5FYJE

Crystal structure at 3.4 a resolution of fully glycosylated hiv-1 clade g x1193.c1 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
213
structure length
213
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjE02
2ZOLA 4PJ9B 4G5ZL 4PTTA 4YAQB 3BDXA 3O2VL 3BWAA 1BJ8A 5T3ZE 12E8H 4CU8A 1I7TB 1MPAL 1CLOH 5JHDD 3VE0A 3MRRA 2E9JA 2G75B 3GMOB 3MUZ1 5B39G 4HCRH 5E9DD 1QRKA 1EUTA 3P4OB 2G2RA 1BD2D 3OWEA 3QEHB 3WNPA 1I8KA 4LGPB 5J06A 5GRUL 4LQ1A 3TVMA 1CL7L 2ILLA 3MRMB 5FAAA 4HDIA 1IM9B 1T7YA 2XQBL 5JO5B 4E42A 1NEZA 3MV8D 3QEQB 4LNVA 2BNRD 1JTPA 1YNTB 4F57H 3T4YB 4FTVD 4OF5A 5D70H 2PXYC 4JG0L 4NNXA 1V7NH 2VITB 4YR6B 3SDYH 1YNLH 3OHXB 4MXVE 4PP2A 2FYYA 3K4AA 3RWFB 5JHDA 2AP2A 2YWZA 3QULA 2J2ZA 5E9DA 4YHIB 3SGDH 4FFYH 4IOFC 2OCFD 1BD2A 1RK0B 3K80A 4M5ZL 43CAB 5F9JA 3FO1B 4NFCA 4QXGL 1JJUA 2D0HA 1ZTXL 1HZHL 5ANMB 3F5WA 5HGHB 2H32H 1QR1A 3NFPA 4ELMF 4KWUA 3LKQB 4PUBH 3BZEB 3MV8A 5MP6L 2BNRA 3FZUD 5BO1L 1D5BA 2NY1D 1J1PL 4FTVA 3VFTA 2GUOB 3BSZH 3FRPA 4EVNA 2WQ8A 2R0WL 1HNFA 1MNUH 3B2VL 1ONQB 4ZPTA 3RZCC 3VRJB 4F33B 4XVSL 5JW4R 5DJZB 2QQNH 5B4MD 2XN9E 1AGCA 2AQ3A 1OWRM 4U0QB 3MZTA 4UIMB 3SDAD 4BUHA 2X41A 3QG6A 4YUEH 2XKNA 1H8SA 1XF2A 3QDGE 3SKMB 3LKSB 5CKAA 1MAMH 4WTXA 1R3KB 5DEFB 2ENYA 1JGEB 2PO6C 3EJYD 4PD4K 1VGEL 2VXTL 2F74A 2GI7A 3P11L 4HIHB 1KV3A 3KYOB 4RBPH 1QSFE 3BGFB 3SO3C 2E6PA 3CFEA 1KXTB 2IBGA 4U6HA 3SQOL 4XAKD 4K8RH 4NNPH 1H3WM 4JFZL 4Y19B 3WHE1 2RR3A 1KSRA 4PRIB 1EEQA 3SDAA 1VENA 3T3ME 1JZ2A 5F7DB 1AY1L 3UTTB 3GIZL 5C8JA 2GK0B 3U4BL 1MFCL 2FNBA 5DHVB 4YE4H 2YD4A 3HE6D 5T33L 4XCFH 2FATH 4ZG1A 3BVNA 2VDPL 2NY4B 5JIKA 3NBNA 2JJUA 3GRWH 1RAMA 1DP0A 2ZUWA 4NQDD 3FQNA 5IVXE 5D72H 5B38B 3RDTC 5D4QA 4KH2A 3OKLA 3S5LB 3F6IA 5FK9A 3W11D 2VAAB 1HOCB 3G9AB 4BFBD 1DQLH 4IRJC 1ZANL 2XZCH 3QCVL 4ZUVB 1QVOB 2BRRH 1FL6A 1YQVH 4IRSD 3CX5K 1FNFA 4X6BB 4TTDC 1HHKA 1PW3A 1UJ3B 3KLHD 5I17B 1YNKL 5EN2A 3QO1B 4HH9B 3MUGB 4YGVB 1BFVH 4MAUL 1TQCB 4PJFE 4JJ5A 1D6EA 3L3KA 4GS7C 3TO4D 1YPZA 3HE6A 2NTFA 5H35B 1KELL 1FG2A 1JPST 5JQ6L 3OAZK 4NQDA 4HHAA 3QDHA 1MWAH 3QI9A 4XVTH 1Z5LA 4Z78B 2XIDA 3VG9C 4L4TD 3RNKB 3HR5B 2IH1B 3ALXA 1MCPH 1BECA 3NACL 2I60H 4LLYB 2BZDA 4ODSL 4FZ8L 4LSVL 2BJML 4IRSA 5F1KC 3AM8C 3VDAA 3RPIB 3IDJA 1NMAH 4U1KA 3HZMA 3TBWB 3QWOB 5ALCL 1GGBL 5E94B 1WVZA 3CLFL 2JJVA 5C07E 3GNML 2AXFB 5HD8D 3TO4A 5CEZH 4LEOA 3L5JA 4PJGF 1LE5A 2NPLX 3GI8L 3HE7D 4G43A 2A77H 2QBWA 3U36B 2AJ3B 4NPYA 4L4TA 4JZJA 4XP6H 4RISL 1BVZA 4H5SB 3INUH 2VQ1B 1IM3B 1CD8A 2ITDA 3RY6A 4ZPVA 4WGWB 3NAAL 4CDHA 4LPUA 3KYKH 3RWHA 3AY4C 3QUMA 5D5MF 3VI3E 2V7NA 4F15C 1S78D 4O2CA 2OYPA 3MOQA 4CMMA 2JJSA 5DUBA 3O6KL 2NY5L 2CGRH 2GSGB 2Y07H 2R8SH 1LK3H 2EYTB 4AH2A 1OTTD 3D3VD 3BGMB 3ZYZA 2R39A 1HI6B 4HUVB 3G6JE 3OSKA 4P5KB 3WIHA 1CVSC 4L1HA 5EFIA 3HE7A 1I7UB 4NRYA 4ZUWA 4BZ2L 4HCRA 2GJZA 5KSBA 3P3YA 5BMFL 3L3HA 5C0FB 1D6VH 4YO0B 4MVBD 1RIVL 2XN9B 1FBIL 4QRUA 1IAII 4MS8D 1ES0A 4X7SL 1S7RA 3MXWH 3VW3L 1PEWA 5TQ0L 3QDGB 4NQXA 4WTZG 1IFHL 3U7WH 1U8LB 1MCIA 1IQWH 1I4FB 1RZKC 2AEIT 4NO2B 4YHPA 5MHSD 3OKDA 1SMOA 3JTSB 4LU5L 5EO1B 4U2YA 3D3VA 1JFQL 4MCYB 4KHXH 3S88H 4ODVL 4FXLA 4FQ1L 2HFEB 1QSFB 4WI7A 2QHRH 3D69A 2DAVA 4HUXB 3GMLA 3JWOH 3TNNA 3VU2A 1IM9D 3KPOB 5KN5B 2VISA 3QEQD 1FIEA 4DFIA 2DS4A 5FHBH 3KLSA 1NBZA 4BA8A 5FF6A 4YAQA 1UB6B 3H6JA 3EOYG 3F7QA 3EO1B 3LAFA 5DD5H 3TJHD 1Y6NR 4P9MH 1I7TA 4QTIL 2W9EL 2X4QB 4Q9RH 3SGKC 4LAQL 2G75A 3GMOA 3CXHJ 3TYGH 5K59F 3ROOA 1RULH 1J0JA 5IVXB 4ONGL 3ZKXC 3P4OA 4JFED 5CJQH 5E8NB 4K8RD 2K3TA 3QEHA 5IBTH 4TPRH 3LDBC 5J57B 5GHWL 4WUUE 1NMCB 3MRMA 4MJ5B 1IM9A 3GBNH 4KI5E 3KPTA 3TT1L 3QEQA 1YNTA 5L88H 4M1CC 3N9GL 3T4YA 5JDJA 3UTZA 2NY3C 4EXPX 2AJVL 2DQJH 3JV6A 4PJFB 3REVB 2DTMH 4ONHB 2VITA 4YR6A 1BJ1J 1H3TA 3TCXA 3OHXA 4A2LA 3VI4F 1QO3B 1JGVH 3CMOH 2AGJL 1AC6A 2Z0BA 3BYYA 3SBWC 4JEGB 4XPBH 1CVRA 4YHIA 2GY5A 1VGKB 4JFEA 4M7LH 4Z0BH 1RK0A 1VCAA 3FO1A 3P30L 3MRGA 2FIKB 5I74B 2CUHA 3GI9H 1LDPL 5ANMA 2FECL 5HGHA 2P5WB 3BMWA 3S3JA 5DC9B 5MEQB 3LKQA 3G5XB 3DO7B 3AAZB 4OQ1A 3BPLC 2GUOA 4MWFB 3JVGA 3DIFB 3EOBB 1U6AH 3GRWA 2HP4A 2ZJSL 1CLCA 2FZ3B 5DJZA 2F5BH 4Y19D 3HUJE 3EDFA 2FEEI 1OAUH 1TZGH 4HXBL 4PRID 4PJXE 4UV4L 1PG7W 4ZYKB 4X5WB 1G7JB 4UIMA 1MCWM 3IFNH 3UTTD 1F6LL 2APFA 2DWDA 1ZLUH 2XXCB 3SKMA 3SY0B 5I15H 1YEFH 2CD0A 5K9QG 1F3DH 2EIZB 4RBPK 2VDMH 1R3KA 5DEFA 1OM3L 1CDUA 3Q5YA 2NY4D 5EOQL 3HA0A 1JGEA 1FN4B 4P2OC 1GZQB 1MRDH 4M6OH 4PLNC 1N0LA 4HIHA 4DKAA 3KYOA 4XHJC 4WJ5B 3ZTJG 3RZWA 2XQYG 2PN5A 1MWAA 1KJMB 4Y19A 3WKMH 4L8SB 4PLJD 3T1FB 3T77B 4PRIA 4YHYC 1FCGA 2I24N 3OX8B 4GAJH 3BE1L 3DVGB 5F7DA 3UTTA 4WI2A 2GK0A 4JPVL 2FB4L 4MLIA 1IGFL 5DHVA 5H8DA 3DXAE 4I2XA 2R2HB 4M9OA 3VA6A 1TTGA 4FFWD 2WSKA 2JIXA 1HH6B 5B38A 3FHAA 1PJ9A 5T3ZD 3S5LA 2VAAA 4Q9QL 1YMME 3SE9H 1IGIL 1NSNL 3T0XA 2WBJB 4EOWL 1QVOA 1JMZA 1A21A 5I18L 3ULVE 4BFIB 4X6BA 5M95B 4QT5B 1UJ3A 3T08A 1NJ9B 5F7WC 1FQ9C 3QO1A 4HH9A 3X14B 3LY6A 4HF5H 2X4NB 5J8OA 5D7KE 2X4PB 1KOAA 3IFLL 3QUXC 4HUUB 1CD9B 5HGAB 2KDGA 3V5KB 1YEHH 2E7LC 4OGAC 2GQHA 4Z78A 2DLFH 3QUML 3HR5A 2IH1A 4R4NC 5HHME 3K74B 5KZCD 4PREB 3DOSA 1P4IL 4LLYA 3IDXL 2EO1A 3GKZA 1FAIL 4ODUB 5IBLD 3PGFL 3WJLA 1I9JH 3RPIA 2OMNA 3UPCA 4PGZA 3O6LH 4X9HA 5KS9E 2IAMB 5HHPA 5J12C 5E94A 3WIHL 3MGOB 4NN5C 4E41E 1AHWC 2AQ1A 2HVJA 2ZWLT 3MLRH 2IALB 4HCRL 2AXFA 1E6JH 3DV4A 1L7TL 3O9WC 4OGZA 1RUQL 3ARTA 1JMXA 2QSVA 1QPXA 4JVPA 3U36A 2VDLL 2AJ3A 4Z7UE 1E4XH 4H5SA 3AREB 2XN9D 5ERWB 2VQ1A 5CEXB 3NIGF 2ZCHL 3F7YA 1IM3A 4APQC 2ADFH 3P77B 4K7PH 1VSCA 5DVNA 3QDGD 4LCCC 4X6DE 2CRYA 1SJHB 4PJ5B 5IW3A 1WFUA 4FMFA 2GSGA 3IVKB 2EYTA 3KGRA 1JF1B 3EHBD 3TYFB 4JO4H 1DBBH 4X8JB 5DYOA 1HI6A 4HUVA 1QSFD 4P5KA 1TJHL 5JR1H 1I7UA 2V5RA 4IHOB 3NZ8B 1XGUB 4Q58C 5A2IH 5AG8A 4YO0A 1Z2KA 2D4FA 2ICEB 1DANU 2N4IA 2V2WA 2XN9A 3OAUH 4PJXB 1OARH 5HY9A 2UVFA 4OD3H 5B39B 4B7IA 4D0BB 2JELH 5GZOC 1I3GL 3BSZL 3QDGA 3CD4A 1MNUL 5DZOA 1RD6A 1U8LA 1GHFH 1I4FA 3PUCA 4NO2A 3BPNB 4QNPF 3KR3L 3QEUB 5BVJB 4JPIB 3OMZA 2GTWB 1MFBH 4MQ7B 5F88B 3JTSA 5EO1A 3EYFB 4QOKB 2E6QA 1DBJH 4LP5A 3OG6B 2ICWB 4O9HL 4ZS6C 2HFEA 1QSFA 2H2SC 5DI8B 3RKDD 3LRHA 3DMMB 4HUXA 1J1OH 3O4OB 2GYSA 3ZTNL 2ZCKH 4YPGB 1VEOA 2VXVL 4V2CB 5DGQA 4EKXA 2Q1EA 3TA3D 3RVWC 1SMAA 3RIAF 1B0GB 3GFUA 4S1SL 1IRAY 1VDGA 1R5IB 3UYRH 5DEGB 1ACZA 5E2VL 1OPGH 1UB6A 3IJYA 3EO1A 3VWJB 3DXAB 3OKMB 4GJTB 4K8RL 4N0YH 5J89A 2X4QA 1FJ1B 5HDQL 5I1HH 5IVXA 1Q9OB 4P9HC 1J8KA 3RWGA 1U92A 3KYNB 4JB9H 1N64L 1YMMB 3MRJA 1B6UA 4XWGH 2DQTH 3AC0A 1ZGLP 4QHKI 2YUXA 4MJ5A 1A7RL 4XCFL 4DW2L 3GRWL 3TA3A 3AS1A 2AJXL 5AZ2H 4MB5A 3WXWH 4J8RA 5GJTL 2DQDH 4MJ4A 3VXOB 4PJFA 3REVA 1NGZB 2ERJC 4ONHA 4S2SB 1NCAH 4TUJA 2P4AB 4U1HB 2XZCL 1QO3A 4JCMA 1AC0A 3F7RA 5F8QC 1FRGH 3RVVC 1U8OB 2AXHA 1VGKA 5GIRB 3RU8L 3B6SB 4KJPC 4O2FB 2R0ZH 4OT1H 3VFRB 3RAJL 1U95B 5J1SC 1BFVL 5HHMB 1J1XH 2Y6SD 2YD8A 3TWCH 3VGGA 4GQ9H 5C0JB 3G5XA 5ITFB 4FS0A 4JDTL 3PG2A 4XBGB 3GSQA 1MWAL 4XVTL 3DO7A 3AAZA 1U41A 4MWFA 5KS9B 2AJYH 1SBSH 3DIFA 3EOBA 2MKLC 5F7LB 2WP3O 1A2YA 4R3SB 1A7QH 3ARFB 4DVRL 2X1OA 4PJDF 3D2UB 2I60L 1BFTA 3DX8B 1JGDB 2ZZUT 2E7MA 4ZYKA 5IBUB 4XVUD 4Z7QE 1G7JA 1XR8B 4M9PA 4OCSL 1Z3GH 1JHKH 5IK3A 2HJFB 1NGXB 4Z7UB 4KJQC 2EDHA 4KGLA 4AYFA 2EIZA 5E8DL 4CKVX 5CSZB 5I0ZA 5JDSA 1QKZH 2FHBA 4OD1H 1OAXL 3ZHLA 1GZQA 1QNZL 3EO0B 5IMOB 4Z7OE 2AJUH 2QL1A 4OZHB 1F45A 1Z9LA 4U1GB 3AXLB 4WJ5A 3SDDC 2WBJD 5DMJB 2W65B 3QSKB 1KJMA 3MJGX 3UO1L 3G6JA 3T1FA 1OAKH 2DI7A 3I50H 1IKNA 3DVGA 5SX5K 5TDOB 4BFEA 3VXTB 1D5XB 4P23D 1KACB 3S3PA 3MLPA 1TXKA 1LEIA 2R8SL 5A16B 1LK3L 4K3GA 1NBYB 5T3ZL 5BOZG 5ILTH 2KQMA 3M8OH 5JZ7D 4KU1A 1BM3H 1HSAB 5CZXD 1HH6A 3MLSL 3O6FC 4LIQH 1S9KC 4F3FB 2FRGP 4JQVC 4YX2H 1MSPA 2FEEL 2GJ6E 4L9LC 1BZ9B 1KEGH 2WBJA 4KJWC 4JPKL 3EOTL 4Z8FH 3TIEB 1JWMB 4GFTB 3AUVA 4XCNB 2ARJQ 2R0KL 4HULB 2ZUTA 1NCNA 1OW0C 3MLYL 4WUUD 4QT5A 3C60C 2IAMD 4M61A 3X3GL 1NJ9A 3UBXG 3EKCA 2VZOA 2RCSL 3X14A 4P23A 4KQ3L 4KI5D 5D1QC 2X4NA 3KXFE 3ULUF 1K8DB 4X7CC 2YS4A 4HUUA 5HGAA 3WO4B 3BRDA 1HHGB 3S88L 1ZT4B 3GMPB 3V5KA 4BH7A 4QHMB 4GLRH 4G9DB 4XH2A 3RVUC 2J8HA 4OLUL 1Q0YL 3RWJB 5LWYL 3ARED 5CUSL 3VGAC 1XH3B 4PREA 1GH7A 3UEZA 5INCB 2GSIB 5IB5B 3NTCL 1FL5B 1JHTB 4ODUA 5DA0B 5DS8B 3QHZL 4LHUD 4WUUA 5LAXB 5DFVD 2IAMA 4XB8A 1KNOB 4P2CG 5GGVY 5D71H 3MGOA 5L9DL 1EJOH 4Q9RL 2IALA 8FABB 4QRTA 3WNKA 1RULL 4HKJB 2HJKA 2Y06L 5JUEH 3QCUL 1H8NA 3RWCB 4F7TB 35C8H 1CE1H 4PJIB 1KCUH 1T0NA 5CD3A 3CSYB 2R69L 4DGYL 3AREA 5ERWA 1HHJB 1QPPA 1J0KA 5BQ7B 5IV2B 1WCQA 2BXZA 3DRTB 5L88L 3P77A 4Y4HC 3X13B 4NC2B 4XMKH 1GIGL 1MFAH 2FX8H 4PG9A 4DZ8B 5LGJA 3TM6A 5GS0C 2DTML 3LD8C 3L3GB 5DD3L 3QAZB 2E27H 4LHUA 4Y4KB 4Y0GA 5M7QA 4IOFD 5ALBL 1JGVL 3TYFA 2D03L 4X8JA 1AO7B 2A6IB 4CW1B 5BV7C 4XPBL 4MA1C 2DLIA 4XPFH 4Z0BL 4MGXA 3DMMD 3IS0X 2HKFH 4IHOA 4N1HB 3NZ8A 1RZKH 1XGUA 3HC4H 4Q6IB 4ODTH 3HUJA 1FFOB 2ADJB 4XPGH 3U6RB 2ICEA 4PJXA 1P7QB 4RNRB 5EB9A 1BQHG 4HMDA 3RBGA 1NPUA 4HPOH 1MVFA 1QFUH 4FN0A 1N7ML 3VWJD 3DXAD 4WWKB 2IEPA 1MHCB 2YXFA 4JVUA 3QEUA 2XWBB 3ZMRA 4JO2H 2F5BL 2NZ9C 4MQ7A 5F88A 1OL0A 1E4JA 3OJVC 5F70A 1RZ7H 4JFYB 1MELA 4OCYH 2ICWA 1MRCH 1ACYH 1YMMD 4NKOB 5I15L 3DMMA 2X4TA 2CDGB 2VDML 2P7TB 3WHE0 3CJJA 1MFNA 4YPGA 3WUWG 5LGHL 2GW5A 3T0EE 1IKFH 3VGDA 3ULVD 1EO8H 1KIUA 2ZCLH 3CU1A 5AYUL 3H0TA 1NUFA 1B0GA 5CCKL 1R5IA 3FT4A 5DEGA 1WUNT 3ARBB 3AB0C 2PR4L 4OM1H 1U8PB 1I1CA 3UTPE 3NH7L 3UTOA 2J4WH 1RURH 3WFDH 1F58L 3VWJA 3ZZ1A 3DXAA 3OKMA 4HT1H 5I1KH 1GVIA 2J12B 1SJEB 2VR9A 3WKML 1FJ1A 3MC0A 3P2TA 2V17H 2R1XB 1Q9OA 3UC0H 3ROLB 1RHFA 5GISL 3BQUC 4OZIB 2BSRB 3KYNA 1KPRB 2WWMC 3VXRB 1YMMA 2GJ6B 4LAJH 1J86A 2W9DL 5HHMD 2BSTA 2V5TA 1XIWC 1A6TB 3RDTD 1YEIH 2B2XH 2GFBB 3QEGL 4JFOB 3W5NA 3QNYA 4QRSB 3KYMB 1F90L 3NA4A 2IGFH 3VFGL 4KKLD 2NTSP 1DUZB 3UP1A 4D3CL 3DVIA 1K5NA 3VXOA 2VLLB 3ARFD 4S2SA 1A3LH 4MCZB 3JWDC 4NQUA 4MHHG 4ZSOE 4PIRF 5BW7A 2WBKA 3ZE1E 5DVLA 5IB2B 5GIRA 5KTEL 3I85A 3B6SA 2VQUA 1YDPB 4O2FA 1FZOB 4RMVA 3VFRA 1U95A 3GMRB 4M7KL 2I25N 4XTRC 3UJIH 5CJBA 4HIEA 3RY5A 1AGBA 5IFJB 2WQRA 3RDTA 1EZVX 2HFGH 1YYLL 1WT5C 5ITFA 1Z9SA 4NKMB 4PGDB 5KS9A 2DLFL 3ARDB 3EYSH 3H9HB 2ORBL 2C5DC 4PTUB 4R3SA 3ARFA 4NSKB 4LRIA 1KB9J 5CGYD 4FFVC 1D7FA 4WRLA 4CBPA 3TBSB 3DX8A 4XCYB 5LKNA 1JGDA 4KROB 4GRLB 1AXIB 2ZNXA 3GK8H 1XR8A 3V95A 4GXVL 4FQ2L 5EZIH 5J4MA 3WXVH 2HJFA 1NGXA 3ARSA 4Z7UA 5FM8A 4L4JA 5ELIA 3EGSB 3MLRL 5CSZA 4ZO8A 2UZXB 4PRAB 3SE4A 1KB5B 1G7LB 3DARA 5IMOA 4X6DA 1PQZB 3DETC 5I1CH 3AXLA 1DBAL 2BHYA 1NGQL 3QFJE 1D5IL 2DKSA 4UV7H 2ADFL 5JOEA 4QGTA 1LO0H 3K1KC 4QGYA 2VLKE 4H20H 5I2IB 1KT2B 2QQKL 5D7LB 5TDOA 1NFDE 3VXTA 4L1DA 2ED7A 3IU4H 2X05A 2G5BA 4OCRL 4XXCC 5I0DA 4TNWF 5HHOE 1FGNH 1NBYA 3BKCH 4NUJB 3SGJC 1JRHH 5J6GB 1DBBL 4D0DB 2E8ZA 2EH8L 5F7MC 5SWZB 2HRLA 2DQEL 1QFWH 1HSAA 3WFHB 1Q9WB 3GB7B 4HS3A 3KNBB 5GRWA 2VLJE 3PP4L 2FO1A 3BP4B 5GS1B 2FJFB 3AY4A 1BZ9A 4JAMB 4NN7C 2IPKB 5I1AB 3BP5B 2H2PD 3OAUL 6FABL 4Q6YA 1JWMA 4PRDB 4XCNA 1UCBL 3B5HA 4H25B 5LVEA 4OJFH 5SX4H 3NA9H 5EBMB 4D8PB 5TPWH 2DWEB 4P3CL 4OTXH 2O5YL 1MFBL 1OAYL 2DM2A 5J3HD 3T0EB 1KEMH 3IXTB 3IFOB 5DLMH 1HHGA 1ZT4A 1P5UA 4QHMA 4G9DA 1QFHA 5F6IB 3BDYH 1SJXA 3TPKA 1KTDB 2L0DA 5HYQB 1CFNB 2WLZA 4R8WH 1ZLSL 4X4ZA 4K7PX 4C57C 4OLZH 5IGXH 4PJAE 5INCA 2GSIA 5IB5A 3UYRL 4HPYL 1JHTA 1OPGL 4GMSH 4PJFF 1MIMH 3O41B 4Y4KD 5LAXA 3MACH 5C0IB 3C09C 1C12B 1L0XA 2LV4A 2EKJA 3AS2A 5DJ8A 3RGVC 4G6JL 3ARYA 1GGUA 8FABA 3IRPX 3Q5OA 4OF8A 1ZLWK 1TTFA 1I9IL 1A1NB 4NJ9H 5TF1H 1HILB 5SWSE 5DVKA 3RWCA 4F7TA 1J88A 4XWGL 5I30H 4S1DC 4MMXC 2CIIB 4OZFH 5DC0A 4Q2ZB 3V4UH 2WUBL 1LEGA 1V5JA 3FT3A 4YDIL 1HHJA 1P7QD 5BQ7A 1N0XH 3X13A 1X44A 3R06B 3JV4B 4DZ8A 3WXWL 2DYPB 5E08L 4N8VG 4WWKD 2DQDL 3SGKA 1UM5L 3L3GA 1NCAL 4FQCL 4Y4KA 4QXWA 2F8VA 1FNEB 5D7JB 1UKSA 3K8KA 4KVCL 5FO7B 4KK6D 1V05A 1AP2B 4CW1A 2A6IA 4FP8L 2YHGA 3DHMA 4EN3B 3P4MB 1G6RB 1B0RB 2CLVB 1BVLB 4ZUSB 4BH8B 1FDLH 4UU9B 4Q6IA 5TFSL 1ITCA 1FFOA 2DQGH 2ADJA 4QCIB 3U6RA 1P7QA 4RNRA 4RMRA 4YHZL 2QJDA 4F7PB 3ARBD 2V9RA 3FTGB 1UM6H 4JM2C 3CX2A 4WWKA 1MHCA 2ZPKH 4F7CA 2VWEC 4L5FL 5HHNB 4TVPE 5A40E 1GGIH 4UQ3A 5EU7E 1G7IB 1MCRA 2AQ2A 5DQDH 4JFYA 4XNMB 2NX5E 2VDRH 4F9PC 2Y5EA 3UJJH 1B4RA 4CVWA 1KULA 4KZEH 2AJZA 1DFBH 1JHKL 2GJ6D 3ULVL 1BJMA 1ZKAA 2CDGA 4TULL 1XGTB 4G8EB 2NR6C 2P7TA 3QFJB 1ORQB 5DMGC 1QKZL 4X9BA 4RA0C 4FXKB 2VLKB 4J1UB 3V6OA 2FJHB 2GK2A 4YDVB 4F8QA 1JGUH 1TCRA 1HDMB 1NDMB 3QQ9C 4P9HH 3HNSL 3JUYA 3T2QA 3ARBA 4GBXC 4MAYC 1G7MB 1FPTH 2AEQH 1U8PA 3STLA 1C5BH 1FCCA 3KXFD 2D7OA 4U31A 4HS6A 1SJEA 5CWSA 4PV9B 4M48L 1X5AA 2R1XA 1LHZA 3B8SA 5HGBA 1OAKL 2QLVB 3CH1B 4WENB 1M1SA 3ROLA 3I50L 2VLJB 4OZIA 2X42A 2BSRA 3PF2A 1KPRA 2A83B 2GJ6A 1EMTH 4P2OA 3WIIH 5D7IE 1A6TA 3G5VB 2X6MA 2GFBA 2C3WA 3KHOA 4JFOA 2OZ4H 2WINA 4QRSA 3M8OL 1JNNH 3G5ZB 1DANT 3KYMA 4LBEB 3QR2A 4LVNC 1BM3L 4LCWE 1ZEAL 1IC5L 1RIHL 2NW2B 5I8CA 3U30C 3ARDD 5F1IB 3DLQR 4YX2L 1EXUB 5DVOA 3BN9D 2VLLA 5T1LB 1RMFL 3KXFA 1KEGL 4MCZA 3MXVH 2DM7A 2XYCA 4KROD 4GRLD 4YHKH 3M07A 5DF0A 4UUJB 5IB2A 1U8IA 3QUXD 2FL5B 4TNVF 1YDPA 1UACH 4HV8B 1G1CA 4DKFL 3GMRA 4XC1H 4H1LB 2E7HA 3QIUB 1J12A 4KI5F 5IFJA 5BXFB 2R4SL 1P6FA 4OGAD 3VH8G 1K4DB 4PJAB 3STBA 2ZUQC 2K1MA 4NZTH 5IIEB 2R9HC 3VFSB 3RIFF 3X12B 1CLZH 4WU5A 4PGDA 2DI8A 4X99B 4ZQKA 5AD0B 2NW3B 3ARDA 2FX9H 5TQ2L 3EJZC 4FG6C 4PTUA 4AIOA 4NSKA 5DJ0B 2GTZB 3MREB 3TBSA 4XCYA 1MIEH 4GRLA 5F3HB 3V5DB 2F58H 5D7LD 3VXUB 3QUXA 2BVUA 3TC9A 5J11B 4NWTH 3TFKD 3EGSA 1EJOL 5FA3B 1A47A 5GGTA 2E7LA 2YA1A 4PGCB 3OJMB 1KB5A 1MCBA 2XWJA 1PQZA 4MXQC 5EZOL 3V6BR 1QZ1A 1ZLVH 4PJXF 4Y5XB 1XZ0A 2ADGA 1IGTB 2UVEA 4U3XA 1OTUC 2X1QA 4YQXH 4LSUH 3NGBC 3BI9X 3ZDXE 4UAOB 1KT2A 4PRHE 1AHWA 5HVGB 5D7LA 1H0DB 2QQLH 4XPAL 3MSPA 3T0ED 5GGQH 2BVOB 4NUJA 5AZEL 4UDUB 4MJIE 5J6GA 4IM8A 4ALAL 1Q9WA 2YXMA 4XPFL 3UTPD 5C0EB 4LLUB 1I85A 3KNBA 2HKFL 2EDDA 5ADPH 1MF2L 4P5TC 4R2GC 3BP4A 5GS1A 1L6XA 3C8KB 1LP9B 2FJFA 4G6ML 4JAMA 2IPKA 3BP5A 5CSBA 3C8DA 2NX5B 3PDOB 4PRDA 1RFDL 4HG4K 4H25A 4ZD3L 5IQ7L 1NLBH 1QFUL 1Q72H 1YYMH 2I26N 5EBMA 5D2NC 4D8PA 2DWEA 4JO2L 1NAKH 3MLVH 2HRPH 3C6LC 3T0EA 2NY7L 1RZ7L 2HLFD 4E5XA 3W81A 4ONFL 2ZSVB 4RFEB 3OKNB 1QG3A 2H1PL 4HK0B 2CDEB 3CK0L 1S7VB 1G7QA 3FB8B 3Q6GH 5HYEA 5F7HA 1I8MB 4N0CD 1KTDA 1NGYB 5L0QB 5HYQA 1CFNA 2IC2A 4QWWC 1IKFL 1AGDB 2ZCLL 4XBEH 5J13B 5CZVH 5IQ9B 3G6DH 4ODXA 4K3DH 3EDJA 2DYPD 4HC1H 4OM1L 4JPWL 4IIQC 1U42A 3O41A 4MJ6B 1A6UL 4XI5C 5D7IB 5C0IA 1C12A 3V0WL 3U9UA 5CS7A 5L8JB 2AABH 2ZP0T 4LCWB 2EXWC 1MLBB 3UC0L 1FGVH 5M94B 3BISA 1MY5A 1BQHB 1OTSD 2XPGB 1A1NA 1HILA 2FD6L 3VMPA 3LCYA 5GS0H 4MA3B 1EEZB 1EEYA 2CIIA 4Q2ZA 2B2XL 3RTQC 4ZSOA 5GGSB 1CICC 1AE6H 1CU4H 4LKCB 1E0OB 4JGMA 5BV7H 5CLTA 3R06A 3CZJA 1FHGA 4OLEA 4YXLH 3JV4A 5DO2C 5KS9F 2DYPA 5LQBH 1AGEB 3CMGA 4WFHD 1GOGA 1JZ7A 5EWIL 5FO7A 1PAMA 4HUWA 5KVFH 1TPXC 3WUWB 2GAZA 3O0RH 1RUKL 1QLFB 3GSXB 2DMCA 5KSAC 1CZ8H 3P4MA 3Q0HA 1G6RA 1QQDB 1B0RA 2CLVA 4Z7UF 4PBWD 1DTUA 1G9NL 4ZUSA 1N26A 4BH8A 3QFJD 4UU9A 5I16A 4I4WB 5DA4A 1MJUH 2VLKD 2IBBA 4KMTL 4QCIA 1FSKB 3HC0B 3P0YL 5F21B 3FTGA 4OZHF 4J3TA 4CMHC 2DQIH 1RZFH 1MCOH 2B5IC 4KTYA 2Z31B 4JN1H 5CGTA 1OOAA 1CTNA 4HGWB 5HHNA 5E6IB 5C92A 5I66B 3CXDL 1G7IA 1MY7A 4J3XA 1G9MC 2FIRT 4XNMA 3DUSB 1UADC 2VLJD 1E4KA 3LKRA 1NKRA 3QH3B 3DTXB 5EZIL 3WXVL 5T5NG 3PXJA 1IILE 1XGTA 3P0VH 4G8EA 5ESVB 1NMBH 4PB9H 2V5MA 1ORQA 3QFJA 3T2OA 5IEHB 1DSFH 2YD7A 4FXKA 2VLKA 4J1UA 2FJHA 4YDVA 1P4BL 3IXAA 1NDMA 5CILL 3UYOD 1GC1L 1CYGA 1I8LA 3S36H 3B9KC 5T5FH 1NFDA 5I1CL 5IP4A 1G7MA 4G80B 3QUYB 5C0BE 2XOTA 2JF1A 1UM4L 4LVOB 4AY0A 2JKXA 4UV7L 3CU7A 4PV9A 4R96B 4ZFGH 2D31B 2DICA 3MFGB 4Z76B 5BZDA 4H20L 3O2DH 4Y5VB 3R1GH 2J8OA 2VLJA 2DDQL 2A83A 1IMHC 3IU4L 3QIUD 3MRLA 3VD5A 1KBGL 3G5VA 3JWDH 4HJJL 2DB8A 1FGNL 4U0RB 3S8WA 1QSEE 1JRHL 3G5ZA 4ZTOL 3NVQA 4QRRB 2OR7A 1L9NA 4M3KB 4LBEA 4D9RE 4JFQB 2NW2A 2QSCH 4KUZH 5FYJH 5F1IA 1EXUA 3DRQB 5D1XB 2MTPA 2ITCA 1FVCA 3GHBH 3C60D 4MDIB 3ZE2F 2P1YA 1WGOA 5SWSD 4DQOH 4UUJA 5GGTL 3SCMB 5BCAA 2FL5A 1V3JA 1KB5L 1S7TB 1DN2A 1BVKA 4H1LA 3QIUA 3T8XB 5BXFA 4Y5YC 4LSQH 1K4DA 4M7ZC 4PJAA 5DLML 4JQVA 3MGAA 5IIEA 3VFSA 2KL6A 5IFHH 1TVBA 3W2DH 1N3NB 3RHWF 4X99A 5MI0C 2BC4B 5AD0A 4PJIF 4JHZA 5KVGL 2NW3A 2ED8A 1YN7B 4KQ4H 1ZHNB 2R4RH 4R26H 4PLOB 2C1OB 3PWPB 5DJ0A 1A14L 1SY6A 1MCQA 2GTZA 4XWOC 2DQFB 4OV6F 3MNZB 3C60A 3V6FB 1EBAA 1MAKA 3V5DA 1JF6A 2BSSB 5SWSA 4GMSL 1WF5A 1AXTL 3MACL 2R1YB 4RIRB 5IVZB 1ROWA 4KRPC 1FLTX 5FA3A 1MCWW 4M93C 4YXHH 4LASH 4KY1L 5E2WH 3NPSB 4HS8L 1XGYH 3VFMB 4Y4HD 4TVPD 3V4UL 1ZVYA 2HT2C 1PEZA 1BFSA 4O58H 4ZAKB 1QLEH 2NX5D 1IGTA 5FDWB 4POYA 1N0XL 4HBQA 3X3FH 1H3VA 3D25B 2BVYA 3TZVB 4DVBB 5ITBL 2ZG3A 3O8XB 3E3QC 2B0SH 4JQXA 2HLAB 5F96L 2X4SB 2BVOA 1MJ7L 4RFNC 1KCKA 4UDUA 4Z7OF 4K71B 2FCBA 3HNVL 4HEPG 1E4XI 4P59L 5C0EA 4LLUA 1OP5H 4AEIL 4Y4HA 2UY6A 2DQGL 1WC7A 4NBYB 4KRNA 4ELME 2AV1B 3TESA 3BIKB 4YWGH 5LXGL 2BOBB 2NX5A 5EBGA 3PDOA 4P48A 5CIPH 1UM6L 3N50A 1AKJD 4HXAH 1L0QA 3L6FA 5F8RC 2HWZL 4O51B 1MHPH 5E8PA 3HAEH 3I9GH 2YK1H 1VA9A 4LCWD 2HAZA 3LMJL 1I1FB 4HK3N 2VDRL 3UJJL 4LSPL 4RFEA 5DSCB 3OKNA 3QBTB 4F7EB 4D0CA 4OZIF 4HK0A 1UWXH 3U7YH 2CDEA 2NY5C 1S7VA 3AS3A 3FB8A 5C0BB 3OXRB 3VGHA 2HT3D 4NUGL 4N8VB 1NGYA 3MRHB 4MHHI 1MFDH 4XCEB 5E1HB 3I2CH 1KIQB 4HKBB 1ZMYA 5IQ9A 2OSLB 3MUJA 1T21B 1BIIB 5KAQG 1S8DA 3LB6D 4Z0XB 1MCLA 2AEQL 1FE8H 1AKJA 4KKNA 4EDWH 3H3PH 3EBAA 4MJ6A 5D7IA 2X70B 4NBZB 5IFAH 5K9JH 4Y16B 2WWKT 5FECA 3QPXH 1G6RL 1QSEB 4U3CA 1AGFA 1CF8H 1RZGB 2GY7B 4LCWA 1MLBA 1NCDH 4FQJH 5E2UH 1AR1C 2XPGA 4PBXA 4Q9CA 1AXSB 2Y7QB 1EMTL 3WIIL 1EEZA 3BD5A 3M45A 2OX5A 3CSGA 3QDAA 1LE9A 1CFBA 3TVMC 3MLXH 5GGSA 4DGIH 1JNNL 3MOBH 4LKCA 1W8NA 3UZQA 4JZOB 4XC3H 5DR5H 5EU4B 5CKGA 1H3PL 4PB0H 1HXYB 3V9FA 1G6VK 2UWEE 5C0CB 1AGEA 1B4JH 1V7MH 4DEPB 3GHEH 2EIDA 5SWQB 3UDWA 3VDBA 3F7VB 1P7HL 3CXHK 4WEUD 3GKWH 1QLFA 3GSXA 2ARJB 2JLLA 4K94L 1WAAF 3E0GA 3MCLH 3BD3A 5F3BB 1QQDA 1JWSA 2NXYB 4GRWE 4XC1L 1J05B 1J0YA 3MJ9A 4I4WA 4I0CC 2C4FU 1LQSR 1LEKB 2A9NH 3SOBH 1Y6MR 1QRNB 3JTTA 3HC0A 1OLLA 4PRHD 1JPFB 2AI0H 3E8UL 4FFVD 2MFNA 2LU4A 2IWGA 3C2AL 3MODH 4OFPA 4HGWA 4WY7L 2MKWA 5I66A 3PWUB 4K7FB 5HHVL 1MIEL 2L7JA 3RWEB 5KW9H 3NFSH 4ERSH 4DFHA 1WWCA 2F58L 3DUSA 4L3EE 2F19H 1INDL 1HEZB 2XA8L 4RWYH 3DTXA 4GMTH 5IHBA 2VC2H 5ESVA 2AK4E 3OJ2C 3RI5F 1X6LA 5IEHA 2IG2H 4QRRD 3MJ8A 3NCBB 5JA8B 4JFFE 5I8OH 2V9QA 1B9ZA 4LSSL 4X80L 5DJ6B 4NGHH 1Y18A 4RMWA 4DKEH 4PJGE 2C7UB 5L8LB 4PRHA 4UT6H 2HTKD 3BOVA 4OZGF 4LLMB 3FZUC 1ZVSB 3QXWA 4G80A 2NY1C 5HPOA 5D1XD 1K6QH 3NPZB 4Y8AA 1C16B 5DUPL 1TZIB 2BY0A 5C3TA 1B90A 3MA9L 5KJRL 4R96A 1MI5E 2D31A 3WNMA 1N5YL 4Z76A 3DNKA 3VH8B 1NC4D 2A9MH 5D5ME 4Y5VA 5B4MC 3SCMD 5EORH 1J8HB 4LKXB 5I76B 3SDAC 3ZE0E 1W72B 1JZ4A 1IQDB 2MQ0A 3K3QA 4G8IB 3N0PB 4ELMB 3GSRB 3C2SA 4QRRA 4KKAD 4G9FB 4JFQA 2PCPB 3EJYC 1SY6L 3B83A 3MNWA 2P43B 2MQCA 1TETH 1T03L 1F4XL 2I27N 3DRQA 2EDJA 5B8CB 2AEPL 5D1XA 2DOCA 4HJGB 2OR9L 2W92A 3PWPD 4U4BA 3W9DB 1ZV5A 1I3UA 2L4OA 4MDIA 1NC4A 2Z8WC 3SCMA 4UIKL 5D1ZB 4ELKA 3PWNB 2NYYD 3QFDA 1S7TA 8CGTA 2EIEA 1S3KL 3CDYA 1NAKL 1MCFA 3T8XA 3CIQA 1TZHB 3ZYOA 3ZYJA 4G6FB 2BNQB 2DQUL 4X0KB 1N3NA 1ZT7A 4WW1B 2C3HA 1XF4A 5BVPL 2BC4A 3ARUA 3N85H 1KXVC 4YBLC 1YN7A 4XRCB 3W11C 4ZAKD 4U6YB 4X6EB 5DT1L 2V2TB 2C1OA 2XACC 4V1DE 2DQHH 3DGCR 2PYFB 5CZVL 3MNZA 3V6FA 4F37K 2H26A 3TZVD 2BSSA 4P2RE 4IRSC 3KS0J 5D8JH 5IROA 3O8XD 2AK1L 2R56L 3UTSB 1DN0B 4OLVH 4KMQA 4YZFE 2A74B 4RIRA 5C9JA 1GPOH 4LQFH 3KLHC 4YHOL 5CIPA 1YMHB 3QA3B 5IVZA 3WFEL 5K59E 2PKDA 4S1DD 4TVPL 3TO4C 3HMWL 3MV7E 1L9MA 1NDGB 2YRPA 3SE3A 2UWEB 4OV5B 1CXIA 3NABH 2NY2B 3E6FB 4JKMA 4ZAKA 5ICZB 5BV7L 1LO3H 3RY6C 3LS4L 1TQBC 3P0GB 3D25A 4FOMA 2VDNH 1F4YL 2D7TL 3TZVA 3FFCB 1UVQA 1BX2B 4GRWB 3O8XA 1DBKH 1Q9LB 4U6VH 3BAEH 3VI4E 2JJSC 1OP5K 2X4SA 3I6LE 1MHEB 1QBLH 1HKLL 1ZSDA 1BOGB 3IS1X 4MNGE 3KPRE 5HD8C 2CRMA 2D7NA 1IE5A 1PKQE 5C0BD 1CE6B 4ZOAA 4WIQA 5FO8A 4WCYH 3DJ9A 3MUY1 1PBYA 1QYGH 1IVLA 4MNHB 1WQVT 4UB0H 1MJUL 5JTWA 3U1SL 2AV1A 2ZKHH 3BIKA 2BOBA 4IRZH 4PJHB 2BDNH 1FORH 3GBLA 5HTSA 5DZLA 4HUMB 4MJ2A 4YDLB 3FJTA 2YPLE 5TE6L 5IG7A 2IFGA 4Y16D 3GJFA 2AK4B 5HGDB 1S78C 3T3PE 1QSED 3CVIH 3ZKQD 4D9RD 5C0RH 4K2UH 1WWWX 4LEXL 1OTTC 1JP5A 4TVSa 4OLYL 5DSCA 2D9CA 5EZJB 2NY6B 4XNYH 2I07B 5C0BA 4O5LL 1NCCH 4WHYH 4DOHB 3MRNB 3P0VL 4N8VA 1ND0B 4CJ0A 3MRHA 1EJ6A 4X7FC 2IMMA 5I6XB 1DSFL 5EBLB 4I8DA 1MI5B 1KIQA 4K3JH 4Q0XH 5IW1B 2OSLA 4A6YB 1T21A 2MSPA 1BIIA 4OBSA 4Z0XA 5T5FL 4K23H 4MS8C 4PJ9C 3QG7H 3I84A 3BWUC 3HRPA 2LE9A 2X70A 5ENWB 4Y16A 1M6OB 1QSEA 3O6MH 2AJSH 1T7VA 2W07A 3NCEB 4XP4H 5L7XH 4ZFGL 4JM4H 4PP1C 1I8IB 1INQB 5F9AC 2OLDA 1RZGA 2PTUA 3O4LE 4HGKC 2J6EA 3MJ9L 3GJFK 5I19L 1UZ6F 1J9CT 2NXYD 1AXSA 3O3AB 2CJUH 3QNZA 3V7AE 4S1RH 5LGKA 3KJ6L 4PJAF 4P57B 1JGLH 5C0GB 1QRND 3O9WB 4JZOA 1A5FL 3A0OA 1F4WL 5EU4A 5J9PB 1HXYA 2QSCL 2FR4A 3TBVB 3OBAA 5C70A 1YEJL 3GBML 4Z95L 5SWQA 3W82A 5HI4C 5C0DB 3F7VA 3D87B 2FSEB 3TJHC 3LSOB 4R7DB 2G60L 3IJHA 3FQTB 1FC1A 5E1AB 4DQOL 1T66C 5IB1B 1GOHA 3HAEG 5GRUH 1REIA 5F3BA 1CL7H 2XQBH 2R9HD 1J05A 4V1DB 1ZA6B 4PYGA 4MSWB 1X5XA 3EYUH 4KZDL 2X89D 1AJ7L 1KCLA 1LEKA 2EDRA 3T0VA 1TTUA 4M7JL 1KN2H 1QRNA 3FHQA 4ZMAT 3S36X 1G9MH 5E6YA 1JPFA 4R7NB 4FQLL 1II4E 3IT8D 1ZOXA 3MRDA 3JVGC 4KQ4L 3U48A 4N0RA 4R26L 3GSNH 3U4EB 4TOYL 4OUOA 5L6YL 4NM4H 1DLHB 3RWEA 3MV7B 4M5ZH 5FKAB 4KRMB 4K9EL 3B9AA 4QXGH 1HEZA 3CFJA 1ZTXH 1HZHH 5GQBA 3THML 1F11B 1MEXL 2EC9U 2AV7B 1T2QL 3HZKB 5MP6H 3TEUA 5BO1H 2X89A 3ARXA 2YN3A 1J1PH 4G9FD 4YC2B 4RGMB 2R0WH 2C7UA 3B2VH 4OFYD 5JORA 4LLMA 1ZVSA 4XVSH 4ACPA 4U1NB 3BGFC 1LP9F 1C16A 1MCSA 1IZJA 5EO9A 4URTB 4O58L 1MCNA 4HJ0C 4XMPL 4NC1E 4MNGB 2VDKH 3L5HA 5JXAL 3VH8A 1PKQB 3AS0A 1T4KB 5EIIB 2DI9A 4M6NH 5D1ZD 3IDUA 2P8LB 4LKXA 4KTEL 2MPAL 1W72A 2J88H 1IQDA 1TCMA 3EFDH 4G8IA 3OPZL 1T0PB 4ELMA 5E7BA 1SVCP 3GSRA 4P5TD 2ZG2A 4PS4H 4P46B 3WSQH 1UT9A 5I1DB 4G9FA 2NY4C 3UX9B 4G6FD 2BNQD 2PCPA 3VGEA 5GGVL 1QACA 4YBQD 4OFYA 5C2UB 3SQOH 4YDKL 4H88L 5CJ5A 3FO0L 1T20B 4JFZH 2EDEA 5HVHB 5B8CA 5JOFA 4HJGA 3L3OB 3W9DA 5HI3D 2A73B 5EU5A 2F54E 2IH3A 1P2CB 3UPAA 4ZDHB 3GIZH 1FP5A 2YUWA 1EDQA 4PLJC 2XTJE 5D1ZA 1MFCH 5FUCC 3UTSD 4M4PA 3QDJE 4QNPE 3HZVB 1UJ3C 3PHSA 1QFWI 5T33H 3WN5B 2KH2B 4L29B 2VDPH 3I6KB 4R4FL 1NAMB 4RCAA 3WFZA 5E4EB 3I9GL 4KMLB 1TQCC 4P3DB 2YK1L 5HHXL 4J3SA 3RUGE 2Q7YB 4P5TA 3T2NH 4EXKA 2AAVA 4JDZB 1IC7L 1HQ4B 4AL8L 2NY2D 4X0KA 3SE8L 4WW1A 4FFWC 3OL2A 3F6LA 1YEGL 2AERT 2CKBB 5JXED 1Q38A 3LN5B 2Q87A 5GS3A 3PWVB 4U6YA 4X6EA 4WNQA 1ADQA 3I2CL 4LNRB 2V2TA 1JYWA 5TE4L 2PYFA 5J1TC 2C3VB 3RJDA 4MDJB 5KANG 4JFHE 1KLUB 1YNKH 4GRMA 1R6VA 3WJLC 4MAUH 4QY8A 3BZ4B 2EXWD 1DN0A 2BK8A 5CHNB 2Q6WB 5F9WB 4BSJA 1KELH 1YMHA 4KKBC 1JHLH 4UT9L 5ACZB 5JQ6H 2CXKA 2CMRL 1NCDL 3ESVF 1NDGA 2UWEA 4OV5A 4IMLB 1I9EA 1PYWB 5MERB 4QXUL 3DURB 3E6FA 3NACH 3D0LB 1CGSL 5JXEA 3CFIC 1UQSB 4LSVH 3MOBL 4LARL 3R4DA 2RJMA 5ICZA 2BJMH 2RQ8A 1I75A 5A2JH 1PG7H 4IIQA 2G5RA 3QB7C 3CSBA 1WZMA 5ALCH 1GGBH 3DUHA 3GSVB 2P8PA 2AK4D 5IBLC 1B4JL 2SEBB 4X6FB 3MRKA 1O7SA 1QBMH 4PJBB 4JFFD 4BSWB 1BLNB 1MHEA 3GKWL 3QIWB 1BOGA 2CIKA 3GI8H 3VFNA 2NY6D 1PY4A 4ONOA 2X4UB 5J1AB 3MCLL 4U7MA 1CE6A 4RISH 1GL4B 4RGOH 1I1RA 4MNHA 4M62L 1MI5D 3NAAH 4YPJA 1BZ7B 4M7LT 2XY2A 4NKDB 1I7RA 1JPGB 3R8BB 5I73B 1NFKA 4Y89A 1KCRH 2PW1B 5TH2A 3QZWB 4NRXB 2D2OA 5F44A 1XF1A 3O6KH 4HWZB 2NY5H 1PSKL 3DVFA 3MZGB 3R0MA 3MODL 2AK4A 1A6VL 5HGDA 3IKCA 2BFVL 4PJDE 1BWWA 1JIBA 3F7PC 4JFFA 1XF5B 4RFOH 1XCQB 5KW9L 4PJGA 4ERSL 3EHBC 5C2BL 1K85A 4BZ2H 4ZUTB 3DUUA 2I07A 5EC1B 3OR6B 1JPSL 1F5WA 3W0WE 4KUCF 2XT1B 1CD0A 3MRNA 1A7BA 1ND0A 1RIVH 4CRPA 1FBIH 5KSUB 3CCHB 2VABB 1OT1A 4Y1AE 3MA7A 2IPTL 5EBLA 1MI5A 1UH2A 4X7SH 4F2MA 4XXDA 4JHWL 3VW3H 5TQ0H 5IW1A 4A6YA 3FQUB 4XP1L 5IR1B 1IFHH 4UT6L 1BFOA 3O45B 4KDTA 2P49B 4WHCA 2JTDA 3QO0A 2IQAB 1T1XB 1M6OA 3VXME 2NQCA 1JFQH 3M17B 3QIBB 1INQA 1I8IA 4N5UA 5DMYA 2WW8A 4FQ1H 3PXHA 1N4XH 4KJYB 3GSNA 3ARGB 4PRPE 2GITA 1KIRB 2J7LA 3GEWB 3U9PL 1X4XA 3RKDC 1A8JH 4V1DD 1XF3B 3O2WL 3K0WA 2F54B 3FT2B 4DN4L 1NMCC 3T1WA 1OSPL 5C0GA 1BQUA 4RZCB 1F3JB 3JV5A 5J9PA 2F8OA 2XTJB 5ADOH 4QTHB 3FMGL 3TBVA 3QDJB 3RKPA 1E28A 4QTIH 2W9EH 4LAQH 3MQIA 5I1GL 5C0DA 3RUGB 2FSEA 2K7QA 1SYSB 3MV7D 1WZLA 3LSOA 1YEKH 4R7DA 5E1AA 4LVEA 5IB1A 4ZNEE 4K55A 2W38A 4BQBA 2QSQA 1HNGA 4Z5RA 4I3SL 4CU7A 1F2XK 5I74C 1ZHBB 3TT1H 4V1DA 3ULUE 1ZA6A 4MSWA 2DIAA 3N9GH 4MA1B 1HH9B 1KJ2B 1T1YB 2AJVH 4U1MA 4WHYG 4UOJA 2VLRE 4P2RA 3QNXB 4KK5C 4R7NA 3TPUB 4XWOD 5EA0H 4HWEL 7FABH 1EO7A 1XCTB 3VG0L 2LVCA 2VH5L 3I6LD 3U4EA 2AGJH 3C5ZB 4NT6B 1W72L 3KPRD 1DLHA 4CVZB 3BH9B 3MV7A 3Q2CA 3MV01 3P30H 5D8JL 1H5BB 2FH8A 1LDPH 3LN4B 3O11B 4M43L 1MHHB 3F58H 1CGTA 1GPOL 1X5IA 2AV7A 3VFOB 3HZKA 4JVWA 3S35L 2Y6SC 1CDCA 4XVJL 2XG5A 2Y36L 4NO5B 2YPLD 3PL6B 3B2UD 4NDMB 2J5LB 2ZJSH 3WEXB 3MNVB 3D5OF 2ARWA 4HXBH 1KB9K 4IOIB 4UV4H 1MLCB 1YN6B 4XZUB 4MNGA 2C26A 5GPRA 3KPRA 1IAKA 1PKQA 4L8SC 1T4KA 5EIIA 1U3JA 2VE6B 3PIQB 2E5EA 2P8LA 1KENL 5INDB 4XVUC 1IKNC 1OM3H 5T3XE 3CFCL 3BAEL 4DJMA 1OAZL 3OKOA 1LDSA 4NKQB 5I1DA 4G6AD 4GSDL 1ADQL 3PDDA 2YPLA 5BZWB 5GS2D 4XX1G 4CN6A 3RA7L 4WCYL 3L1OH 4NCC2 1EFXB 1QYGL 4PJDB 5AWNL 5GRXG 1T20A 4ODWB 1YA5A 3ZDYE 5LJYH 5HPMB 3L3OA 5F6HI 3OKYA 1PGRB 1FVEB 2A73A 2ZKHL 3LRSB 2WBJC 4AENB 3LEYH 3OB0K 1LVEA 1P2CA 2BDNL 1HE7A 1WWAX 5IOPB 4JPVH 3CVHB 2HN7B 2VNCA 3W0WB 1SJVA 1ZT1B 1KG0A 3WN5A 1P7KB 1V3MA 3G9VA 4L29A 4Y1AB 3VRIA 1NAMA 2ZUSA 4UQ2B 4P3DA 5C0RL 2RB8A 1DUYA 5EIQA 4NQTA 4BQ6A 3MRFB 2Q7YA 3A67H 4JDZA 2QR0A 1HQ4A 2RIKA 2DM4A 5JZ7C 4HWBA 4Q9QH 4W68A 2LTQB 3HI1A 5CD5D 4FNLH 1IGIH 5CZXC 1NSNH 2CKBA 5GSVB 3LN5A 3VXMB 2KBGA 2MNUA 3PWVA 5I18H 4LNRA 3BEWB 1KC5L 1TNNA 2C3VA 4L3AA 3BESR 4WVRA 4MDJA 4J3WA 4PRPB 1KLUA 3IU3A 1RU9H 5CHNA 2Q6WA 3IFLH 1VEMA 2W60B 2IAMC 3MJ7B 4XP4L 1CLYL 4JM4L 2A2QT 4U33A 4I3GA 2LAAA 5ACZA 2XY1A 4KI5C 3T09A 1EV2E 3PJSB 2OS7A 1DEEB 3F65A 3QUMH 2OL3B 4IMLA 5MERA 3DURA 3D0LA 4CU6A 1P4IH 3IDXH 3WDIA 1FAIH 1UQSA 1JGLL 3AREC 3PGFH 4RRPG 2EKSB 2XFXB 3QJHB 2PF6A 4U6TA 3PNWB 3LPGA 2YKLL 1RQ5A 4JN2B 4L8BB 3GSVA 4XB7A 3WIHH 2SEBA 4X6FA 2OJEB 5I9QB 4UOW0 1NC2B 5AG9A 5DFVC 2VDQH 4BSWA 1L7TH 3H9SE 1I1YB 1BLNA 4W4NA 2VLRB 1RUQH 4X4YB 4JFDE 3WIFB 2VDLH 5J1AA 3ARVA 1QTYT 4PJ8B 3SDXE 2VQTA 4CGTA 4A6YL 4LHQB 1JWUB 1VFBA 2ZCHH 4JY4B 4QXTB 3EYUL 1IGJB 1BZ7A 2E6JA 4ZOBA 1JPGA 2PW1A 1KN2L 3QZWA 1G9ML 4NRXA 4XHQA 4U1IB 1GZPB 4HWZA 1NQBA 5CBEA 4DUXA 1A6ZB 4TRPL 4UINL 3EDKA 3GSNL 5C6PB 3QQNA 3HZYA 4YHLH 3BPNC 1FC2D 2EZ0D 4NM4L 1XF5A 1CK0L 4GW5B 4ODHL 1XCQA 5H37H 1MCDA 3HCVB 4FA8A 1TJHH 2DF3A 3ARGD 4PBVC 4UBDD 4MZ2A 3SPVB 4ZUTA 4H8WC 5EC1A 2HFTA 3OR6A 3AMLA 4M4RA 4ZXBB 3DMMC 4XNXL 3O4OC 2F54D 5KSUA 3CCHA 2VABA 4N90E 5I1EL 5I71B 1SVZA 1I3GH 2XTJD 3FQUA 3MCKA 5IR1A 1GXEA 3MRIB 3QDJD 3O45A 1X5YA 3KR3H 4OFDA 15C8L 2XZZA 1FLRH 3HAEB 4POZD 2IQAA 1T1XA 3VWKB 1F42A 1U8NB 5FYKD 3VWJC 4FQXB 2Z4QA 5LBSL 1WIUA 5DQ9B 2VDKL 4O9HH 3CFBA 4KJYA 1DL7L 4M6NL 3ARGA 3ZTNH 2OQJA 3E1F1 1KIRA 2J88L 3RGVB 5BJTA 4G3YL 2VXVH 3EFDL 2YOCA 1RJYB 1XF3A 3QHTC 5FB8B 2F54A 3FT2A 4S1SH 3WMSA 1NH6A 4PS4L 3WSQL 1VPOH 3ZKNC 1T3FB 2CRIA 4JFHD 5E2VH 4RZCA 1F3JA 3EO9L 3BYTA 4YFLI 4NCDA 3ULVC 1IJ9A 5DRWB 4MD0B 4QTHA 5FHAH 1UC6A 4LRNL 3QDJA 1WV7T 4M5YH 1B6DA 1K4CA 5FYKU 5E4IA 1RK1A 2PTTB 3C5ZD 5HDQH 2B39A 4QF1A 1Q1JL 1NGPL 3RUGA 4H26B 4K3HA 1SYSA 4JREB 3KJ4B 2CRZA 3WFBL 1SM3L 1UYWL 4GAGL 1N64H 2X40A 1TVHB 1P84J 5BW7C 3OF6D 4DAGH 5EU3A 1UENA 1IAIH 1A7RH 4DW2H 4Y2DB 4YHNB 1ZHBA 1OGTB 5T3XH 3IDYB 1YY9D 2XG4A 3T2NL 1HH9A 1KJ2A 2AJXH 5GJTH 3QNXA 2UWEF 3IF1B 1N6QH 4NN6C 3TPUA 2EDXA 1LO2L 5DEZA 4KKLC 1HK6A 5TGBB 1XCTA 4NBXB 4OGYL 4DGVH 1QD0A 3C5ZA 3ARFC 5DJDB 4LRIC 5F89B 1FFQA 4AEHL 4CVZA 3BH9A 3SKJL 3RU8H 1EHAA 4HWUA 5L2JB 1ZHLB 3UMTA 3RAJH 1S7QB 4GRWF 1H5BA 4EQ3A 3OF6A 3LN4A 3J8F7 3O11A 3VD3A 3V6ZB 1JHLL 3VFOA 2VL4A 2D7PA 4JDTH 1INEL 4G7YH 4AZ8A 4NO5A 1FFPB 3SE4C 4FXGB 1RUPH 3WEXA 1EFXD 3MNVA 4DVRH 4U1GC 3RIAK 3SJVE 4RQQB 5HSFA 2P5WE 3H9SB 3PWJB 3LKNB 3V0VB 5DHVH 1MLCA 4PJHF 1PG7L 4XZUA 4JFDB 4OCSH 1F00I 5CGYC 1AR2A 1NAML 2UZIH 2VE6A 3A6CL 3PIQA 3W0WD 5H2BB 3SDXB 1S5IH 2WBWB 5INDA 2VTFA 5E8DH 1HCFX 3IDMB 1QBML 3KPSE 5IUSA 4Y1AD 5L8KB 4HWBL 4WW2B 1OAXH 1QNZH 4AM0B 3KDMB 4HIXL 2CKBL 1HINL 2FBJL 4CADB 3FRPG 3TCLA 1UA6L 5I1IL 4NP4L 5BZWA 5L2KE 4RGOL 3D0VA 3VXMD 1CDIA 4KK9D 4FABL 1EFXA 4PJDA 4ODWA 2R2BA 4KAQL 5HPMA 3UO1H 4XBPB 5KBNC 1FVEA 1PD6A 2YD5A 3LRSA 3PGDB 5DRZB 4AENA 1KCRL 2P24B 1K8IA 4PRPD 4G8GE 3BW9B 4LPWA 3ZE0F 3U2SA 5IOPA 2F9BT 2HN7A 5IHUL 3W0WA 4LLAA 5CJOH 5T3ZH 1P7KA 4Y1AA 2EC9T 4UQ2A 2F53E 4RFOL 5F7UA 1U8JB 3TBYB 2QEJA 3MLSH 3MRFA 1P6AB 4LSRL 1S7XB 2RGSA 3TO2B 1U3HB 1HWGB 2IBZY 4U7KA 4JPKH 3VXMA 3EOTH 4Q97A 2NY0B 2DBLL 1PG7X 2R0KH 3BEWA 5K9OB 4PJ9D 4QYOB 4OFKA 3MLYH 2H2PC 1IAOA 4ORGB 4PRPA 3X3GH 2Y5TA 2RCSH 5D6CB 3TJEH 4KQ3H 4PP1D 4LF3B 2YPKB 4OB5H 3ULUD 5T5NF 3IETB 4AT6B 1A9BB 1NC2D 2W60A 4PR5A 4JKKA 1FVDB 1BBDL 2VLRD 4E0RA 5J3HC 3LQZB 1N4XL 1FO0B 3PJSA 4PGBB 1JZ3A 1DEEA 1Q0YH 4OLUH 2CLRA 3RGHA 4PJ8D 4DCQB 5LWYH 4GW4B 2OL3A 4EUPB 5CUSH 5D6DA 4X5LA 4YLQT 3ZHKA 1IT9L 4R9HA 1UWGL 3RX7A 3NTCH 4UILL 1Q0XH 5IF0B 3A6BH 4PJ9A 4ZNEA 1IGCL 2XFXA 3QJHA 3V4VL 5D7SL 3PNWA 3QHZH 5D96B 5ADOL 1M7IB 1MCJA 4JN2A 5HI4D 5IJVB 4L8BA 4OKDA 4YZFF 5CJXA 3WE6B 1NEUA 5AUMB 5L9DH 3GM8A 5CINL 1T66D 4PYHA 4I48B 3QAZC 4XP9L 4Y4KC 1NC2A 1X6NA 2Y06H 1I1YA 3EOAB 3PP3H 1YEKL 5HJ3B 3KAAA 3QCUH 2VLRA 1FZJB 3OR7B 1DLFH 1WBYB 4DUWA 3WIFA 3ARPA 5DC4B 1FV1B 3Q1SL 4PJ8A 2R69H 4ZXBD 4DGYH 5JO5A 1JWUA 5IT2H 1HIML 4JY4A 4N8PA 4QXTA 3FRUB 1IGJA 1F8TH 4QRPE 4Q6IC 2C3GA 5F9OL 1GIGH 3BKJL 1AH1A 4IOSD 3ABZA 1GZPA 4O4YL 5DFTA 3BXNB 5DD3H 5T3XD 5C9KA 5EA0L 1OSZB 7FABL 5ALBH 4WEMB 1A6ZA 3RWFA 3VWKD 4FQXD 4WWKC 5EC2B 4NOBA 1RZIB 2D03H 3WNOA 4GW5A 4EZMA 3HCVA 43CAA 4KK6C 1T22B 3BKML 2VKWA 4PJ5E 3SPVA 2DD8H 1HCVA 3SJVB 1A7NL 3BRFA 3F58L 4ZXBA 1UWEL 4MA7L 3AU1B 3BZEA 2Q8BL 2BY2A 2HMID 1MQKL 3MLWL 2LFGA 4GKNB 4Q9BA 3V6OC 1N7MH 1G9NC 3MRIA 4HJ0D 1FH5L 1ONQA 2Y25A 3VRJA 5ID1B 4EI5B 3T3PF 3ARBC 4F33A 4CL7A 3KPSB 1LGVA 2FHCA 3GUTB 1R3LB 4MA8L 5HYIA 1U8QB 2G9HB 4FQXA 3MGTB 5DQ9A 5JHLH 1KN4H 1EERB 5JMRA 1CFSB 1LD9B 3G04B 5L2KB 3LKSA 2VN4A 1KJ2L 1J5OL 1DCLA 4Y2DD 5LGHH 1RJYA 5AYUH 3MBEB 4QOKE 5CCKH 2M8XA 1GGTA 4G8GB 2PR4H 2HYMA 1O5DT 4RAUB 3NH7H 2RHEA 1K2DB 5DJ2B 5DRWA 4MD0A 3AROA 1F58H 3L1OL 1ZE3C 4OGXL 2VZ3A 4GG6B 2PTTA 2BCKB 2F53B 3D18B 3LEYL 4H26A 3GSWB 1GC1C 1I1AB 4LPTA 4WI6A 4RSVA 4LPXA 1JI2A 3KWWB 5MEOB 5GISH 3P9MB 3HG1E 2VSDA 1TVHA 4M03A 1BGXL 2W9DH 4KGJA 1HHHB 1QFPA 2D4DA 5C6TL 5H37G 3KPMB 3DYOA 3QEGH 5DVMA 5TDNB 1UCTA 1F90H 3SDCB 1OGTA 4XGZB 1T7WA 5SX5H 3GJEB 3VFGH 5KSAB 1U93B 5TE7L 3A67L 2Y9RT 3CNKA 4J3OC 4D3CH 1HOCA 5AAWA 1CS6A 3IF1A 1M71B 1U8KB 4FNLL 2R2EB 4ZUVA 5TGBA 3ARDC 3H9SD 3KPQB 3U46B 4JKPH 3TLRA 5F7NC 3BN9C 1EO5A 1BEYL 4Z7VF 4JFDD 5DJDA 3ZL4L 2ATKB 5F89A 4UTAH 5KTEH 3U0PB 4KROC 4GRLC 5I17A 1ZHLA 4KKBD 1P9MA 4M7KH 3MUGA 4YGVA 1RU9L 3C6SB 4PJBF 5EIVA 6CGTA 2EH7L 4MQXD 3HFMH 5EO0B 1ZS8B 4L9DA 5H35A 1YYLH 3V6ZA 4JRXB 3S37H 2FHFA 2Z35B 1FFPA 1N8ZB 3RNKA 5KAQF 4OI7A 4FXGA 2ORBH 5DK3A 2BOCB 2DQCL 1C08B 1VEPA 3VFVB 4EIZC 4RQQA 5BS0E 3H9SA 3WD5L 4WDIB 1BWMA 3LKNA 3C5SB 4JFDA 3WJJA 4GXVH 3TBWA 4FQ2H 3QWOA 1T83A 3AGVA 3UJTL 5H2BA 3SDXA 2DIJA 5KOVC 3IDMA 3LQAL 4N90D 4XNZB 2RFXB 4QRPB 4RGNB 4WW2A 4YJZL 2VDQL 2EO9A 4X9GA 3O81A 4AM0A 1FZMB 5C1MB 4U1JB 3TFKC 4CADA 4D9LL 3QXDB 1T80A 1DE4B 1KCSL 1DBAH 3O3UN 1I9RH 1I85C 3IAQA 3L3IB 4JANB 1DQML 1NGQH 5TF0A 2D3VA 2NY0D 1D5IH 1RIUL 2JK5B 1UFUA 5GS1C 4XBPA 3GO1L 1PZ5B 5DRZA 1U0QA 2P24A 2QQKH 1WIPA 1ZGLM 4QO1A 5ICYB 5D93B 4OZHE 3BW9A 3GIVB 5DRXB 3DECA 4AEEA 4OCRH 3BGMA 1L7IL 4YHLL 2VXSH 4DTGH 2EH8H 2OL3L 3EZ8A 2DQEH 3T0EC 3TBYA 2YMXL 3LS5H 1S7XA 3PP4H 3QPQD 4LLVB 3TO2A 3V2AR 1EZVY 1G7PB 5E5MB 3V52H 5DJYB 1YJDL 5J56B 5C0FA 5F6IC 4ETQB 5KG9B 3QUKB 6FABH 2APXA 3CLEL 5K9OA 1UCBH 1CBVH 1C5CL 3S9DB 3DYPA 3ULUL 4QYOA 4ORGA 3KG5A 1H15B 3C9NB 2O26U 3FCTB 1S9YB 1OP9A 1YC8A 4P3CH 4LF3A 1FLRL 2QHLA 2O5YH 1OAYH 2YPKA 3IETA 4AT6A 1A9BA 2FX7L 2CR6A 1RJCA 4MCYA 3RUGF 5DUML 5IWLC 1RVFH 4E9LA 1FVDA 4Y8DC 4W6WB 2VUOA 3LQZA 1FO0A 3S5LG 3SEPA 1T5XB 4PGBA 4WV1B 2EDKA 2HLFC 4AK1A 4DCQA 4GW4A 3KPOA 4Z9KB 5B21A 4Z7WF 1E4WL 4EUPA 1ZLSH 2YN5A 5KN5A 5KSVB 3IKKA 3NFNB 4N0CC 3CPLB 4HWNA 1VPOL 5IF0A 4BSVB 3H42L 4HPYH 4I13B 4P4KB 2R2CA 3HG1B 3CDGB 5IMMB 4N1EA 3DBXB 3PP3K 1M7IA 3L95B 5FHAL 5FDYA 4S11A 5IJVA 1JTOA 1T2JA 4OCWL 4M5YL 1MCEA 4G6JH 5AUMA 3WE6A 4LPCA 3CUPB 4G6KL 4I48A 1WISA 3W5MA 3DVNB 3EOAA 5E8NA 1RI8A 3LKOB 1I9IH 3BT2H 4UT7H 5D7JC 5HJ3A 3ZE2E 1FZJA 2YD3A 3OR7A 1OP3K 5GXBB 1WBYA 1FV1A 4DAGL 3SJVD 4TNWK 3LEXB 4EN3C 1A4KB 2P5WD 1WZ1H 1G84A 1OTSC 1IAIL 2AW2A 5DJCB 2WUBH 3L5XL 4YDIH 3TP4A 2X09A 4KK5D 3RWIB 3FRUA 2WIIB 5T3XL 2MMXA 5E08H 1SEBB 1UM5H 5GGSY 3BXNA 1N6QL 1RZ8B 4FQCH 5KOMC 3KPSD 4H8WH 1UZ8B 1OSZA 4PJIE 4RAVB 4KVCH 4DGVL 2F15A 5EC2A 1RZIA 4F80A 3O3EB 4FP8H 5C6WH 2VL5B 1CXLA 2B1AH 1CDGA 5L2KD 2FIKA 1T22A 4XMLH 1E4KC 2EDLA 5TFSH 3SJVA 1OD9A 3U0WL 5BS0B 3DI3B 2P5WA 1EGJA 5MEQA 1UXWB 2NXZB 4YHZH 4G8GD 1AO7E 3BMVA 4K94C 1CTOA 2E7BA 4G7YL 4GKNA 5HI5D 1X7QB 3VRLF 5F7YC 5GJSL 1RUPL 4YFLF 1I8LC 4L5FH 2FZ3A 3KPSA 1WZKA 2F53D 4R90L 3GUTA 1R3LA 4IDJL 5AYQA 1KJVB 3F12B 3DGGB 5EOCL 1OAQL 4KFZC 3QCTL 4X5WA 1I1AD 1OT2A 3MGTA 5IKCB 2Q3AA 1A6WL 2UZIL 3ARRA 2ZOLB 3SY0A 2C9AA 1CFSA 3ULVH 1LD9A 1LO4L 3G04A 1S5IL 5L2KA 4TULH 3LH2L 4MB4A 4JO3H 5FYLE 3WNLA 1FN4A 3SDCD 3FOMB 2CR3A 3E6HB 2ZSWB 1OF2B 1E6OL 1N2RB 3HNSH 2EEAA 4G8GA 4LGSB 1X5GA 1PX4A 4RX4D 4RAUA 1P53A 1K2DA 4XPHL 1X5LA 4WUKH 3FOLB 4KDVA 3LOWA 3QRGL 3RNQB 4HDIB 2BCKA 2F53A 4M48H 4E42B 4L8SA 3T77A 3V6OE 1V8HA 5GRYA 2ICCA 3GSWA 1I1AA 1A6PA 1NANI 3KWWA 5MEOA 3OX8A 3P9MA 1HHHA 1NUNB 5CJOL 2R2HA 2NZIA 4PP2B 2FYYB 1CFVL 4JRXD 3SDCA 3QIUC 4W6YB 4XGZA 5E2TL 1ZEAH 1IC5H 1RIHH 3GJEA 3QULB 1U93A 1QBAA 1PX3A 4HK3J 2OJZL 1DJSA 4OZIE 5GRJL 3VXRE 1M71A 3B3IB 1U8KA 3MLZL 2UZYB 4RX4A 1RMFH 1BF8A 2P5EE 2R2EA 4I77L 1J0ZA 3F5WB 1WBXB 3KPQA 4WO4B 5DK2B 4F58L 3U46A 3BPOB 1TITA 4BFIA 3MV8B 1GJIA 3U0PA 1NLDL 4G7VL 4EVNB 3S6CA 2GT9B 3T2PA 3FO9B 3TJEL 1T0MB 4DKFH 1HXMB 2APTA 5DD6B 4OB5L 4ZPTB 3C6SA 2R4SH 2XWTB 2X4PA 4QRPD 1ZS8A 1N59B 3VFUB 5J11C 2OK0H 4JRXA 1KTLB 1W8OA 2Z35A 1D3CA 3QG6B 4UNTA 1N8ZA 2XKNB 1CR9L 4YXKL 3TIDB 5TQ2H 2BOCA 3ZDZE 1C08A 3VFVA 2WUCL 3ORJA 3C5SA 1Q0XL 3DPBA 1TFHA 3A6BL 4Y5XC 4PJ5D 5DK0B 1AIFB 3REWB 2FH6A 4YGAB 4PRNB 1JE6A 4UAOC 3MRQB 1NGWB 4AJ0A 1P5VA 2RFXA 4QRPA 4IJ3B 4JQXC 4OZ4B 3S7GA 1FZMA 5T1KB 1CIDA 3VXPB 1DLFL 4FQIL 1F4AA 1DE4A 5DFWH 5JOPE 1WAAE 5EZOH 5T1DL 3L3IA 4YEFA 4JANA 5CEXA 5IT2L 1C8PA 4KKCC 1ZLWH 2A1WH 2JK5A 4TSCH 1F8TL 1KJ3H 1PZ5A 5EU7C 4YK4B 5DRNB 5SV4A 3FQNB 1TJIL 1SJHA 3BEVB 3OKLB 3QXUA 3GIVA 4PJ5A 3N1MC 2QADB 5DRXA 4XPAH 3WUZA 1DVFB 1FO0L 3IVKA 1A3QA 1JF1A 3DSFL 4QOKD 5AZEH 4N9GB 3BZDA 4ALAH 2R0LL 2R29L 2O5XL 4TNVK 1MF2H 1HHKB 5D7LE 2DD8L 4LLVA 1G7PA 1B88A 3ZDYF 5DJYA 3VD4A 4G6MH 4I0PB 2XICA 5ID0B 1JPTL 4ETQA 5KG9A 5FGBA 3QUKA 2Q7NA 1CDHA 1KPUB 1I3VA 3HE6B 3RIFK 5B39A 1AQKL 5L0QC 1RFDH 4P4KD 1FG2B 4D0BA 5SWZE 3HG1D 4ZD3H 5IQ7H 4NQVB 5J13C 3QI9B 4OZGE 1CN4A 1H15A 3C9NA 4OD2B 3FCTA 2A38A 1S9YA 3P40A 5BVJA 4JPIA 2GTWA 1M7DB 2CDFB 2YUVA 3EYFA 2NY7H 4QOKA 3K8MA 4ONFH 5JHLL 2H1PH 1KN4L 5DI8A 3CK0H 4IRSB 1C7SA 1T5XA 5JIPA 4WV1A 2C3XA 4QLRA 1GAFL 1FNHA 1X5FA 3HZMB 4JHBA 3ZKND 2F5AL 1VADB 3ZO0A 5KSVA 1TDQA 2HT3C 4XCCH 3CPLA 5LCVH 3CZFB 3WYRA 4BSVA 4P4KA 2W0FB 3HG1A 3CDGA 4JPWH 3EIFA 3SHSA 3DBXA 1A6UH 3L95A 4I0KA 3HC3L 4LHJB 4LFHG 3V0WH 3LB6C 1CQYA 2EEDA 4JZJB 2RAMA 3CUPA 4XP5L 4Y4FB 2PTVA 3TT3H 4ZPVB 3DVNA 3UDWC 4M6MH 3LKOA 1EGJL 3B4NA 2FD6H 3WL9B 1MVUB 3E2HB 4KK8D 2DKUA 2P5EB 4NWUL 4OQTA 5BS0D 1A4KA 1OWWA 5DJCA 5GRVK 4DUVA 3MO1B 2WM0A 2NXZD 1QHOA 3RWIA 5FYLH 2WIIA 3SKOB 3C5JB 3OAYH 9CGTA 1FSKC 1SEBA 1NGZA 3HE7B 3N06B 4U1HA 2D0FA 3D2UD 1YECL 4DN3L 5HYSG 3B9VA 1ITBB 3K2UL 5EWIH 2Z31C 4HZAA 1FNLA 3SQBA 4JKPL 1OQXA 1RUKH 3UXFA 3O3EA 2VL5A 1X5HA 4QRUB 1U8OA 4UTAL 3SDXF 1JF5A 1G9NH 1ERNA 4LDEB 4WW2F 5BS0A 3HFML 5CAYB 5CEZE 3OKDB 4KMTH 4A2MA 5C0JA 4BQ8A 1UXWA 3S34L 3L7EB 3P0YH 3S37L 4XBGA 4M1DH 5I8KL 4U3HA 1X7QA 3VJ6B 4LHUG 1TVDA 3D2UA 3QUYC 5FUOL 5E99L 3CXDH 2DMKA 4HKXB 3F12A 3DGGA 2VUYA 4LVOC 3BUYB 3CFDB 5IKCA 2FECI 5ECJE 3H8NA 3N1QC 2Z9TA 2H32B 3BHBB 4Y5VC 3ARWA 2P42B 3TV3L 1OCWL 4WFHE 1ZGLB 4NJAL 1NL0L 5CBAB 3FOMA 3E6HA 2ZSWA 5FGRA 1P4BH 1OF2A 3EO0A 3ROOB 3ZKMD 4JRYE 1N2RA 5CILH 4K9EC 1GC1H 4U0RC 4OZHA 5HBBA 25C8L 4LOUD 5FM5M 1WCBB 3LIZL 4TSAH 1I9RL 1UM4H 2W65A 3FOLA 2YZ1A 1KUMA 2HTKC 3RNQA 1B2WL 4JO1H 4WO4D 4NOFA 5D1XC 3ZTJH 2O5ZL 3UTZB 2DDQH 1D5XA 1X9QA 4GAYB 3JV6B 1F97A 4OIIL 5A16A 2YPVH 1KBGH 3SCMC 4DKDC 4HJJH 4WHTB 1RSFA 2P44B 3MJ6A 1CFQB 1BF2A 2VXSL 4ZTOH 4DTGL 3S37X 3Q6FB 5C71A 3T65B 4U6XB 2E9BA 3LS5L 1IGYB 4F3FA 4JFEB 4OZGB 2GIYA 4ESKA 3AVEA 1G9EA 3TNMB 4KKAC 3V52L 3B3IA 3MRGB 4ZTPL 4NRZB 2I9TB 2W9LA 2VLME 1WBXA 1LMKA 4WO4A 5DK2A 3TIEA 3Q5TA 3K8LA 5CGMA 1T1ZB 3SKUD 1CBVL 3LKPB 5GGTH 2R1WB 3JWNC 4JY5H 2GT9A 1KB5H 3FO9A 1T0MA 1HXMA 4HMCA 5DD6A 4HLJA 1S5HB 5IROC 4KXZI 1K8DA 2XWTA 3S96B 2OR8A 2NYYC 5T1KD 1RVFL 1N59A 3VFUA 3GMPA 3MOAL 1EHLL 3PQYB 1KTLA 3GGWB 4NHCL 2P47B 2IF7A 5ESAB 5KVGH 1UZ6E 3UAJD 3RWJA 3TIDA 2DWDB 4EBQL 4ISVB 2CO6B 3NPSC 3SE3C 1XH3A 1A14H 1CXEA 2CK0L 3NCMA 5HVWA 2VZTA 1FL5A 4ZAKC 5DS8A 5DK0A 4AIZB 4R97B 4F9LA 1AIFA 2QADD 3REWA 1AXTH 1DVFD 1KNOA 4PRNA 3MRQA 1NGWA 1WEJH 4J4PD 2DLEA 1LNUB 3I6GB 3TZVC 1QUNA 4HQQL 4NCC1 3O8XC 1AO7D 1MWAB 4HKJA 4OZ4A 1R0AL 5T1KA 4KY1H 2HFFB 3BT2L 4UT7L 3LHPH 4AEFA 4HS8H 3VXPA 4YHML 4K71C 4LVHB 3P9LB 3VXUE 2H6PB 4PJIA 5BRZB 3IB4A 4WTZA 1A7PL 4I0PD 4CN4A 3CSYA 1WZ1L 4F8TA 5IV2A 3V0AC 2R15A 3MYZA 4GXUN 4I2XB 3DRTA 5IBUG 3FFDB 5DRNA 3QI9D 4Z18A 5ITBH 2JIXB 4X9IA 3BEVA 5K9QI 1S7UB 5FYLD 5GRVL 2LABA 4H8WL 1DVFA 2D7MA 5F96H 4J4PA 1Z9OA 5J6HB 1MJ7H 4B7LA 2M26A 4N9GA 4NM8L 1AO7A 3HNVH 3L9RB 2B1AL 4P59H 4N0FB 4N9OB 4P99A 3TF7C 5E8EB 3QYCA 4XMLL 4AEIH 5GRZA 3BX7C 4I0PA 2BERA 5ID0A 4HX1B 3RWDB 2ZG1A 5JPMB 5ISZE 4J23A 5IESH 5LXGH 3ETBF 2OTUB 1KPUA 5F71A 5E95B 3RHWK 3LQMA 4NQVA 4NZDA 2VZ1A 4OD2A 3SGDI 5DD1L 3BFOA 2XWBA 4ZOEA 2HWZH 4QKXB 4Y4FD 4GG6F 1LP9E 5F6HJ 1JK8B 1M7DA 2CDFA 1GGYA 4JRYB 3LMJH 4OQTL 4Y16C 3JV0A 4LSPH 3UCRA 4YNYB 3VXRD 1AD0B 4NKOA 4X6CF 2P5ED 4RMUA 4NUGH 1RZJC 4JO3L 1EK3A 1VADA 5HHPB 1NBVL 5EUOE 5AAMA 4TQEL 3WS6A 5H94B 3BIBX 3QDME 2HVJB 2EE6A 4X7TB 4QHNB 3BRGC 3JBG7 3BN3B 4J6RL 5FFLA 1W0YT 4ETYA 1D9KB 2VYRE 3CZFA 3I3DA 1PLGH 3DV4B 2W0FA 3WHXB 4C58B 1H8OA 5DQJB 5CP3H 3RL2B 5I75B 3ZT7A 4WUKL 3SGEH 1G6RH 4Y4FA 4DEPC 4EQ2A 3F7YB 5KZCB 3V79C 2XNAB 2YEZB 2DL2A 4HD9A 3WL9A 1MVUA 3PABB 3VXRA 3MR9B 3H9YA 1U3ZA 2P5EA 3OAYK 4KV5F 5C0ND 3MYJB 3MO1A 1S7SB 2NXYC 2EXYD 1W2KT 1H3PH 2C1PB 3ARQA 5DYOB 1DUZA 3SKOA 3C5JA 4WI4A 3EFFB 5DXWA 4ZO7A 1ZXQA 1CIUA 5F72S 2DLTA 4UTBH 1DQDH 2V2WB 5HY9B 2EYSB 4K94H 5JOPD 2FLBT 1FZOA 4Z6AT 4AMKH 4PRBB 5CZKA 5FUZH 1URLA 3L7EA 2OK0L 4R0LB 3BPCB 4LDLB 3E8UH 4NKMA 2NCMA 2XZAL 4IMKA 2ID5A 3NN8B 3H9HA 3C2AH 3VJ6A 1IARB 5JW4N 4I3RL 4WY7H 2XKUA 5IEKB 4HKXA 5HHVH 4WHDA 5FCSH 1FNAA 2PNDA 3BUYA 3CFDA 2BVTA 3S4SG 3OKEB 3CAFA 2XA8H 1INDH 3WLWC 1WAAA 1H3XA 1V3LA 1CFTB 2H32A 3BHBA 3FAXA 3IJYB 4MB3A 1ZGLA 5CEYB 4PRAA 5CBAA 5SWZD 1FAKT 2EDNA 4LSSH 4X80H 3TGXA 1G7LA 3LEVL 3MROB 2P46B 3RWGB 4C55A 1U92B 3SO5A 4UNVA 1WCBA 2HKHL 2Z8SA 5DUPH 2XQYK 3MRJB 5EZLB 5JW3L 3UBXB 5F7EL 4OF7A 5F1NB 3BIAX 3MA9H 1IBGL 2A1WL 4TSCL 4LCIH 5KJRH 1KJ3L 1HSBB 1N5YH 4H1LH 5B8CC 4W4OA 5I2IA 2H41A 4L8DB 3TA3B 1UH4A 2OI9B 4WFGE 1NCWL 4TUKL 4EDXB 3IGAB 2VXUH 3BO8B 1T6WA 4J8RB 4GAYA 1GGCH 3H7LA 4TUJB 5D1ZC 5ISZB 4WHTA 3T4AB 5FEBA 1CFQA 4D0DA 5KVDL 3Q6FA 3PQYD 5SWZA 1AFVL 5I1JL 4JR9L 2JJWA 3T65A 3WFHA 3GB7A 1SY6H 4U6XA 1IGYA 4OZGA 1QEWB 1T03H 3TNMA 1F4XH 2IPUK 2AEPH 1JBJA 2OR9H 1X3DA 4NRZA 2I9TA 5I1AA 4YBQC 1DQJB 4QRRE 1T1ZA 3LKPA 5LG1A 2R1WA 5HI3C 3GSQB 4UIKH 1ZVHA 1MCHA 3RFZC 1S3KH 1MFEL 2PYEE 5EUOB 2N1KA 1S5HA 3HB3C 3QDMB 1A2YB 5EUKB 3IXTA 1MRFL 5C07B 3S96A 3IFOA 1FIGL 2YA2A 3PQYA 2DQUH 3GGWA 3QUZB 5BVPH 3BD4A 5ESAA 5BRZD 2UYLB 5IK3B 3RI5K 4ISVA 1ZAGA 1YEEL 1P4LB 2XKSA 5DT1H 1EA9C 2A0LD 2NY2C 3G08B 2BXYA 4XCCL 5JDSB 5JXEC 5LCVL 1X4ZA 3RJQB 3FL7A 2JIXD 5FGCE 1NKOA 4AIZA 5ESQB 1RJLB 1ED3B 2AK1H 2R56H 4PLKD 1CG9B 5CEZD 5IWLA 1LNUA 3I6GA 4YHOH 5D7JD 3WFEH 3G6AB 3BDBA 1O7VA 3PWPE 5IVOA 4P2QE 4JHAH 4FRWA 3TT3L 3C8HA 4TVPH 4MD5B 4EN3D 4M6ML 3HMWH 2HFFA 3G6JB 4OI9A 3P9LA 2WWKO 3V8OA 2H6PA 5BRZA 3TN0B 1TIUA 1U9KA 2BSED 1LEIB 3AFLA 1BREA 4EIGB 3WBDA 5FYLL 3LS4H