4P2RE

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
SGGKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 245
sequence length 245
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE01
1LE9A 3I9GH 5FGBC 2FSEA 3QFJE 4DFIA 4NQTA 2F53B 2Y23A 1TZIB 3EYUL 4QHNA 3GHEH 3DARA 3JWOC 3CC5B 4N90D 2QADC 4NO3B 1KJ2B 3C2AH 3DTXB 2AJSH 1MWAB 3HZMB 1ZT4A 5DTFA 3HLAB 1CU4L 1AJ7H 1GHFL 3BEVB 3CPLB 1MCDA 4KY1H 1VHPA 5GGSB 3CCHB 5DRNB 5FHAH 2XYCA 3GJFK 2MJWA 4YQXH 2VQ1A 1VGKB 3HZKA 5E99L 4A6YH 4PRHB 4LQ1A 3UC0L 3RBGA 4KTDL 2D31B 1XGRA 5C09B 4PY8J 5HHQA 2NXZB 2UZYB 4RDQF 4GG6B 3O4OB 4HJJL 5IHUL 2H9GB 5EPMB 2AVGA 3CFCL 4BH8B 2EYSB 2F53E 3WNNA 4GQ9H 2D9CA 5DC9B 4MCYB 1TVDA 3HZVA 4FQHA 3J7HA 1UJ3C 1UJTA 1YECH 4XXCA 5D7IB 1IILE 1VFAB 3NZ8A 3W2DH 5BV7B 5DMKB 1RUMH 3IFLL 5HTSA 2OK0L 2BP3A 3RWFB 2YD6A 3T4YB 1KIRA 3LS4H 1U8MA 3G5ZA 1MSPA 1FBIL 5E00B 3D2UD 1P4IH 2FZ3A 4MJIB 4ZNEE 3GMNA 1ORQB 3A6BL 1A21A 4Q9BA 3LPWA 3C87A 1LO3L 3IXAB 4PRHE 3W39A 3OWEA 1P4LA 1DVFD 3OR6B 4ZFGH 5IQ9B 1M6OA 1EZVX 4LOUC 4OCXL 4GG6E 3U1SL 5FKPA 1FZKA 1NLBH 2GTWB 4NQCA 4PJ5D 3GSUA 2YUVA 4PJ7F 1FJ1B 2XKNA 3DV6A 2C3VA 3ZL4H 3MRMB 5EU3A 5FA3A 2Y7QA 3FZUC 3TNMB 5C70A 1A3RH 3B9VA 3UPCA 4XMKL 1BQHB 3HE7D 3L7EA 2CGRH 4YGAB 4ZSOB 5TGBB 4MJIE 4X4ME 4ENEC 1L0XA 2NR6C 4LU5H 3EDEA 2QL1A 2FB4H 2V2TA 4KMQA 3D0VA 1NAKH 4KKCD 4X6CB 3MUJA 4MQTB 3JBG7 1ETZA 5JW5B 1FNAA 1BM3H 2WBJD 4UT7H 35C8H 1W72B 3EFDH 3GGWA 2X2YA 3IVKA 1E4XL 1I9JH 5JOEA 4PJEF 3RVXD 5TQ2L 5I17A 5A2FA 1PEWA 1UENA 1KXVC 4OBSA 4XHJD 3ARYA 4NKOB 1AGCB 1HZHH 5DMGC 1F4YL 2PTTA 4L8SA 4QRTA 2WP3T 4HUKB 3FT3B 4JO3L 3EUUA 3P4NA 3TIDB 4Y4KD 3FQTA 4KUCD 3GMQA 2J3SA 2H1PH 3NTCH 2E7CA 2X42A 3F7PC 3KDMA 3UTZA 4X6BA 1OB1A 4OI9A 3TBVA 2QADB 4X6CE 1I7UA 2DMKA 5HDBE 3AB0C 1DBMH 4I9WD 4KJPC 1JBJA 3PP3H 5BRZB 5L8KB 4KQ3H 5C08B 1U2HA 1UQSB 1EK3A 4J3XA 1P7HL 4DCQA 4LEXL 2YBRA 1CDHA 1QQDA 3U4AA 5ACLA 3BT2H 3MLRL 3ZKXC 5D72H 2M26A 2NY4B 5H94B 4EI6B 5TE4L 4N0FB 2MNUA 1YC7A 1HNGA 4U3HA 1BJ1H 1T04B 1QEWA 1YN6B 5EFIA 4XNMB 3BQUC 3S36X 3ZTNH 4HBCL 4NKIL 1A7QL 2OMBA 5E2TH 3WXVH 1AR1C 1VACA 2DYPB 4GKZB 1JHLL 4LVHC 1EV2E 5E8OB 3C60A 4KKAC 3QDJA 4JRXB 3TWCL 3JSSA 4HG4K 3RVWD 4HFWA 3V6FA 5C08E 3IKKA 4I0PA 1I3GL 4KQ4L 4LLMA 4YDVA 4ZAKD 1FC1A 3QCVL 3BP7A 4Z0BH 3AUVA 1JGDA 5T5FH 4BQBA 2UUDK 3LPGA 5HYIA 4MA3B 5KOMC 3E3QC 3KWWA 2IPKB 5D93C 1W0YT 1JF6A 3VXMD 1HYSD 4MA8L 2IALB 2AV1A 4JRYE 1JHKH 1NCBL 3BPOC 3WIFA 4P46A 3LQZB 1DSFL 2AJXL 3U0PB 3PP4L 1I3RB 4J3UA 5C1MB 3EOYG 3D85D 4HEPG 3UTTB 3UBXI 3ORJA 4PJDA 3NACL 4G7VL 4MQ7B 5EO0B 2AJVH 4JRXE 2Q8AH 2R2CA 5GS1C 1MQ8A 2HVJA 2I60H 2OJEB 3O2VH 4OKVA 3NN8B 2M8XA 1UZ6F 3ARTA 4X6EB 5CS7A 2K7PA 4R3SA 3JUZA 4WW2B 1MF2L 2B1HL 5DRXB 4HAGA 2E9JA 2W0PA 3D39D 3Q2CA 3MV7D 3R0NA 3U83A 3VFOB 2X4SB 3DV4B 3DXAA 3GBNH 3QUMA 1T7WA 4WY7H 3VGBA 4QHUA 4BQ8A 1U9KA 4JFHD 4Q9QL 4PJ8D 4WFHD 5D2NC 4Y4FA 5C0BA 4X9FA 4JO2H 4TRPH 1JZ8A 5EU6A 2IAMB 2HWZH 4KPHL 4GKOA 1YEJH 2DAVA 4UT6L 3DMMA 5L7XH 3PWJB 3UJTH 5E94A 2DQDL 3UTTE 5IMKB 4Z7UA 4LCCC 3TA3A 1YN7B 1L7TH 2UV3A 5KANI 3QB7C 4LLUB 3THMH 4NWUL 1V05A 2BY0A 5IB2A 4PD4K 4A2LA 3RL1A 2A1WL 1EHNA 2PYED 4QY8A 3L3HB 4ALAH 4KKBC 1K8IB 2EDLA 4M3JA 5BVJA 3DGGB 5F1IB 1PVHA 2XTJD 4X7SH 2XNAB 4I5BA 3EZ8A 3ZKXB 2DMBA 2P5WB 4RISH 3QXDB 1NMAH 3S3PA 5DURD 1FRGH 1XCTA 4ZG1A 5CEZL 1U3ZA 2VSCA 3D9AH 1I7TB 1NGQH 5ACMA 4JZOB 2EIBA 1A6WL 3P30H 4FQJH 2ILLA 2ZCKH 1QFWM 4DAGL 1SHMA 3JV4A 3REWB 25C8L 3IDNA 3A6CL 3P0VH 3BZFA 4XPTH 3B2VH 5HGAA 1XIWD 2ZPKL 3PUCA 4JCMA 3C5JA 1KJMB 3NCFB 1LK3L 1NUDA 4GQPH 3K8MA 1FORH 1IM3A 5C07B 1IM9D 3QDGB 4GAYB 1QBBA 3SDXE 5FUOH 5B21A 4NQSB 4I0CC 3UJIH 2AAVA 3T0EB 1AD0B 3KPRA 1VADB 1KCRL 5EBMB 2YPKB 4WO4C 3WSQH 5BXFB 3QISA 1FNFA 1R3HB 2J1KA 2JJSC 2P5WE 3QFJD 5D93B 3QCUL 2OSLB 4EBQL 5B38A 5LXGL 3S96A 4OD1H 1NGPL 3U7YH 3FQNA 4CVZB 3RDTB 3PWPB 1MCEA 3PJSB 1XZ0B 3GKWH 5CD3A 2GUOA 4XPAL 1AO7A 2ICWA 5HJ3B 1W0WA 1CFQA 1VEPA 1NAML 4JVUA 4HK3J 2XFXB 1HK6A 1CFTB 5CBEA 4X98A 4D0DA 4PJFA 1OTTD 2FYYB 1ZT1A 3QHFL 5F96L 4LIQH 4HULB 1G7QA 4R4FL 4OCLC 1KLGB 4JAMA 5GJTL 1J12A 3DUHA 3I50H 1CGUA 4BYHA 2HTLC 4TTDD 3IU4H 4P57A 3MV11 2QQNH 4QOKB 5DJ8B 1RV6X 2X4TA 2FLRT 4U1JA 3WNOA 4KVCH 1MEXL 4HDIB 1JIBA 5FGCB 4WU5B 2JKXA 4U7KA 2H8PB 3SGJC 3QIUB 5DJCB 2QLVB 3PWPE 1EGJH 4GRMB 1KIPA 1G7MB 2PN5A 3GUTB 1A6TA 4UDUB 4XVJH 3PNWA 5DDHB 3G6JF 3I6GB 3KS0H 5B39G 5J0BA 1KG0B 4O5LL 3WHXB 2H3NA 3EZJB 4LSSL 1N6VA 2HFEB 5DEFA 4M43H 5A2IH 3I84A 2D7MA 4HX1B 4PRHD 5L2KA 1DQML 5JXED 4OCSH 2ZUTA 5E8PA 2NXZD 4GXUN 3W9DA 1H0DB 2LU7A 1TJGH 5BJTA 1UWEL 1JNHB 4QOKE 2EXWD 2FX7L 1CF8L 1J0YA 5B22A 4S1DD 1T80A 5DA0B 4N8VB 4L8BA 3VW3H 1SJEA 2VERN 5KS9A 1CBVL 3TO2A 1E6OL 1Z9MA 3RZCB 1QFHA 3GIVB 1MNUH 3OKOA 2VISA 2DM4A 4AM0B 2ITCB 2AW2A 5IESH 3BKJH 3VFVA 4DGYH 4ODTH 1CXIA 2W0KA 5A16B 4YHYB 4OFDA 1V7NL 1AP2A 2P49B 1RIHH 2DM2A 1QNZH 4EUPB 3X14A 4YO0B 3TO4C 4A2MA 5D71H 2V5MA 5D2LF 5HI3D 5DA4A 3PDOB 5B8CB 3GMLA 3CVHH 5K9OB 3W9EA 3C5ZC 2G5RA 4U6VL 1YEDB 4OCYH 3SDCC 1X44A 5HVHC 4NT6B 3CUPA 1MHEA 3VRIB 3WHE0 1FVCB 3MNWB 1URLA 3PGDA 3MLTB 3OF6A 2KZ1B 2HH0H 2LAAA 1AQKL 4TSAL 2BSRB 4UU9A 2OI9C 2RCSL 2UZIL 5ESAA 1OAYL 1ZT7B 2YD1A 4WO4B 5F88A 5E4IA 4YBLC 5F7NC 3HE6D 2X9XA 3GDBA 2Z8RA 3N50A 3J8F7 5E8DL 5IVXB 4RAUA 4YXLH 2MQCA 5FCUL 4BFIB 5FYJU 5GGRA 5DK2A 4M48L 4D9RE 3KPOB 4FMFA 5DHVB 3U30C 1ZGLA 3QIWA 3DVNA 1MIEH 3NA9H 3NH7H 4P3DB 1ZS8B 3RWJB 4C57C 1A6ZB 5KAQG 1UYWL 4G6MH 1TDQA 4CMMA 3LIZL 4GH7B 3HC3H 1FL6B 2VXVH 3ZDYF 4MAUL 5AZEH 3MLZH 1OP3H 5J1AB 2A38A 4OTXL 2X05A 1J1XL 3ZLQC 1T4KB 1T7YA 2EE2A 3SBWA 3QI9D 2G9HB 2DJUA 1BOYA 1YJDC 3NBNA 1WFOA 5FYKU 4XPGL 2BVPA 2GT9A 3G6JB 4P2QA 5IVXE 5F9OH 1RHHA 5IB5A 1G7HB 2W1NA 2Q86A 3D25A 5C08D 4MD4A 4EN3A 2R8SL 1I3VA 5ILTL 4K7PY 1IAIL 3OGOE 4LSPL 5E2UH 3CZFA 4HKBB 1U93A 3GJEB 1FZJB 3ARRA 5FV1L 3VFPA 1RPQA 3LEYL 5GGQH 2NY4D 3BRDA 2VDPL 4TUKH 3V5KB 4IOFD 1OTUD 4JM2B 3MGAA 4JRYD 3DIFB 4JY5H 4Z7VA 3B9KB 3N9GL 4M7JH 4LP5A 1RZKC 1CDUA 2XZAH 3BP4A 2OYPA 4XVSH 3ARQA 2VDRL 4OUUB 4YHIA 3BDYL 2CKNA 5KSAD 5JW4M 4IRJA 4HIJB 1CXHA 5I1AA 4ZOBA 3TT1L 2X70B 5D7JA 4J4PC 4AZ8A 2BHUA 3HG1D 3SDYL 4AMKH 2JF1A 3CD4A 4PS4H 4JDVB 1LMKA 3FKUS 4F80A 4PGDA 4F3FB 4JY6B 5TDNB 3K1DA 1QFUL 4GLRI 4ELMB 4ERSH 2HLAB 4NKMA 5I73C 2DWEA 3PHOA 2HYMA 4Q9CA 5C8JB 3DBXB 3GO1H 3CDGB 1INDH 5D2LB 4PIRF 2WW8A 5TF1H 4ZUVB 2R0WH 5I19L 3B5TA 3HHRB 3TH4T 1FL5B 3BDBA 1HOCB 1OAXL 4G43B 4LSUH 1GGIL 3CX5K 4YH6A 4N9GB 3WO3B 1CICB 3DHJA 4Y5YA 2Y5TA 2XQBH 2BVEA 4KROC 3UTTD 5I8CA 1MY5A 2OLDA 2YMXH 3I9GL 4HUNB 5GGVH 1LO2H 5D6DA 3MNVA 3GHEL 5J06A 4G8FA 5GRVK 2AJSL 1UM6L 3JV6B 3HRZB 1Z6JT 3QRFM 4U1GB 1AJ7L 1D5IH 5ANMA 1N59A 5LBSH 3V8OA 3G5XB 5DHYA 4D0CB 5DWUH 4KY1L 4ELME 1HE7A 5FHAL 3WIHH 1B0GB 2EC9U 4P9HC 5I1KH 4KUCF 4F7EA 5I16A 4YQXL 3P9MA 1T20B 3QUML 2VZSA 5SWQB 3MRQA 6FABH 4HUUA 5DD1L 4K7FA 1NMCC 2IAMD 3GKZA 3MV9A 4RFEB 3DSFH 1V3LA 5TQ0H 4Y5XA 4WU7B 1G9NL 3QIBB 5I1HL 1A9EA 2H41A 4OZFG 4WVRA 2MKLC 1GC1C 4GQ9L 3HC4L 5D96C 4OGXH 4AH2A 2O61B 2B7DT 3LKRA 1U95A 3HN3A 4BFGA 1A47A 4QRUA 3IXTB 3LS4L 4KZDH 4H26B 1G7IB 3WEXB 1W0VB 1P4IL 4ZUWA 4QNPF 1A7PH 2EC8A 2IWGA 1S7TB 3ALPA 2VZTA 3WFCH 5BZDA 1MPAH 3P0YH 4ZFGL 4ZOCA 1DDHA 2CD0A 1RZ8A 2G2RB 2GCYA 3JTSB 4MYWB 3FMGH 1I7ZA 1MCSA 4RDQG 4YHNA 5ESVB 5A1AA 5DS8A 1XGTA 3H3BC 3SCMC 5IEHB 1KPRA 3GSNA 3RA7L 4OV5A 1L4IA 4L9LA 1XH3A 4Q6IA 4X8XA 4X5XB 3ZYZA 4P4RA 4PJGF 3ZL4L 5BOZG 1GZQB 5FK9B 4PRAA 4WNQA 4L9DA 4LFHG 3HI5L 4MXWH 1G7PA 2Y5EA 1XR8A 1CTOA 1A3RL 1JYVA 4ZOEA 1U92B 1IEAA 1JGVL 2CGRL 2E7HA 3EOBB 5HHVH 1U6AL 2PYFA 2I26N 4QRPA 4MA7H 2OJZL 4WWKC 1S9VA 5CHNA 2FB4L 1U8IB 1HILB 3QQ9C 5E6IB 4OZGA 5JQHC 1NAKL 4L4VB 4HS8H 3IU3B 2Q6WB 5LJYH 1PZUB 4NCC2 5IR1A 2J2ZA 4HKJA 1BM3L 4LGRB 2V17L 4UT7L 2YK1H 2ED8A 3BOVA 4YGVB 4UNVA 5IIEA 2HRLA 4HZLA 2JCCA 2ZCLH 2P47B 5FM5O 3MRKA 2J88H 3RDTD 3OAYK 1BGXL 5KSUB 4J7RA 4XCFH 4PJ8C 2J6EA 3MUHL 2Y6SC 4XP1H 5E9DD 5D1XD 2X44D 1HZHL 1B90A 5F7KC 3UP1A 1IFHH 1RJCA 4GT7A 4KROB 4ORGA 5CWSA 2ADIA 2YSSA 3TESA 1F6FB 3TF7C 4HZAA 3SDDA 4Z7WA 4JRWA 2H1PL 3GZKA 5HDOA 4K3HA 3B6SA 5I1JL 4L4VE 4N8PA 4XNXL 1IGCH 5FYJH 2EXYC 4E5XA 1S7XB 4U1SA 2NZ9D 4HF5H 4ZMAT 4KTEH 2ZG3A 4YPGB 1S7WB 4P3CH 1CCZA 3WBDA 3WFDH 4H1LB 1ONQA 3FB8B 1KBGH 2ZSWB 5D5MA 5K59E 5FO8B 3GSWB 4FFWD 1U0QA 2XN9B 3MLXL 3O3EB 1KIUA 1T3FB 1JGEA 1BIIA 2H26A 1NMCB 2XTJC 1JPGB 3ARGA 5LCVL 3B8SA 4MGXA 4R4BA 2PUQT 3VD5A 4HUWB 2VIRA 1QZ1A 1FAKT 3CVIH 1N6QL 5E2TL 3JTTB 3WXVL 1BBJA 4P4KB 5FYKH 1RSFA 5D7LA 5ICZA 3EYOB 4YDIH 3IJHA 2FH6A 3I3BA 3A67L 2IJ0C 3ECBB 5I75C 3V7MA 5JDSA 1IGYB 5I1DA 5IBLD 4AG4H 3FCTB 4F33A 1MLCA 1K4DA 3P40A 1P2CB 1OAQH 1J0JA 1G9MC 2PXYA 3VE0B 5T5FL 5I1LB 3KJ6L 2XN9E 2CRZA 1CD0A 2IFFL 5INCA 1HH6B 5KVMC 3I75A 3RZCD 1YY9D 5DO2C 4ZYKB 6CGTA 1TVBA 4OM1L 1JHKL 3SCMB 1NSNL 5GSRB 1F58H 3OB0K 1BD2A 1INEL 5F3BA 5E7FA 4XGZB 1WWWX 1FG9C 2AJUH 1YY8B 4N0UE 2AJVL 1EVUA 2ESVB 4ZFFA 1RZGB 3FFCB 4NO2A 1JTOA 2NY6B 4U1KA 3EYSH 3TM6A 4F57H 3OG6B 1B6DA 2XZCL 3F7YB 4G9FB 1KTKE 1U3HD 1OTTC 3NFPB 1D9KA 1U8KA 4ODXB 4GW5B 1RFDL 3S36L 4GAGL 1TXKA 3TC9A 1FDLL 3GJFA 4XVUD 5ICXB 3VXOA 4ELKA 4LCYA 1WZMA 5BW7C 3BSZH 4JO2L 2CLVB 4TRPL 5FV2A 5EBGA 4NQCD 1AXSA 2W60A 2P46B 3K74B 3OJMB 1YEJL 4PGBA 2NY1B 2YPLA 1OQXA 3DROA 1CFVH 1XGPB 1OAZH 2CO7B 4OLXL 3PQYA 1RVFL 3HUJB 5AAWA 4Y4HA 2DQHH 4JQXA 5TE6L 4XBGA 2ESVE 1PZ5B 2X40A 3FFCE 3V0AC 2P8LB 2VLKE 1M71A 2VO5A 3DVGA 3EDDA 1U8LA 4U1MB 3LKNB 2HFFB 3C6LC 3WD5H 1IGJA 4ORZC 3WS3B 4HQQH 2BNRB 5IJVB 1WGOA 4ALAL 5JXEC 5ADPL 3ULSB 4NZTH 5F1NB 5DEZA 2ZOLA 1MVFA 4NRYA 5CIPH 1BLNA 3FHAA 2EXWC 1CGSH 4P59L 4KDTC 3RTQC 5I66A 1ZMYA 3QEQB 4HIEB 4FP8H 4RISL 1NMAL 3S4SB 1H9VA 4DOHB 5I1GL 1UWXH 1FRGL 3HUJE 1KELL 2BC4B 5CINL 1C1EH 3D9AL 4KHXH 3VXSA 4FQJL 5C9JA 3OQ3B 4Z7QE 3FT2A 1KYOJ 3P0VL 5EOQH 3OV6A 2XT1B 2GEEA 4XPTL 3B2VL 3KPPA 5IBUG 3IFNH 4MNQA 4HH9B 4FXKB 1FCCA 4LF3B 2DLFL 2BNRE 2VXTH 5TDPB 1MI5D 1DLFH 2FJFA 4LLVB 5D1ZD 4JM2D 3UJJH 2WWKO 3CAFA 1Q9KB 5IVOA 1N5YH 1OF2B 2X10A 5GZOD 3C8KA 5D8JH 5FUOL 1CL7H 3UJIL 1HSAA 4LLYA 4MQXC 3U4BH 5JHDB 3M17B 4B41A 3WSQL 1ORSB 3DGCR 4YHPA 3HPLB 4HMDA 5ETUB 5JIPA 1X5JA 2FH8A 3I6KA 2EYRA 4Z95H 4D3CH 3BW9B 1BWMA 1T89C 1CT8A 4OD1L 3LRSA 4HC1A 4EDXA 4Q2ZA 1HHKB 5EC1B 2KZWA 4YR6B 3RWGA 1NQBA 3QDAA 4NRZA 4MQSB 2F54B 5EOCH 4WI4A 2IH3B 1P7KB 2D4FA 5BV7H 3QDJD 3QJFA 4OCWH 2AXGA 1N7MH 5C0RH 4I2XB 2JJTC 5LAXB 4YIQB 1N3NA 4RBPK 3LN4A 1NGYA 3KPSA 3L3OB 3O4LE 5HDBF 3I50L 5I1EL 1WCQA 1VKXA 4L3EB 1HXYA 4OZ4B 2QQNL 2B39A 4AY0A 5IG7A 2I9LB 3V6OC 1KLUA 2KUTA 1QR1B 1HEZB 1KB9J 4PUBL 4YX2H 3GSVB 5SWSD 2FEDC 4P46D 1K2DB 5ID0B 2JELH 3AS1A 3M1BA 4R97C 3RL2B 1EGJL 4U6XB 2AK4A 1MRFL 3MOBL 1A1MA 3OKNA 3LS5H 5CJXA 1YPZF 5C6TH 2RFXA 1MCRA 4RRPG 4FG6C 1DBBH 2N56A 1KN4L 4I2XE 3VWKA 3QXAB 1KJ3H 2EIZB 1MHHA 3BEWB 5E1HB 4KKLD 2VDKL 4OCSL 3GM0A 4G6FD 1MFBH 4BK5A 5IWLA 4ZNCD 4IMKA 1L6XA 1TJGL 3QIBD 4QXTA 3C6LB 2X4OA 5B39A 3TVMA 4JFEA 4BK4A 1QVOA 2VABA 1ROWA 4IOFC 4JDZA 5F8RC 1OTUC 4UOW1 3VW3L 1KNOA 1U91A 1W72H 3OPZH 3K2UL 1QO3A 1FO0H 5CP3H 4ONHB 4AIOA 3MRIA 4PJIA 1NGWB 4JKPL 3AU1B 3SGDH 4XRCA 1DBKH 3UO1H 1QACA 4NM4H 2O93L 1WFTA 3HI1B 4YZFE 1CFSA 1IQDB 5AAMA 4EOWH 1BZQK 3VXRB 1RIHL 1WFUA 5FKAB 2WMPA 5ITFA 1JYWA 2W65B 1QNZL 5T1DL 1JI1A 4NCDA 5D71L 2AJ3A 1GVIA 3QNZA 1TZHB 4OCRH 2JB6B 3JWOH 3OGCA 2DS4A 4LCIH 3UDWC 5A2LH 3BUYB 3GSNL 2YN5A 2B20A 2ARWA 3L9RA 4OCYL 3VH8G 1QLEH 2R9HD 1QYGH 1VSCA 1AKJA 3OKKB 4IOIA 4EI5B 3QUYC 1C7TA 4LLAA 5D6CA 3IDJB 3QPXH 4UB0H 2HH0L 1RUQL 5DJAA 5DC0A 2CDFB 3BGMA 2EZ0C 3MR9B 4KRPD 4ZUUB 5I9QC 1LO4H 1JWUB 3CFKB 4E41A 3P4OA 3T3MF 3RNKA 5DJ0A 1CK0H 1CD1A 1MVUA 3T8XA 3KHQA 3HR6A 1EEZA 3U46A 1IL1A 1BVLA 1BJ8A 4PBXA 4WW1A 4RNRA 4MZ2A 2APTA 1I1CA 1UZ8B 2BMKB 4J12A 3AM8C 4YXLL 1AXTL 3K3QA 3QJHA 3QG6B 1MFNA 3OJDB 4PJBE 5D1QD 3MYJA 1VESA 3ZE2F 5C2BH 2E9WA 4I18C 1NKRA 1MIEL 3NA9L 3K80A 5MP6H 4NZRH 1LEKB 3MXWL 4Y5VA 1P1ZA 5EULV 4G6ML 3WNMA 2R56H 3EJYD 2VXVL 4IRZH 5EO1A 3LY6A 4JEGB 3CFDA 4IOSD 5F6HJ 1R5IB 5KVDH 1R3LA 1CIDA 4U0QB 1WZKA 5CSZA 4R2GB 4QT5A 4HIHA 4U1IB 1AD9B 3KPNB 3MRHA 1X7QA 4XH2B 3REVA 3BH9B 4ZTOH 5HI4D 2HG5B 4QRRE 1B0RA 3C5SB 3MO1B 4K23H 1T5WA 3VXUE 2FO4B 4LQFH 3WS6C 1FVDA 5F9OL 1CXLA 4H25B 1QKZL 1DQJA 2QKIB 5F9WC 5T3ZD 4M6OL 4GKNA 2E6QA 4C4KT 1N26A 2O5ZH 4LHUG 5E2UL 2IQAB 3BVNB 3MJ8B 2R69H 2W9DH 2XN9D 4YHKL 3CJJA 5DD6A 4Y16C 4AQOA 3BWAA 4MCZB 5F71A 5CJOH 4TUKL 5FDYA 4DVBA 1EO8H 3U6RB 2R2HA 3F7QA 1BZ9A 5SX4I 3SDXF 4GG8B 4JFDA 5A2JH 2B5IB 2XZAL 3LV3A 1E4KC 2FCBA 4YC2C 5IEKB 4R7DA 5KW9H 3MA7A 2YZ1A 4M8QB 2ZUQB 3S88H 4KJQD 4PRPB 3UCRA 1Q0XH 1WCBB 1F90L 1XF4B 3IDXH 3EFFB 1TMCB 2EH8H 2VDNL 5GS2D 4NNXB 3FRPG 4FQQA 3PWLA 1CLYL 4P2OA 3ARBD 4MAYA 4QYOA 5IROC 4KI1A 4AEEA 1TZGH 4IDJL 3EJZD 4ERSL 3P2TA 4XX1E 2FWOB 3EYVB 3GO1L 5EZOH 4ZS7L 5DRWA 2VR4A 5TF1L 2R0WL 5BMFH 5CUSH 3L7FB 3PV6A 5EORH 2J4WH 1RULH 4LHJB 4HK0B 4LSUL 2FL5B 7FABL 5SWZB 3HR5B 2P8MB 5H8DA 1L7IH 4S10A 2XQBL 5MHSE 1X4YA 1GL4B 3BXNA 3PWVB 3ARFA 5GGVL 1LO2L 1GOGA 3TPKA 1GGTA 1LDSA 2ESVD 4L4JA 2VB5A 1JNNH 3NCBB 3FFCD 4HMCA 3CFJA 1MFEL 4AIZB 2P7TB 1LD9B 5D1XC 2CJUH 2VLKD 3N85H 1NFDB 4UQ2B 4PP2A 1D5IL 2UWEB 4CVXB 5DWUL 1RK1A 3VXUA 3NAAH 4GUPB 1DL7H 3SDAA 1YEFH 5TH2B 3WIHL 1MCNA 4K8RC 1E6JH 5EN2B 5I1KL 1LGVA 3U0WH 4XNZC 2ATKA 2NX5B 2EDRA 6FABL 3MX0A 5C0AA 4OM0H 4UQ3A 4I18B 2Z92A 2AK1H 3KPMA 3VGAC 2WUCH 4XAKE 3DSFL 4H20H 5SWZE 1MRDH 2NY1D 4PR5A 4LNRB 3O3DB 4F15C 2JK5A 3L3IB 1T2QH 1X3DA 4GKSA 4Z7OE 3X3GH 1J18A 4NKDB 1K9TA 4F37F 1CE1H 3VFUB 5DFVC 4OCNC 2GJZB 3Q5YA 5HYQA 2FGWL 1NFDE 3OXRA 5K9KA 5ISZB 1FGNH 1DQDH 4Y2DA 4LRNL 2BNRD 2NY0B 4OZFA 1W8NA 1A7PL 3H7LA 4PRDA 3ZSSA 1PG7H 1FNLA 3WFCL 3MV8B 3QIWD 1C5BL 1LVEA 3O6MH 4BUGA 3Q48A 3FMGL 5ESQA 4Y1AB 5F44A 1QLRA 3WXWL 4JANB 4CAGA 3QEUA 1F4WH 5DRZB 5EIIA 5KVEH 2V7NB 1R5VA 5DI8A 1HHHB 2BVOB 1YY9C 2HVKA 2GY5A 4HUXA 4M61B 4XHQA 4NO0D 4AL8H 4PGJA 5ENWB 5B4MD 5ISZE 1LO5A 2VC2L 3V8CA 4BKLB 3H9SA 1WBXA 2CXGA 4XXCC 3BN9C 4Z5RB 3NZHL 4NZDA 4TPRH 1LP9B 1PJ9A 5HHNB 3O4LD 4XCEB 5F1KC 1JPSL 3MV8E 5C0EB 3R06B 1T6VN 1QRNA 5EA0H 3LCYA 4P3WA 4TQEH 2VAAB 3WFHB 4OB5H 2YK1L 5FYLH 2IQ9L 3O6FA 5GSVA 3E1F1 3QWOA 3VFTB 1FZOB 3QAZB 3LH2L 3O11A 4MDIA 1H15B 5BVPH 1DBAL 5JLZA 4HC1L 4Q74A 4XCFL 3VGGA 4WDIA 5IFJA 4HW6A 3QG7H 4XP1L 2QEJA 4IRJD 3AS3A 1SEBA 3BGAA 1IFHL 1QFOA 3O45B 1B6UA 2R2BA 3MRRB 1Z0MA 1NBZA 3EIFA 2VSDA 4MD5A 4S2SB 3QNYB 5EUKB 5J6HB 3F65A 4LLDB 4V1DA 1IGCL 5F7LB 4E9LA 1HHIB 5CEZE 1EFXB 5GXBB 3F7RA 4HF5L 2BNQB 4P2RA 4HS6A 4WCYH 4KTEL 4LPYA 4TVSa 1CXEA 3BPNB 4P3CL 3IDUA 1BFOB 1MHCA 4XNZB 1NAMB 1F6AA 5SX5H 3VG9C 3TV3H 2A9MH 4LSDA 4JHBA 3EHBD 4NUGH 1SYVB 5I71C 4QF1A 2DKSA 3VFNA 4QWWD 3R8BB 3VGAB 5EO9A 3Q1SH 1WAAE 1X5IA 4B5EA 4K94C 1F3JA 4F15B 3LEVH 2A6IB 1F8TH 3CVIL 1ZE3C 2YEZB 3QXUA 3O2DH 4JG1L 3HCVA 1NLDH 4B0MM 3MA9H 3OJVC 5FYKL 4L8SC 4Y8DC 3QEHA 1LE9B 2OR8A 4NNPH 1ZLUH 2J5LC 1I1AA 3STZB 4HPOL 2JIXA 2FSEB 4F7CB 3BIKA 4KVNH 4C58B 2NY3D 2R29H 4OGAC 1MJJB 4QHNB 5E5MA 4AG4L 2I9TA 3IDIB 3LDBC 5I76A 2NNAB 1WZ1H 5DTFB 1QBLH 3VFGH 1CLZH 2CXKA 3IJSB 5D1ZC 5DHVH 1HYRC 2E7LA 1VFBB 4ODVL 1HSBB 5IFHH 4XXDA 1AFVH 2VLJA 5DR5H 5GZNC 4PJAE 1A4JB 4JFQB 4BZYA 3HI6H 3QUZB 3NCEB 5FXCH 1XGRB 3UTPD 1GSMA 4HJ0D 4U7SA 1G7LA 3OTTA 5HHQB 4KUZH 2YD3A 4YHZL 2Y06H 2WV3A 5FOJA 3D3VE 1R3KA 3L5WA 4FXGB 1KB5H 4I48B 2EE3A 1GGBH 4L8DA 5C0IA 2DD8H 1VENA 3BUTA 1JRHI 3EYSL 3U9UA 4F57L 3C60C 3NZ8B 4YBQC 2DQJH 3QDMA 1J8KA 3LKPA 1AE6H 4EI5D 1KIRB 4I0PC 2MQ0A 3G5ZB 3GHBH 1CN4A 5IMMB 1KN2H 1CYGA 5E6YA 5E95B 3UZQA 5CZVL 2JJUA 2AGJL 4OZIB 1MFCL 5HGDA 5T1LA 3LHPH 3BSZL 2ZG1A 1P4LB 1WWBX 1S7SA 1S7QA 3DYMA 1PDKA 4QRRD 4K3GA 3S3JA 1IAKA 2J8UE 1CFVL 2Z0BA 1FZKB 3V6ZA 4P46C 2I25N 3MRGA 3VMOA 3MROA 4X4ZA 4P2YA 5GGSY 3GSUB 3ARED 3MRNA 1HQ4A 2Y1VA 2XKNB 2C3VB 5EU3B 5M95B 3VXTA 5FA3B 5J9PA 2EDQA 4PJDF 1ES0B 4DN4H 1FGVH 3L7EB 1P4BH 3TYGH 3C6SB 5HYJA 1RUAH 4U0RC 1BAFH 4OZIE 2NLJB 4DKEL 2VWEE 3QDHA 2IH1B 2YA0A 1IE5A 3UXFA 1PX4A 2DLEA 4NZJA 1IEBA 5C71A 3PL6D 1A7OH 3GIZH 4M62H 5I71B 3GGWB 3IVKB 1HIMH 3MRCA 1C1EL 3WDJA 4KHXL 4J2XA 2EIDA 3NFSH 4JFFA 2VKXA 5I17B 5DMJB 4U6HA 1U8OA 5F70A 3ZDZE 5EIQA 4PY7A 1TCRA 5EOQL 3TA3C 5D2NA 43C9B 3RWDA 4L8SB 2PTTB 1C16B 4QRTB 3RFZC 2J5LB 1NBVH 4Z7UF 5JPNB 2VXTL 1TETH 3FQTB 1DLFL 1JV5A 3GMQB 5CP7B 2ICWJ 3KDMB 3UTZB 4X6BB 1NEUA 1OB1B 4JLRA 5D8JL 1CL7L 1I7UB 3OKEA 4BZ1H 3WFZA 4LCCA 4K2UH 3QYCA 3UTSA 2R9HC 5T3XE 4PJXA 1CIUA 3KLDA 5GS0C 4DCQB 4LCWE 1TJHH 2YBRB 1QQDB 4Z95L 3S35X 4D3CL 1OQOA 4GBXB 1BBDH 5KOVC 5ITBH 1OVZA 2Q76B 3E2HC 2IANA 1MCPH 1CE6A 1T5XB 5ID1B 1JYNA 1U8PB 5H35A 3CDYA 1RJZB 1WV7T 2EDEA 1JWSB 1RZIA 5KVFH 2VUYA 4OCWL 5C0RL 3PWNB 1N7ML 4Z6AT 3L5HA 3PDDA 4IRSA 1KTLB 1YJDH 1TCMA 3C60B 3DETD 5D1QC 4NC1E 4XAKD 5SWZD 4K3DH 4F7MA 2ICEA 1A2YA 4P48A 1IC7H 5GRUH 4LLWB 3V6FB 4I0PB 2DI8A 3MJ7B 4YX2L 5HHXH 3ILPA 4U1HA 4OLYL 1VFUA 3EJYC 4NM8H 4K7PL 1JGDB 1BREA 2JELL 1WQVT 1NCWH 3KWWB 2C3XA 4HWBA 4MLIA 1DUYA 1P5VA 1SMOA 1I7RA 2IGFH 3H42H 5C6TL 5HI4C 3DX6B 2G60H 3CH8A 4OQ1A 5IQ7L 1RAMA 3WUWA 4YHLL 3L1OH 5DUPH 3P4MA 3D0LA 4IIQA 5I74C 1KEML 2FIRT 2JJSA 1MFBL 4PJDB 4RMVA 4DK6A 1ZSDB 1NC4A 3V5HA 2NTFB 3HC0B 4PJFF 2FD6H 2NY2B 3RAJL 2P5EA 4RGNB 3B3IB 5B3JE 2F5AL 3CSYB 3VDBA 3GM8A 4RRPA 1NPUA 2GQHA 3H9HA 5BCAA 1SJHB 2K7QA 3HFML 4RFOH 2VRAA 1FO0L 3RVTD 3DNKA 4PLJC 1MUJA 3EOAA 5ISZD 4JHZA 3DXAB 1IAOB 3QUMB 1DBKL 3UO1L 4Y4FB 5DYOB 2NY0D 4KJQC 1CDIA 3L3KA 5HPMA 3SKUD 4X6DB 3DMMB 3MV8D 3STBA 5SV4A 3TZVA 1B2WH 3ARBC 2E3VA 1FG2B 1LEGA 4WUUA 5E94B 4QLRA 4XTRC 3VXQA 3JWOL 1QFPA 1QSEA 3TA3B 3QZWB 3EJZC 4X0KB 2IPTL 1T03H 4OD2A 4RGNE 4QTIL 3W0WA 3TLRA 2Z8SA 4JO1L 2DQTH 1S9YB 1JL8A 3RL1B 3QXWA 4P9HH 4QY8B 5IM7A 4H1LH 3PIQA 2AV7B 4IBLT 4KI5E 5BVJB 5IF0A 4O2CB 4QXUH 4U1NA 1MELA 1WICA 2WIMA 5F3HB 4KDVA 2XQYG 5DHXB 3TH3T 1IC1A 4I5BB 5KS9F 1ZHBA 3QUXD 3VH8A 1ITBB 4X6DE 4YEFA 2GSIB 2W0FA 3E2HB 5CZXD 4F7TA 1EJOH 3NCJL 4R26H 1KCSH 5E4EB 4LEOB 4MNQD 3W5MA 1FYHB 1IAIM 1R5WA 3WIIL 4NZRL 4KK8C 3JV4B 4JPWL 3HNSH 2XA8H 1XF5B 5CSBA 1CFNA 5J6GA 5HGAB 1T66D 3FOMB 3C8HA 2C4FT 4IRZL 2FBJL 5KVDL 1JF1A 1F2QA 1IM3B 3PE9A 1EHAA 2Y36H 4ZTOL 4Y8AA 2V2XA 4YK4B 4K23L 3KPRB 1I9IH 4LQFL 4X6FA 2G75A 3K8KA 3U0TA 5IVZB 5HYEA 5B38B 3ARDB 1I8KA 2WQ8A 1FC2D 3FQNB 3F8UB 4ODBD 2GUOB 1AO7B 5F6IC 1W0WB 2R69L 5AWNH 2W9DL 1A3LH 2BDNH 3SGDI 1QBMH 2GKIA 5I74B 2ZNXA 5CBEB 3ARVA 4D0DB 1CDBA 5GJSH 3QIWC 2A73B 3U36B 4JAMB 4MMZC 1MCWM 4W6YB 1H3UA 1C08A 2OP4H 5ABDE 2X1OA 2DJ4A 3D3VD 5DQDH 3MODH 2CKBH 5A40E 1N8ZA 3IDXL 3NFNA 2EH8L 5DVMA 4F8TA 2PCPA 1FCGA 4U1JB 1H5BC 5A43C 3SBWC 2B2XL 1HH9A 1MCIA 5DD3H 3S5LA 4M1DH 1X5FA 4C83B 1U58B 1QFWI 4J1UA 1CZ8H 3STLA 2IADB 5EZIH 1TZGL 1KIPB 1SBSH 3KXFB 4NN5C 3SKNA 3T1FA 3M45A 1JPTH 5CD5C 2DIAA 1HWGB 3QULA 5FUCE 4RCAA 5FCSH 1A4KB 5CUSL 3MRBB 1TPXB 5L2KB 3QUZD 4YDJA 1AHWB 1YNLH 2NTSP 3D69A 3FRPA 2P4AB 5T33L 2DB8A 2MFNA 3VXPA 1L7IL 4XCNA 4NJ9H 5JXAH 2F58L 3OAUH 3D2UA 4ZFZA 4Z7VF 4FFVC 4XPFL 5E1AA 5E08H 1A1OB 4IRJC 1RJLB 2CPCA 2CJUL 4L8BB 3N85L 4NQXA 5I30H 3TO2B 1DVFA 3WFBH 5D7JC 3MGTB 2XOTA 2VISB 3KXFE 2QHLA 3GI8L 2YN3A 2CK0H 2Q8BL 1A6AB 1H3TA 1YEFL 3BWUC 3VFVB 1RI8A 1E6JL 3U0WL 1FN4B 1D5BB 5F1OB 5MEOA 4PJ5A 4CN4A 1UG9A 1MFAH 3RGVB 1BFSA 4KHTL 1MRDL 3GMLB 3X12B 2FDBP 5JOPE 3HE7A 5GGUA 4P5TD 2N4IA 1QR4A 5ADOH 2P48B 2VDMH 1VB9A 1G9MH 3X3GL 3NIDF 3S9DB 3CUPB 1MHEB 1I85A 1CE1L 2AJYL 4Y5YC 3PGDB 1JGLL 4HWEH 1SY6H 3MUGA 3NIGF 4UU9B 4M7ZB 5FB8A 5EZJA 2WBJA 1DQDL 4MSWA 4Z18A 1X9QA 5JW3L 1U8QB 3ARPA 3MNZA 1FFQA 1YMMD 5F88B 4DW2H 4FQXB 3DRTA 4UI2A 1DUZA 1YC8A 2J7LA 2BNUB 5I8EA 4HHAA 4JHAH 3O6ML 5EUOE 3V5DB 5GGRB 1T7VA 3BZ4A 5T3XD 5JOFA 4YDKH 5HYSA 4R90H 4LCWD 4DZ8A 4BUHA 1KEGL 1F4WL 4POZD 1ZGLB 4RGOH 5KVEL 1T22A 1ZWIB 3DVNB 3R8QA 3BN3B 4Y4KA 4MJ2A 5EBLA 1RZFL 4FQ1H 3FTGB 4CMMB 1YZZA 2XZQL 2CUMA 1RIVH 3QR2A 4UUJA 4E42A 3FO0H 1VGEH 3EAKA 4LKXB 1V7MH 3O6LH 1S3KH 2HN7A 2ERJC 4LCUA 1KPVA 3DPBA 3P77A 3WN5A 2HRPL 2BVPB 1BQLL 4P2QB 3T65A 1UB5A 3PHQA 4NN5B 2AXFA 7CGTA 4G42A 2Q86B 3D25B 4OB5L 4EN3B 4NUJA 5IB1A 3SKMB 4X9BA 2NYYC 1I9RH 4KMTH 1XMWA 4HMEA 3CZFB 4GBXD 1BHGA 1ZXQA 5HHPA 1V8HA 2H6PB 43CAB 1T1ZA 4BQCA 5BVPL 5BZWB 4GRLD 1MLBA 3VFPB 4DUXA 4IS6A 3MXVH 1WJ3A 1OL0A 4L9LC 1CU4H 4Q6IC 3K8LA 1I1YB 1A64A 3K46A 4ZAKA 3BKCH 2NW3A 2P1YA 4M6AA 1QSZA 5E99H 2H2SC 3UC0H 1ITCA 2ZUVA 1HWHB 4KTDH 3AREC 1U8HB 5KSBE 1RK0B 5FO7A 3VXMA 4XWGL 3VD4A 1YA5A 4G6AD 5IHUH 1FSKB 2PO6D 1OGAB 5E2WL 5CBAA 5DZLA 4OZGF 1TNNA 5TPWH 2A0LC 2DWEB 1NCUA 2XICA 3DX9B 4NKQB 2FX9H 3WE6A 1X4XA 4EZMA 1HCVA 3Q1SL 1EH9A 4OAWA 2J8OA 1IRAY 3LEVL 3PL6C 3QNXA 4M1CC 1F8TL 2YOCA 2FHBA 3X13A 3ZTJG 3V7AE 4OZHE 1CGWA 2GFBB 3MA9L 2VJXA 4Y5YB 2Y5TB 4NNPL 5I8CB 3HTLX 3DHMA 3D39A 5J56B 3MV7A 4XP4L 4WHTB 3VXUD 1RUPL 2R29L 3FAXA 3KNBA 3SDDC 2W38A 3G9AB 4W68A 2NY2D 3B4NA 3MZTA 1UKTA 5HGHB 1IJ9A 3O2WH 1OGAE 1I8IA 3VFWA 3KPLB 4Z7WF 3HAEG 1WZ1L 1LILA 2R4SH 1KCLA 4PRBA 3VFGL 4AK1A 1WF5A 1CLZL 4MA1C 4LAJH 1OM3L 2VE6A 2QQKL 2AQ1A 2ZKHH 4P5KA 5I16B 4F7EB 3PDGA 1YEGL 5DR5L 5IMOA 1J0IA 1JN6A 4LIQE 4KI5D 1JZ2A 4XMKH 1MIMH 4P23B 3QWRA 4XPBH 3HI6L 3MRQB 4XBEH 2EECA 5D5MF 4K7FB 2D0HA 4TUOB 3ARGC 5JA8B 4M6NL 3QH3A 2Y06L 4Y5XB 3MGOA 1BOGB 2X4NA 4RGMC 2PYEA 1KB5L 5F9JA 1B88A 2DD8L 3TBWA 4GS7C 1OP5K 3LKRB 1ZHLA 4XNQA 1U95B 5JNYA 1ZGLM 2DQJL 1LDPL 1AE6L 1NGZA 5E70A 4QKXB 3DUUB 5DEGA 1KN2L 1MJUL 4MNHA 3L5IA 5KSVA 2PXYC 5IFAH 2O5YH 4NQVB 2DI7A 1A9BA 1F4YH 3OB8A 3LHPL 3O9WD 4JO3H 3BESR 4MLSA 5CEYA 1DDHB 1RZ8B 1I7ZB 3F5WA 2XWBA 4YHNB 5DS8B 2EEAA 4WEUD 1PW3A 3ZKSD 1FIGL 3VFRA 1XIWA 3GSNB 5JORA 1I4FA 2X41A 4S1RH 4Q6IB 1EFQA 3N1PC 4P4RB 4X9GA 2R0ZH 1IM9A 3ZE1F 4PRAB 2H32H 1G7PB 5FA4A 1EBPA 1XR8B 3LN5B 4RWYL 4DN4L 1AGDB 2PYFB 1RUAL 5AG9A 3QFJA 4GRWF 4I4WB 2VXUH 4FFYL 3EYFA 5CKGA 4ZO6A 1L6ZA 1II4E 1D9KC 4U6YA 1S9VB 2HT4C 4OD3L 4KFZC 3SJVB 5A2KH 2FX8H 4HUVA 4YHMH 4HXBH 4HBCH 4R4NC 1NJ9A 4NKIH 4HKJB 4LBEA 4RA0C 1A7OL 3GIZL 2N7BA 1UVQA 1IGIH 5D70H 3K4AA 4M62L 2BJMH 4OQTA 1QSFB 3TWCH 1HIML 3RVTC 2JCCB 4XWOD 3NFSL 2X09A 1JWMB 1F6LL 5MENE 1N2RA 3LKSA 2QR0A 4ZPVA 2VZ3A 5KN5A 5C3LD 1J86A 4K3JH 3KYKH 4ZXBD 5CWSB 4N0YH 4X9IA 1X6LA 4XCCH 2Q87A 4XB7A 4MVBC 3SJVE 3O6KL 4N5ED 1NCBH 3CC5A 3B6SB 2A6JA 2PW2B 4NO3A 1KJ2A 2AJXH 3DTXA 2D7PA 4MX7B 3Q5TA 4BZ1L 1MWAA 1S78C 3HZMA 5A3ID 4E5XB 4U1SB 4K2UL 5DJYB 2K9UA 3BEVA 3A0OA 3PWUA 4LP4A 5GGSA 3NACH 4ZNEA 4G7VH 1ADQA 1QSFE 1CR9H 2R23B 3O8XD 1BBDL 1ONQB 1CLOH 1VGKA 4K3EL 5ITBL 5D5MB 2IBZY 1MCPL 4PRHA 4RIRB 2KH2B 5JXEA 1A1NB 4CADA 1BIIB 3KXFD 4LPXA 4QRQA 2D3VA 1AGEA 4KH2A 4GG6A 4R4BB 2B1HH 3KPTA 1TQBC 2UYLB 4FTVE 3QO0A 4R8WH 1TENA 2VIRB 5ACZB 3LB6C 4KDTA 4XPHL 4BH8A 3PG2A 3RIFK 4Q9QH 1YJDL 1BBJB 1QA9B 1VFAA 4BSWB 5ICZB 5DMKA 2BSTA 3RI5K 5HY9A 1IC7L 5GRUL 5JDSB 5JOPD 4XT1C 1M7IB 2CDEA 3BRFA 4YDLB 1MLCB 1K4DB 4MJIA 4X4MA 5HHXL 4YPJA 1RZ7L 4NM8L 2EO9A 2MHAB 2ZCHH 3IXAA 4P2CG 1NCWL 4PJCB 4IM8A 4NWUH 3OR6A 2LE9A 5INCB 1UH2A 4HG4J 1C8PA 3I75B 2IGFL 2XI9A 1JHTB 3H42L 4X9HA 4UOJA 1J8HE 2G60L 4IEFB 1RZKL 3QRGH 1WIUA 2WNGA 4DTGH 3L1OL 5LGJA 4YEEA 5DUPL 1NFIB 5MI0C 1BD2B 1OT1A 4S1SH 1XGUB 3S35L 3U7WH 1EAPA 1T89A 5JUEL 3TNMA 4FZ8H 4ZFFB 2D03H 2FD6L 5IW6B 1BQHA 1BFVL 1MCOL 4POUB 2GK2A 5TGBA 1WVZA 4BQ9A 5T1LD 3HE6A 2GITB 5BS0E 4OFIA 1D3CA 1A6WH 4NN6C 4Z7NE 1FYTD 4PJCE 4DAGH 2IEPA 3GJFB 4PJAF 2ZOKB 4Z76B 3LZFL 1ZHNB 2Z4QB 2VLRE 4M8VA 3T77B 3QQNA 2W60B 5GPRA 1LK3H 5CJXC 5J1SC 1RQ5A 3SGEI 5IMLB 1I3UA 1B2WL 1FNEA 2BCKB 3PQYB 2C5DC 2VLLA 4MJ5B 3VWKC 3GMMB 4N9OB 4Y4HB 1KCRH 1WWCA 1T21A 4NKOA 1D5MA 3S97C 1J87A 3ULVC 1T03L 4OI8A 2HJLA 3QCUH 1KIQB 3DVGB 5CILL 5IWLC 5LXGH 4IMKC 2DQTL 3ULVF 3QI9A 4FABH 4HIXL 4PJHB 2RIKA 4K8RH 2HT3C 3TVMC 2BRQA 1NAMH 1UM4L 2UVEA 5ALCL 3B2UD 5C08A 5J57B 2DQUH 4QXUL 4B53A 4OLZH 2VMFA 1BLNB 5F96H 2BK8A 4PD4J 4YHOH 4BSVA 1T7ZA 2J8UF 1B9ZA 5GJTH 1CDYA 4RAHA 2Z35B 4G8GE 3MOAH 4PJIF 5CGYD 1TNMA 2DLIA 1EJOL 4EI6A 1GC1L 2NZIA 4N0FA 3O3UN 1BQUA 1FHGA 3VI4E 4JRYA 2ENYA 2KBGA 3VWJB 1TQBB 3VXSB 5C9JB 2H32A 3FT2B 2XXMB 3DURB 1J0ZA 5FM4A 3RUGB 5KSAA 2XA8L 2DYPA 2YD8A 4PJHE 1ZVSB 5GRZA 3FQWA 4JRXA 3CFBB 4YXKH 3BPCB 1MREH 4H5SA 2EDWA 2Y36L 1HSAB 4BJLA 2X5PA 1X6NA 1EEQA 3GMRB 2V2WA 3UDWA 2DIBA 3AAZA 2V6HA 4YHPB 1MCCA 4Z78A 4PBWD 3I6KB 2EYRB 1UCBH 2A77H 1CT8B 3L3GA 3QXVA 4EDXB 4Q2ZB 1OGAD 2C4FU 2FX7H 2EH7L 1JPST 4APQD 1A3LL 4J3SA 2DN7A 2C26A 2HTKD 3JV0A 1I3RA 3RUGE 1CBVH 1J0HA 3UTTA 4WRLA 3ELAT 2DIJA 4G8EB 2D9QB 5EO0A 5TFSH 3P73A 1N3NB 3LN4B 4Y5VC 1NGYB 2IC2A 5CGMA 1QTYT 4HWZA 3KPSB 2MSPA 2BY3A 5IHLB 3AM8A 5GISL 4ZPTA 5CEXA 2OP4L 3T2OA 3ZKNC 1HXYB 4POZC 3OG4B 4X6EA 1T7XA 3W11C 4AEFA 5IG7B 4WW2A 2CKBL 1KLUB 4NN6B 1Z5LB 5DRXA 4O02L 4JKLA 3OX8A 3RVVD 4MS8D 5DJ6B 2X4SA 5I2IA 1FL3A 3JWDC 2E9IA 4M93B 4HJGB 3RY6A 4U6VH 2AK4B 2IAMA 5BO1H 1A1MB 1JPTL 5DD5H 4ZOAA 3MSPA 4ZDHA 2KKQA 4TSAH 1AQKH 1T0PB 3G5VB 2OM5A 4GMTL 3VWKB 1HCFX 2CLRB 2RCSH 3BMVA 4P23D 8FABA 3WS6A 4JJ5A 1OAYH 2IMMA 4LLUA 5FYJE 2ZSVA 4K71C 5M94B 3IDGB 4JB9H 3MTRA 3S4SG 4QXTB 4NJ9L 5JXAL 3FB5A 2X4OB 1F3RB 3CDCA 4KK5C 5B39B 3BE1L 4JFEB 3L3HA 4M48H 5C6WH 1KACB 2C1PA 4QCIB 4NHUA 3DGGA 3SDXA 3H2WA 1U91B 5F1IA 2ORBL 3UAJD 5I30L 2VR5A 3MLSH 3VI3E 1X5XA 2X4UB 2XNAA 3GEWB 1Q9LA 3MRIB 1KGCD 2IPUK 2MCPH 1FV1B 1FPTH 1QUNA 5I1CH 4XRCB 3TZVD 2YXFA 3QT2A 2P5WA 4N8CH 3QXDA 1CFSB 2A2QT 3GRWA 1BF2A 1TJIL 4RMUA 5KZCD 1QSED 3ILQD 4JKMA 5FYKE 3MJGX 5IVNA 4JZOA 5ITFB 4G6AC 1J1XH 2CIIA 2MQ3A 1MFAL 2PO6C 2ZJSL 3MACH 5DMIH 1GGCL 2AJ3B 4NBYB 2H2PD 2RJMA 3QNZB 3UTOA 4K9EC 1Q9OA 5ECJE 3EJJX 3L9RB 1G9ML 1KJMA 4YNYA 4PRIB 1AKJB 4LSPH 4O00A 4OSUL 3RPKA 3ARFC 5MEND 5DJAB 3N1QC 3L5JA 4NQSA 4OF3A 3BGMB 1N64H 2AEPL 4J3OC 4TTGA 3P4OB 3RNKB 5DJ0B 2VDPH 1CD1B 3RQ3A 3VGDA 4YFEA 5BXFA 1A6VH 1R3HA 1C5DA 1MVUB 1V5JA 3P11L 2AEIT 3U46B 4DVRH 1IL1B 3SJVD 1BVLB 2EYTA 3N9GH 1UADC 4WW1B 4BA8A 4I13B 4RNRB 5I18L 3SDAC 3K0WA 4X5WB 4CVZA 3RDTA 3V6BR 4JHAL 1XZ0A 2EDBA 4Y19B 3T3PF 3WNPA 4GAJL 1S7VA 3L3JA 1CFTA 4YDKL 3KPQA 4R90L 3LSOA 3MYJB 1HDMA 2L0DA 4QHMA 1QSFD 4RGOL 4OQTL 2RQ8A 2APBA 3SDYH 5J11B 2ADJA 3KLAA 4PRIE 3WLWC 4FQ1L 3T2PA 3GBLA 1NDMA 1D7FA 4L4TB 1KXQE 4KI5F 5H2BA 5JHLH 5C0CE 2ARJB 1R3LB 2ATPA 3FO0L 1BQSA 4QOKA 5DJ8A 4FTVD 5CIPB 1G0XA 1V7ML 3O6LL 4QT5B 5CSZB 5KTEH 3MRHB 1X7QB 2DQEH 1NUGA 5CLTA 4PG9A 1WISA 1ODAA 1T5WB 2H8PA 3QHZH 4L29A 5DJCA 1OAXH 1FVDB 5C0ND 5EU4A 1UXWA 1G7MA 4Y19E 4UDUA 5EU7E 1A7RH 2CUIA 3MJ9A 5DDHA 3I6GA 2GJ6B 4KXZH 3WHXA 1I9RL 1ZLWK 4KMTL 4HIIB 1IC4L 3ULUD 1FLTX 3VU2A 2CUHA 4WEBH 3K4DA 3CH1B 4HX1A 5E8NA 1RIUH 3MXVL 1UM6H 4C56E 3O9WC 4L4TE 1BZ9B 1PG7W 1J8HD 3AC0A 4EKXA 4UBDD 1H0DA 2IBZX 4JFDB 1T1YA 1P84K 5FFLA 1PKQB 2NY5L 3BKCL 4R7DB 4M1GH 3MA7B 3VD3A 3QUMH 2X4QB 5DD1H 2VAJA 4P9MH 3NGBB 3NPSB 2NW2A 3RZCA 3GIVA 1G9NH 4AM0A 5I1HH 2ITCA 3PWLB 4M9OA 4P2OB 2R1WB 4MAYB 2GJ6E 2FATL 2R2EB 3KG5A 1R6VA 3U4EB 3B9DA 5A16A 5TPWL 3HC4H 4HXAH 5BS0D 3O6FC 2LVCA 4EUPA 3T2NL 5AZ2H 4YO0A 3TN0D 2FX9L 2E6JA 4X7EC 5JQ6H 1DCLA 2J8HA 3RWIA 1WTGT 2VLRD 5B8CA 5HVWA 2YD5A 5FM8A 3INUH 4DQOL 3PV6B 3TP4A 1PKQE 4TOYH 1U3HA 1R24B 4LPVA 4O2FA 4U33A 4OLVH 3LD8B 2JJVA 3VRIA 3RWEB 3OHXB 4LSRH 1RJYA 3MLTA 3FB6A 3BXNB 5C09E 2FHCA 3ARFB 5GS0H 1QP1A 3CLEL 1J05B 3IS0X 3CFJB 3O3BA 3RA7H 4FQCH 2Z31B 12E8L 5JMOC 3O2WL 3CX5J 2R4SL 3FT4B 4RFNC 2AXHA 2WUBH 1JJUA 4CU6A 1NBYA 1NCNA 5D7IE 2YUZA 2PETA 2ZKHL 5IVXA 4NQDB 3HI5H 3MYZA 5JR1L 3MBED 1J1OL 1MIML 5A3IC 1JGVH 4XPBL 1U6AH 4XBEL 1V3KA 4AEHL 2IPUG 1OHQA 2OJZH 3DVFA 2NXYB 1ZS8A 1OARH 4G8GD 3UBXG 2WANA 3HAEA 3O8XC 3GMPA 1ZK9A 1NANH 5I8KH 4OLWH 3ZYOA 1FL6A 4GKSB 3CSGA 4LPWA 1CWVA 2V17H 1MCBA 4DZBB 1JMXA 1Q94B 5T1KD 3ES6B 5J1AA 1UH3A 4YUEH 1FO0B 5HYQB 1I1AC 4XX1G 3GNMH 3OXRB 5K9KB 4X7FC 2COQA 4UDTB 2APXA 3DI3B 1BGXH 4Y2DB 5L8JB 1A8JH 2YUWA 3ZDXE 4NQDE 4KU1A 5IFAL 5E2VH 2O5YL 1G7HA 4PRDB 1IT9H 2E7LC 4HT1H 5T3ZH 4ZSOE 4HKBA 3P9WB 4CGTA 5I1JH 5GRYA 4XNXH 5T5NG 1YQ2A 3QEUB 3V5KA 2APVA 3HS0B 4S1RL 5EIIB 5KANG 1MI5A 3VXNA 5D1ZA 4JM2A 2HVKB 3QA3A 3DIFA 4LASH 3B9KA 2R0ZL 4HUXB 5HVFB 1SJXA 3CSPA 3MLXH 4PJ9D 1WBXB 1Z3GH 3D6GA 4JQVA 2IG2H 5LCVH 2X70A 1XCQB 2VXUL 4QGYA 4PP1D 3E6FA 3EDKA 1LK2A 2RGSA 5CJQL 2FX8L 4YHML 4HXBL 4HKZB 4D9LH 3MJ6A 1QRNB 1N6QH 2V7HB 4ELMA 4HEME 1UJ3B 2HLAA 1IGIL 3DBXA 5D70L 5GSVB 1BZ7B 2ADFH 2BJML 3A67H 3CDGA 3WLBA 3DJ9A 4XBPA 3E6HA 5BRZE 3O11B 3GFUA 4WDIB 5IFJB 5F89B 4G43A 2MMXA 2I07A 3KJ6H 3T0AA 3UYPA 4S11A 4K3JL 2IFFH 3DUSB 3KYKL 1T1XB 4M3KB 2R2BB 4N0YL 1VCAA 4MD0A 4XCCL 2FEEL 4OM1H 5SWSA 1NSNH 2R1XA 3IAGC 5FYJD 4PJ7B 4V1DB 3LQAC 3G6DH 2A6KA 3JV6A 3RZWA 3HRZA 5ELIA 1QRNE 2FRGP 1INEH 3FQXA 4D0CA 3PGCB 4P2RB 5JIKA 3X3FH 3C2SA 5F7FA 1E4XI 1CR9L 1MHCB 2O26U 2YRZA 3QQ4A 1CLOL 1F6AB 1HI6A 3KVQA 3K7UA 3LQMA 4UIMA 5SWQA 4EIGB 3B2UC 2XZCH 3MBXH 2EDXA 1NGXA 4UINH 3FB7A 1RFDH 4WU7A 4MJ4A 3QIBA 3S36H 4GAGH 4U7MA 4TULL 5CGYC 3UMTA 2Q20A 1FDLH 4R8WL 5HDLA 3MCG1 8CGTA 4PRNB 1ZLVH 5GGTA 1YEEH 3NIFF 1FNHA 3HPJA 5FYKD 4YXHL 2O61A 4JHWL 4PJ7E 4J6RL 1I1AB 4PJEB 2D7QA 3G6AB 2JIXB 1G6RA 3BIKB 2IFGA 3ZO0A 3IXTA 4H26A 1G7IA 3WEXA 4OLXH 4JG0L 1IAMA 1RVFH 1W0VA 5EBWA 2I9TB 2EKJA 3BH8B 3ROOB 5TE6H 3QWRD 4PTUA 1FVEB 1A7NH 2ZCHL 3U7AA 1XFPA 3JTSA 5ESVA 4PJXF 2VLJB 3Q5OA 4Y0GA 2XACC 1RHFA 5I8OH 4M00A 3QRGL 4ZS6D 4DTGL 3AB0B 1AY1H 4OZHF 5ADPH 3IS1X 4D0BB 1U2CA 2BY2A 3GRWL 3SE3A 3MRFB 3FN0H 1OCWH 4S1SL 1GZQA 5FK9A 3TJHC 1KLFA 3U7WL 5EOTA 5ICYA 4PJEE 4P59H 4IRSC 3L5XH 4FZ8L 2D03L 4L8DB 1KOAA 1U92A 3GMOA 2XKUA 4JPVH 2AEWA 3U9UB 4DWHA 5I1GH 3RHWF 1KELH 3MFFB 4G9DB 1G7JA 4PRID 1U8JB 4DN3H 5CINH 3QDMB 3LKPB 3BQUB 1U8IA 1HILA 2JB5H 1U41A 3RIAK 2BOBB 3IU3A 2Q6WA 4OJFL 5C0CD 2AKRA 3BO8A 1Y6NR 4BELD 1KT2A 4LVHB 5D1QA 3HMXA 4YGVA 4M02A 2DLFH 1S7SB 1S7QB 3SE8L 1OWWA 1EEYA 5C3TA 5GRXG 4R0LA 2YD7A 1IAKB 5KSUA 1V3MA 3V6ZB 4RZCA 4Y19D 2GI7A 1I1FA 1S5HB 5F97E 3HB3D 3MROB 5DQ9A 2DLGA 4IIQC 3GSOB 3MQIA 1MCKA 5J9PB 1ND0B 3TBTB 4FABL 3BPOB 2UY6A 4C56D 1EUUA 2R4RH 4K8RL 2CLZA 3WKMH 2NPLX 1S7XA 2DQUL 4O58L 2P44B 4OLZL 4YPGA 3RNQA 4YHOL 3PF2A 3TPUA 4MXQD 5GS1B 3HZYB 3FB8A 4UV4L 1IEBB 2ZSWA 1NC2B 5C07E 3GSWA 2XN9A 3MOAL 1S8DA 3EYQD 3QDGE 5I1EH 1GXEA 1R3JA 1AC0A 3GB7A 3ROLA 1JPGA 3T0EE 5CAYB 2GJ6D 1HNFA 2B4CL 3TZVC 4PUBH 5D9SA 2F53D 1U8OB 3IRZA 1S5IL 3K4ZA 1TCRB 1Y6KR 5AEAA 5D2NB 4P4KA 2DTSA 3TYFA 1A02N 4MXVE 3EYOA 1MRFH 4TNVK 4N0UA 4TSBH 3MOBH 3ECBA 2BFVH 1JV5B 4YXKL 2X1XR 1MREL 1IGYA 1JYXA 4O51A 4KV5F 2H2PC 1KN4H 3ARBA 1MRCL 4JLRB 2X7LA 4LCCB 5C0GB 3VE0A 5FF6A 1DEEA 2VDKH 1UZ6E 4Q7DA 3B5GA 5C09D 3CFIC 4PJXB 4QXGH 4PV9B 4U1LA 2VZOA 2PW1A 5JZ7D 2AABH 1UCBL 2A77L 5IBUB 4N5UA 3MLUH 2IANB 1CE6B 2VL5A 2V9TA 5H35B 5FGCE 4JPIA 4NC0B 4WI2A 3K2UH 5DK0A 1JK8A 3TCLA 4XGZA 4JKPH 1FQ9C 2OCFD 5TFSL 2V5SA 2ESVA 1RZGA 3FFCA 3DX8B 2XWTB 5I6XC 4MJID 2VLKA 3K2MC 4DKAA 5FECA 3F7YA 3VA6A 5DZOA 2ICEB 3NFPA 1A2YB 3OAZH 5FYLE 4HCRA 5T1DH 3Q3GB 2C1OB 3QUKB 3IGAA 5IP4A 2BHZA 2SEBA 3ILPB 3SOBH 2X1WL 2O5XH 3ZKMD 5ICXA 5JO5B 1JFQL 4KDWA 3GSNH 3PABB 4CRPA 2HLFC 3VA2C 2YD4A 1DUYB 1E28B 1LHZA 5BO1L 1UT9A 2DLTA 4XZUB 1MQKH 5DD5L 4X4YB 1NL0L 4FN0A 2VLME 4M4PA 3DECA 1RUQH 2HFTA 1P6FA 3QQ3A 4X7TB 3P4MB 5DT1H 3S98A 3MRJB 2WWMD 2CO6B 1BFTA 2F9BT 4QO1A 2R0KH 3O3AA 2BXYA 4TUJB 4J8RB 3WFEH 5DSCB 1GIGL 3GSQA 2NXYD 3ULUC 4JB9L 4NNYA 3LKNA 1NC4B 3CFEB 2P5EB 3ULUF 1KENH 1IKNA 1AXTH 2BNRA 4G6JH 4MHHG 1OLLA 3ULSA 4MB4A 3H9HB 1W2KT 5F1NA 1JZ4A 4OF6A 4RA3A 1WIOA 2X4PB 5F9AC 3MLSL 1LWRA 1BVKB 4YAQB 1EBAA 1MUJB 3MXWH 2MCPL 4IHOA 3RPIA 1FPTL 5I1CL 3KYNB 1BVZA 4K94L 3QHTC 4HIEA 2QSVA 5TE7H 5TF0A 4N8CL 2J6EH 3S4SA 1JZ5A 1CGVA 3MREA 1IMHC 5HPMB 3WNLA 3HMWH 4NO0A 4F8QA 1WTLA 5K9JH 1H5BA 4WUUB 1KB5B 2WINA 3MACL 5DMIL 2ZUXA 3NOIA 5C0JA 3VXQB 4HLZG 2QADD 2P5EE 4OD2B 4LF3A 5BRZD 3W0WB 3LKOA 1QKZH 4LLVA 4M7LT 4Z7NF 4F7PB 4M6OH 3O4LA 1OF2A 5CSGA 5IM7B 2VXSL 3PIQB 2KQMA 3PP3K 1SBBA 5HYFA 1N64L 4YHKH 2E7MA 1QSVA 5IF0B 1ORSA 1A6VL 32C2A 5J4MA 1C12A 5ETUA 3RY4A 1DVFC 4Z8FL 4EDWH 4OLUL 3V0WL 4DVRL 1FZMB 3BW9A 5FHBL 1BECA 1ZHBB 3VH8B 1D6EA 2W0FB 4YR6A 2D7OA 4JZNA 4OFPA 4YJZL 4WUUE 2DYPD 1EJ6A 1CXFA 1F90H 4RX4D 3G6JE 2LTQC 4JRXD 2VDNH 1OAKL 4I2XA 5E24E 5LAXA 4YIQA 2X9WA 1CLYH 2B1AL 3BIBX 3L3OA 3HE7C 3M07A 1CFNB 5J6GB 3O41A 4KJWD 4IDJH 5JHLL 4OV6F 3DSNA 2QJDA 2FR4A 3L3DA 1JF1B 1F02I 1I85C 2I9LA 4ZS7H 5KTEL 3TO4B 4KKCC 1HEZA 4G6KL 2E5EA 2DQEL 4LOUD 2V2XB 5IB3A 2WBJC 2VTFA 3C5ZB 1K2DA 3QHZL 1RD6A 3GK8L 3L6FB 4X6FB 2G75B 3RL2A 4U6XA 3SDCB 7FABH 3U0TB 5HVHB 1A7RL 1I8KB 2DBLL 1KXTB 1CTNA 1Z9SA 2OR9L 3RVXC 2HFGL 2JTDA 2QTEA 1E0OB 3FZUD 3I2CH 1WBZB 2OMNA 3BGFC 4WEBL 4ETQB 4NQEB 3QXAA 2X89D 2OI9B 1MFEH 4XHJC 4GRWH 4MHHI 5GIRA 2C3HA 1RIUL 1IARB 4YBLB 2NR6D 4Y4KC 4MDJA 3EO0B 1KCUH 2I24N 2DKMA 2DWDA 2LVEA 5D2LE 3MCKA 4M1GL 3GJFH 1C08B 5GGTL 2GTZA 1HQRB 4LHUB 1DFBH 1Q72L 3U30B 4P9ML 4TSCH 3JUYA 1N8ZB 2MWCA 3I85A 3NFNB 1XF1A 2Z9TA 1NGWA 1G6RL 1QLFA 5J12C 4XVTL 1IAII 4R7NB 3WN5C 4PJ9C 5F7EH 4Q97A 1IQDA 5IHZA 1J88A 4R9HA 4HXAL 4NQEE 3T1FB 1S9WA 3V4VH 5FKAA 2BY1A 2FGWH 4G5ZH 3QULB 5AZ2L 4HBQA 2YUXA 5JQ6L 4J3TA 1P5UA 5CGTA 4PJBA 1T0MA 5EU5B 1TZHA 1F5WA 3KYMA 2JB6A 4LRNH 3INUL 3VG0H 4NBXB 4TOYL 1AIFA 2EEBA 1NDGB 2V9RA 4OLVL 4NWTL 1EERB 1M7DA 3RVWC 3VXPB 4EI5A 1C5BH 4LSRL 4XCNB 3V4UH 4WFFE 5GS0L 3DWTA 5IV2B 4ZAKC 3D2UB 2CDFA 4L8CA 4ZUUA 5E1AB 2P5WD 1AGBB 1EZVY 3WXWH 3UPRB 4FQCL 1F4AA 4NQXB 1DVFB 1HYSC 2WUBL 4QRRA 3BQUD 3RY5A 1CVSC 4LRIA 1PD6A 3FQUB 4ZUSB 1UZ8A 2VZ1A 3F62A 3S7GA 5MEOB 1AH1A 2VC2H 3OJDA 4NRXB 5FDWA 3AREA 3NZHH 2D0FA 4DUVA 3HMXL 1KPUA 1K85A 4BSJA 1OARL 4UILH 5DQJA 5IKCB 5C07D 5HGBA 4DEPC 3QDGD 1JPSH 5I8KL 4OLWL 5ALBH 3T0ED 5JA9A 2WSKA 1R5IA 5I73B 2IQ9H 1AGFB 2OR7A 4YUEL 3M8OH 2VITA 1OSZB 1PY4A 3KPNA 3GNML 3LH2H 3MUGB 5KG9B 1K6QH 3BH9A 2HG5A 5DJXA 1DBAH 3C5SA 3G04A 4HC1H 3PWPD 4OKDA 5EZJB 2YWZA 3PL6A 4MSWB 2FO4A 3MNZB 5L88L 3UBXA 3W81A 4PTTB 3ZSTA 5E2VL 1YNKH 1DUZB 4H25A 1IT9L 5F7HA 4HT1L 5T3ZL 1B4JL 1QOKA 5I8EB 4HHAB 3H9YA 5JMRA 3KYOB 3RHWK 3BVNA 4JCLA 3BZ4B 5JOFB 5FO9A 1D5XB 1T22B 1VEMA 3MRPA 4CDHA 4Y4KB 4CN1A 4QOKD 3LRHA 4WI6A 3DYOA 4LASL 3ZZ1A 3EW3B 5IEKA 3A6OA 4ZS6C 1CI5A 2VDQH 3OKMA 1OD9A 3JZ7A 4E42B 1HINL 3BZEB 3HNTH 2DBJA 3QIUD 1Z3GL 1YUHB 2IG2L 3EFFA 4JR9H 3IDMA 4LNVA 4PGEA 4WV1A 5J12B 4D9LL 3T65B 4JG1H 3PHQB 5D96B 5FYLD 4G42B 4NUJB 3EYVA 1ZAGA 3ULVH 4NSKB 2ADFL 4BFBD 4HPOH 2DQFA 1S7RB 2LAGB 4ZQKB 4K07A 1MLBB 4IS6B 3L95B 3BI9X 1XIWC 5DGRA 1PEZA 4LAQL 1WC7A 2WIIA 4V2CB 2E8ZA 1C5CL 5SWZA 3HR5A 2VLMD 2P8MA 4R96B 2UUDH 4ODVH 3MRDA 2HKFL 4J3VA 4HSQA 4YFLI 1UA6H 4JO4H 2NW3B 4ZAKB 5HBBA 1RURH 3T4AB 3HB3C 1I8LA 4JN2A 4AIZA 2P7TA 1MJ8L 5LWYL 4NDMB 4PJGB 1RZJL 4I3RL 3G6DL 1NFDA 5LGHH 5LGKA 5CKAA 4UQ2A 3VXMB 4YHZH 3D5OF 4CVXA 1P9MA 4HCRL 4GUPA 3X3FL 4LGSB 5CBAB 5EOCJ 2R39A 1MFDL 2R1YA 4D9RD 4X5LA 2DM3A 2WZPD 5HSFA 3MBXL 1ZHKA 3D85B 1XGQA 4UINL 3WE6B 4WWKB 4U6TA 4OAWB 4LNRA 2Q7NA 3QNXB 3CXDH 3EYQC 3FONB 3L3IA 5HI5D 4TTDC 5CZVH 3X13B 4UTAH 4LDEB 1YEEL 3BDXA 2AGJH 3ISWA 3WO4C 3GSXB 3JVGA 1MFCH 4NKDA 2EKSA 4WO4D 2CKBB 3JWNC 1ZV5A 4W4OA 1X4ZA 2GAZA 4PJGE 2A6DB 4OF7A 1N5AA 3D39B 1EXUA 3ZYJA 3MV7B 3VXME 5ISZA 3MLYH 4NGHH 2FECL 4XC1L 3D18A 4PJ8B 1EAJA 3VFWB 1Z2KA 4CVWA 3WDIA 4TNWK 4PRBB 1A7NL 5B3NA 2VE6B 3MV8A 4G9FE 4AQ1B 1LNUA 4P5KB 1JN6B 2ARJQ 5I8OL 4FQ2H 3K1KC 2HTLD 4MJ6B 1AY1L 4S1QL 1K5NA 3TIEA 2V7NA 2NXZC 2BVOA 4J23A 3FN0L 3O4OC 3AXLA 4DKEH 1DANT 3MGOB 1OCWL 4CU8A 2NY5C 2X4NB 4M61A 4GG6F 2PYEB 1OP3K 4Q9RL 3L5XL 5F9JB 3D39E 3JWDH 4PYGA 4S1DC 3IETB 3TBWB 1GCFA 4JPVL 1ZVYA 4LKCB 4BKLA 1HXMB 4Z5RA 1ZHLB 2MOVA 4XNQB 3ZHDA 5JNYB 2E6PA 2XTJB 1ZGLP 4DN3L 5D7IF 2YD9A 3QUXA 1Y6MR 1IZJA 2JB5L 4YLQT 2FO1A 1INQB 5C0EA 4MNHB 5KSVB 3SY0B 5DURB 1SM3L 4K7PX 2VAAA 4QHLB 4N1CA 1O5DT 3VFTA 5I75B 1GZPB 5CEYB 2ZP0T 4HLZH 3B9KD 5HI3C 3F5WB 2XWBB 3ZKMC 4AT6A 1XR9B 4V2BA 3T0BA 1I4FB 5IOPB 3MUZ1 1WAAA 3WDHA 3QEQE 4FXLA 3TT3H 4X99B 1IM9B 3IAQA 3MRRA 1FIEA 4DOHE 2XG5A 1EUTA 2F8VA 5DZNA 5EUKA 1JE6A 4JGJA 2R4RL 3WKML 1EMTL 2YR3A 1DN0A 1HHIA 4EVNA 1EFXA 1NCCL 3HE6C 3EYFB 1PY9A 2DICA 3F6LA 4AEIH 2N1KA 4HUVB 1BFOA 1NJ9B 4X6CF 1YQVL 1DTUA 2Y4SA 3C5ZD 4K9EH 5HHMB 3N1MC 1UVQB 2YRLA 4JM4H 4EIZC 3IFPB 1CICD 2IMNA 3WUWG 5JHDE 1X5AA 4PJAA 4I8DA 3MPCA 1A6UL 2A6IA 4LSVL 4QRSB 4OLYH 4OFKA 4NQED 2YEZA 5J7CC 4K7PH 1N2RB 2QR0B 2F74A 4MWFA 2EDTA 2BSSB 3D3VA 4NHCL 1ZLSH 2F54E 4TSBL 3STZA 1TTGA 4QXWA 4F7CA 2BFVL 1GYAA 3QI9C 5IQ7H 1MJJA 2W92A 2A6JB 1GPOH 2DQGH 4YHLH 3IDIA 2NNAA 4DKDC 1P7QB 5DJZB 4CUCA 4LHUD 1KEMH 5C7XL 3IJSA 3PWUB 4XNYL 4N0CD 4WFFD 4NIKB 4PB0L 1VFBA 4QXGL 5HHME 3SEPA 1HSBA 1KC5H 4L3EE 2QSCH 5MEQA 2AABL 2WP3O 4RWHA 5DVLA 1MCQA 3IKCA 1EDQA 5D7SL 3RAJH 3MLUL 1A4JA 2F5AH 2NY4C 3QUZA 4HS3A 4JFQA 4O2EA 3WJLA 2GIYA 1DE4A 5IW1A 1F2XK 5AUMA 4CADB 3BHBA 4QRQB 2E8YA 3V79C 1AGEB 2OL3A 3HFMH 1WK0A 1DQLH 1GOFA 2J8UA 1XAUA 3C9NB 3WL9A 1JNLH 2EDDA 3MCLL 3QO0B 4FXGA 4PGZA 4I48A 3LPFA 3RTQB 3IFOA 5KSAC 3ETBF 4G7YL 3SE9L 2WWKT 4X80L 1A5FH 4OZFH 2BSTB 4LSQH 1T1WB 5HY9B 1A0QL 3VRJB 2CDEB 4JKWA 5IMMA 3SOBL 2O5XL 4KJWC 4LDOB 2Q3ZA 2YC1A 2IPTH 4OZIA 4QTIH 3OKYA 4JO1H 4FRWA 1MQKL 3K81A 2BRRH 3P0GB 4WENB 4D94A 1Q9WB 2JJWA 4P5TA 5LGJB 5DT1L 1CXKA 4XMPH 3CXHK 2R0KL 3MFGB 3OKDB 4ONFH 3BKMH 3UYRL 1I1RA 3WFEL 4J4PD 2PF6A 1LEIA 1EAPB 5E6ID 3VXRE 4L4VD 1ES0A 1KENL 4XAWH 4KJYB 1YMMA 3NCJH 3C6SA 4G6JL 3HE6B 4WW2C 3WIIH 2NLJA 3G08B 2IH1A 2Y9RT 4JPWH 4M03A 4WW2F 1JUFB 1CDJA 4KC3B 4PG2A 1CQKA 1DQTA 3IYLW 4TVPH 1WSST 5TE7L 3RY6C 4LCWA 2J6EL 3TGXA 2FBJH 2HKHH 3ZE0E 2IAMC 2V5RA 3HMWL 1NKOA 4KROD 1U8NA 1PQZA 4WTZG 1FNEB 2UZXB 3B83A 5K9JL 1CQYA 2GW5A 2VLLB 2ITDB 2EDKA 1T21B 43C9A 1D5MB 1PSKH 4X4XB 4MZ3A 4R97B 2OXHA 1C16A 1YPZB 3UTQB 2HJLB 2LU4A 5JPNA 5L6YH 3T09A 4Y89A 1D6VH 5L2JB 3QI9B 5CP7A 1MHPL 2F19H 2LU3A 5GGVY 4JFPA 2A74A 3DRQA 3S5LG 4EDWL 4Z77B 4BSVB 4GBXA 3NA4A 3DLQR 1OGTB 3V6OE 4GRLA 2Q76A 2HJFB 1T5XA 5ID1A 1EVTC 1K8DB 1U8PA 1RJZA 4P4KD 1Y0LA 3WMSA 1JWSA 1G0YR 4EQ2A 1CG9B 4JRYB 3PWNA 2EDJA 1YPZE 1ZANL 4P49A 2H32B 2B2XH 2HT2D 3H3PL 3TH2T 2GK0B 4WGVB 5ERWB 1KTLA 5KSAB 3BKYL 1O7SA 2RAMA 1PYWB 4LPTA 4MMXC 3FQWB 1FFNB 2EDYA 1FE8H 3HG1B 4LLWA 3ARWA 1DBJH 4JQIH 4NZUH 4H5SB 2PO6A 4NO5B 3CU1A 3MJ7A 4ZD3H 2BOCA 3SCMD 5AYUL 3SQOL 3T0EC 1FFRA 1LO0H 3TNNA 1IEHA 2V2WB 3AAZB 1B0WA 4Z78B 2XXCB 5T33H 3ARXA 3BP6A 1WEJH 5INDA 1CD9B 3GSRA 3L3GB 4PPTA 1HHJA 3QUYB 3DX6A 1T2JA 4PRPE 2F58H 5C0FA 2FHFA 3RDTC 1TTFA 3I2CL 5I9QB 1BX2B 2W9EH 4XPFH 3RKDD 2ZUYA 5EC2A 2NY6D 4MXVF 5CZKA 5DD0H 3IJYB 4G9FD 3ZT5A 4I77H 4WWKD 1RMFH 1KCUL 1ZSDA 3GI8H 3QQ9D 4M5YL 3P73B 4NYLB 5DUMH 2NTFA 3TEUA 3HC0A 4HPYL 2Q8BH 9CGTA 3HG1E 4HWZB 4PREA 4ZTPH 3SE4A 3B3IA 2GSGA 3CSYA 4ZPTB 5CEXB 3HA0A 3NCYS 2KDGA 1DFBL 3IB4A 1SJHA 2CDGB 2NZ9C 4TSCL 3OX8B 3LKQA 4KHTH 5HHOB 5J13C 5I2IB 1FL3B 1IAOA 4A6YA 4FFWC 4BH7A 4CW1A 1TIUA 2Y6SD 3AMKA 3QIUC 3CU7A 3C08H 5F7EL 3T3ME 5DYOA 3VCLA 1ACZA 3P3YA 3OXSB 4U31A 2AJYH 4XP6L 3V4VL 3F12A 4X6DA 4C55A 1JGLH 2B4CC 4JY4A 4ZDHB 4G5ZL 1IGFH 2ENSA 2LFGA 5F7YC 1FG2A 5HD8D 5HYSG 1LE5A 2UWEE 4FNLL 8FABB 3KR3H 5JW3H 1MCWW 1ZA3A 4CNIB 1VPOL 3QZWA 4JJ5B 4X0KA 3DX7B 3TBSA 3VG0L 2EXYD 3MLVH 3RWHA 3LQAH 3S37X 2NX5E 1OSPH 4TYUA 2ZSVB 3ZE2E 3V52H 5F9WB 1S9YA 2WK2A 3RRQA 4FQPA 3LEXA 5IBLC 3V4UL 4QTHA 3FB5B 2FGZA 3FRUA 3QEQD 5HHOE 1U36A 5FUZH 2AV7A 4Y16B 4MNGB 2C1PB 3VD7A 4NHUB 4O2CA 3ZT7A 3SDXB 3O9WA 5F3HA 1KEGH 2A83B 2YPVH 3RZCC 1Q9LB 4PB9L 3GBML 5MERA 1RZFH 2W07A 4YC2B 1T6WA 5TJWK 2GSIA 2XZQH 1UWXK 2E7BA 3QO1B 4H88H 1GGUA 4YHYC 4LEOA 4UIKH 2CIIB 3WJJA 4EXKA 4UILL 3LRGA 4FQIL 5JW4Q 4PLKD 4WJ5A 5B8CC 1NEZB 1KTRL 1S7UB 3BX7C 3FO9A 2HRPH 1XF5A 1Q9OB 1BQLH 3FOMA 3I02A 5ALBL 5JHDD 1U3HC 4Y1AE 3T08A 3QFDA 4YNYB 4F9LA 4JFOB 3SO5A 3M8OL 4MNGE 2KPNA 2YKLH 5DO2D 1K6QL 4UTBL 2XRAL 5HI5C 4XVUC 3O81A 1KCVH 1XGYH 2F54D 3OAYH 1I8MA 3S37H 1C5DB 5IVZA 1YNKL 2OZ4H 4OF0A 3ARDA 3OJ2C 3RJQB 2EYTB 4FZEH 3H9ZA 1JI2A 4D8PB 4D9QE 4KWUA 1LP9E 3KLSA 3V2AR 5E9DB 5IVXF 4FS0A 1S7VB 3L3JB 5D1XB 15C8L 4NFDA 5HHMD 3KPQB 3FQRA 3LSOB 4L3ED 1HDMB 4QHMB 4G80B 2ICES 5D4QA 4XWGH 3VFSA 3X11B 4ZXBA 1CLCA 2Q7YA 2ADJB 2A73A 1D5ZB 3KLAB 1P69B 3NABL 3U36A 3H0TA 1FLRH 2K3TA 3Q6FA 5E2WH 1NDMB 2VDQL 5H2BB 2VKWA 1F45A 3HNTL 2ATPB 5E5RB 5DJDA 4HWBH 1HKLL 4JR9L 5J13B 3O8XA 3E0GA 4PG9B 4OGYH 4L29B 1U58A 4C83A 4HV8B 2IADA 5EU4B 3VFMB 1UXWB 1P7QD 3KXFA 5J8OA 5E9DE 1PBYA 4OF8A 3ULVL 5EWIL 2A9NL 3CDFA 4XP4H 1RUPH 1FP5A 3O0RL 1A4KA 3C6LD 2BNQE 3MRBA 5E8NB 3KAAA 1AHWA 2WLZA 3VD9A 4WFEE 4NOFA 1ZT4B 1OW0A 4B7IA 4XMLH 4JM2C 1OM3H 2Y07H 2OL3L 3TCXA 2XTLA 3B9KC 2QQKH 1T1YB 1IGTA 5GZOC 1UA6L 4JM2F 4JO4L 1YEGH 5IT2H 2YD2A 2VQ1B 1RURL 3HZKB 3RTQD 2ZNWA 1A1OA 1EHLH