 3KPSB 4X6CE 3QXWA 4B41A 1V3LA 1T7WA 2HFGL 3L9RA 5EFIB 2VLME 1KFAL 2DQCH 5GS1B 4QHMB 4ONGL 3CMOH 3GSUB 5F6IB 4WV1C 3UDWC 3WL9B 2ICES 3B9KB 5HHOB 1BVKB 4KJPC 2HJKB 3NFSL 4WCYL 4TN9A 3T0ED 4W81A 4PJHB 4XBEH 5F7MC 2NY5C 4Y4HC 2BVOA 4FFWD 4AH2A 1OLLA 4WI9A 3RTQB 3QHZL 2CH8A 1A2YA 4LBEA 5KS9B 3BFOA 2HTLD 3FAWA 1RFDH 3TIEB 1G7HB 3SE3C 3UPRA 3CFBB 4A6YA 2VITB 1A5FH 1X4ZA 4TSCL 1ZHNA 3VFRB 4PGDA 5J4MA 1T80A 3QG7H 4HPOH 5IHUL 3OGOE 4P2QD 2VZSA 3FT2A 3RKPA 4PJ9A 5K33A 5ITFA 4FXLA 4JFED 2WP3T 3WHXB 5KVGH 3STLA 4LGSB 4M00A 2WINA 5JW4M 2QBWA 1EERB 1MI5A 5H35B 4BQ9A 3T2QA 5IB2B 4S1RL 5MEQA 1BZQK 4W6WB 2DBLL 2YSSA 5MEPA 5EIQA 1TTUA 2XWTA 3G5ZA 3DBXB 2NR6D 3IDMB 5TF1L 3R0NA 3MV01 3LKSB 1T21A 1DN0B 3VFMA 1QRNB 3BSZL 5C0BD 4N90D 3NAAH 4ELMB 2EDNA 5T1LA 2NW2A 5HYEA 5KJRH 4U1JA 3K2UH 5F93C 2VLJD 3U4EA 1NEZA 4F7PA 1KLGA 4MXVE 4ZXBA 1MIEL 2AXJA 5FM8A 5I8KH 4KUCD 2DI8A 1EGJL 1FO0A 3DARA 3QIUC 4NUJB 1FN4B 3MV8B 5D1ZC 1EVTC 4HFUH 3CXHJ 1EHLL 2E9BA 3HAEB 3PL6B 3W82A 3UTZA 3PGFL 1N4XL 1INQA 1PJ9A 1DBJH 2JELH 3IU3B 3HI5H 1T7VA 4ZFGL 4M7JL 4PP2A 4GKNB 4YDVA 3WS6A 3UTQB 4QYOA 2HA1A 2G9HB 1TFHA 1A1NA 3LDBC 4KPHH 4UIMA 2E3VA 1T0NA 1JGVH 4M7LT 5IEKA 3C5SB 3IJYA 1A7PH 1JF1B 2YA0A 4LSQL 1KLUB 2YZ1A 3QA3B 2B5IB 5D7IF 4NN5C 2DB8A 1MPAL 3GBNL 1MELA 2VERN 5J3HD 5GIRA 1QSFB 4HG4J 1QQDB 2LVEA 3FO1A 3KXFB 1JWSB 3V6OE 1QR1B 1FZOA 4P2OC 4P23C 1I4FB 3QNZA 3HE7D 4JO2H 1BBDL 1UJ3A 1F6AB 3R06A 3F5WA 2ED8A 5D1QA 3QRGH 2O5ZL 4UV4H 4XVTH 3IAGC 4PTUB 1G9MH 2XZQH 4BKLB 3OR7B 3QXDB 1KCSH 1VFBB 1HHGB 3MXWH 5C7XH 4XVUD 3IXTA 3EYSL 4LASL 4OM1L 3UTTD 1MFEL 3ZHLA 2DQTL 1I7RB 4HS3A 4XPTH 5DHYB 2Q87A 1NDMA 1HINL 2HVKA 4U7KA 3OAYH 2J12B 2QSVA 1OCWL 3VWJC 1P7QA 4L8SB 5IW6B 4EEEA 4BSWB 4ZD3H 4XHQA 4OLZL 1A14L 4YXKH 4LLWB 3LKRB 5JPMB 1U8KB 1TITA 2PW2B 4KZDH 2EIZB 5C0BB 2GK0B 4LSTH 1LO0H 1HN1A 1J5OL 3U0PA 1MWAA 5B3JE 1MCSA 2VDML 4JFDB 3TO4D 1A5FL 5DD0L 2VDRL 1QNZL 43C9A 3ULVC 2G2RB 4P4RB 1IMHC 2HJKA 3HI1B 4M48L 3ES6A 4N0CC 1K9TA 1PLGL 4KQ3H 2QSCH 1IFHL 1XCTB 1ZANL 4FTVA 4MHHG 4I2XA 1S3KH 3T3PF 2F5BH 1NBVH 5SX5K 2NXZC 3U48A 4LLMA 3QUZB 4W4OA 3VG9C 1Z3GL 2NY2D 3GKZA 5IMLB 3WSQL 3VFGL 1NANI 1U8HA 5A1AA 1XR9A 2BNRB 5L2KE 4ODUB 2FDBP 3SJVD 1CGVA 3CDGA 3TIDA 3QWOA 12E8L 2Q1EA 4Q74A 1MAKA 3EOTH 4XP9H 2BY1A 1NUGA 3ROLB 5DDHA 3V9FA 1BMGA 3T65B 1MIEH 4KHXL 5E9DD 2ZCKL 1CFTB 5CILH 4YHNB 4NFBA 1MSPA 4M7KH 4K7FA 1NLBH 5J1AA 1DBBL 4K3DH 3KYMB 4QNPE 3HC4L 4XZUA 3LY6A 1TCRB 3GIZL 1KNOB 1NFIB 2J8UE 5ICXA 4U1GC 4LHUG 2OYPA 2JLLA 4KHTL 4PGBB 4S1SH 2NX5D 3GMMB 4HX1B 3M07A 5FXCH 1MUJB 1RUKH 4R4BA 3U7WH 3ZKSD 1UH4A 1CGUA 5J1SC 3WO3B 2X2YA 3NA9L 1VKXA 1KULA 3OJ2C 4HUNB 1AHWA 1UWGH 1VACB 3RFZC 3RX8A 4XWGH 1A7PL 5EOCH 4NO2B 1QBLL 3C09C 1NEZG 3UTZB 2NPLX 4XMPL 4WWKD 1FFNB 1J86A 4YK4C 2LABA 5FECB 1Z9LA 5TJWK 5HYJB 4LKXA 2VQTA 4PPTA 2NY2B 4KTDH 3GBLA 5GSVA 2CDEB 5D9SB 1YY8B 4NO0A 1JF1A 1TJIL 3C6LC 1OW0A 3ILPB 3VFOA 3WXVL 5IMKB 3NFNB 4M5ZL 3MUGA 4U31A 2H6PB 5ESAA 1T7YA 4M9OA 3VXRD 1MLCB 4Z77B 2J8HA 2C3VB 3GUTB 2MPAH 4UBDC 3RY5A 3VRIB 4XT1C 4DN4L 4LSDA 1QR1A 1ZV5A 2BOCA 4NQCE 4KJQC 5I8OL 2B20A 3HE6C 5C0AB 5D2NC 5L2JB 4GG6F 2VLJE 2D7NA 1LMKA 1ZTXL 2A9MH 4JDTH 4TOYH 1A14H 2B7DT 4RNRB 4YXKL 3RUGE 5IESL 2Q8BL 4J8RB 1EAPA 5JHDB 1F97A 1JPSL 3R0MA 2BRRH 3OR7A 1QSEA 1FL6B 1HEZA 5D7IA 2FECL 1P84J 3JV6A 3B5GA 3IXTB 5FM4A 5E95B 4F7EA 1J5OH 1A7QL 5D1XB 1J8HD 7FABH 25C8L 2MSPA 1CD0A 4NPYA 1TJHL 2P8PB 3TBWA 2FR4B 2XKUA 3IDGA 5I73C 2XTJC 4X99A 4LLUA 4R90H 1QPXA 4JLRA 4BSVB 4FTVD 1PKQE 5TDOB 4I0CC 1VGEH 1IM3A 3NH7H 1R3HB 5SWQA 5KTEL 1EVUA 4PJFE 3EOAB 4BH8B 1A9EB 4S1RH 4KAQL 3WLBA 1IEHA 5CZXD 5GZNC 5D7JB 1T66C 2VZUA 4NWUH 3F6IA 3HI1A 4H20H 4UV7L 3D0VB 3QWQB 4Y5YA 4F37K 4PIRF 2LE9A 1XF5A 5ESVA 2LTQC 4OZFB 3IKKA 4U7MA 4JFFB 1OP9A 3AVEA 2VDQL 1HI6A 4YHZH 4KHXH 4BYHA 4WHTB 3IDJA 1BP3B 1C7SA 1OGAD 3KPLB 4EN3C 5IFHH 2BJML 4WY7H 1KJ3L 3GMNB 4W6XB 5E2VH 3JWDC 2J88L 4B53A 5LCVH 3V4VL 5KSAA 1MH5B 4XVUC 4HFUL 4PJ5E 5BV7B 4JKLA 5GGRA 3BWUC 3DX9B 3EGSA 4JDVB 4EUPG 4ODHH 4XCEB 1QBAA 3T77B 3WFCH 3DNKA 1A7RL 3MRCB 3RVVC 3BO8B 1EEUA 3MBXL 3OG4B 2YUWA 1T2JA 3TGXA 1UWGL 3FQNA 5EOCL 2MWCA 5HBBA 1QBLH 1PQZA 5E6IC 4YHIB 1CDCA 5IV2B 3GI9H 3QIWC 2AGJH 3QEQE 4PGZA 2VQ1B 5HYIA 2DJUA 1FG2A 2HVJA 2JE8A 4N0CD 5DXWA 1KBGL 5FO9B 3TFKD 1NGPH 3ZKMC 4R7NB 3WEXA 5K9JH 2NXZD 4G42A 4JO2L 3SPVA 3N1QC 3U36A 1NUNB 3WXVH 4M43H 2FX9H 4LL9A 5FM5M 1ZHBA 2NY2C 3RWJB 4XRCA 3SKJH 1TQBC 4U1KA 4K3JH 2HT3D 5J6GA 3HN3A 3FQTA 2DQJL 4HBQA 1BX2B 3TF7C 3VFVA 3MCLH 1ONQA 5DVMA 1C5CL 4DTGL 1NLDH 5I18L 3WDJA 3O4OB 1BOGB 1A8JH 1Z9MA 1DBAH 4HFWB 2VDOL 4HKBA 4OQ1A 3QEGH 1BQHG 4L9LA 4GAJL 1RZ7L 1YEGH 3NCJL 4YXHH 5IESH 3FOMA 4G6FD 3BQUD 4KZDL 3GSUA 3ZKNC 2OMBA 4QXWA 4XPGH 5AZ2L 15C8H 3GRWL 2YPKA 4RGNC 5HVHB 1A7QH 3MRPB 2YPLA 5JMRA 2NZ9C 1XF4B 3BAEH 3EO1B 1R3IL 1MRCH 4UDTB 3O6KH 3BW9A 3MLSH 2YKLL 5IQ7H 2HJFA 5KS9A 1UJ3C 2HT4D 2IF7A 3BHBA 3KLAB 3GMLA 1ZA3A 1LK3L 4UAOC 3D85A 1KPUB 2ESVA 2IBBA 3K8MA 1IQDB 2Z93B 1X5KA 4F7EB 4UTAH 3TYFA 4LHQB 1V7NL 4XGZA 3NACH 4HCRH 5MP6L 5E00A 3OKOB 3CDFA 4KROD 5I2IA 4NZRH 4OM0H 1CGYA 4BFIB 4H20L 4UV7H 1F13A 4TQEL 5FB8B 5ID0A 1QO3A 2V6HA 1RMFH 1V05A 2Q76A 5DWUH 3RBSA 3V4PH 2ZNXA 3AROA 2V7HA 4NN6B 1E4KA 2CKBH 3QCTL 4L5FH 4YHZL 2IH3B 4RWHA 4NP4L 3OKMA 1Y18B 3FAXA 2NTSP 4R96B 3DXAA 2HRPL 4PJ5A 5DEGB 2FD6L 3NIDF 5FHAH 2BNUA 2QR0B 4ZPTB 2YD4A 1U41A 2DQEH 5CLTA 4XBGB 3UC0H 1NBYA 1A7BA 3F8UB 4KHTH 3HE6D 2VE6A 3UTSB 2BCKA 5ESQA 1T3FB 1CT8B 3QO1A 5BVJA 4WHTA 1IGIH 4MXWL 4DKFH 4HJJH 4M7LH 1K3IA 1A7RH 1CD1A 1VFAA 4L3CA 4LCWE 5A40E 2EDEA 5KSAB 1BQLH 4OZFH 5K9QG 4PJBF 1D5BA 1ND0B 2X4UA 3GI9L 1QVOA 3ARED 3FQUB 1ULVA 3D87B 4ZS7L 4XMPH 5H8DA 4JQVA 5I19L 1KN4H 1O7VA 2R4RH 4ZAKA 1CDYA 2V5TA 1G1YA 3J7HA 5DRZB 2EXYD 4ZOBA 1IRAY 3I3BA 3V5KA 3QH3B 2B4CH 2F74A 3VG0L 5E99L 2GUOA 3MZGB 5HHXL 2NY5H 5FF6A 1PQZB 5CZXC 3IETB 2DJSA 4OLUL 3FHAA 3NIFF 5KG9A 1ZLSL 4LAQL 1KEMH 3E3QC 3GZKA 3DURA 3EO0B 3LN5B 3HPLA 3QNZB 2BK8A 3EJYD 4GT7A 4HS8L 3MUJA 1ZWIA 2AXGB 3MRMB 2WIIA 4YHOL 3FOLB 4PTUA 3K46A 1JGDB 4KUZH 2YBRB 2XICA 1FJ1A 4JDTL 3NCJH 4YXHL 2HG5A 1A6VH 1HE7A 3MLVH 1P9MA 3C8KB 1JZ5A 1JPSH 2ZUQB 4J3WA 4GQ9H 1JPFB 3D18B 5KVDH 3P40A 3TT3H 4U1MA 4ELKB 2XOTA 1NMBL 3QPQD 4JZOB 2EYRA 1MRCL 3CZFB 2W60B 4JKMA 1F90H 3GJFH 3TNMB 2VUOA 3KPRE 4OZHE 3T09A 5BW7A 1MLBA 1AKJD 4HGMA 2OJEA 1XGQB 1KJ2H 5F3HB 2X4SB 1FL3A 5EIVA 1V7NH 1S5HA 5IHLB 2VAJA 4MD0A 4RFNB 3JVGC 2BDNL 1R0AH 1BAFL 3C60B 3MV7E 1F3JA 2YRZA 2DBJA 5EO9A 4NYLB 5AYUH 2Y5TB 1K4DA 3ULUL 5HHOD 2X7LA 4ENEC 3I2CH 4KJPD 1QRND 2ITCA 3MRQA 4QGYA 3UO1H 2UYLA 3LN4A 5CJXA 1RU9L 4IM8A 2BNRA 4Y4HD 4J4PD 4ELMF 2FD6H 3DRTB 1OARH 2X4RB 4U6HA 3ECBB 4YC2B 2NQCA 3V4VH 1GSMA 1CIUA 3KAAA 1FIGH 3FRPA 4U3HA 4WJ5B 3O6FD 1SJEB 4OV5B 2QKIA 3EYQC 3MGAA 1UZ6E 4L3EE 2P5WA 1IAII 4ZNEE 1KCLA 4K23H 2EECA 4LSVL 2YRPA 3ZE2F 2EIBA 4WNQA 2VWEE 4NC1E 1F02I 3LV3B 3FN0H 3AY4C 1NFIA 1MCDA 5C09A 3S36X 3IRZA 3ZZ1A 2IQ9L 3O2VL 5HSFA 1BQLL 4NQCB 5C71A 4ODBD 2OTWA 2C3HA 3HKFA 4O58L 5I74C 1U92A 5HI4D 3LEVH 2UY6A 4W4OC 4NJAL 1GPOL 4IRZH 4MB5A 4ETQA 2X4NB 1T20A 3ARXA 5IVZA 3FTGB 5EORH 1QFWM 2R4RL 3KYKL 1I1AC 4RX4A 1A1OA 4TNWF 3VRLF 1CD1B 1VFAB 4PJBB 5CEYA 4GW4B 3LPGA 5DJZB 1ITCA 1CQKA 2UWEE 2YUZA 3P11H 4RISH 4D9LH 4S1QH 1CWVA 2Z31D 2IJ0C 3HMWH 4U1SA 3IF1A 5JMOC 2R2CA 5FECA 1KEML 3QFJB 4Y1AD 4BFEA 2OR7A 1PKQB 4JO1H 3GMQB 1DQLL 2DQUH 4QXTB 3RWHA 3IJSB 1B3JA 2IGFL 5SWSB 5TQ2H 1AD0A 4HJ0C 1T2XA 2BRQA 4G9DA 3SN6N 3ZDXF 5I1DB 1A7OL 1QBML 3L3DA 3UJTL 4OBSA 1SBBA 3SGJA 4PV8A 4G80A 1YNTA 5B8CC 4O00A 5MERA 4PB9L 4PS4L 4U1IB 5BMFH 5FYJU 1HKFA 1UB6B 1FGNL 3K0WA 4UB0L 1T04A 4JHAL 5JHDE 5JW3L 1IGCH 5IROA 4LEOB 4OJFH 4PR5B 3KPNB 2XA8L 1N7MH 3IDNB 1IVLA 4NKMB 3VGAB 1R3IH 1U58B 5E8DH 4TULL 4QCIB 4M02A 1HSBA 2D7PA 3PWJA 4QRPA 1FL6A 1HEZB 5D8JH 5L7XL 3MLXL 4P23D 2VABB 1D5IH 1INEL 2R4SL 4H0IA 2FX8L 3N1PC 2AEPL 3VJ6B 4DGIL 1GIGH 1Z5LB 5E8PB 4HEME 1TVHB 4UU9A 1HKLL 4Z8FL 3L5IA 5EN2A 4XHJD 3OGCA 4KKCC 3ARDB 4X6DE 4Z5RB 5JPNB 1B0WA 5TPWH 3SJVB 2EXYC 2JJTA 1JGEB 4WWID 4PJEB 3LQZB 2CO6B 3RQ3A 4DGYH 4I18C 4TPRH 1UWEH 4NJ9L 1QRNA 2Y06H 2ICWA 1DSFH 2Y07L 2YD8A 5F3HA 4G6ML 4XNUL 1VADB 4IMKC 4NZDA 4Y4KD 4WU5A 2H3NA 2QHLA 3BXNA 4YBQD 4KI5F 5KZCD 3TH4T 4DFIA 4BH7B 2GSGB 3Q48A 4WTWA 5I75C 3EJYC 1FIGL 2DMKA 4NYLA 4PBVC 2H26B 2WBJD 2NX5B 3C2SA 1N0XH 3CVHB 5F9DC 4P9HL 1FAIL 1AO7D 2VTFA 4JQIH 1T2QL 4WTZA 3MBEA 5DMKA 5LJYH 1HHKA 1FVCA 1KCRH 1MH5A 3LN4B 5E4EC 4O9HL 1X7QA 2Q8AH 4K8RD 4PJFF 3MRBA 4I77L 2ZUWA 1RI8A 1WT5A 3T3MF 3REVB 4PJ7F 5C6WH 4IRJB 4OV5A 2PW1B 4YHYB 4R4FL 5FUZL 4ODUA 3P9WB 2AJZA 2P44B 1SMOA 3BPCB 3QPQC 4OD3L 2IWGA 4JDZB 5E2TL 3F7VB 4ZAKD 5FYKU 5FYKL 4UIKH 3F65A 5C0CE 2F9BT 4MJ2A 3FB7B 5HHVH 2GCYA 1QLEH 3I02A 4D9LL 3VCLB 2NY5L 3U9UA 2Z31A 4PJXA 5F89B 5E1AB 3QIUA 4CN4A 4B7IA 2DM3A 2VYRE 1W8NA 3D9AL 2C3XA 1FG2B 1FLRL 1BIIA 1QYGL 5CCKH 2AV1A 4PY7A 3ARWA 5I1IH 4KUCF 1MCHA 1I9IH 1D9KC 3C6SA 4I48B 3C08L 3RWFA 4DZBA 4LARH 1FZKA 4Y4FC 4L29A 4P5KA 1HYSC 4CMMA 1HHGA 4U1KB 3QJFB 5GRWA 5FOJA 5HHOE 4P4KC 3FQTB 3E6HA 4HXBL 5J9PA 3BP4B 1XZ0A 4I1NB 1MVUA 5HGGS 4M6OL 1CLZL 3S36L 3CFCH 4OCRL 1U3YA 3CPLA 3MRLA 4FFYH 2BFVL 43CAB 2DL2A 1IGCL 5L6YL 5E6ZA 3WFEH 5GGVY 3O6FC 1LGVA 4JO3L 5C2UB 4HFWA 4PTTA 4NNXA 3QFDB 5C0BA 4CUCA 5B4MD 3ZKQD 1WC7A 4N8VB 5ICZA 4MLIA 1KLFA 2AV7A 5C0RL 1QA9B 3LS5H 2ZCLH 4DUWA 2XACC 4NHCL 3WE6A 2WLYA 3KPPA 5EBGA 5HGDB 2YPLB 3HNTH 2AEPH 4PRDB 3RTQC 1KJ2L 2V7NA 5HI4C 2E7LA 1CGSH 2AJVL 5IJVB 4PJIA 2D3VA 3VFSA 1HIML 3MRNB 4X8JA 1U93A 4RGOH 5FUOH 1WBZA 1I1AD 4JVPA 4ZUWB 3PP4H 2JCCF 4G9FD 2DL9A 4LPTA 5DJCB 4LDOB 3TYFB 5ANMA 3GSRB 2P46B 4KJQD 5IBTH 3I2CL 1EAPB 3RVUD 5DMYA 1KIUA 2IFFH 4G6MH 3HAEG 4ZOCA 3QEHB 1A22B 2XKNA 4XB7A 4G9FE 5GGRY 2V17L 4XCFH 1RU9H 2DYPA 3VRJA 4JCMA 4HLJA 4XAWH 3QEQA 4JJHA 3FT2B 2XPGB 5E56A 2YEZB 3MV8E 3O6FA 3MX0A 5DQJB 1ORQB 4X6BB 3WUWG 2B4CC 4NNPH 1NGYB 4RA3A 3ZKXB 5MEQB 2BMKA 1TCRA 4JQIL 1MHHA 2AXFB 4AMKH 3DXAB 5IBUG 1XH3A 3OAUH 4LHUA 1S9XA 4O9HH 1DLHB 3TBSA 2AEWA 1E4JA 5I30H 1UH3A 4RBPH 5GISL 3U7YL 5HI3D 5D7JA 5DO2C 3QNYA 1EZVX 4ERSH 5M95B 4ODSH 1LNUA 4R97C 5BZWB 2QSQA 1CT8A 3VD5A 1MFCH 2PKDA 3CD4A 3OJDA 3T0EE 1HNGA 2QQLH 5IJKC 1MQKH 3MLYH 1JRHH 3RDTC 1TIUA 2VUYA 3DOSA 3MLWH 2EDTA 4LSPH 4M1DL 3BDXA 3NFSH 4WCYH 2AK4A 4XPFH 4LSSL 4BZ2H 4MA1C 3N50A 5GPRA 5HGBA 3ARPA 4LKXB 4P46B 3WFDH 4LRIA 2PO6A 1FRGL 4NZJA 1EA9C 4Z7NF 1YJDH 1IQWH 4YDLB 5J11B 2NY6C 2XY2A 3EYVB 5E94B 5BZDB 4JFEE 1A7OH 1QBMH 4HV8B 1TQBB 1I7UB 1L9NA 2P5EE 2Q20A 4KVCL 1ACYL 3SY0A 3MRJA 1P4BL 2YPVH 3HFMH 5LXGL 1BQSA 3TJEL 4Y4KC 4AEHH 4JPKL 3UPCA 4IMLA 1MI5D 3OKKA 4YBQC 3KPQA 2DBLH 3G6DH 3WFEL 2D4DA 4Y16D 5DD5H 1AC0A 2ENSA 3PNWB 5D7SL 4YUEH 4JJ5A 4V1DD 4ODXB 3I6GB 2MFNA 4G5ZL 3W9EB 3RKDD 1OTUD 5DJYA 4U1LB 1I9RH 1AO7E 3OX8A 3K2UL 2I9LA 4WTXA 2VLJA 3C8HA 3HNVH 4K8RC 3MLXH 2X05A 1D5IL 4PJAB 1UQSB 2H1PH 2XKSA 4MVBD 5HHNA 4NCC1 5DURB 1CGSL 2P43B 1FH5L 3RIAK 3QHTC 2EYRB 1G7IA 4PTTB 5CINH 2HT3C 4AL8L 5EIIA 2VL5B 3G5VA 5JUEH 3KNBA 5AD0A 5GGSB 1YJDC 4P2YA 2XZAL 4EKXA 2H8PA 2R0ZH 3BE1H 3MNVA 2MQ0A 1JCKA 1XGYH 5D2NA 2JELL 1MJUH 2X40A 3PV6A 4J6RL 3UMTA 3VMOA 2Y06L 5GS3A 1ZLWH 4KROB 3MLTA 3KYOB 1H5BC 4MA3A 1EMTH 1KB9K 4WW1B 4DN3H 5IHZB 4Y19B 2EE6A 3FRUA 2E5EA 4XXCC 4OCSH 1HI6B 1EJOH 3ZKND 1C1EH 4OCYH 3TJHD 1RVFH 5CD5C 4RGND 4D8PA 2CRZA 1MPAH 2VQUA 3VDAA 2WWKT 4Y4FD 5D2LF 3UTSD 2J3SA 2ZWLT 3HZMB 3EIFA 3V6FA 3GM8A 1BVLA 3V79C 5A2IH 3BPNB 4ZQKB 4F7CB 2P5WE 4PRBA 1HDMB 1MNUL 2HT4C 2R1XA 4WI6A 5GGVH 4JREB 4NKIL 5GJSL 1DUYA 2O5ZH 4UV4L 4WTZG 4P5TB 2QL1A 1U6AH 3MRCA 4XP6H 2BNRE 5L2KB 2VZVA 5ILTH 1JI1A 2FATH 1MFCL 1DBML 5ID0B 5LQBL 3NFPA 2Q76B 5B4MC 3N9GH 2UVEA 5EO1A 2EKSB 2ICCA 2V9QA 3MZTA 2SEBB 1IC4L 1YNKH 4DW2H 4M1DH 3OKMB 3SKOB 4UAOB 1QG3A 1BEYL 4KK6D 5C09D 5DEGA 2XTJE 4NFCA 4JRXD 4ZFZB 3N0PB 4IOSD 3I3EA 3QJHB 1NH6A 1IGFH 2PR4H 1FC2D 1AGDB 1F4XL 3NA4A 4U4BA 1ORSB 5JHLL 3ARBD 2W59A 4GKZB 4WHYG 5LAXA 4EZMA 5T3ZL 2Z0BA 5CP3A 1YEJL 3IFOB 3ZE2E 4RX4D 4Z7VA 4RFOH 3H42L 5CEXA 4I2XE 5K59F 1MHCA 2D4FA 5DRXB 1U8JA 1YEFL 5HGBB 1R5WA 3RNQA 4TVSa 3GKWL 1LK2B 2VO5A 5D7JC 5I1KH 1CCZA 4L4VD 3DVNB 5F7DB 2EDBA 1DVFB 3LCYA 4G6FB 2EDHA 1PW3A 4HLZH 3LB6D 2EH7H 3ME0A 4BQ6A 1MHEB 2R0WL 3WSQH 1JHLL 3O3AA 2DQDL 4O5LL 3VFWA 1IL1A 3AREB 4XNXL 1RUPL 3M1BA 4YPGB 1MCCA 1BD2B 5BRZA 2AK1H 5C0DA 5JLZA 3CGTA 1KPRA 2X4TA 1EBPA 3B6SB 4DZ8A 3GSNB 3V5KB 3H9ZA 4P5TD 3L9RB 3MUGB 5GZOC 3PWUA 1I8KB 3IKCA 1H3XA 3WD5L 2ATKB 5IF0B 3DYMA 4C4KT 3AXLB 5BRZE 3KXFE 2KL6A 3UXFA 1QSZA 3T1WA 5CINL 3PWPB 4PJCB 4C56A 3LVEA 4JN2A 1QSEE 5I1EH 4GMTH 1CLYH 1YY9D 5C0AE 1KN2L 2VLJB 4QTIH 1P1ZA 1ZT7A 2FSEB 1IAMA 3WHE1 1PZ5B 4LU5H 5JW4Q 3VA2C 5ENWA 2WUBH 4NN7C 2ADIA 2V17H 2DLIA 4XCFL 2OJZH 3S35X 3MMEB 4N5ED 4XX1E 1JGUH 2WINB 3U79A 2H45A 4ELKA 3BZDA 5GRUL 4UDUA 1KNOA 2R1YA 4WO4D 1ZLWK 1CF8H 3NCBB 4PJ5B 2B2XH 4AY0A 4HKJA 4HAGA 3OB0H 1OM3L 4X4YB 3NABH 4AMKL 1RIVL 3EKCA 1J0KA 3OAUL 3ULVL 1A47A 2CXKA 2ZPKL 3UX9B 3GSXB 2X4SA 3DI2B 2FBJL 4FQXC 2GY5A 4NO0D 1WWWX 1FORL 1UVQB 1QUNA 4OGYH 1ERNA 1K8DA 4GRWB 3JVGA 2A83A 3MLUL 3T2NL 4G8GA 1HH6B 2JJUA 4LVOC 4ODSL 4Z18A 2P4AB 3C5ZD 3BI9X 4AG4L 4PGCB 4JR9H 4XP1L 3X14A 4DN4H 1OF2B 2J5LB 4I3SH 4NZTH 5IB1B 1IBGH 1OTTC 3IFPB 3MUY1 4OZIA 2C3GA 3MOBH 1CDGA 3QQ9D 5E6IB 4YHKH 1R24A 4NO0B 3WFHB 2JIXD 4JDZA 4H26A 5F7UA 4MNHB 5DR5L 3X3FL 4PLJC 1TLKA 3DSFL 3RX7A 4HWBA 4F7MB 5I1CL 4OF8A 5CUSH 1E28A 1G6RH 1UC6A 4XTRD 4HXAH 4C58B 2P7TB 3ZKXC 5JA9A 3HPLB 1BVZA 4R90L 2Q7YB 1EXUA 3BPLC 3ZTJG 3VFUB 2UZXB 3TBYB 5JIKA 3BZEA 2HFTA 1VGEL 1ZHKA 1KC5L 4Q6IA 1LVEA 4U0RC 1EEQA 3V5DB 5IWLC 3JTSA 3TJHC 5E8EA 4YHPB 1ZLVK 2V9TA 5TE7L 4IRSA 2BSTA 4OF7A 5CMAB 1D7FA 3RWCB 5DD5L 1BJ1H 2CMRL 3CVHL 5AZEH 2ERJB 3RZCD 4G5ZH 1T1YB 1A6TA 2OK0H 1S7WA 5D2NE 2YWYA 3HLAA 3K81A 3FB5B 4HGKC 4LIQH 5DFVD 1FVDB 2NY3D 5D6CB 3KPSE 3IFNL 1WBYB 3DV6B 1IM3B 2W60A 3QFJA 1S7QB 1AGEA 4NWTL 1ED3A 3WIHL 4PJ5D 1Q72H 5ADPL 3G6AB 5HYJE 2HT2C 1BOGA 1D5MB 1TZIA 4AL8H 2PW2A 4UNTA 1R6VA 4JY5L 4HKBB 3C09B 4OLYH 3PV7A 5EBWB 3MJ8B 3ELAT 4GRWF 3BE1L 5I9QC 3MV9A 4NBZB 4CJ1A 2D9QB 3DV4B 5B8CA 3VDBA 1UB6A 2DMBA 4YFDB 3FFCE 2ORBL 3L1OH 4R26H 3L5XH 4DN3L 4L4VB 5DZNA 3HR5B 3H9HA 4O2FA 3PHQA 4NC0B 5F1SA 5TFSL 1ZSDA 3B9KD 4J7RA 5ADOH 2NLJB 3GSRA 3GMLB 4OQTH 3H0TB 1DUZB 4XPBH 1JK8B 3GSOA 2JJWA 3VGEA 3PP3H 2DWEB 2GJ6D 3DO3A 4CW1B 3BT2H 3DX9A 3EGSB 3MC0A 1YQVL 4CADA 4YWGH 3HAEH 4JQXA 5BS0B 1K85A 4LLAA 1MVFA 4HQQH 2E7BA 1M7DB 3UZVB 3SKMA 5JW5A 5EC1B 5GS2H 3LB6C 1WTLA 2GHWB 3LN9A 3T65A 5F6HJ 1Y0LB 4DQOH 5JPNA 3NCMA 1WQVT 4WEBL 5T1MB 3NCYS 4Q2ZB 5LBSH 2FX7L 3BEVB 1KFAH 1IGML 2CDFA 1PY9A 4PGEA 3TBSB 1L0XA 1MFNA 2IADB 3VH8B 5GZOD 3MFGB 1S7SA 5ICXB 4YIQB 4PYHA 1YN7A 1DP0A 3T0EA 3CZJA 2PYEB 4YGVA 2CGRH 4ESKA 2YS4A 1YUHB 1K8DB 3S35H 5IMMB 4P3CH 1WEJL 5C0GA 1NGQH 1S78C 1HZHH 3OSKA 2H9GA 5AAWA 1NCBH 4H25A 3IGAB 1ZA6B 4MD4A 5D1ZA 2M8XA 4PV9B 4OZGF 5ECJE 3VXPA 1ZS8B 2R1WB 1JYXA 5CUSL 4JRYD 1FVCB 1YEKL 1WJ3A 4XB8A 1PBYA 5E5MA 3X12B 3H42H 3TYGH 4LOUD 2VIRB 3QUYC 3MLSL 3WN5A 4WFFE 4WU7A 2X4UB 5CEZL 1KCVH 4GW5B 2VZ3A 3P3YA 5I1DA 3VXMD 5MI0C 2X42A 2XRAH 4GS7C 4N5EC 5GGQH 1BZ9A 1YMHA 2J8OA 5D7IE 2YD6A 4I3RH 3U1SH 4C55A 2C1PB 3NACL 4HCRL 4KMQA 3T4YB 1W72H 3U30C 1XIWA 2H32H 1RUPH 4FS0A 3F62A 3VGHA 4KI1A 3U0WH 1DJSA 3Q6FB 4O51B 5HHOA 4ZAKC 3VD9A 5KG9B 2VH5H 5EUKA 4NKMA 3MSPA 2QADC 1OAZH 2A6DB 3RY4A 5HD8C 3IFNH 4KXZH 3ARDC 3KYNB 5I8CA 4PJAE 3QFJD 2EXWC 3LQAL 5L2JA 5EOTA 4JPVL 3EYUL 1IGYB 1G7JA 4Q97A 4MZ3A 3P4OB 2VLLA 3B83A 3LOWA 3TN0B 2HTKD 2OTUA 3P0YL 5TDPA 4CMHC 3TZVD 1CLOH 3OF6D 5I74B 1NCWH 1YMMA 2BNQD 3TBWB 2BXYA 4DKDC 3QQ9C 3TV3L 1HCVA 3DV6A 1ZK9A 1KCUH 5C0BE 2D03L 3TA3B 5FK9A 5IBUB 5I15H 5EWIH 3O3UN 1CXEA 5C0NC 4KZEH 3MNVB 3FQRA 1UA6H 4H88H 5JW4R 1CGXA 1KB5A 4MJ4A 1FDLL 4PRNB 1OAYL 4L8BB 4LFHD 3GBNH 4AENA 4XTRC 1JHTB 3UJJH 2GJ6A 2IH1A 3U82B 2AJYL 3AUVA 1X5IA 5DMIH 3SDAB 4WV1A 3LEYH 3NABL 4GXVH 5C09E 3VXTA 1KEGH 2IPTL 1HILA 3T3PE 1FFQA 2B4CL 5FGSA 1WAAF 3C60A 2YRLA 5DC0A 1XF1A 2E7LC 3BYTA 3QEUA 3BGFC 5D1QD 4Q9RL 4JFFA 4Y4HA 5D70H 3RTQD 3MBEB 3EFDH 4ODVL 3M8OL 3MLUH 4RAUA 5MI0B 3MPCA 3RZCC 4L8DB 1GHFL 3L7EA 3PL6A 3HAEA 4LASH 1TZHB 4OM1H 2H32B 3OR6B 2ZNWA 4MD5B 1Q9LA 4Z7OF 4PGDB 1CFNB 3WLWD 2RBLA 5EZJB 5C0CA 2FWOB 2X4RA 4U6HB 1HQRB 3HZVA 5DMJB 4U6YA 4XCEA 2D2OA 4NGHL 4OGAC 1YYML 2HT2D 1MCWM 4LHJB 4X6DA 4PYGA 1J7VR 4GBXB 3WBDA 5AG8A 2D31B 2RHEA 3O4LD 3TEUA 4UT9H 1MIMH 2Y72A 1T21B 4G8GE 3VFMB 5J57B 1AI1L 4TUOA 3QUMB 2GFBA 5IV2A 2GKIA 5SV4A 4KI5D 1QFOA 3VWKD 3TYGL 4OZHA 4PY7B 3CH8A 4LKCA 4Z76A 4N9GA 2EDQA 2AQ3A 1E4KC 2QSCL 4CDGC 1UXWA 1A6UL 3DETC 1WBXA 4RFEB 5KVFH 3HI6L 2ARJA 5HI3C 3RHWF 4PV9A 1P6AB 2H2PD 5CEYB 2JK5B 1XZ0B 5A43C 4W6YB 4H8WC 1SJVA 1AGFA 3U2SB 3O45B 1QRNE 3VWJA 4WU7B 1AGCB 3U0WL 3PHOB 4GRLC 3WO4B 4QRPE 3WJJC 4FQXA 2KUTA 3RDTD 1CFVH 5DT1L 4LIQL 3D2UD 5J7CC 4HH9A 2OI9C 4OLVH 1CR9H 1UWXH 1AD0B 2FLRT 1DQJB 2N7BA 3GSNA 4JPVH 3S5LG 5SWZB 3HC4H 5DA4A 2Q7NA 1S7VB 3ZLQC 1CL7H 2DTSA 1LE5A 2VC2L 1EO7A 2NY6D 5CKGA 4FQIL 1QQDA 3MCG1 4IS6B 4I3GA 43C9B 2FO1A 1CS6A 1T04B 2OX5A 3TNNA 2WBKA 4LVNB 4GG6A 2FO4B 4XNZC 4ZFOL 4PJEE 1LE9B 5EB9A 3SDCD 4PRIE 5FYKD 1BF8A 2HFEA 1IGJA 3IS1X 1MAMH 4BJLA 4F58H 2OL3H 5DVLA 2D03H 5I1GL 4NKQB 2QTEA 1JV5A 3H3PL 3EZ8A 1UM5H 1EFXB 4RZCB 3C8DA 1HHIB 4ZUUB 2NR6C 3RL1B 1HSBB 3S3PA 2XKNB 4I0KA 2EH8L 1KXVC 5AAMA 2A6JB 2HVKB 4XGZB 3V7MA 2ICEB 4LDEB 5GGUA 1IEAA 2W91A 5TE4L 3QUYD 1G6RB 2UWEA 2D7MA 5MENE 4KDTA 3P11L 1AXIB 2ICWI 2GEEA 1DEEA 5C09B 1N2RA 2OQJA 4CU6A 1NC2B 1FGVL 2I5YL 5IFJA 5DTFA 2H8PB 1B4JH 1GGYA 1NKOA 4NRYB 4V2CB 4X80L 3VXSB 4E41B 2MPAL 5BXFB 4KQ4L 4GOSA 5TQ2L 1NMAL 2BNUB 1RHHB 2AJSH 5HPMA 3CSGA 4QOKA 1MFBL 1Z0MA 3WNOA 5J13B 2QADD 3LKNB 2Z91A 3QZWA 2GSGA 2P1YA 4WW1A 4I18A 4R4BB 5FGBC 5HHPA 3DO7B 5TF0A 2A9ML 2R56L 5DEFB 3MNWA 2VZOA 3QRGL 4U6XB 3BGAA 1GGTA 1YYMH 4OD1H 2BRRL 5MEOA 3H7LA 4L3CB 1NCBL 1TCMA 3VGGA 5A2JH 4NUGL 4EOWL 1TZHA 2BXZA 3GSNH 25C8H 2VXSL 3KWWA 3UTTA 2NY4C 1HXMA 5DQDH 1BFSA 1HINH 3GB7B 5CLWA 4RBPK 1OB1B 4Z7WA 4P2OD 5GRZA 3BDYH 1S9YA 3WFHA 1JFQH 3HE7C 5JZ7C 4TULH 4IRJA 5DQ9B 3S3JA 1BREA 3ALPA 3A6BL 1J05A 1A6UH 4I4WA 3EDDA 1UKQA 4DGIH 2XRAL 2F74B 3BRFA 3QDJE 1LO0L 3KHQA 4JN1L 4HIIB 5EZOL 5T1KD 4I0PA 3X13B 2SEBA 2C3VA 5CSZB 3MCKA 3KPRA 1J12A 2P8LB 1YZZA 3OPZH 4DGYL 4QRQA 5FA4B 3SCMB 1PLGH 8FABB 4XNYH 2VDQH 1OAZL 5HJ3B 3W9DA 4NQXB 4YBLB 4W70A 2WIIB 4OLVL 4O4YH 3AU1A 3MROA 3S9DB 2OXHA 1X5LA 4D9QE 2VN4A 1FL5B 4EIZC 3KVQA 3PABB 2NY3B 1OQOA 3TO4C 3E3QE 5INCB 4X8XA 4X6CB 2AQ2A 2CPCA 3CVIL 2I26N 3D1MC 3HPJA 1NCAH 4D9QD 1D6VH 4PJ7B 3OF6A 1FAIH 4HPYH 12E8H 1P2CA 3QHFL 3UJIL 1KCRL 2IAMC 4JLRB 4BSVA 4ZXBD 4F58L 2Q8AL 2ICWB 4MAYC 4JVWA 4L4JA 2MHAA 5EWIL 3K2MC 2FYYA 3D39B 3TNMA 4WENB 5D7JD 1C5BH 1B4RA 3JV4B 1UM5L 1KJVB 1EEZA 4B50A 4CVUA 3ZDYF 4BH7A 1BVKA 4J1UB 4JGJA 3MV11 1BLNA 4MQ7B 3WNMA 3VWKC 5CBEA 3QXUA 4MJIE 3VXNB 3CVHA 3O4OC 4A2MA 3SDXE 2DQFA 4ZODA 1YPZE 5DURD 1F3JB 4P5TC 4OI8A 2XN9D 3FQXA 5D7LB 1LDPL 3BZ4A 5F70A 4XWGL 4QHKI 4YLQT 2ITCB 3ARQA 3M8OH 2J5LC 1HDMA 5I71C 3RPIA 1CXIA 4GXUM 4N8CL 4KV5E 5IVNA 4X80H 5CSGA 1QEWB 2JCCA 2LFGA 1IARB 3L5JA 1F4HA 2QHRH 3MLZH 1YY9C 1RZGA 3VH8G 1LP9E 1WLHA 4M8VA 3QEQB 4OB5L 1MI5B 5H35A 3BKJH 3REWB 3MGOA 3IDYB 1NANH 3ULVE 1J1OH 3C5ZB 3VD7A 4EDXA 4ZTPH 2F15A 4GAFB 1L7TL 2XWTB 4XXCA 1A9EA 1CLZH 3S36H 5DTFB 1GYAA 4M4RA 4K94C 1G9NL 4DGVL 4QRRD 2NW2B 4Y1AB 1MIML 3CK0H 2YR3A 2PYEA 4U3CA 1AR1D 1U95A 2DLGA 1KLGB 3Q5YA 4FQHB 4P3DA 4YDIH 5IMMA 1YEIL 3PWNA 3DGGB 1OP5H 3SDCC 1S7XB 4LLVA 1CLCA 1F42A 2VR9A 1T89A 3OXRB 4Z7VB 4PJBA 4UTAL 4WUUE 1KJ2A 1YC8A 2AJVH 2PO6D 5DJ0B 4DKEL 1T1ZB 4NZRL 5F7DA 3C5ZC 3CFJB 1TJHH 5B39B 4Z7WB 2PXYD 5F44A 5MHSE 4TQEH 4YDVB 4G9FA 1GCFA 3CCHA 5E70A 5K9OA 3OPZL 3F7YA 4FXGA 4GAGL 3UYPA 1YPZA 2CLZB 5C0EB 1T22A 5HDBE 1J0IA 3KR3H 1RK0B 1II4E 2GTWA 3HTLX 1J8HE 5KOVC 3DXAD 2RR3A 3ZYOA 1BZ7A 2P8MA 4A6YH 4C56E 1YN6B 3X13A 2EYSB 4HKXA 4G6JL 1Y6NR 3KXFA 4R4NC 4XC1H 2CLRB 4KJWD 2XTJD 3HUJE 3SCMD 3PWPA 1OAUL 3EOBA 3G6JF 3HE6A 4P57A 2GJZA 1O7SA 2DQGH 1T7XA 5GGTA 4HJJL 3MROB 3DRQA 1GZQA 4YXLH 4RMRA 1P4IH 5L2KD 2EE2A 1LO3H 2LV4A 5C1MB 3PWJB 4QRPB 3U7YH 1C5BL 4HAFA 4UQ3A 4FG6D 4TSAH 5D4QA 4OUOA 5INCA 1ZOXA 4MAYB 5JR1H 3VXRE 3VFVB 1C5DB 3D39E 4Y5XA 3L5WA 3S96B 5MENB 1TPXB 3O41A 4HCRA 3T0DA 4K3HA 1A3RL 2NTFA 3L3GB 5JZ7D 1L7IL 1DFBL 1AKJB 1JPGA 1PG7H 3LKRA 4LSRH 3RIFF 5IKCB 1I8IB 4XBPA 1XF3A 2DM4A 3IU4L 2I07B 4F7TA 3IXAA 4HZLB 5HHXH 4JFDD 5T1DH 3AAZB 2AXHA 3Q3GB 1KB9J 4OLUH 2I5YH 3QDJD 1ZLSH 2VR4A 1CE1L 3MRPA 2DQIL 5F7EL 1UVQA 2JJTC 4OLEA 3EFFB 5EC2A 5IHZA 1EZVY 3FRUB 1QHPA 4WDIB 4BQBA 1V3KA 4PJXE 4PJ8A 3Q6GH 4EN3B 1RZKH 4IEFB 5HYFA 5C6TL 4KUZL 1DQQA 1OAKL 3L3HB 3AB0B 4LFHG 4IMKA 2FH6A 1IZKA 1MF2L 1CE6B 3S5LB 4X4ME 3QR2A 3DECA 4NQVA 1TZGH 3OB0K 4B5EA 3DUUA 2DQJH 1L6XA 2BY3A 2BVPB 2DWEA 1KTLA 3P4NA 2CSPA 3O3EA 4JPIB 4S10A 3OWEA 3STZA 5D7SH 4RAHA 2R1XB 3RA7H 1FBIH 4PJFB 4DTGH 3RDTB 3HE7B 3TFKC 5GJTH 3ZKMD 5E8NB 3P9LB 5FKPB 5CZVH 5C3TA 4X7SL 4MAYD 5I1AB 3B9EA 1TQCC 3MJ7A 3BUYA 4JAMA 3ARSA 2EDLA 1WVZA 1NL0H 4OAWA 5DJ6A 1HWGB 3W0WE 1ZT1B 4G43A 1EXUB 5J56B 4FQQA 4KJYB 3EHBD 3U9UB 4PGEB 3GSVA 5EULV 3DURB 1T0MB 3MRRB 4H8WL 4ELMA 4Z7OE 3SDCB 1NGZB 2COQA 3QQ3A 4Z7VF 3QG7L 1N6UA 5IP4A 5LWYL 1RZFL 1MJUL 4X5XB 2YKLH 4PRIA 4LNVA 1BJ1J 1FZJA 1W8OA 3BQUC 4NQDB 1T0PB 4N90E 4LAJH 5DFTA 3AMLA 4JREC 1S78D 4PREB 5DMGD 2C9AA 3VXPB 2E9IA 5D6CA 3PHOA 3FQUA 3IDYC 3QPXL 1TMCB 2NZ9D 1YNLL 2VIRA 1GGCL 3OB8A 1S7UA 4Y4FA 4OCXL 1T83C 2OMNA 4Z7QE 5MEND 3TBVA 2VLKA 1DQJA 4NNXB 4WHCA 1CICD 1CFSB 1Z2KA 4GAYA 4LOUC 4F57L 3QDME 4MA8H 1QKZL 1P69B 5EU3A 3TWCL 1LE5B 1JNHB 4UOW0 4TSAL 3GUTA 4JCLA 3VRIA 4KROC 1ZGLB 5IB3A 4NJAH 5JR1L 3ABZA 4X4ZA 1UG9A 3PHQB 4O51A 4K8RL 1PVHA 1CDUA 1JHKL 2AEIT 4KTEL 3IFLH 3A67H 1WIUA 2B1HL 3HI5L 1X5XA 4FXKA 4ZS6D 4M7JH 4AT6B 4M7LL 1OHQA 4GO6B 3IU4H 3W11D 4PJDF 4JN2B 3WN5C 5LG1A 5EBMB 5CJXC 1VSCA 3O4LB 1HHJA 4UTBH 1FFPA 2CUIA 4CADB 5FEBA 3WS3A 4BKLA 4LSQH 5J0BA 4PLKD 3VFNB 2C4XA 2XQYG 2UVFA 1A3LL 2R9HD 5E9DE 1N2RB 1M6OB 3L3JB 5JOPD 4PJ8D 1KG0B 4Q2ZA 5FKAA 5DYOB 2AKRB 3G5ZB 3VG0H 4NQCD 1NFDE 3A6CH 4CL7A 3Q3GA 2EICA 1U8KA 3VH8A 3ARFA 4LK4A 4OFDA 4PJGA 5DJDA 5IEHB 4TUKL 5HY9A 32C2B 3L7FA 2YA2A 4X9IA 3MXWL 4MX7A 1OAQL 3NZ8A 1N7ML 3SCMC 2AK1L 2FEDD 4P2QB 3RVTD 4RGMC 1MJJB 1OCWH 3MA9L 2IANA 1IAIM 4ONOA 3SGEH 1CTNA 3GMNA 4KKLD 1TETL 1UB5A 1NAMH 4OLZH 4KRPB 1XGUB 2ARWA 4PJ7E 2R23A 2GJ6E 1ZEAL 3L7EB 3QCVH 5C0JB 3O3EB 4JPIA 2VZTA 3STZB 3DVFA 5HI5C 3GMQA 3RWHB 5I1EL 4RMVA 4CVXB 1RIHH 1W0VA 1FIEA 4X5WB 2X89A 1R24B 4MA7L 3QWOB 1FE8H 1GRWA 4CBPA 4NQTA 4M1GH 1RURL 2NY4B 3WLWC 4K9EC 4L3ED 4OT1H 1DSFL 1IFHH 4UT7H 2UZIH 2C5DC 2D9CA 5EU5B 2C4FT 3A6OA 4L8SC 4D0DA 2GYSA 2XTLA 3HA0A 3GSVB 5IF0A 1JWSA 5DRWA 5CP7B 2X70A 3RGHA 4A6YL 2RCSH 4YFLI 3IDUA 3RIFK 5D7LE 5I76A 1UEMA 3LS4H 2YMXH 1XFPA 1K8IB 2D0GA 4YQXH 3VFPB 4LGPB 5A3IC 2DIBA 3ULUH 1AO7A 1H3GA 2BOBB 3EOTL 4XP9L 5GS0L 4JFZH 1N3NA 4F57H 5D7KE 2A6KA 3CLEL 4MA8L 2JB5L 1C16A 3THML 4YXLL 1QSFE 4I77H 3OX8B 4NIKB 4OGYL 3MO1B 4ZPVA 5FM5O 1OARL 5CIPA 2CLVA 1D9KB 4P99A 2W9DH 1S7RB 3GIZH 1AXSA 1FVEA 2H2PC 4EBQL 4AG4H 4NN5B 1PKOA 3TBVB 1S8DA 4HUVA 1NAMA 5B3NA 2FYYB 5FYKH 4ENED 5B38G 5E6YA 5AD0B 1RUKL 3TN0C 2V9RA 3MGTB 2YPKB 1AC6A 5EFIA 4P4RA 2Z92A 4U49A 3WDIA 1RJLB 1T1WA 5DR5H 5GQBA 4IRZL 3QEUB 1AJ7H 4MNGB 1G9NC 3L3KA 4WW2C 5I1IL 3R8BB 3DUSA 1JP5A 2VISB 4LVNC 4AQOA 1DDHB 5JORA 1BD2D 1G6RL 1EK3A 3T04D 3UBXI 2WP3O 1SJXA 2AJXH 1QFWL 4HIHB 1VPOH 4S2SA 1ZSDB 1D3CA 3P0GB 1IQDA 2Z93A 4GRLA 2DDQH 3HZMA 5DUPH 1XR9B 4PJIF 4RMTA 5C6TH 4EI6A 3L3OA 3FB8B 1HHIA 4LLYA 4CVWA 4HUWA 3CFCL 4OCRH 5FV2A 3JV6B 1HQRA 5DFWH 5EN2B 5DDHB 1Q94A 5FB8A 3JWOC 2CR6A 4NKOB 1QO3B 3BP7B 4OUUA 3BP6A 4F15C 2AW2A 3QI9A 4F33B 5IBLC 3MBEC 3KYMA 4XZUB 3JV0A 3DX7B 4EI5A 4H0GA 2DTMH 2Z31C 4NQEB 2JB6A 3BEVA 4OBRA 4PJXB 5IEHA 2YUVA 5F89A 2Y7QA 1MY7A 4P3DB 5DC9B 4IHOA 1MUJA 1KPVB 4WUUB 3KLHD 2VXVL 3PDOB 5CIPH 1AGDA 2NY1B 2WZPD 4OZ4B 3PP4L 3LKNA 5DEZA 3Q0HA 4KKNA 4NO2A 2A0LC 3O9WD 5C92A 4TUJB 4ZUSB 5DEFA 3ULVF 4NQED 5SWSD 3KJ6H 5DJ0A 2FIKB 5AEAA 2OZ4L 2N56A 1WSST 1VCAA 4W4NA 5F9JA 5D1ZB 2FX8H 1ND0A 3CFJA 5B39A 4ZO7A 3JWOL 3VXQB 2D7TH 3FO0H 1DCLA 3REVA 4CN1A 1KIRB 2QLVB 2NMSA 3CCHB 3O6LL 3VFTB 3JWDL 1IM9B 4HC1L 5DRZA 4OQTL 3VD4A 1SBSL 4FQLH 2NY4D 3H7BB 1ZVSB 4OCXH 2M26A 3FFCA 4O2CA 3SGJC 3OKDB 1RZIA 4ZO9A 3MYJA 1KPRB 3CLEH 3DV4A 5B8CB 1WISA 3MV9E 2QADB 5I75B 4QGTA 2JB5H 5HYSB 4XNUH 3KPPB 3HCVA 5IFHL 3FQNB 1KJ3H 3S98A 4KMLB 4XCYA 2BNRD 5IROC 4URTB 5L88H 4ERSL 3E8UL 2O61B 5CSZA 4PJIB 1QPPA 5F7LB 1K8IA 4EBQH 5L8JB 3V2AR 4RNRA 3L6FB 3RVTC 5IW1A 1EFXA 5FA4A 3SCMA 4L8CA 2BVQB 4Y2DB 3NCCB 4NQXA 5GGSY 3O6ML 4KKLC 4UUJB 1LO4H 1G7JB 1ZHNB 3VFRA 2YN5A 5C2BL 3BD5A 3BP4A 1OD7A 4M6AA 1G7LA 3QEHA 4X6EB 1ZT7B 4HF5L 2FH8A 5I17B 4P3CL 2G75B 5BO1L 4X6CA 3BN9D 1Y0LA 2ZUYA 4K07A 3OKYA 2R2HA 4NHUB 5C9JB 4MNQA 4HZAA 4QHNA 1F2XK 3BH8B 3DYPA 1BHGA 5E2WH 5I1HH 3DBXA 3IDMA 4OZFG 5E2TH 3EW3B 1KBGH 2F53D 1X5ZA 3CH1B 4ORGA 4AIZB 5CEZH 3HFML 2A73B 3JV4A 1YEHH 3TCXA 3OXSA 5IGXH 4PRPA 1MCPH 3GK8H 3SKJL 3QO0A 4QRRE 3LHPH 3MNWB 4HWNA 3V6BR 1G84A 4HW6A 4M93C 1FZMB 4PJGE 3CC5A 3UAJC 2ZG1A 3MCLL 5D2LE 2ILLA 4NQDE 3HNSH 2DQFB 4G8GB 1XCTA 4FTVB 2R1WA 4UDTA 1NFDA 1PSKL 1MCFA 1G7PB 1N8ZA 3MA9H 1HQ4B 5ANMB 2KKQA 1LO5A 3UROR 2EEDA 3HR6A 1KXQE 1AXTL 5HYQA 5BJTA 3NZHH 2BVPA 4GAJH 4K2UH 4OIIH 4GW5A 4M6OH 1DQML 1U8IA 4FNLL 2AI0H 2DMCA 5JIPA 2EIEA 1F4YH 3T4YA 5KN5A 1JF5A 4JZNA 2FJGA 4MNHA 4NO5B 4UQ2B 1HYSD 4MA7H 1FE8L 1CXKA 4KWUA 2MMXA 3T0EC 1UADC 4Y19E 1EGJA 4NQEA 4J6RH 3R1GL 1JNNH 4WEUD 1DLHA 1KJMB 3RP1A 1SEQH 2Y7QB 3GNML 1T0MA 1ZGLP 4Z0XA 5JQHC 3KDMB 4QRQB 1NGZA 4R9HA 1U36A 4PRHB 4KZEL 1T6WA 3GJFK 5I66A 1HOCA 3SO5A 4XBGA 1IKFL 1IGYA 2R69L 5SWZE 5EU6E 4DK3A 3X11B 2EE3A 5J6HA 3P0VH 4ZUSA 1REIA 4DEPC 5EZLB 4U1LA 2EYTB 5CHNA 4UI2A 1VACA 5F9JB 3IF1B 3ZT7A 4PRID 3MJGX 4C4KO 1K2DB 1OPGH 1LEKA 2KPNA 1Q9OB 1KIRA 1QFHA 1I1YA 4NKIH 4NP4H 5GJSH 1FYTA 2APXA 3F6LA 5L88L 4OCWH 1U6AL 2DIAA 5KSAD 4XPHL 4P5MB 4L4TE 3PE9A 2VB5A 1BGXL 3IAQA 3U83A 4MWFA 1D5XA 3D6GA 2XN9E 1MEXH 4OSUL 1MJ7H 4KKAC 3KLSA 4HV8A 3ILPA 3VFOB 4OFYA 1RQ5A 2PETA 1XCQB 1JYWA 3P9MA 3SDDB 4XCYB 3BWAA 4TTGA 5GISH 4PJCE 4NGHH 2X5PA 3S4SG 2A77H 3O4LE 4YR6A 2PR4L 1JL8A 4FQJL 1KT2A 4L1HA 3SKNA 2BOCB 1PG7X 4MMZC 1AJ7L 1IGJB 5I19H 2CIKA 3K7UA 2XQYK 4Y2DA 1FYTE 2BY2A 3O9WC 3MRMA 5T3XL 1G1CA 5I1HL 2BC4A 4FN0A 4Q9QL 1DBKL 1FFPB 2F53A 1A2YB 1QFWH 5DJYB 1G9EA 4OKVB 2Q6WA 2CR3A 3S88H 1A6WH 4LCWB 3MLWL 4ZQKA 5I0ZA 3D3VB 3MLRH 5KVEH 4A6YB 4ODTL 3TM6A 1RZGB 4KGLA 4KGJA 5DO2D 5IGXL 1BD2E 3GMRA 4G8FA 4IIQC 3TBTA 1G6RA 2Q3ZA 4RWYL 3H9SA 1GH7A 3JUYA 3L3JA 3BH8A 5JW5B 4JM2C 1LHZA 4K9EH 4U1MB 5F1IB 1W2KT 5JXEA 2V2TA 4WIQA 5GGSA 2DQHH 3S8WA 4AIZA 3C5JA 3I6LD 3F7PC 3G6JA 4OKDA 1ACYH 4ZPTA 2QQNH 5HY9B 1DN0A 2DTML 3OQ3B 2OJEB 3LSOB 2LU4A 1DZBA 1XGQA 4BZ1H 4JPKH 4TVPE 1OAXL 1RUAL 1UM6L 4MDIA 1MREL 5DZOA 5IIEB 5HHME 5ESVB 2VXVH 4IOFD 5EC2B 5ITBL 3O81A 1X5AA 3CFDA 2V5SA 3K1KC 4WI4A 2J6EL 1F2QA 3V6FB 3IFOA 3O9WA 1BVLB 5CBAA 1I9RL 3INUH 1I1FB 4IRJD 1XF2B 1NFDF 1EPFA 3SDDC 2ARJQ 2OL3L 3UTTB 4CDHA 2H1PL 5F96H 4W68A 2K1MA 5F7WC 1OW0C 1JPTL 4P3WA 3O8XC 4JDVA 5JW4N 3VFWB 2PNDA 2R69H 5T1KA 4YPGA 2UV3A 5BRZB 1BZ9B 1YMHB 1SBSH 3CAFA 4RGNB 5HVHC 3RKDC 1DANU 1GZPB 1KLUA 1XIWB 5HDQH 5TE4H 3V0VA 2NNAB 5I1JH 4UMGA 5E1AA 2NYYC 1X3DA 5FYLH 1AD9A 3IVKB 4PG2C 4FQQB 2FBJH 2GJZB 1F00I 1FORH 4JFPB 2FRGP 3MCKB 2DYPD 1FZOB 1BJ8A 1FGVH 4YHLH 4D3CL 3RGVB 5H94B 3MRHA 3UAJD 3X11A 1H5BB 1ACZA 4L29B 5E2UH 5TE6H 2Z4QA 4JR9L 3QQ4B 5A2KH 4OSUH 5IHBA 5INDB 4R7DB 4POUB 5F9WC 5EO0A 1HH9B 2B8OT 2KZWA 1HSAA 1MFDL 3EBAA 3O6MH 5DD6A 3L5WB 2I60L 2YUXA 3G08B 1LD9B 1E4XH 3PDGA 3GSWB 4RGNE 3WDHA 2C7UB 2X1OA 4KDVA 3BIBX 3PUCA 1CG9A 1I85C 4L8SA 4O58H 4G3YL 4Y88A 2GITB 2IPUK 1P2CB 4MGXA 3AAZA 4POZC 5LQBH 3DSFH 3FZUC 2R2BB 2V2WB 4DZ8B 5IMOA 2AVGA 3FT3A 1CFSA 1DBKH 1T5XB 1FL3B 1R5VB 4XCNA 3CLFL 1CQYA 2FHFA 4PD4K 4P49A 5HYSG 2R8SL 2Z91B 5B22A 4S1QL 2KBGA 3VXUE 4X4XB 4OZFA 5DI8A 1CK0H 1NGWB 3FN3A 4M61B 4RWYH 1IAIL 4YBLC 1XGPB 4HUXB 3G04B 2YN3A 1Q8MA 4UT6H 5J06A 5JQ6H 3NGBB 3P4NB 2VABA 3JSSA 3V52L 4MD5A 4KK6C 4LPWA 1LP9A 3RNKA 4JFEA 3UYOD 2JIXB 3ARRA 3GKWH 3TH2T 3BP6B 1JPST 2X1PA 5CWSB 4JHAH 4FNLH 1MREH 3QWRA 2LAGB 2WAHA 4TVPH 2YD7A 4WNQB 3SE4C 2R0WH 1GJIA 4I8DA 2HKFH 2XA8H 1RSFA 4PLKC 1IE5A 4HIIA 2XXMB 4JFDE 4JQVC 1SVCP 3TZVA 3MV9D 1IJ9A 3O3DA 1Y18A 1H15A 2WWKO 5LGJA 2RJMA 3IAPA 4G6AC 5IM7B 3G5XA 3QIWB 3TVMA 3ARVA 4TSBH 3BZEB 3PDOA 1DEDA 4RDQG 4OZHB 3QRFM 2H3NB 2BSED 3L5XL 2QEJA 5F9OH 3RVXD 3SGDH 5DHXB 2ZOKA 3LQAC 3V5DA 3VU2A 1JPTH 5I6XC 4JM2A 4MQSB 5E8EB 3VWKB 3OKEA 5AUMB 4YO0B 4F8QA 1OWWA 5D7LD 2YZ8A 4POYA 1MCKA 1E4WL 3KS0J 1KELH 3S37H 4JO4H 1KACB 5BQ7B 2OZ4A 1OTSD 1UB5B 4YWGL 1G6VK 5D1XD 4QHUA 3IJSA 2GI7A 4YEFA 1HWHB 1FFNA 1B90A 2CRMA 3P77B 3VE0A 2D0FA 2BVTA 1D5ZA 2FEEI 3DROB 5JNYB 1ED3B 1J0HA 4DQOL 1P5UA 3F12A 5JIIA 4FXGB 2ZJSL 1W0VB 1FFRA 2JKXA 1YY8A 4G7VL 5GRUH 3NBNA 1BBJB 1H3PH 5HI5D 1I7UA 1VEOA 4U2YA 2N4IA 1MRDL 1OM3H 3FB7A 3MFFA 1DQDH 2DI7A 3NPZB 2LQRA 3EO1A 3BKJL 3O2DH 3NIDE 2JJVA 2I60H 3TBYA 2ZPKH 2CGRL 4JFQA 5SX4H 1J11A 2PF6A 1L7TH 2NY7H 5CJ5A 3RWEB 1BFOB 1I8LC 3H9HB 4H1LA 5DS8B 1P5VA 4M03A 5CS7A 4G8GD 3R8QA 3TPUB 4DGVH 3QBTB 1UKSA 5GRVL 4WO4C 4M5YL 4NBYB 1I7TA 3EDJA 4F8TA 1YEEH 3IDIA 3RL1A 4OFPA 4YHML 2YOCA 4OQTA 3QJFA 3VFNA 1F11A 3C8KA 1UACH 4D0BA 1N5AA 3FB5A 3RVVD 5BS0A 3IRPX 5KVEL 2BVEA 3ULUD 4TNVK 2UWEB 3MV7D 3QDGE 4EUPH 5DD1L 4JRXA 1KG0A 5FKAB 3WHXA 1E6JH 6FABH 3G6AA 3O8XD 2IH3A 4MXVF 4KY1H 5IB2A 2BX5A 1R3KB 5LGKA 1QYGH 3KLDA 2Y5EA 5FOBB 4PB0H 5I1CH 1F8TL 1VFOA 2VDRH 5DD3H 4WU5B 32C2A 1UZ8B 1OTTD 1NBYB 2XIDA 3NTCH 1F45A 1A1MB 2HLFD 4GAGH 1SYSB 4JKWA 4PJ9D 5KSBE 4ISVB 1BOYA 3D0VA 4Y5YB 2GK2A 4ALAL 3RWIB 2F5BL 1KC5H 4F7PB 5J13C 4L4VA 2IANB 3QZWB 1U91B 5ISZB 2JTDA 4NQSA 3B2UD 5TE7H 1M05A 3MRNA 1HXYA 4JO3H 5TF1H 5AZEL 5DK0A 2RAMA 1RK1B 3P4LA 4XC1L 1TJGH 4DEPB 3D0LA 5ERWB 3ZO0A 3H6JA 3T1FB 2UYLB 4P0DA 5FYKE 1U8IB 3OHXB 3MNZB 1HXMB 5E5RB 2MOVA 2V5MA 4FP8L 3ARGC 3LMJL 3FCTB 4PP2B 4G7YL 4GKNA 3TT1L 5L2KA 4HIXH 5EC1A 5I15L 3QH3A 1FP5A 3ROOA 1PG7W 4M6NL 4RSVA 1DBBH 2VNCA 4POZD 4Y2OA 5EO1B 1Q38A 3VMNA 3IJYB 1K6QL 1JVKA 4YJZL 3QCUH 2CDFB 1UYWL 2N1KA 2OS7A 2KQNA 5F3BB 2ED9A 1H15B 4OZHF 3BH9A 1JZ8A 1B0GA 4OLWH 3QUXA 2LVCA 3LEYL 4GXVL 1T4KB 5EUKB 4UNUA 1U92B 4JG0H 1FSKB 3O2WH 2F19H 3ESUF 4DUXA 2OBGA 2X1XR 2ZUSA 1M1SA 5C3LD 4P5KB 1LNUB 4V1DE 4GKZA 5BZWA 5LAXB 4D3CH 1T03H 5GS2D 1A02N 3SE3A 2BP3A 5JDSB 4LCCC 2W38A 2NY1D 1TTFA 4NM8L 5F7EH 1OSZB 4FZ8H 3U4BH 3KLHC 3MRGB 4XPBL 4JG1H 5K9QI 2FNBA 3RJDA 1HHHA 5MENA 3BT2L 1WFTA 3JXAA 5B3JF 3DVNA 1PYWB 4KMTL 3WIFA 1MFDH 3PG2A 4JRYE 4PRAB 1LEGA 3CDCA 4AZ8A 5DJ2B 2A9NH 3MJ9A 3P4MB 3BKCL 1E4XL 3PHSA 4F7TB 1TJIH 1MF2H 1IL1B 2NY7L 1S7UB 4Y4FB 1BM3L 4N1HB 3MGTA 5JPMA 4XVTL 2OR9H 1JZ7A 2XZQL 4WEBH 1CVRA 2WBJB 4JB9L 5L8KB 1XGTA 1NBZB 1XCQA 4MD0B 3RA7L 3MFFB 1X5GA 4G80B 4DUVA 4YHMH 4OIAA 4R2GC 3KGRA 3BWAB 3U0TA 3G5YB 1JRHL 4WV1B 5E9DB 2G2RA 1JTPA 1Q1JL 4HLZG 5CZVL 3DUSB 3RU8L 3DMMB 2P5EB 5F6HI 4ZD3L 4BZ2L 1WBZB 1MCQA 3MRQB 4JY6B 4N0UE 1UM4H 3WUWB 4DAGH 3HMXH 3KS0H 3PL6C 4LLYB 1YJDL 3RY6A 4L8DA 2YHGA 1OP3K 4Z0BH 2UWEF 5TDNB 4MXQC 1VGKB 3NTCL 1C8PA 2ADIB 4TTDC 1WAAA 3H9SB 3GHEH 3TJEH 3O6FB 5DT1H 1ORQA 2G75A 4X6BA 4U6YB 4BFBD 5FK9B 3EYOB 4D0CB 1NGYA 2CKNA 1H8NA 1Q0YL 5EUOE 1OGAB 2O5XL 5KSBB 3PWLB 1ZT1A 4G43B 3U1SL 3G5VB 3ETBF 2D31A 2HKFL 1INDL 4L8BA 4XNMA 4P4KB 3QPXH 3SQBA 1UZ8A 1XGRB 5FGCB 3KPTA 3SDAA 5E4IA 1T20B 2DD8H 4YFEA 2F58L 3GMMA 1X5HA 5D93C 3MLTB 2A83B 4LCYA 1FO0L 4KVNL 3NZ8B 4GW4A 2L4OA 4RMUA 2ZCKH 2IC2A 3K80A 2J88H 3V0WL 5LCVL 1EHXA 1A6AB 4AJ0A 1OD9A 3QT2A 2JK5A 2K3TA 2XNAB 4PRHD 5CJ8A 3LRHA 3S37L 4JO4L 4K8RH 3ZDZF 4KTEH 5F71A 4KFZC 4U1NA 4EIGB 4G9DB 1FLTX 1QZ1A 4JG0L 2EXWD 4LVEA 3NA9H 5D6DC 4BQ8A 4X6DF 4X5WA 1S9VA 4GBXA 5C0EA 2B39A 3FMGL 3QEQD 1C1EL 3LH2H 2ZJSH 3HZKA 4AM0A 4JFFE 4Y5YC 2JF1A 1AD9B 1H3PL 1KTDA 4FQ1H 2GIYA 3TZVC 3WCYA 4LVHB 1I7ZB 3IETA 3LAFA 5IB4B 3KPQB 3ALXA 5DVOA 1ZHKB 1DQDL 5L8LB 1AP2B 4CU7A 1WWBX 1CXLA 4MQXD 4MJ6A 4ONFH 4KI5E 1A4JA 3U4AA 4XWOC 1EBAA 4RFNC 2FX9L 4NO3B 2Q86A 3LZFL 1MCOH 5IT2L 2ARJB 3BGFB 4JM4L 4ZSOA 1IC5H 2DS4A 1OY3B 4JB9H 1A6TB 2HFGH 3EYQD 3VW3H 5DD6B 3RL2B 1HHHB 1TVDA 2PYED 2KH2B 2AJUH 1RZJC 4JRXE 3U2SA 3BPOC 5JOFB 1IC4H 5DUML 1JFQL 1K2DA 1LEKB 5C0CD 5C9JA 5I8OH 4BM7A 1S7RA 1BEYH 3A6BH 1ZTXH 4HH9B 3SOBH 4HKZB 1AKJA 1JPGB 1LO2H 4F9PC 1E6JL 2AJ3A 5ISZD 1NC2A 4HMEA 4HZLA 1F4XH 2ZUQC 3IXAB 4DAGL 3QCVL 5DJDB 3EDFA 4RIRA 3QDMB 1G7MA 1NAKL 5HGAB 3U46B 5JHLH 1U8NB 4JE4B 3KYOA 3LKPA 4NSKB 2CUMA 1NCNA 2EDRA 3SDXF 2Y4SA 4RFOL 1VB9A 4M1GL 4P2QA 1S5IL 4MHHI 1V8HA 4LP5A 2V7NB 3QAZB 5IQ7L 3AY4A 3EFFA 4O2FB 4X6CF 2YD5A 4XNYL 5ELIA 1XGPA 4XMLL 5KTEH 4J3XA 1IEBB 3KPLA 4WFHD 3D25A 5D71L 4KV5F 4JHZA 3ALWA 5C9KA 1W0YT 2DQDH 4GH7B 4Y16A 3VXME 4WI5A 5GGUB 3RGVD 5CWSA 5GGTL 5D5ME 2DYPB 3N1MC 3QHFH 2XWBB 3UJIH 3RDTA 1T6VN 4NKOA 3F7RA 1OGAA 2GCYB 2XPGA 4HT1L 1U8PB 4HIXL 3TH3T 3NMEA 1NCCH 2HRPH 1XR8A 1I8MB 5FHAL 2HAZA 2HLAB 2ZSWA 4EVNB 1K6QH 4FFZH 3TC9A 4XP5H 5E8OA 5LGJB 3RWGA 1H3UA 4R2GD 4PRHA 1N64L 3QJHA 1CYGA 1T1XB 2ESVE 1WV7T 3VI4E 1R3LB 4ZUVA 2OP4L 4F2MB 2J6EA 4LU5L 3SDCA 4I48A 3TVMD 1U8MA 4HJGB 1MAML 5I1GH 3FTGA 3I9GL 5HJ3A 3W9DB 3MRIA 2ZSVB 2FJHA 1BFVH 2XFXB 5EZLA 3X17A 3MBXH 3G9AB 4P59L 1GGIH 3IJHB 1MRFL 5FV1L 5J9PB 5LKNA 2EDOA 1I1RA 3VA6A 1U8OB 1JGUL 2JCCE 3QZWG 4JFOB 1Q9OA 2FIKA 2O5YL 4PJHF 1AXSB 1ZHLB 4JG1L 4FQ2H 4MXQD 3TCLA 2AK4B 4MSWB 1DVFA 2VKWA 1F3DH 3C9NA 4HWBH 4G8EB 2VDLL 1AQDA 1KGCE 2IALB 4KMTH 2DLFL 2EO9A 3QUZD 4XAKD 1UCTA 3LEXA 3UTPD 5IG7A 4MJIA 1KF9B 3LZFH 3D39A 1L0YA 3GFUA 1MCWW 2ZCHH 1G9ML 2CUHA 4OFVA 2ZUUA 4NN7B 4F7MA 3CX5K 5J8OA 1GZPA 1JZ2A 3Q6FA