4P2RE

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
SGGKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
total genus 51
structure length 245
sequence length 245
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE01
2F53A 4PJDF 4RMWA 3GSNB 3GHBH 3FONB 4H5SB 1JYNA 4XB7A 4PJXB 1B6DA 3BXNB 2NZ9C 1C7TA 3PV6A 4OF8A 1GZPA 4OUUB 1ED3B 5SWZA 1EAJA 4PJHB 4KKAC 1BECA 1WUNT 4JHBA 4G80A 1CGWA 4OLYH 1A14L 5FECA 4L8CA 1MH5B 25C8H 1QYGL 3QWRA 3QB7C 1MCLA 2H45A 3QHTC 2X7LB 5F6IC 4R96B 2YXMA 1B9ZA 2ICEA 5JO5A 2IADA 3QDMB 4QXTB 4K55A 1DQJA 5J0BA 3MRDA 1JPST 2CUIA 2DBLH 4PRBA 3DPBA 1Q72L 1YQVL 2WWKT 4N1EA 3LKRB 4Y4HB 1TVHB 1WF5A 1T1WB 1CR9H 4O2CA 1FZKB 5D96C 1CTNA 3KYNA 3VH8A 4PFEA 2R23B 2ESVB 4HHAA 5KVEH 5GHWL 5GJTL 3VXME 4M8QA 3MOBH 1LO3L 5J12B 1MCWM 4ELMF 4LPVA 4HK0B 5I1AA 1JGUH 3GMNB 3H7LA 2X9YA 5C08E 3L1OL 3SHSA 3VXOB 3HE6A 4R6UA 2CSPA 5CGYD 3TC9A 5ABDE 4NKOA 4LNRA 2DWDA 4HX1B 2P5WB 1U58B 2R69L 1DN0B 1JYVA 1FFQA 3BH8B 4JZNA 2VZUA 4DCQA 1C16A 2R4SH 5JA8B 3HNTH 1FFRA 4M1CD 2DWEA 2X1QA 3VFTA 2DQUL 4MNQB 1IGIH 4X9GA 1IILE 1LP9E 5MI0C 5DHYA 3TO4A 4ACPA 3EO9H 2GCYA 3LDBC 3GJFH 5C0JB 5EOTA 5FO7A 1Q0YL 4GO6B 1MEXH 5LVEA 4FFWD 2DYPA 4PRPE 5SWQA 3SDXB 3T04D 3UPRA 4YXKH 1I9IL 2D7TH 3SGDH 2VLMD 5FO7B 1XFPA 1CXHA 1MFDL 1VENA 4UIMA 2NNAB 1QHPA 4GW5B 4P49A 5LCVL 1VESA 3ZKND 4OBSA 3OAZK 4I77H 1YNLH 2HFGH 4HKBA 3T3ME 4I3SH 1ZHNA 3GSRA 1ACYL 4H1LH 1BFVL 1QFWI 4QNPF 1CL7I 1EMTH 3WEXA 1WWBX 4UT6H 1CE1L 5IJVA 3STLB 5F8QC 3C2AH 3ZE2F 2FO1A 2QLVB 7FABH 3ZE0E 1M1SA 3C6LA 3S3SA 3DX6A 4UQ3A 2D9CA 1QR1A 1MCOL 1CT8B 1KB9J 4JJ5A 1ZHKA 3L3IA 5CD3A 4AEHH 4C83A 5IROC 1EVUA 2OYPA 4LHUG 5LCVH 5TE7H 5DO2D 4Q2ZB 1PBYA 4ODSL 4TVPD 4HIIA 4NJAL 1OARL 4NQSA 2OL3B 2DLTA 1CFQB 5T1MA 2GJ6E 1U8PB 5CJQH 2BRRH 5I1CH 4RWHA 1UA6L 4LGSB 2QQNH 3PL6D 4ZXBD 5I9QC 4XPHH 5BO1L 3LEYL 3OHXA 5F7YC 4L8BB 3DOSA 1SJHB 4FN0A 1I1AB 4JY5H 3PHSA 2JJUA 1QBLH 1QLRB 5E8OB 1QPPA 1SQ2N 4LEOB 2HMIC 3TF7C 3CSBA 5I1LB 2NZ9D 4LLVB 2CDGB 1PG7L 1HOCB 1NGQH 5F6HI 5F6HJ 1DQJB 4KK5D 1LEIA 1MCSA 4PJAF 1MOEA 2R2CA 3BXNA 2B1HH 4S1SL 5FGSA 5F71A 2D31B 1EO8L 3BHBA 4X6EB 1OP5K 4ZFZB 4Z7VA 4NO2A 2H26A 2WMPA 3A6CH 3N0PB 4OFKA 3MZGB 4XMKL 3KLSA 3IF1B 5BO1H 3EIFA 2GSGB 1CXIA 1Q1JL 2VXQL 4BSWA 2ZP0T 4JY4B 3N85L 1TJIL 1OF2A 4LRIA 3KJ6H 4XNMB 1MJ8L 2X4SA 1I1AD 1M71B 1T6WA 1Y0LA 3C5ZC 4Y4FA 1NFDF 4K23L 2EXWD 3QDGD 4PR5B 3TNMB 4PS4L 2VMFA 4FXKB 1FGNH 1NCCH 1PY9A 4BK4A 2VLRB 1IARB 1OSPH 2H32H 1KJVB 1FRGH 3QDAA 3OAZH 2P7TB 2ARJQ 4JFPA 5ICZA 5BW7C 4NCC2 1DLFH 5SWSB 2PR4L 3BGMA 3BH9A 5DHXB 2KH2B 2YUXA 1MFCL 4OLUH 2CXGA 3LQZB 5ICXA 2A2QT 1T7VA 3T0XA 1HXMB 4MQ7B 1HHKA 1OVZA 1MCWW 4FS0A 4ZUTB 1TJIH 4KK5C 4M6OH 5CINL 4NO0A 5EH1A 4JO3H 4L3ED 4PTUA 4KHTL 1JBJA 1Z9LA 5CIPH 5D70H 4OLWH 3VFOA 1FAKT 1NCCL 3O45A 1MREH 2NCMA 1T5XB 1TVDA 4NUJA 4JFZL 3TESA 4ODVH 4WCYH 5I2IA 1FIEA 1SEQH 3F7QA 4P0DA 4XT1C 1ZANL 4Z95L 3ARGB 5IGXH 3D3VA 3LIZH 4YPGA 5CZVL 3O6MH 2AXFA 1UQSA 3ZHLA 1YDPB 3WDHA 4WW2B 1FP5A 2XN9B 3S6CA 1V3JA 4WI8A 3IDIB 1UKQA 5L6YL 2DYPB 4L3EE 1ZVSA 5SV4A 4UV4H 4Z7UA 5EDXA 1RZJL 2PCPA 3C2SA 2GEEA 2VL4A 4U7SA 5K9QG 5GJSH 3IJHA 4M00A 5J7CC 2P43B 2X9XA 1L0YA 1K9TA 1XGUB 3V4UH 3HCVA 2GT9B 1OAZH 4E0RB 5C09A 2EIDA 5FHAL 1RIHH 1T89C 2IPKB 3S3JA 4AEEA 3RVUC 5LKNA 4M7ZB 4ODBD 5C71A 4JO2L 1BIIA 4H0GA 2V6HA 3O6FD 4NYLA 3D1MC 4HAGA 3AMKA 1L0QA 5EA0H 3VWKA 4MXWL 4LHJB 3OGOE 4NCC1 3FFDB 2R23A 3KYNB 3DSFH 3GB7B 5HGGS 1CZ8H 2MTPA 3PXHA 3SGJC 4JPWH 1QBML 3SDAA 1SYSA 3T8XA 1BAFL 3ARGD 4FXLA 5J1TC 3HR6A 1K8DA 1NAMB 2ADFL 2XICA 2ITCA 2UZYB 3EYOA 3HLAB 2WZPD 5FYJD 2EDRA 1KELL 4IMLA 1FFNA 4R4NC 4ONFL 1S7UB 4XCYA 1KBGL 2FIRT 5FK9B 4ODXB 4JKPL 4ZG1A 4YQXL 1CDGA 4MZ2A 1HXYB 3MV7D 4K94C 2YWZA 1VKXB 3S3PA 3M8OL 1NCWL 4G9DB 4NM8H 3SN6N 4TOYH 1HHGB 3HMXH 2DJ4A 1OSZB 1G1CA 5EC1B 2C7UA 2YA1A 4WFED 3ZE0F 4LLUB 1FFOA 1ED3A 1D5MB 3HPLA 4L4TB 2YPLE 5GZOD 3MPCA 4Z0BH 5FM8A 4Y2DC 2IF7A 1H0DB 2A1WL 5F9WC 4N8VA 1TITA 1V3KA 3MYJA 4K3DL 4MHHG 4ONFH 4L5FL 1KBGH 1OARH 4L4JA 2EEDA 3C5ZD 5HYJD 3L6FB 4KJWC 2FL5B 1FE8L 4S1RH 1A22B 5F89B 5FCSH 4RAUA 4PD4J 2FJHB 1VFBB 4XPHL 2VYRE 1HIML 1BVKA 1DEEB 1W72H 3MRRA 4M93B 3X11B 3TFKD 4KROD 3NH7H 3RL1B 4NRZB 5CWSA 4BQCA 5TF0A 3FOLB 12E8H 4CVZB 2G5BB 3U30C 4G6KL 2XPGB 5MEOA 4YDLB 5F9JA 1CXKA 1UT9A 3MNVA 1Z9SA 1BZ9B 3T3PE 1BQLL 3LS5H 1BWMA 3QCVL 4M61B 3WUZA 4I5BA 3QDJD 5HSFA 3WL9B 4JO4H 4K3DH 3BP5A 3ZE1F 5JIHA 4ZUSA 2A9ML 1HEZA 5E56A 2F15A 3GSXA 3HFML 2CRMA 1T3FA 3DYMA 5I76A 4J1UA 3LKNB 5DD6B 3MRKA 1AH1A 2QJDA 1C7SA 2B0SH 1Z2KA 5FA4B 5E2UH 2UZIH 1L7TH 1I75A 5ANMB 1P4LB 2J6EH 3Q6GL 3V0AC 5I1DA 5E4EC 3H9SE 2H9GA 3BMVA 5FYJH 3U2SA 1JTTA 4JN1L 4ERSL 3RWGA 4RFOH 2OX5A 3L3HA 4HWBA 4P59H 3ECBB 3O11B 4NO5B 5TPWH 2R8SH 1M7DB 4GG6B 2XXCB 5DT1L 4LOUC 3DX8B 5CD5D 5HHVL 3TH3T 3UTTB 5HHNA 1FGNL 5EIVA 2C3WA 4PLNC 2BCKA 3EKCA 1GZQB 4MDJB 4J23A 1FNFA 4UT9H 4FQQA 4IOIB 2EEAA 5GGTH 1J5OL 1I9RH 3L7EA 5C8JB 2C5DC 3ZTNH 5IMMA 1JYXA 2EE9A 3P4NA 1JNNL 3QEQB 3QNYB 5MERB 1GGBH 1A1NB 2JB6B 2V2XA 4ERSH 1E0OB 1FYTA 3VXUD 3P9MA 5C0RL 4O9HH 3X3FH 3G5ZA 1CFNA 4UDUA 1KEMH 4DFIA 4ZNEE 5JW4N 2XOTA 1IKNC 5CEZH 1KTLB 3FT2B 4AIOA 1OGAD 1WIPA 1CIUA 1FORL 1YC7A 1D6EA 4DGVH 1MWAL 4G9FE 1BZ9A 2Z91A 2X4PB 3MJ7A 1IGCH 3DYPA 5EU5B 3TBWA 5HVWA 1OAYH 5J3HD 3MLZL 1ZGLM 2A74A 1IAMA 3WXVH 4AT6B 1YEJL 2CRYA 1BVZA 2F8OA 4HDIB 4Z18A 1H3UA 4FABH 1DVFB 1M7IB 2EC9U 3QXWA 3SE9L 3BJLA 1U8LB 2BP3A 5DC0A 1F6AB 3ARED 1QFWL 1YEGL 3IAPA 4XWGH 1QSEB 4FQPA 3EFFB 4LLMA 1HH6B 5BV7B 5GS0D 2AJVL 3TN0C 4POYA 5JXED 1KEML 5I0ZA 4HFUH 5C86A 1JF5A 2RCSH 4MAYA 3O6KL 2NXYD 3MNWB 3TJEL 3UTQA 2IAMB 3RHWF 5F7UA 1X6NA 1TQCB 4JVUA 2BNUB 3K0WA 1NFIB 3MLZH 1DP0A 4MWFB 2W0LA 5E2JA 3MRIB 5BMFH 1QKZH 2DKUA 2GFBB 5H2BB 5KAQF 1RZFH 1S9VB 3VWKC 3ULUF 1MVUB 4KMTL 2VB5A 4JPVH 3SY0A 1D5XA 1UJ3A 3MCLH 3QEGL 3LZFH 1I3RB 4MNGB 4HK3J 3MRBA 4Y5XB 2VZTA 1JUFB 3V6FA 2UVFA 3QEQE 4XPAH 1JPTH 4JG0L 1NUGA 3VFSA 2XN9A 5FUOL 4J3SA 2X9WA 3F7YB 3O3UN 3OB0K 2VC2H 5F3BB 1XH3B 4MAYC 4Y1AB 3PJSB 3VGAB 3MA7A 4LKXA 5DI8B 2VZ1A 1F2XK 3CFBA 4JFHD 4YEFA 2CPCA 1K5NB 5HTSA 3MRHB 5F8RC 5IWLC 4KKCD 1ND0A 3U36A 1RURH 3T77A 1PY4A 1K8IA 3S35L 2AP2A 1EJOL 1XCTB 3FL7A 1G7HA 1BQSA 2DKMA 5DRZA 1BVLB 2ITDB 4ETQA 1LEGB 1A7NH 3W9EB 3S37X 2AERT 1UXWB 4XCCH 2GJZB 5K9QI 1IQDB 1KV3A 5EO0A 2YD2A 1W0YT 4WTXA 5A16B 4YHIA 1ZVYA 3LQZA 1IGMH 3V79C 4ZTOL 1XF4B 2G2RB 3BAEH 3C9NA 4ZTPL 4EUPA 1R0AL 4PJ5E 3QI9B 3PNWB 1KJMB 2P5WE 5C0FB 2ENSA 4JANA 4P2OC 5DURD 3RIAK 4M7JL 1XCQB 2CRIA 3KPRB 4F7TA 2D03L 1CVRA 4NHUA 4UZGA 2YZ1A 4AG4L 2X4RB 5BS0B 3C08L 3TVMB 5FF6A 1A7OH 4AMKH 4KRMB 3BN9D 1AGFA 2DQJL 8FABB 5F7LB 5E08L 3AMLA 1TZIA 2PXYB 4O00A 2BNQE 1KENH 3I2CL 4K71C 5IR1B 3KHOA 1DBBL 3S9DB 3P0VL 5DEZA 5I75C 1LO0H 3QFDA 5CUSH 1UB5B 2NY5H 3WLBA 5D71H 4PJBF 5D7JB 5DJDB 3EO1A 3JZ7A 3H6JA 4N0FA 3T2QA 1FL6B 3QA3A 1CLOL 3PF2A 4LCWA 1EK3A 1T66D 3B9DA 3BZFA 4GUPA 5FYLH 3CAFA 4FP8H 3QI9C 1JN6B 3SBWA 3MGOA 4L8SA 2G60H 2AV7A 2YD1A 4EI6A 1XIWD 1FQ9C 3NACL 4LSPL 2UYLB 2J7LA 1W0WA 4P46B 5JDSA 1EX0A 3OPZL 4P2OB 5B38G 5CS7A 5ADPL 1LNUB 4XPFH 1HINL 3OZ9H 3TZVB 3IFPB 2FATL 4NSKA 4Z78A 5F7KC 1J18A 2OJZH 3G9AB 3MLRH 3WIFA 2RFXA 3GJFK 3IKKA 4XBGA 5BCAA 1T0NA 2EDFA 3H2WA 5L8KB 1VADA 1T2JA 3IJSB 5C08B 3U7AA 3KPOB 4MHHI 3AREB 3KWWA 4FFZH 1P9MC 2E9JA 5L2KB 4IHOB 4M7ZC 4P23A 3RY4A 3MBEB 1CLYH 4WHTB 4ZFGL 2FD6H 4IEFB 2YRZA 1CD0A 3WSQL 3GMPA 1CQKA 2P8PA 1DQDH 3O3BB 2Y36L 1FC1A 1UM6H 1BJ8A 2IH3A 2IBZX 2A38A 3OX8A 4KTYA 3VU2A 1N5YL 1CL7L 4HQQH 4Q58C 3PWNA 4YIQB 3L5XH 4MLSA 3VJ6A 3LMJH 1N8ZA 4GW1B 4XC1L 5GPRA 1S9XB 5LAXB 1IAIH 5DFWH 5MEPB 3GSWA 4YHPA 1QFPA 4B53A 3O3EA 3HI6H 4DGIH 2E5EA 4QXGL 4NZTH 1YN7A 2X40A 3S4SA 1JGEB 3TBVA 5FUZL 1MWAA 2ID5A 3T0EB 4XPTL 4N0CC 4PRAB 3P9LA 4Z76A 1I1AA 3GHEL 1NSNH 4NBXB 1SJHA 1U91B 3RL2A 3V6FB 3SDDC 3OQ3B 4BJLA 3SE3A 2P8MB 5CJOL 1DE4B 4WDIB 2GUOB 3EOBA 4RX4A 5EU6E 5GXBB 1MWAB 3T0EA 1ZMYA 1Y6NR 2DM4A 4OV6F 3MBXH 5SWZE 3OKMA 3DNKA 4M1CC 1QEWA 4RGND 1MEXL 1ZXQA 3MA9L 4Q2ZA 1DN0A 2LU7A 3TV3H 5BRZD 4NN6B 1MNUH 1XF1A 2BHYA 2JCCA 3KPTA 4WGWB 3T0WA 1IL1B 2FCBA 4HWEL 5EULV 4Y4KA 3QIBB 4XZUA 1Y18B 4L3EA 3GSWB 2DB8A 2VUYA 5DD5L 3OKDB 3LKQB 3SGEH 4WENB 4JGMA 4HDIA 3WNNA 4ELMB 5C0NC 3VGDA 4WV1B 2B5IB 3I02A 3WFDH 3OR6B 4PGDA 2NY0D 4YXHL 2DLFH 1QFOA 3MR9B 3OKDA 1K2DA 3RWJA 4RGNE 1SY6H 1D9KC 4WUKL 1I8KA 3Q6FA 3VFWA 2VISB 2CR3A 4LAJH 5GGSY 2NY3C 5ACLA 4HKZB 5SWSE 3BD5A 1WIOA 1L4IA 5IHUL 1FO0H 1FZJA 1HSAB 1KLGA 1HH6A 5C2UB 1HKFA 2F53D 2HJFA 4X4XB 5FM5O 4PJ7B 1B4RA 1RZIB 5JDSB 2C3HA 4KI5F 4JY6B 1DJSA 5JPNA 1D5ZB 3N50A 3CPLA 3QEHA 1CLZL 5E9DA 2P49B 4NSKB 4Z78B 3RA7H 4XWOD 1WISA 4ZSOB 5HHNB 1ACZA 2QSCH 4RRPG 3V6BR 3JWDL 4OCRH 4GRWH 4P48A 5C09D 5IP4A 1KJ2L 3U0PA 2NY0B 1A7RH 4ZPTB 3UROR 3T0DA 1CCZA 4ISVB 5FO8B 1UADC 3IDNB 4TUKH 1AJ7H 4J4PC 2VDMH 4ODUA 5HVHB 3OXRB 1M7XA 3UYRL 1RZGB 1WAAA 3HKFA 4F2MA 2O93L 2J88L 2BMKA 1IMHC 2XTJE 3IDJB 3QFJB 3VXPB 3H42H 3DVNB 4M3JA 3VDCA 3V4VH 3WN5B 3BPCB 3LPGA 4A6YA 4QRSA 2OMBA 5CCKH 2HVKA 3IDMA 3B5GA 2OJEB 4M48H 2AW2A 5DVKA 2XWTB 1RK1B 1V5JA 2HA1A 5EBWB 4QWWD 3MFGB 1VEMA 1VFUA 2X4UA 5CIPA 1LQSR 1J8HA 3WJLC 4JZOB 1MCJA 4F37F 1GIGL 3KWWB 1BM3L 3RWGB 5C0AA 4P5TB 4O2EB 3HUJB 4G8FB 4L8CB 4PS4H 5A16A 1KCUH 4F9LA 4LLAA 4FZ8L 2PF6A 2AQ2A 4U1KA 4LSUL 4X7TB 4HS6B 1N26A 3EYUL 2YWYA 2XIDA 5GS1A 1FRGL 1BJMA 4EN3B 2KQNA 5IV2B 2X42A 1T1XA 3EJZC 5HGDA 3LN9A 4I4WB 4RZCA 2WNGA 4JM2A 3ALPA 3WIHA 1CWVA 2C4XA 5IMOA 1JK8A 3W0WD 1MJ7H 1KN2L 2JELL 3LD8B 3GUTB 1F4XH 3ULVC 4Q9RL 3A67L 3WXWL 4PUBL 4KHTH 4PGEA 5D5MB 2UY6A 3WN5C 4D9QD 1NC2A 5C9JA 3QUXA 1TVBA 4PJ8D 2FATH 3V7AG 1XGRA 3DARA 2YA2A 3T77B 4WO4C 1YY9C 4HGWB 2I9TA 3CLFL 2NX5E 4OIAA 4L3CA 1FO0B 5E03A 3BDYL 1HHIB 3MRBB 9CGTA 5CSGA 2I5YH 2BDNH 4OLXH 3GSUA 4AQOA 4D9LL 1I85C 4RFEA 5KG9B 5ISZD 4YHZL 2WUBL 3O4LD 5TGBA 1FYHB 3KS0J 3FQUA 2Y36H 2Y4SA 2A0LD 3MRIA 4PD4K 3HPLB 2ESVD 4L4TA 3WYRA 5BVJA 3MRFA 4LSSH 5B4MC 4L29A 2AXGA 1D9KB 4JFXA 1Q0YH 1YC8A 1SJVA 3EYFA 5ADOH 3K4ZA 3CFDA 4PJXE 4TRPL 4OIIH 2C3VB 4MA1B 1G0YR 3QO0B 5IHZA 2A6IB 3MLYL 3NFSL 3QEHB 3L1OH 4MJIE 4Y19A 1JTOA 3RVWC 4EOWL 4ZAKA 1A7QL 1AGBB 1F58L 4GKNB 2DMKA 2DD8L 1A1OA 1QR1B 1T1YB 5I18L 3HB3D 4EXPX 1E4XI 1QSFA 4XPBH 3MRMA 2XG4A 4JQXC 1XGUA 4KK6C 3U83A 4QRRA 1BP3B 3KHQA 2PYEE 2GAZB 3RWCB 3ULVH 3D85B 3HPJA 5CEYB 1K8IB 4WEMB 1J11A 3OR7A 5GGUB 1D6EB 5IB4B 4PGBA 3KPPB 1PD6A 5T1LD 2Y5TB 3MRGB 5CSBA 1Z5LA 4ZUVA 1CDCA 3CDGA 1MHEB 3V5DB 1TCMA 4Y16C 3KNBA 3VXUA 5CJ5A 4HV8A 5CEXA 5LQBL 3OAYH 4UU9A 2IAND 4Y2DD 5BZWA 1ZHNB 2YHGA 2F74A 4OUOA 1JPSL 3FQXB 2V2WB 3HC0B 4FXGA 4HUXB 1AY1H 2XTJB 2OCFD 3AS1A 4KRPC 4Y88A 4K3EL 4D94A 1T5XA 5DRNB 1QPXA 1A3QA 1U95A 2FX9L 5DK2A 4NN5C 1RY7B 2I27N 3U7WL 4YHOH 5J11B 3CFKB 3ARQA 3TT1H 3AS2A 4PY8I 4NPYB 4F7PA 2ZUUA 3TO2A 4BKLB 1FG2A 3N9GH 4FQJL 1WGOA 4BUHA 3S96A 3OSKA 2ZCLH 5D2LF 2QHLA 4M6NH 4Y16B 4O58H 2IANE 4X4MA 2EDHA 3RJDA 1IBGL 2DM7A 4LVEA 4R4FL 2FWOA 5FA4A 1ITCA 1NGQL 1ORSB 1P1ZA 4QF1A 3WLWD 1XIWB 3ARZA 5GRVK 4HHAB 2G75A 5HDBF 4YE4H 3HRPA 3LVEA 2ICWJ 2WSKA 3MUHL 4M5ZH 3KVQA 3QHZH 3RUGA 4M4RA 4M4PA 3MXVL 3S98A 3TYGL 4YIQA 4XNYH 2O5ZL 4S0TD 4OCRL 1RUKL 4G7YH 5E6IA 3X3GH 4OI8A 3SGKC 3ZO0A 5FA3A 4M3KB 3GSVA 3L5HA 4XRCA 4XX1E 1TVHA 3IJYB 1VPOL 3P30H 5J11C 1YEHL 4FG6C 1H5BC 2E7HA 3QDJA 3RQ3A 3ULVD 3LEXA 5TE7L 4DN4L 3JV4A 4NN5B 4OTXL 3KYMA 5EUOB 5HVGB 4Q7DA 2R9HD 5A2LH 4X99B 3MRQA 1E4XH 4JFFE 1NCUA 2PTTB 4W4OC 5SWSA 2EE2A 3WFBH 2ARWA 1FYTE 4U0QB 4V1DD 2PR4H 1T0NB 4LIQL 4RAUB 3ZMRA 2H26B 4QRQB 3GI9L 5F89A 3GSOA 1MI5D 2J6EL 3Q6GH 3TYGH 5IB1A 3O9WC 1J05A 5D2LA 5I1LA 3MXWH 3WNLA 3V0WL 2APBA 3AROA 4LCYA 5KVGL 2N4IA 1UQSB 1LP9A 3RBSA 3O6FC 3DYOA 4XXDA 4B50A 4QTHA 1PEZA 2Q3AA 3LY6A 2YD9A 1HHJA 1D7FA 5KSBE 1HXYA 3FQTB 1A21A 4QHNA 1UEMA 3QUZB 1A5FH 4D9RE 5A3IC 3LKNA 4XNZB 4JEGB 2XQBL 3G9VA 5DUBB 2EYRA 3H9HA 1UWGL 1WC7B 3SDXE 1YZZA 2VLJD 1RK1A 3AC0A 2GSIB 2JJSC 5GGRY 1CFVL 4R4ND 1YN6A 4NNPH 3NAAL 5KVGH 4QNPE 1NMAL 3QG6B 4K3JL 1NEZG 2GTZA 4GAYB 2DQFB 4KI5E 5FM4A 5LWYH 1E6OH 3AUVA 1C5DA 5KSAA 3QXDB 4QY8B 2F8XC 4I0PB 4R8WH 3Q0HA 3HC4L 5JTWA 4R0LA 2VLLB 3ILQC 5CHNA 1P69B 4HS8L 3QPQC 4JDVB 2DL9A 3GB7A 1YEDA 5I1JH 5CKAA 5F1IB 5BZDA 1IGFL 5DJZA 4OLXL 5D5ME 2W38A 2X6MA 3HNVH 4XXDB 4K2UH 2YKLH 3FO9A 4ZPTA 4ONGL 4H88L 1MJUL 2J8UA 1A2YB 3ESVF 2MKLC 4Y16A 4C59B 1LP9F 1UXSA 3QBTB 3IKCA 5EIIA 4X7SH 3DV6A 1DBKH 4XNXH 5EWIL 4FMKA 4XXCC 1YMHB 1KPRA 1PX4A 1HK6A 3QFJE 5A2IH 4OGAD 3QZWG 5HHQB 1OHQA 3I84A 3FQXA 2R0KL 3RWDA 1N0XL 5D5MF 4YHYB 1T20A 3NGBB 1RZFL 1KPVB 3MLYH 4M8VA 1YDPA 3BPNB 1KPRB 2AK1H 4UAOB 3DECA 3U6RB 4OD3L 1OW0C 1ZSDA 3DO3A 4GFTB 1G7IB 3GMQA 2DQEH 5HYSB 4X7EC 1A9BA 1ZA6A 3QEUB 4G8GA 3UJIH 1AXTH 5E6ZA 2F19H 4HWBL 2R2HB 1NCWH 2EDQA 4P4KD 3ARPA 1XIWC 4GW4A 43CAB 4EUPH 1DL7L 2ZG1A 2YRLA 4LVOC 5DJZB 3GMRA 2MMXA 5E2TL 3KYOA 1KC5L 3OKKB 2CMRH 4JFFB 2NYYC 2DS4A 1OAKL 4PTUB 5ALBL 3NPZB 2UWEB 2AAVA 2R4RL 1LO4L 1RUAH 1T7WA 2AK1L 3ALWA 1NBZB 5DMIH 3VH8B 1CD1B 2KQMA 3DMMD 4DZ8A 4PTTA 3VA2C 2X1PA 3QNXA 3E6FA 3U1SH 3IDUA 4I77L 4DVRL 4BSJA 3ULVF 1HSBA 5DJ6B 2W59A 2YC1A 1J1OL 3DGGB 4YNYA 1OM3L 3RDTD 4NDMA 2YXFA 3C6LB 1NGXA 1OTUC 1IAII 4HFWB 4NOFA 4MXWH 4CAGA 4U0RB 1UCBH 2OTUA 3BGMB 2HG5A 5INCA 4M7LT 4EI5B 4PJDE 2AJ3B 1HHJB 4BZ2L 4G6KH 3KAAA 5DD1L 1MCOH 3QRGH 2K7QA 5ESAB 4RAVA 3VFPA 4TQEH 3PQYA 3I75A 4HLZG 5D7KD 2D9QB 3GSNA 4RFEB 2FDBP 2IGFH 3JSSA 4XP1L 1RIUL 3RX5A 1MCHA 5DUBA 4F37K 4JR9L 2ZKHL 1QSED 1TLKA 2ICEB 5JO5B 4F7MB 4YQXH 1OPGL 1A9EB 5C0CD 2X89A 3HFMH 3I9GL 3QQ9D 5K33A 3M8OH 1L9NA 4U1LA 4ZPVA 4IOFD 2RGSA 1HOCA 2CXKA 4HWZB 4TNWF 5T3XD 4AH2B 2CIKA 4G7YL 4PV9B 3X3GL 1B90A 3QXDA 4X8JB 4PJFB 2FECI 4ODWB 3NZHH 4JPKL 4ZO7A 1KCVH 2WBWB 2QR0A 3C8HA 2X4TA 5IT2H 5DC4B 4APQB 4RQQA 1IM9A 3P73A 4LCCB 1EFXD 3L3KA 5I8CB 4X9BA 4OCWL 4YH6A 2A9MH 5GS2H 1GGCH 1A2YA 5IMKB 2C1PA 2BVEA 2A6IA 2YRPA 1I8IB 3BW9B 2ICWI 5EU6D 3PHOA 2B2XL 3CCHB 4HIIB 4LIQH 1OD9A 3SJVD 3CXDL 2C1PB 4NQED 5GS0H 5D7LD 3VWJD 3ZZ1A 1NFDB 1QBLL 1RK0A 4LASH 5EUKA 4RWYL 4QY8A 4KV5E 3QQ4B 1OP5H 1OT2A 4HAFA 1KLFA 2LTQB 3BE1H 3DVNA 1II4E 1JPGA 4OZGE 4HPYH 3BKYL 4N0FB 1S7SB 4FZEL 1FBIL 1AC0A 4JO4L 2P5EE 3VXUE 4KDTC 1EJ6A 4HWZA 4LDLB 2FD6L 1TJHL 2VDQL 2VQ1B 4Y2DB 1U8HA 4Q97A 4UMGA 2APVA 3KPRD 4P2RD 4U6VL 4XC3L 3WFZA 1A5FL 2WWMD 5CILL 3HZKB 1O7VA 4FQ2H 1OB1B 3QDJE 4UINL 1H8OA 3T65A 4QRPD 3E6HA 1LEIB 3THML 4YUEH 1WIUA 2HT3D 2DQGH 2I26N 3VFRA 3KPNA 5I1KH 1J88A 2V2WA 1JK8B 1NMBL 2X4OA 3MLSL 1YEKL 2OZ4L 4DGVL 3M1BA 4I0CC 4QXGH 2VL5A 3UTSD 1JE6A 3ARYA 1B0RB 3QDGB 3EW3B 1NGZA 2Z8RA 1FVDB 3VMPA 1HDMA 5HD8D 2K9UA 2Y5EA 5C3LD 3MLPA 3JVGC 4DCQB 1GGIH 2AI0H 4OBRA 1Q9OA 4PGBB 3IFNH 4Y5VB 4YAQB 4OAWA 3T0ED 2XT1B 1KFAL 1CF8H 4JG1L 2AJ3A 4H20H 3HNVL 3SE3C 4M9OA 3RWFA 3MCLL 3QEGH 4K2UL 4LVHB 1RZ8A 3FN9A 1QLEH 2SEBB 2XZAL 5I66B 1DLHA 3WHE1 3SKUD 3WD5H 1VERA 2DQGL 3VE0B 4KKAD 5IM7A 1D9KD 5EOQH 3F58H 3AREC 1T04A 1NMBH 3B2VH 1LGVA 1TZGH 3S36X 3N1MC 1PG7W 5T1KA 4FNLL 3KPPA 1SVZA 4QGTA 1RU9H 4RGOH 1FDLL 4DEPB 5E0QA 4BFEA 5FA3B 4R0LB 1C8PA 2JJTA 2NW3B 4H0HB 1YYLH 3ROLB 2DQDL 3DIFB 1YEJH 4PJGE 5KG9A 2AGJH 3WEXB 1LK3H 5D1QC 4D0CB 4YHLH 2HT4C 2I25N 5HHPA 1BQHG 2VLKE 5TQ2H 3DXAD 3GMQB 3WO3B 1X3DA 4DJMA 5IJKA 4ZAKC 2DJUA 1T89A 3WKMH 4NNXA 2XKNA 1X4ZA 2HRPH 5C0GB 3CFDB 3QP3A 4WW2C 1N5AB 5ISZA 1ZWIB 2CQVA 4X7CC 2NY1C 3HE6D 3UAJD 1SJXA 5BS0E 2BOCA 1FIGH 4PBXA 3V95A 4L4TD 1QSVA 4OF5A 4P2CG 1IEHA 3OG4B 2A73B 4CL7A 3O0RL 1CFTB 1A0QL 3BO8A 3MRLB 4Z7QF 1N59A 1Q9KA 4H5SA 1QHOA 5E00B 1J9CT 5JUEH 4A6YL 1TPXC 2J4WL 1F3DJ 3DXAE 1M05A 1N8ZB 4GW1A 3JTSB 4OUUA 4YX2L 1CE6A 5LGHL 2Z93A 4WNQA 4HUXA 2YZ8A 2I60L 1P84J 4OCSH 4U1KB 1EH9A 4KKBD 2EKSA 1DVFD 3JXAA 4ZTOH 2OTWA 1J0HA 2PYED 2CKBB 1UWEH 5IK3A 4HKXB 1AQDA 3V5DA 2C3VA 3K8KA 2JJVA 3KPSD 4I0PA 4LQ1A 4BM7A 4UOW1 3GMLA 2OR9H 3SCMB 3QULA 3KLDA 2PXYD 4ZYKB 5LGJB 3RIFK 4EXKA 4M03A 1RMFH 4UIKH 2WWKO 3C6LC 3FQWA 2R2EB 3NIGE 1C5DB 3QAZC 5KSAB 1UGNA 2ED8A 1X5IA 2GHWB 1TQBC 2W60A 4ZFOB 5B8CB 3UTTD 1F3JA 4KQ3H 4PJIA 4QOKD 5MERA 2X2YA 1J8HD 5FAAA 4YHNB 4OLVH 2NY6D 2YD4A 3RUGB 3GIZL 4HBCL 3KPSE 4ZS7H 4XHJC 2YUWA 2Z8VC 3LV3A 1S78D 3JTTA 1KCUL 1JZ8A 4KRLB 4ORGA 3QUXB 1IT9H 4M7JH 3BZFB 4GUPB 4DZBB 4UQ2A 2IFGA 4OKVA 3T09A 5TE6L 4OB5H 4PJXF 4JM2D 3TBYA 2F5BL 2P46B 3NPSB 2E9BA 2HVKB 3IDMB 4CDGC 4L8SB 3G04A 3MLXH 1MCPL 4F57L 4KQ3L 3REWB 2XY2A 1ZHLA 2Y6SD 4QRQA 3T2NH 4XAKD 3LQAL 4NNYA 1W72A 4H8WH 3BZ4A 5E8DH 3EO1B 5J6GB 1JZ7A 3GBML 3PWNB 3BJ91 3NIFE 4U1JA 1KTRL 2BY3A 4OLZH 4HD9A 4HT1H 3OB0H 4AH2A 3QQ3A 4Z7NF 5SX5H 5D2NA 4LASL 3CPLB 4OM1H 2XN9E 4ZFOA 5B8CA 4HKZA 2MHAA 1IT9L 2DMCA 3BPLC 3FZUC 1XF2A 2B7DT 3EFDL 1R3LA 3SOBH 5E6ID 3HI6L 2ARJB 3ARWA 4XHQA 4OGZA 4ZYKA 4UI2A 4HPYL 5F70A 1WWAX 4CW1B 5EO9A 3BD3A 5FFLA 5I1GH 4KMLB 3DSNA 4TVPL 4PB9L 4CN4A 1EGJA 1R6VA 1CGSL 3MGTB 2Z9TA 1IKNA 2QSVA 4TTDC 1RQ5A 3ARDA 5EPMB 5H94A 3T4YB 2RAMA 2A77L 4JANB 3U30B 3CMGA 3AM8A 4EI5A 3AU1A 2PTUA 1A7PL 3KXFE 4QRRB 1MF2L 4GKZB 4Q9CA 5KVDL 4V1DA 4QCIB 4GS7B 4G8IA 2BVTA 3UJTL 1FNLA 3QUYD 1Q9KB 2C1OB 5H35B 3TA3A 4U1GC 1JRHL 1NCDL 1GC1C 4GSDL 4X80L 5JW5A 2Y7QA 1J1PH 2YPVL 4UT9L 3A0OA 4AK1A 1TMCB 1JZ2A 3ZKNC 5HYSG 5CZXC 1T2QH 4JRXD 3RZCB 2OI9C 1JFQH 5BQ7B 2IQ9H 1JNNH 3VCLA 3MRFB 2ATPB 1YY8B 4FQLH 1DE4A 3INUH 4WDIA 4BH8A 3NABH 5C0CB 4FQCL 5B39B 1PLGL 4HIEB 5EOQL 2JKXA 3D25A 2XA8H 3P0YH 2PYFB 2PETA 5EIQA 5DVLA 3WE6B 4HWEH 1X5LA 2UWEF 3ARFB 1JRHH 1N3NA 2YPLA 4NZTL 5LQBH 2D3VA 4R2GB 1OTTC 4Y4HD 1KEGH 5DD5H 1QUNA 3WXVL 1FN4A 4JFFD 1H3WM 1TZHA 3BUYB 3CDGB 3RA7L 5AWNH 5IOPA 3UTPE 3FB7B 1WFUA 3I6KA 5D5MA 1P53A 2EIZA 1IVLA 5C0AD 1E6JH 5JZ7C 1SM3L 3QUYC 4WUUE 1CDBA 2QSCL 2FX8L 4LF3B 5A3ID 1DLHB 1JV5A 1S7TB 3TT1L 1A7RL 1JPTL 1BD2D 4JG0H 1Q0XL 1D5BB 4MJ6B 3QIBA 4XZUB 3TT3H 4MNQA 3TV3L 4IIQB 4S11A 4X6CA 1JNLH 1CYGA 1G7HB 1G7PA 3U4EA 1ORQB 3R06B 4XP5H 1LNUA 1JGVL 1OTSC 6FABL 1NBVH 2QKIB 2XXMB 3O4OB 1H5BA 2YD6A 2CJUL 3BEWA 3HC3L 3DUSB 4LDOB 3L3GB 1EERB 1WEJH 2Q86A 2E7CA 2ZUXA 5A40E 1UACL 4C54A 5KSVB 4G8FA 2MCPL 3QG7H 2P24B 1S78C 2Y1VA 3WFDL 2J8UE 4NWTH 3NCCB 4DOHE 4QHMB 1T80A 3W11D 4NQCA 1NC2D 3QUXD 4PJ8A 4X8XA 1N0LA 5DA0B 3EYFB 4HMDA 3U9PL 4JFXB 4PJ7F 3REVA 1RJZB 4YBLB 2ARJA 1QFUH 3SDAD 3FOMA 4LKCA 5B39A 4E5XA 1IAKA 1NL0L 5T5NG 4MNGA 1PGRB 2NY2D 4JREB 3WFEL 2RFXB 1MIMH 4XBGB 4JDZB 4LMQE 2QSTA 5I74B 3SY0B 3NMEA 1GZQA 4NQVB 3BVNB 3B8YA 5FB8B 3WMSA 1F97A 3NCMA 3MYZA 2VXUL 3KLHC 3O4LA 4WIQA 3ZKQD 2OP4L 1QEWB 5SWSD 4F58L 4OT1H 3RAJL 4XNUH 1F13A 4KRPD 1PYWA 4NWTL 4JHWL 2XQYK 4RMVA 5D1XB 3G6DL 1MI5A 4ZUTA 2OQJB 4XI5D 3L3HB 2AV7B 4KK8C 5GSRA 3MXWL 5IVXB 4OKVB 1AC6A 3X13B 5IQ9B 5DJ2A 3MV9A 4YK4C 5KZCD 2YD8A 4K8RD 3QA3B 2EDDA 3VJ6B 2XV6B 5EN2A 2H2PC 2DDQL 4K8RC 2NY4B 3IJSA 3IETB 3NIDF 4G6JL 1IKFH 3CMOL 3MROA 1NKRA 3RRQA 4K3GA 1OQXA 2NY5L 3BD4A 5D71L 5HYJA 4WI9A 4M6ML 5EZJB 1H5BB 5DO2C 5J56B 4WWKD 1AR1D 2XKUA 2O5XL 4X99A 5CIPB 2VABA 1H3PL 2G60L 3V52L 5L2KA 2W60B 1KCSH 2FZ3B 1RHFA 2BVPA 2EKJA 4Z7WB 2V5SA 2I07B 4LRNH 2JK5A 4FRWA 4NHUB 4R26L 1G6RL 3VXTA 3CFEB 5ALCL 4ZFZA 4QT5B 4OZIA 1ONQA 2QQKH 4R97C 2JJWA 3PHQB 2H8PA 2HJLB 4XVJL 2VAJA 3QXVA 3MLRL 3NFNA 4F9LC 5GRWA 5KVEL 4WI2A 5GHWH 3Q1SH 2MJWA 1PZ5B 2EYTB 5FIEA 1GC1L 2ZWLT 3EFDH 4PRHA 1WCBA 5DJ8B 3OAUH 1JGUL 3EJYD 1PVHA 3IDNA 3FHAA 1A7QH 1TETL 3VWJB 5E4EB 3G5VB 1H3PH 1P1ZB 3V52H 1M05B 3ILQD 3TBTB 2X09A 3HMWL 3NIDE 1CGSH 1I3VA 4WY7L 4Y16D 5E8PB 3UC0L 5B3JE 4LFHG 5E5MA 1EUUA 1CR9L 1R3JA 4HS3A 1N2RA 2X4RA 3H9YA 4X7SL 2H9GB 4NQUA 3C6SB 1NDGB 3MMEB 4DFHA 3TN0A 4WU5A 4JFEB 1ZA3B 3L5XL 4PYHA 2FSEA 4NQSB 4BQ8A 1F00I 3ZHDA 1R3HB 1H3GA 3WS6A 2PO6A 1P4BH 5HHOD 1O5DT 4XI5C 3P0GB 5E5RB 4N8CH 4OZGA 1MLBB 1AO7A 3UEZA 2PW1A 1MCCA 2X1XR 4TNVK 2V5MA 1B4JH 1JFQL 2F19L 1BX2B 1DANU 3EBAA 3FQWB 1J0IA 4HIXH 4N1CA 4BSVB 5GGUA 4F15C 5T3XE 5LGJA 2P8PB 3LKPA 4XC1H 4YHOL 5KVMC 2OL3H 2X41A 4L3EB 1KTLA 4H0IA 2VTFA 3O9WD 4OFYA 4JFQA 5DJXA 2NLJA 1P7QD 2J8UF 3N9GL 2IMNA 4FQJH 4F80A 5IM7B 5EU5A 3LB6D 3KR3H 4PY8J 3DMMA 5DMIL 2NYYD 3EFFA 1QZ1A 1T20B 4QRTB 4OZHA 4P9HH 2V2TA 4YDVB 4ZOEA 1OW0A 4WU5B 3RDTA 4W68A 2F9BT 5JXEA 1UJ3C 4I18C 3UTSA 4D3CH 1CGXA 3TO4B 3HCVB 5T5NF 3HUJE 4TSCL 1KIPB 2DWEB 1UA6H 2R9HC 4POZC 4IJ3B 4P46A 3B8SA 3CH1A 1F4AA 3C87A 1HNFA 3B2UC 5DSCA 1BBDH 4X6DE 3ARUA 2FJGB 3WHXB 3PIQA 1MNUL 2DQHH 4YR6B 5JHDD 1J12A 1G9NH 4CVWA 3G5ZB 3K81A 1RAMA 1U93A 3MX0A 3WUWA 4XBPA 5HPOA 3NGBC 5DUML 2PYFA 2WIIA 4P9HL 3S34H 3HLAA 4NZUH 1UYWL 3MV8D 2HLFC 1YEFL 1U8MA 1NQBA 3SDAB 4YHPB 1D5XB 1I7RA 5GGTA 4K7PL 4OCXH 3NFNB 1RZ7H 4GRMB 4IDJH 4UBDD 4QRPE 4XMKH 4WJ5A 3F62A 4M61A 2BX5A 4WWKC 1F45A 4YGVB 1AI1H 3KPSB 3MLVH 1BBDL 4BFIB 4QXWA 1PZUB 2X4PA 1AJ7L 2YUVA 1GGUA 1KCKA 1YJDC 2VE6A 4W70A 4NUGL 3RPKA 5IIEB 1G6RB 4U1NA 5I66A 1TXKA 1CGVA 3UBXB 4EZMA 5IT2L 4HXBL 4JFPB 5ICZB 4LDEB 4TVSa 5DR5H 5H37G 5GZND 1EFXA 3BQUD 2CD0A 4L4TE 1X7QB 3IAQA 3LRSB 3MZTA 3QQ3B 3GO1L 3U0TB 3QNYA 5I30L 1OGAE 4AZ8A 5GS1B 3VXRB 5LG1A 4GBXA 3I6GB 3PWLB 3L7EB 5C8JA 1FNSH 3PDDA 1W0WB 3IFLL 2BY0A 5ID1A 2CO7B 3CXDH 2K7PA 3VWKD 3O3AB 3P73B 4LCCA 2FL5A 4P5TA 3NN8A 5C3TA 3FT2A 4LHUD 3LKOA 1LMKA 3W9EA 2R0ZH 1PG7X 3OJMB 5CSZB 4ODWA 4X4YA 1I9JH 3B9VA 1RPQA 4PPTA 3OXSA 4K3JH 4GXVL 4X8JA 1T66C 1L7IH 5C0AE 3L5IA 3ARGA 3JWDC 4MVBD 2BHUA 4GRMA 2XACC 1KJ3H 1KPUA 1SHMA 3BVNA 3DXAB 4KHXH 4R4BA 2H41A 1NC4D 1TNNA 4OV5B 2FJFB 1FYTB 4HS8H 3BHBB 4M7LH 3FTGA 4X6EA 4HCRA 2ENYA 3H7BA 3K1KC 3BN9C 1SEQL 4P99A 5HYFA 1U8QB 2BJMH 4NBZB 1GYAA 1RZGA 5DUPL 2H2SC 4O51B 2PXYA 4XAWL 3P4OB 2HFTA 2W0FB 4PRPB 3MC0A 3NPSC 4NC1E 4DK6A 1KN2H 2JELH 3KPMA 4G6AC 4B7LA 2W9DL 1S8DB 3M07A 1FNHA 5ALCH 1JZ4A 5ELIA 1W8NA 1E4KA 3O3AA 5IR1A 2ZPKH 4OLWL 5K9OB 4N9OB 3T1FA 1UEYA 1L7IL 4OJFL 2HG5B 1X4YA 2OL3A 2VIRA 3DUSA 2WP3O 4OZFG 1MREL 3VXSE 3VXNB 1CICC 2NX5D 4HBQA 3L3OB 5IK3B 2P24A 3BDYH 4NIKB 1IGFH 3IGAA 2V7HB 1AFVH 3ZDZF 1FG2B 4PJHE 2XQBH 2QKIA 3SEPA 3UJJL 3VWKB 4EDXA 3IAGC 3PQYE 2DQEL 1CD1A 4YHZH 3RJQB 1I1FB 4N0RA 5DK2B 4Q9RH 3TIDA 4PUBH 4NNPL 2JIXB 5EWIH 3SDCC 5I71B 1JL8A 2EDEA 3JV5A 1ND0B 2QQLL 4HUMB 3D6GA 3BWAA 2VLJE 3GMMB 5B39G 1RHHA 2EECA 3H3BC 2R0KH 3BRFA 5JLZA 3STLA 1CZ8L 1IC7H 1I4FA 4PJHF 1FVDA 3MOBL 4GJTB 3DROB 3RU8H 5DJYA 3DI3B 1OD7A 4NFBA 4G9DA 2FJHA 2V7NB 2W0PA 3F7YA 1FZMA 4GMTH 1F58H 1JNHA 3OG6B 4G8EA 2MCG1 5SWQB 1SVCP 4NZDA 1I9EA 4BZ1L 1IQWH 4NO3B 3BO8B 3MRLA 3CFBB 3TA3C 1G7MA 1JZ5A 5IB4A 4C56B 1D5MA 4PJIE 1TPXB 3FB6B 2Q1EA 4QXUH 4RNRA 5EC2B 1NMCB 1S7RA 3O2WL 3CSGA 1RULL 5HDLA 3DSFL 3IJHB 5F1NB 4JFEA 1A64A 2QQLH 5D6CB 5I8KL 4PJBB 1JNJA 2F8VA 5DURB 3K46A 1A6ZB 5BVPL 2AJXH 2GUOA 3TYFB 1OP9A 1C08A 4AENA 4EOWH 1I3GL 3D18A 3MREA 1JPGB 3IB4A 3VGBA 1QBAA 2IG2L 4DVBB 2J4WH 2IGFL 3FFCD 1NCBL 4KRNA 4HC1A 4YBLC 3SDCD 4NDMB 4JJ5B 1AY1L 2YC1B 3DGGA 1A4KA 1HZHH 4JLRA 1X5GA 3IFOA 4YNYB 4OGYH 5DK0B 1AP2B 5TH2A 2GTWB 3GK8L 1DVFA 4KGLA 5FCUL 4U6XB 2BC4B 3EO9L 2HTLC 1QACA 3CK0L 2P47B 4JAMB 1CICD 4DTGL 4MS8D 5C0BE 1HEZB 1UKTA 2V17L 4L4VB 3VXTB 1I9IH 1MLCB 2D7TL 3FB5A 5DTFA 1BF8A 5KJRH 1UG9A 2M8XA 1GPOH 2E8ZA 1ZT1A 2X4SB 4UIMB 1E27B 4HJGB 3P9MB 3U1SL 3VE0A 1UZ8A 2VAAA 3F5WB 5AEAA 3S36L 1YPZB 4K3EH 3DBXA 4KI1A 4RISL 5FKPA 5IROA 1ZSDB 2EEBA 3P40A 1ZT7A 3B3IA 4KY1L 3A6CL 5FECB 1A3RH 2ZUQB 2DLHA 2P1YA 1A6UL 1CXLA 3GNMH 5DMGD 3AY4A 4KVNH 4EBQL 3TCLA 3JWOC 4NRXA 4PJ8C 1QRNB 5I17B 5IMMB 1J1XL 4OCYH 4JE4B 5IB2B 1AQKH 4BFBD 2VSCA 1B2WH 3LD8C 3QIUB 4LGRB 4RCAA 1VPOH 4Z7OF 5E7BA 3ULVE 3HE6B 2D7PA 3G6AA 1RI8A 4U31A 5C0IB 3O3DA 2A6KA 3PWPA 1MCPH 4N0UA 1ZHBB 2R39A 2EDLA 1J8KA 4DKFH 5GGTL 5DGRA 4YHNA 2CIIB 4IMKC 3EAKA 5IKCA 4R7DB 2X05A 4LSQL 2P7TA 4UINH 1EEQA 5C0EB 3NCJL 2VOTA 2ZUWA 3CZJA 2HT4D 1MCEA 5FYKU 3V0WH 2F54D 1DBJL 4UT7H 1OAUL 2GSIA 2BVYA 4J1UB 1RK0B 3NZHL 4JPKH 3QUMH 3TBSB 4JFYB 5HHXL 4AJ0A 3GDBA 5C0ND 1H8SA 1FBIH 4WFHE 5KBNC 2GYSA 2EDBA 4Y19E 3QDME 5E99H 5HGAA 1AQDB 3IU3B 5I8OL 5DMGC 4DQOH 5ICXB 1AR2A 1DUYA 3QPXH 3WS3A 3QCUL 1AE6L 5IQ7L 1NFKA 4AM0B 2BJML 4PGCB 5CMAB 3BH9B 1FHGA 3KPQA 2NNAA 1OY3B 5DEFB 4KAQH 3V7MA 1ITBB 4Y1AE 1UM5H 2WLZA 4NQDA 2DBJA 3VFVA 2FBOJ 3UJTH 4X4ME 3C8KA 1DQML 5EU3B 1I8LA 4F3FB 3H0TB 5JPNB 1PKQB 1FLTX 4ZPVB 3ZKXC 4LLDA 3DI2B 3W0WA 5TDOB 4KUCD 3U4BL 3PP3H 3HA0A 1U8OB 4KC3B 3IF1A 4OZHF 4B41A 3VXSA 4E42B 1U58A 2WLYA 2BFVH 4HUUB 1JWUB 4JG1H 4NC0B 2CLRA 2F58H 5F88A 4H20L 3RY5A 4BQBA 5ITBH 4JPVL 4M1DL 3SE9H 3HE7B 5JXAH 1FFOB 1WWCA 3RBGA 4Z95H 2XZAH 1S5HA 1KB5A 3LIZL 4OCMC 5K9KB 2E8YA 3NABL 1MCQA 2R56L 4QOKB 3UP1A 1C16B 1C12A 4D8PB 3QZWB 3MRQB 3LEVH 5IBLD 1ZT4B 3L7FB 4P2QE 5INCB 3BUTA 4PLJC 3MRGA 2H1PL 4K7FA 3GBNH 4LLVA 3I02B 3AFLA 1QQDB 3OMZA 2NW3A 3NCYS 1U8PA 5BMFL 3EYQD 2OR8A 4JFFA 3HRZB 1IC7L 1LO3H 4GRWE 3W0WE 4L1DA 1FFPA 4Y4KC 2NTFB 3IFOB 3OHXB 5IB5B 1LK3L 1F02I 3DIFA 4WTZG 2WM0A 2G9HB 4UILL 4GRLB 3ZDXF 4OGXH 4MWFA 1I7ZA 1UM4H 5D1XC 4PRHD 2R69H 1YJDH 4OQTH 5AG8A 5T1KB 1QRNE 3U0WH 3OV6A 1U8JB 4BKLA 1BD2A 1T4KA 1AXIB 5D1XD 3VFUA 1I7ZB 5JZ7D 5MENE 1VFAB 3HMXL 4LLWA 4ZAKD 4HUKB 1NBZA 5J57B 3GEWB 2D0HA 3B4NA 1OLLA 4EDWL 2EIZB 2VITA 4FNLH 1OAQL 3LPFA 5AUMA 1ZT4A 3ARSA 3PL6C 4ZXBC 1EZVY 2VZOA 4NM4L 4OAWB 5TQ0H 3D5OF 4JM4L 3T4YA 5F7NC 1KXQE 1IE5A 4D8PA 1INQB 1QQDA 2IFFL 2D03H 1EGJL 3DO7A 1WBXB 2YPKB 4NQTA 3QWOB 4Y4FB 5HHOE 1M6OA 1FAIL 4HKJA 5D9SA 4OGXL 5EO9B 5L0QC 2CLRB 3QH3B 4P5KA 1PAMA 5T1LA 4FFYL 35C8L 1G7MB 1KJ2A 4U2YA 5AYQA 4CVXB 3CIQA 5T33H 1DBML 5EA0L 5I1IL 4Q74A 1NJ9B 4WRLA 1MH5A 3BT2H 1X5XA 3P0VH 3RI5K 1LDPH 3G5XA 4G9FA 2VLKD 1HI6B 3IU3A 3EHBD 1Z6JT 2HJKA 2ZOKA 4EVNB 4DTGH 2OS7A 3O45B 1Z5LB 5KTEL 3N1GC 4O5LH 3EJJX 3JV4B 3VXQA 4GQ9L 4OKDA 3UYPA 5HHMD 2IAMD 3IRZA 1T03H 1EUTA 1ZAGA 2ED7A 3DVFA 2VDLL 5DZOA 5C0BB 1QLFA 1U8IA 4AM0A 2A0LC 2Z92B 4ZAKB 4JM2B 4HK3N 1QLRA 2DTMH 1I1FA 3B9EA 3L3OA 2BNQD 3MV9D 1DSFH 3VRIA 3VXNA 2FEDC 4PJFE 4HF5H 3AVEA 2DQFA 3UPAA 3GBMH 5H37H 1FNGA 3IGAB 4O2CB 2CGRL 4BZ2H 2E6QA 3L3KB 1NBYA 4RFNB 3BKMH 12E8L 5ID0B 2DAVA 4CMMB 4G80B 1M71A 1YY9D 2VLME 1I8IA 1VEOA 1MCDA 1QFHA 4GG6F 4CW1A 4QRUA 1G7JB 1N4XL 5FGCB 3S96B 3UO1L 3D39D 2Y9RT 4FXKA 3WLBB 2YD5A 1KG0B 1KB5B 1UVQA 3LB6C 3MV9E 4BK5A 2B1HL 5DEGA 1YEEL 2ADIA 3O2DL 4DKEH 1HH9B 2MPAH 4OD2A 5JIIA 4R26H 1DSFL 2P8LA 2HFFA 4R7DA 4HG4J 3PWPE 4N0UE 1A9EA 1L7TL 1B0GB 4JDTL 3NCJH 5GRJL 1W72B 3QSKB 3U4AA 1IGJB 3X14B 4GXUN 2OK0H 3VGGA 2APFA 3SOBL 2F74B 4OGAC 3EUUA 5IB1B 4M7KL 3MO1B 4FTVB 4OCNC 3L95B 1RJYB 2NR6C 2ZJSH 2P5ED 3QUKA 4WW2F 4JKLA 2FEEL 4XPTH 3TNNA 1RZKH 3ZKMD 3QIBD 3WSQH 1KUMA 4PJXA 4F57H 4HS6A 2UWEE 1TFHA 2BC4A 1DUYB 2O26U 2ILLA 1MFCH 3GSOB 5DJCA 3JWNC 4Q0XL 5CP3A 5DK3A 5D93C 4KTDL 5EC1A 2DIJA 5E2WL 3DVGA 5IIEA 4JPIA 4YUEL 2EZ0D 4L4VA 5JHDE 2W92A 3BIBX 4TSAH 2FX7H 2XA8L 4Y89A 5CEZL 5DEGB 2NY1B 3TJEH 2OZ4H 2J3SA 5E8NB 1MHHB 4DN3L 5IB5A 2Q8AH 3WHE0 1XF3B 4PJEF 2XQYG 1JWSA 1H3XA 4I18B 2ZJSL 1K2DB 3RWJB 4CNIA 4HIJA 5D7IF 2NY2B 4TVPH 1K5NA 3U4BH 4PY7B 3PDOA 1I9RL 4WCYL 1U95B 4EVNA 2KZ1B 1GAFL 4Q0XH 3QEUA 5C2BH 1T1WA 1CK0L 2DLFL 4Q6IB 1G0XA 2FO4A 3FQUB 1NGPH 4P57B 1V8HA 1EO5A 5C0RH 2HKFH 4KKLC 4KJPC 5AZEL 4WUKH 2JIXD 1R5WB 3V5HA 5DD3H 5I73B 4NPYA 4TSAL 3W11C 3QIUA 5IHUH 5D6CA 3UTPD 2YN3A 4WHCA 4C56E 5FUCC 4HUVB 4AEFA 5MEQA 4HKJB 5D9SB 3OKMB 1BIHA 1JGVH 1CFTA 1JHTA 3GRWH 5J6HA 4RSVA 1J1PL 1AKJD 3BOVA 3BWAB 3WLWC 4JN2A 5GRVL 1U8OA 5AUMB 5SV3A 1ZLSL 1U91A 1HDMB 5TDOA 5DWUL 3KDMA 1LO2H 4PJHA 1BLNA 1N5AA 2V7NA 4KI5D 2D0GA 4X9FA 1EEYB 3GJFA 5E2VH 4DW2H 4YDJB 1MFAH 1QSFB 2VWEC 4NJ9H 3VFUB 2X1WL 1V7NH 3VXOA 3MLWH 4W4NA 1EEZA 2RCSL 2FGWH 1FJ1B 1T22B 4EKXA 1D5IH 2GI7A 1MI5E 4EDWH 3MR9A 2AXFB 3BAEL 4Y5YC 1XF5B 2DM2A 1X4XA 3D85A 3RVXD 3ZYIA 3C5SB 4G5ZL 4UNUA 4HW6A 4K7PY 1FVCA 4MD4B 4GRLC 4FG6D 3QEQD 1QKZL 1I8MB 2Y5TA 2J88H 4GAGL 3QO1A 4NM4H 4NN6C 1UYWH 4FQ1L 2XI9A 4Y1AD 2E6PA 1INQA 4AL8L 4OD2B 4OT1L 3T1FB 4S2SB 3DHJA 3MJ8B 4U4BA 5SX4I 1YUHB 1M4KA 5JXEC 5F21B 1EHLL 4ODHH 2VJXA 1U3HD 4XNQB 3UMTA 1F8TL 2ESVA 4APQC 2VZSA 1U3HC 2JB5H 1MFAL 2ZSVB 3I3BA 4KDVA 2Y23A 1T83C 3QUMB 5I15H 3BZDA 3RGVB 3U46A 2HP4A 1K4DB 2VR9A 1FVEB 1GRWA 3H7BB 4K94H 5HHOB 3PWPB 4N0UB 3UTZA 3UX9B 2CDEA 4NQEB 1NGWB 1FL3A 2D0FA 2Q76B 4OQ1A 1CXFA 2Q20A 3ULUH 4LSRH 3C5ZB 3D9AH 3O41A 1IJ9A 1WJ3A 2AXGB 5T3XL 5TF1L 3G6DH 5JUEL 3WIHL 3MODH 4GAJH 4K9EL 3O8XD 1A6TB 3TP4A 2YS4A 3VXMD 3NTCL 1DDHB 5EOCJ 4Y7MA 4WEBL 5J1AB 5I1DB 4RMSA 4O51A 3TBTA 4LEXH 5KS9B 4K8RL 2R15A 3MRKB 4XPFL 3CFIC 1IGML 5E1AA 3DURB 4JHAH 4MQSB 1WLHA 1NEZA 3PDGA 1LDSA 3QT2A 4GXVH 4D0BB 3O3EB 2HJKB 5DVMA 3ES6A 5HI3D 4G8GE 3MRPB 2P8LB 4JHZA 3BSZH 3I3DA 3P77B 5EZIL 1BBJA 1NC4A 3EYUH 1ZT1B 3T4AA 1A6PA 1G9MH 2VQ1A 4Y2DA 2L0DA 3RVUD 2WV3A 4P23D 4JRYB 4LSRL 1EFQA 1XGPB 1RMFL 1Z3GH 5J3HC 1AGEA 1K6QH 3BKJL 4X7FC 5FYLL 3AY4C 5HD8C 5BJTA 5BOZG 2WIMA 4M93C 3FO2A 3AGVA 5KS9E 1R5IA 2UV3A 2JK5B 3C8KB 4GKOA 3LKOB 2GITA 1C5BL 3O9WA 4OM0H 1JZ3A 4QTIH 5I9QB 3KXFA 3CXHJ 4LNVA 2BK8A 1ETZA 4R7NB 1BEYH 5D7KE 4M02A 4JLRB 5GRJH 2GIYA 2WW8A 2OTUB 3HZMA 2P5EB 2X70B 4HMCA 3GMOA 4P59L 3EOAB 2FWOB 2OLDA 1G9ML 3WIFB 5GZNC 4DUXA 3SGDI 3SPVA 4YGVA 2R1XA 1WFTA 5DK0A 3C5JA 3CVHB 3I6LE 4FFZL 1KNOB 1IM9B 2X4TB 5SWZD 1CLYL 1DCLA 2J8HA 4HCRH 4RA3A 3WKNA 5HVFB 3QIUC 4ZFGH 1J5OH 3ZDXE 1J0YA 5M7QA 1EXUB 3ULUD 2VLJB 1MI5B 1UKSA 2QQKL 4CUCA 4P2QB 3MBXL 2OR7A 1SEBA 1U3JA 2VLKB 4YBQC 4NGHL 4BQ9A 4PJCA 2P8MA 4MYWB 3VXPA 4OM1L 1G0DA 5C0BD 5CBEB 3RWIA 1X5AA 4G6ML 4TRPH 5JORB 5BZWB 2GJ6D 5ITFB 5MP6H 4LIQE 3NFSH 4Z8FL 3AS0A 1UENA 2DQCH 4MJID 3GSRB 2VKXA 4IRZL 1U36A 5I18H 4V2BA 4KROB 5I0DA 4ISVA 3NN8B 4PB9H 2L7JA 3MV7E 5GGSA 1MVUA 3CVIL 4JRXE 4NZRL 3PWLA 4NRXB 1S7WA 4G7VL 3PNWA 4YXHH 15C8H 1J7VR 3ORJA 1CL7H 4HQQL 4CN6A 1QFWH 4TSBH 4JFED 3RNQB 4F7TB 1CDUA 1WSST 3MRMB 4XXCA 1U8NB 2B4CH 1MY5A 4U49A 2FGZA 3DV6B 3EZ8A 3BKCH 1JWMB 3KG5A 3E1F1 4OF6A 1UB6A 5DJ6A 1UXSB 3R06A 2N7AA 2DQCL 2Q6WB 3LN5A 5DHVB 2WANA 1J0ZA 5IMLB 4L3AA 2CK0L 2WBJA 5E9DD 2PTVA 3KS0H 1JWMA 4I3SL 5IVNA 5A2JH 4YBQD 4OZGF 3C6SA 3JWOH 1LEGA 4KMTH 3GKZA 4P3DB 3OKEA 5AWNL 4XB8A 2XZQL 4UTBL 3CDCA 5T1KD 4PGDB 5IB3A 5F1NA 1RZ7L 4IDJL 4UUJB 3UTSE 2VIRB 1R5VA 5E2VL 4MA8H 4DW2L 4F9PA 1N6UA 1IFHH 4CDHA 3C60D 1SY6A 3CZFB 1CD8A 3D3VB 4DGYL 1AP2A 2W9LA 3W9DB 4JVPA 5GSVA 4O58L 1W8OA 4YR6A 3MLTB 3SQBA 5IW1A 3MRCB 2YN5A 2Z31D 4CADA 4LMQI 2FSEB 5E94A 1I3RA 1VACB 5I6XC 1NFIA 1E6JL 5K93A 5JPMA 1FNSL 1JHKL 1MRDH 1HYSC 3PGFL 4RA0C 4PRHE 5C9JB 2R1XB 1XGTB 2NX5A 3TT3L 4M6AA 4PB0H 1NCAH 1S9XA 5LAXA 4X4YB 4I48A 3S88L 2BSSA 1NAKH 5FF6B 1UB6B 4WI6A 5DR5L 4R9HA 4MD0B 5GGVY 4ZOCA 3OX8B 3VG0L 1NBVL 1YEIH 4GG8A 4GLRI 4RDQG 1BFOB 3QWRD 4GBXB 3DROA 4M7LL 4DKFL 2FZ3A 3MRJA 5B38B 2EDTA 2XWBA 3MNZB 4GAYA 1KIRA 3L3JA 3SKMB 4C56D 3HE7C 5CCKL 4LPXA 3JWDH 3UZVB 5E08H 2FYYB 1AGEB 4M62L 2XWTA 3QNZB 3OKNA 1IGTB 1I1YB 1AO7B 1T5WA 1S8DA 3BP4B 3HE7D 5EZJA 3WDIA 5DC9B 3S97C 2YMXH 5IW6B 5AD0B 3TEUA 2ERJC 3L3JB 3SKMA 2ORBH 5FKAA 2X4UB 1CDYA 3D87B 1BMGA 1BGXL 3UYRH 3RGVC 1EHXA 3P11H 3V4PH 2YSSA 3C09C 4I9WE 1OSPL 5K9JL 1HYSD 3E8UL 2V7HA 2BERA 3E3QC 3DWTA 4MDJA 3TWCL 4CRPA 4DQOL 1A1NA 2ESVE 4KDTA 4R90H 4BZYA 5GQBA 4Z0XA 2VXTH 4GRWF 5IBTL 5F3BA 5L2JA 2X1OA 3TJHD 5ESQA 1PEWA 1QP1A 3ZT7A 1MPAH 5J1AA 1OQOA 2A6DA 4KFZC 3MGAA 4LCYB 3HAEH 2HWZL 3O4LB 2DQIH 1A6TA 2NY4C 3HHRB 1F5WA 3TBYB 4L9LC 5FXCH 5MENA 1PZ5A 2EYTA 3SO3B 5B8CC 1DBKL 1BF2A 4LARH 4XNXL 5AAMA 2EH8L 5ADOL 1HQ4A 2VDRL 4ORGB 3PQYD 4KKBC 2HTLD 3VXRA 2BHZA 1ADQH 2Z4QA 2BVQB 3HZVA 3OJVC 2Z8SA 4OFPA 2XG5A 4MCZA 4LSTL 3IU4L 3LOWA 5I75B 4QO1A 5FGRA 2J5LB 2AVGA 4CN1A 5EO0B 5F7MC 1NGYA 4S10A 4UNTA 5ITBL 3EGSB 5JXAL 4WFEE 1T7YA 3SQOH 4ONGH 3S37H 5DUPH 4ETYA 4J4PD 4XRCB 1MJ7L 1MRCL 2E7MA 2VABB 2EIBA 5IJVB 4PLOB 2QADD 2GJ6B 2I24N 3BP4A 1WWWX 4XNQA 1N5YH 5KW9L 5T3ZL 4PJ9C 1Y6MR 2FB4L 3F7PC 5C07B 3RFZC 4X6CE 4BSVA 1JIBA 1FN4B 3K3QA 3EZJB 2PW1B 1IAIL 2WAHA 3C6LD 4FQXA 3FQNB 3RVTC 3FOLA 5KSBA 1OAZL 2JCCB 3NZ8A 4KDWA 1NUDA 4NC1C 1S7QA 3JTSA 2O61A 1G1YA 2HYMA 3MUJA 4ELME 5HPMB 5FUZH 4ZUUA 1FG9C 1T21A 4EI5D 1QNZL 1CFBA 3VRJA 3W5MA 1T22A 1XAUA 2HH0H 1A1OB 1DDHA 3QHFH 4MJ6A 4NKIH 1JV5B 1S7TA 1YJDL 3LQAC 5D1XA 4JKKA 3S7GA 3NCYP 5I16A 1BVLA 3EDDA 1CE1H 4ONHA 3MA7B 4LKXB 4PJ5D 1S7RB 4MA1C 3BWUC 4OIIL 3RZCC 1EBPA 4JM4H 4LVHC 4WWID 3ZLQC 5E94B 1S7VB 1MSPA 4M6NL 3EO0A 4KV5F 2IFFH 4F7EA 3CZFA 5FYLD 3FB6A 4PJ9B 4PP1C 3BMWA 3NZ8B 2WQ8A 1OM3H 3EO0B 2UUDH 4P57A 3FQNA 5D2NE 1FH5L 3CNKA 4R7NA 3I6LD 2A83B 3MXVH 1RUPH 4S1QL 3QIBC 1S7QB 3LRGA 1K8DB 5I8KH 1FLRH 3ARXA 4NN7B 1OTSD 1WVZA 5J1SC 2DN7A 5BV7H 2ZCHL 1K85A 4CGTA 1JWSB 3FMGL 1KCVL 3DX7A 3Q5OA 5SX5K 5FO9B 2DICA 1PX3A 4MJ5A 2DF3A 1F3RB 4QYOA 4AQ1B 1CIDA 3ARDB 5EPMA 5I1EL 5EOCL 5IMLA 4FQHA 3TPKA 3QXUA 1BFVH 5KANI 3R1GH 1EHAA 4YGAB 4MNQD 1INEL 2SEBA 4JFQB 2OXHA 3AU1B 3QHZL 4YO0B 1HQ4B 4YHKH 1ODAA 3TO4D 4MNGE 4XP6L 1JI2A 3S4SG 3T0AA 4WV1C 1D9KA 1WBZA 1HIMH 4XP4H 4UOW0 4LK4A 3E0GA 5EBMB 3EJZD 1XF2B 1D3CA 1KTKE 3OKYA 5JDJA 3AAZB 3I50L 2V17H 1R5IB 4NO0D 4YZFF 1AQKL 1J8HB 1JN6A 1KGCD 1B2WL 2G5RA 4GH7B 4CVUA 3V7AE 3CSPA 4Y0GA 2HVJB 4EI6B 3MV7B 1P4IL 4LP5A 1N4XH 1C1EL 1R5WA 3BKYH 4FZEH 2VDKL 2E7LC 1LEKA 4K7PX 2FO4B 4JQIH 4S0SD 4KKNA 3BZEB 2IALA 3KJ4B 1AIFA 5D2LE 2OSLB 2YSSB 5DD6A 3QEQA 1JZ6A 2UZIL 3FT3B 3PABB 3E3QE 1R3IL 1SBSH 5FHBL 4PJIB 1MAKA 3LEYH 5GS0L 1RJZA 3BPOB 4N9GB 5IG7B 5FM5M 4KAQL 4NUJB 4PJDA 4PJEE 4U2ZA 3QDMD 3V9FA 3GUTA 3DGCR 3I50H 2YMXL 2ORBL 4QHKI 3PGDA 4C58B 3LV3B 3BE1L 3FOMB 2A6DB 5GGQH 3LS4L 3U9UB 5AG9A 4QRUB 4PJIF 2MSPA 2ICES 4ZOAA 3RWEB 3TH4T 1ZGLP 2DIAA 4TUJA 3EOAA 3QAZB 5KSAC 1U0QA 2NY0C 3GM0A 1A3LL 2FEEI 3GMLB 3GO1H 3FN0L 4JGUA 1WCQA 3HUJF 5L9DL 4P3DA 1TDQA 3U2SB 1FZOA 4H8WC 1E4KC 3IFNL 3L3GA 2Q86B 4R90L 4WHYG 2F58L 2QV2A 1KJMA 4JFHE 1J0JA 2GITB 4TUOB 2G2RA 2FEDD 4IBLT 5D6DA 2PYEA 1X7QA 1FGVL 1MRFH 3HB3C 2E7BA 5AD0A 4XHJD 4WI4A 4KJPD 4ZD3L 1YEKH 4JRWA 2GJZA 4O2FB 1RZJH 1DQMH 3OL2A 3UYOD 1I1YA 1BVKB 3X11A 3FRPA 4GOSA 3IVKB 1HI6A 1H3VA 4NO2B 3P4MB 1FDLH 1W2KT 2G5BA 5D7JD 4HXAL 3VRLF 1DEDA 4RMRA 2AEWA 4K71B 5BW7A 1Z9OA 3IU4H 5CZKA 2AGJL 4HC1L 2BDNL 4WU7B 2A83A 5JPMB 3QCUH 3MRCA 2XZZA 1UWGH 1K3IA 3FQRA 4PJ7E 3SQOL 1YNKL 1YEGH 2X44D 2OBGA 3WD5L 4H88H 4P4KA 4E5XB 1P2CA 5ICYB 5DI8A 2B1AH 4MD5A 1R24B 1VGEH 5AZEH 2W9DH 5LBSL 2BSSB 2R29H 2AXJA 3QH3A 5EORL 5IQ9A 2UUDK 3GBNL 4XBPB 3KLHD 2C7UB 1KN4H 1RSFA 2B4CC 1OP3H 2F53E 5CBEA 2CMRL 5JHLL 1NDMA 3STBA 4P2QA 4IIQC 4CNIB 1KF9B 3ZTJH 4J6RL 1RV6X 2Q7YB 1XF3A 4GRLD 2R4RH 1WZ1H 1AFVL 1NLDH 4XVUD 3OTTA 3VW3H 3U46B 3ZKMC 2Y06L 3O4OC 4ZDHB 4HH9B 3SDDB 4LHQB 4P4KC 3K4DA 4NKIL 5CGTA 3UTQB 4AEIL 3RWFB 1QLFB 4G43B 3P3YA 3DRTB 3Q6FB 1T0MA 4Q6IA 2R29L 2Y72A 3UJIL 2ADJA 2J6EA 2FGWL 3QXTA 5H94B 1IEAA 4D0CA 3V0VA 2ZSVA 3GMOB 4MA3B 1R5VB 5CD3B 2H3NA 5C6WH 5F44A 4QRPB 5GJSL 3H3PL 4NQCB 5TQ0L 4KU1A 5DD1H 3W39A 3RVXC 3HAEG 4DAGL 2VZ3A 3QXAB 4NC2B 1BQHA 3FO1B 1BOGB 4ODHL 1ZGLA 3FFCE 1S7WB 2VWEE 4P23B 3C5SA 1NCBH 2XA3A 4Y5VA 3GJFB 4FFYH 4E0RA 4P5MB 4JY4A 5F72S 3VDBA 3H9ZA 3PP4L 5T5FL 5DFVC 2ADGB 4OCSL 3RTQA 4QHUA 1N59B 2Q3ZA 5DF0A 1JGLH 3L3DA 3FT4A 5EOTB 4XGZB 7FABL 2CO6B 1N2RB 1FCGA 2APXA 5ERWB 1V3LA 1S9WA 4MA7L 1OAQH 4PV8A 4LHUB 3RKPA 2ZCHH 2GQHA 4MSWA 1BQLH 3LS5L 3MV9B 1I1RA 3T65B 2DQTL 1GPOL 5T3XH 5TF1H 3QQ4A 3V5HB 4F15B 2PN5A 2ZCKH 4AMKL 1BD2B 1T4KB 3HZKA 4KXZI 2R2BB 3VFRB 4Y5XC 1HZHL 1GGTA 1HHKB 1IC4L 5DDHB 4YBHA 3O6FA 4G8IB 2VDPL 4JDVA 3PP4H 5T5FH 2XKSA 4JB9L 5ITFA 1AO7E 5DEFA 1U42A 3T2NL 1G9MC 1T83A 3ECBA 3SO3C 4KVCL 5HDOA 4L9DA 1F4WL 5L8LB 1KNOA 4G6AD 5KANG 1CGTA 1RZKC 4HT1L 1MELA 3G08A 1RUKH 1QSEE 4MNHB 5JOEA 4JZJA 5IW6A 2VLRA 4IRJD 4M8QB 3V5KA 1CFSA 3BQUC 5EZIH 2R8SL 32C2B 4NQDE 2OK0L 4U3CA 1JJUA 3M45A 4P4RA 3V6OA 2HRLA 3KPRE 1VHPA 1G7JA 4TQEL 1YEHH 1J87A 1TZIB 4XPGL 2F5BH 5J4MA 1ZLUK 3QUZA 1P6FA 4X5XA 3RZWA 2EC9T 5F96H 1NAML 3D0LA 4GMSL 2DTML 4LPCA 5IMKA 3G5XB 4G9FB 4GG8B 4HSQA 3WO4C 1XGQA 3QIUD 3FB8A 5HHME 3RNKB 4FFVC 2LVCA 4PJBE 1WT5C 4WW1A 1FVCB 2JLLA 3FHQA 4NHCH 5TDPA 2EXYD 1GOFA 5SWZB 3T4AB 2R1YA 2XRAL 3P77A 3REWA 3IDXL 4EN3D 1FJ1A 1IQDA 1RUMH 3IETA 1U8IB 4IDLA 3VG9C 4V2CB 1QD0A 1XGYH 4XPGH 1RUQH 2E9IA 2R1YB 3OKLA 5I1GL 5D2NC 3S5LA 1RZKL 1TTUA 4NOBA 4GMSH 1B0GA 1NFDE 3E2HC 3B2UD 3TPUA 2APTA 3QPXL 3IXAB 5DYOA 2B0SL 1MQKH 3RWHA 2FBJL 1CK0H 5EZOH 1MF2H 2BSRB 4L8SC 3ARFA 3ULUC 1CFVH 3THMH 1XH3A 3QUMA 4Y1AA 5GIRA 4P5KB 4HFUL 3CJJA 4NKOB 4ZD3H 5MP6L 8FABA 4Z8FH 2HLFD 3VG9B 3FO1A 3PQYB 4P4RB 4FTVE 1KG0A 5B21A 3KJ4C 1E6OL 1FFPB 3MV01 4PRIB 4XTRD 2KBGA 3FB5B 4A2MA 2W1NA 1JF6A 3VGEA 1C5CH 4HXAH 1TIUA 1P84K 2X4NB 2A6JA 4U1SB 4X0KB 4MD4A 5D1ZA 2FHFA 3QIWC 4PG2A 4U33A 3OF6A 1RFDL 1CF8L 1IEAB 3B43A 1GGBL 4HZLA 1U92B 3MJ8A 2NXZB 3QIWD 5CD5C 4IIQA 5C70A 5E2WH 2LU4A 3DMMC 1RZ8B 5I6XB 2Z92A 4I8DA 5I1KL 4PRNA 4ELKA 3BKCL 3HG1A 3SDDA 2VRAA 1K4CB 2XTJC 4KRPB 1FORH 2V9QA 1GVIA 4U0RC 2H1PH 4FQIL 1I7UA 1JI1A 3K8MA 3SCMC 1RU9L 4RX4D 1X5YA 3SE4C 5IVZB 1A9BB 1ZA6B 5GGRA 4JN2B 3QRFM 3SKOA 5C1MB 3CGTA 1Q94A 5GGSB 4F3FA 5ILTH 3S35H 2XY1A 1X5JA 2V9TA 2J8OA 1ZT7B 3B3IB 2MCPH 1RIHL 4M1DH 1EHLH 5BOPA 3BDBA 1GAFH 1VGKA 2DTSA 1KJ2B 2GY5A 1DANT 2CLVA 2DKSA 1F8TH 1UWXH 1MCKA 3TBWB 1SY6L 5T1DH 1NGPL 1MFNA 5KS9F 3GGWB 3D25B 1P2CB 4MVBC 1R3LB 5ICYA 3SE8L 3HE6C 3F58L 4HWBH 4XVSH 3EOTL 4N0CD 4UDUB 3DO7B 1N3NB 4J4PA 5F7FA 4OZIE 1QA9A 3O8XC 4JQVA 3ZL4L 4LCIL 3RGHA 1MLCA 1FL5A 3VXUB 4HUWA 5DHYB 1P7QB 4NKDA 2IWGA 2IC2A 1WTGT 2IPUK 3UTTE 4I9WD 2WBJC 4FA8A 2YD7A 4AL8H 1WK0A 3BPOC 1RHHB 4KROC 2ADFH 4V1DE 4NBYB 1IAIM 1ZTXL 2IJ0C 2R0WL 1YMHA 2WQRA 4I18A 4FQXD 1UVQB 5IVZA 1FAIH 3RZCA 4DVRH 3F7VB 1MRDL 1JRHI 4J3OC 1D6VL 3DX8A 3ROOA 3PUCA 5CHNB 4P46C 1KSRA 2VXVL 4PG9B 4J12A 1L9MA 5B22A 3S5LG 2BVUA 2WP3T 3EOTH 4XCNB 4TOYL 3VMOA 5DMKB 2X7LA 3TZVD 1YNTB 4LCIH 3MUGA 3FO0H 1B0WA 3PG2A 5F1IA 1OP3K 5BZDB 4P2OD 3SGJA 3IXTB 3FFCA 5J13C 3O3DB 1DFBL 4G6JH 3TZVC 4DEPC 1FV1B 3ULUL 4OZ4B 4U1IA 4RQQB 1YPZE 4MAUH 4QTHB 4GT7A 1WFOA 1Y6KR 4M1GL 3L7FA 4FP8L 3MODL 1B88A 3C60C 3F6IA 2VL5B 1U8QA 5DMJB 5I8CA 2BSRA 4P4KB 5JOPD 1IM3A 1OPGH 2XN9D 4KJYA 3RTQC 2EDOA 3HE7A 3V2AR 2F53B 3CX5K 1F42A 1GL4B 3QYCA 4XNZC 3BT2L 3MV11 4RIRA 3GSQB 3HS0B 5F6IB 1HE7A 1C12B 5C7XH 4R96A 2D4DA 3BYYA 3H9SB 4IRSA 5KTEH 1INDL 3FQTA 4G3YL 1PW3A 4U3XA 2J2ZA 3BKML 4LQFH 2MQ0A 3SDYL 3VXSB 4E42A 5JOFA 2CDGA 4ZSOE 1BFSA 1K6QL 3PGCB 1MAMH 4UV7H 1S7SA 4ZQKB 4P23C 3GIVA 3ARDD 4X5WA 1GGCL 5JOPE 3R0MA 2Q87A 1NAMH 3NTCH 4HCRL 3ALXA 3VFMA 3PGCA 4N90D 5DD0H 5GS3A 3ESUF 5ESAA 2HWZH 4NQDB 5FEBA 1HILB 4LEXL 4K8RH 3IRPX 1CG9B 4PLKC 2PW2A 1TTGA 1KOAA 5FYJL 4NGHH 4JZJC 3OAYK 3JUZA 4RGNB 5E1HB 3RGVA 2VDRH 5JQHC 3QNXB 4RIRB 4ONOA 3CLFH 4JRYE 1RIVL 1T7ZA 25C8L 2VQUA 4KPHH 3ULUE 2W07A 3NOIA 5D7IB 5HBBA 5C0AB 1P4BL 5MI0B 4I5BB 1NCDH 1K4DA 1FFNB 4LLYB 2Z31B 1OGAA 3TIEA 1I7RB 4D0DB 3WJJC 1CU4H 2EYRB 3H9HB 4WY7H 2F54A 1T2QL 3TBSA 2G75B 4NP4H 3QFJA 2LABA 3EYOB 3CVIH 1BJ1H 5FV1L 1KTDA 2A77H 5JHDB 1ZHBA 5JW4M 3G6JA 5T3ZH 4XWOC 4LCUA 1GHFH 5BRZB 2NY7L 5TDNB 3HAEA 1AD0B 4ZO9A 5HJ3A 4G6MH 1KULA 1BOYA 3X3FL 1NMCC 5GJTH 3L5JA 1UH4A 3CCHA 4WNQB 4YC2B 4HV8B 4B7IA 5CEXB 3F12A 3L9RB 2VUOA 2Q8AL 1MJJB 2CDFB 3UPRB 3F7VA 5L0QB 1QNZH 4XCEB 1ADQA 4MAYD 4KWUA 3NCBB 5E9DB 3UAJC 5C09B 2D2OA 3DVIA 1J0KA 2OMNA 4NQDD 5JIPA 4EJ1C 4KH2A 4NWUL 4P9ML 1EV2E 3Q3GA 4O02L 4XCEA 4LHUA 3IKCB 4UB0L 5CP7A 5DRNA 3DX9A 4LLDB 4WTZA 2ZOKB 4P9HC 4FQLL 1KLGB 5KVDH 5C0GA 1VFAA 4Z7NE 1IFHL 5J6HB 4FQCH 4Z7UB 3VDAA 3CUPB 5DD3L 3VFGL 5L7XL 4YXKL 1TZGL 2DQHL 3U48A 3VFTB 4BH7A 3GKWH 1A6VH 4G6FD 3KR3L 5ISZB 2VAAB 3F5WA 4BA8A 3BIKB 1ZOXA 4GSDH 4X80H 4PYGA 1PDKA 1I1AC 1M6OB 3WNPA 4JAMA 3WIIL 3JBG7 5JLZB 5EUOE 1L0XA 4D3CL 1ZEAL 3OR7B 5DRWA 1NCNA 1QSFE 2XNAA 3VWJC 1EMTL 5IJKC 1T1YA 4WUUB 5GGVL 1HCVA 2AEPL 4UTAH 5J8OA 2QADC 3LZFL 1AHWB 4WV1A 2HKFL 5MHSE 2NY1D 5HXMA 2B4CL 2YBRA 5BRZE 4PRNB 3HMXA 4ELKB 5BV7L 2AK4B 1YN6B 1FPTH 1KXTB 1MIML 3LH2L 3UBXI 1HHHB 2ERJB 3DLQR 1L6ZA 4PRBB 3GRWA 3LDBB 4ODTL 3S35X 4IS6A 4WEUD 5DQJB 3RX7A 2BVQA 1BD2E 5I1EH 4JPIB 4UAOC 3HI5L 5D1QD 2VR5A 4F33B 3VFMB 1IC5L 3T0BA 4LPWA 2UY7A 3FKUS 4YHYC 3TYFA 3OXSB 2YOCA 5CJQL 1YMME 1LO2L 4PJEB 3UTSB 4UTAL 3EOBB 5EO1A 3B9KA 2CH8A 8CGTA 5KSUB 3QI9D 4KQ4H 4MA8L 3VFVB 2QR0B 4R2GC 3TCXA 4LRIC 4FFWC 3BPNC 3TJHC 3VH8G 2E3VA 5DJXB 2DIBA 3ARTA 3Q2CA 2BNRB 3CMOH 1FZMB 2ADIB 2EDWA 5FOBA 4HUUA 1O7SA 3GMPB 4JQIL 4QLRA 1CLZH 3EYVB 3UBXA 4AG4H 4OF0A 4FMFA 1YQ2A 4M5YH 3O6LL 4LVNC 1JTPA 3D39B 3WS3B 1RJLB 3QDHA 3L5WA 5K59E 4JFYA 1P5UA 4YFLF 2VXQH 1KB5H 5I15L 3BEVA 2R0ZL 1VADB 2LFGA 4QRSB 3NA9L 5I74C 3ABZA 4MCYA 2R1WA 5ID1B 4OLVL 3G08B 2PYEB 4HZLB 3MUGB 5TDPB 4WWKB 5CUSL 1INDH 4RMUA 5D1ZB 4U05A 4PGCA 5CMAA 4OLYL 1AR1C 4WVRA 2EICA 4JZOA 2PXYC 3HNSL 5HYJB 5F9OH 2PKDA 1U8KB 1V7MH 3FN0H 3SKJL