4N8CL

Three-dimensional structure of the extracellular domain of matrix protein 2 of influenza a virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSVGEKVSMSCKSSQSLFYSSYQKDLLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYFCQQYYTYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of monoclonal antibody
publication title Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody
pubmed doi rcsb
total genus 50
structure length 219
sequence length 219
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8cL01
1QLFA 3LKRB 4RGNB 3VXRA 5EU6A 5C09B 2HG5A 3NABL 3NGBC 4G8FA 1EO8L 1VESA 4O2FB 4V1DE 4NKDA 1DE4A 4ODUA 3JUZA 5I18L 1MJ8L 5L8JB 5CBEB 4KKNA 4NO5A 3ARBC 4UTAH 5I1GL 2FL5B 2GT9B 1DL7L 4WWKB 3UTSA 1UJ3B 1VFBB 2H6PA 1WTLA 2FEDC 2XY2A 3T0BA 4L3EE 3TO2A 2X5PA 4QOKB 3V5KA 2M8XA 4FZ8H 5IQ7H 3V0AC 4HIHA 2CLZA 1WCBB 4XNQB 2H8PA 2YN5A 1J86A 3ES6B 3MRPB 4DK3A 3BQUB 3QPXL 2FZ3A 1FN4B 3BXNB 1IGCH 1KCLA 2VLME 1HCFX 2PCPA 1AI1H 2V5YA 3LB6C 5IK3B 5EZJA 1DUZA 4ZNEE 3DV6A 3ORJA 4GMSH 5IB4A 1JMXA 1CFVL 5TDNB 1J8KA 5TE7H 2FO1A 3P4NA 2K9UA 1AD9A 3G5VB 4ODWB 3BZ4A 2DQJH 4NKOA 1NCWH 1KIQB 5ISZA 3W2DH 4OUUB 1J1PH 2WLYA 4LHUB 5CHNB 4OD1L 4KTYA 2EZ0D 5DHXB 3G6JE 5DD3L 2CLVA 4NN6C 4HKBB 2R29L 2IPKB 4I4WB 4M4RA 3T1FA 2HKHH 4LASL 3VXOA 3X13B 4OZIA 1KYOK 3LEXA 2CKBB 3NGBB 4D8PB 1S7TB 4KMTH 5E99L 3C2AL 1YY8B 5J13C 3BEWB 5F96H 5D1ZD 1ZA6B 3MRNB 2F8OA 1ODAA 1I8MB 1RFDH 3DX7A 3LH2L 4Y5YB 3ARBB 3BDYH 5IJKC 3DVNA 3G5ZA 5EFIA 2X7LB 1MVFA 3O9WD 2G5RA 3FT3B 4L29A 5CP3H 2ENSA 1TJHL 2OL3L 4WI9A 2XZZA 3G04B 3T77A 4X5LA 3EJYD 1P7QA 3VGFA 1DCLA 5ID1A 1YDPA 5CLWA 2ZCKL 3JTTA 3KXFD 3KYOA 1EFXD 2OP4L 3IAPA 4JRYD 1BECA 4MAUL 5EC2A 4AG4L 2VLJB 4UV7L 4POYA 1QOKA 1XR8B 5ITFB 5IEKB 4AH2B 1MAML 4ZO7A 2VDQL 4ZUWA 4U6VH 4Z95L 1UCBL 1ZT7A 2AGJL 4U49A 5D72L 3MRCA 3LMJH 4NWTH 4XCYA 2NW3B 4GLRH 2IQAA 3CD4A 4WI2A 5GISH 2XZAH 4GOSA 4CNIA 1AGFB 1VFAA 2YUVA 4KVCH 3WHE0 3T09A 3TC9A 3HZKB 3KNBB 2F5AH 5HYJA 4OCRH 5J13B 1FAIL 3HMWL 3EYQC 1FDLH 1T1XB 4O00A 1I7UA 1XGTB 1S5HA 1MFBH 4PJHE 5JPMB 4MA3B 2FECI 2AJUL 5J11B 5CJXC 5DC4B 5ILTH 1DBBH 3NPSC 3O6FD 5EBLA 1BVKA 3IJHA 4PJFE 3ROOB 4Z77A 2ZP0T 4GRWH 4KI5D 4M6OH 1IRAY 2CRMA 3FQTB 4G3YL 1RIVL 3TA3B 4EEEA 4KKLD 2OR7A 3B9AA 3PL6D 3UTPD 4LKCB 2VJXA 3FO2B 5ID0A 3WXWH 3A67L 5DFVD 2V5TA 4PJDF 1HXMA 5IV2A 4LK4A 4PR5A 1U95B 2V17L 3QDGE 5HGHB 4HT1L 5HGBA 1IJ9A 4B50A 3QCUL 3GSNA 3MLVH 4WI5A 2DI8A 4NQCD 5E9DD 3WXVL 1U8HA 3IU4L 2EDBA 5E1AB 4LVNB 1XGQA 1WBXA 1MHHA 4L8DA 2XG5A 5CMAB 3L6FB 1RZ7H 3MLYH 3VWJC 3DIFA 4R2GB 4JRXA 1YUHA 1A4JB 3SDDA 2IPUG 3EFDH 5IVZB 2EDKA 2RIKA 3ECBB 1IL1A 4ZTOH 2EXWD 3PWLB 3GMOA 3G6DL 5K9KA 4FXKB 3M07A 3ZT7A 1A1MB 4EI6B 1ZXQA 1CGUA 3F12A 4APQB 4NQEE 4IRJD 4X6CF 2A0LD 5L9DH 1G0XA 1HZHL 3KXFE 1H3PH 1MCNA 4HQQL 3RGVD 4HJ0C 1AXSB 4H0IA 3NPSB 4K2UH 4OZGF 3DARA 1NFDB 4K9EH 1JGUH 4M5ZH 4O58L 1KJMA 5IHZA 3AY4C 4PRAA 4C56D 5F9JA 1V3LA 2R2HB 1AR1D 2KKQA 4KKCD 4BH8A 1JPSH 4M02A 4ONGH 2MHAA 4MQ7B 4XMLH 4QRPD 3VFPB 5H2BB 2R0KH 1J9CT 4GW4B 3BW9A 5JPNB 5I1KH 1JZ6A 2P5EA 3P4MA 1UB6B 3EOAA 1UWXH 2J88H 4JM4L 2VDRL 4PJEE 2A74A 2I5YL 3QXDB 2NTFA 3AFLA 1WGOA 1MRCH 2J12B 3MREB 5EG6C 5SX4I 3SJVE 2VLLA 5CBAB 3OX8B 1FL3B 1EO5A 1U8LB 3HE6A 4X8XA 5IB5A 1S9VA 3VWJB 4G42A 4WUUA 5FGCB 2MWCA 1RHHA 25C8L 3MO1B 2HMID 3STLA 3ULUH 1WZMA 3BESR 2EH7L 4MCYB 5I19H 4Z7NE 4YDJA 5GIRB 3C5SA 1O7SA 1S7SB 4JPVL 5TDOB 4ZUSA 1I8IB 1UB5B 5HYEA 2FATL 4P9HC 5DD6A 1GVIA 2KH2B 1S7XA 3TNMB 4OUOA 1FSKB 3WKNA 4QRUA 2R1YA 3EYFB 3ARPA 3ULSB 2H41A 2ADIB 3Q6GL 1KFAL 4MZ2A 3VFNB 3CFEB 3LKNA 4Y4HD 4WJ5A 5DR5L 3WHXA 3LD8C 4FXGB 5CD5C 3GDBA 3IB4A 4BK5A 3RJDA 3FKUS 1S7WA 3WCYA 2UWEB 3GHEH 3B6SA 4LHUG 4DKFL 1K5NB 1U8PA 4HIEA 1INEH 3I6LD 4PLKC 4ELKA 4ZOAA 2GJ6B 1MPAH 2X44D 4JM2A 1BMGA 3EJZC 4NO0B 1UADC 4C56E 1IC4H 4UI2A 5DJCA 2ADGB 3OSKA 5ANMA 3NTCL 4TRPL 5FCSH 1TZGH 3RY6C 5DMKA 2DIBA 3RZCB 5D93C 3W0WD 3GSUB 1EV2E 1KG0A 4UQ2B 1LO3L 1A6WL 1CVRA 3PP4H 2ZSWB 5JXEC 1IMHC 3K3QA 4NN7C 2L4OA 2MOVA 3SQOL 5FECA 4GRWF 3ZE2E 5GGRB 5IFAL 5IR1B 3L7FB 1JI1A 1K4CB 4G9FD 5ICXB 2DOCA 4DAGL 4K8RD 4RQQA 3W11D 3MV8D 3QQ4B 2Y4SA 1UT9A 4ALAH 2AJXH 3QFJE 1NC4B 3OXSA 3I50L 4XHJC 4BZYA 1MCHA 1T21A 4AMKH 1OGAE 4L4TD 3AXLB 3CMOH 2Q76A 3IDIA 1AFVL 3MYJA 2E9JA 3UZEA 1WAAA 4XCCH 3GO1H 1DBMH 5IMLB 1QQDA 1BLNB 3LD8B 3TT1L 1A6TA 1VGKB 1MRFL 3F7VA 3GSOB 2JCCE 5IT2L 1DR9A 4S1DD 1OF2B 2NX5D 2A9ML 4NDMB 5IESH 5EUOA 3BKJH 5IUSA 4YHLH 1CT8B 5GS2H 4RFEA 2Y7QB 43C9A 2VKXA 5DJZA 1DZBA 3OMZA 2DLIA 5DQ9B 2DQHH 2GITB 3U6RB 5GHWL 3VGAC 1N64H 4D2NA 5ALCL 3RWIB 2FX8H 2JK5B 4NN5C 2YK1L 5CEZD 1MAKA 3GMMA 3IDYB 4X4XA 3WFZA 1UWEL 2AJVL 5D93B 4R26L 5CJQH 3VWKA 4YHYC 4KRPD 1N6QH 4MZ3A 4KGJA 3LHPL 3AREC 3C8HA 1OGTB 3BT2H 4KXZH 1N5YH 3EOTH 4M7LH 3UDWA 1JGDB 4GKSA 3B8SA 5DK2B 1Q9OB 1XCQA 4D9QD 4OBSA 1H3XA 3QH3A 3CPLB 5SWSE 2JJVA 3AS2A 1UM4H 2NXZC 4RMTA 3I75B 1F4YL 5DJAB 3IT8D 4LLYB 4IDLA 5E8NB 1KB9J 3VMOA 4AYFA 4WI4A 1ORQB 1NGPH 4MXVF 4NJAH 4FRWA 4XGZA 3CCHA 3G5XB 1RZJL 5F7EH 3JV6B 3X12A 1D5ZB 1FNSH 5CUSH 5FYKE 3VXRD 5DQDL 4LL9A 5EU6D 3RX7A 4RWYH 3QJFA 3REVB 4HFWB 1YQ2A 3MUZ1 2VXSH 4PJ5D 1NMAH 3THML 3RI5K 3UTSD 5CWSB 1G9EA 3RWJB 4KHXH 5EOCL 2FBJL 4MS8C 2Z4QB 1NANH 3FCTB 1DUYA 1MJ7H 2QADD 2R23B 3BZDA 4G9FE 4NN5B 4OLZH 4PREA 1IC7L 3TBWB 4A6YL 1YQVL 5DDHA 2Y07L 5EORL 3BHBA 5E5MA 4G8IA 1SY6A 3VDBA 4P2OB 2Z92A 4KVNH 2OI9B 2C3VB 2AVGA 1ACYL 1MHPH 1QG3A 4PS4H 5I8KH 1G7PA 2FH8A 2I26N 3AREB 3QXVA 3QIWA 3L3OB 3H0TA 1G9NC 4KQ3H 5JXEA 3CZFA 4B5EA 5KS9E 3LOWA 1J0ZA 4O02L 2NW2A 4ZSOA 3I2CH 4YDVA 4RFOL 4KDWA 1YN7A 5DRZA 2EDEA 1OM3H 5JOFB 1K3IA 2EC9U 3VDAA 1C8PA 4XVSH 3UJJH 1S9XB 1OY3B 1WLHA 5ISZD 4HUWA 4XWGH 2NXZB 2XY1A 4UMGA 3RVVD 43CAA 4YPJA 1UZ6E 1R0AL 1T83C 1ZLSL 3QUZC 4HPYL 4RGMC 1XT5A 3TYGH 2IMNA 5CCKH 5E8OA 2BOBA 4XMPL 5ERWB 3PV6B 3FOMA 4FFYL 3P9LB 3OKNB 1HHJB 4JHBA 4K55A 5E2TH 2A9NH 3ET9F 1HDMB 2FDBP 3MRRB 3IFPB 1QR1B 1CD0A 1MCWW 2ZUUA 3BISA 4LBEA 5E8EB 2VDPL 5AYUL 3VRJA 4OZFA 5IBUB 3VXTB 3MRIA 1OHQA 5KSAA 1NDGB 2WP3O 4GAGH 3HUJF 3TH3T 5I1AA 3BE1H 1V7NH 2ORBH 3V52L 4FTVE 1TTGA 3QULA 1P7QD 1R3LA 3HNVL 1WEJL 4AIOA 4CW1A 1JNLH 4KK6D 4JANB 3KYMB 4XNYH 5D7JC 2YD4A 4LQFL 4NQTA 2Z8WC 4R96A 1JV5B 4A2LA 2ZJSH 2IPTL 5ABDE 3VXRE 3CK0H 3VGEA 3ESVF 2B7DT 2QBWA 5HSFA 3VXUB 5KBNC 5JNYB 1X5IA 3K80A 2Q1EA 3DVGB 3MV7B 2BMKA 1F6FB 4NP4H 4XNMB 3UTSE 3LSOB 4RGMB 2DAVA 1WZLA 5JHDB 4EBQL 1IE5A 3KPRA 3MCKB 4OBRA 3M17B 5HPMA 4Z9KB 4PGEA 4HLZG 4RDQG 5HYJD 5IB1A 3SY0B 4JFDA 2CUMA 4JFZH 2BY1A 2P24B 1CDGA 3MUJA 1MUJB 3BN3B 4QTHB 1XIWA 1KIRA 3SDXA 4H8WL 4PUBH 1GAFH 1UJTA 4UTAL 1FPTH 2A6IA 3H6JA 1BVLB 2FR4A 4K7FA 4WTWA 4OLYH 4IOIB 4ETQA 4PJGE 2OJZL 3U0PA 5IQ7L 5ISZE 2R56L 3QUYA 1D5XA 5EUKB 1JNNH 2XTLA 5KSBB 5D7JB 4OZHB 5C3LD 1IGCL 2VDKH 3DTXB 5TQ2L 1ZLVK 2GW5A 2V2TB 1AI1L 1BEYL 4MDJB 5I16A 3RA7H 1VGEH 3IFLH 2VH5H 3P11H 4Z6AT 2WANA 5B8CB 4AIZB 4RGNE 5CEXA 4UNTA 5C09E 3O6MH 3RL1A 4YDIH 3GKWH 4PJBE 5TE7L 3JWDC 5DGQA 1W0WA 2PO6C 1FGVH 2DQJL 4ZD3L 1IAKB 3WNPA 1NCWL 3W2DL 5BRZA 1J1PL 5C0FB 1HI6A 1SM3H 3WS3B 2IALA 2YHGA 4JRXD 3TJHD 4N1EA 3SDDD 4LHQB 4KI5F 5I1LB 5KAQG 3MBXH 4X6BB 2HH0L 4JJ5B 1FLTX 4I8DA 1I3GH 4Z7NF 1JI2A 3BH8A 1FNAA 3UROR 1MIEH 1PLGH 3RWFA 3HMXH 5IMMA 3QHFH 3BDYL 4ONFH 3AS0A 2EEBA 4LARH 2H9GA 1V7MH 4XP5H 4CJ0A 4U1KB 4HULB 3OJDA 4NZJA 1T1YA 5BV7C 1RUPH 2J4WH 5DJYB 4WHCA 3S8WA 2P5ED 3N06B 1MIMH 4LMQI 3S4SB 2PKDA 3MNWB 3RPIA 1A6VH 2CRIA 4PIRF 2AV7A 2XTJB 5HYJE 3CDGA 3FOLB 3RVWC 3WLWD 2BSRA 3JWNC 3NZ8B 2PO6B 4KY1H 3DHJA 1ADQH 4LLMB 4LRIC 4LSPH 4FA8A 1FHGA 3GHBH 4HLJA 4U6VL 1IAOB 3FFDA 3GMPB 4KDTA 3HE6D 3D18B 2DN7A 3LMJL 4NWTL 4TUKL 1KJVA 5HHQB 3RPKA 4N8PA 3QPQD 5GISL 2XZAL 1KNOA 4WUUD 1KSRA 2BJMH 5EO0B 1DLFL 3LPFA 5F7KC 3W39A 2BVEA 4UBDC 5H35B 1X5KA 2F5AL 4P2RB 2Z0BA 4K3HA 1XAUA 4OCRL 3T3ME 1R5VA 5AAWA 5INDB 2NY1C 4X5XB 1YEIH 4ZQKA 4PG9A 1JHTA 1FDLL 4U1SA 2R0ZH 2NY5H 4LLUA 3T0EB 1MFBL 3QI9A 4M93C 5F21B 5JORA 3GM8A 4PY8J 4PJXA 3DSNA 1DBBL 4QCIA 5DJDB 4ZPTA 3K46A 3PHOA 4M6OL 4NNXA 3FTGB 3NIFE 2BFVH 3E3QE 4Q6IA 4E41A 1U8JA 1G9MC 1NUGA 4LCUA 5F6HI 1MWAB 1RU9H 1DQTA 4U1LB 3WXWL 1ZHBB 3MRMB 4JRXE 5J12C 2PXYA 3UXFA 1R24A 4K7PY 5B38A 4N9GA 1U8QB 3L5HA 4O4YH 1H15B 4YH6A 2JJTA 1XF5A 3H9SA 1LEIB 3MLVL 1BF2A 1JGEB 1AC0A 3QIUD 4QTIL 3ILQC 4G80A 2PTUA 1U93A 4JO2H 4RMQA 4JM2D 1JE6A 2HTLD 2I24N 1NUDA 1M7DA 1MCFA 1RZ7L 3MLYL 5T3XD 3QISA 2K3TA 1TLKA 4RNRB 3ZDXE 3EFDL 3UBXB 4ZTOL 3L3GB 5E0QA 3VI4F 3GGWB 3DBXB 2IAMC 3SCMB 5IFHH 4LPVA 4UB0H 3QXWA 4WV1A 2CH8A 4PBXA 1I7RA 5L9DL 1H3PL 1FZOB 4YFDB 2IANA 3QUMB 1IQDB 2R9HC 5IBUG 5C0IA 2A6DB 4PRDB 2VSCA 1QR4A 4K2UL 4YC2C 3T2PA 1TVHB 1XCTB 3OKEA 4U6YA 4K9EL 2R1WA 4H88H 1JGUL 1NBYA 1P2CA 1GIGH 4M5ZL 5GRYA 3I6GB 4Z7VA 2WZPD 1WIPA 2VLRA 2YPLB 1JPSL 4JKPH 4ONGL 4N8VA 5TH2B 4XMLL 4BZ2L 5EC1A 2E7LC 1LDSA 5GZOD 3PABA 2NNAA 5I1KL 1TFHA 5KVFH 3FHAA 3L3HB 5D7IA 1CGTA 2F74A 4QRSB 4YXLL 1FZJB 3MMEB 2J88L 5E00B 5J3HD 3TIDA 4XI5D 3NIDE 5D2NB 1MRCL 4CU7A 1F02I 4YEFA 3NPZB 3RP1A 1XFPA 3IKCB 3TIEA 4P2CG 4KJPD 3Q5TA 3L95B 5D70H 4DGVH 1NFDE 1IM3B 4J4PA 4WHTA 5T1KA 4AM0B 1DANT 4GAJH 3MV9A 4YDKH 3RNKA 2MQCA 4O2EB 2AK4D 4PJCE 3B5GA 2J8UB 3ULUL 2VAAB 5GSRA 3VWKD 4MXWH 5I19L 2XN9A 3FQRB 5D7KD 4TOYH 1Z9MA 4D0CB 3GI8H 1CXEA 3PDOA 1ZWIB 1HHIB 1J1XH 2ICWB 4KC3B 4DEPC 2LFGA 5CGTA 3OB0K 2DYPD 2EIZA 1UFUA 1OWRM 4Z78B 5ACZB 3SN6N 5J7CC 1OTUC 1CFSB 4U1NA 2CDGA 3ZKMD 1CVSC 3GUTA 2X4UA 4JO3H 4YHOH 3SEPA 2B0SH 4JDVB 4BSVA 2ARJB 4X4YB 4I18C 2AS5M 5D6CB 4ACPA 2ICES 3DX6B 1AO7B 3P4OA 4MAYA 5ANME 2J7LA 4XCEA 4M61A 5J56B 1PX3A 2VZUA 1B90A 4S0TD 2Z35B 5F7HA 1TQCB 4MDIB 3GHEL 2WWKO 3TH4T 1WZKA 1INEL 4KK5C 1HIMH 4HF5H 1UH4A 4OFYA 2A6KB 3MCLH 4MD5A 1MPAL 4FFVD 1C5BH 1K4DB 5C0AA 2EE2A 1IC4L 3O2VH 4UILH 5A2FA 5L8KB 1KTDB 2GIYA 2F54A 1H3TA 2WQ8A 1J0KA 4L8SC 4PJAB 3S88L 2BNRE 3QIWD 5I1DA 2OX5A 4BFBD 3RVXD 3FT4A 1SJVA 1MJJB 1JN6A 4WW2F 3PP4L 2LAGB 4GKZB 5FYLD 4FQHB 3D69A 4ZFFB 3SKUD 4F33B 1GGBH 3FMGH 3GRWA 1J0IA 4EXKA 1VA9A 1GGIH 2OTUA 1T7YA 5HYQA 4ALAL 3I9GH 2AJXL 3ZL4H 1GOGA 1X5GA 4LLQA 4Y2DA 4GXVL 3KLHC 4AMKL 3KYNA 3S4SG 4E42A 2NR6C 3CMOL 3SDAC 2HWZL 4OGYH 4RZCA 4Q9CA 4C4KT 3D0VA 4XCCL 2HFFB 1FNEA 5DRNB 3GO1L 2MKLC 3DUSB 4RWHA 4L8CA 3F7YB 4GAYB 3WUWB 4G9DA 1IZKA 2DMCA 1FO0A 5IESL 3BKJL 4L4VB 4YHLL 5DYOB 4HG4J 5EOTA 2N4IA 4RGOH 2WBKA 5C1MB 4WO4A 2XKSA 3MRGA 3CH1B 4D0DB 5KSAD 3IVKA 1T22A 4MNGB 5C0DA 1QRKA 3HR5B 4GG8A 4W70A 4YBLC 3WIIH 4HKXA 1N64L 3GBLA 3VFMA 2FX8L 5IF0B 2HVKA 1Z2KA 1S9WA 1YY9C 4PGDA 1B2WH 1C7SA 5ALBL 5FOJA 5CJQL 3U82B 1N6QL 1A9BA 3K2UH 3PWPB 1S7VB 1N5YL 3BT2L 3EOTL 3RTQB 4OZIF 3HA0A 2YEZA 4M7LL 4H1LB 5I1JH 2ENYA 5JW5B 1LP9A 3QXUA 3FO0L 4ZDHB 1T04B 2AW2A 1JTTA 2NQCA 2GJZB 5IGXH 1HQRB 1WK0A 3ARFA 4NUJB 1DN0A 1QLRB 4LPWA 1UM4L 1N59A 4R4NC 3Q6FA 1GZQB 3C6LC 5B3JE 4JFFE 1IGYA 3KPRD 1WQVT 1CWVA 1NGPL 2OQJB 3LRSA 4NJAL 3CVIL 2Y36H 2YPKB 1T66C 5F7EL 1I85C 1FNSL 4PRHB 2GSIB 1RZIA 5CUSL 3QSKB 3U36B 5MENA 2V2XA 3VFRA 1XIWD 2VXSL 4Y5XA 2D31A 1NMAL 3QFDB 2X9WA 5HDOA 5SWZB 2HVJB 4ZSOE 5BMFH 3MGOA 3MYZA 5FYLE 2H32A 3F8UB 4MCZA 4YBLB 3VXNB 3MRDB 4HKJB 2VN4A 2ED9A 2GY5A 4OLZL 1BX2A 5CSZB 3UBXG 1OLZA 4KKBD 2VC2H 4XCNB 3L5IA 4NM4H 1BFOB 1FVEB 3QUYD 3RQ3A 2Z8SA 3O3DB 4Z7QE 2DS4A 3MV01 4M3JA 1WF5A 2WQRA 1XH3B 1MHPL 4HK3N 4PS4L 5I8KL 3BDXA 2JKXA 3GBNH 3D25B 5C0GA 2VERN 2W0FB 3UJIH 3EYOA 4KQ3L 5HHNB 4P4KC 3RNQB 4WFFD 2OJEB 3DXAE 4OD3L 4AJ0A 2A83B 2I07B 3I2CL 3WFHB 3LKRA 5GS0C 1OM3L 4YPGB 3R8QA 3P2TA 2VZVA 2Z93A 2X1PA 3BP4B 1TZIB 4XVSL 4A2MA 4O2FA 5D71L 4CJ1A 5BRZD 3MRJB 4ZXBC 4XWGL 4J3SA 5CBEA 2X4RA 5BS0A 3C6LB 3E8UH 1ZHNB 3DURA 3RRQA 1L6XA 1A0QL 3T0WA 1INQB 3TYGL 5CCKL 4Z8FH 4QNPE 3MRPA 4ZO6A 2RQ8A 2HJKA 2AERT 1FN4A 1AGBB 2A9NL 5IKCA 2XXMB 4NC2B 4AT6B 1VSCA 5D1XB 3RUGB 3A0OA 1IGFH 1TENA 5IOPB 4OB5H 4YGVB 5HBBA 1FNLA 4XPGH 2I9LA 4XPAH 2XZCH 3W9EA 5T1DH 4BKLA 1GGYA 3UBXI 4NNPL 1I1YB 3DGGB 4YXHH 2V7HA 3BE1L 1V7NL 2ORBL 4M7KH 1KIQA 5JIIA 3ALWA 4LHUA 4JVPA 4F7CB 5DF0A 1N8ZA 1JNLL 3GK8H 1PKQA 3KPRE 4XNYL 2HTKD 4I4WA 4P4KB 5DHVH 3X14B 1A5FH 2EC9T 4U31A 4LPUA 4JFDE 1OPGH 2VXVL 4Y4KD 4D8PA 4QLRA 3CFJA 2NZIA 3BEWA 3BO8A 1ZA6A 4CGTA 1TJIH 4N8CH 4Y5YA 3BDBA 4XB7A 2EDDA 5BW7C 3FT3A 3O4LB 1RZKC 1ZTXL 1CD1A 5HHMD 2BY3A 3G04A 1UGNA 2NY2D 3UMTA 3LS4H 3VI3F 4Y5VA 3D9AH 1UM5H 5C0EB 1KPVB 1EHXA 4JFZL 3V0WH 3C5ZB 3EYVA 5BVJA 3SGDH 1A7RL 4WFFE 1ND0B 4PUBL 4B7LA 4LAQH 1GAFL 4HK3J 5F6IC 1FPTL 1NCBH 5GGTA 5C0BB 1P9MA 4OLYL 3VXUE 1HQ4A 3OR7B 1IEHA 2RBLA 4ELMB 2P45B 1T0NB 1WSST 4K3EH 4BQ9A 1A6PA 4E41D 1JNNL 4NPYB 2NW3A 4GLRI 1WCQA 4ISVA 4X5WB 2PXYD 2VDKL 4PD4K 2JJSC 2ICWI 4HV8B 1J8HB 4NQXA 4XVUD 3EDKA 1R5WA 4EDXA 3RA7L 1VGEL 3TT3H 3IFLL 2VH5L 5DD5H 3HZKA 3KNBA 4PY7A 3H9SD 2GKIA 3KS0J 4YDIL 1YMMB 3ZHLA 4KK9C 4HWNA 4MJIE 4ZXBA 1XGTA 3LKQB 1J05B 5I1CH 4PBVC 3JWOH 3Q2CA 4IMKC 4LOUC 4MA3A 4XC1H 3MRBA 3L1OH 3OL2A 4YIQA 4XPFH 5JW4N 1SM3L 4ZFOB 2B1AH 5E8PB 3ROOA 4M9OA 3A6CH 1T1ZA 3WS6A 3MBXL 3TA3A 4JFOB 1OW0A 4NC1C 1I3GL 4N5EC 1WBYB 2J3SA 3TZVC 1PZUB 2UZIH 3KR3H 1T03L 2IAND 1OAZH 3WFDH 1SJEA 1PLGL 3HMXL 4PGZA 4ONFL 5F6IB 4G6KH 4L9DA 5D2LA 2OL3B 3X3FH 4M6NL 4L1HA 1V7ML 1G6RH 2KUTA 4U3XA 4TVSa 3QRFM 3R1GH 2VLRD 4PJ9C 1DDHA 5ESQB 5E1AA 1RUPL 1MH5B 3CNKA 4JM2F 4ZYKB 1EK3A 1MIML 2XICA 5IVXB 5CMAA 1FYHB 2NY4D 3LRGA 5DD0L 1A6VL 5HPOA 4HK0B 1HKFA 4H1LG 1CGYA 5IVZA 4Y16D 4QHMA 5ICZA 5DRWB 3G6AB 1FG9C 3NMEA 1MCRA 5HGAA 4F7PB 4DUWA 4WIQA 2V7NB 4APQA 5CIPB 5CEZL 4KY1L 4F7TA 1U91A 1ADQL 1JPTL 2VUYA 5J1AB 1E28B 2UY7A 3MA7B 3GHBL 5C9JB 5JA8B 2P8PB 4PP1C 1AXSA 2CIKB 5T1KD 1JMZA 3MV9D 4QYOB 4C55A 2BJML 5FDYA 2AJYH 2W07A 1PZ5B 3O2DL 4MQ7A 5H2BA 1BD2B 4E41E 1MREH 1SYSA 3TZVB 1WAAF 3R0NA 5EN2B 2XN9D 3SGKC 5JPNA 1IM9A 3O81A 5HGDB 5F93C 4N0RA 5I75B 2R0ZL 5DJXB 2NY5L 5BJTB 3VRIA 4MNQB 2DB8A 5I17B 3RL2A 5EUOF 2HLAA 1YEJH 2DTMH 2W0LA 3BKCH 3H9SE 3VD7A 1LO2L 3AB0B 5C0CA 4KDVA 4OI8A 1FNGB 4PJ9B 5HYIA 3QR2A 4TVPD 4FN0A 4LSVH 4Z7WB 3DUHA 2BFVL 1UACL 2P7TA 1S8DB 1WFUA 5ESAB 5F9OL 5SX5H 4HIJB 2ZUWA 3N50A 2B2XH 4N1CA 2NY3B 3WYRA 1RU9L 1MHEB 2LQRA 5AD0A 1FE8H 5EU4B 2C1OA 2XWBB 2V2WB 2ARWA 4MAYD 3U4AA 3N1GC 3BJ91 3VG9C 5GJSH 3NIGE 3PF2A 3EDEA 4JY6B 3CVHB 1U3HA 3MA9H 3ZDYF 4LIQE 4YHMH 3UP1A 2PYFA 1U8NB 2UUDH 4KJQC 4ZPVB 4L9LB 3WUZA 4G8GA 2ZOLB 4PRPA 5TDOA 4CN4A 4OFYD 1HK6A 4JO2L 2HT4C 4Z7VE 3PP3H 1P1ZB 5C0AD 2NY0B 4UZGA 4HFUH 4TUOA 2ATPB 4HZLA 4U1HB 2ZNWA 2F54D 1YN6B 1FYTE 5IFHL 4GAFB 4UB0L 1H8NA 5D7IE 2DIAA 3DJ9A 3VFNA 3BSZH 3VXSA 4P23C 2E6QA 4I2XA 4HS8H 5EO1A 4OFIA 3NCJH 2DD8H 4X99A 4H88L 1GIGL 1VFOA 3W5NA 4X6DB 2UWEA 1FH5H 4X98B 4Y2DD 4JKPL 2GY7B 2ZSVB 4JZNB 1TVBB 2H1PH 5CGYC 1OD9A 4HDIA 4NT6A 1BZ9B 2XI9A 1IGMH 1N7MH 5KVFL 2AV1A 3IAGC 2DLFH 1CGVA 4XT1C 2ADGA 4IOFD 3L5JA 4NRXA 5D5MA 3HZYB 4ODHL 2MFNA 2C1PB 3RZCA 1LE9A 2FJFB 3TP4A 3VMPA 4WO4D 4UQ2A 4M48H 3QEHB 4LLAA 4PV8A 4NM8H 4FABL 3P3YA 1ZEAH 5ACMA 5GGRA 4DGVL 5D70L 2FLBT 2ED8A 3L7FA 5EOQL 4U0RC 5DZNA 5ICXA 2VN7A 1ERNA 2DBLH 2NZ9C 5EZIL 1ZGLB 1U6AH 4QRQA 4YDKL 3EO0B 4R3SB 4OIBA 1RAMA 3AXLA 1JZ8A 4MXWL 4PG2C 4HGKC 5JW3H 1NCUA 3BPOC 3VXMA 5ESVB 5C86A 4BFIB 4P23B 3GI8L 3EO1B 4LCWE 2IH3A 2UYLB 3GSOA 1DVFC 2VQUA 4JFEA 1J1XL 4FOMA 3DUUA 4NDMA 2V9TA 3MZTA 3IGAB 3S5LB 3ARFD 2R4RH 2Y7QA 1I3VA 4JLRB 1GOHA 1L7TH 4PJIB 4W4NA 4WY7H 5C8JB 3U6RA 1IC5H 5TF1H 1Q1JH 3P73B 4JO3L 4KJYB 4YHOL 5FK9A 5HYFA 1O5DT 2B0SL 3IS1X 1KCUH 3RWIA 5EBGA 2JK5A 1CIDA 1H3VA 5IW6A 4P5TC 2O5ZH 1MCPL 5C08B 1LE5B 4L1DA 5FO8B 3GEWB 4U1JB 3V2AR 1A6ZA 1OGTA 3D2UB 4KXZI 4ZUTA 4EVNB 5MP6H 1F2QA 1JGDA 3KPQA 1JZ4A 3VFGH 4AZ8A 3V79C 2HFTA 3C87A 4F15C 4GH7B 1Q9OA 1HIML 4U0RB 1JPFA 3ZSSA 3MCLL 3MLWH 4X9FA 5I8EB 3BP7B 2RB8A 1RJLA 2VDMH 5CD3B 3UTTB 1Q0YL 1K8IA 2HYMA 1JHKL 4ZOBA 4UILL 3EDJA 2XQYK 3SHSA 1PYWB 3I75A 3GSNL 1XF3B 5DJAA 1B0GA 2Q6WB 1T0MB 3GJFK 3LN4B 4LLYA 5E8NA 4HEME 3KPTA 1HHHB 3BPOB 3FAXA 4NCC2 2OM5A 5KG9B 3G5XA 4LQ1A 3JV6A 2XXCB 4MX7B 3K2MC 2ESVA 1GGBL 2YD7A 1EEZA 4HFWA 1GGIL 2A6JA 4EDWH 1A4KA 5CILH 5J8OA 3SDXF 1NLBH 3I9GL 3DETC 3ZL4L 1JWSA 1OB1B 4UNVA 5BS0D 1XZ0A 2GFBA 3MGTB 1F4WH 3M1BB 3RWJA 5AZ2H 3R0MA 4ZMAT 1S9YA 1NPUA 4QOKD 1C08B 1NANI 2R23A 5CEYB 2AXGA 5FKAB 3PWVA 2GSGA 4DZBA 3BQUD 5FUCC 3BPLC 1EEUA 4PJAE 4E9LA 4P2OA 3HR6A 3EYUH 4TSAH 4S1RH 5HVGB 1OAXL 4D9RD 3LKOB 2BHYA 4HUUB 4GUPA 5ADOH 1OTTC 1QKZH 4F15B 1KB5H 1I1AA 2C7UA 1NAMB 3TPUB 4XXDA 1KUMA 3QDMA 1QBBA 4ZS7H 1K6QH 3TBVB 5AWNL 3D0LB 4JQVA 1AQKH 1EIBA 3RGHA 1IZJA 1BFTA 3DMMA 2DTSA 5GRUH 5DUBA 4LHUD 2FIKB 3WFCH 1QSEB 3TBTB 4PG2A 1B2WL 1D5BB 4K94H 3K2UL 2YUXA 2DJSA 4F7MB 1IKNA 4M7ZC 4FP8H 3AGVA 3SDCC 4I3GA 3P9LA 2MPAH 4PRIB 1HHJA 1F00I 2APWA 2EE6A 1B6UA 5I1JL 3S35X 1QO3B 4OF7A 3H3PH 3GNMH 5MENE 3AS1A 1HDMA 3KDMB 4I0PC 5IGXL 2XACC 5HI5D 5D7LE 3V7MA 4U4BA 4Z0XB 1NKOA 4XH2B 4EUPH 1A21A 3VXTA 5CS7A 5GQBA 5GRZA 2BNUA 2PTTA 2G2RB 5DLMH 2IFFH 4Z76B 3F6IA 5L88H 4M1DH 2Y36L 1ZT1B 1BPVA 1CK0H 5GRJH 1CL7L 1TNNA 2JELH 4JANA 3KYMA 5TDPB 1TJGH 1INDH 2NY6C 3RIFF 1KC5H 1WIOA 5F8QC 1RJCA 2B4CH 3QAZC 4OF6A 3ZLQC 4FQ2H 4DKAA 4MJ6B 1K2DA 3QYCA 4J3XA 3KYAA 4PP2B 2VC2L 3H7BA 3MV7A 4NM4L 1RJYB 4KZDH 4NQVB 3L5WA 3DROB 2P5WB 3D39B 5E4IA 2PR4H 5EA0H 4OF8A 4XNMA 5MERB 3VXQB 3B2UD 3FQXB 1H3UA 5F9WB 3GBNL 2H26B 4M7ZB 3IRZA 3SDCB 2F19L 3M17A 5J1TC 3UJIL 3LDBC 5H37H 3NCYS 5HI3C 1D9KA 3DPBA 3LQZA 3Q5OA 2Q8BH 2D9CA 4I9WD 3SY0A 4GG6B 2R0LH 1ZANH 5T3XL 2OTWB 5TE4H 4I0PB 2Q86A 1CDHA 3MNVB 2OR8A 1DSFL 1F3JB 4TULL 3PIQB 4KMQA 5GGSB 1FZMA 4PJXF 3BP6A 3GJFB 3E8UL 1FFQA 2EDXA 5I76A 3UYRL 3HI6H 5HI4C 3MBEB 3OBAA 4NQDB 4CL7A 4CRPA 4RAVB 2XFXB 3GRWH 3TA3D 4Z8FL 5J6HB 3CXDH 1RUAH 1PY9A 3HB3C 1JF5A 4FQXA 5FGBC 5KSBA 1PKQE 1MI5A 5D6DA 3QIBB 3P9MB 4H8WC 2NY6B 4MJ4A 3FN0H 3GMQA 2V2TA 2IMMA 3UO1H 4HJGB 4MDJA 4OB5L 2Y5TA 1YNTB 4XPGL 3MR9A 1YEEH 4A6YA 4XPAL 5B8CA 4JQXA 1EAJA 3O3EB 3MTRA 5T1DL 3WN5B 5D96C 1HNFA 4OF5A 4D9LH 4YXHL 1IAKA 4YFLI 3BUTA 3QEQE 2BY0A 1FV1B 4KZEH 3RY4A 4OM1H 3FO9A 2BHZA 1G7MB 1FZKA 2HT2D 2R2EA 3GK8L 3ARDB 4R2GD 4Y0GA 4P3WA 3LDBB 1A5FL 3B9KB 4NO3B 2CKNA 1OPGL 1WFOA 4APQD 3QJHB 2O26U 4DVBB 1ZHLA 1LILA 1TJIL 5F7LB 2VOTA 4N8CL 1ZVSB 5BZDA 1J1OH 4XVJL 3WNNA 5FUZH 3MRQB 2FD6H 5ENWA 1F3RB 4HWBH 4OV6F 1BOGA 2A73A 5FO9A 2HFEA 3O45B 3B5TA 1GZPB 3L9RA 1B4JL 3LS4L 1VPOH 1UM5L 1IM9D 1HWGB 5FHAH 3S4SA 3V0WL 1XR9B 4DUXA 1BAFH 5DVKA 1IEAB 5EU5B 3RWHB 1E4JA 4YQXH 5C0JB 2LVCA 4OGXL 3ULVH 5C07B 3PNWB 5FGSA 3FOLA 4XAKD 3TO4C 5C0CD 2BSSB 3CUPB 5KSUB 1T7WA 4IDJH 2Z31C 1NCBL 1I7TB 1AY1H 2J5LC 2YSSA 3GMPA 3F58H 4K3EL 2JIXB 1BQHG 3S36X 2I60H 1DQDH 3V6ZB 4P2YA 2H32H 3UX9B 3NCBB 3PXHA 4XP6L 5TE6H 2BC4A 5F7MC 5I1EH 1SJHB 4U1GC 1NJ9A 3TT3L 5DD5L 5E08L 1KJ2B 4P2RA 3KAAA 2X9XA 1U3HD 1AGDA 3TCLA 2IADB 3CSYA 3GSQB 3IDJB 5E56A 3QG6B 5I1CL 3T0EA 3C60B 4G8GD 2KPNA 3TJEH 4PRPD 3JWOL 1C5DB 4WTZG 4XC1L 4JN2B 3QEGH 1TCMA 4YE4H 1EAPB 2NY7H 5A2IH 3L1OL 4U1MA 5F1KC 3RWEB 4QHUB 4XPFL 1F4XL 3LKSB 3U0WL 2B1AL 5FB8B 1TITA 4OKVB 4RAUA 1RK1A 1LO5B 1Y6MR 4KMLB 2BHUA 3A6CL 4KROC 5CGMA 3QUXC 4OI7A 2H3NA 4EXPX 3HC3H 3MUHL 3O8XB 1NFIB 1MWAA 4G6FB 3QNYB 3VXSD 2UZIL 3KR3L 4U1LA 3SE8L 4P0DA 1ZHBA 1MCLA 1OAZL 2BK8A 5F1NA 3WFDL 3OR6A 4G6KL 1H15A 3TO4B 4UTBL 4WTXA 3X3FL 1BM3H 2Z31B 5HTSA 2EDTA 3OKKB 1LEIA 1UENA 1Z5LA 3V6OC 5T1LB 5E24E 1CE1H 2GJ6D 3L7EB 1FVCA 2UZYB 3ILPB 1OSPH 2SEBB 4C58B 1V3MA 3MJGX 5GXBB 4H5SB 3P4LA 1VEOA 3S96B 4U1GB 4RNRA 3VXPB 1KN2H 3UBXA 2E8YA 1X5FA 3GGWA 3DBXA 3OAZH 3MUGB 1CICC 3RZCD 1RK0A 2XNAA 3GMRA 3I3BA 5EIQA 3PWJA 5C6WH 3VG0H 4P5KA 2GYSA 3OAYK 4X6FA 5KSVA 2A6DA 3X3GH 3SKNA 1AD0B 5C0CE 1TVHA 4F9LC 5F97E 4JPWH 1FFNB 3KJ6H 3I6GA 2CKBH 5I1HH 5I1IL 4KROB 5DTFA 1F58H 2AJYL 4HH9B 3MLSH 3GBMH 5TH2A 3HFMH 3IDGA 1MREL 4UDTB 1HSAA 4WGVB 4OFKA 3L3HA 3OHXA 3QCTH 3BN9D 4QRSA 4LSRH 4MD4B 4JFED 4PJ7B 1QBMH 4ZOEA 1AHWC 3SKMA 4LKXB 5CP3A 2Z8VC 3UPRA 1I9RH 2EE9A 3NH7H 5DMGD 1YEJL 3O6LH 3BKCL 4BQ8A 3MOQA 1S3KH 1CFBA 5D2NA 2H2SD 5DRXA 2MJWA 1A7OH 4JJHA 3HG1E 3VD4A 4PRPE 4LSVL 2X4SA 1JWUB 3EJZD 1IM3A 2G75B 2B2XL 2OSLA 2ERJC 3WD5L 3K81A 2FCBA 3UPAA 1NCCH 2WW8A 3EGSA 4O2EA 4P46C 4N5UA 3RFZC 4NFCA 1FFOB 5E5UB 2J8UA 1CICB 2PW1B 4NC1E 5I74C 2VAAA 5MEOB 3WO4C 1D5MB 3VXSE 1U8IA 1GL4B 2Y72A 1DLHB 3U30C 1AXIB 1LP9F 4WHYH 1WC7B 3CLFH 4WW1B 2ICWA 5F8RC 4UIKH 4NHCH 5JO5A 4L3EB 5JW4R 4HFUL 1U41A 4Z78A 3MRKA 1E6OH 1CFSA 4JZOA 4LCCC 3KPNB 5I6XB 4MJ5B 4YHKH 5E6IC 3QA3B 2CO6B 3SPVA 2B39A 4JDVA 2XPGB 3U2SB 4K7PX 3BSZL 4X4YA 1AHWB 1A3LH 3PG2A 3DX6A 4HS8L 1AO7A 4DTGH 4NGHH 2ESVD 1NBVH 5FCUL 1CYGA 1I8LC 3NCJL 2DLEA 2DD8L 4Z7UF 4YHIA 3M45A 3PWUB 4WNQA 3FRUB 2Z35A 3MV11 3FB5A 3SO3B 1FH5L 5GRVK 4JFXA 3WIHA 3VFOB 2W9LA 5HDBF 3G6JB 3L3KB 4S1QH 3AS3A 1XGPB 1IGML 1N7ML 4LP5A 4WWID 4ZFZA 1K4DA 4OCWH 3QBTB 4X9IA 4MSWB 1G7IB 2DLFL 5I74B 3LZFH 1KTDA 3QO0B 4P2OD 2GJJA 2ICEA 1KTRL 2VR5A 5DWUH 3SO5A 4AENB 5EU3B 3VXME 5F1IB 3QDAA 2BNQA 4M48L 3T04D 1FC1A 1TZHB 4JFEE 3U30B 3BH9A 1I1AD 4NM8L 3QDMD 2CIIA 5HD8D 4ZFFA 1ZEAL 3RDTB 3B3IB 1JK8B 4F33A 1U8OB 3DMMD 2BVYA 2DBLL 5GJTH 1U6AL 1L0QA 1LDPH 3WKMH 4LCCB 3C6SB 3HZMA 4LGRB 3M8OH 5TQ0H 3ZYIA 5IJVB 2KZ1B 5JW3L 2EZ0C 3DRQA 2HFFA 4NRYB 2GQHA 4QXTB 1JPGB 3DUSA 3FHQA 1U3YA 1A2YB 1IFHH 2A77H 2PN5A 1Q72H 1V3JA 4BJLA 2VISA 3MRHB 3KPMB 3ETBF 4L4VA 5DYOA 2R4RL 1GJIA 3D6GA 4RSVA 5D1ZC 1L7TL 4D0DA 1TVDA 2VQ1B 4XNZC 4NRZB 2P8LA 4WY7L 3MLRH 3F5WB 4MNGA 4Q9QL 1IC5L 5TF1L 1Q1JL 3V8OA 3O9WC 4GS7C 5DURB 1KCUL 3V9FA 5IF0A 4ZUVB 2RAMA 4PTUA 3GMNB 4IRZH 4QY8B 2VAJA 5CP7B 4PTTB 3IDUA 4JPIB 4Q0XH 3HPJB 3L3IB 3BWUC 3EJYC 3VFTB 2HLFD 3PWPA 2F15A 2CJUL 3I02B 2DM2A 4PJHB 3RTQA 1R3KB 4H1LA 3RVUD 2AEPL 2NXYB 4KRNA 1UEMA 3BD4A 2ESVE 4UT9H 1HHGB 5F70A 5CAYB 1CFQA 1WTGT 3UJTH 4ZDHA 2O61B 4YGAB 3N9GL 4PJFB 1QPXA 5EZLA 3GSVB 3MV7D 5K93A 3P77B 1NFKA 5KTEH 1GZQA 5TGBB 5JHDD 1JYNA 5J06A 3C5JB 1NSNH 2HKFH 2OQJA 5FYKU 1D9KD 4PLNC 3UTQA 3QDGB 4X0KB 1JF1B 4PRHA 4IS6B 1F42A 2J8OA 1NGXB 4EDWL 5CILL 3CMGA 1NLBL 1QHPA 4XNZB 2HVJA 5C2UB 1Y18B 4AEEA 1F4WL 3HNTH 3QDME 3RU8H 1FFRA 2IGFH 5AZ2L 2HJFB 3LV3B 2BRQA 3O9WB 4JZJA 1HYSC 3IS0X 2YR3A 4DKDC 3O6FC 4QHKI 5CSZA 4B7IA 1TMCB 1FVEA 5DQJB 4WU5A 1KB9K 3O3DA 4KI5C 4FQXD 1CBVL 1Z9LA 3CC5A 4KKLC 3EYUL 4S1RL 3PL6C 3VRLE 4NQEB 2CDEB 5FA4B 2W0FA 3KXFB 3RNQA 5BQ7B 4R7NB 5ADOL 2BRRH 5DFVC 1A7QH 3MFGB 1E4KC 3VGDA 2OJEA 4E0RA 1QKZL 2I07A 1KB5L 4PFEA 1NGWA 1E0OB 3QQ3B 4K07A 4ZS7L 4YPGA 1K6QL 1ZS8A 2D0GA 1AQKL 1TZIA 4QRTB 2DMBA 4UAOB 5GRUL 2BVUA 3WFCL 4JDTH 4E5XB 4YHPB 1EGJA 4ENED 2DQCH 5ICYB 2ZPKH 3CFDB 3V6FA 4CU6A 3K0WA 2MSPA 4P9HH 1QRNA 3GJEA 4FP8L 2VE6B 5AEAA 2VIRA 3V7AG 4KWUA 2EXWC 4PJEB 3VCLB 3ISWA 4JDZB 1AGBA 3H3PL 4AT6A 4DN4H 3FQNA 5D1XA 5EPMB 4J3WA 2FGWH 3S9DB 3STZA 1I9EA 3QNXB 5D1ZA 5IOPA 1C12B 4TQEH 4IRJC 2A0LC 4HUVB 1Q8MA 5JIPA 5D2LF 2AEQH 3SJVB 5HHPB 2BVQB 1N0LA 3BIKB 3GSWB 2IG2H 4Y19A 3RGVC 4UT7H 4HKZA 1A1NB 1SYVB 3MOAH 2GCYA 5DLML 2E27H 3O6FB 4KAQH 2GTWA 5HDQH 4NYLB 4GW1B 4KUZH 1LK2A 4R4FH 1IGJB 5FAAA 1AR1C 4KKCC 4U7KA 4PB9H 1A6UH 4IIQA 4F7CA 3S37H 1CK0L 1W72B 1CIUA 4GRLA 5GRJL 3W9DA 3HE7B 2KZWA 2X89A 1TJGL 1INDL 4TVPL 3OJMB 4X7FC 2W60B 4AEIH 4PRIE 2GI7A 2XTJD 3LS5H 1RZGA 4JKKA 1KC5L 1WUNT 1U36A 1R6VA 2Q87A 5SWQA 4BH7B 4X7TB 3SKOB 5DFTA 4I5BA 1B6DA 2XV6B 3ZDZF 4YJZL 1QYGH 4NZUL 4I13B 4LCYA 4P9MH 1NC2B 3GMLB 4HUXB 4IMLB 4KZDL 1KCKA 1VEMA 1L6ZA 3QWOB 5IEHA 1D6VH 2PR4L 5EA0L 4BQ6A 3O4LA 3BX7C 4PV9A 1ZVHA 5FUCE 4P2RD 2HMIC 1FRGH 1P7KB 2Q8BL 2R0LL 1ZANL 1KPVA 5HHOA 1MI5E 5TE4L 3C5ZA 3MUY1 4IRJB 4MLSA 3T0ED 3WHE1 1FFPB 2CRZA 2PYEE 1ND0A 5DVLA 1E27B 3RGVB 3AVEA 3VGGA 4ZAKB 1HH9A 1LO0H 4F7EA 4Q74A 1A6AA 5HGGS 5C0BA 4K3JH 3HI6L 5F89B 1NAKH 3MLUH 2PF6A 4C56B 3GRWL 1U8MA 3AU1B 3E6FA 4ELMA 4N0UE 1HILB 1T0NA 3D39E 3SE4C 3L5XL 1RUAL 4QRPB 3UTOA 4G7YH 3PL6A 1U92A 1LEGA 3IDMB 1YPZA 2GAZB 5KVGH 3G5YB 1L0XA 4HV8A 1E4KA 1VADB 3S98A 2QQLH 2D03H 2E6PA 5LGHH 4Y4HC 1HINH 1NDMB 1VENA 3DX9B 4KPHH 5FEBA 3J7HA 1FO0L 3BIAX 3QFJB 4KRLB 1M7IB 4NQCA 4D9LL 3CSPA 3MC0A 1CF8H 3HI5H 5T3ZH 2IEPA 4OM1L 1HOCB 2X4PA 1AGEB 5IMKB 1XF2B 4KH2A 1BWWA 1YEKL 2JCCB 2DIJA 3SCMD 2WIMA 1A9EB 4H25B 1TIUA 3MLXH 3MLTB 2UZXB 4MA1C 4FG6D 1MEXH 1T2QH 2YA1A 4CADB 4TNVK 5DUMH 3WJJA 1J1OL 5IB2A 1IEBB 2DQFB 4YK4B 5AUMB 5I66B 5EOCJ 4YBQD 5FUZL 1BOYA 5EU7C 2UWEF 3ESUF 3QXAA 3REWA 2YPLD 1KTLA 4K8RC 3UC0H 3W11C 1NBZA 2HRLA 3MX0A 1MH5A 1JPST 4U6XB 1O7VA 1BAFL 4K3DH 4HWZA 1RI8A 4HK0A 1H5BC 4PJDE 1MLCA 4Y4HB 4YQXL 4EI5A 1HSBA 5D5MF 4URTB 1OLLA 4WFHE 4Q7DA 3ULVL 3RBGA 1BBJB 3ZKND 3UTZB 5L0QB 4S1DC 4IDJL 4IRSA 4LFHG 4WI3A 2QR0B 4OCXH 3DRTA 5CKGA 3HPLA 4LSSH 5SWSB 1UA6H 4P57B 2ILLA 2PW2A 4WVRA 3F58L 4C83A 2P8PA 1AR2A 4CDHA 2CIKA 2FHBA 3T4YB 2CLRA 4OIAA 5LBSH 1RVFL 4LLWA 2I60L 3O3UN 1DQDL 3PWNA 2X4OB 5MHSD 1NEZB 4XPTH 4JPKH 1QSFA 3BP5A 5FM4A 1DEEA 3CDFA 5I1EL 4YBHA 5A2JH 1E4WH 3U9UA 2YZ1A 3V4PL 4XNXH 2YRZA 3W0WB 1PG7X 4FQ1H 4X6CE 2QSQA 4N9OB 5DJXA 2VXUL 3HAEB 5KAQF 5BJTA 2B5IC 4MNQA 5I17A 1VKXB 1TCRB 3QEGL 4YE4L 3K7UA 1IAIH 2NY7L 2OXGA 4OZGE 3WMSA 4D0BB 1FNGA 3BGMB 4G9FB 5BVPH 1UXSB 3MV8B 1ONQB 3MRFB 4Z7WA 2XKNA 3TBSB 4OCNC 4OFVA 5CJOL 3HC3L 1CFNB 1HHKB 2NY5C 1X5XA 1T89C 2A1WH 3PGDB 4XZUA 1H5BB 3IF1B 5C6TH 4UDUA 1AO7D 2V2WA 2APXA 2RR3A 1BHGA 2X42A 1FBIH 4PBWD 4WW2C 5K9OB 1NEUA 2AXFB 1BM3L 4JFYB 3K1DA 4ZS6D 4XWOD 3GIVB 4YXKH 4XBPA 1G7HA 2YOCA 2E9WA 1G1CA 4L9LA 4CKVX 5ETUB 1CE1L 1QA9A 4I1NB 3FRPG 3T2NH 1GGTA 1P1ZA 2GK0A 1OSPL 2N1KA 1OP3K 2QADC 4XB8A 2X05A 5E5RB 4ORGA 1P5VA 3RAJH 1FG2A 3AAZB 4NQSB 2EIBA 4JAMB 3MJ9H 4X7DC 3K8LA 3VG0L 2C3HA 2BNQD 1BZ7A 1AH1A 1N4XL 2B5IB 2W59A 4QWWC 4MHHI 4YHZH 3WL9B 3INUH 1IGIH 1C5CH 2BVTA 3BPNC 2DLTA 4OD2B 4LSUH 4JPWL 3KJ6L 5F3HB 2I9TA 2CKBL 5I1HL 4X6DA 5BOPA 4ONHB 1F58L 4TNWK 3MLSL 1JJUA 4FTVB 3ZKQD 3GBML 5B4MD 3HFML 2ZSVA 4JZNA 4OZ4A 2G60H 3RVVC 2EIDA 4KK8D 4MA8H 2NCMA 5F7DB 4CVZB 1T2JA 2X70A 3HMXA 2ZZUT 3QCTL 2J1KA 5L2KE 3IJYA 4LSRL 2BSTB 2XWTB 5IHBA 1ETZA 1QLFB 1I9RL 3NH7L 3O41B 3HLAB 3QRGH 3VXRB 5EU6B 2NX5A 3HZYA 4L4VD 3O6LL 1OSZA 4OLXH 2HA1A 1S3KL 4G8FB 5M7QA 3VH8B 4YR6B 2VMFA 1W8NA 3T2QA 3P30H 4ODUB 3QEHA 1A7OL 5B21A 1FJ1A 4KK5D 3FFCE 2E9BA 12E8H 3UTSB 3HC4L 3IETA 5IB3A 5DS8B 4XCFL 3FQUA 1NCCL 3V5KB 1BJMA 2CLZB 5GGTL 4N1HB 3RVTD 4BA8A 2DJUA 1ADQA 2FZ3B 3FONA 4OJFH 1MVUA 4G6AD 1G7JA 3PWPD 3ZSTA 1DBAL 1QPPA 5ESVA 4KK6C 4BFIA 4GKNA 3RTQD 2CRYA 1DUZB 1I1RA 2UYLA 4Q97A 4G6JH 3N0PB 1QNZL 3NFPA 2CUHA 3BPNB 5IB4B 3CLFL 4GRWE 4M7LT 3ULUD 4UIKL 3IGAA 1M7XA 4NHCL 3VFWB 4EKXA 3NA4A 3BOVA 4PJGB 1SEBA 4NKOB 5ISZB 2E8ZA 7FABH 5J6GA 1E6OL 1CZ8L 4JG0H 4POUB 5C8JA 1MFAH 4QHLA 2F53E 2CLVB 4YHKL 4KJYA 3P73A 1A3RH 1K8DB 4FQPA 3T1FB 3UPCA 5E94B 4YEEA 3VFVA 1LVEA 4QRRA 3O2WH 4PRHD 3MQIA 4AEHL 2EE3A 4DTGL 4NGHL 3LEXB 5C08A 5BV7H 5LWYH 1NBVL 1R5IA 3PE9A 4PJBB 1FGNL 2W0KA 3DX8A 3D2UA 4N8VG 3DX7B 4PJ5A 1NGQL 1MWAH 4EVNA 4OTXH 4HIIB 3DVNB 1EHLH 4YUEH 4FQQB 4KJWD 1HKLL 1P53A 1EEQA 1NCDH 4S1QL 3TWCH 3BP7A 5E03A 3ARGA 3BD5A 5CD3A 4HMCA 1ZMYA 4OCWL 4XRCB 3T77B 3LZFL 5D1QB 5DWUL 1P7QB 1T0MA 5ID1B 1YDPB 1BQHA 3PHQA 4LSQH 3JTTB 3KYOB 3Q1SH 4JFHE 1IKFL 1WFTA 1ZLVH 5EC2B 4JREC 4XPBL 4HH8A 5FGRA 3NAAH 1EO7A 2OR9H 3PV7A 4X8JA 4OQ1A 4KTDH 5JIHA 2DRUA 1OB1A 4QT5B 1LDPL 3QDHA 4LSTH 4P2QA 3MGTA 3M8OL 4XCYB 4WTZA 2IQAB 3QUMH 4EUPG 1CS6A 2LTQC 3E3QC 4CNIB 5F72S 1VFAB 5JXAH 1QRND 1T5WA 4MVBD 3K4DA 1XEDA 4MXVE 3TJHC 3SDDC 3P0GB 3MODH 4PJ8B 3OQ3B 3QZWB 3OJVC 2A77L 5L7XH 5HYSB 1P6FA 5KSBF 5HYJB 3AUVA 4OZHF 5D1XD 5FFLA 1A1OA 4WEBL 1G9MH 2NTSP 3LKOA 1I7UB 2V5SA 1J88A 2WAHA 3RI5F 4MQSB 1MFEL 4Y19D 5LAXB 1TPXC 1GCFA 3CXHJ 1NAMA 3MLRL 4WDIA 1NEZG 2R2BB 5EBLB 3ULUE 4GXUN 1BVKB 3IJHB 3ZZ1A 2PTVA 4XP1H 2L7JA 5GS2D 1QSEA 1FCGA 2XQBH 4IRZL 4GRLD 4GO6B 5FOBA 3B9EA 4F57H 1IBGH 4Q0XL 4MB4A 2X89D 4K71C 5HJ3A 5ID0B 1D5BA 1OT2A 1HXMB 3PDGA 5AG9A 3BKYH 4JREB 2RCSH 5HGBB 4HG4K 6FABH 1QO3A 5H37G 1XMWA 2LU7A 1YEFH 4AQ1B 4C54A 3UJTL 3WLWC 3KDMA 2ZKHL 3GSNB 1U8HB 2VDNH 1XGQB 3TNNA 4NN6B 1DFBH 4YDLC 5KTEL 1JYWA 3HE6C 3O4LD 2G2RA 1Z0MA 4Z76A 3DIFB 2HN7A 3QPQC 4PGCB 1JFQH 1NSNL 2HKFL 4JRXB 5IG7A 4Q9RH 3SDDB 4POZD 4V2BA 3NN8A 5K9KB 3D1MC 5HHOD 4DGYH 4QF1B 3C5ZD 3ZE0F 4M43L 3F12B 3KYKH 4RFNC 3OKOB 5TDPA 4Q6YA 3EBAA 4FFZH 5KVDL 2YWZA 3LEYH 5ECJE 3JSSA 1RUMH 3HNTL 1F6AA 3RU8L 2IGFL 5CZVH 5C0BD 5FA3A 3IDXL 4LNRA 1KJMB 1F90L 5IHZB 4MJ6A 4PRAB 3HUJE 5F9JB 4BH8B 4JO4L 4G5ZL 3DROA 3RX5A 2UY6A 2OXHA 3BW9B 4K71B 2P5EB 2MMXA 3P4MB 3VXQA 4BFEA 3WIHH 1QRNE 1DQLH 2BRRL 1A7QL 3VE0A 4M6ML 2WP3T 1Z3GH 4GG6A 1YMMD 2A74B 2J2ZA 2NTFB 2DQUH 3JTSA 1REIA 3E1F1 2EKJA 1NBQA 5SV4A 1F3JA 3BZEA 3N1FC 1ZA3A 2KDGA 1EMTH 4JDTL 4L8BA 1I3RB 2DQCL 2ZPKL 2Y6SC 3HE6B 1DJSA 3GB7A 4ERSH 4G42B 3FO1A 3ARXA 2VABB 1ZT4B 2UVFA 4JM2C 5EBWA 1UKTA 2HTLC 4NKQB 1RHHB 4RAVA 4PGBB 1MCEA 1EBAA 2P8MA 1DANU 3VH8G 2JF1A 1Z6JT 3QIBA 4DN4L 3C5SB 3QDJA 2FGWL 1QFWH 4TQEL 4HJGA 4JRYE 4O2CB 1MF2L 3WIFA 2AEQL 2DQIH 2IG2L 4M1GH 4CU8A 2D7TH 3SE9H 1ES0B 1QTYT 4UT7L 4GSDL 5DD6B 4D94A 2ZUVA 3WN5A 3MOAL 1S7XB 2E27L 3QXTA 4KAQL 5HDQL 3BRDA 1JWMA 1PX4A 4KUZL 2R1YB 1Y6NR 4R4FL 1FL6B 4PJCB 4FHBD 3FN9A 4PB9L 4J6RL 2X4NB 3HRZB 5GZOC 4XVTH 3ARDA 4NKMB 4M8VA 3PUCA 5EZOL 4PRBA 4WJ5B 4EI5D 3EHBD 4AEIL 1UQSA 1EZVY 3LS5L 4LF3A 4IRSD 5HHOE 3CFKB 3QJHA 1F11A 1UVQB 4X83A 5J3HC 1QYGL 2WUCL 4XI5C 5FYJD 3B6SB 5I71C 4P9ML 4MYWB 3WDJA 2AEIT 1U8PB 3GSRA 5K9QI 4L3AA 4ELKB 1D6VL 1LO4H 4P3DB 4KJPC 3CFBB 4H1LH 1AIFA 4JM2B 1QSFD 1UYWH 2N7BA 4KI5E 5LVEA 3LIZH 4G6MH 1JYXA 5DJCB 1GZPA 3O6KH 3T0VA 5ANMB 2QQNH 1FRGL 4DVRH 3TESA 5DMKB 2MTPA 3UTPE 1YPZE 3VWKC 1RUQL 2FJGA 3D85A 3Q3GB 4NFDA 4KKAD 4MNQD 2OZ4A 1P84J 2YRPA 4HIXL 5C0JA 3UDWC 4J1UB 4N0YH 1NQBA 1LO0L 5KSUA 4I48A 4TUJA 4RQQB 5GGVH 1HXYA 2XIDA 2R15A 3BVNA 3D5OF 3MLUL 4NQCE 5E9DE 2GHWB 3OB0H 1OL0A 4M00A 1VERA 1T21B 1MQ8A 4MD0B 3GIZH 4NUGH 3IDIB 4JR9H 2DM7A 4F37F 2NY3D 4Z0BL 3MYJB 2BNRB 3ZKMC 1VB9A 5KVGL 1QQDB 1A6TB 3F7VB 2J8UF 2K1MA 2QQLL 2D03L 3BUYB 2QQKH 5LGHL 5FDWB 5LCVL 1HINL 1KJ2A 5EUOB 3B9VA 3QUKB 3KPLA 5GGQH 4C59B 4KPHL 2IADA 4RFEB 2W65A 43C9B 4YZFF 3IDJA 1CQKA 2VR4A 5I71B 3SBWA 3C60A 3QIUA 1CF8L 3PJSB 5KW9L 3HI5L 1R3IH 1HH6A 1U8KB 5T3ZL 2EKSA 4B0MM 2XRAL 4IEFB 5DK0A 2FSEB 4QHUA 2NY0D 3V4VH 1AXTL 1HEZA 2YC1A 3O3BA 3UCRA 3QZWG 4FFVC 3A6BH 3GMMB 1IVLA 5HYSG 4X4XB 4XP9H 4XTRD 2WBJA 5DEGA 4TTDD 4QRPE 2BCKA 3LQMA 3SGJA 3ARTA 3MLXL 3TEUA 4M62H 1MEXL 1EGJH 3JWOC 1T2QL 1PDKA 3QIWC 5KN5B 4B41A 1ZHKB 3RVXC 2W1NA 4GKSB 3OJ2C 1XCQB 2EDRA 1RIUL 3OKKA 1IQWH 3QH3B 5CZXD 4JCMA 4OLVH 2ZWLT 2X1OA 3UC0L 3VFSB 2EXYD 4X4ME 1OTSD 5K9JL 4PY8I 4TN9A 2RFXB 1ITBB 3IXTB 1AKJB 4L5FH 4HWEH 4YAQA 1QSFE 3E6HA 4K3DL 1NGZA 4HGWB 4KHTH 4H5SA 4XGZB 3CCHB 3IXAA 4XXCA 2Z8RA 3VXPA 3X12B 4R7DA 4WEUD 3ZYJA 5L6YL 4WHDA 1FCCA 1WT5A 1YNKH 4OCXL 4LSSL 4C57C 4DN3H 1UA6L 4JHAH 2K7QA 3ME0A 2EYSA 2XYCA 5DHVA 1AD0A 4WHYG 1DUYB 1MCCA 4JFFB 5KSAC 5I8CB 4PREB 5GS0H 4XPTL 1CLCA 4EN3A 3LQAH 4JPKL 4X4ZA 4JGUA 4MA7L 5HVWA 2AK4A 1CLYH 5DJ2A 4G8IB 3NZHH 2V9RA 3VI4E 4KRMB 5JMOC 2Z92B 4HCRH 1G7PB 4UDTA 3QIWB 4XNXL 3H0TB 4FQ1L 1S7QB 2W9DH 4MD4A 4NN7B 5IFJA 2ZUQC 4XC3H 2NW2B 3D3VA 4ZSOB 2BXZA 4YDVB 1YN7B 3EJJX 1M6OA 2KL6A 2DQTH 1I7ZB 4MQXD 1AQDA 2DYPA 4HUWB 4QGYA 4R0LA 1MFDH 1PAMA 4D3CH 1MJ8H 4LDOB 43CAB 4HEPG 1XGYH 1JWUA 2DM3A 1PBYA 3I6LE 3HCVB 1JTPA 1R3HB 4JKMA 1JZ7A 3TYFA 2BOBB 3U7WL 3TF7C 4QRRD 2VSDA 5C6TL 2AABH 2EDHA 3UYOD 3DXAB 5C08D 1FFOA 3HTLX 3RKPA 2PW1A 1FBIL 2WLZA 2NYYD 5MEOA 1XGRA 1CDYA 1CDIA 4X6EB 5JIKA 3W0WE 1D5MA 4YXKL 1B0RA 2VL4A 3D2UD 4S2SA 4LBEB 1UZ8B 1XIWC 2G5BA 4V1DA 3VRJB 2WUBL 2YD5A 4OZFB 3VGAB 1WC7A 3RIFK 4QXWA 4WW1A 1Q9WA 4QHNA 5EU7E 3ULUF 3C8KA 3ARGD 3T2NL 1C16A 2FX9H 4F3FB 3MV8E 2OYPA 1HCVA 1U3ZA 8FABA 4KKBC 3RAJL 3QUYC 4L4TE 1PQZA 5T1MA 4YHYB 2Q7NA 3MJ9L 3U2SA 4YNYB 2ZG1A 4GQ9H 4TSCL 2VLKA 1RZKH 3INUL 1IGIL 2NX5E 1WVZA 4FQCH 2VTFA 3C2AH 3PWUA 4LSUL 3IYLW 2YD6A 4JY4A 5A16A 4P2QD 1BWMA 3WLBB 1CE6B 1JGLH 2BMKB 1LD9A 2G60L 4R4BA 4MA8L 3G6JA 3N85H 3KPRB 3H9HB 2OL3H 2QJDA 1QVOB 5HPMB 4MXQD 4PGEB 2BDNL 4F2MA 1CI5A 1G6RA 1RD6A 5CEZE 3RHWK 3K74B 3PGFH 3QO0A 4JFDB 3PGCA 4JFPA 2DM4A 3QRGL 2VITA 3I6KA 1PGRB 2GEEA 3SE3A 4OLXL 1XIWB 3P30L 1G7LB 2IFGA 2A6IB 3RDTA 4AG4H 1JK8A 4K7FB 4D9QE 1U9KA 3WDIA 1U8OA 1MCDA 4ETQB 1UM6L 3U0PB 1QSED 5CIPH 1EUUA 1GHFH 4LP4A 4RMSA 4OJFL 3KPPB 4ODTH 3WBDA 2W38A 5FYJH 4X80H 2WWKT 2YBRB 4JFQA 4QRRE 5I16B 2HTKC 5IVNA 1A2YA 2VXTH 4G6JL 2QV2A 1KIPA 5CEXB 1NCNA 5EU6E 4HS6A 1RJZA 3RUGF 2YPVH 2AP2A 1W0WB 3QHTC 4Y4KC 1IILE 4PJ5E 4W4OA 2VQ1A 7FABL 3R4DA 5IMOA 3QUZB 4NRZA 5F7FA 3RIAK 4KDTC 1HI6B 3V5DB 1MFAL 3B83A 5FF6A 3H7LA 2DKMA 1A3RL 2IALB 2WWMD 1CFTB 5HVHC 4DFIA 5E2WH 4HJJH 3O2WL 4Q2ZA 3GMNA 2ITCB 1YJDL 4PTTA 5LWYL 2NY2C 3B5HA 3HPJA 4K23H 2BVOA 3BH8B 5IIEA 4G7VH 1IT9H 5I9QC 4MJIB 1X5LA 5IMMB 1MWAL 4OTXL 3QI9C 1T80A 1HHGA 4F9PA 2H9GB 4YUEL 1FIEA 1JBJA 1D5IH 1NCDL 3TWCL 4ZFGH 1N5AA 3OJDB 1T1YB 4FZ8L 3IU4H 2OCFD 4NOBA 4P2QE 3CVHH 1KGCD 5DI8B 4RMVA 4LSQL 4Q6IC 2AKRB 5C0NC 2JJUA 1FVDA 3RPIB 3Q1SL 1F5WA 3C5JA 3KHQA 2PXYC 1W0YT 1ITCA 1Q9KA 2AV7B 2HP4A 4OZIE 3G6DH 1JF1A 3CDGB 4GMSL 4XVUC 3V6BR 4IS6A 2X10A 1KIUA 5IHLB 2JJTC 2P46B 1HZHH 1SMAA 3K4ZA 3HS0A 4KTDL 3FFDB 3VFUB 4KFZC 2OS7A 3QO1A 3X11A 3QUML 2N7AA 2GUOB 1KNOB 3LKPA 2HJFA 2X4TA 4O58H 3MBED 5JXAL 3TH2T 1K9TA 1X3DA 4ELMF 2HKHL 3QWQB 2Y06H 3W39B 1JYVA 3MODL 4O5LH 1DQJB 1F4AA 2QKIB 1YPZF 3OXRA 2X6MA 1CXKA 4KQ4H 3QIBD 1R5VB 4KMTL 3IRPX 3QDJD 5D9SB 4ZQKB 4NQEA 2CDEA 1JHTB 4WV1C 5F96L 5I9QB 3VD5A 1G9ML 5LGJA 1MFNA 4LLUB 1RFDL 4X7CC 3QI9B 4R7NA 5JORB 5F88B 2LAAA 5TFSH 3HKFA 5BZWA 1T6WA 1VACA 4ZUUA 1Q9LB 5GSVB 1S7UB 1QACA 2L7UA 4NNXB 2YKLH 5DJ0A 2XQBL 4MB3A 4Q6IB 5ICYA 4E41B 1D3CA 3CFDA 2I27N 4LCUB 4F57L 2CK2A 5DJ8B 3ARDD 2YD3A 3FRPA 3NOIA 2NY4C 3B9KD 25C8H 5B38B 4N9GB 3BKYL 4LNVA 1MCIA 4Y16C 6FABL 4PJEA 1XF5B 3H9SB 5INCB 4Y4KA 5EPMA 4UU9A 4OAWA 3DGCR 3QNXA 3MLZH 1C12A 3SJVA 2VDNL 3IKKA 3GSWA 4FMFA 3I84A 1U93B 5F1OB 1DFBL 5HI4D 3JV0A 1SYVA 1M7DB 4UQ3A 4J4PC 3B4NA 5CJBA 1JFQL 1F2XK 4G8EB 4Q9RL 4KVCL 4LVOC 1CXHA 5SV3A 1Y0LA 2B20A 1F97A 5IVXF 5BXFB 4DGYL 3D85D 3TVMA 5IHUH 3HE7A 3Q6GH 4WV1B 1CDUA 4FFZL 2IANB 1PEWA 1PEZA 5DMYA 5C0IB 5C07D 1RUML 2C5DC 4RMUA 4S10A 5ILTL 4BH7A 3ARUA 1E4XI 2R1WB 4Z7VB 1P2CB 5KVMC 3TLRA 1U3JA 5BV7B 1JRHH 4XNUH 1PG7W 1NC2A 2VZTA 4DKFH 5E2JA 3GMLA 4IMLA 5EC1B 3QWOA 1FYTB 3PABB 2NNAB 3O3AA 1CLOH 4GRMB 4N90D 5D7IB 2NY4B 3WIHL 1SHMA 4Y89A 2YD8A 1DQLL 2JTDA 1TTUA 3F65A 3LPWA 4MAYC 1Z3GL 3RWCA 5DSCA 1JTOA 3FB6B 3NFSH 5ADPH 3QDJE 2DQUL 5EDXA 2ZNXA 3C60D 3KGRA 1FFPA 3HC0B 3TN0A 3TIEB 1EMTL 1YZZA 2R1XA 1BZQK 4WHTB 3WSQH 2FGZA 5T1KB 4ERSL 2EEAA 5JUEH 3MV9B 1JF6A 1EBPA 4Z7WF 2WBJD 2JB6A 3CLEH 5J57B 5C6PB 3O8XD 3VI3E 2P5EE 4G6FD 1RULH 2NY1B 3KPSA 1OP5K 2XN9B 3IDMA 3MROB 2AJ3B 2D7OA 3G5YA 4M93B 1XF4A 3PDOB 1VADA 4DOHE 1ZKAA 3UAJD 1VEPA 1I9JH 4LAJH 1EXUA 2A9MH 3FN3A 4M1GL 1YMHB 3MCG1 5IM7A 2FB4H 3AC0A 1FLRH 2EIZB 4N0CD 3WJLA 5TF0A 3BYYA 1M7IA 3CIQA 1BREA 3N1MC 1J87A 4U1NB 2CDGB 3MFFB 4Y2DC 1OGAA 2R0KL 2QSCH 3GUTB 5E8DH 1UXWB 5J12B 4LEOA 4XVTL 4WUUE 1KB5A 1NAMH 1AGEA 2RHEA 5IMKA 1BQUA 4LCWB 3LEVH 3QQ9D 3SOBH 3P4OB 4MAYB 4Y16A 5DVOA 4YFLF 4M61B 2V5MA 5GS1A 1A9EA 4H25A 1F4HA 4IOFC 4DQOH 1DN2A 1N6VA 3IU3A 4GXUM 1BJ1J 4HX1A 3D48R 2IBGA 1LHZA 4WO4C 3ZTNH 3OKDB 4GBXA 1IEBA 5I66A 2WINA 5IW1A 1LO4L 4M7JH 4MD5B 4EN3D 4X6DF 4U2ZA 3U46A 1UYWL 1SBSH 1E6JH 5E7BA 4Y4FA 3LIZL 4G6ML 2IAMB 3O6KL 4CMHC 2F54B 2QQNL 4JCLA 4DVRL 2R8SH 3RWDB 5I2IA 5IP4A 5I1DB 4EUPA 3EDDA 4J8RA 1V5JA 3FT4B 3RWGB 1JN6B 5HY9A 4BK4A 3NFNB 1KXVC 5DHYB 3D3VD 2EDYA 4YC2B 4N0YL 1BBJA 1GC1C 1PW3A 4XP4H 3MJ8A 4WRLA 3JZ7A 1TETH 2OTUB 5HYQB 5GGVL 2E5EA 5F3BB 5SWSA 3ARFC 3NCMA 3THMH 4RX4A 4LLQB 4Y2DB 1T7ZA 3QG7H 3KYNB 4E42B 4NUGL 4ZO9A 4JR9L 2X4OA 3WV0A 3ROLA 2VZ1A 1NEZA 1IC7H 5E7FA 5T3XE 1YQVH 5L2JA 5EORH 5IROA 2QQKL 5KANG 1ACYH 1PFCA 5CJ5A 1ZSDB 4V1DD 2NLJA 4Y5XC 3MRGB 4EQ3A 3TV3H 3BWAA 1TCRA 3IVKB 1T22B 1R3IL 5LG1A 5C0DB 1IAII 3VJ6A 4HKXB 2CK0H 4GW5A 4L3ED 3V4VL 1KT2A 2WK2A 3BGMA 1DQQA 3VFMB 4PJIF 1MNUH 1NUFA 2HVKB 1URLA 1ONQA 1WWCA 3A6BL 3MRFA 1S9WB 3U0TB 2H2PD 4PGDB 1TZGL 1WAAE 2VLMD 1CFNA 5T5NG 4TYUA 1A9BB 1EGJL 3PGDA 2DBJA 3GJFH 2VLKD 5KS9A 4DEPB 3IFNH 5EUOE 1LP9B 1M71B 2Y5EA 3NCFB 1IQWL 3ARFB 2FHCA 3MSPA 1JUFB 2VDPH 2QSTA 3EOYG 3Q6FB 4GMTH 4L3CA 4IBLT 4BZ1H 4L5FL 4HWEL 1HE7A 2EDLA 1DBML 1X5JA 4I18B 5JLZB 4KHTL 4NO2B 5KANI 5DEFB 2AK4E 1X4XA 1RZIB 3WDHA 3AAZA 3ZT6A 5MENB 5GRWA 2V2XB 4LQFH 5D7KE 4Y5XB 2OMNA 5EO9A 3ZDYE 5D7LB 4RBPH 4DN3L 1BGXH 3D3VE 3KHOA 4Y1AA 1XGUA 4NHUB 2IPTH 3MGOB 4OQTH 2DQHL 3RDTD 4MCZB 1X9QA 3V7AE 3BEVA 1TDQA 4N68A 1MCJA 5GS0L 1BX2B 3LQAL 5F3HA 3S6CA 1KPUA 4CVXB 4U6HA 4FTVA 2DWEB 4G43A 4L8SB 1CLYL 4HCRL 3ZE1F 5DUPH 3EYOB 4YO0A 2W9DL 2XWTA 4XC3L 1PY4A 5LXGH 4HWBA 3O41A 3HLAA 2ADJA 4Z5RB 2Z93B 3VH8A 2DQTL 4YR6A 4YHNA 4H8WH 1G7QB 1MFDL 4D3CL 3Q0HA 4Y5YC 5HI5C 2X4RB 5KOMC 5BS0B 3SDAB 1XGYL 3IDNA 3DURB 2OZ4H 2VDLH 3T4AB 5DURD 3PQYA 1RZFH 1ULVA 1MCSA 1V05A 4R97C 5DS8A 2OJZH 2R56H 2AABL 1MLBB 3GI9H 2HJKB 4RMRA 4Y5VC 4RWYL 5IKCB 4KGLA 3LN5A 5TQ2H 4Z7UA 1BEYH 1MHCB 3T65A 2VLKE 2NXYD 2I9LB 1RMFH 2DWDA 1LEKA 4PRNB 3W9EB 2ATKB 4KHXL 2DLGA 3ARVA 3FL7A 5FM5O 4BKLB 1DBJH 5GZND 1MJ7L 4LFHD 2D7NA 3VFWA 4O51B 3MOBH 1KJ2H 2FX9L 3U48A 4ZD3H 1P9MC 2V7HB 1IGTB 4PJGA 1F45A 3DI3B 3FAWA 5EIVA 1N8ZB 4KVNL 3V95A 5DK3A 1PKQB 3T8XA 3U4EA 3G08A 4HHAB 4UNUA 4JN1H 4ZTPH 1K8DA 2LU4A 3B2UC 5E94A 1X7QB 4HXAH 1N26A 4GQ9L 3QDGD 2R4SH 2HH0H 1RZKL 4ZFOL 4MQTB 3QB7C 4Y88A 4WCYH 5C09A 4FQCL 1YA5A 1FIGH 3CFJB 4PJBA 3BO8B 1N2RB 3HNSH 3UJJL 4OLEA 4JY5H 3QEQB 4HIIA 1KLGB 3PXJA 1I9IH 1JGLL 5IWLA 2FL5A 4U7SA 5J11C 2GT9A 2J6EA 4WWKA 3D87B 4FQQA 1UJ3A 1VFBA 3BJLA 3N85L 4R97B 4QOKA 4W6WB 1CD1B 1T2XA 4XRCA 3NCYP 1TTFA 1WCBA 4XNQA 5JZ7D 3WS6C 3PGFL 4FMKA 3ES6A 4MMXC 4FXLA 3BQUA 4Y5VB 5D1QA 3TA3C 5E2TL 1OW0C 4PLJD 3ZHDA 3BXNA 4NQED 3EYVB 5BVJB 4WEMB 5IK3A 5KJRH 1OAYH 4GG6F 1QZ1A 1LNUB 3HRPA 2W0PA 5TDNA 2X2YA 1PD6A 5EBMB 4GAGL 4XBEH 2QLVB 2OTPA 3G5VA 4ODWA 3EO9H 1HQ4B 1OQOA 3AM8A 4OUUA 4QT5A 1GHFL 2DKUA 1A64A 4LVNC 5CHNA 3K8MA 4TUKH 2FNBA 1CGSH 2IH1B 3L3JB 4ODTL 4ISVB 4HKBA 5FYJL 3ZTJH 4X80L 1IAMA 2IPKA 2RJMA 2WV3A 2FJHB 2HT2C 4NQXB 1DLFH 4R2GC 1RZ8B 1R5WB 4EDXB 1WWBX 4PJ8A 3QZWA 2ZJSL 2VXTL 4PY7B 3X13A 5HYSA 2ICCA 4I3SH 5DMJB 1W0VB 3CK0L 2CKBA 2YA2A 4R9HA 1S7TA 2Q3ZA 5FO7B 5E2UH 1YY8A 2YPVL 2EIEA 3MRNA 5E6YA 4APQC 4ZXBB 3SDXE 3C2SA 3SJVD 1I8MA 2VL5B 3ARBA 5LAXA 2E9IA 3MRBB 1NKRA 3FZUD 2X7LA 4NP4L 1HYSD 4NFBA 4YIQB 2R2BA 1WWAX 1T1ZB 4RCAA 5E2WL 4HJJL 3TVMD 3KWWB 3HE7D 4K23L 4LRNH 1S9KC 4G7VL 3RKDD 1IT9L 1SJEB 5D2LB 4MLIA 4F58H 2VLJA 4Z7OF 4JGJA 4JHZA 1D5IL 1QFUH 5ITFA 1XR8A 2UVEA 4ZFGL 5IEKA 4AH2A 1NC2D 5ELIA 1DDHB 3KPOB 5BRZE 4QTIH 3CVHL 3H8NA 3OKLB 1WFNA 1AGFA 1OP9A 1WZ1H 4PGCA 3EW3B 2FIRT 4QHMB 5ICZB 4GT7A 3P11L 1ZE3C 3ZO0A 5HGAB 1KLFA 3O6ML 4LLDB 4QF1A 3GKWL 1P6AB 2IBZY 4BUGA 4W81A 4F7TB 3OKOA 1U91B 1FP5A 1T1XA 1U3HC 3FQWB 3VA2C 1AE6H 1FGVL 3HN3A 3WFBH 4JE4B 5CSGA 3TN0D 5IJKA 5JPMA 3K1KC 4ZAKD 2XT1B 3R06B 3BPCB 5HVFB 4OT1H 3KLSA 2DLHA 3EYSH 1KXQE 5MEQB 1FSKC 3WUWG 5K59F 2Y06L 3FQTA 4BZ2H 2FYYB 4O5LL 1SYSB 3KPSD 1KCRH 4LKCA 2Q20A 4KQ4L 3FO2A 1IM9B 2XWJB 1T3FB 4YXLH 3VRIB 1MIEL 1U95A 8CGTA 4M1CD 3RL2B 3QHFL 2HLAB 5HGHA 5DFWH 3WNMA 4LARL 5TFSL 4XP5L 5C3TA 5C0CB 4PLOB 1BFVH 3QFJD 3T3PF 4ODBD 2YKLL 2J4WL 2P7TB 1OGAD 2CPCA 1Z9OA 1I3RA 5C71A 2VKWA 3L6FA 5AD0B 5FM8A 2VABA 1ZT4A 2C1OB 2F5BH 1A4JA 4HAGA 4I77H 5HHME 3TFKD 3ECBA 3HHRB 4PGBA 3PWLA 4FXKA 5FIEA 3UZVB 4DCQB 2DJ4A 1A1MA 3OGCB 4EI6A 1AP2B 1U3HB 3RZCC 2WNGA 3DYPA 1L7IH 4LSPL 1QFWI 3MLZL 2PYFB 4YWGH 4O2CA 4GBXD 3HG1B 4G8GB 5CJXA 1T1WB 3OAYH 4PRPB 4N0FB 3CGTA 4PJXE 1ES0A 3EZ8A 1NFDA 1I4FB 2R2HA 4OLWH 4Y4FD 4TUOB 4HZLB 3DV4B 5F9AC 1FL6A 4PJCA 3RJQB 3VFPA 1SVZA 4GW4A 2V9QA 3EUUA 2X4NA 5IHUL 5CJ8A 2EYTB 3HRZA 3T0DA 2L0DA 1YEIL 4NKMA 3VXSB 4NZDA 4OGAD 1UB6A 4JHWH 4I2XB 4HMEA 1EVTC 3CAFA 3BN9C 5EO1B 1H8SA 1I3UA 2GK2A 4KUCD 4P59H 1GGUA 3QXDA 4X99B 2EDQA 4AEFA 5DMGC 3CFKA 5SWSD 1RUKH 1UVQA 2NPLX 3MREA 1JRHL 4RX4D 2H2SC 4XNUL 1YYMH 1ZLWK 3EFFB 5CBAA 3OX8A 1FL3A 6CGTA 4HDIB 4NT6B 1U8LA 4P3DA 3ELAT 3VWJA 3CFBA 1CLOL 2AV1B 2BX5A 4JB9H 3MO1A 4LGSB 5FYKD 4O4YL 3IDYC 4NRXB 5D5MB 1ZV5A 4MCYA 3S88H 3KPSE 1LE9B 1EX0A 3OKMB 3NFSL 5GIRA 5ADPL 4PJ7F 3Q3GA 2IANE 4PV8B 1PKOA 1A3QA 5D4QA 1S7SA 1OD7A 4J1UA 1I8IA 1X6LA 1UB5A 1J5OH 1MQKH 1KEGH 4U3CA 3AY4A 2JE8A 3TNMA 3WSQL 3WFEH 1L9MA 2VLRE 3LAFA 5JUEL 4QRQB 2O93L 4BSWB 4GXVH 2DQDH 3EYFA 5C70A 4MD0A 3ULSA 3CLEL 1C1EH 2HWZH 2ADIA 1RULL 4UIMB 1QSVA 2BNRA 3VXMB 3CFEA 2EH8H 2IH3B 3W82A 1DP0A 4JFEB 3BUYA 3ARWA 4FXGA 1FAKT 1I9JL 3DUUB 5FDWA 3ALXA 4OCLC 4TSBH 3QUKA 1KBGH 2FB4L 1FLRL 4J12A 3LPGA 2CUIA 5A3IC 1BVZA 3PJSA 1K5NA 1U8KA 2QSCL 5FK9B 2FSEA 2GJ6A 2VZ3A 5E8DL 1ZLUK 4WENB 1NAML 2QHRH 3MV9E 3B9DA 1FNFA 3IFOB 4NO0A 4OKDA 3LEVL 3JXAA 1ORSB 3SOBL 3VG9B 5IW6B 5ALBH 2XN9E 4P2OC 4DQOL 2OI9C 3GSUA 1OAUH 1A6ZB 4ZUTB 5KN5A 3P9WB