5FYJE

Crystal structure at 3.4 a resolution of fully glycosylated hiv-1 clade g x1193.c1 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
213
structure length
213
Chain Sequence
SVLTQSASVSGSLGQSVTISCTGPNSVCCSHKSISWYQWPPGRAPTLIIYEDNERAPGISPRFSGYKSYWSAYLTISDLRPEDETTYYCCSYTHNSGCVFGTGTKVSVLGQSKANPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjE02
4P5TC 1J9CT 4HXBL 4NSKB 3VFRA 3Q5TA 5FKPB 4PBWD 1A3LL 3QUZC 5J12C 5SX4H 3ULUL 3BHBB 4M6ML 1MEXL 3GHEH 4PRBB 4QRTB 4D0BA 3CFIC 3C87A 2FLRT 3IJSB 5I19H 4GAJL 4D9LH 3GJFK 1SY6A 3RX5A 2IPKB 5CHNA 3VJ6A 2UY6A 5TF1H 1OSPH 4XWGL 3LKOB 1F4XH 1KLFA 5CP3A 2HRPL 2ZSVB 4JFFB 4U1JB 4X7EC 4IJ3B 1UACH 1MREH 4LSVH 5IJKC 1D5ZB 3P30H 1GCFA 5GRJL 3H9SB 2J8UE 3LIZL 1EFXB 3QQ4B 3CGTA 5CZXD 4K3GA 1ZSDB 4JKKA 3VD9A 1U8PB 1FL6B 4F7PA 3F8UB 3QEQD 1KIQB 5CJOH 5CS7A 1S7UB 5JOEA 1RHHB 3CSYA 3T8XA 4RFEB 2B1HH 3C8KA 1KLGB 5KSBE 4GFTB 1N6QL 3F7VA 2NTFB 3HZKB 2FEEI 1EBAA 3VD5A 1BD2D 3LB6C 3BIBX 3NCYS 3ARRA 5H2BB 2EKSB 2XTLA 3E0GA 4NJ9H 4KHTH 4NQCB 4DUWA 3MZGB 4EQ2A 4NQDE 3FB6B 1QR4A 2YZ1A 4G80A 4Y1AA 1AD9B 1X5YA 2UUDK 3U6RB 1E6JH 3SDXB 3D39D 3OR7A 5LWYL 4XAWH 4Z7WE 2QV2A 4K2UL 1A6AB 4JO1H 4XPAL 1INQA 3LEYL 2G9HB 4J4PA 4U1IA 2KZWA 4YHYB 5HPOA 1I3UA 2Q8AH 3OKOB 5BQ7B 3QDGE 1I9RL 1XF5B 5JIIA 2B4CL 4HUKB 1BGXL 4M48H 4Y8AA 5DEGB 4Z18A 4TTDC 3ZTNL 4WJ5B 3NGBC 1MUJA 5DJYA 4W6XB 4M6OL 2VLRE 3PWLA 1KBGL 3MRQB 4FTVD 1VEOA 4PJIB 5KSUB 3VFSA 2C5DC 4YDKH 2HH0L 1A1MB 2I26N 5FYKU 3AFLA 2BC4A 3M07A 5F88A 4WUUD 4UOW1 3U7YL 1E4KA 3ARXA 3JBG7 5CINH 3F5WA 5FYLL 4R4FH 2Y06H 1ZT1A 4KPHL 4XT1C 3W2DH 3TM6A 1IGYB 1MY7A 2XFXB 5GGUB 1T3FB 3MGAA 3S96A 1MJ8H 1D5IH 1CE1H 1B0GB 5IVZB 5GS1B 3W9DB 4RDQG 3FO2A 4Z78A 2BMKA 1KJ2A 1NLBH 3HC4H 5EU6B 4M7LL 1F6AB 3IXTA 1YEGL 4ZO9A 5EBLA 5ITFA 5DVNA 5BRZE 2BVQA 5FM5O 1OTTD 2XG5A 1NCCL 3HB3D 3IJYA 1ZVHA 1AD0B 1XF2A 2FDBP 2VSCA 1J5OL 3CFJB 5FUCE 4K3DH 5EDXA 1R3KA 2HVJA 4AYFA 3AU1A 1W72A 2VLMD 2YSSA 3BWAA 4MZ2A 1NMAH 4XHJC 5FKAB 3HPJA 4O5LH 4G6MH 4CU7A 1MF2H 5B38B 2J3SA 5DD1L 3WD5H 1UWGL 2HN7B 1IQDB 4Y5XC 3V6OC 1FRGL 3UZQA 5TPWH 1YEKH 3HA0A 5CUSL 3VD3A 1T1XA 3R0MA 2EIBA 5GGTL 5E95B 3WL9B 1JN6A 1TPXB 4OZFG 3KDMB 2ICWA 2YPVL 2C1PB 2AK4A 3C6SA 5JQHC 3VGGA 1NCDH 4ELMA 5SX4I 4XGZB 2NW3A 1H3WM 3QWOB 3F65A 1I9IL 3G5YA 3QEQB 2XTJC 3AXLB 5E2TH 2WINA 3WIHH 4NRZA 4KI5C 2APFA 1U6AL 2AVGA 5E6ID 4FXGA 4CU6A 3PL6D 1ITCA 5DJXA 1N6UA 3D69A 1FNLA 3F62A 2BVTA 1BD2B 5I30L 3GSWA 2EE2A 3C2AH 4OT1L 3K74B 3B3IA 4CADB 4KU1A 3AM8C 5DJ0A 1SMOA 3FQWB 1I1AD 3GNML 5JZ7D 5ESQA 1IGCH 4Y2DC 1EMTH 1LO4H 1QR1B 3RI5K 2NY7L 4BSWA 4G9FA 2P24B 1EAPA 5K9KA 3TN0A 3D39B 4LPUA 3LY6A 5EZOL 3MSPA 1Z3GL 3CVHA 5KSAA 4PJAF 3U79A 4AIZB 4LBEB 2DM7A 3UTPE 1R3IL 3N9GH 3FO0H 3WEXB 4JM2D 4OJFL 1NKRA 4MA1B 3GJEA 4KUCD 1CICB 1QFUH 1A6PA 3OGCA 5I2IA 1INEL 4OV5B 3IVKB 1MAKA 4F57L 3SDAC 1ETZA 5DTFB 1AR1C 3QXVA 4GMTH 4HLZG 5FIEA 4X5XB 4DVRL 4LCYA 4FTVB 1QSEE 1JK8A 4ERSH 1OB1B 4OGXH 4U05A 4WUUB 5C07E 5MERB 3ES6A 1S78D 1B4RA 1L7TL 5EU7E 3ULUF 4I3GA 5CIPH 2NY6D 1VKXB 1XF3A 2EDXA 4KY1L 1FO0H 2PYEA 3HLAB 1HCFX 3LRGA 4KJPC 4XVSH 1X44A 1F58L 1RUAH 5HHME 2DQHH 3O8XC 5IMMA 4U3HA 5CAYB 1S9VA 1EUTA 1IC5L 3FRUB 3IDYC 1RK0B 4N8CH 3OXRA 3HG1E 1CLZH 4B5EA 4G42B 4U4BA 1Y6NR 3DYMA 3N1QC 1J18A 3H3PH 2A9NL 4LLAA 5EU4A 3QZWB 2R0ZH 4FQXD 1C16A 2VDQL 3NTCH 3MRIA 1HXYA 4IHOB 3Q5OA 1GOFA 4PJFA 4R7DA 2AKRA 5GGQH 1K3ZA 5GSVB 1KCRH 4P5MB 3JWDL 4PYGA 4QYOA 3S37L 5F9WC 4NYLA 5TDOA 3U9UA 3UTTA 5T1KD 1GJIA 3D2UD 4IDJL 2O5YH 4M8VA 3MV8E 4CGTA 5JNYA 5ADOH 5JOPD 4HWEL 1CFSB 1CYGA 3UJIH 2HJKB 3RWDA 3ARGD 3IFLH 4NO3B 3V7MA 4TN9A 5DJCB 3EGSA 4NRYA 2LTQC 2ZWLT 4DZ8B 2BFVL 1AY1H 2CJUH 3BE1H 5K9QI 3T1FB 3GI9H 4DFIA 2XG4A 4BZ1L 4OQTA 1P4LB 3IFPA 4HJGB 7CGTA 3CLEL 5I1AA 1NQBA 5BZWB 4WHDA 2DDQL 4ZS7L 3HUJE 4NBYB 3MRBB 2D9QB 5E6IB 3EYFB 4GRMB 2FSEA 3DWTA 4MMZC 3PL6B 2VDRH 4EI5A 3HI6H 3SKOA 3PUCA 3WFCH 1NFDB 2HMID 1TNNA 4MXWL 3LKSB 4ZQKA 1PDKA 3GK8H 5SWSE 3LPFA 5I18L 4LEOB 4OM1L 3ULVC 5D1XC 2DB8A 1UB5B 4JY5H 3TYFA 3V5KB 2D03L 2DD8L 4LVOC 1NGXB 1NUNB 2FX8L 4RA3A 4HUUA 1Q1JH 1QSFB 3HPLA 1MPAL 1QFWL 1N4XL 4HWZA 4NQXB 1HNFA 3IXAB 5FK9A 3GUTA 3DRQA 4CJ1A 3O6KL 3T0EC 5F1OB 1ZANL 1I8KA 5DDHB 4B41A 4XCEA 3FT3B 1UB6B 3MMEA 4JM2B 5CLTA 5JUEL 5HI3D 3LEVH 2ATPB 5CEXB 1DUZB 3GJFA 4KK6D 3VWJA 1N5YL 2XPGA 4GAGH 5DRZB 4M7JL 5IBUG 1G1CA 1Q9OB 3TBWA 1OAYH 4ELKA 4GKSA 5A3IC 2H2PD 1P1ZB 1X5JA 4I18C 3SJVD 5E8DL 2CO7B 3MRHA 4OGYL 3MROA 1P7HL 4OD2B 2X6MA 3RGVD 1NEZA 2QHRL 3K7UA 1KN4H 5FGSA 5EZLB 3WXVL 4DGIL 2KH2B 3J8F7 4G8FA 2VXTL 4LLYB 3EOTH 3QXAB 1JPGB 2I25N 4ZUUA 2R15A 2KPNA 4XXDB 5EIVA 2X4SA 5ICZB 2XACC 1MRFL 4YHOH 4MA8H 3BD5A 3WLBB 1D6EB 2VL5B 3GO1L 5IROC 4LU5H 2YEZB 3DV6B 3PQYA 3DVNB 4NRXA 4MYWB 1FYTA 3T77A 3RUGE 2EC9U 1JHKL 4NFDA 3OKMA 2YKLH 3DSFL 2WV3A 3WHXB 4XNYH 4GRLB 1CT8A 5GSRB 4FQXB 1A6WL 4F3FA 2X4RA 1RU9H 5KVDH 2EIDA 2R4RL 3F12A 5JPMA 1QFPA 1QLEL 5ITBL 5FYJL 5F1IB 2XY1A 3BDYL 4Y4FD 5EC2A 4GBXA 3D2UB 3L3GA 2EH8H 3S4SB 5KJRH 2I24N 1MCIA 2HJLB 3GBLA 2K9UA 3O2DA 1YNTB 2QSQA 5CD5C 3LD8B 2C4XA 5IR1B 4YPGB 3KYOB 4LLMA 4C54A 1ZVSB 4MDJA 2VH5L 2R1XB 1L9MA 2Y36H 1A6ZA 1HHJB 1M05B 4LSSH 4G3YL 3TCLA 3OX8B 2ZCKL 4ZOAA 5F7LB 3HE7A 2VITB 4RGND 3O9WD 4QHNA 3RZWA 4AQ1B 5ETUA 5D2LB 1UH2A 3MLRH 4HS8L 1PYWB 3NZ8A 4ODSH 4L4VE 3THML 3VFVB 2PTUA 3I75A 3O6FD 5FB8A 1YNLL 4JANB 4Y19B 2ENSA 4XC1L 3BYYA 5JHDD 3TPUA 4U1GB 1RUKH 4WI8A 2MMXA 5I74B 2A38A 3QDGD 2LV4A 3LCYA 1DEEA 1LEKA 4POZC 4JZJA 3LN5A 3RZCD 4J3UA 1LE9B 3O3AB 3G6AB 1O0VA 5F3BA 1JNLL 3QI9D 1KXTB 5KS9A 3R06B 4NM4H 3BPNB 4NHUB 4JE4B 1T0NA 1VFAB 1I3RA 2EECA 4OGAC 2YD7A 3B9VA 3FQRB 3Q0HA 1H3VA 4KGLA 2VDKL 3DVIA 3I02A 3IU3A 3PWPD 5E1HB 2FRGP 2H1PL 3P0VL 1FFNB 1JMZA 1EERB 1GXEA 3FFDA 1CDYA 3QQ3B 3WE6B 5T3XE 1JV5A 4PJGB 3CK0L 3BPOB 1CWVA 2JJSA 4BZ2H 4JM4L 5I75B 3SJVB 4YE4H 4P9HH 1FZKB 5BRZD 2EDHA 4TNVK 5I8KH 5DHYA 2CLZB 4DAGH 4EKXA 1SBBA 3RGVB 1YEHL 1CGSH 2FB4L 5B8CB 1ZA3A 2R9HC 4R26L 2VXVH 5C0IB 2AEIT 1OW0A 3L7EB 2QADB 2LU7A 4MGXA 1K8DA 3B5HA 4R2GC 5C0AD 3RDTC 5H35A 2V2WB 1D9KB 2IADA 1MCKA 4XMLH 2XA3A 3OKLA 4JFED 3MYZA 3P3YA 4JO2H 5E5UB 1TZGL 3WKML 5H94A 3RWFB 4X9GA 2WBJB 4P5KA 1XGUA 3FN3A 1CR9L 1G7QB 5K9OB 4PGEA 3DARA 3P77B 1JHTA 3MBEA 1BZ9B 1RIHL 3D18A 4RGMB 3N1FC 4Z76A 1NJ9B 3RA7H 2GJ6E 1QLFA 4X4ZA 4UINL 3P4OA 5AWNH 2FHCA 3JTTA 1HHHA 3V95A 2EDEA 3RVVC 2PXYB 3HR6A 3GI8H 2DTMH 1BZQK 4WUKL 2CUMA 3IETA 4U6HB 5CZVL 4YGVA 4X4MA 2A9ML 4LSPH 2GAZA 3ARQA 4POYA 1U58A 1IKFL 4NC1E 3VG0L 3FO1A 2V7HB 5E0QA 1JNJA 1KJMB 3MLXL 5MENE 4HHAA 3MRDA 2Y25A 4Y16D 3S36X 1YJDL 3ZKQD 5CGTA 4XP6H 5BMFL 1KYOJ 2VDPH 3I50L 4XBEL 4DOHE 3UYRL 4JPWH 3EYOA 5BZDB 4GKNA 2AEQL 2X1OA 4RGNB 2KL6A 3MJ9H 3HI1A 3PDDA 2MPAL 4FP8L 2XZQL 1GC1L 4D0CB 4W6YB 4JG0L 4M7LT 3LRSB 4A2LA 1HXMA 3MNZB 4D0DB 5JHDB 2P49B 1S9XA 3KHQA 1CK0L 2B20A 1A9BB 4UTBL 2AJYH 5IW6B 4PG9A 4W6WB 1HNGA 5LGHL 3DVFA 4JB9H 3ROOA 5TQ0H 1VDGA 4ZDHB 3RZCB 4TTDD 1BIIB 5EUOB 3RP1A 3X14B 3BW9A 2NQCA 3KPSB 4L5FL 3QI9B 5JOFA 4LVNB 4S2SB 2X7LB 4QXGH 4G8GB 1CQKA 3QULB 3DX9B 2AI0H 4ODUA 2JELH 1FFPA 2XKNA 1FGVL 1OL0A 4JHWH 1KF9B 4EQ3A 4KKLC 4PJCF 4XVTH 4LCIH 4ZSOB 4XWOC 1YECH 4Z5RB 4JN2B 5C0BA 5GGTA 2E7LC 4MNQE 4NKMA 3LS4H 2ITDB 5A2JH 3PWPB 1BX2A 4XPBH 2HLFC 5D7IF 1UVQA 1MRCL 3ZSSA 2KBGA 4WFED 4HS3A 3VFPB 4TNVF 4I2XE 4P5TB 1ZT4A 1AO7D 4PJHA 3HG1D 5A2LH 1HEZA 4HPOH 2AABL 4J3WA 4MNHB 4YFLF 2FIKB 3PWUB 4QRSA 5DLML 3CDYA 3QUZB 5J12B 1AJ7L 1CL7H 4PGDB 3ZE1E 4WTXA 5DRXB 4OI9A 4A6YB 1HDMB 4M43H 1NPUA 1BBDH 5F7NC 2ESVE 3HNTH 2ZUSA 3IDJA 1SYSB 3G6DH 4ZAKA 5CD3B 2APXA 4TVPH 4W81A 1FN4B 2JB5L 1HHIA 5LCVH 5DJZA 4S1DC 4PRIB 4MWFB 2EE6A 4PP2B 4JFEB 4QRRB 2FHBA 3O41B 3OB0H 4N5EC 3SGKA 1C1EH 4PJAE 3KYMA 3C60A 1FZOA 2AEWA 4JKWA 1DP0A 3SKUD 3STZA 3DTXB 1RUQH 3PV6B 4LHUG 3GM8A 2XTJD 2JK5B 1GOGA 4Z7NF 2NR6C 1JGVL 1PD6A 2R4SL 3MCKB 5BVJB 4KJYB 4MD5A 4KI5D 1MWAL 4ODTH 3T2OA 3OKEA 4XPHL 2CO6B 4NSKA 1M7DA 4WNQA 1FNSL 4WY7H 1Q94B 2WBWB 2F54E 4G6KL 1EUUA 1MFNA 3SKMB 2C26A 3BHBA 5IB1B 1DBMH 4LEXL 2VE6B 2V2XB 4PRBA 2YMXH 3OF6D 7FABL 4FFZH 3KPTA 4Y2DD 4GG6F 1D6VL 3TWCH 4CAGA 2FBJH 4D94A 1KCVL 4N8VB 3BH9B 4NNPL 1BQHG 2AQ1A 4GH7B 4ZFZA 1LEIB 3X11B 1CDIA 5F9OL 4UOJA 2Z4QB 4K3JL 1S9KC 4FQCL 1JP5A 3K8LA 3HN3A 4DW2H 4YXLL 4DN3H 4XCNA 3KLAA 1U3YA 4PB0L 2A6JB 3B8SA 1IT9L 3BAEL 3TO4D 1WLHA 4CW1B 1EFXA 2J1KA 1QG3A 3TH4T 3MACH 4E0RA 2YWZA 4NO5B 1CFVH 1U8PA 5AAMA 1KIUA 1CE6B 2P46B 5E2JA 2ICCA 3BPCA 1UENA 3NGBB 3RIAK 3WSQH 3SDAD 2C4FU 1A7PL 1CTNA 4RFEA 1KLGA 1T03L 1XT5A 4MD4A 3PHOA 1FIEA 1KT2A 4LHUD 5I8CB 1FVEB 5H2BA 1A6UH 5EBMA 3TBVA 4HXAL 3RWEB 4YHLH 4FQJH 5GIRB 1UKSA 5F7WC 2DQDL 3E6HB 4BH7A 5CIPB 1QA9A 1AD9A 4J8RB 4KJPD 3IKCA 5BV7C 3U6RA 3TZVA 1NBZB 1ZT7B 3E8UH 4AEEA 3BIAX 2DMKA 5ECJE 4X7TB 1TJIH 1T66D 4V2BA 3EIFA 3QA3A 3RWCA 1AO7B 1T7YA 1OLLA 3TT1H 4FNLL 3K81A 3O3BA 4M5ZL 5DFVC 5BQ7A 1YMME 3AS0A 1U8HB 1J0KA 2R69H 5GGVH 1J7VR 1ZA6B 5ISZD 3K2UH 1BFOB 2VABA 1LP9F 2ADJA 4ZG1A 1YNKH 1GGIL 4YDLC 4H88H 4MS8C 4PJIA 5F9JB 5JA9A 5GRUL 5FA4B 2FBOJ 3SBWA 1PG7X 4Y5XB 5IFJB 4OF6A 4TULH 3DX8A 4JFDA 3HNVH 3VMOA 1ZHBA 2YR3A 1S9YB 3MOAH 4Q9BA 3RPKA 2PYFA 4X6CE 3CH8A 3Q6FB 4OTXH 3QHZH 2D9CA 2XTJB 3E2HC 2CIIA 4YJZL 3QXUA 4HV8B 5DHVB 4P2QE 4IIQC 4YH6A 2FWOA 3B8YA 3WUWA 3ZKSD 3QR2A 2Y7QB 5EG6C 2VISA 1YEIL 4MCZB 4CVXB 3HZMA 3WHE0 5TE7L 1GGCH 1MCLA 3QEUA 3G5ZB 1JFQL 1GL4B 3Q6GL 3ULVD 2BNRA 4UQ3B 5D1XD 1RZFL 1GHFH 3RWGA 3VU2A 4Y2DB 1IC4L 43C9B 4EVNB 1JYVA 1RIVH 4Z95H 4WWID 2XWJB 5CBEA 1IQDA 3CCHB 3EDJA 2OZ4L 2R0LH 2EXYD 4I1NB 3VE0B 1JMXA 4G7VH 2X4UA 5E94B 4TSCH 2FO4B 1T20B 1IM3A 5HHOB 4JN1H 1YYMH 2ZUYA 4MVBC 4HLZH 3AREC 4N5UA 3T2QA 3E6FB 4XVJL 3RIAF 3QWOA 4JPIA 2O5ZL 1NLBL 4QNPF 3AXLA 3SCMD 5JR1L 4MJ6A 3BT2H 3MGOA 2UYLB 4BJLA 4IOFC 1QOKA 3SDAB 3LS5L 4FQLL 3TV3H 5JIPA 2PTTB 4JFZH 3BP4B 4X5WB 3BKYH 3L95B 2Z8WC 4HZLA 3JTSB 1U8NA 5DD3L 5JHLH 4BH8B 1AGDB 5I1DB 2CGRH 3V6BR 3MUGA 5F97E 2MCPH 4KRNA 1MCOH 4BSVA 2VXUH 2GW5A 3EAKA 4KKCC 4Y2OA 4KQ3H 2VJXA 4CADA 1KB9K 5D7LD 3QJHA 2Q7NA 3LSOA 3UZEA 3WNNA 1HH6B 1CDUA 4M4RA 1G9MC 3UTSE 2WNGA 1RZ7H 2JJWA 5BS0D 3O8XB 4U0QB 4C4KO 1TTGA 2G5RA 2D7QA 3IDYB 2HLAA 3BYTA 1HI6B 1FGNL 4B7LA 5C2UB 5CJ8A 5LXGL 2KDGA 1C5BH 2IFFH 3ZO0A 4LSUH 2LFGA 3C8DA 1MI5B 5E7FA 4XB7A 2P8MA 5LGJB 3WEXA 3C6LC 1BQHB 1CICA 5ISZB 1X6LA 2H9GB 3LQMA 4KQ4L 1MNUL 4LQFH 5GS0D 1FPTH 4R3SA 3IDIA 5CKGA 3KPMB 3CH1A 5F9WB 4B53A 5ID0A 1RUMH 4X5XA 1E27A 2P7TB 4X6FB 1HIML 1D7FA 1CD8A 2EO9A 4WCYL 3KVQA 5DUBB 4LASL 4EDWH 5J56B 3TESA 5MP6H 1T7XA 4K23L 1YEEL 3B43A 4DN4L 5MERA 5FV2A 1LO0H 1QZ1A 4TUJA 4LMQI 1I1FA 3DECA 3X13A 5FUZH 1VFMA 2LTQB 3VXUD 2HFFA 5ALCL 4U7KA 4YO0A 3GKZA 5FUCC 3Q3GA 2Y6SC 5J3HC 1KUMA 1F3DJ 4PRPE 5C1MB 5J9PB 2H45A 2A6DB 4DTGL 5FHAH 4KDWA 5L88H 3SOBH 3EOBA 2W0KA 1WBXA 3HZVB 3VXSB 3SPVA 2C7UA 1X5AA 2V9QA 4NQEA 4X6EA 2R0KL 3V0VA 3VH8A 3KPOB 2XN9E 4RGOH 5AEAA 3MUZ1 3QHFL 4L8DA 1TTFA 1TCRA 3MA9H 4LLVB 4IRSA 5MEOA 1LHZA 4OKDA 3D3VD 5DMYA 4PJ9A 1UXSB 4V1DE 2JCCB 4LRNH 1TETL 2C3VB 1TJHL 5DHXB 5D1XB 4POZD 4IHOA 2H3NA 1IAOA 1UZ8B 1GIGH 3L3OB 2XQYK 1G0YR 2JJTA 4LVOB 4MJ2A 4P99A 3V0WL 2A74A 3MUY1 5EULV 3MRLB 1CD9B 1AGBA 1CFSA 4N0YH 2RHEA 2HJKA 3HZYA 2FZ3B 3T0EB 3VXTA 3RWIB 2XZCL 4LARH 1WTGT 1K6QL 1U8QB 3ARDC 4YBLC 5D7JA 2XZAH 1RUAL 2CKBL 4JFQB 4OCMC 4O2FB 4L9LA 5SWQB 5HJ3B 3PWJA 1Y18A 2JLLA 1YDPA 1A7RL 2BRQA 2W07A 3MRBA 1P4IL 3F7PC 4C56A 3ARFA 4I18B 3OJVC 1F5WA 2BSTA 3AB0C 2FEDC 2HFGH 5HI4C 3KS0H 1YQVL 5DD5L 5D7LB 2YBRB 5GJTH 2IGFL 4XNMA 5DRNA 5GZNC 2XWBA 1UB5A 1G9MH 2APTA 1G9EA 4Q9QH 2GIYA 3TYGL 2GEEA 1ZEAH 3OKNB 4OB5H 1GGBL 3W9EB 5EO1B 1OTUD 3QNXB 4TOYL 5BS0B 5EC1B 2OL3H 4P59L 3HAEH 3NIFF 5IFAH 2V5SA 1JF6A 5FFLA 2GTWB 4L3AA 1SVCP 1A1OB 1QVOA 3BE1L 1MLCB 3FT3A 3DBXA 3ZT5A 1UB6A 2F8XC 3CSPA 1Y6KR 3O6LL 5HGHB 2OJEB 3DPBA 3AY4A 3EDDA 4PRAB 4FZ8H 4P46C 3FO9B 4E9LA 3GMQB 5C08D 4ENEC 4HC1L 2GSGA 1FBIL 4OUUA 1YPZB 3UC0L 4OLUL 4NKQB 4P2YA 1N7MH 4KVCH 4XCFL 3VFGL 3PGCB 2CRYA 2GTZA 4JFOA 3A67H 1JRHH 3MNWB 2BNQD 5I76B 5C0NC 5JIHA 4UBDC 4DKDC 1EEUA 3AAZB 3O2WH 1IGFL 2GK0A 3QNYB 5DJAB 3VXUB 1X5GA 5TFSH 5EZLA 4P23D 4UV4L 3ZT6A 1A5FL 4PJCE 2XQBL 1UM5H 1XH3A 4MAYA 5EOCL 1NUDA 1B0RA 3QJFA 1G84A 3FFCA 4XXDA 5DK0A 3B9AA 2Y07H 2W9DL 3CMOH 1J8HB 4C58B 3SO3C 3FONB 4F58H 4QWWC 5D7IE 3DV6A 4OQ1A 12E8H 4I4WA 1PLGL 4OBSA 5DURB 2DL9A 3UPCA 4LCWE 4X9FA 2AK1H 1I7ZB 2OJZH 3QDJE 4AH2B 2ZZUT 3CX5K 4M61B 3LEVL 3WHXA 1AC0A 3D3VB 4GRLA 2WIMA 5I1GH 3NFSH 3V6ZA 5DF0A 3I6LD 4GW5B 1NAMH 5GGRB 4EXPX 2UV3A 2P8LB 1KEGL 3EO1A 3BEVB 5E7BA 4NN7C 3D9AL 5FYJE 1FH5H 3DJ9A 3PGFL 4H8WH 1SYVB 2DJSA 3IFNL 2H2SD 4YPGA 2DLFH 4MJID 4KKLD 3PJSB 4AG4H 2LU3A 5C71A 3BP6B 1ND0B 3V4UH 3Q5YA 5HGAB 1AFVL 1YEJL 2FYYB 3OX8A 3ULSB 2HLFD 3S6CA 2L4OA 4HIHB 5E1AB 4EOWL 1JE6A 3MUJA 4RFOL 1E4KC 1KJVB 3VFVA 1OAKL 1LO2L 5E8OB 1KTDA 4MZ3A 1NDGA 4Y19A 1PY4A 4M9OA 3R1GL 4FFYH 1EEYB 4QY8B 5KSVA 2WANA 4G43B 5FUOL 4AMKL 1ORQB 2CUHA 1EGJH 4P2OD 3V8CA 4HULB 3O3AA 2R29H 2BOCB 2XV6B 4NQTA 1F42A 4GG6E 2QLVB 4R2GB 4XP4L 3RDTB 1NC2A 2W1NA 2VXSH 3R06A 2F53B 2NY5H 4N0UE 4HD9A 3QUXA 4S1DD 2JF1A 1JPFB 4KTDL 1CGVA 1CF8H 4QO1A 2ZOLB 2HG5B 4MNGA 5HHNA 4N5ED 2DBJA 1Q72H 4U1MA 1IKNA 5IBTH 3D25B 5IFHH 3L5WA 1N2RA 5IMLA 5C08B 3LHPH 5CP3H 2NR6D 2C1OA 1HWHB 3ZHDA 1JWMB 1MHPL 5DR5L 3LRHA 1A4KA 2EDLA 1IAKA 1NCAH 3Q1SL 4J3VA 2BNQB 5JW5B 5F93C 1YEDB 4OLZH 3PIQB 4J6RH 1FL5B 1OQXA 1VFOA 3RVXC 2CR3A 4UMGA 1K9TA 4P2RB 4H26B 4PJ8A 4ODWA 1P5UA 3H6JA 3UBXG 2KUTA 5J06A 5FF6B 4UNVA 1WCQA 4R0LA 3IU4H 1S7TB 4Z7UF 5I73C 2GI7A 2RAMA 3MLYL 1M1SA 2Q76A 1UEMA 2MFNA 4IMKC 3U4AA 4MJ5A 3EO0A 2IANE 5J6GB 4FOMA 2Q7YB 2AJZA 2AAVA 4ZUVA 3VXOA 4NM8L 1IBGH 5E08L 2WBJA 4LAQL 4PJXF 5CEZD 1OSZA 1G7QA 2AJVH 3GGWB 3QNZA 3P77A 1G9NL 2JB6B 4YR6A 3SKJH 1LP9E 3TN0C 1S7WA 3RY6A 3OXSA 4XP5L 4YE4L 5A2KH 2PXYA 2HJFA 5FO9B 5CMAA 5KVGH 2BHYA 4GW4B 4ZPVA 3ARSA 4DAGL 3QFJD 3BD4A 5FAAA 2ZCHL 3GB7B 4QHKJ 1LK2B 3GIVA 5LVEA 1N26A 1CU4H 4CN6A 1ZOXA 5JDSB 5FO8A 1AP2B 3U46A 5DT1H 1GAFL 2EXWD 3SDDD 3FCTB 1RIUL 1K85A 4XRCB 4QXUH 4S10A 3G08B 2ICEB 3R4DA 1I7UB 2BCKA 4EDXB 1I3GH 2WWKO 3MZTA 1WF5A 1BBJA 1ZGLA 2CLRA 2ZPKL 3MNZA 4N90E 4D0DA 5DFVD 4E41E 4U6VH 2UVFA 3MLUL 1A9BA 4U7MA 2EIZA 4TSAH 3BH8A 4HUXA 1QQDA 1VSCA 3E3QC 4G8IB 1WAAA 2OS7A 2P5EA 3RA7L 4PJBF 3T04D 5HYJE 1R3HB 3LQAH 4WEBL 5CEYA 4AY0A 5C3LD 5JW4Q 3U7AA 4IRJD 4MS8D 4S2SA 3EFDL 2GHWB 4G8GA 2AJ3A 4UUJB 3QULA 3DX9A 4WWKD 2VLJA 4JO4L 3NOIA 4PJ7B 1IFHH 5DD6A 3WDJA 4NP4H 4JDVB 2HVKA 5GGSA 1YN6A 4ZSOA 1OWRM 1CFNB 1W72H 2ADIA 2D0FA 5JXEA 3WLWD 1CDJA 5GS2D 4D8PA 4L3CA 3RWJA 1RHFA 5ERWB 2QSCH 1P84J 4QNPE 4G7YH 1PEZA 5F9AC 1DQLL 1X5XA 3X12A 4S0SD 1QP1A 4P5TA 2V2TB 5IIEA 5HDLA 3FB8B 5KZCB 3PWNB 4MNHA 4MA7H 2FIKA 3K3QA 4YHPB 1KELH 4HUMB 1OWWA 3MJ7A 4ELME 3LOWA 1HYRC 5ANMB 1S7RA 4PGDA 2JJVA 5DRXA 3RL2B 3QWRA 2E7HA 4WW2F 4ZYKB 3ZTJH 5B39B 4P4RA 2NXZD 3G6JF 5CD3A 4D9RE 4U6XA 1PG7H 1Q0XL 1FN4A 1JUFA 3G5VB 2VKXA 2F74B 3S37X 4EI5C 1WFTA 4RMSA 4QRRA 2VZUA 4J1UB 3O41A 2QSVA 3OG4B 4M5YL 4X80H 3U0WH 4GQ9H 2Q86A 4MVBD 1S7VB 3ARED 4NC1C 3SDYL 4L3ED 5EN2B 4I48B 2A6IB 1VADB 3CXDH 3DRTA 5T33L 2NY4C 4IOFD 4LLQA 5IJVB 1U3ZA 1LO3H 1C12B 1OCWL 3HI5L 4O2EA 3WIHA 4J23A 4LKCB 2BERA 5ICXB 2NTSP 3OPZL 1AXSA 2ILLA 1OF2B 2ICWJ 5IQ7H 1IARB 1JGUL 3QEGL 1RZKC 4KKCD 4BUGA 3RNQA 3WS3B 1FV1B 2VE6A 3K46A 4C57C 3V5HA 4M03A 1PKOA 4OZGF 4EUPG 3QUYA 5ENWA 1LE5A 2DQIH 2FHFA 3VFUB 4LDLB 1TCMA 2ZCLH 4TVPL 3VWJC 4DQOL 1WUNT 1ONQA 2B1AL 3EZJB 5BV7B 4OZIF 1J05A 3S5LG 3UCRA 1Q38A 3JV6B 4KAQL 5D72L 4ETQB 5I15H 2WWKT 2DYPD 3SE3C 4WO4A 5TE4L 4TVSa 1KC5H 1J87A 4EJ1C 4TQEL 5D9SA 4CW1A 4PLKD 2EYRB 3EYUH 1AHWA 3C6LD 4KJQC 5TDPB 3VRLF 1XGQB 4HIJB 4PRNB 3SE9H 4HMEA 3V79C 1JHLL 3TJEL 1C5CL 3WJLA 2JKXA 5JTWA 4M6NH 1JJUA 1JNHB 2ZUWA 4AM0B 4YDLB 1BFVH 5T3XH 3K4ZA 1FJ1A 4Z7UA 4PGZA 1QRND 1U42A 3A6BH 4E5XA 1N0XH 3S3PA 4AIXA 3AS1A 3BO8B 3L1OL 5DJ2B 1RFDH 5CJXA 3DSNA 2XY2A 4WHTA 1BHGA 5GRZA 3CFBB 4FFZL 1KB5B 3ALXA 4U2ZA 1YY9D 1JIBA 1S3KH 5IHUH 5J3HD 4UT9L 1BEYH 2RBLA 4PJXA 4UOW0 4PTTA 3E2HB 1FO0A 5IWLA 3RPIB 3KXFD 2VLKE 3IS1X 1YYLH 1ZT7A 2BRRH 3MV7A 5F70A 4IIQB 5F3HA 4JG1H 5KAQF 5T1MA 1FNEA 2CKBA 2V7NA 1WVZA 5DZOA 4ZUSB 5GHWH 2NX5B 3OKKB 1P7QB 4MX7B 3U2SA 2M26A 3S35L 1A6VL 2NY2D 2C3WA 1WT5A 4OIIL 1BJ8A 1LEGA 4ZUTA 5C92A 2QL1A 5GZOC 2H32H 3TPKA 5EBGA 4OQTH 3MJ8B 1BFOA 2I07B 1RZ8B 2IALB 4LGPB 4NO2B 1DQMH 3FQXA 1PKQE 5D96C 1WICA 1NGPL 1DUYB 2AXGB 4G6AC 4Q9RL 1YZZA 4LSDA 3QFDB 4CKVX 3NIFE 2EEDA 2J4WH 2RR3A 3V4PH 3P0YL 5DZNA 4LL9A 5D93C 2AS5M 4P3WA 4PRHD 4AENB 3BJ91 5C86A 1YY8B 5EO0A 2ENYA 1CXEA 3ARDD 5EORH 3AREB 3IAPA 4L3EB 4JZJC 4G5ZH 4PY8I 3GMLA 4YEFA 2NW2B 4NPYB 3ULUC 3MRPB 3CFEA 4BQ9A 3UPRA 1HSAA 1NBVL 3LN4B 1A7OL 4PJBA 4Z7VA 3W0WA 3DYPA 2AEPL 4DK6A 1I1CA 3S88L 4YHIA 3W5MA 4CMMA 4LSRH 1F4AA 4JQXC 4JKPL 1RZKH 1IM9D 2OBGA 3VXRB 4HUWB 43CAA 3OB0K 3ZL4H 5D1ZD 4OFPA 4KVNH 1F11A 5T3ZE 2CDGA 3O11B 4U1LB 5SWZB 4JRXB 1NFIB 3SKNB 4IM8A 43C9A 3QDMA 4OF3A 1ZS8B 1MFAL 1TVHA 4QHMA 4TRPL 4CNIB 4GAYA 3CX2A 4YHML 5EWIH 2JJSC 5KTEL 2HT4C 2DQFB 4PLJD 1T2QL 1CQYA 4OZHB 3HAEB 3W11C 3ZDXE 1CGXA 4QOKE 1OT1A 2DYPB 2GCYA 4ZFFA 1Z9LA 4FA8A 4TPRL 5HHOA 3U1SL 3VCLB 4GMSH 1A3RH 3C6LB 1SM3L 5TGBA 1P2CB 1UH4A 3QSKB 1MHEA 1XGYL 3NZHH 5GQBA 1F4YH 5JW4M 2R56L 2J6EH 4WW2A 4R90L 4N9GA 1G7JA 2A73A 5ACMA 1NL0L 3BP4A 2EEBA 1ZLSH 4ORGA 1QRNB 5IW1A 3JTSA 5ESVB 1T1ZB 4BH8A 1K2DA 5D2NE 4Z0BL 4AL8L 5C0ND 5IMKA 4UBDD 3QQ9D 5C0EA 4HKBB 1CVRA 2OQJB 1TZHB 2HYMA 3WFHB 3C8HA 3KYAA 4WFGE 1YMHB 2DS4A 4PREB 1JWSB 3MBEC 5I8OH 4JPVH 3ARZA 5FYKE 1NUFA 1V3JA 1WBZB 3KXFB 4P3CL 4X6DB 3O8XA 3TIDB 4UT6H 3BN9C 3QG6A 1CN4A 1PZ5B 4QWWD 1Q9KB 4RAUA 4JFYA 4LSQL 2IAND 5IT2L 1AXIB 4MXVF 1OPGH 2CDFA 3MV9E 4UDTB 1MI5A 3KYNB 4JGMA 4BZYA 1L7IL 1XIWA 1E28B 5C0CE 5L2KE 5IV2B 3ZYOA 2YXFA 4IEFB 1T1YB 1ADQL 1OTSC 4FQQB 4QRUB 4UILH 4XPTL 3P9LB 1UADC 4Y1AD 2GITB 2DLTA 3OTTA 4FQHB 3HC0B 1BWWA 4NHCL 4L4TE 5DD0H 2EZ0C 3KPRB 4KTYA 4P2CG 4G8EA 4J4PD 1BF2A 4K7PL 4HGWB 4J2XA 4NQUA 1Q9LB 4HXBH 4PRHB 3GHBL 1KTRL 2FR4A 4M8QB 4J3XA 2IMMA 4EZMA 3ARDB 3O4LE 1A3LH 4YBLB 3FOMA 3FZUC 4PJDA 2X10A 3ULUH 4M6MH 4GXUN 1MEXH 5K59F 2AXFA 4K9EL 5TDNB 3OAYH 4GAJH 3IDMA 3ARYA 2EC9T 2W65B 4X0KA 2Z93B 3EO9L 4K8RC 2YUVA 4XWGH 1AC6A 3VXSA 2DQTL 2HRPH 3BZFA 3AB0B 4L29B 5EO9B 1K5NB 5GRJH 4HIIB 3LIZH 3I3EA 5DJ8B 3PGDB 1UZ8A 4RZCB 1D5XA 1F6LL 5FOJA 3DUSB 4NUJB 5HYSG 4HKZA 1VGKB 5AYUL 4XTRC 1FNFA 3IF1A 5F9DC 1XR8A 4NFBA 3T0EA 3CC5A 3BMWA 1N6QH 5C07B 1AXTL 2DLGA 4H0HB 4D0BB 4LQ1A 1QHPA 1QPPA 1J1PL 4P46B 5E9DA 3SOBL 4POUB 4O2FA 5CHNB 4ZAKC 3VJ6B 5CGMA 2GYSA 5SWQA 35C8L 1MFBL 1DN0A 4P57A 1JBJA 5LWYH 2HKHL 4OCYL 2B0SL 1GOHA 2DQJL 4K2UH 3SGKC 4XPAH 2AK4D 3LEYH 4LHQB 4GKOA 1T80A 1KXQE 1OP9A 2B5IC 1I9RH 3BGFC 4O58L 2B4CH 1BGXH 5BW7A 1JVKA 4X4XA 3WFEL 1U8OA 3CSYB 4OLWL 4UDUA 3ZTNH 3T8XB 2J8HA 3PXHA 5F7MC 3SO3B 4RQQB 4LRIC 3C8KB 4U3XA 4M6OH 1KBGH 3F7VB 2HH0H 1A1OA 4RDQF 1H9VA 4AIOA 3U7YH 5FYLH 4IDLA 4KK8C 4KPHH 2PW1A 4V2CB 2OJEA 2VDNL 4G80B 4Y1AB 1J8KA 2FLBT 4ZFOL 1YPZA 4G9FD 3TN0D 4G6JL 3AVEA 1N3NA 3P4NA 3P73A 4NN7B 4YXHL 2HFGL 5KSAD 3FHQA 1INQB 1CG9B 3MNWA 2WQRA 4XPFL 5I76A 4U1IB 2YRLA 4M7LH 5DA0B 1AIFA 2A1WL 4OCWL 1YEGH 4JM2F 5CSGA 4FMFA 3O45A 3QNYA 5SWSB 1NCCH 1OAXL 3PNWB 2YPLA 4U6YA 4XMPL 1J5OH 1CXFA 1E4XL 1I8IB 1MRDL 1MUJB 1RULL 5DJYB 3OJ2C 1J8HA 4LVHC 3FN0L 2RQ8A 3CFCL 3VFSB 4S0TD 1K4DB 1SEBA 3JWDC 4XBPA 5DD1H 3VXMA 5F88B 1UWGH 3MJ9A 1CGYA 3F5WB 1FRGH 1I7ZA 4GSDL 1ZT1B 3LKNA 5CUSH 3LMJL 3QO0A 5GGTH 5C09A 3UX9B 2YPVH 3S96B 5D5MF 3NIGF 5IKCA 4GW5A 1B6UA 1DQQA 3LEXA 3MFFA 4BYHA 2PYED 3DX6A 4NIKB 3CZJA 3T0BA 4G9DA 5E24E 4Z78B 1KJ2B 4NCDA 3TZVC 4RSVA 1I9IH 3G6JE 2RIKA 2E5EA 3MXVL 3IXTB 3M1BB 5EBLB 5F6IC 3BPLC 1U6AH 1OGAA 2XA8L 5ITFB 3LAFA 4A6YL 2BVQB 5TFSL 4XP1L 3IJYB 3HMXL 4DVBA 1XF2B 2AJUL 1U91A 4WFFD 5I30H 1T21A 3BP6A 1ND0A 1R3KB 2VIRA 2HVJB 4OT1H 3FHAA 3AU1B 1W72B 1UYWL 3BWAB 5E03A 3PP4L 5EOCJ 1CTOA 3HPJB 3OR6A 3GNMH 1CDGA 5HGAA 2EDQA 2FYYA 1RURL 3UTTD 3UJJL 2NY7H 5E1AA 3SBWC 1S8DA 4ZOCA 4QTIL 5EZOH 3BKJL 1Z3GH 1T1XB 4R97C 2UWEB 3SQBA 1JN6B 4DGVL 1W0WB 3C6SB 3WNOA 2AK4B 2Q8BL 5I1GL 5MI0C 3WNMA 1DQTA 1U8JA 4QY8A 2PNDA 1BPVA 1CLOL 4HAGA 2NW3B 1ORQA 1GVIA 1R3IH 3JV0A 4AEHL 1NEZG 3G5YB 3QXDA 4OJFH 1T4KA 4OZGE 4UQ2A 3LPGA 3L3JA 5I73B 2WINB 3RJDA 4NRZB 5D2LF 1INEH 4LNVA 3DIFA 3RDTA 5AUMA 4XX1E 4F57H 2D7PA 2F53A 1NCTA 4DVRH 4FXGB 2YOCA 4LFHG 3VGBA 5H37G 5DJXB 2FATL 4EI5D 2D3VA 3D69B 2ZOLA 4QXWA 3S36L 2GQHA 4ZNEA 1EO8L 3B3IB 4AT6B 1ZK9A 2DICA 5DJ0B 5CFHA 1EA9C 1NDMA 3ZMRA 5ESQB 2EICA 3DXAA 3NCCB 3VRLE 4WU7B 4BSWB 3AMKA 2DKMA 4LNRA 2BJML 4KY1H 1ITBB 2NY4D 4G9FB 5K9KB 1EAPB 3TN0B 1IAMA 1F58H 3CVHB 4JFFE 4NN5C 1DANU 1L9NA 1XR9A 3O3DA 1JPTL 4RWYL 1YEDA 1CXIA 3H9SE 1Z5LA 1X5LA 3DHMA 2IAMD 3QO1B 4P48A 3GJEB 1MELA 3NVQA 1EJOL 3S7GA 3GKWL 5T3ZD 2W9EL 1A9EA 4K3HA 3OGCB 5I2IB 2A9NH 2NY1C 1UA6L 3OZ9L 3KG5A 3VWJD 2VDQH 4PJGF 1S9WB 4H5SA 3UPAA 4ZO7A 3JWDH 1F90L 1JK8B 3S37H 3W5NA 1W2KT 1F2QA 1VEPA 4JCMA 3U9PL 1LGVA 2XICA 4QOKD 2Q7YA 5D1QA 1U93A 2P5WA 2N1KA 5EZJA 4HWEH 2E8ZA 1J0ZA 1G7MA 1DBAL 4NQCE 5ABDE 2PW2A 3H7LA 4KJQD 4XZUA 1XF3B 2G75A 2BFVH 2PYEB 3JV5A 2ORBL 4S1QL 2MHAA 1NCAL 3SDXE 3VGAC 3EDEA 1QPXA 4BZ1H 4J12A 5IMMB 1S9VB 3CLEH 5L6YL 3T2PA 1WQVT 3OXRB 2DDQH 4ZS7H 1MQ8A 1U36A 3OGOE 3TT3L 2BP3A 4NJAL 1MCJA 4U1KA 4K7PY 4ZO8A 3I6KA 3UDWA 5EU4B 5IBLD 4MXWH 3MRIB 1HXYB 4PJFB 4R7DB 2AKRB 5I18H 1MCQA 4OM1H 4QYOB 3UO1L 1B90A 5I0DA 4NYLB 4PJIE 4GBXD 5TDOB 3UTTB 5L8LB 2D03H 1ACZA 2DD8H 3MODL 2FX8H 3G08A 2ARJA 3I84A 4XI5C 5JNYB 1MPAH 1QFWH 1N4XH 3TO2B 2Z91B 3S8WA 3RWDB 1FAIL 3JVGA 3MV9D 3EGSB 4NRYB 3O6KH 4QRPA 2JTDA 5IF0A 1ZANH 5IHBA 5GZOD 4Z77B 4WTZG 2H32B 1HSBB 2OSLB 4NZTL 4WHYH 1X4XA 1RZIA 3IFPB 5JUEH 1NMBL 4RX4A 4Z7WF 5EU6E 4GUPA 4M3JA 3HE7D 3U4BL 1N5YH 4M7JH 4PJ7A 2FSEB 4OIAA 3IYLW 4EI5B 3SKOB 4W70A 2QQQA 4NZRL 1MLBA 5E8DH 1BZ7A 4IRSC 5E8PA 4ZQKB 4OGYH 2APBA 4LP4A 4PJ9C 5I0ZA 1F6FB 1IGTA 1T5XA 2QHRH 4CMHC 5MENB 3TYFB 3WXVH 4DGIH 2JJTC 2VXTH 2FH6A 2NY4B 1W8NA 4ZD3L 4HWZB 4CVZA 2EO1A 1MRFH 4HWBL 5LQBL 5FK9B 3ESUF 1L6ZA 3GO1H 3GUTB 1CD1A 3FB8A 3NCFB 1I8KB 2I9TA 1XZ0A 4XCEB 4I0CC 5D7JC 4PR5B 5ANMA 3MMEB 1JGLL 1JHKH 5B3JE 3EJYD 3DSFH 4IRZL 3QEQE 4ZYKA 1HKFA 2ZUXA 3GJFB 4L9LC 1A6WH 3VWJB 1MCNA 3QIWA 2XPGB 1P7KA 3IDGA 2R4RH 3TBWB 5T1KA 1QLEH 5ITBH 5FYJH 3L5HA 1IAIL 3BDYH 1M6OB 3WDHA 3ARFC 4GJTB 3VGEA 3KR3L 3MRHB 1BD2E 2GSIB 1K3IA 3MROB 1Z2KA 3ARBA 5HHVL 5SX5H 2WZPD 4R4NC 5EN2A 4G8FB 5IEHA 4I48A 3C5SA 1VADA 4ZUUB 4JRYA 3SHSA 1U2CA 2VH5H 1HH9B 1NSNL 4P9ML 3CD4A 3D39E 4RBPH 2N7AA 1C12A 3CIQA 4G3YH 4PJEA 1ADQA 3LDBC 2ZCKH 3PQYB 4NRXB 4B50A 1OF2A 1FYTB 3T77B 3S9DB 1FCGA 2BZDA 5IEKA 5L9DL 5IVXA 2NY0C 1J12A 4HS8H 3THMH 1WIPA 3OKMB 4Y4HA 3WS3A 1A14L 3ZKMC 1YNLH 4PY7A 1GC1C 1ZV5A 5F71A 4XC1H 3B2VL 1HE7A 2ZUVA 4F3FB 1PQZA 1EH9A 2X4RB 1INDL 3F12B 5K59E 4BFBD 5EC2B 4FTVE 4PJ5A 3JV6A 5ID1A 3BN9D 3L3GB 4NO0A 2A83B 1JNLH 3CNKA 3GMOA 3C08L 4ZOEA 4WUUE 3NMEA 4JQVC 2WK2A 4I0PA 4BK4A 3WFDL 2EYRA 4JEGB 4MDJB 1G6VK 4U3CA 4MAYC 5TDPA 3GSVB 2HT2C 4ETYA 2V5YA 5F6HJ 1UJTA 1OTSD 2R8SL 4JPKL 2ZUUA 3TBTA 2VDKH 1JNHA 5KOVC 1BLNB 2CR6A 5D96B 2H1PH 3HE7B 3P0VH 2OP4L 1OD9A 4QHNB 3NCBB 2EZ0D 1DCLA 3NZ8B 4IOIB 3I75B 1FVCA 2IQAA 3CK0H 5J6HA 1QFWI 4HIEA 3ULVL 3TPUB 4JM4H 5D93B 1BJ1J 5E99L 4RMUA 1DEEB 1LEKB 1VFBA 1UKTA 3D85A 1YEHH 3FZUD 2FB4H 4JZJB 3LN5B 3D1MC 1WFUA 1HHGA 5FM4A 2IG2L 1J11A 4R26H 3L5IA 2QHLA 3R8BB 3RPIA 5F3BB 3ILPA 5KS9B 2XI9A 4RISL 4K8RD 4X7FC 1T0NB 3MFGB 2W38A 3EJJX 5K93A 4XX1G 3WO4C 1I3RB 2J8UA 3WKMH 1TZGH 5C0BD 3DO3A 3JWOL 5ACLA 2I5YL 5GISL 3I02B 2OCFD 3IU3B 2YPKB 2R1YA 2VLLA 2Q3ZA 1CR9H 5HBBA 2SEBB 4WHCA 1RIHH 3TFKC 1IZJA 4UINH 3BISA 2RGSA 4XTRD 3BKML 3UXFA 3QPQD 4UI2A 5KSBA 1SJHA 3FQUA 4ZXBA 1NFDE 4WUKH 1BAFL 1F2XK 5CZVH 3OL2A 3KJ4C 4RAVA 3RAJL 1ZA3B 3MA7B 4YFLI 2A9MH 2V9TA 1KOAA 1PSKH 4MHHG 4S1SL 1DFBL 1IKFH 2QQNL 5IMOA 3VG0H 2NW2A 4NPYA 3MLXH 3MRPA 4NQDA 2BY0A 4ZAKD 1K8DB 1QSFE 1NCBL 3G9AB 1YJDH 5H35B 1TMCB 4YNYA 3V8OA 5BMFH 2IADB 3I50H 4XBEH 3QUXC 1VENA 3UYRH 4Z7WA 2ZUQC 2GY7B 4ZFOA 3GZKA 2AEQH 3OKLB 3VXRA 5DMJB 2MPAH 4FP8H 2XZQH 3NPSC 1GC1H 1J1OL 3C60D 4JG0H 2GFBB 5GS0L 5KAQG 2A77L 1FIGL 4P5KB 1CK0H 1IKNC 4PGEB 4UTBH 4HUVA 1JHTB 3BP5A 3MBEB 1CDCA 3D18B 4JRXA 4MDIA 5DQJA 4Z76B 5DO2C 4KI5F 5LGHH 1QLFB 3HUJF 3P4OB 3JTTB 2VLRA 4DKFL 1YEFL 3QUML 1DBJL 4APQD 1EEZA 5IB5A 2OL3A 4L5FH 4N0CC 3IETB 2X4QA 3JUYA 5IP4A 1T0MA 1JZ6A 3M8OL 2PR4L 4KXZH 4TSBL 3ARVA 1FGVH 5D71L 3VCLA 4HKXA 4PJ8C 2M8XA 4OUOA 4HHAB 4R0LC 4KV5F 3VWKA 5D5ME 5A40E 3NIGE 2H8PA 2VWEE 2IQ9L 5KANG 3EYOB 4P2QB 3OAZH 3P9MA 1JYWA 1MCDA 2X1WL 4JFFD 3HI1B 1OAQL 1MRCH 2WBKA 4ONFL 4M1CC 5BRZA 4UV7L 4F37F 1S9XB 1AI1L 2HKFL 1JZ3A 1EFXD 2OTUA 2AABH 5INCA 4M93C 1FCCA 3V4VL 1A4JA 5DLMH 1QFHA 4PG9B 1AJ7H 3ROOB 3FQNA 3HMXA 1TTUA 4ZO6A 1HCVA 4OCNC 5BJTA 3BW9B 4ODVL 1WBZA 2XRAL 5JOFB 1U9KA 1UT9A 4FQIL 2CKNA 4H1LH 4ODUB 1SMAA 3O6ML 3O0RL 4XP9L 5JOPE 2JB5H 1J0IA 1FFPB 1JNNL 1WWAX 3MRGA 3KYNA 1AGEB 3JUZA 1QLRA 1E28A 4AZ8A 2DLEA 3BN3B 5C0BB 4KKBD 3OKDA 1UWEL 4OLEA 4X99A 1EIBA 1BX2B 1NAMA 4FQHA 4OF0A 3R0NA 1UVQB 5I1EL 1U92A 2EE3A 4N1EA 1KYOK 4HS3B 2Z92B 1JGVH 3RUGF 5D2LE 2R4SH 1WISA 3KPRA 1ZT4B 3CLFL 5H8DA 4PJHB 3NBNA 1MWAH 1HEZB 2BVEA 1XEDA 4Y19E 2HT3C 3ZHKA 4KFZC 5HDBF 5B38G 2GY5A 1L0XA 4RMRA 3MLWL 4JZNA 1DQDL 1FNSH 1UM4L 4G6KH 1I75A 3ZE2F 4LEXH 4Y16A 4CVUA 5D6CA 4DUVA 5TDNA 7FABH 1JCKA 2B2XL 4K94L 3IDJB 5C3TA 4ZAKB 4YHNA 3VFMA 2ZJSL 3VFTA 1D6VH 1KCVH 4ALAL 1G6RL 1HHIB 5IM7A 5DJZB 1FVDB 4KROC 4NNPH 4BSJA 3KJ6L 4Z8FH 4NUGH 3FTGB 3K8KA 4HW6A 5F9OH 4M1DL 4K7FA 4K3JH 4JVPA 1KJ3L 1RJZA 3BXNA 1QO3A 1EO7A 2DQEL 4BQ8A 3KYMB 4PB0H 2X9YA 1FZOB 4X7SL 5JXEC 1IT9H 1FP5A 1K5NA 4NNYA 1ODAA 3BAEH 3STZB 2CD0A 4I5BA 4HIIA 4L4JA 1IGIL 4NN6C 2B5IB 4F7MA 3BGFB 3T3PE 2MQ3A 5GRVL 4Y5YA 3VGHA 1GGTA 4MD5B 3VMPA 1RSFA 4FFWC 4PJGE 1TLKA 1LNUA 1QSEA 1X5HA 3OKEB 5LAXA 3SJVE 1A7PH 5C9KA 4N8PA 1J1XL 1M7DB 4WNQB 2FO1A 2IJ0C 1T03H 3EFFB 1IVLA 4HG4J 3CAFA 4I9WD 5C07A 2F5BL 3ULVF 3O3EA 3X3GL 1F13A 1T83A 3GMMA 2JE8A 4KWUA 3T0DA 1MH5B 3U7WL 3GBNL 2HTKD 1R0AL 4P46A 3ORJA 1V3MA 1NANI 5B22A 1T22A 4HXAH 3GMRB 2DQDH 1OAUL 4BQCA 3PP3K 1DN2A 4ZFZB 4NZJA 1G0DA 2FGZA 2FIRT 1MHCA 1Y0LA 5BVPL 1UGNA 2UZIL 3BP7B 5DSCA 4XCNB 3KLAB 3HG1A 4RIRA 5CJ5A 4L9DA 5DGRA 4QHLA 4HUNB 3B9KA 4FNLH 4PBVC 2XKUA 4M5ZH 2NMSA 4HMDA 4E0RB 4H25A 3BPCB 3QRFM 1V7NL 4X4YA 1WBYA 2WSKA 1NH6A 4YHKL 4LVHB 4RQQA 2IBZY 1GGIH 3L5JA 4Z7OF 4YQXH 1ZMYA 4MD4B 1M7IA 4NZDA 5GRUH 3PHOB 3MV8A 4TUKL 1KT2B 3RVUC 1LK3L 1MCWW 6FABL 1DBBL 2LVCA 3K2MC 4OGZA 5IB3A 5EBMB 3KPLA 3TBVB 3QUYC 3REVB 2V5TA 3KNBB 4BH7B 1QA9B 3IKCB 3MLSL 3QZWG 1F00I 2EYTA 3TZVB 5HY9A 3T0WA 2F5AL 4RGNE 1QKZL 1IEAB 1XGRA 1OARL 3HUJA 1CG9A 2Z9TA 4OLYL 3QA3B 4WO4C 3RWCB 1ZHKA 5F6IB 3BPLB 3O3BB 5CSBA 5JHDE 5IG7A 1YEIH 3KPPB 4RMQA 1BQUA 1TNMA 4JY6B 1AHWC 3TF7C 3SE8L 2IPUG 5SWSA 1CICD 2ZSWA 3PNWA 5TE7H 3MPCA 4B7IA 1JL8A 5F1NB 2VABB 3WJLC 2ADJB 1JFQH 4PV8B 1I8IA 5EUOE 2ZOKA 3Q6GH 3KPSE 1RZFH 1LILA 1VHPA 1A3QA 1IC4H 2VZ3A 1K4DA 4G8GE 1DTUA 1I8LA 4XI5D 5CJXC 2CRZA 3NCMA 1DQJA 2G2RA 1IC7L 4F8QA 2OZ4H 4R97B 3DX8B 1XMWA 4JFDB 4FZEL 1ZHBB 5MI0B 4ZSOE 4LOUC 5TJWK 3TO4A 4N1CA 3B5TA 2PYFB 3BRFA 3PWPE 4F7EB 1T89A 2CIIB 4XVJH 1NCWL 5IWLC 4LCCA 5LG1A 2O5ZH 5KVEL 2FJFA 5JR1H 3OAYK 2FWOB 4X6BA 2EDNA 3IGAA 3QB7C 3WUWB 3LS5H 3FRPG 3M1BA 1WC7A 1UFUA 2VISB 4FQLH 4X98A 5A2IH 2OX5A 5DD3H 3VXPA 3HZMB 3CXHJ 3GBML 1GZPA 3MR9A 2WIIA 1WT5C 4IRSD 1MVFA 3QEUB 2FD6L 1BFSA 15C8L 4PJ9D 2BNRB 4JJ5A 1DJSA 3RWGB 2V17L 2VC2L 1I7TA 5C0AE 5IGXL 1AR2A 4XVUC 5CBEB 2O93L 3CPLA 4HT1L 3P4LA 4PRIE 4NN5B 4JFEE 4QRRE 3RUGA 3K1DA 2UWEA 5CEZL 2YRZA 4NKOA 5I9QC 4JO3L 4CL7A 1W0WA 2X4UB 1FGNH 5LXGH 1IM3B 3QDJB 5D7JD 1F45A 4P49A 1J0YA 3QEHA 3S35X 1CBVL 4MJ4A 4JPIB 5E8NA 2NY1B 2Y1VA 4MJ6B 4RA0C 3TNNA 1TXKA 3MGOB 1IGML 1WWWX 4KQ4H 1MNUH 1H3XA 2QQKL 2C3HA 1CCZA 3P11L 4HQQL 4IMKA 4HZLB 1U8NB 2LAAA 3VFNA 4C56D 3ARFD 1HIMH 3MUGB 2MTPA 4BSVB 3HR5A 4EBQL 4WCYH 1L0QA 3UTQB 4LASH 3ZE1F 4DKAA 2YD8A 1EXUA 4AT6A 4K23H 1YEEH 3T3ME 4DN4H 3QJHB 3LSOB 5BV7L 4XMKL 1Z6JT 5ALCH 3PDOA 4WU7A 3KWWA 4LPVA 1DVFA 1XGTA 1QSFD 4CDHA 4ESKA 3VGAB 1C7SA 3L5XL 3IT8D 4DTGH 4XXCA 2H6PA 1CGUA 2CLVA 2HLAB 2BNUA 4L4VA 5F21B 4BQBA 2NY0D 5HI5D 3S4SG 2R0KH 2P8MB 1NCUA 3ZKMD 1LD9B 3QO1A 2E8YA 1P4BL 2XOTA 3QHFH 5GGRY 1MIML 3MLVL 2I9LB 3WJJA 1JYNA 3FJTA 1OP3H 2X4OB 1TETH 1TJHH 4WW2C 3CFDB 4R3SB 3IDIB 1KFAL 3CH1B 1S9WA 2VOTA 3LQZB 3QDHA 5ID0B 1E27B 3T08A 1BQLL 5D7SL 3ECBB 4Q9CA 4F7TA 1S5HA 3V0WH 1OAZL 1A21A 4IMLA 3RJQB 4F33B 2BDNL 1X6NA 1KB5L 4YLQT 3PHSA 4EEEA 4XCYA 2DI7A 2X4TB 4D3CL 4JR9L 4TUJB 3X13B 1I1FB 3MO1A 1ORSA 2HFFB 1E6OL 2XZCH 4YO0B 3Q3GB 4MAYD 1K6QH 2HT2D 4QCIA 4Z0XA 3CU7A 1CZ8L 5KG9B 3FFCD 4KHXL 4YC2C 4DGYL 2YUZA 3SCMA 1B4JL 2CKBH 5I1CL 1FZJA 3EOBB 4WFEE 4ZUWA 5C7XL 4Y5VA 5TE6L 3NIDE 1WBXB 1DEDA 5DC4B 5I6XC 3VG9C 1UCTA 1AO7E 3SPVB 2C7UB 4NQEB 3V0VB 3DX7A 4X6EB 4YUEL 1A7RH 3VH8B 3ZZ1A 2NY3C 3EKCA 1PEWA 1P4IH 4L8DB 1TCRB 2VNCA 4IRSB 5MEOB 1XIWC 4EN3C 1PY9A 4WW1A 4GRLD 4PJ9B 1YQVH 5DD5H 4PPTA 5DMIL 3L3IA 2H3NB 1IAOB 2OXHA 4CMHB 1LDSA 1ACYL 2IGFH 1RK1B 4LPXA 3TYGH 2A74B 1GGBH 2X09A 5BXFA 3ZKXC 1VACA 3V6OE 5DS8A 4TOYH 4PLOB 4P59H 2EYSA 4J7RA 3TO2A 2Z91A 1AGBB 3HZYB 3VXTB 3V52L 1I1RA 3JZ7A 2YD5A 5EIQA 5D7JB 1I8MA 3P0GB 1IGJA 4Z77A 2GJZA 1P9MA 2H32A 1HSBA 2OSLA 2XTJE 3O6LH 2PETA 4L9LB 3OV6A 3H7BA 3V5DB 2GJ6A 4M00A 4JHBA 1LP9B 3PWJB 1XFPA 4KI5E 1T6VN 2QR0A 2RFXA 4HC1H 3BRGC 1FBIH 1Y18B 1YDPB 3TFKD 3UC0H 4OLUH 1NBYA 4U1NB 4HH8A 4XCFH 5F7KC 4C56B 2OYPA 3ARFB 1G0XA 3VFGH 2W0FA 5MHSD 2BSTB 4WV1A 4Y19D 4U6TA 1TQBC 1HHKA 3BUYA 3T65A 4YHZL 4XNMB 5DRNB 4K7PX 1IGFH 2XWBB 5MENA 1R3LA 4UV4H 1A5FH 2XQBH 1PX3A 2D7OA 2E9BA 1DLFL 5EOCH 4KV5E 1QHOA 5B21A 1T1WA 1NC2D 1RJLB 2E6QA 2Y5TA 3GM0A 2W9DH 3QUXD 3MNVA 3LDBB 3TJHC 1JF1A 1CFTA 4GRWB 1SBSL 1QVOB 1PLGH 3B2UC 5J8OA 4U49A 3BFOA 2NY0B 3SGEH 4S11A 3DBXB 5HHOE 4X6CF 4PR5A 4ZOBA 3ESVF 2DI8A 1X5IA 2XKSA 1O5DT 1UC6A 2GSGB 5DVMA 5DO2D 4OUUB 4DJMA 3TP4A 3OHXA 2GTZB 4JFOB 1KEGH 1M6OA 1QBML 4N0CD 3RVTC 1H5BA 3D9AH 3SE3A 4P9HC 2GSIA 1MCFA 2VZOA 2GK0B 1ZTXL 1N5AA 3PGFH 3STLA 4GQPH 3IFNH 4PJ8D 2R1WA 1XH3B 4MAYB 1CFBA 5C6WH 5BW7C 1TVBA 1B0RB 3QJFB 3FFCB 4KJWC 3T4YA 4MNQA 5CP7A 5DK0B 2QADD 1HH9A 1L6XA 3HMWL 3QISA 1I7RA 3INUL 2J6EA 1TZIA 3WYRA 2K7PA 4C59B 3O2VL 1D9KD 1KEML 5TF0A 1AFVH 1YEJH 3VFOA 4M1GL 4I4WB 1C08A 4I2XA 1JI1A 3RNKA 4EOWH 1B88A 2V5MA 4M1CD 4RFOH 1OAKH 4JAMA 3N1MC 1LO2H 5HDBE 3PHQB 5E4IA 2WBJD 1MJJA 5GGVY 5E2WL 5EIIA 3R1GH 3V6ZB 3IRZA 5ISZE 3SGDH 2R0WL 2YRPA 2DLIA 5FUOH 2I60L 2ESVA 3ZE2E 4HMCA 1I4FA 4AMKH 3EO1B 3U30C 2PXYD 2A83A 2COQA 4XP4H 4UB0L 4H1LB 5M7QA 4Y4KA 1V5JA 1G6RA 1F02I 3WO4B 4KTDH 4LCUA 4PJAA 4RAHA 2C9AA 1SEQL 2HAZA 5L8KB 5FCUL 3GSVA 3FKUS 3QUKA 2DRUA 4Z9KB 4FN0A 1BLNA 4MCYB 4FQ1L 3VXSE 3KLHC 1J0JA 1T04A 3HFML 3HRZB 4HEPG 1MHPH 4IOIA 3LZFL 5DR5H 2WQ8A 1KTDB 3DURA 1NDGB 2D4DA 3Q1SH 3KHOA 5I17A 5AAWA 3ZDZF 2F54A 3KJ4B 5CZXC 2JCCE 5KSVB 2J12B 3ULVE 2P5ED 4P23A 4JGJA 1A6TA 2AJSL 5F7HA 3KPSD 2MOVA 3QG7L 5FV1L 1NC2B 4EI6A 4G8GD 2X4NA 3QUXB 2VLJD 3MLYH 4KROD 2ZUQB 4N68A 4JQXA 5AZ2L 3JSSA 4J3OC 3T0EE 4MNGB 1R5VA 5HHNB 5ILTL 2YA2A 3NPSB 3SY0B 4FG6C 1SY6L 5AYQA 3DI3B 4U1MB 4PGCA 4NM8H 3UJTH 5E08H 2YPKA 3L5WB 4LAQH 1N2RB 3QCVL 4XC3L 5IMLB 2SEBA 1ZHLB 3FB7A 2C1OB 2VDMH 4FXKA 1G9NH 3B6SA 4HJJL 1A4KB 4PRDA 5CCKL 1IAKB 4MQXD 1RUPL 4P5TD 4N8VG 4XP5H 5DQ9A 4BELD 4UZGA 8CGTA 4Z7OE 1OLZA 2ITCA 2PO6A 3QUZD 4FFVC 5D7LE 2ZCHH 3MA7A 3SGEI 4XNUL 1NGWA 3QWRD 4OKVA 4PJ8B 4ODWB 3VRIA 4UU9A 3L6FA 4JFPA 4R0LB 5ALBL 4HDIB 1ZGLM 3QCTL 5BS0E 1GAFH 2Q76B 2L0DA 2APVA 4MJ5B 3P2TA 5CKAA 5AG9A 1IL1A 1RIUH 3W82A 3BDBA 4PRID 3EO0B 4QLRA 4QRRD 5C0FA 3IDNA 2AJXL 2AJZB 3LKQB 4ZUVB 2E6JA 5DEZA 3VXOB 1CGTA 2GFBA 2ZPKH 1YMMA 4M93B 1OSZB 1T7ZA 3F6IA 3MLUH 2P48B 1V3KA 3QNZB 5SX5K 3TNMA 3NFPA 4CBPA 3MCLL 5T1LA 4YR6B 1YPZE 3LKPA 4KRLB 2IC2A 1JF5A 1S7WB 1U8LA 4F2MA 4F7CA 3OXSB 4RBPK 4WEBH 1NGYB 2HJFB 5CMAB 4ZPVB 1HOCA 3EFDH 1S5IL 1F3JB 4JO4H 3GIVB 3LB6D 4GKZA 1PSKL 3QRGL 3RVUD 1AGCA 3QIBA 3H42L 2O61A 3VXUE 3MLZL 4FQ2L 4QHUA 3QUYD 5FO8B 3U46B 5BO1L 1EO5A 3SGDI 2FX9L 1J8HE 5C0GA 4C83A 4PP1C 5JQ6L 1X5KA 4P2QA 5C8JA 2HTLC 1B6DA 1AQDA 2BCKB 1BBJB 4WO4D 1DQLH 2MKWA 5D1QC 1ZGLB 2CLRB 1CIUA 5T5FL 4KZDL 2MJWA 2EIZB 3D3VE 3BH8B 4HUXB 1QQDB 5L0QC 4K71C 3T0XA 5JA8B 5DJDA 1KJ2L 2P5EB 3LV3B 2J88L 5JO5A 1LO5A 1UZ6E 1EHXA 4HGMA 1PX4A 5CEYB 3O4OC 3QBTB 1KSRA 2AJ3B 2AV7A 2AV1A 1RI8A 1VB9A 5IW3A 2VLJB 4W4OA 4KROB 2CPCA 1A22B 1Q0XH 3HS0A 5DD6B 3DNKA 1QRKA 3EW3B 1QTYT 3VW3L 4BFGA 1HILA 5F89B 2HVKB 5GGSB 1AGEA 1YN6B 1W0VB 2ADIB 3UDWC 3GSRA 4M5YH 5HSFA 5DQDL 1I1AC 4NN6B 5JORA 5JZ7C 1MHHA 4D8PB 1BM3L 4L3CB 3CVIL 4X6DF 3RWJB 3SDYH 3EYVA 1MCWM 4OM0L 3MV7D 5DI8A 4UTAL 5I16A 5T33H 1CLYH 2Z92A 3X12B 3K1KC 1VGEL 2P8PA 4N0FA 5IIEB 1OCWH 3HI5H 4OFYA 3O3UN 5CSZB 3OPZH 3T0AA 5C0JA 2A2QT 3JVGC 5E2UL 2CH8A 2HWZL 4CN1A 3MJ7B 2BSSB 3MV11 4G6FD 1S7RB 1G7LA 1T6WA 3LVEA 1JGUH 3QEGH 4OF5A 3D87B 4OAWA 4P4RB 1H3UA 3AMLA 4XHJD 3UTSA 3F58L 4U6XB 3SDDA 5FOBA 4DQOH 4XVUD 4MQ7A 1JUFB 2B1AH 3GSNL 1FVDA 4QT5A 2VQ1A 2B39A 1WFNA 3FTGA 1QYGL 4KAQH 5D72H 1N8ZB 3GSUB 3L3DA 3UBXA 5TE4H 1QBLL 2Q86B 1S78C 4WI5A 3TH3T 4TQEH 1RJYA 2NY6C 5C0RL 5L2KB 3DRTB 3CVHL 5C08E 3G9VA 1HZHL 4LLQB 3TH2T 1JHLH 3TJEH 1C5CH 1MQKL 4O2EB 2QEJA 2EDYA 4IRJA 3MYJA 4LRIA 3DV4B 3A6CL 2X42A 1AXSB 2BNQE 4WWKA 2W60A 4NNXA 5D6DC 1T2XA 2LU4A 3EFFA 5FHBL 3RNQB 3ETBF 3L1OH 5GRWA 5IB4A 4NT6A 4P2RE 2AGJL 4KTEL 3V5HB 1RZJL 3GRWH 3QDAA 5T5NG 1MH5A 3QUYB 1O7VA 5ENWB 1LE5B 2X89A 3H0TA 4PRPA 1ONQB 3TVMA 3QIWC 5I1LA 1JYXA 4Z7QE 3QDMD 2GJJA 1FFRA 3GMRA 4UT9H 1J05B 3QIUA 4Z8FL 3OAUL 4UIMA 4NUGL 4OF7A 5E56A 3BP7A 4WO4B 5DUML 1I9JL 4NWUL 3CU1A 5J7CC 1A8JH 2XN9A 3ARBC 3ARGC 4YBQC 2ARWA 3S3SA 5D9SB 4XHQA 5HHOD 4PYHA 3S35H 1A6VH 4LPYA 1ZLWK 1AHWB 1FG2B 3I6LE 4OIIH 1BREA 4V1DA 3K0WA 4BK5A 3HC3L 4HAFA 4OFIA 1AR1D 5D4QA 2YN5A 1FJ1B 4JGUA 4Z7UB 3SN6N 1NGPH 2Z8RA 3OAZK 4E5XB 5FGCB 4Q9RH 1UJ3A 5I1KL 5DWUL 5JPNA 4WHTB 4P3DA 3T4AA 3I2CL 4Y4HC 4MJIE 3VXQA 1MAMH 3P0YH 2Q20A 4ONHB 3ZKNC 5EA0L 5HPMA 3MRRB 3REVA 4KMTL 1QBAA 3UTZA 3KNBA 4PJXB 1DANT 4PTTB 5C6TL 1FO0B 1PZUB 3O8XD 3MV7B 1EHNA 5F3HB 5T1MB 1FNEB 1MSPA 1NBVH 1IEAA 2CKBB 4K9EC 5INDA 1A7OH 1M71B 2V7NB 4LLDA 4HF5L 2AEPH 2YS4A 3U2SB 3S88H 4I0PC 5EU5A 3KPPA 1MI5D 4LMQE 4JKPH 1LEGB 4ZUTB 4G6FB 4JY6A 1XIWD 1A7NL 5ICYB 2A0LC 5HI3C 2J7LA 4JDTL 1KLUB 5F1NA 4PV8A 4XH2A 4KK6C 1E0OB 2BVPA 3FQXB 5HYIA 5A16A 5L8JB 4OZFH 4YQXL 4I0KA 1TENA 4PJ7E 1MFAH 4TRPH 4XNZC 2IBZX 1HYSC 4YHMH 4O51A 3BD3A 4RMVA 5KTEH 3KPNB 4WI9A 4C55A 1T2QH 4EIGB 5TH2B 5I9QB 1FNAA 2VAJA 5EO0B 3GEWB 1FQ9C 1CL7I 4TPRH 1RZGA 3MRJB 3GMLB 4XPGL 3U1SH 1F8TL 4F7EA 5IESL 3CFEB 1SM3H 5DFWH 3UPRB 1HSAB 4PJBB 4JRWA 4Z7VB 2ADFL 1XGYH 3W0WB 5CILL 2AP2A 2R56H 5DVKA 4PG2A 4R90H 1IEBA 4YHIB 4CMMB 3VXSD 4JY4A 3QQNA 1NL0H 3QH3A 4HBCL 3OKYA 3I6GA 5AD0A 2X9XA 4Z0BH 5T3ZL 1KPRA 43CAB 5ANME 4AL8H 1F11B 2CDGB 4YDJB 4PJCA 3OWEA 4PTUA 5LJYH 3G04A 1KCUL 5LBSL 3QDMB 4Y4FC 1TVHB 5AZEL 4QHMB 4GAYB 2DWDA 4JHZA 2ERJC 5J1SC 2X2YA 4U2YA 4P3CH 5D7IA 5JLZB 3HE6A 4XNQA 3BGMA 5E8EB 4ZXBC 5DA4A 2GCYB 4LCWA 4DUXA 5EUKA 5C70A 1ZE3C 4OCLC 3T0ED 1CFQA 4ZFFB 2MNUA 4LSQH 4EUPA 5IT2H 3QDJA 2QKIB 3VDBA 5CEZE 3J7HA 3FB5A 2A6KA 2E7CA 5TGBB 1D5MA 3S5LA 1MHEB 2VL4A 1KG0A 1L7IH 3RQ3A 3DGCR 3N06B 4LKXB 1QFOA 4WW2B 5I8EA 1IILE 1ADQH 4N9GB 1G7JB 2A73B 4XPTH 1FDLL 3TA3A 4ORGB 3O9WC 4TUOA 3G6JB 5IW1B 2RJMA 1K2DB 4NHCH 3CMGA 5A3ID 3QFJE 3RVTD 3O6FC 2FGWL 5TQ2L 4ELMF 3UTQA 5IMKB 1FL3A 5C0EB 2D7TL 4CJ0A 1H0DA 4DKEL 5FO7A 5DJ6A 4K7PH 3UYOD 5FYKL 3GHBH 5K9JL 1MFCH 3WIIL 2IPTL 4KJWD 3BQUA 1A02N 1DLHA 4YC2B 5BOZG 3O2DL 3ZYZA 2D4FA 4K9EH 3QG6B 1QSZA 4OCSL 2X4PA 2YUXA 4N1HB 4PB9L 4RAUB 4JFYB 5I6XB 3VG9B 3MOQA 3EO9H 1R5IA 1IM9A 2I27N 2NY3B 2CDFB 2DQTH 1LD9A 2VXQL 1XIWB 4O2CA 1DL7L 4EN3B 3ZDZE 1YC8A 2I9LA 3VWKC 4WI6A 3MXWL 2X4OA 3D48R 2ADGB 3X17A 3CFDA 1JGEA 3LQZA 3NCJL 3ZLQC 1JWUA 3ECBA 4GG6A 2DBLL 3PWVA 3ZKXB 4OZIB 4F33A 4N0UA 1KIPA 4G8EB 2NZ9C 3DVGA 1XCTA 5AYUH 5HDQL 4LF3A 3VDCA 5CD5D 2X4TA 2FR4B 3DO7A 1GPOL 4EIZC 3FOMB 4PJDB 2YPLD 1AXTH 1KTLA 3GDBA 5KG9A 3EBAA 4ZTOL 1ZWIB 2AXFB 2R39A 4X7DC 1T7VA 2ARJQ 1J8HD 1J1PH 3IDMB 4X0KB 1K8IA 3RY5A 2DQCL 2NX5E 5DURD 35C8H 4KKAC 3KLHD 3VXMD 5L7XL 1MFBH 1U3HA 1A1NA 3BZFB 1OD7A 2HKHH 1TQBB 4L8SA 4OCYH 3ZE0E 2B0SH 1CLCA 4RRPG 5HHPB 2DQJH 3Q48A 5C09D 3MGTA 4F9LA 5CGYC 5E5RB 4L1DA 1WZKA 1RK1A 1D5XB 1QNZL 4O58H 3MTRA 3NH7L 3WFEH 1IC1A 4HKZB 3U0TA 1DBKL 4DWHA 4OLWH 2WWMC 3IF1B 1OGAD 1XR8B 1NGQL 2IANA 4O9HL 5I1JL 3CC5B 3VXNB 4H8WC 4OGAD 2W59A 4PJFF 2B8OT 4FG6D 5F7UA 3FT4A 4L3EE 4MLIA 3OMZA 4Y16C 3IRPX 5HHQA 5E9DB 5KW9L 2D0HA 5FDWA 2ED7A 3V5DA 4HFUL 2VDNH 1LP9A 1R24A 32C2A 1DN0B 4P57B 4U1NA 3V6FA 4G6JH 4JVUA 1C7TA 1MCCA 3L3KA 4NKIL 5DRWA 3VXRE 4YXHH 2E9JA 2E9IA 4L8BA 4XPFH 4Q0XL 4X8XA 4FFVD 1Z9OA 2A1WH 4OCWH 2D31A 3TGXA 2R9HD 2YN3A 5SWZE 4WDIA 4OLXL 4JRXE 1RQ5A 4X4XB 1OAXH 1U8OB 4LGSB 4Y5YC 4M4PA 3C5ZA 5FECA 4XMPH 1FZMB 5JW4N 4R2GD 1E4XH 4UDUB 2EH7L 1MRDH 3RDTD 1RULH 1RJLA 2F53D 4TVPD 3KYKL 1WIUA 4OZHE 5FA3A 4YX2L 2NY5C 3FN0H 1HQ4A 1MJUL 3CFCH 3RIFF 3SDCA 3BUTA 4E41A 1T83C 5ELIA 2GUOB 4MD0A 2CXKA 4GSDH 3VA6A 2PW1B 5EU7C 3MLTA 3LMJH 1GSMA 2FJGA 5J0BA 1CDHA 1MFDL 4NQSA 3DXAD 5HYJA 1VFUA 1MCBA 2VR5A 1N3NB 3P4NB 3P73B 1QRNE 5ACZA 3RVVD 3U30B 4DFHA 1E4WL 3EDKA 2VYRE 2CQVA 1AIFB 3MXVH 3KS0J 2YK1L 2R2HB 4JQVA 2OR9L 1IQWL 2XA8H 3B9KC 3ZDYF 3O45B 4MQSB 4A6YH 5C2BL 4P2RD 2OTWA 4XP1H 3HMXH 2AJUH 3GMNA 2YPLB 4U6YB 2R23B 2MQ0A 4X5LA 3RL1A 4ONGL 4K8RL 3DMMA 1UYWH 3KXFE 2VZ1A 4X6DE 2XIDA 1DE4A 4PP1D 1HINL 1OP3K 3PP4H 2IF7A 5EU3A 1SEBB 3ZDXF 5DEFA 2DQGL 4XBPB 1O7SA 1RURH 1FLRL 2HTLD 1V05A 3UJJH 1FE8L 3VXMB 5JW4R 2YD1A 2P5WD 5D1QD 5JW3L 2VTFA 3C9NB 1HKLL 3LKNB 1U8IA 4QTIH 3BKJH 3PHQA 3QO0B 4HCRL 1MCRA 1YN7A 1OHQA 5C09B 4DGVH 3I9GL 2Q8BH 3QXWA 5IKCB 2Q3AA 1DQQB 3LEXB 3MFFB 3DX6B 2P42B 4G9DB 1EZVY 1CLOH 4X9BA 1I1YA 4JHAL 4AEHH 1GZQA 2VZSA 3RKPA 4RMWA 2JIXA 3IJHB 3V0AC 3KPRE 2HA1A 3D0LA 1R3JB 1OGAB 4H1LA 4R4BA 4PRHE 3B5GA 1RMFL 1KCLA 3GSNA 4DVBB 2FATH 5HTSA 2X70A 1U91B 1EEQA 3DI2B 4D9QD 4XWOD 1T21B 5EOQL 2VIRB 1PBYA 3S36H 3TBYB 1EO8H 4BM7A 5FXCH 4UNTA 2YZ8A 5HYSA 1G7HA 3OR6B 3CDGA 1KN2L 2QTEA 4MCYA 1UWXH 1MCPL 5DXWA 4DZBA 5CJQL 1BFTA 2DKUA 5B39G 2BJMH 3PABA 1I8LC 1S8DB 5L2JA 2EDDA 3HRZA 2QBWA 8FABB 1MWAA 1KNOA 4KUZL 1FG9C 1QEWA 3NAAL 1U8JB 1JPTH 4QRPD 4RWYH 3TO4C 3NFNA 3RKDC 1R6VA 1AE6L 4KI1A 1T89C 3QXDB 1T4KB 3BJLA 1EJOH 3BIKA 2EDBA 3GKWH 3L3JB 4LCCC 2W9EH 4RX4D 4UQ2B 1RVFL 3LQAC 1UA6H 3KAAA 3DIFB 3OZ9H 4YIQA 5AUMB 3NABL 2VERN 4KDTA 4K07A 1VPOL 1H8NA 1F90H 1ZKAA 4OI7A 2DIAA 1MFEL 3U9PH 3FMGH 1W8OA 3GSXA 4HS6A 4YXKL 4AQOA 3SY0A 4OLVL 3H2WA 1NDMB 3BOVA 4XAKD 3B9DA 5FGBA 1ED3A 1EJ6A 1DBAH 3DXAB 3CSGA 5KS9F 1ZHLA 4LNRB 5IQ9B 1NGZA 2ORBH 4R7NA 4S1QH 1E4XI 4OZ4A 1BP3B 1T66C 3MRKA 5D70L 1XR9B 3EJZC 2NLJA 5HHXL 5KZCD 3O3DB 5L6YH 3BSZL 2Q6WA 2PCPB 1Z5LB 2Q87A 3TT3H 3VDAA 4LPCA 5KVFL 3ROLA 4NJAH 3ZHLA 2OTPA 1A9EB 1JTTA 5ADPL 3GIZL 3D5OF 4W4NA 2H41A 4HDIA 3QIWD 1BECA 4H5SB 3ALPA 3BKCL 3M17A 1RY7B 2VLKA 3UO1H 1NAKL 1YUHB 2E27L 4UNUA 1KPUB 1PG7W 3MOBL 1JRHI 3MODH 5E4EC 4OCRL 4HIXL 5D1QB 1U93B 2P5WB 2JJUA 3K4DA 3LKQA 3ARBD 2G60L 4YBQD 5EZJB 2E6PA 3UJTL 1G7MB 3RWHB 5L0QB 1EFQA 1FAIH 4K71B 2PW2B 2VUOA 2XT1B 2GT9A 2G75B 4XZUB 3N1GC 2VDML 4GO6B 4JRYD 4Y1AE 4HWUA 5DHVH 5F96L 5FEBA 1DVFC 2ATKB 1DSFL 2MHAB 3MRNA 4RCAA 4M7KL 1PKQA 3O4OB 4NZTH 4LHJB 1NMBH 4XXCC 1NGYA 2H26A 1KPVA 4DEPC 3U4BH 5KN5A 2DAVA 4JVWA 1KULA 4HBQA 1F3JA 4UIKL 4WFHE 4U1KB 1V7ML 4LIQL 4Y4HD 4NZRH 3I6KB 3TIEB 2R2BA 1OT2A 4YDVA 1KENL 3RI5F 3ZKND 4CN4A 1I1AB 3WJJC 4JKMA 3MRCA 4JQIL 5DK2B 1S7QB 3UAJC 5J89A 4PJ5D 4Q2ZA 4ZTPL 4NO0D 2K7QA 2ARJB 3MCG1 2DMBA 4ZD3H 2EXYC 1F4WL 4XNXH 2CK0L 5LQBH 4HWBH 4QRQB 4I0PD 5CWSA 1EHLL 4DCQA 3IS0X 4QRPB 1WCBA 3KPQA 5IF0B 4GG8A 2IAMA 1H15A 3RX7A 4WGWB 2A0LD 3DHJA 4WI2A 4RNRA 3LV3A 1QD0A 3PXJA 4BA8A 1JGLH 3PV7A 3SCMC 3P9WB 1RZIB 4XB8A 2CMRL 1WJ3A 4UT7L 3F7YB 3JWOC 4IRZH 2HP4A 4GUPB 4Y5VC 3RRQA 3VI4E 2DWEA 1AKJA 4OZFB 4PD4K 2ZG2A 4OCXL 1HN1A 1CGWA 1B2WL 1HYSD 1IAIH 1C5DA 4QOKA 1MLBB 5F89A 1BZ7B 3KR3H 5E8PB 2OZ4A 5EFIA 1W0VA 5HHVH 3D85D 1NLDL 1IGTB 1T5XB 4LGRB 3MJ6A 2NY6B 1U95A 4P4KA 5E2VL 4HH9A 2W0PA 5D5MB 4HEME 4WTWA 4X8JA 4HK0A 4CVZB 1NSNH 4GXVL 4P9MH 2NX5D 4XBGB 3U0PA 1P7QD 5D2NA 1KACB 2UZYB 1CD1B 5CSZA 2UWEE 2AK4E 1LDPL 1XZ0B 2I9TB 2BSSA 5L9DH 1MJ7L 3HAEG 4MB3A 3BVNB 3QCUL 3WFBL 5EOTA 1NUGA 1A14H 1P9MC 3DGGA 5C9JA 2FJHA 3S34L 5GS0C 3B2VH 3QIWB 1INDH 1BVZA 1P7KB 4HFWA 3IDGB 2DLHA