5FYJE

Crystal structure at 3.4 a resolution of fully glycosylated hiv-1 clade g x1193.c1 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
213
structure length
213
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords GP41 ENV ECTODOMAIN
total genus 34
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjE02
2P8LA 1XMWA 4KI5E 4XGZB 3CDGB 4X0KA 2DQUL 3VXRD 4AEFA 1IBGL 5BZDA 4HCRA 3D69A 1QR1B 2V5TA 2DB8A 1OW0C 3H3BC 4YAQA 3QCVH 1OSPL 5BVPH 1CXHA 2FECL 5JW5A 4IMKA 3AFLA 4PJGA 5JQ6L 4WCYL 5CEZH 1CFQB 4XWGL 5JOPD 3UZVB 4HHAA 2P44B 4KK8D 3SDCA 3SGKC 1A6AA 1NGPL 3MFFA 1HI6B 4RGOH 5CSBA 2Y7QA 4BH7B 5ESAB 2ARJB 1WQVT 4FXLA 1UXSB 3OKNA 1A9EA 2NY3B 5CEXA 5KS9F 3B2VL 3FFDA 4NZTL 2YEZA 3I6KA 4JRYB 1CBVH 2NR6D 4CVXB 1CQKA 4NQED 3MA7B 4WI8A 3WLBB 4I5BB 3JVGC 5IWLA 1DJSA 2VQ1B 2G75B 4PIRF 4FQHA 3ZDXF 3UO1H 3GJEA 1JGEB 1KNOA 3IAQA 3K7UA 4MXWL 5EPMB 5L88L 3ARGB 3LHPL 2QL1A 1B4JH 4GS7C 5D96C 1G7HB 1GPOH 1AGBA 2I26N 2W0LA 1DQJB 3CFBB 5F6HJ 5FV2A 4MXWH 3NCYP 4LQFL 1DVFC 5ISZA 2R69L 3QXDA 2ICCA 1CFNB 1A6TA 4PS4H 2QQNL 4ODXA 5ISZD 3QFDA 4NDMB 2Z35B 3GB7A 3QQNA 2DQJL 3RKPA 1RJYB 1CD1A 5E1AA 1TJHH 4ZAKA 1Z5LB 5HPOA 2ZOKB 3HUJB 3WLWD 5IHZB 3F7RA 2AXFB 2UZYB 1TJHL 1X5XA 3QXAB 3LN4B 1ZLUK 3TA3D 4MQXC 3CZFB 1A6UH 3GIZH 1NBVL 4M1GL 1F3RB 1BIIA 4X7DC 4ELMB 4Y0GA 5C0BD 1QSFB 1IFHL 4ODWA 4JO4H 4R90L 4OCWH 5D8JL 5FUOL 2RCSH 1T22A 3NH7L 4QYOA 3TWCL 4IRSA 4BZ2L 3RWFA 5AAWA 3UTSB 5CFHA 3FZUD 1ZHLA 2BC4B 1UB5B 5DURD 1HXYB 3DROA 3SQBA 1SJHB 3MSPA 4RFNB 4PRPD 4LASH 4YHMH 4CKVX 2Q3AA 5JHDB 1MI5D 3PWPB 4X7TB 5JIKA 5FA3B 1U3HC 3LEXA 4S1QH 3HAEA 3VXRA 3LH2L 4OQTH 3IU4H 1ZA6A 1UJ3C 2YC1A 2D4FA 5DRXB 5ENWB 1DUZA 1G9MC 1J1OL 4GQ9H 3FQUB 4E42B 2F74A 5SWZE 4NQCE 4U0RC 1QVOB 3O0RH 4LMQE 3KS0H 3QWOA 4NO0B 5DMIL 4OF0A 1TZIB 1GOFA 1A1OB 4PGJA 4UIKL 4WY7L 5C07E 4YFEA 3MBEB 1QOKA 3ZKSD 2YZ1A 1Q9WB 1WAAA 4H26B 5A16B 3ARBB 2NZIA 1U2CA 3VFMB 4ZXBD 2ICES 1J8HB 1JV5A 4BJLA 3ARGD 4FQPA 4XCEA 1A9BA 2BP3A 4WDIA 3P73B 1W8NA 2G5BB 3RUGB 2I9LA 4NFBA 4I3SL 3HRZB 1L7TH 5DJ8A 1JGVH 3BP4B 1WZMA 2YWZA 1S7WA 5L9DH 4MB4A 2ZPKL 2W60B 3KYKL 4Y88A 5I9QB 3ZE0E 5E9DB 4IRSB 3ESUF 1YEGH 1JPSL 3L7EA 1U8QA 2M1KA 3I6GA 4UB0H 4B53A 4ZUUB 4P5KA 4XP6L 4J3VA 4N8VB 1N59B 4NT6A 3RVVC 1CLZL 1PX4A 3QUYA 5HGDA 3KYNB 2EEBA 4NQEA 1T5XA 3MLXH 4XT1C 3AREC 1IC7H 2X89D 1S7TA 3TBSA 2L7UA 1RAMA 3L5IA 5HHME 3PDGA 5E5RB 1W0WB 5DEGB 3T8XA 1HINH 2DQEL 3OB0H 1U91B 4L3ED 3BSZL 1VHPA 2ICWA 4P3WA 5I8OL 3FCTA 4JFZL 1BF8A 5ADOL 4XC3L 4G8FB 4U6YA 1JF1A 2XZCH 4D9RD 4IJ3B 4MB5A 5F7KC 1MH5B 1IC5L 2VLJA 4R4NC 3DVFA 3VH8A 4L4TD 3W9DA 3PABA 1QLFB 2ITDA 3BGFB 4P23C 2HT2D 5KAQF 2ICWI 4JCLA 2JJUA 3MLTA 1W0WA 4P46D 3WL9B 1YNTB 1CIUA 4HMCA 3X12B 5DVNA 1JGEA 4UILH 1MAML 1VACB 3MV01 3ARDB 1CT8A 3MJ9A 2AI0L 3BISA 3IVKA 3NCJH 4HEPG 5D2LE 1MH5A 5D7IE 2GJJA 3VG0H 4G80B 1WFNA 1MEXH 2X7LA 3I6LE 4R4FL 3UYRH 3NZHH 5HHOD 1F4WL 2QEJA 5DJ2B 3IGAA 3SHSA 5E5UB 4RAUA 1R5IA 3EJJX 3GSXB 1AO7A 1U3HD 4MD5A 3N85H 5I1CH 1QZ1A 2YD7A 3CSGA 5IR1A 5IP4A 3HB3C 4E0RA 1FZOA 1NDGA 3C87A 4M3JA 3R1GH 5I1HH 5I1CL 2ED7A 1KFAH 1SJXA 1FZMA 2RCSL 1OAXH 1DQLH 4N8VG 1ZGLM 4U05A 4UUJA 5I1JH 3VFMA 2PYEA 1J1XL 1NBVH 3KVQA 2H8PB 1NH6A 4LU5L 4S1RL 1YEDA 1NSNH 5CJXA 2BVOA 1HHIA 2MPAH 1EEQA 3JTTA 3CFEB 4YGVA 2HG5A 1BHGA 2AJSL 2DBJA 5DMIH 1CICC 1C08B 3SKNA 4QXGH 5CINL 3GMPB 4HT1L 1XF3A 5FA4B 5EBWA 1VCAA 2IPKB 3KHQA 43CAA 2C3VB 4OQTL 3OZ9L 3C6LD 1T20A 2Z8SA 5F9OL 4I4WA 2HJFA 1A3LH 1XF3B 2FX9H 3FRPA 5FYJD 1J86A 1NCDH 2RGSA 2NTFA 1G7PA 3RWCA 3VD7A 4ZS7H 5K93A 3STZB 3OPZL 5CUSL 3KR3H 4NIKB 2NY3C 4Y5VC 2FBJL 2FHCA 5JXEA 2B4CH 3MRQA 2FATL 4NFDA 4U1JB 1WIPA 1JZ3A 3OKMA 4KKNA 1NC2A 3MYJA 3D85D 3MJ9H 4EN3C 5J4MA 1TFHA 1U9KA 3OAUL 4V1DA 3MJ6A 4J3SA 4YPJA 4DKEL 2VLKE 4LLMB 5HYEA 1FN4B 2Y06H 4AM0A 4BFGA 2XNAB 4WCYH 2VUYA 2P45B 3DARA 4R97C 4QT5A 4YHOH 4X9IA 2D7TH 5F9AC 1CLYL 1CDHA 1UB5A 4CW1A 3RZWA 4KMQA 1UWXH 5E8OA 3DUSA 3ZKXB 3EBAA 4JPVH 3FO9A 1E28A 3CPLA 4AEHH 3IJHA 3QCUL 4NHCL 1TQBB 1RMFL 4D3CL 4KZDL 2HAZA 4Z7UB 4YPGB 3BPNC 5J1TC 5F7EH 3CZFA 2P46B 3QDGD 2AVGA 1P4IH 1WC7A 3LCYA 4YHYC 5C09B 1BJ1J 4BSWA 3D3VA 2NW2A 4J3UA 4OM0L 4DZBB 3X3FL 2ENSA 2DKMA 5EC1B 3L6FB 1FVDB 1G6RA 1DR9A 2APFA 2VRAA 2AW2A 3JZ7A 4UILL 2PTVA 2B4CL 1NBYB 3UDWC 4JZNB 4RBPK 5KSAA 5IW3A 1RHFA 1MFAL 2Y7QB 4O2CB 5DI8B 4MQXD 2DQDH 3UTTD 5I1GL 4GG8A 3ZE2E 3V6ZA 1BQLH 3CFKA 4HHAB 4PGCB 5FGBA 5HGHB 2F5AL 2AJUH 1BAFH 2VDMH 5KS9E 2Y72A 3MODL 3OX8A 1RUAH 2HVJB 2D2OA 4LOUD 1ZLSL 5CP3H 1LP9B 4R90H 4NC0B 4R2GC 4L8SC 4FQHB 1O7VA 4Z0BL 1MCSA 1I85C 1I3GH 3DVGA 1NMCB 3QUYB 5DK0A 5DQJA 2VLRB 1BLNB 1U8KA 5I75B 4GRWB 4HPOL 4OGYH 4RAUB 1T7XA 3EOYG 3QO1B 2G9HA 2WM0A 2CUMA 5E2JA 1J8HD 3ZKNC 3DUUA 4FQJL 4K07A 4LLQA 2YSSB 4LBEA 1Q94A 1R3LA 3UC0H 3HRZA 4PJBE 2WUBL 2XKSA 3ARGA 5FOBB 2DI8A 1MWAH 4U33A 2OQJA 1ORQB 1JRHL 7FABL 1AHWA 2AJYL 2YRPA 3CFDA 4PJFA 4WGWB 4BFEA 3MXWL 1I7ZA 1RD6A 3HE7D 5TDPB 3RFZC 4OLZH 2BFVH 3EYUH 1DANU 3BD3A 4NM4L 2FLBT 2W92A 4BELD 3DUUB 1OTSC 3CH8A 4N0FB 4QXGL 5CINH 2OMNA 4ODHL 5KBNC 4Y7MA 2QR0A 3GSOB 1ZOXA 5EWIL 2FH6A 4MJIE 2J8UE 4Y19D 4F9PC 2K3TA 1QRND 3L5WB 2IPUG 1D6EB 4AQ1B 5HD8C 2BOBB 1I1FB 1PYWA 3H9ZA 1HXMB 4PRPE 2N56A 5IFJB 1V8HA 2V17H 4LSRL 3LH2H 4OZIA 5MI0C 5TE6L 4L3EA 4PJCF 4HIEA 4OAWA 1P7QA 3C6SB 4IJ3C 3UJTH 5IQ7L 3UTQA 4KI1A 2VISA 1YNKL 2VWEC 5A2IH 4PRHD 3W0WD 2VNCA 5HGBA 5HHMD 2QHRH 1JF1B 3QFJE 4AK1A 3V8OA 4HV8A 4JDVA 2JIXB 4DCQA 2IALA 3BHBB 1N3NB 4R4FH 3K2MC 4BK4A 2VMFA 1CFSB 3DHMA 3PQYA 2P8MB 4GAJL 2IFFH 1YN6A 5GISH 3N1PC 1OTTD 4S2SB 3SO5A 4M62L 4ZYKB 3L95B 5CILH 4X4MA 1P6AB 2XN9B 2CKBA 3L3IB 4X5LA 4YIQA 2C3HA 2AABL 5F72S 4NZTH 3BESR 3PWLB 4FA8A 4OCLC 4CNIB 2VAAB 1UEYA 1WSST 1WICA 3QIUC 1ETZA 4K8RD 1QG3A 1SYSB 3VFVA 4NWUH 4WW1B 4JHBA 4XPFH 2CJUL 3RWEB 4N5UA 2YPKB 1ACYH 4G8GE 2CDFB 5HHVL 3O11B 4TTGA 4PV9B 1KCKA 1S9VB 5FOJA 3SY0B 3VJ6B 3BP4A 3D87B 5DHVB 3SDAC 2V17L 2BMKB 4IOFC 3OAYK 1GGIL 4YHKL 3O9WA 5CJOL 5JPMA 1IGJB 4KK5C 2VLKA 4R26H 1M6OA 1R24B 4WWKB 5C0BB 3T1WA 3GSWA 2BMKA 2ZSWB 1S5IL 3X11A 1AJ7L 3STLA 4OBSA 1NUDA 3RWGA 1U58A 1SY6L 1MQ8A 2P5EA 1C1EH 2OTWB 5TQ0H 4M6ML 3NFPA 2W91A 1J1PL 1TZGH 2NPLX 3P0VH 3V0AC 3U6RA 2F5BL 3QP3A 1UFUA 2GCYA 1GIGL 1QVOA 4HF5H 2VAJA 2XG5A 4FZEH 2E7HA 3WJLA 3EO1B 32C2B 3THML 4AH2A 1WFTA 1R6VA 5DJCA 3HNVH 1KXQE 1QA9A 2IBZX 1QLEL 5K9OB 5KOVC 4HEME 4DKFL 1DUYB 1FO0H 1FZOB 1KCVH 1MCHA 4AG4H 5IVNA 1SJHA 3MUGB 1CD9B 4EUPG 2R9HD 2JKXA 1R0AL 2Q8BL 4YC2B 1OARH 2PW2A 5J3HC 4L3AA 2HLFC 3MV7E 1WK0A 4YGVB 5LAXA 1XGQA 1MLCB 4APQD 1KSRA 1CFNA 4OCRL 4ELMF 1FNHA 1IM9A 5F21B 5B8CC 4KRMB 43C9B 1FHGA 3CU7A 4J3WA 2BSTB 2ESVD 1OTUD 2NY6D 1G6RH 1GSMA 1ADQA 2X1OA 2W9EH 2HT3D 5DQ9A 5MHSD 1ZHBA 4UIMA 5E2UH 1R5VB 2BY3A 4LHUD 3S4SB 2PW1A 2NY1D 3W5MA 1DBAL 4LRIA 4MLIA 3HZMA 4DKEH 1DBBH 3HNSL 5T5FH 4HFWB 5EZIH 2VDNH 1YY8A 4MAUH 4WI5A 5GJSH 4IRJC 3C2AH 1A7PH 2B2XH 1KYOJ 5EFIB 1UA6L 3F7YA 5J6GA 1LNUA 1A7OH 3I50L 3RY4A 2WMPA 4G43A 5I74B 3PQYD 2CLRA 3QZWB 5DFVD 4XVSL 3HNVL 3O81A 3VH8G 5K9JH 5FHBL 1CGWA 2H2SC 3BVNA 5ICZA 1CN4A 4HWEL 5L2KE 4Z7NF 1G7LB 3H0TA 4UDUA 3WFCL 1ADQL 5IMKB 3CUPA 1FFNB 4HIIB 5ETUA 4ZUVA 3RPIA 5KJRH 5M7QA 1RIVH 2ATKB 4P0DA 1FL5B 1NAKH 5DMKA 2Y23A 2BSED 1CXEA 3FONB 4C56B 1MHEB 2BY0A 4HZLB 4KRPB 1OM3L 4MA1B 5HVFB 4NSKA 1NSNL 4ODTH 2UUDH 4F7MB 3C9NA 4P4KA 4K7FB 1U58B 2FECI 5D7KE 4UMGA 4AEEA 4NQEE 3OGCA 5DWUH 5C0AA 1J12A 4HGWB 1RULL 1CGXA 3GO1H 4MAYA 3CVIH 3BAEL 3MRLB 1RUML 5BJTA 4JFEE 2VL5A 3WS6A 1ZHNA 5EN2B 1UWEH 3E3QC 4LHJB 3VA6A 3A6BH 3WO4B 1D5XA 1FFPA 4JZOA 5CGYD 2HRPH 3QXUA 2WUCL 3UTTE 3R0MA 5T1MA 3EFFB 4YR6B 5J7CC 4XMKH 4XXDB 1NEZG 2AK4D 2GTWB 2QADB 5IBUB 2VO5A 1KJ3L 3RWEA 4CL7A 2GJZA 1UM4H 1ZXQA 4AEIH 5FM5O 5DVKA 4NO2B 4HS8L 5B3JF 4ALAH 2R2HB 4LSUL 3EOAA 1FNSL 2AI0H 4POZD 3N9GH 4QRRE 2OR8A 2ZJSL 3ULVC 3AUVA 3QDMB 2A0LD 3N1GC 3E1F1 1F4HA 4L9DA 5F1NA 3RUGA 3FQTB 3NIDE 1RJLA 2HLFD 4M1DH 3PWUB 4NZRH 1NFKA 1H5BB 4LSQH 5J06A 5GQBA 5C0EB 2P8MA 4M1DL 2Z4QA 3ARBA 5IBUG 3LSOB 1UCBL 1N3NA 3RNQB 5TFSL 4MJ5B 4PJDB 2NY6C 3HNTH 2IFGA 4IRZH 3WXVH 3OXSA 2EDTA 5SWZA 3OKLA 3HE7C 5GRUH 2NY1C 1KCSL 3LKRA 2O93L 3QG6A 3EUUA 5DRWA 4D9LL 1DUZB 5D2NC 2EDXA 4ZTPL 4AENA 3U9PH 3UJJL 1IGYA 3AY4C 2J88H 3OKEA 3PGDB 4XWOC 5CZVL 4ZPTA 5ESVB 4BFIA 5B38G 3R8QA 5FYLL 2XNAA 3KYOA 5ID0A 3IDMA 3MA9H 4TUOB 3ALXA 3PE9A 2JF1A 3OJVC 3P30L 4GOSA 1J87A 2WW8A 5EUOB 2EZ0C 3L1OL 5DJ2A 1DBKH 3ZTJH 5KW9H 4XAKE 4NRXA 4JFYB 3MV9E 5FYLD 2FIRT 3UBXG 2Y36L 3IFOA 4Y2DC 3E8UH 1Q9KA 4NQCD 4K71B 3DGGA 1I9IH 1AXSA 2VLMD 1ZVYA 3IDGA 3FN3A 4P57A 2WUBH 4ACPA 1FRGH 4J4PD 3S37H 4IBLT 4XMLH 2HJKB 4NUGH 3RUGF 5JDJA 3HA0A 3UTOA 2AXFA 3OQ3B 1CYGA 4JQVC 2WBJD 3VGAB 3LKNB 1XF1A 2W9DL 3NCCB 4M8VA 3TV3L 1ZGLA 1FDLL 5FO8A 3Q0HA 3ABZA 3QCTL 1IAIH 2ERJB 4P2QA 3O3BB 4RGMC 1UZ6E 1QSEB 2VE6B 3U7YL 4B5EA 4CAGA 5BMFL 4MSWA 2Z93B 4S1SL 2XG4A 4HS6A 1Y6NR 5IBLC 3U7YH 4V2CB 4AIXA 1KJMB 2X4QA 1MCJA 1RVFH 3RZCD 5HY9A 3HI5L 4Y4FC 2BERA 3LKPA 1U91A 2BVOB 4P59H 2CLVB 3B4NA 4S1QL 4HUWA 2O5YH 2WWKO 1MCNA 1PJ9A 5HHVH 4G6KL 4ZS6C 4F8QA 5C0FA 3HCVB 4JKWA 3RGVB 4O2EB 4MAYD 4AMKL 3L3OA 3MA9L 2EDEA 3FMGL 5IMOB 3WNMA 1Q0YH 3ILQC 2A9NL 5T5NF 4F15B 3VXUB 5DA4A 2X9WA 2F19L 2WNGA 1CICD 4W81A 4R8WL 5JW4Q 2XKUA 2Y6SD 2GSGA 3QNXB 2GITA 2HKFH 1LD9B 1P2CB 3A6BL 1JPGB 4NQVB 1C1EL 5GISL 3STBA 3SQOL 3VFRB 4IHOB 5ACMA 2UUDK 1X3DA 4CBPA 2NY0C 3HAEH 5FKAB 1XR9B 1MHPH 3MREA 5JDSA 2OL3L 3ZDYF 1RZ7H 1B6DA 3U36A 1AQDB 1CTOA 1LEGB 1ORSA 3QG6B 5DRWB 1LP9E 1YQ2A 1Q0XH 2EIZA 2CKNA 4KROD 4ESKA 2XRAH 3DX9B 4MA8L 3MJ8A 5INCB 3GMRB 2VZSA 4RRPG 4WY7H 5CEZD 1BOGA 3FJTA 4JVUA 4EXPX 4Y2DA 1TMCB 3CDGA 4X0KB 2Y9RT 2ADFL 5TE6H 3BPLB 4IS6A 1Q9LB 5JO5B 1QLRB 5FV1L 3OHXB 5ICZB 1J1OH 2J12B 4APQA 2AV1B 1XZ0B 3DUSB 4HKJA 3KPPB 2MQ0A 2IG2L 3QDJA 3S36L 1XGPB 5TDOB 4NBZB 4Y4KC 3TF7C 2MJWA 5EU5B 5JW4N 2I5YL 4PGDB 4X6CB 1FVCB 3D39B 3DETC 3C60B 1QO3A 4OZHB 5DJXA 3SCMD 1UCTA 3QDGA 2H3NB 4HJ0D 5SV3A 1MJ8L 4LKXA 5E99L 4R2GD 2MCPL 1RHHB 2GSGB 3TJEH 1OTUC 3PF2A 1MUJB 3EYOB 4I3RH 4YH6A 1IEBB 4NQEB 5KSBB 1QRNB 5IVXA 4NNYB 5I74C 4GUPB 1C7TA 4A6YH 3FB5B 1NAMA 1OB1A 2J5LC 5GIRA 3SDXA 4LKCB 7FABH 1B0GA 2EDDA 1TQBC 1ZTXL 4Y16D 4U3HA 3O8XA 4RGNE 1YZZA 43C9A 4YDLB 4XCNA 4DOHE 3BD5A 4KMLB 5E6YA 5KVDH 3QRGL 3L5JA 2DN7A 5LBSL 4OD3L 1MJ7H 4M5ZL 5ID1B 3MRCA 3C9NB 3DO7B 3OTTA 4KHXL 1NCUA 4GW5A 3V5HB 1UB6B 3QUXA 5L8KB 4JFED 3SJVB 2OR7A 4TTDD 3ZLQC 4MAYC 2ADIB 2P5ED 3ZDZE 1OD9A 2GFBB 1M05A 1O5DT 3T0AA 5MEPA 2WQ8A 1BBJB 4I48A 1YPZE 3EO9L 5HI5D 3MACH 3LS4H 4OV5B 5I73C 3ULVE 3D0LA 2CGRL 2VLKD 3T0EA 4HGMA 2EE2A 5T1KA 2FX8H 1KLUB 2MQCA 5EZIL 1N2RB 4ZXBB 1XR8B 1ZSDB 3QQ3B 5C2UB 3BKYH 3QUXB 1U8KB 4D0BB 4MD5B 1G9EA 1RVFL 1IGFL 1U6AH 2BC4A 3AS1A 4QOKB 3VD3A 5FF6B 4BH7A 1JNLH 3BP7B 4QCIB 2DS4A 2GAZA 3OAZK 4ZPTB 1A6AB 3GDBA 2MPAL 3EIFA 4KJQD 3FB8A 5C07B 2A38A 5AYQA 5JQ6H 1J1XH 3MGOA 4P4KC 3GKWH 3BIAX 4NM8H 1O7SA 4KAQH 3WLWC 3MLUL 3SDAA 1YNTA 2VN7A 1XGQB 1SYSA 3EJZD 3VFVB 1QRNE 1UB6A 5E6IC 1FNLA 1P4LB 3X3GH 2AJUL 2V5RA 3SPVA 5EC2A 3OJMB 4WHCA 3G6JA 3PJSA 3SCMA 1VFAB 3ARSA 3IKCA 1T1XA 1S9YA 2Y36H 5GGSY 1A02N 1QBAA 1DLFH 1I9JL 4HAGA 3OAYH 4MVBD 4UNUA 1T0MB 4Z7OF 5BV7C 1IC7L 1EERB 1T1WB 3FO2B 4OZGE 5D1QC 3MV8B 3OF6D 4OT1L 3DRTA 5GGRY 2IAMA 2JJVA 2NNAA 3HI6H 4LEOA 1CVSC 4DCQB 5D7LA 3RIFK 4EIZC 3D18B 5BRZA 4OUUA 4ERSL 5C0CA 3CXHJ 5IVZB 3MLPA 1KLFA 3EGSB 1OPGH 4MJIB 4KKLD 3PWVB 1F45A 4XAWL 1JGDA 4Y5YC 5C0ND 1QHPA 2DMBA 4Y2DB 5CGTA 3FO0L 4PJAB 3WMSA 1JYNA 3T65B 4JANA 4BQ9A 2OXGA 2EYSB 4ZUUA 3G08B 1NMAL 1VFMA 1IC5H 1KCRH 4FG6D 3O6FC 1U8OA 3IS1X 3KWWB 3ARFA 1WFOA 5BJTB 3M17B 1QBMH 3LB6D 4G6ML 3WCYA 3VG9B 3O45B 1F00I 3DV4A 3VXTB 3W2DH 2HT4D 2AJZB 1SJEA 4K8RC 1J0IA 1AKJD 1PX3A 2GUOA 3GUTA 3K3QA 3GSOA 1S9VA 1Q9OA 1CF8H 2ERJC 4KJPD 2OTUA 1S8DA 1X5LA 3GMOB 4UT6L 5C2BL 2VZOA 3B2UD 3SE3A 4C56A 4X9GA 3HPJB 1P6FA 1EFXB 2UWEE 4NRZA 1HEZB 3MLXL 4XP4L 1WT5C 2YMXL 4JFEA 4CNIA 1DQML 5FK9A 1AQDA 1ZV5A 2YUVA 4YX2H 3FQTA 4YLQT 5BQ7A 2BSSB 1G7QA 4Z95L 2P43B 2JK5B 5L9DL 2NLJA 3FRPG 4PG2C 2ZOLB 3NN8A 4MZ2A 5B8CA 2IFFL 3CVHA 1RIUH 1B88A 1YEIL 4ETYA 3TFKD 5EZLB 1VERA 5B39G 1N26A 4PJHB 3UBXI 1OAYL 1ZT1B 2AJXH 1N4XL 5A40E 2DYPA 4U1HA 1VESA 2HG5B 4LIQE 3OJ2C 1QYGL 2VLRA 4PGBA 1MI5B 3BW9A 1QSEA 2VE6A 4ZS6D 1KELL 4M4RA 2V2XB 2R0LH 1I3GL 1YQVL 1PKQB 3RZCA 2X1QA 2BVQA 4P5TA 1ONQB 4NP4H 1FZMB 1J0ZA 4TOYL 5IVXE 3S5LB 5KSUB 4P5TD 4G8EA 5CZXD 4K3EL 3BH9B 4OTXH 1SBBA 1WBXA 3U0WL 5MENA 1T0MA 4AT6A 1OF2B 3TYGL 3ZYZA 1A21A 1Z9MA 1AXIB 4YBLC 3QDGE 1F97A 4ELKB 4ZAKB 2IADA 4Z76A 1UJTA 2NY0D 1HH9A 4QOKA 2OTPA 2VXSL 4L8BB 1UWEL 2VIRA 1VGKB 1A14H 4PB0H 3T0WA 3N50A 2X4OA 1HE7A 1T21A 3DXAE 2A6JB 4OZGF 4NC2B 2XXMB 2WINA 1K8DB 4QHMB 4K7PL 2P7TB 5DD1H 5GRVL 1AHWB 4PJ8D 3A6OA 3D48R 4KZEH 5CBEA 2F58L 4L8DB 5IEHA 1FCCA 4WWKC 3RA7L 7CGTA 3FT4B 4QOKE 3QDAA 4LU5H 2YA0A 4JQXC 5F8RC 1BZ9A 1NLDL 4OZ4A 1O0VA 3EKCA 4L8BA 1I9JH 3LD8B 2AKRA 4PTTB 3EHBD 4FHBD 1EVTC 5LBSH 3MLWH 4YE4H 2VXVH 1YMME 3RX7A 4J6RL 2ADIA 2DM3A 2DWEB 2DQFB 1PFCA 1BVLA 4FQIH 3PWPD 3K8KA 3FO1B 3LB6C 2C4FU 1F4AA 2GTZA 2X4RA 1EXUA 1KG0B 3PL6A 5DK2A 1JYWA 5IFHH 5C0EA 5JA9A 4HJ0C 4LSPH 3GJFK 4I0CC 1UXSA 4POUB 1LO5B 3TH3T 3V7AE 5IMOA 4P2QE 4PYHA 1QQDA 1QNZL 5C92A 3Q6GH 3LZFH 1NLDH 4GBXD 1QD0A 1JHTB 2BVUA 2RBLA 5BZWA 2DD8H 3D0VA 3EDJA 4ZFOL 1MCWM 5CSGA 1HHHA 2QTEA 3G5YB 2MHAA 4YDKL 5HI3C 3SE4A 1LO2H 3G6AA 3QIBB 4XBGB 4Y1AA 5EH1A 3ME0A 4WEBL 2X05A 1WZLA 3HNSH 1WZ1H 2LAAA 5FYKL 3EOTL 5D96B 4O5LL 1FFPB 3O3BA 4YWGL 2GJ6D 3HG1E 3ULUL 3PDDA 5I16A 3V5KA 4LASL 1LE9A 2Y4SA 4EDWH 4J3OC 4NN5B 1FGNL 5DJCB 4NQDB 5ADOH 4ODBD 4XXCC 3BFOA 4ZO9A 3D5OF 1L7TL 1B3JA 4NC1C 4CN6A 2AEQL 3TP4A 4WUKH 5ACLA 2DM2A 5DZLA 4XWOD 2ZZUT 4UTBH 1RZ7L 3B9KD 4ZFFA 4JM2A 5DSCB 5AD0B 1Q9KB 4NZJA 3RY5A 3BPOB 1YY9C 4LSPL 4HUNB 1I1YB 4G3YL 4LSDA 4OAWB 3ULVD 1F11A 1OT2A 4CW1B 5JNYA 3OG6B 1HH6B 2H3NA 3WO3B 1OGTB 3KJ4B 3O9WB 1A1NB 4QF1B 3Q5OA 3C60A 2EDYA 5LGKA 3B8SA 3M8OL 3PGDA 5CMAA 3RVXC 5TH2A 2FJGA 4R8WH 1MVUB 3U7AA 6FABH 3CDYA 3UMTA 4Y4FA 1RURL 4L1HA 3P0VL 4JFPA 3WS3A 2YD5A 3ECBA 1F8TL 1SMAA 1G9MH 1F2QA 4G6KH 5C8JA 4N0FA 4YXHH 5D7LE 2QSQA 5JUEL 5DS8A 2AJVL 3ARWA 2UWEA 1A8JH 1MSPA 1INDL 3HFMH 3CGTA 5I1IL 1JRHI 1KJ2H 3ULUF 2MKLC 3LSOA 4U6XB 5CCKL 5DUPH 3CFIC 3OGOE 1XFPA 4UIKH 5GZOD 4CUCA 2R9HC 4YHLL 1EO8L 4XH2A 3LPWA 1FNEB 2FO1A 5IT2L 3WO4C 2DLHA 1A6UL 2R4RH 3PGFL 5C0AE 1WT5A 4JJ5A 1IKFH 1A7QH 4QRTB 3QNXA 3C09C 2F15A 2UZIL 1N0XH 1I7UB 3ZDYE 4TULH 5I1HL 3EYSL 3ULSB 2VSCA 4X7SL 3BIKB 3S34H 1V7MH 1U41A 1BP3B 4P2RB 5E5MB 5DQ9B 4A6YL 4JHWL 5IFJA 3QFJB 1G9NC 5MEQA 5C0FB 3O3AA 5EU6E 4PJBA 5I1JL 3L1OH 5E94A 4DWHA 2NX5A 2DIJA 3DI3B 5KOMC 2GQHA 3ZTNH 1G7MB 3RBGA 3JWOL 1BJ1H 1JPST 3LHPH 1J0KA 2R0KH 3O2WH 2LFGA 4OF7A 2BOCA 2VZTA 4YNYB 2DBLL 4FZ8L 3BN9D 1I3RB 3ELAT 3RZCC 5K9QI 3MCLH 3KHOA 1LEKB 3UC0L 4HMEA 2VOTA 1FG9C 2GIYA 4BH8B 3QUKB 4RQQB 3BO8A 3GMMA 1QSFE 5CJXC 1YPZA 1IAKA 1T1YB 4JEGB 1KN2H 1KGCE 3FOLA 4P9HC 4XPAH 5K9KB 1ZGLB 3P73A 4JR9L 4OI8A 4UDUB 4Z6AT 3SGEI 2BVPB 4PTUB 4AL8H 2KKQA 4MHHG 2O5YL 3H9YA 1FV1A 4X4XB 3ZSSA 4QTHA 4I1NB 5C09A 1XIWD 3NIFE 5JHDE 2R69H 4JFOA 4GRMA 4HD9A 1TJIL 5FYJU 5MEPB 4L4TB 5ESQB 4CGTA 3BO8B 2I07B 3PHQA 3SCMC 1LK2A 2ESVE 2X44D 4MYWB 1K8DA 3FQRA 1A7NL 4XNQA 2P47B 3HI1A 4K3JL 1JPFA 4CDGC 3ULUE 4I18C 4YXHL 5F3BA 1FFRA 2C9AA 3ULUH 3SE3C 4LQ1A 3DO7A 1YY8B 2F8VA 5EOCH 4M93C 1MVFA 4TRPH 4KDVA 4U1SA 5MERB 5C7XH 3DVNB 4FNLL 4PJ9A 1C5CH 3QDJD 4OFPA 4XTRD 2D7QA 4P23A 4R6UA 4KV5E 5I18H 4OIBA 5EU4A 2QQQA 3ILPB 1C12B 2OR9L 1BD2A 3KPTA 1KC5H 3CFJA 5GS0H 1MUJA 1JGUL 5IB5A 2P8PA 3OKMB 5J1SC 3FRUA 3OSKA 3PWJA 5LAXB 3UEZA 1MJJB 1BVKB 2QLVB 4QOKD 2D31B 4LHUA 4MDJB 1AIFB 3GKWL 1BEYL 2ZG1A 1MWAA 2Q76B 1JNHA 3W39A 5BVJA 1D5BB 1RUAL 1MQKL 3ARRA 3CD4A 1F90H 2XN9E 4RGNB 1MFDH 3KPPA 4HMDA 3HUJA 1H15A 4JFFB 1U92B 2LAGB 4LCCC 4W6XB 3T4AB 5T33L 4NN6C 3LD8C 2X4SA 2LU7A 1IGFH 1U6AL 1UQSB 3MV8E 1JV5B 3T3MF 4CMHB 4HV8B 2BVYA 4JDVB 4XNYL 5BQ7B 1RUPH 4F9PA 3LRGA 4P46A 4JFEB 3SJVD 5DD1L 5IROC 4RX4D 1K4CA 1Z3GL 5JDSB 4NRYB 5LWYL 3N1FC 3BP5B 4OJFH 3KYAA 2BDNL 3GSQA 1UQSA 1KJ2A 2AJZA 1P4IL 3OPZH 4HIXL 4MCZA 4LGSB 1YMMD 4JGUA 1SEQL 4XBEH 1EAJA 5JW3H 2P48B 3LVEA 1BZQK 5IIEB 1JZ4A 4XMPH 4KJQC 2RFXB 5KSVB 3H3PH 1IJ9A 2IWGA 2RJMA 1Q94B 1R3LB 3TO2B 2YS4A 3UXFA 3UPAA 4PBVC 2ZUWA 4XNXL 4W6WB 2J88L 3GSNA 3MR9B 2OK0L 4P2QD 4ZOAA 3RTQB 3QEQA 4OCWL 5DMGD 4O4YL 4HKBB 1FG2A 5IVZA 4AIOA 3QO0A 5D7SH 1E0OB 4QRPE 1NGPH 2JB6B 2UVEA 3TBTB 1L7IL 3LEYL 1JGDB 4FP8L 1V3MA 3O3EA 1EEYA 1LP9A 4XWGH 2R0WH 1NCCL 3JV5A 3O6LH 2EYRA 2XOTA 4PJGE 1KPRA 1OWWA 2C1OB 2A1WL 4GS7B 3LPFA 4WHYG 1GOHA 1XH3B 2XWBA 5EO9B 4CVZA 1NJ9B 2ADGB 3KJ6H 5J11B 5I73B 3VMOA 1KJMA 5EC2B 1AE6L 1RI8A 2RR3A 1FGNH 4U6VH 3WFEL 2X4PA 1RZKC 1IGCL 5ICYA 4JRWA 3C5SA 3SE4C 4HUXB 1T6WA 4BK5A 3QUXC 4NGHL 3NZHL 1NGYA 3BMVA 2PW2B 1GIGH 4TSBH 3ZE1F 1JNNH 1MCQA 4HWEH 3B9KC 4WO4A 4LCYA 2QQLH 4FQXD 3RDTD 4P57B 4YO0A 1X5ZA 5F3HA 1BWWA 3L3KA 3GRWA 2VUOA 1D5IL 3ARFC 4NP4L 4P23D 2ARWA 2GAZB 4KI5C 5IR1B 5FM5M 2GYSA 4Z7VB 4HFUH 4M02A 3ZMRA 4K3DL 5HGDB 3U7WL 4FQCH 1EXUB 4ZD3H 5HDBF 3RTQA 4PJGF 1JPFB 1LQSR 2R39A 3HMXA 4OZGB 2OL3H 4U6TA 2AJXL 1W72A 3WFDH 2JJTA 5EO0B 2FL5B 4HWBL 2ENYA 4X7EC 5HXMA 1HWGB 2F53E 3IDNA 4PRDA 5D70L 5HI4C 5IB3A 4JN2A 3TT1L 5IW6A 5D7LD 4LAJH 4PRBA 1HH6A 2B8OT 3GMNB 4NJAH 5EU3A 1PKQA 2AAVA 3FOLB 3QCVL 4NZUH 1LMKA 3NA9H 1S7VA 2ATPB 3HI6L 4GAGH 4GMSL 2DTMH 3IJHB 2Z4QB 2AGJH 5E8NA 5IOPB 1EGJL 1HOCA 3PDOA 4HH8A 3DGCR 2AK1L 1S7XB 3RAJL 1V3KA 1R0AH 5I2IB 4PJ8B 5C08E 3GMQB 1HSBA 3RWDB 2JELL 2PXYB 1S5HA 3HG1B 4WEMB 3T8XB 1IGJA 2F8XC 1W72H 1F3JB 5CEYA 3BKCL 4PJEE 3TBVA 1QBML 4P5TC 3DROB 5FK9B 3MBED 4I18A 3PQYB 4JKPH 1EBPA 2I60H 4GKNB 1UXWB 4G6FD 4MXQD 2F8OA 4PJDE 3C6LC 4DGYH 2P49B 3OJDA 3EOBB 5TGBB 3T09A 5GIRB 2DL9A 4H25B 4QRTA 1TTFA 4FXGA 3I3EA 1CGYA 1UXWA 3OKDA 4WHTB 1ZEAH 3CFJB 4NUGL 1QO3B 4OZHA 4J12A 1AR2A 3VXUD 3QDME 2KDGA 3DVIA 1XIWB 4OGZA 4JGJA 4U1GC 1N5AB 5CEYB 1FAIH 3BEVB 3UZQA 4KGJA 2C3VA 4OGXH 4D8PB 2IPTH 3TZVB 3T08A 4ZNEA 4GSDL 4I2XA 3NFNA 4NCDA 3O41A 1KB9J 4HULB 3B6SB 4PGDA 5BXFB 2KZ1B 4H1LG 4HKZB 3G5XA 1CL7L 2XACC 3SO3B 9CGTA 4JPIB 5EBMB 4ORGB 1B4RA 3LS4L 4LPYA 5IGXH 1S9XA 3HC3L 4NWUL 3O6FB 3EYVB 1JFQL 3QEQE 4PJ9C 3FMGH 5EIIB 3EYFA 4X4YA 2F74B 5ISZB 4BZ2H 2MFNA 1L0YA 3DX8A 3SKMB 1DQJA 4U2YA 5AG8A 4NNXB 3GI9L 5DHXB 1I1CA 1UVQB 4PY7B 1UM6H 4UUJB 1VACA 3O6KH 5FKAA 3RIAK 5AZEH 1ND0B 4DVRH 4JY5H 2BVPA 4KHTH 5GGVH 1ORQA 4B7IA 1T3FB 4KJYB 4J4PC 3VGFA 5K9KA 2VQ1A 3IFNL 5J6GB 4K3JH 4M03A 4CN1A 3NCMA 4I5BA 1AXTH 5JHLL 5IUSA 1F5WA 4YQXH 4TVPL 4YDJA 5IM7B 1HZHH 5HDQL 3VMPA 5BV7H 2XYCA 4HBCH 4ZUWA 3B8YA 2DIBA 1R3JA 4Z5RA 2X10A 3G6DH 2Z9TA 4BZ1H 2XQBH 4RFEB 3VDBA 1G7MA 3AXLA 3F6IA 4LSUH 5C0IA 2WP3O 1FYTA 2BHZA 3WFCH 1IM9B 1MRCH 4NN6B 1X7QA 4JO3H 1IQWL 3MLTB 5H35B 4HLZH 1UM4L 3WL9A 1CXLA 4G6FB 5HY9B 1Z5LA 3VFTB 5JIHA 3TWCH 3GHBH 4QY8B 5A2FA 2IC2A 1R3IL 5M94B 3VFSB 1YPZF 3SE8H 2VR5A 5IW1A 4DEPC 3P30H 1PQZA 3PGCB 1KEMH 4U1LB 3V7AG 5HHPA 5DMJB 1RK0A 4S0TD 3CMOH 3ZDZF 4LLDA 3S9DB 2IG2H 3S36H 5ABDE 1MELA 2VZ1A 3T3PF 5IW1B 5DWUL 3B3IB 2Y6SC 2X4TB 5J9PB 4WNQB 1NMBH 1VPOH 2YXFA 4NJAL 4TSAH 4F33B 1JUFA 5EOCJ 3DURB 3IJSA 5H94B 3L3GB 3QULA 3TCLA 2A9MH 3IAGC 1N0XL 4LAQL 3FAXA 2PYEE 5DD0L 2D7TL 5BRZD 1V7NL 4OZFB 1CR9H 3CCHA 3BN3B 1H0DA 4RISL 5HYJA 4XX1G 1INQA 3GIVA 3EFDL 4DAGH 4P46C 1MJ8H 4KVNH 4QRSB 5DJ8B 5C09E 1K6QH 1QFUL 4YBHA 1AO7E 1P5VA 3WS6C 1C16B 2FJHA 5I1KL 3EDKA 3ZE2F 4OI9A 4C55A 2OK0H 3T2NL 3S97C 3B2UC 3ARDA 5JHDA 3RWHA 3CVHL 5DMGC 3NTCH 4XPHL 4H0IA 4HPYH 4X5XA 1MCDA 3RX8A 5FECA 4RMRA 5IHUH 2VXTL 4H8WH 4P2RA 4K7PY 1FVEA 4MAUL 2W65B 1NAML 3P0YL 4LDOB 4WFGD 4M7ZB 4WFFE 3OXSB 4K23L 1TZIA 4HDIB 3CZJA 1C5DB 1QSFA 5F96H 2GJ6E 3EJYC 5EOTA 3NZ8B 4LK4A 4MJ6A 1MI5A 1AD9A 2FEDC 1HZHL 3SE9L 1E4WL 4F7CB 3TO4B 5IJKA 3BPCA 2ICWB 4MA7H 4S1SH 1YEKH 1LGVA 4IRSD 4CU7A 1K3IA 4I2XB 4ZYKA 2APWA 2NX5E 5BO1H 5FYLE 3RWJA 2AV1A 2W0KA 1BPVA 4JY5L 5EU6A 4N8CL 4LLVA 3V8CA 1IGIL 4RZCA 4MJ6B 2DQGL 3QBTB 2BRRL 4TYUA 1C5DA 2Q6WA 2Z91A 2NCMA 2R56L 1RMFH 3HPLA 3TNMB 3NACH 4ZSOE 1JWMA 2ICEB 1KC5L 4K94H 5JOFB 1CFVH 3KLDA 2BNQB 5HBBA 5DJXB 4FABL 2CUHA 3IB4A 5L7XL 2YRZA 4NN5C 3RHWF 1ZGLP 1I8IB 5EOQH 3S37X 2QSVA 3CXHK 5D93B 2XKNB 3SDYH 2IBZY 5IJKC 2XY1A 2EXYD 5TQ2H 3V4PL 2EDRA 1S9WB 1SY6A 4K3DH 3GB7B 2AJ3A 4OLVH 3LQZB 3QUYC 1IGTA 1AH1A 5L6YH 1JGLL 4KTEL 2IAND 2EYSA 3GMRA 1FLRH 5DZNA 4HF5L 2GKIA 1E6OL 5DO2C 3GBML 2JJWA 4RMTA 1PSKH 3ZO0A 3WE6A 1S8DB 2OJEB 3GMOA 1D7FA 4KQ3L 5CIPH 3BRDA 4U1IA 2LE9A 3I3BA 3GSUB 2YPLD 4XZUA 1PEZA 1BZ9B 1EAPA 3HKFA 3L5XL 3SGKA 1I8MA 4U0QB 5CJQH 1GH7A 4XB8A 5E4EB 1NL0L 3X12A 1UENA 5FOBA 1JK8A 4DN4L 1ZS8B 3TVMD 4C59B 3SJVA 1S9KC 2VDKL 4P4KD 1CLYH 3O8XD 2W59A 4FTVE 2BNRB 2BSRB 3DX6B 1ZHLB 5D1XB 3B9EA 1ZA3A 4KMTL 2XWTA 3WIHA 2IADB 4UNVA 5FO8B 3F62A 5AUMB 3F12B 1P7HL 4HS8H 5DC4B 1D9KC 1U8PB 1FL3A 1XIWC 5J3HD 5BS0E 4O9HL 3T2PA 2DMCA 5GRZA 1PKOA 2DKUA 3EAKA 4H1LB 5HI3D 4O4YH 3NPSC 1RZFL 2NXZB 3BUYA 4IIQC 2BSTA 5EU4B 4R4BA 3MV8A 1J5OH 2H41A 4JM4H 4NWTH 2QHRL 1JRHH 4DZ8A 1ONQA 4WV1A 3P4MA 2APBA 2A9NH 4PJHF 3ARED 4YHIA 3SO3C 2V5SA 5AUMA 3LRSA 2NY5H 1BVZA 1NGYB 4GAJH 4RIRA 3QSKB 5HVGB 4HUXA 3PIQA 1MEXL 3IXAA 4GMTH 3JV4A 5EU6B 3AC0A 4MDIA 4OJFL 3Q3GA 1BQUA 1DUYA 2HFGH 3KPQB 4BFBD 2WIIB 2I07A 4OCXL 4QO1A 4FG6C 1UVQA 5BMFH 3X13B 4PJ9D 1KXTB 1HNFA 2H32B 3GSVA 4LSRH 1FH5H 5T1KD 4Q6IA 1EEYB 3ZT5A 3NIGF 3U6RB 1KB9K 2IH3B 4NO3B 1N6VA 1T5XB 3P4NB 3UBXB 5J89A 4NRXB 4UAOC 1JNNL 3BXNA 4BSJA 2VIRB 3FQWB 2IQ9H 3H42H 3VWKB 1LDPL 1WUNT 2GCYB 1A4KA 4M61A 3MRPA 4IDJH 4NOFA 5JW4R 3KYMB 4PR5B 4FQXB 5CCKH 1L9MA 4Z95H 2YD8A 3F7VB 2FHFA 4F15C 5DF0A 1HI6A 1XGTA 5I8CA 5I15L 1Q38A 2UWEF 4DK3A 4IMLB 1FORH 3U4EA 1CE1H 4N1HB 1AGCB 4LARH 4XCYA 5EU7C 4NO2A 3LKQB 3RVUC 2KQMA 4H25A 2NY4C 4HQQL 1RUPL 3D69B 5CZVH 1G0YR 3MRIA 1GZQB 4P2OD 1MCPH 1KF9B 1OP5K 3VGGA 4UV4L 5JLZA 4CMHC 1ETZB 1IEAB 1OOAA 3WSQH 4G7YL 3L3GA 3ZHDA 1ZT1A 3PV6B 2CR3A 3PWUA 2XA8L 1EV2E 4P9MH 3WEXB 2CK0L 2F5AH 4KUCF 1DEDA 3MLUH 3QUZD 1FYTD 1NGZB 5IJVB 1QKZH 4UINL 3AMLA 1QFWM 4YHOL 1XCTB 3WEXA 4X6DE 4KQ3H 5IB2A 1SEQH 3V5DB 3HR5B 4LP4A 3BT2H 1K4DB 4LCIH 3LV3A 5E1AB 1C08A 4Y19B 1GGYA 2AEPL 3FQNB 4EI5B 5J56B 2VN4A 4YR6A 3B43A 4GKSA 4L8CA 4NQXA 5IMMA 2JIXA 5IF0B 3V9FA 2VDQL 3JV6A 2EIEA 4YHIB 4YDKH 4G5ZL 4LFHD 1AKJB 4XPAL 2DD8L 3IU4L 4J1UA 2WIMA 5DURB 4WTZA 3P0GB 1JHTA 4ZOCA 4PLJD 3TFKC 5EORL 3VFPB 1C16A 2FJHB 3VCLB 5C0RL 3DV4B 3ARYA 2X4UB 4EN3D 4OFVA 1QPPA 3P2TA 5BOPA 4M8QA 1QACA 3QRFM 3I6LD 3FT2B 3K46A 5D1XA 4KVCL 2GITB 2YUWA 1I3UA 5D7IA 5I30L 3DMMA 5DD6B 5J11C 3IVKB 1MIMH 1HYRC 3QPQC 4DJMA 5EDXA 4GRLB 5F1KC 5I30H 3CXDH 5SWSD 5A3IC 4J3XA 1NGWA 2GW5A 5CJ8A 3MREB 4OCNC 4NQDD 2A6KA 1EFQA 3GEWB 4HIHA 1KNOB 4ODVH 1KPUA 1FJ1B 2ZUVA 3QEGL 1DQDH 1MHHA 3CJJA 1M05B 1T2JA 2WINB 3LKSB 3PQYE 4LF3A 5B4MC 3WE6B 5DLML 4LVNC 3G04A 4ZFZA 5C6WH 1JPGA 4NQVA 2UYLA 5FIEA 4OD1L 5D7IB 5BZDB 4NQXB 3NMEA 1NCBH 2XWJB 3S8WA 3RKDC 3IU3B 3H7BA 4QXTB 1K5NB 5DHYB 3FKUS 2EDJA 4HFWA 3KXFD 1AR1D 2CGRH 2G9HB 4X6EA 4F7TA 5T3ZH 1KIPA 2BOCB 1I9EA 4QRRB 5I76B 2LVEA 2Y07L 5IVOA 2Q7YB 4H88H 3MFFB 2EDFA 4R3SB 3G5VB 4LCUB 1B4JL 1A7BA 4Y19E 1RZ8B 4OUOA 1RK1A 5DT1H 5CKGA 3EJZC 2HJKA 4XVJH 4RFEA 1FL3B 1N59A 2KH2B 5DJ0B 5DI8A 2OJEA 4JVPA 4MD4A 3S35L 1E4XI 5TGBA 1NGXA 2ZUUA 3TN0C 3CFKB 4BKLA 1QRNA 2HYMA 4XRCA 3EYOA 1FE8L 1XF4B 4PJIB 1V7NH 3V5DA 4ONHA 4LKXB 4ZFGL 1HHJB 4NQSA 2FB4H 2J8HA 2WV3A 2HT3C 1RUQH 4K8RH 3MBEC 3D0LB 3TYFA 2Z31B 2F58H 3ZKND 4P4KB 2VLJD 3V2AR 4KI5F 4LARL 5E2VH 2W1NA 4Y4HB 5IEHB 1MFCL 1G7IA 5DR5H 4DZBA 1HQ4B 3VFUA 5FO9B 2JJSA 4JHWH 1MPAH 2VC2H 2LQRA 1N5YL 4WI2A 4HIXH 3UTTA 5D5ME 1QFWI 2L0DA 4WIQA 3O6FA 1V7ML 1I85A 4FXKB 3KPMA 3HTLX 3E6HB 3BWUC 5GHWH 4PLJC 5IMKA 3LQZA 1D9KB 1MCKA 3MRBB 4XP9L 1EJOH 1BD2D 4PJ5B 4KY1L 1DQMH 5JR1L 3DRQA 4YWGH 2NXZC 5DJDB 1IKFL 1D5MA 3GBNH 2FYYA 3QI9A 4M1CD 2YOCA 5LGJA 3F58L 4JO3L 3O4OB 2IPTL 3O4LE 3UPCA 2O61A 1FFOA 3VXQB 2PN5A 1NCAL 3LQMA 5BVJB 4KXZH 4JLRA 3VXUE 5HJ3B 4OM1L 1CD0A 4ODVL 2VERN 1KCRL 3MRBA 5T3XL 3O2VH 5EA0L 4PJIE 1IM3A 4UQ3A 2ZUSA 3VG9C 3ARBC 4KKAC 2KL6A 1P1ZB 1HILB 4X98A 2W65A 2DDQH 2ED8A 5T1MB 2PW1B 4PG2A 1KTKE 4XNUH 1IM9D 4JQVA 4F9LC 3DRTB 2SEBB 3GRWL 3RGHA 3ULUD 4JLRB 2PO6A 1MREL 4XPGH 3EOTH 1RJYA 5MENE 5FDWB 4X6BB 3GMPA 1A6ZA 3DXAB 4JREB 2X4PB 2VABA 5E03A 4HXBH 1DQDL 4CJ0A 3OHXA 2XTLA 3PV6A 1ES0A 5CIPB 5EBWB 3QAZB 4UOJA 1R3KB 3QXDB 3H9SA 3PGCA 4U1LA 3ES6A 4FQXC 5D71L 2BHUA 1KIQA 3H7BB 2X41A 5KVEL 1U42A 3TA3C 5GZOC 4K9EH 3VFOA 4LEXL 1D5ZB 1VENA 2A0LC 4RMSA 1HXMA 2NMSA 3QIUD 3QHZH 3MUY1 2VXUL 3HUJE 3HI5H 3PP4L 5DJZA 2PNDA 1UZ6F 1RUQL 4K8RL 4A6YA 3U30B 4IMLA 3U4EB 4F9LA 2XPGB 4H20L 3H3KA 2WQRA 2XN9D 3TYGH 1JHLH 2NY2B 4DN3L 5HYJB 5GSVB 5FKPA 4CVXA 4GXUN 1CE6B 3GSNL 1H9VA 5FYKH 3IFPA 4JANB 4RMWA 4QY8A 2CQVA 3UBXA 1JP5A 3UP1A 2EDNA 2G2RB 2DWEA 3D39D 3FT2A 5JPMB 2HJLA 2W07A 3PWVA 4CDHA 4MA7L 1FNAA 2HVJA 4LCCA 1SYVA 4D0DB 5L2JA 5DUPL 3DBXA 2W0FB 1W72L 4ZAKC 2E5EA 3EHBC 1PVHA 4U1IB 5EB9A 4EI5D 2IH1B 5DYOA 2A74A 4JZJA 1IFHH 1JPTL 1H8NA 2A6IA 5JXAL 1MAJA 1QKZL 2E27H 1AO7D 3Q48A 1A5FH 3DX7A 1KLGA 2DQIL 4M1CC 1YC7A 5CBAB 5F7FA 1K2DB 1TZHB 3FT3B 3T4YB 3MRFB 1ZT7A 1CDIA 3LKOB 1KPVB 3O3UN 4JM2C 3M8OH 4PREB 4CVUA 4ONGH 4ORZC 4YJZL 1ZMYA 1KTLB 2YN3A 3P4MB 1QBLH 4RAVB 3NAAH 4L4JA 5A2LH 4M7LT 2W38A 3WFZA 2PYED 1CFSA 2YD6A 5I0ZA 3KS0J 3GIZL 3PUCA 5FGRA 5KVGH 1YEHH 15C8H 2BNRD 2R2HA 3WXVL 1Z9OA 1X4ZA 4OFIA 4PD4K 2NQCA 5KANG 1MLCA 2MQ3A 5IVXB 4TSCH 4PLKC 1F13A 3CH1A 3HZVA 1MFBL 2EC9T 3MV7B 5E9DA 5EBMA 1YEFL 4UQ3B 1RHHA 4GBXB 3U83A 3ILPA 2N7AA 3F65A 4LLVB 5E9DD 5C0JB 3S98A 3L6FA 3MRNB 4KKLC 1CLOH 5CMAB 3QJHA 4KRLB 5JIIA 4C56E 3QIBC 5KJRL 2NY5L 4LVOB 1H8OA 1CDYA 1CLOL 5J0BA 1A47A 2ICWJ 4I3RL 4HG4K 1JHKH 3OGCB 5TDOA 4NCC2 4QRPA 5GRJL 4WFFD 2OL3B 2AXGA 3BP5A 8CGTA 3VJ6A 5DFVC 4OCYH 3VE0A 2AXJA 3OKDB 4WHTA 4WUUB 1T1ZB 4OIIL 5CD3B 4FQXA 4N0YH 2E7LA 1AGFB 1EGJA 3HMWL 4F57H 5F1IB 1PLGL 1KCLA 4MJ5A 2IEPA 2D03L 3DX9A 1RULH 2XTJE 3KPRE 2MNUA 4JFFE 4JAMB 4Z7QE 3O41B 35C8H 2IANA 1HQ4A 3FTGA 2R1YB 5EOQL 2I9TB 1N4XH 4GMTL 1LO4L 3V0VB 3VRIB 4UTBL 5KVDL 3KPSA 1W2KT 3MRRB 3S88L 1DBBL 3RKDD 1RIUL 4NQCA 4OCMC 2XKNA 5GGRB 3KPSD 5CWSA 2CK0H 5HYSA 2DQJH 1LO0H 5IB4A 4JFZH 2NY7H 4HWBA 4EI6A 3KLHC 4PB9L 2FR4B 5D93C 3MYJB 4BSVB 5DO2D 5I1EH 2EDBA 5EG6C 4F58H 1EVUA 3PXJA 1DVFB 4PJEB 3TGXA 4OZFA 5CHNB 2HLAA 3BPOC 4P48A 4GKNA 4HQQH 5J12B 1YUHB 3BZFA 3IETB 2WBJB 3P77B 3O3AB 5CGYC 4NUJA 2Z31D 3OAUH 5EN2A 4YEEA 4RZCB 4W70A 2ZUQB 2D7NA 2EIBA 5D2LF 3QXAA 1DLFL 5D7LB 2J6EL 3FL7A 3MYZA 3QUXD 4XBEL 3D85B 1WEJH 4L29A 4Y4HC 3VRJB 4E0RB 5IV2B 4M7LH 3ARVA 2Q7YA 4MJ4A 3V6OA 2IPUK 4Y5YA 5IFAL 4H5SB 2ZG2A 3SDYL 5KSAD 2YBRA 2FX8L 5A43C 1MF2L 4POZC 1JI1A 1HOCB 1MOEA 5MP6H 1D9KD 2A6DA 1F58L 1PAMA 1FO0B 4EQ2A 4ODXB 3MLSL 3IXTB 2ADGA 2XRAL 4MA8H 4M48H 2IQAA 3WIFB 1NFDA 5I1KH 1OPGL 3KLSA 4XPTH 1KPUB 3WSQL 4JFHD 2GJ6A 4E9LA 4D0DA 5L2JB 2VH5L 2OLDA 2W9LA 1DEEA 4PRDB 3EFDH 4DAGL 1SBSH 2DMKA 4S1RH 2KZWA 2DLTA 4ZQKB 2BJMH 2X70B 3F58H 3UPRA 1RPQA 4D94A 1S9XB 4LPUA 4NCC1 5ICXA 3BZEB 3B9KA 1JPSH 5HVHC 2D4DA 4I8DA 5DRNA 5FYLH 5C0AD 1AD0A 4H1LH 1ZAGA 4DQOH 3MXVH 3KYKH 1G1YA 2XIDA 5F89A 5I1LA 1ND0A 2RIKA 1R5VA 4IOFD 4HLJA 2QJDA 3AAZA 1PY4A 3T0EB 1T2QL 5TDNA 4Y2DD 5F7NC 2NXYD 3TJEL 2B4CC 4HUMB 1WJ3A 3BWAB 3O11A 3R4DA 1K85A 4GG8B 1NDMA 1EO5A 5F44A 4U1MB 4O2CA 3S7GA 3VDCA 1ES0B 1UH3A 3S96B 4EOWL 1OAZH 1J0YA 2FR4A 1IAIL 4NQDA 3MRKA 1DANT 3KLAA 4JFQB 4AIZA 3ISWA 3RGVC 3QUML 3RWJB 4V1DE 3IKKA 1ED3B 3JVGA 3BI9X 1EFXD 5IBLD 4HS3B 3GJFH 1I8MB 3VXSA 2P4AB 4GFTB 2AQ1A 3GMQA 1WC7B 1DBJL 3WDHA 1FG2B 1SHMA 1FSKC 3PL6D 3DECA 3GI8H 1N7ML 3LMJH 4EOWH 4Q9RL 3KXFB 4OD2B 2CXKA 3U0TA 2ED9A 3QWOB 5D8JH 3UDWA 4QGTA 2CRMA 3D25B 1AC6A 2HRPL 3PNWB 4I18B 3G5ZB 4OB5H 1PDKA 1MCIA 4DUVA 1IL1A 5D1ZC 1WTLA 2VQTA 1RUMH 4JFPB 3WS3B 4Y5XB 2Y5TB 3CLEL 1FFOB 3VXQA 2IBGA 4FFYL 1Z6JT 4LP5A 5CSZB 6FABL 1OCWL 1S9WA 2EICA 1VADB 4ZFGH 3MRMB 1CGUA 1Y6KR 1LDSA 2ZCLL 2JB5H 1P9MC 3VWJA 2ADFH 1IGYB 1FE8H 3PL6B 5DFWH 1AO7B 1RZKL 5IGXL 4CU6A 3FO1A 4YK4C 3LIZH 2QKIA 4G80A 3RVXD 3FAWA 2QR0B 4KKBD 1INQB 4WFEE 5CJQL 3T0BA 1D9KA 1J18A 4JM2B 3TNMA 1BIIB 2HRLA 1QEWA 4I77H 2FIKA 1E4XL 2Z91B 2J8UF 3BQUD 1G7LA 3H0TB 4KROC 3O2DL 3OG4B 1OGAD 4NO5A 2EO1A 3RWHB 4HFUL 1KTLA 4Z0BH 3VFGH 1JN6A 4HK3J 2YD2A 1MLBB 4XPTL 4EDWL 4KGLA 2HTLD 2VDRL 3LDBB 4JO1H 4WO4C 2DI9A 3SKUD 1FNSH 1CCZA 4GQ9L 3UZEA 4UT7H 4QHLA 4LVHC 5ICYB 3TIEB 2N7BA 3D25A 3ZDXE 2ZG3A 1T6VN 2DL2A 3MTRA 3TZVD 2KQNA 4JZJB 3UTPD 1I8LC 4PJ5D 4N0CC 1G7PB 4PUBL 4XPHH 2ZUTA 4EUPH 4PJFF 1YEFH 2HA1A 4LCIL 3E8UL 5B21A 5B4MD 1NUNB 1CU4L 2HJFB 3DVNA 4UOW1 2X9YA 3N1QC 5CKAA 2GI7A 5DDHB 5KW9L 1RK1B 2A1WH 3RTQC 3Q6FA 1D6EA 4CU8A 1PG7W 3AU1A 2Z35A 2YXMA 4R3SA 5SV4A 5AWNL 2D7PA 3QCTH 3VWKD 2DTML 5HDLA 4QEGA 1NC4D 5T1DH 3V6OE 4X6CF 4NSKB 1NUFA 2X40A 2X7LB 2BSRA 2W60A 5C0RH 2IAMD 3PWNA 4JFDB 5KTEH 3X17A 4PRAA 4LCWB 4OQ1A 3C5ZB 1MQKH 3TEUA 1OD7A 4RFOL 2R1YA 4G9FB 3AVEA 3HR6A 3JTSB 3CNKA 1C5BH 4RX4A 1FPTH 4F2MA 4WNQA 2ADJA 3B3IA 2PO6C 3PABB 1LWRA 4ZD3L 3NFPB 3OF6A 2OR9H 3OR6A 2D0GA 5J12C 1T5WA 1T83A 2JCCA 3K81A 3QPXL 5EFIA 3X11B 4WI6A 5F7UA 4OFKA 4PJFE 5C0CD 4G8FA 4JDZB 4P2RE 4TUOA 3MRDB 2QQKH 4ZQKA 2OI9C 4XCNB 3MQIA 5TPWH 5H37G 2NY4D 1FDLH 3NFNB 5ITBL 5TQ0L 2V7NB 1GHFH 3I9GL 4ZUSB 4LVNB 1R5WA 3WUWA 4G7YH 2BVQB 4FFVD 4P5TB 3W5NA 5HYJD 1WCQA 4PG9A 4GBXA 2YD1A 3GHEL 4UV4H 3TT1H 4O2FB 5HPMA 2Z8WC 4RFNC 4MA1C 2GY5A 1CZ8H 3C5SB 1CI5A 1X4YA 1DE4B 5C8JB 5GGQL 1DVFA 4PJ7A 4NQTA 3V6FA 3MLWL 4YE4L 4PJHA 1EPFA 4JCMA 3AREB 1RIHH 1U3YA 1DL7H 4F8TA 5IMLA 2Q7NA 4Y89A 5E6ID 4U0RB 2NLJB 4TUKH 4PUBH 3QI9B 2CDEA 1FBIL 3WJLC 3B9VA 4LPWA 4PREA 3LN5B 5CEZE 2FD6H 3HG1A 4M6AA 3VXNB 1NEZA 2DF3A 3O4OC 4XMKL 1JL8A 5F1SA 4YHNA 2V2TA 1DE4A 1TZGL 2EXWD 2RB8A 1OWRM 1MCBA 4MQ7A 4N8VA 4X4YB 1NMCC 5SWQB 1GGUA 3S3JA 3VXPA 4Z77B 3JXAA 3GK8L 2DQTH 3JTTB 4V2BA 3QUYD 4GKZA 4XXDA 3PP3K 4XVTH 1MCEA 3IFLL 4JO1L 1JPTH 3DJ9A 5E6ZA 1G1CA 1IGCH 1YEJL 4JFOB 4WVRA 4KRPD 3T0EC 2AV7A 4EI6B 1FC1A 1ZANH 1S78D 5C0GA 4KU1A 5GGRA 4QHNB 1L6ZA 3C6LB 4QRPB 3S34L 4PRBB 3HMXH 1IQWH 2QHLA 4WV1C 4L4TE 4G6JL 3SDCD 1LEIA 2F53B 1GC1L 1E4KC 4W4OC 4QHNA 1S7SB 3WNLA 4BH8A 2V7HA 2DQTL 5DXWA 1AGDB 1N2RA 2ARJQ 4ZXBA 5EU6D 4JREC 4G9FE 5H2BA 1J9CT 2NZ9D 4PJEF 1PY9A 4G8IA 2ADJB 4DUWA 5DK3A 3KPOB 1DN0A 5C86A 2VXQH 1HHHB 1I1AC 3SN6N 5BRZB 1MRDL 1RUKH 4QTHB 3P11H 3QULB 2PO6D 5D7IF 5ILTL 4PRAB 4DVRL 1Z0MA 2DQEH 1T1WA 1P53A 4GW4A 2JTDA 3QHTC 4ZOEA 4GW5B 2YMXH 4YFDB 3NCBB 4FFZH 4S0SD 1JZ8A 3RGVD 3MRFA 2GK0B 4UT9L 4XCCH 4GAGL 4GMSH 5GGSB 3JV4B 4DGIL 4ZAKD 1Y18B 3VFSA 2NR6C 4Z7UF 1FJ1A 4FFVC 1Z2KA 3TCXA 3RIAF 4YHPB 5F7DA 1QBBA 3WKML 1P7QB 5T1LB 3RPKA 1FNEA 4PRIB 2FEEI 3MLRH 5HD8D 1KTRL 2I24N 3B9DA 4M9OA 4EZMA 3K8LA 2GY7B 3WIHH 1A3RH 2IJ0C 5DHVH 2V7NA 3ULVL 4YK4B 4OKDA 3C8DA 4XNZC 1M1SA 5EULV 1X5HA 4UU9B 1VEMA 3IT8D 2FHBA 2FIKB 4QTIH 1A7NH 3DYMA 3QPXH 5DS8B 1DVFD 2R1XB 3IDIB 1OLZA 2OCFD 4ETQB 1GGIH 4N0UB 4NZRL 1UWGH 4FQCL 4KROB 2VLLA 1NBYA 4S10A 3D39A 1P7QD 1AHWC 1KULA 2M8XA 1F58H 2BVTA 3BQUA 1Z3GH 5F1OB 3MV11 4OFYD 4U1KA 2PETA 4B0MM 4PJXF 3UROR 4OZIE 1MWAL 5CSZA 5EO1A 1J1PH 2DIAA 3WIFA 2NY2C 3DV6A 1X5JA 3QB7C 5JW5B 5JR1H 1JMZA 1F11B 3MZGB 3RNKB 1I3VA 1QLFA 2ITDB 25C8H 4FXKA 3QO0B 2FD6L 3KPMB 3TJHC 1F3DJ 1P5UA 4DVBA 1JTPA 2R56H 4M7ZC 2J8OA 1VSCA 4K3GA 3EYVA 5JMRA 3FQNA 3QUKA 4U7SA 2PTTB 3HE7A 1AE6H 1BM3L 5LXGL 2P24B 3U4AA 1Q9OB 1DZBA 3BPNB 1PKQE 2YC1B 4KAQL 2ZSWA 4CVZB 4GLRH 1K3ZA 5DD0H 4QT5B 1UYWL 2R4SL 4JPKL 4QRQA 1OGTA 3L5HA 1IKNA 4LSQL 4M48L 4D9RE 1J05B 5JORA 4WFHE 2ZSVB 5C07D 5GRYA 4POYA 4QLRA 4NNPL 4N0CD 3WIIL 3PNWA 4X99B 5MP6L 2VKWA 4Q0XL 2Q6WB 1NC4A 1UZ8B 4ODWB 2VLJE 4G7VL 1HSAA 4JHAL 4M7KH 2FX7L 4OSUH 1KBGH 4BSVA 2X42A 4LCWD 4JJ5B 4Z7QF 1XGRA 4MA3B 5EBLA 5I71B 2JCCE 5K59F 2NXYB 1J05A 4RBPH 2BHYA 5JORB 3TPUA 3LRHA 1NUGA 5D9SA 1T7VA 3MLVH 1OP5H 5GSRB 3GO1L 4JAMA 4Z7VF 3GSQB 2C7UB 1A7PL 2BFVL 3EYUL 3HZYA 4P2OC 5D1QA 1BQHB 2APXA 4NZDA 4KK9D 3BHBA 4F58L 4ENED 1J7VR 2D31A 1T4KA 3S3SA 2FX7H 1XF5B 5KAQG 1BJMA 2COQA 3BIBX 1TLKA 1UG9A 4LOUC 3OKKB 4OUUB 4DN3H 4PG9B 3GGWB 3ILQD 3QEGH 1FFQA 4E5XA 4LDEB 4YQXL 3VFNB 3K2UL 2ID5A 3UYOD 2R0LL 4X5XB 5FECB 3DBXB 3OR7B 5KS9B 1QSZA 3PWPA 5CLWA 3ARFB 5DJDA 5I17B 4F80A 3N85L 2EE3A 2EDQA 2K7PA 4ZUTA 5JNYB 3WN5B 5CJBA 2VWEE 2Q8BH 1QFPA 5GS3A 3WNNA 4TPRL 2A6DB 4KV5F 3AMKA 1IAIM 3M07A 3U9UA 3K74B 3WFBH 3NCJL 2FBJH 2AKRB 4PTTA 5D71H 5E6IB 4EUPA 12E8H 5ESQA 5IESL 3GM0A 4YDIL 5F7YC 2UZIH 4W4OA 1FIEA 2HT2C 5LKNA 4KK8C 5LG1A 3FOMA 3CFDB 4PJFB 4Z7WE 3VXSB 1NEUA 1EH9A 2H2SD 4PTUA 1ERNA 4HK0B 4OD1H 3IXTA 3IETA 1D6VH 2FDBP 2E6QA 5BW7C 1HH9B 2D7MA 2X4NA 1I8LA 1VFUA 3HUJF 1TVHA 1H5BA 3MNVA 4CMMA 2FGWH 4XNQB 5JXED 4GXVL 1YEHL 1T89A 5J57B 3CVHB 5ANMB 3T0DA 4HK0A 1BAFL 2VDML 5AEAA 5T33H 4YZFF 3LQAC 1KACB 2ZUYA 2NW3B 1GYAA 4XMLL 3F5WB 1U8NA 2AQ2A 2DQCH 5KSBF 4GG6A 2EH8L 3IDGB 2YK1L 1RZKH 2GEEA 4ZUWB 5I1LB 3GBNL 3QWRA 1QP1A 4GKOA 3V6ZB 2V5MA 4JKMA 1EFXA 4NRZB 5JXAH 5F6IC 1EHLL 4TQEH 5CEXB 4BUGA 2A83A 1OHQA 1HIMH 1VB9A 3RA7H 3MJGX 4U6HA 1JGVL 1T3FA 5CP7B 4EEEA 4UBDC 3REWA 1BREA 3MGTA 1B9ZA 1HN1A 1QRKA 1G7QB 3ARFD 1MAMH 3OBAA 3VW3H 3IAPA 3QEUA 3U46B 1FNFA 2AEPH 2MKWA 1P69B 3MNZB 3DRQB 5C0GB 5JOFA 1B0RB 3WFHB 4K2UL 2HTLC 3L3DB 1ITBB 3Q6GL 1AKJA 2A6JA 4WW1A 3NPZB 3BIKA 2B1AL 3CAFA 3HPJA 4IS6B 5JO5A 1XF2B 4E41E 1KIQB 3W0WA 4PRHA 2IQ9L 3H42L 4XVUD 1R3KA 1M7XA 1FL6B 3DTXB 3VGBA 5FYKE 4JG1H 1KB5L 5KZCB 1FH5L 3BSZH 1VGEH 1UH4A 2FNBA 4X6CA 3TPUB 5D6DA 5CD5C 5IKCB 3BH9A 5D1ZB 1H15B 4DGIH 3ARDC 2NYYC 1BGXL 5H37H 4ZDHA 4N90E 2QQLL 5F9JB 2E6JA 1MPAL 5KSBA 2GK2A 1N5YH 4GG6F 5T3ZL 1NFDE 3SDDB 1YUHA 3KYNA 4G6AD 1OAXL 1FORL 4XTRC 4YBLB 1FIGL 3MRHB 4UTAH 3WD5L 2Q3ZA 1RZJH 3FN0H 4Y4HD 5HPMB 1A2YB 3I84A 3L3OB 4OF6A 4Q2ZA 4UV7H 5T3XE 2ZSVA 1I8KB 2MHAB 1C12A 3P11L 4X5WA 1RZJL 5D1ZA 1QFOA 3E2HC 1INEL 4JDTL 4LRIC 1CFBA 1UACL 3NH7H 4KKCC 1EJ6A 3K2UH 4Y4FB 3V6OC 5B38A 4CADA 2AJSH 2YPLA 1XZ0A 1P84J 2DLEA 5JXEC 4HK3N 2J6EA 4TUKL 3PGFH 2DWDB 4KHXH 5E56A 4G3YH 3MV9A 4HC1A 3SKNB 5CBAA 5T3XH 1ZT4B 5D7JA 1A6WH 4RWYH 4EDXB 2XTJC 4FOMA 1JNLL 4HW6A 3RY6A 2DRUA 1MIML 3FQRB 1XT5A 1JE6A 2EIZB 3FHAA 1CICB 1KFAL 1TCRA 1INEH 4JDTH 1S7QA 1K8IA 4EKXA 4G9DB 5FM4A 3RI5F 4QNPF 5I66A 4HIHB 4YC2C 3GHEH 1AGCA 1A5FL 1OAKH 5HHQB 2W0FA 2OL3A 4ONFH 2R29L 4GW1B 5DVOA 4L8DA 1EJOL 1S7QB 4XP9H 5E00B 1J8HE 1MF2H 1SEBB 3GK8H 4LLQB 3TIDA 1AXSB 4LQFH 3Q2CA 3HHRB 1DTUA 3QPQD 5DJAB 1ZVSB 3HFML 2P5WE 1CXKA 1MHCB 4PJ5E 1KG0A 3DSNA 4EI5C 1I1AA 3T2NH 1RZFH 2VDQH 3W81A 1M7DA 4OLXH 4OBRA 1I7TB 5DDHA 1NCWL 2G60L 4OT1H 1N6UA 4F7PA 5KVGL 4QRPD 4WO4B 1IEHA 5IQ9A 2CLVA 1EHLH 5F9DC 1RZGB 5D7SL 2XFXB 4LCUA 2PCPB 3OB8A 3BGMB 2GJ6B 3NOIA 3L3KB 3UX9B 4EUPB 2VDKH 4RFOH 1OB1B 4H20H 2XXCB 2DQUH 3MRGB 1PZ5B 4JRXA 1VFAA 3IKCB 5C6TL 2I27N 5TE7H 5JOEA 4P2YA 5HYQA 3U0PA 2CSPA 3TNNB 1UT9A 3HB3D 3UJIL 3QDGB 5KVEH 1E27A 2YR3A 4HUVB 5M95B 1NCTA 4GLRI 4YHYB 1N64L 2D9CA 4MA3A 5EBLB 4P2RD 1OLLA 3VFNA 1TETH 5GS0D 1P4BL 1CF8L 2VLME 4N0YL 1IZKA 3QFJD 5SWSE 1JWSB 3FB5A 3GJEB 8FABB 4IM8A 4ZMAT 2GJZB 4OF3A 4MNHB 3WN5C 4QRRD 3F12A 1U8HB 3MR9A 1T21B 2E7BA 4GT7A 2JCCF 1YYML 4NPYB 5DD6A 5EOCL 1M7DB 2B2XL 1XF2A 4JG1L 1BOGB 3U2SB 3WN5A 3DNKA 4CVWA 4KKCD 2NX5D 2F54A 1BQHA 3GBLA 4U1HB 4KZDH 4HUUB 4R96A 4ELKA 1HKLH 3LKQA 1XGYL 3IS0X 4K94L 3H8NA 4Y16C 3RVTD 5F1NB 3WFBL 4U3CA 3VWJB 1T80A 1MVUA 1XGPA 3SDCB 1N5AA 3C6LA 2FYYB 1JWUA 5C6PB 4QRSA 1QNZH 4TVPH 3OKKA 4GRLD 4K7FA 1Q72L 4G9DA 3BMWA 3FTGB 4I3GA 4N8CH 1QHOA 1IL1B 2PKDA 3VFOB 1T0NA 2HFFA 4JY6B 3E0GA 5I75C 1E4XH 3OJDB 4MQ7B 3MRHA 4PJ8C 3T0ED 4PJXA 2EC8A 2NTFB 1OARL 4PRIE 1HQRA 3GSRA 3HAEG 2Y25A 1KV3A 1T1ZA 1U8NB 2VXVL 4HJGB 5DJ6B 4KUZH 5GSRA 5I15H 3JWNC 3QUMB 1JUFB 3VRLE 2CLZA 2IPKA 4Q97A 1A6ZB 4CADB 5GRVK 3GJFA 5J1AA 2FCBA 1GC1C 3BUTA 1T66D 2XICA 3ZYIA 4WEUD 3BPCB 3VI3E 5EBGA 3LPGA 5FCUL 5GGTA 3O4LA 3V6FB 5F6IB 4F7MA 3DIFB 4PJXE 3CFEA 1CXIA 3JUYA 1K5NA 5DHYA 4PJXB 3P9MA 2QADD 1GZQA 4U7KA 1GGTA 3CH1B 3HZVB 4JZOB 1L9NA 1RQ5A 3F7QA 1T03H 4KK6C 4OFDA 3HC4L 4EBQH 1GC1H 1ZHNB 3LKNA 3KNBB 4ZTPH 3OX8B 4J4PA 3WFHA 4LSTH 2FGZA 1NCNA 5F89B 2V9TA 1AC0A 1TNNA 4P3CL 4RISH 3WUZA 5ISZE 2R4RL 1NBZB 4NFCA 5EU5A 3DSFL 2AQ3A 3OMZA 4PJHE 5HHXL 3U30C 5KVMC 1E27B 3QRGH 3D6GA 3K4AA 3JUZA 4MS8D 3MCLL 5FAAA 1UCBH 3KWWA 2HVKA 4PRNB 2PTTA 3GZKA 5I19L 5J13B 1KT2B 1QYGH 3W0WB 3IDXH 5LJYH 4FMFA 3C08H 4UTAL 3U4BH 3UPRB 4Z7OE 1OT1A 1DBKL 2UY6A 3ESVF 1YECL 4JN1L 3QHFL 4WU5B 5DD3H 3DURA 2NNAB 4LEOB 4M7KL 2EEDA 5D1QD 5IBTH 5BW7A 1G7JB 2Z31A 4G8GA 1YY9D 3GI9H 4EVNB 5D2NA 4IMKC 2ZCKH 5EIIA 4KQ4H 5DTFB 3K4ZA 3IDJB 1E28B 1P2CA 4WJ5A 4JO2L 4PJ7E 1KT2A 1VGEL 3MXVL 1YNKH 4L4VB 3CCHB 4JRXE 1RK0B 3SPVB 1WWAX 2C7UA 4OLUL 5DD5L 1F42A 4IRZL 2DJUA 4F3FB 3WFDL 1NGXB 1DBMH 1MCRA 3SDAB 3SGEH 1BFTA 1GOGA 3MOBL 5DJ0A 1IAII 5E8DL 3WJJA 4WFED 2XZZA 5BV7L 4GAYA 4NHUA 2FLRT 2OJZL 4PP1D 5C09D 5I8OH 4Q9QH 4HCRH 2JB6A 4L9LA 1BQLL 4HKBA 1AP2B 5JUEH 1CICA 5DC9B 1IT9L 2EKSB 4JFFD 3BP7A 4QCIA 2BNUB 1S3KH 5IMMB 5D7KD 3A0OA 5JZ7D 4NYLA 2XWTB 3HE6A 1JI2A 4HXAL 1ZT4A 1J88A 3SDDA 4D0BA 4QXTA 3STLB 1BX2A 4WWID 3OKOA 3GFUA 4WFHD 4ZUTB 3INUH 2E3VA 4Q74A 1WVZA 2G5BA 4MNQE 3QDMA 4BZYA 2D3VA 5FA4A 2KBGA 3MACL 4X6BA 3P4LA 4NO5B 2CLZB 1PW3A 2CO6B 2BSSA 3CVHH 4U6XA 1GXEA 3EO1A 1S7UB 5C0DB 2OYPA 3F7VA 2BK8A 2OMBA 5ACZA 5CEZL 4JPKH 4A2LA 4LSVH 4R7DA 4XP5L 5I6XB 4KPHL 1DCLA 1OSPH 5BVPL 2YPKA 1EHXA 5T5FL 3VE0B 3IFOB 2V7HB 2HFFB 2PYEB 1Z9LA 4ORGA 5ENWA 3V0WH 5ALCL 1XGUB 2XA8H 4P9ML 5F9JA 3U48A 2R1WB 1TQCC 5CD3A 2RAMA 1OTTC 1CR9L 4FQIL 4Z8FL 1G84A 3VMNA 3IJYB 3QEUB 3U46A 1D6VL 3IDYC 2DJSA 1BFSA 5GRUL 3SE9H 3BN9C 3ZT6A 1ZTXH 1QSVA 3TBWA 3REWB 4OZGA 5D4QA 1SM3H 3ROOA 4MWFB 2MMXA 4FXGB 1V5JA 2AERT 5EU7E 6CGTA 5DMKB 1H3TA 4GQPH 5IHUL 2DLFH 4H0HB 1T4KB 1IZJA 3CUPB 4HIIA 1GPOL 3BKYL 3OB0K 4MJIA 4Q58C 4R0LB 4RNRB 2Y1VA 4EI5A 1JF6A 1VEOA 3S4SA 1KN4L 2VYRE 2R2EA 3BYTA 1CTNA 5JTWA 5H94A 3NGBC 3ALPA 5C0DA 5T1LA 4S2SA 1I1FA 2CKBL 5F7HA 1MIEL 1GL4B 1KEGH 4DTGL 4FMKA 3DYOA 5E2UL 4PY8I 5TE4L 2VTFA 5HSFA 2WANA 5D5MB 5L0QB 2GK0A 3QEQD 2V5YA 1QFHA 3MNVB 4IDLA 4CMMB 1LK2B 5DGRA 1TVHB 1IGIH 1KLGB 3BQUC 2EZ0D 2VITA 3DX7B 1R3HA 1NGQH 4JKLA 2OP4H 3VI4F 5HYJE 3WNPA 4WHYH 5AYUL 3T3PE 5I71C 3KPLA 5A2KH 3OV6A 2BNUA 1P9MA 3VWJC 1D3CA 3QUZC 1WBYA 1CG9B 4XI5C 5BV7B 1P7KA 4JJHA 4LCWE 3TO4D 4H1LA 3FOMB 1IQDA 5INDA 4KDTC 4DKFH 3TN0A 4EJ1C 3QEQB 3L3HB 5F96L 2W0PA 1LE5B 2FH8A 2CIIA 3VXOB 2G2RA 1WGOA 2DAVA 4E41B 3SDDD 3PDOB 2FATH 2DQFA 2BNRA 4RRPA 1T0PB 3MUGA 5TPWL 1KCSH 3B5GA 4F2MB 2O26U 1DFBH 3JWDH 3TLRA 1SY6H 1V05A 4G5ZH 1YA5A 4TOYH 4L5FL 2CUIA 4ZFOB 2JE8A 4XCEB 5FUZL 1Q1JH 1KIRA 3RTQD 2LVCA 2YPLE 3B9AA 5FHAH 3ZKMC 4FQ1L 4M43H 3QEHA 4PGCA 5HGHA 3CVIL 5J6HB 5LWYH 4XGZA 2B5IB 5KANI 4M43L 1OAUH 3OKLB 4Z77A 4X9HA 3QH3A 3NA4A 2M26A 2Y5EA 1W0VA 3TIEA 4LAQH 3CDCA 4A2MA 2I25N 3IXAB 1AGEA 3KAAA 1IGML 4RA3A 4PP2A 4JG0L 2UY7A 3NAAL 1FVDA 1G6RB 2XWBB 1FZKB 2OXHA 2VABB 2I60L 2N1KA 4XH2B 4Q6IC 4ZPVA 2C1OA 5IHLB 1OW0A 3PXHA 1OP3K 4RMUA 1NPUA 3S5LA 5DD3L 1J8KA 1F4YL 3LOWA 2ILLA 1FSKB 1JVKA 1HSAB 1WZKA 4N8PA 4K71C 1TJGL 3FQXB 1IM3B 2K9UA 3P9MB 2Q86A 3P9WB 1UC6A 4M4PA 4TNWF 3VXMB 5ILTH 4QXWA 2OP4L 5EC1A 1MHCA 3HR5A 4RAHA 2EYTA 2J2ZA 1JN6B 3PWPE 5BRZE 3SGJC 3VDAA 3IRZA 1A4JA 2VH5H 4NN7B 1JF5A 1ZS8A 2ZKHH 2LU4A 5IKCA 1NAKL 1NGZA 3DSFH 4E41D 3WIHL 5T1DL 2BY1A 3TN0D 2AV7B 5GPRA 1A6PA 2HWZL 3QIBD 2MOVA 1M7IA 5D6CA 4RDQF 1JZ2A 3X14B 2ITCA 5E8PA 2RHEA 1K4CB 5SWZB 1Q72H 1QSED 1TTGA 2DDQL 1AGFA 3ARQA 5K9JL 4L4TA 4HIEB 1B90A 2VKXA 5D6CB 3QG7H 4NKDB 4YHKH 5T3ZD 3UTTB 1MCLA 1OP3H 2CR6A 3VXME 5AZEL 1K9TA 4XBPB 1NEZB 3AAZB 5DMYA 5IIEA 1TTUA 5EO1B 4K9EL 2ZJSH 1I1AD 1ACYL 3L5WA 4YHML 3LQAL 4RWHA 5TJWK 2FL5A 1FO0L 4ALAL 1U2HA 1DSFL 3LDBC 1PG7X 2EDOA 3GMMB 5SX4H 12E8L 3DPBA 3HG1D 1LILA 1RJCA 4X9BA 4M7LL 2D7OA 5DUBA 1TJGH 1WIOA 4LLDB 5FXCH 1MHEA 4PJIA 1U8JA 1GCFA 1MCFA 4XBGA 2NTSP 2DICA 1YEGL 3UCRA 4N1EA 2XY2A 5D7JD 4P3DA 2YKLH 5D2LA 3C2SA 4X99A 3CLEH 4PGZA 5E70A 1U8IA 4Y8AA 3D0VB 4M1GH 5IG7A 2XA3A 2YPVL 4PJGB 3BAEH 2OQJB 2GSIB 1RIHL 3TBVB 1CG9A 3QR2A 5H35A 3B5HA 4OQTA 1TVDA 4BYHA 4NZUL 3TM6A 1RZJC 2E9JA 2BRQA 2IQAB 2PYFA 4G6JH 4QKXB 4WUKL 4YHPA 3MV9D 1KCVL 5C3TA 1NLBL 2R2BA 2X9XA 2GTZB 2IALB 3ARBD 4GAFB 4NKIH 4FQ2L 5EZJB 4EN3B 1MJJA 4DGYL 2Z92B 5HHPB 4ZOBA 3IU3A 2R2BB 5B39A 5KSAC 4HWUA 4TNVK 2ATKA 1H3PH 1MNUL 1KN2L 3HZMB 5IW6B 1WEJL 5GXBB 2DQHL 3QYCA 5FHAL 1KIRB 5T3XD 4MMXC 1JGLH 5SWSB 3UAJC 1KN4H 2J3SA 2HJLB 4Q9CA 4AH2B 4ODHH 5BS0D 2GT9A 4KVNL 5DRNB 2HLAB 1Y18A 3JWOH 3SDXE 2BDNH 2B1HH 4