4P2RE

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
SGGKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
total genus 51
structure length 245
sequence length 245
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE01
3GBNH 5AD0A 3UJIH 1RUMH 4TTDC 4AMKH 2D7TH 4LHJB 4U1HA 3FN0H 5HGAA 5F9AC 1FCGA 5GGTH 1T1ZA 1JPSH 1CE6B 1KT2B 2P5ED 2WLZA 3V4VH 5HI5C 2FO1A 3BXNA 5EBMA 2FSEB 4HG4J 3QDGB 4X4MA 4Y4HC 1IAKA 4U6XB 2E8ZA 4LLWB 3UTPD 1MAML 2ADGA 5GGQH 3RZCD 3FN9A 1EMTH 1GGUA 4RISL 4NWUH 4MCYA 4Y19D 3SKUD 4Q9QH 1F4YL 3LEYH 4PJXB 5IG7A 3BZEB 3VXUD 3G5ZA 4NHUB 4AQ1B 2HYMA 2QEJA 2AV7A 5DYOB 4QXWA 4NM4L 2I9LB 3KPRD 1FH5H 4H0HB 1BQHG 5DC0A 4PJ7B 2EZ0C 4J3SA 4N8CL 4M6OH 5B8CC 5CZVL 4FFZL 5LCVL 2VMFA 1B88A 1TQBB 3CMOL 1KJVA 3OKMA 3NMEA 5GJTH 1NDMB 1Q9OA 5D7JB 4OM1L 4Y1AA 5LJYH 5JOPD 3QCUL 3TPKA 2AVGA 4YEFA 1I4FB 3LMJL 3LN4B 2BY0A 5DD5L 6CGTA 2V9TA 3IU4H 4HGWB 4H5SB 5HI3C 1IC5H 4S10A 3TZVC 1TIUA 4JPWH 4Z7UB 4KK8C 2IG2H 1Q0YH 3UYPA 4IJ3B 1JZ3A 2A73B 1PKQE 2QR0A 3QXDA 5J06A 5KANI 4I0PA 1E28B 2IQ9H 1J86A 5KSAD 3WS6C 4A6YL 3DX8B 4QHKI 1V05A 1D5ZA 1NL0H 3KYAA 2HKHH 1PBYA 4Y4HB 2Z91B 5IBUB 5DQJB 3ZYOA 1EVUA 5DHVA 4N1EA 5MERB 5IEHB 4DZBB 1EERB 1FYTA 5IFJA 3EDFA 2H6PA 2J6EA 4F9PA 1YEDA 4JFQB 2DTML 1WICA 3MOBL 3IDUA 3O4LE 3TZVA 1UACH 1WIPA 3IT8D 3BH8A 3N85L 4JKWA 4NZTH 4ODSL 3ARGD 3W11C 2GK2A 2HT4C 5JHDD 2Z4QB 5F44A 2ZNWA 4JO4H 3QHZH 3SKOA 4HT1H 4IOIB 3K1KC 4J3UA 5HGHA 1NDGB 4KQ4L 3GRWA 4PR5B 2RAMA 1QEWA 1B6DA 4ZDHB 3EYVA 5KVMC 1UEMA 3T3PE 4PGJA 4H5SA 2NY2B 1RULL 1FLTX 3FO9B 1OCWL 1SYSA 1FGNH 1DQLL 1IGYB 3PV6B 4BH8B 4IOIA 3MRFA 5DDHA 3N0PB 1MHHA 5D7SH 5GS1B 5BVJA 1LK2B 5H2BA 2DBJA 4OCXL 1NC4A 5BOZG 2EYSA 4XI5C 4ZO7A 1ITBB 3ZDZF 2V5YA 3KPPB 4PJAE 2I5YL 4G8IA 1PVHA 1R3JA 3L3KA 4EEEA 2P5EA 2IANB 3P11H 1HDMB 4WWKC 1PLGH 4X99A 2D0HA 2UY6A 1A3LH 3ZSSA 3ZKNC 5A16B 3FRUA 5FO9A 1KCVL 1U3YA 2R0LH 3HE6B 2A9NH 1B90A 3OWEA 1AGDB 1DZBA 4WI4A 3PQYB 5EU4B 4C55A 3L3IA 3G5XA 4ZXBD 2DLGA 2ZOLA 4H25A 3VWJD 3VXUA 3WFZA 2YEZB 4YAQA 3EYUH 5GRUH 1RURH 1HYSC 1NKOA 1B0RB 5E6IB 4ZOEA 5T1KD 1IAIM 4ZS7L 3SEPA 2O61A 4Z78A 5DRXA 3OX8A 5A2LH 2GTWA 1ZLWK 5DUMH 2H1PL 1FORH 4MNQE 3RKPA 2ZSWB 1I8KA 1K8DA 3U7YL 2IBZY 1YEJL 1DFBH 4Q2ZB 4UT9H 1KCSL 1RZGA 2PW1B 4FABL 4PRHE 1MFBL 2DAVA 3ILQD 5C8JB 2IALB 1JFQH 2D31A 1Q9KA 3D3VE 4GBXD 4Y1AD 1OF2A 3HTLX 5CAYB 1MEXL 3NTCH 4K7PL 1BVKB 1XCQA 5LG1A 3P0GB 3WJLC 5DK3A 4HS8L 3WFBL 2W07A 4PJHB 4R26L 5I16A 4RGNE 3FT4A 1UZ6E 2XPGA 4PBVC 2R4SH 4FQHA 3T2PA 3MNVB 4F7CB 5I73B 1X4XA 4LSPL 3RGVD 1OD7A 5DZNA 5HYQA 1P6AB 1JF6A 2C3WA 3IJYB 3B43A 5MHSE 4TTDD 2GK0B 4XXDA 3TLRA 3VCLB 5C0DA 3TNNB 5D7LD 3ZKXB 4E0RB 2L7UA 2E3VA 4N1HB 3FZUC 1KB9K 2YR3A 1Y6NR 4ODXA 2BMKB 3GB7B 3IJYA 4QT5B 4R2GD 3PUCA 1FYTD 1HQ4B 2CRIA 1TZGH 2ID5A 2UWEA 1NCNA 3PDGA 3PJSB 4XNQB 1CFVH 4HC1A 5C0AD 1U8IA 2V5RA 4P99A 5IJKA 2VXVL 5C0FB 4G7YH 4LSVH 4JCLA 3CX5K 2C3VA 4LSQL 5ENWA 3T0ED 4H1LB 1OAYH 3VFWA 3I02A 4BZ1H 2YRLA 3EZJB 4MJIB 4TSCL 4TUOB 2VDOH 4LLVA 4OLEA 4UV7L 3PJSA 4HQQL 1UXWB 5C2BH 4YK4B 1MI5B 1TITA 4HKBA 5SWSA 3RVXC 3QNZB 3FQTB 4UQ3B 2DD8H 5I74B 5DJ8A 1VFBB 3L5WB 4NP4L 4H0GA 2BVPB 2QQLH 2J88H 2EH8H 5ITBH 4PB9L 3OR7A 1QA9B 1MRCL 1X5JA 1IEAA 3WFCH 5GSRB 1KACB 3LDBC 1U91A 5CBEA 1NC4D 2DDQL 3IFNL 4AL8L 1ETZB 5F6IB 3BGAA 2E9JA 2FJGB 2VZUA 4PV8B 4OD2B 4WO4D 4XNUL 4WUKL 5F7NC 4NWTH 1A02N 5ICZA 5JA8B 3B9VA 1Q94A 2WMPA 3KPMA 4XX1G 4MXVF 5KSAC 5FM8A 4MS8D 1IGMH 5JZ7C 3PL6D 3OXRA 5IV2A 3RBGA 4P2QE 5ACZB 4G5ZL 4P2OD 1CFSB 1FYTE 4LRNL 1Y0LA 1OAZL 5CD3A 2AEQL 5KSBF 1D5MA 3OPZL 1OAXH 1PQZB 3KLAB 4LGPB 3Q5YA 4R7DB 2XN9E 5T1KA 1JV5A 3Q3GA 3RNQB 3TBTB 3X3FL 4BFIA 4G8EB 2AK4A 5IHBA 4ZFGH 4LVEA 4R96A 2D9QB 3BT2L 3BWUC 4OZHA 3VXUB 5D70L 4ZDHA 3O6FD 1FVCB 1QBML 3D9AL 4LKXB 5C09A 3OKLB 4GAYA 2F8VA 3FO1A 4A6YB 4ZNCD 4K07A 3GKZA 3W5NA 1JNJA 3T0AA 3GM8A 1RMFL 1TQCC 4RDQG 2AGJL 1UJTA 5E8PB 1CICB 3MLYL 5FYLD 4ZUWB 1I7RA 1WV7T 2ICWA 2OBGA 3IFOA 3Q1SL 4NZRH 3RGVA 3ZKMC 4ENED 4GRMB 1MFEL 1D7FA 2VDKL 4Y5VC 2EE9A 2PR4H 3MJ8A 4NQXA 5SX4I 4K3EH 3LS4L 1PSKH 5D7LA 4FP8H 4IHOA 1INEH 3MLRH 2AEIT 3OKDB 1I8KB 1A4KB 4KROC 5JOEA 1AR2A 3DGGA 4L4VB 4NNXA 1LP9E 3R0MA 1T04B 3CFBB 1UGNA 2GT9B 3BX7C 4XC3H 5F9OL 4I0PB 5HJ3B 5ESQB 2HVKB 3Q6FB 2XTJE 5EOCL 3TN0D 5D6CB 3HKFA 1MWAL 1TZHB 5C0AA 4WHYG 4HIEB 5D7IB 4L4VA 2CGRH 4QTHA 3O6MH 5TE6H 5CILL 2FB4H 1N6UA 3MCKA 3T0EA 4K71B 2Y6SD 3I6KB 3TWCL 5IB4B 2XTJD 1D6VH 4Y88A 4Z76A 1YEDB 4JFQA 4KRPB 4NOFA 5LAXA 5L9DH 1AGEB 3DX6B 5ETUB 3MX0A 1I1AB 1F6AA 3ORJA 4YE4H 3BKJL 3MGTB 2OS7A 3KHOA 3B9KD 2D0FA 3QQ9C 4HKZA 3STLB 4F2MA 5INDB 2DICA 4HPOL 2X1OA 1T1XA 1YQ2A 1KBGL 1LGVA 5CZXC 2NX5D 1QFWI 2D7PA 2XKSA 4ESKA 1ORSA 2BOBA 4LBEA 3RA7H 4WFEE 4PLKC 4RMUA 3I6GB 4OCYH 4FQ2L 3GSQB 4OGYH 3CDFA 4L4TD 1XF2A 1SYVB 1OAKL 3PHOB 1ZEAL 3VI4E 1A7RL 2BDNH 1ZLWH 4KK9D 3IDYB 5LGHH 4H88H 3PWJA 5KJRL 2ZKHL 4JFYB 4KHXL 3PL6A 1ES0A 1EEYA 1T66C 4P2OA 2FLRT 1GXEA 2OZ4L 1VEPA 4P23D 2B7DT 2ESVA 4XPAL 4Y16D 5F70A 1UKSA 1YDPB 2A9ML 5ANMA 5EULV 4BK5A 3UC0H 2D03L 3K4DA 2AK4D 5HHNB 1P7KA 1NC2A 1WBXB 4K7PY 5DURD 4S1RH 2JCCE 1TJHH 3OL2A 2HP4A 4PREB 4NFDA 1ZHKA 4WDIB 3IFPB 1IZJA 3FHQA 5E7FA 5I8OH 4B0MM 4WNQA 5JPNA 3WO4B 4ZTPH 3BKYH 4P9MH 2RFXA 4I2XB 3B83A 1YMME 3GMQA 5H94B 3D0VB 1KEMH 3V4PH 3JTTB 1PX4A 1AC0A 4JJHA 2GSIA 3J8F7 4XPBL 2YWZA 3K81A 3VXTB 4MXQD 4R90H 3SDAC 4MWFA 4IOFD 3FQUB 2ZP0T 3T4AB 4Y1AB 2H26B 2Z8RA 2F53B 4UOW1 1HHIA 5HGAB 3QI9B 1YMMD 3QCTL 4HIJA 1VACB 5I17B 1F3DJ 4P3DB 3VXSD 2R8SL 1ZMYA 1T7WA 4ALAL 2FX7L 2YK1H 2YUVA 4U6VH 3SDCC 3ULUL 3SY0A 3WSQL 2AXGB 3T3MF 4Y5XA 1AP2A 1LDSA 1ZWIB 4GH7B 5DC9B 3MODH 1M6OB 2APXA 3ARPA 1E4KA 5EO1A 4UNVA 4YGVB 2I26N 4P3DA 1D3CA 1JHLL 1INDH 5DRNA 3L3OB 3NA9H 1T2QH 1G6RH 4ZUSB 3VFPA 3O2DH 3S36H 3KYOA 3H9SD 4AK1A 1KN4H 4NO2B 1JPFB 1NMAL 3SJVE 3A6BH 1RJYB 5FHAH 1XGQB 3PWVA 2GSIB 4GAGL 2R0ZL 1W8NA 2IPTH 2P5WA 4ACPA 2NW2A 5FGRA 1ZLUH 2Y25A 4DGYH 2DM3A 3H42L 1CR9L 1T2JA 1DL7H 3JZ7A 3T3PF 1TFHA 1XR8B 2CO6B 1UM6L 3L5WA 1N5AA 2PUQT 3FT3B 1MRFL 1ZE3C 1EFXB 3MRMA 5L7XH 2ZCHL 5B39G 4PUBH 4ODUB 4UTAL 4Z0XA 3VXMA 3P0VH 3ME0A 1DUYA 2WZPD 1OTSC 1I3VA 4M7KH 2LU7A 3L1OL 3QCVL 5L8KB 1SM3H 4GRLC 1CFNB 3C6LD 1MCRA 5BS0A 3EFFB 4HFWB 3D48R 4EN3D 4YHNA 5EU7E 4MWFB 3BP6A 5D7JC 3VH8B 2CRZA 2VAJA 1OW0A 1QSVA 3P4OB 2XWBA 3TEUA 1D5XA 1JF5A 4OCMC 4OSUL 3F12A 4AENA 5CCKL 4L4TA 2B5IB 1BBJA 1NGYA 3MBEC 2HTKC 5KSVA 3JV5A 3U83A 5EORH 1RJCA 3HAEB 1WWAX 5DJXA 1AKJD 1EO7A 2VZ1A 4V1DB 2R1XA 4X6FA 2A77L 2ZOLB 1DQTA 2Z8SA 2IC2A 4G9FB 2AERT 5JXED 4P2CG 4P23A 3KWWA 2FL5B 4Y16A 5ICYA 1IM9B 3DV4A 4YDJA 2Y36H 6FABH 2NZIA 5B3NA 5I19H 5JW3H 4W6XB 4C4KO 1UCBH 1WCBB 5CMAA 3LKPA 4K23H 5GS0C 25C8H 5FHBH 1IGIL 1ZT7A 5KVFL 5CUSH 3L3KB 3VWJC 4OCWH 1BJ8A 2JJVA 1U2HA 5F3BA 4LOUC 4JFEB 1RVFH 3NVQA 1CLYL 1S7VA 3O2VL 2X4SA 3PHOA 1DQQB 5T33H 3VXTA 1MCWW 4HBQA 3M1BB 4DEPB 5LWYL 3V0VB 5FYKH 4EVNA 3UTSB 1U92B 1OSZB 4HK3J 2XRAH 4YFLF 2EH7L 5DJZB 1J9CT 1RK0A 3UJJH 2AQ3A 1R5VB 4J3WA 4OLVH 3ARDA 4PYHA 4UT6L 3U9PH 5AZEL 5T5FH 5ADOL 3DI3B 3VXSA 3KPQB 5CJXA 3C2AH 4M7LT 3DGGB 3KGRA 1T4KB 4LHUG 3WKNA 4I3RH 1WBXA 4LCIL 3T2NH 1RJZB 2DQIH 2DI9A 1K8IA 4ZUUA 1WITA 1H15A 3GSRB 4KY1H 1YDPA 1H3WM 4XPGH 2F58L 5TQ2L 1RJLA 4HV8B 1QBLL 5EC1A 3S9DB 4BJLA 1NEZA 3BZ4B 3CZJA 4K94H 4EI6B 2W60A 4OUUB 5JXAH 5T3ZE 5GGVH 1HKLL 4G42B 1LVEA 3I9GL 4JVUA 5GIRA 4HBCL 1F02I 4YHPA 5IB2B 4F7PA 1MFDH 4MJ6A 4YQXH 1DSFL 4LDEB 5J0BA 1QZ1A 5I1AA 2G2RB 4KUZH 4OIIH 1RY7B 4WUUE 1U8MB 1G9NC 3QXDB 4KJWC 1BBDL 4JDVB 1L0QA 3ES6A 1A64A 5E08L 2BJMH 1CGTA 5D2NB 1HXYB 1VGKA 2ED8A 5IB2A 4RA0C 4JFFE 1I8IA 3OKDA 4RGNC 3RX8A 2HH0H 1HH6A 1KJMB 3RWCB 1U8MA 5K9JH 5HVFB 1G7HA 4RGND 1PG7X 3MNZA 4M93B 4TRPH 3RIAF 4C57C 3VXRD 2OMBA 2QADB 4ORZC 4OZIE 2CH8A 3FRPA 3DMMB 4KI1A 2GQHA 5K9QI 2KBGA 1HXMB 5DMGD 1CL7L 2NYYD 5DYOA 1YPZE 4EQ3A 4HAGA 5T1MB 5HYJD 1AKJA 4JO1H 3BIAX 5IVZA 2P44B 3THML 4KDWA 5ISZE 2DQDL 5TDPB 3WLWD 4PJIA 8CGTA 5D2NA 15C8H 4LVOC 1I9RH 3V5HA 4HZLA 2O5XL 3ZLQC 5KN5A 1FN4B 4E5XA 2Y23A 3UTTB 1RFDH 4WUUB 1NKRA 3MRIA 4PJEE 5D93B 4Z18A 3Q5TA 1CLCA 1A7OH 4U1NA 1RHHA 4MSWB 5EWIL 1G6RA 4KGLA 4PY7B 1QR1A 1GJIA 2XG5A 2W60B 3MUGA 1VFMA 4WFHE 3HUJF 5T3XE 1N7ML 4BSVA 2HT3D 3MFFB 5TDNA 5CP3H 3ZE2E 3BKML 4Z7WA 1U8LA 1YEGL 4MQTB 4U1HB 4HKJA 4HK3N 1G7MA 1I1YA 1DUZA 4JB9L 2BY3A 5HGGS 1BGXH 1YEEH 2GUOB 3EOBB 2R0WL 3MROB 2GY7B 4XP4H 4CAGA 3IKCA 2V17L 3BAEL 3GSNA 4PD4K 1S5HB 4PS4H 4Z0BH 3E6FB 3ULVC 2YXFA 1FCCA 2ORBL 3GGWB 1YN6A 4GFTB 1MLBA 5EC2A 3LKSB 3UTZA 2VDPH 4GAYB 3RGHA 2YD3A 7FABL 2M26A 3PNWA 4MDJA 1NAML 1U8KB 3C6LC 4EI5B 2J5LB 4RQQB 2ADIB 3QULB 4P0DA 3GBML 4PLOB 4KHTH 4PGDA 3RWFA 3E1F1 3SKJH 2XY2A 1H3UA 5EU3B 3B2VH 4X4ZA 1D5IL 5BZWB 2P46B 4IDLA 1CE1L 3UYOD 4PJ9A 1U8KA 2P49B 2VC2L 3DX9A 4XCYA 1OAUL 3VFPB 1JTOA 3UTQA 4YO0B 2FEDD 2GKIA 1UJ3C 3CXHJ 1QBBA 2BSTA 4M5YH 1UQSB 5DEGB 2OJEA 1ZVYA 3MRKB 1M6OA 4FFYL 1CFTB 1BZQK 2Y7QB 1UWEH 4R0LA 1MFCL 1PG7W 1XCQB 5EA0H 1SEQL 3KLSA 2BVOB 4JN2B 2DQGH 3NFPA 3O3BB 1J88A 1LP9F 4R8WL 4RMTA 3HFML 2W9EL 2XA8L 2SEBA 4BSVB 1F90L 3MA9L 4TUKH 2NY3D 4X7SH 3VFNA 1HINH 2JJUA 4WIQA 1E27A 4L8SB 3CLEH 3EDJA 5I1GH 3MFGB 5B38A 2R56L 1DBKL 3GMQB 5I1LB 1CGXA 4EOWH 3QRGH 4MAUH 4H1LG 3NCFB 2O5ZH 3L3OA 2HKFH 5ILTH 4HGMA 4PJ8B 4X80L 4JM2D 5E2TH 5FYLE 3LSOA 4OLXH 2EYTB 4E41E 1JPFA 4KRLB 4RNRA 3VXRA 1PW3A 1QHPA 3M8OL 4DZ8B 3V0WL 4X9FA 4UOW0 1CFQA 3MRRA 3IB4A 5FUZL 3BIBX 4MA7H 5DJDB 5IKCB 3ZDXE 2GIYA 4YGVA 4X6CB 2YD4A 3ZZ1A 5FOJA 1AD0A 3BDBA 1G9NH 2W9LA 1IEBA 3J7HA 1Z3GH 3REVB 1KPRA 1XF4B 5HYJA 1AP2B 1ZWIA 4WY7H 1CXFA 3T3ME 1J1XH 3O6LL 3C5JB 3U1SL 1YEKL 3MRMB 4HJJL 5IFHH 5BRZE 4LNRA 3S34L 1U3HC 2F53A 5JQ6L 2YA2A 3Q6GL 2VL5B 5IQ7H 2OR9L 1IARB 2G5RA 2VKXA 3QUZA 3FO9A 1HYRC 4DKEH 5TPWL 4ZODA 5C0RH 3P73B 2A83B 2HFGH 1WZKA 3C08H 1WEJH 4F15B 4HUVA 4NBXB 4Q6IC 1ADQH 1R3KA 4OD1L 4PR5A 4GKNA 1BEYH 4Y2DB 1T03H 1AH1A 4W81A 4NM8L 4N0RA 4R4FH 4XCNA 4QY8A 1GGBL 4D8PB 1T7ZA 3LVEA 4R4BB 1MRDL 4JFFA 4OF8A 1AGCA 2NY7H 3RWDB 4WEMB 4I0CC 4RAVA 4FFVC 3C9NA 3BVNA 3BEVB 1BFTA 1T0NA 4WI2A 3I84A 3QB7C 5F9WB 4LRIA 1OWRM 2NR6C 3LD8C 4TUJB 3UJIL 5IUSA 4AMKL 3FN0L 1YUHB 5IIEA 2FEEI 4E41D 3MRCA 2BSRB 1LO3H 4P2OB 4S0SD 3B9DA 3BZDA 1KB5A 3KJ6L 5E94A 3V4VL 1AHWB 1QOKA 3I6GA 3IDXH 2ERJC 3MLWL 3GI9H 4TVPD 3KS0H 4RIRB 1KXQE 3QYCA 4PJ9D 5GGQL 4PJ7E 2DI7A 5CD5D 3ARZA 5KG9A 1TPXB 5SX5K 4RISH 4NWUL 1C7SA 5DK0A 1NEUA 4FNLL 3D25A 1F4YH 4MGXA 5ERWB 4O00A 3V0VA 3DTXB 3EHBD 3M45A 1V3MA 4DUVA 5GGSY 2H2SD 1LILA 4NM4H 2CIIB 3K8MA 3SOBL 3FRUB 3ABZA 4TOYH 4N8CH 4UT7H 4NQVA 4XHJD 5CZVH 3U0TA 2FGZA 1A1OA 4LEXL 2VUOA 4Z7WE 2WBKA 3IDNB 4X0KA 4MQSB 1I7UA 4ZSOE 3BEVA 2IH3A 5GJTL 5GS2D 2NNAB 3IXTB 3OHXA 4PG2C 5HPOA 2J3SA 1KLGB 2O26U 1QSFE 1HEZB 3P40A 4MHHG 4QLRA 5E5RB 4OV6F 5J6HB 3TO4A 3QZWG 3IU4L 2VABB 4PYGA 5E4EC 3IS0X 1G7LB 4JM2A 1IQDB 5FF6A 4HIEA 5D7IA 5FUCC 4PRIA 2IG2L 5DJ0A 1PZ5A 4NQXB 2IH1A 3MRCB 5GS0L 4J8RB 2QLVB 5CJBA 2EIZA 5DZOA 2A6KA 1NL0L 2HKHL 5E99H 2KKQA 4LNRB 2BXZA 4R3SA 1CE6A 1KT2A 1BQLH 5IHLB 4XP5H 1VSCA 3CJJA 1L7IH 1OTUD 1ZVSA 4IRSB 4KJPC 2F53D 3O9WB 2BC4A 1U8PA 2NPLX 4QF1A 1KULA 4HH8A 3MYJB 3MOBH 3KYMB 3QZWB 1YZZA 5C6PB 1Q0XL 2YPKB 2R2BB 2IAND 4JO4L 4Z6AT 1JGEA 4U2YA 4HT1L 4IIQA 3D85D 3QA3A 5ID1B 1SQ2N 3O6FC 3IKKA 2LVEA 1ZT4B 4KI5D 1O7VA 2FRGP 5ESAA 4L9LA 1M7IB 1JN6A 1OCWH 1FGNL 1DQLH 3DURA 3GSXA 4JY5L 4LPCA 5D7SL 2V7NB 5D2LA 3RY5A 5E00A 4L8BB 5E6ID 4EBQL 2FD6H 1B2WH 1NMBH 3MRJB 4E41A 2I5YH 3MLUL 4I18A 3QUXA 5EBGA 4X6CF 4XB8A 3I02B 1RAMA 3AGVA 3P11L 1PLGL 5KZCB 1KIPB 5E2UH 5EB9A 2XY1A 2BOCB 4I9WE 5CSGA 4AM0A 2KUTA 5T1DH 3RX5A 4D0CA 4KV5E 3M17A 4FQIL 3HZMA 3X14A 1C08A 3EYUL 3JBG7 5GGTA 5GRUL 3HR5A 4JFPA 3GMNA 3QFDB 1WJ3A 3VFNB 3VD5A 3L3HA 4BFIB 1CD9B 2IEPA 1S78D 2XTLA 5HYSG 1XGTB 2X2YA 3EYQC 5E24E 1MJ7L 5GRWA 3TNMB 5DUML 2H1PH 3ILPB 2ZOKB 1P1ZA 3U7YH 2G75A 4WRLA 2M2DA 5DI8A 1YEJH 5EBMB 4CVZB 3L3GB 1IGJB 1GL4B 4O58L 1KCSH 5DMIL 4APQA 4OZFB 4FABH 1HWGB 1MFBH 5F7LB 4XP9H 4MVBD 4WFGD 2AAVA 3SQOH 1JFQL 1FNGA 1ORQB 1LEGB 2GJ6A 1MEXH 3NTCL 4K7PH 5I1IL 3LDBB 2QQQA 1LEGA 1K6QL 1ZGLA 2E7LA 1ZSDA 4P5TB 4OGAD 4G8GA 2R2CA 2HJLB 2FECI 1WWWX 1PZUB 2VNCA 4GXUN 1MJJB 3N1QC 4M7JH 2E7LC 1LO5B 4PBXA 5HGBA 5GSVA 4HUWA 2X4RA 1U91B 1MUJA 2QHLA 3KDMA 3ZDZE 3UTTA 1CXEA 5FB8B 3S4SG 2GI7A 1S7QA 2R2HA 3KPSA 3GRWH 5E9DA 4O2FA 4JANB 2OR8A 3IAQA 2EECA 3N9GH 1F2QA 1LMKA 4GBXB 5E70A 5I74C 5J12B 2PYFA 3RWIA 4GSDH 4XMKL 5TF1L 2NY6D 3V6OC 1IBGL 1UH4A 1WTLA 1B3JA 5HHNA 1YA5A 5CGTA 2AQ2A 3KYMA 2VR9A 1CFVL 3G6DH 4D2NA 1S9YB 2XQYK 1U8HB 1QQDB 3T65A 1ZS8B 4HWEL 3BI9X 2D0GA 1MCNA 5C70A 5D1XA 4YDLC 1OAYL 4WWKD 2IANA 3N06B 1I7TB 3L3GA 1QVOA 2VDOL 4UV7H 4HQQH 4JM2C 2EDXA 2IAMA 3O0RL 1MCJA 3OKNA 3TNMA 2IBZX 4U1NB 5C2BL 1DDHB 2OR7A 4DUWA 1DJSA 1U8OB 1LDPL 5E5UB 4KDVA 4OI9A 2VZVA 5I71C 5HSFA 4KROD 4NP4H 1J8KA 3VRLE 2J88L 4PB9H 5GGSA 3VE0A 5BVPH 5D4QA 1BQHB 1MRCH 5F21B 3T77B 3TCXA 4PRIB 1WAAE 1ZAGA 3MTRA 4JAMA 5D6CA 2N56A 2DDQH 2D4FA 5E6IA 4E5XB 1NDGA 1K9TA 5D2NC 3EYQD 3CK0H 3DUUB 3QQ3A 3DBXA 3ULSB 2VLKE 2FO4A 4F8QA 3CNKA 2N4IA 4WUKH 3DLQR 4NWTL 4NJ9H 4RZCA 3BP5B 2NZ9C 5FO9B 1MH5B 4E41B 1N6QL 4UU9A 2FYYB 1JZ5A 4CNIB 1IGML 3MJ9A 2CLVA 1IQWL 3MRFB 1H8SA 2Z91A 2AEQH 5HVGB 1VKXB 4HWBH 3OPZH 1OAXL 1I8IB 2NY3B 4DVRH 4P4KB 2ZCKH 3EYFA 5J6GA 3RVWD 4B41A 1AIFB 1SYVA 4HWZA 4NKMB 5EZIH 3O4OC 4ZFGL 3WHE0 3S37X 4LCCC 4XH2B 5C3LD 1HHJA 3G6JE 4O51B 3L6FB 5D70H 4ZYKB 4PD4J 3LQMA 3QO0B 1G9MC 5TDPA 3LIZH 4Z7VF 4QRTB 3D9AH 4RBPH 4WW2C 5AUMB 1KTDA 3FCTB 2GJ6D 4Y19E 3RDTD 5HGDB 3MJ8B 3G5VB 5BV7B 5DD3H 1E6OL 3T0WA 3CD4A 2DIBA 5A2FA 4F57H 4L3AA 3ARTA 3V6ZA 2AGJH 5F1SA 5I6XC 3V6FA 3UTOA 4O4YL 3B9EA 4XBEH 4LSRH 2MOVA 2EC9T 4PLJD 5ECJE 1Q72L 5D8JL 4J3VA 2X10A 4JO3L 1JPGB 2XTJB 2VDKH 4LVNC 4Z76B 3BP5A 4HUMB 3P3YA 4UV4H 4K3EL 3LS4H 4D8PA 1INEL 1R0AH 3IDYC 5E9DD 1BFOA 1FQ9C 4P23B 3UX9B 3FAWA 4P4RB 2D7MA 2FJGA 3A0OA 3TN0C 3WV0A 2IADB 4EIZC 3HRPA 1KIRA 3QEQE 4MDIB 2YA0A 4FXKA 1QACA 4R96B 2ATKB 5KOVC 4UMGA 1G7IB 5CBEB 4JR9L 1DVFD 4NBYB 4HKXB 2CGRL 3OJ2C 3D3VB 2VZTA 5CILH 2FB4L 3P4NA 2NY3C 5CIPH 5F3BB 4EN3B 1MCQA 4WO4C 3TWCH 1D6VL 2X09A 3WLBA 1SMOA 4ZPVB 1JYNA 2IAMD 4YNYA 3NFPB 3O3BA 3MV8D 5DRZA 1P9MA 1I9JH 2I07B 2YD9A 2F5BH 4NC0B 3RWJA 1ED3A 4JZNA 3O3UN 5CS7A 1JNHB 3BKJH 1CS6A 3P77A 3S36X 1CFTA 3AMLA 2UZXB 4IMLB 4HPOH 2X4TA 3VXSB 3SHSA 2NY6B 3PGFL 3UAJC 1ZOXA 3WFDL 4GAJH 4ISVA 5CHNA 1YNLH 4F7MB 4PJXA 1MUJB 5IG7B 4FQXA 3RA7L 5DSCA 1ZHBA 4F80A 4L8SC 5GQBA 3IYLW 1P7QB 3EGSB 5DURB 3LAFA 4EVNB 1IC4H 2JIXA 4OCYL 4X5LA 4OGYL 2Z35A 4YDIH 4B50A 3IDGB 2PW2B 1OAKH 3HAEA 3UTTE 4U6HA 3RU8L 1A7RH 3WHXB 2W9DH 4U49A 1NCTA 3UYRH 4H88L 3PHSA 2BVOA 5HHXL 3UBXB 3VH8G 3UBXG 3WL9B 2R1YB 3JV4A 4WI9A 4X5WB 5DVMA 1ROWA 3EFFA 2OZ4H 3SDAA 1S5HA 4Y5XB 1F4AA 1PG7H 3S3JA 3SDAB 3SN6N 3DROA 4HXAH 4ZD3L 5MEPB 1YMMB 2XZAL 4APQC 5K9OA 3QI9C 1OP3H 1F00I 1QBAA 1Z5LB 2DQCH 3NFSH 2PF6A 3ZHLA 1CGWA 4KKNA 4M9PA 4EN3C 3SDYL 3VXMB 2PO6A 4LPWA 4IIQC 4S1RL 3AU1B 5EBLB 1TETL 4HJGA 4HWUA 1JN6B 5I8OL 4LLMB 5K33A 3W11D 3ARED 4ZTPL 3TNNA 4P9ML 4W6WB 3G6AB 1T6WA 1UVQB 2X4RB 2EDLA 1TCRB 4NCC2 2CR6A 4PRBA 2YEZA 4XPBH 4R90L 1YN6B 5F8QC 3PWUA 1DN2A 4Y2DC 2VDQH 4X6DA 3TT1L 3NZ8B 2AJZB 3QCTH 3P0YL 1AKJB 3RZCC 4U1LA 5AD0B 4NHCH 4R9HA 1RUPL 2BZDA 4ALAH 3VFVA 1QG3A 4M03A 4U1LB 2FR4A 3WSQH 3MOAL 3MSPA 3W9EA 3WIFB 4MA1B 1OGTB 3MODL 1U93B 2YRZA 2CJUH 1X7QA 1BX2B 1S7UA 3DNKA 3BH9B 4J3OC 3WLWC 1JHLH 1INDL 1XR8A 3MV9B 3CPLA 1HQ4A 3NA9L 4XT1C 1T2QL 1G6RL 4HKXA 4RRPG 3S36L 4JZOA 2AJ3A 4GRLB 1NMAH 2NY2D 3QJFA 3A6BL 4YFEA 5FHAL 3PV6A 4NQCA 4R97B 3QFDA 3GMNB 1A14L 2R0ZH 2DWEA 4W6YB 3QEQD 5MHSD 3HCVB 1VEOA 4DGYL 5CEXA 2DIAA 4XC1L 1ZT4A 1CR9H 5I0DA 1EEUA 4JN2A 1DL7L 4JRYD 2B5IC 3MBEB 1UM6H 2B2XL 2ZCHH 4ODWB 4PUBL 3FB6A 1B0GB 4PB0L 5FA4A 4LMQE 4UTAH 3P0VL 5CEYA 3HE6D 1EZVX 4M7KL 1SJHA 5J4MA 4J3TA 4OFYD 1BOYA 1SM3L 2JK5A 4X6CE 5EIVA 2DBLL 5ANMB 1G7MB 2P47B 3OTTA 1CDGA 1Y18A 2XFXB 1S7WB 4FQXD 4IM8A 5IM7A 1Q9WA 4JRXB 3GIZL 5HHOB 4LPVA 5IB5B 2VQ1B 4XNXL 5DRXB 5JW4Q 3MRIB 2MQ0A 1HIMH 1KGCE 4WNQB 5JPNB 4MDJB 3MGOB 1H3TA 5CBAB 3S5LG 4PREA 3B6SA 3PQYA 3CX5J 3SDAD 5EIIA 1U92A 1FAKT 5CWSA 2LTQC 4X0KB 2NW3A 3VXOA 3QIWA 6FABL 5I19L 4JFXB 5GRJH 1UCBL 2HT2D 3QFJB 4MZ2A 25C8L 2XQBH 5I8KL 2PO6D 3PWPD 5C0AE 5KAQG 1I7RB 1BVLB 1QVOB 5IR1B 2JB5L 1R5WA 4OCWL 1UG9A 2YOCA 3QIWB 3DIFA 2RB8A 4EIGB 3GUTB 4GW4B 1NFDA 1RVFL 4FG6C 4I3SH 3NPSC 3O2VH 1VESA 3T0EC 4ELMA 4JQVA 4KV5F 3UBXI 1NEZG 3H3KA 3O9WD 2ICEA 4QOKA 4BA8A 5LWYH 3MCKB 3LKOA 5FYKL 1G7PB 2C7UB 1JNLH 4X9GA 2AXHA 3MLZH 5DJ2B 4RIRA 4Z7UA 1VFAB 3GSOA 5E1AB 3VRJB 5L2JA 3WXVL 4CMMB 4UT6H 3U9PL 4YPGA 5AZEH 5T5FL 5ADOH 2FLBT 4JDZA 1N0LA 4JREC 3C2AL 1CD1B 4U1GC 5DQDH 3QUYA 3TO2A 5C6WH 4PRHD 3T4YA 5MI0B 1LNUB 3H2WA 4F37F 4K3GA 3IDNA 4Y1AE 2DQIL 3FJTA 1NBZB 4P5MB 3HI6L 4XPFH 2ICES 2F58H 5TQ2H 3FN3A 3GMMB 1CG9A 2F54E 2J8UF 3RP1A 5JXAL 5IT2H 4HUVB 1HZHL 4RAVB 4HBCH 1MELA 5E8OB 4G9FA 1MFDL 4Y16C 1MLCB 1E28A 4GKZB 3IVKA 2FGWH 2WUCH 3BWAA 3BEWB 2XN9A 4NN7B 5E08H 2BJML 2OYPA 1KIUA 2APFA 2H3NB 4Z7VE 3ULUD 5FO7A 2BVPA 3RPIA 1AHWA 1MCBA 5K9JL 4O2CB 3W5MA 2E9IA 4OFYA 1NCBH 4WTZA 2VXUH 2MJWA 3CPLB 1MCPH 5KS9B 1CFNA 2FYYA 4ZAKC 2XG4A 1IAOB 1Y0LB 2X4PA 5SWZD 2J5LC 5F7EH 8FABB 3KJ4B 3MZTA 2WBWB 4OD2A 3QPQD 4OZFA 4OFDA 4BELD 2AKRA 2NXYD 1KSRA 1FBIH 4I48A 3NOIA 4XCNB 1CDUA 1KENH 2EKSB 4QHUB 1I1RA 2CQVA 4QYOA 2C26A 4P5TD 4ZTOH 5GGRY 3P73A 2HN7B 2X7LA 3BZFB 5LBSL 1FL5B 2P45B 2V5TA 5J1SC 1BZ9B 2O5XH 3MUZ1 4ZQKB 2G60L 4GXUM 3DVFA 2CRMA 1MCEA 4P5KA 5SX5H 5BZDB 3EO9H 5C0DB 4LVHB 1RFDL 3RNKA 3OB0K 4QYOB 5CJQH 2PO6B 1CN4A 5GSVB 5EWIH 5B4MC 4XBPA 3R8QA 2CDGA 2WUBH 4ODBD 3RWEA 4CVUA 1QR4A 2AJSL 5ACZA 4MXVE 3BKMH 2WM0A 1OPGL 4M3KB 2I27N 2HRLA 4OB5H 5HYJB 3KPNB 1HHHA 4TYUA 1FPTL 1H3PH 5D1ZB 1BGXL 1YEEL 1R5IB 2YA1A 4NFCA 1F4HA 1KFAL 2BC4B 3O9WA 5HHME 4G9DB 2R0WH 4ZG1A 3ARFC 1UJ3B 4QOKD 3BAEH 5J1TC 4X6DB 4Z0BL 1CD0A 2ORBH 3EKCA 3HC0A 4YHKL 5BJTA 2JIXB 1FNEB 4V1DE 5I18H 5C0BB 1G6RB 3RAJH 4JFHE 5DSCB 5FDWB 1EX0A 3GBMH 4KHTL 4M1CD 1S7SA 3DXAB 4FQXC 4GUPB 4PRHA 3SKJL 2GSGB 5BO1H 4HZLB 3IFPA 3B2VL 1ZA6A 1D5IH 3SKMA 1DQJA 2HFEB 4PJHE 3D0LA 3MNVA 1CIUA 2R2BA 2YPLE 4LQ1A 1OAUH 5BS0B 3SO5A 5F6IC 4K8RL 4UDTB 1IL1B 4EUPB 3QZWA 3MROA 1VDGA 2Y72A 1ACYH 1W72B 4FFYH 4B7LA 3O4LA 4RFEA 1U8LB 2DB8A 3TBYA 4NUJA 2E9WA 3OB8A 4JKPL 4MAYA 5A43C 5EA0L 1EEZB 3OF6D 5KSAB 2PO6C 3CCHA 4G6AD 1JZ8A 2ZOKA 1JTPA 2DQGL 1EBAA 2H8PB 2NY5L 4L8BA 4PJFE 3OX8B 3O3EB 4R8WH 3RVTC 1U58B 3HFMH 2W9EH 2PYED 5JW4M 5C0GB 1DEEA 4TUKL 1TJIH 3I3EA 3KLHC 1GC1H 3PWVB 2JKXA 1B4JH 2VLME 3CLEL 3VFUB 3VI4F 5HHMD 3EIFA 2CXKA 5GS3A 1IGTB 4QOKE 2B8OT 3GMLB 3QEHB 2O5ZL 4YIQB 5E2TL 4M5ZH 5J11C 4ZUVA 3RL2A 4PJAA 2Z4QA 3B8SA 3RY6C 3LRGA 3M8OH 2GTZB 5CP3A 4KUCD 1KIQB 3CFEB 5E2WH 1RI8A 1BLNB 2OI9C 1UZ8A 4FQCL 3RJDA 5KVDL 1G9NL 1DUZB 2IPUK 2WP3T 3RVXD 3MNZB 4WY7L 1T83A 4PGZA 1J1XL 4X99B 2PN5A 3U1SH 3UMTA 2A6JA 5DDHB 5IFHL 4K7PX 2J7LA 2XTJC 4XPHH 3VXOB 1A1MA 4QRTA 2DIJA 5ESVA 1PKOA 4MXWL 3Q6GH 4ONFH 3WNOA 5F7WC 2F54D 5IQ7L 2OR9H 3C5SB 5IMOB 4HDIA 1CQKA 4RX4A 4X98A 4DWHA 3X13A 1GHFL 5TPWH 3W39B 1FZJA 4QCIA 4GQ9H 4Z5RB 1EPFA 2FEEL 1I1CA 3C08L 5DD1H 2P5WE 4NM8H 1F11A 4R4FL 3VXPA 1GGBH 3ULUC 2K3TA 2G2RA 2OL3A 3Q3GB 1MRDH 4WHYH 3RNQA 5FXCH 3G08A 4KJYB 5TGBB 1IRAY 1TPXC 4G42A 1D9KA 3IU3A 1D5MB 3NGBC 1H15B 5DLML 5I9QB 2EDYA 1DBMH 1CICA 4QHNA 1A6WH 3GSUB 2X89D 5ISZB 1V7MH 4HV8A 3VGDA 1FP5A 2CIIA 3EJZC 1UYWH 4LL9A 1LO3L 3T0BA 2UUDK 3KJ6H 4LP5A 4DGVL 4GQPH 4Y4HA 5E0QA 1T4KA 3ZTJH 3IDXL 3MLWH 3BZEA 3GI9L 4QHMA 3FO0L 4MCZA 3KXFA 1IMHC 4B53A 1ORSB 2BOBB 3PDDA 5I1DB 5IQ9B 2NXYC 4OM0H 1F4WH 3GSNL 5KBNC 4HAFA 4FNLH 4I4WB 4IRJD 1PKQB 5F1NB 1OP5H 3O4LD 3BH8B 5EN2B 1QRND 1P7QD 3QDJE 5FOBA 5EG6C 4YZFF 1BD2D 4TOYL 3SOBH 2DTSA 1JGVL 3O3EA 1AI1H 3DUHA 4NCDA 4UT7L 5KSUB 3I6LD 1FLRL 1R24A 4LEXH 1LP9A 4PJ7F 4UQ2B 5IB4A 2CUMA 5FO8B 3NIDE 4U4BA 4HIXL 3QXVA 2FHBA 1WTGT 1XGPB 5SWZE 4Z0XB 2P48B 4XGZA 4LLYA 4GG6B 4LPYA 5C0AB 1U8IB 2O5YH 3DUUA 4LCUB 1U0QA 4BSWB 3OKLA 2PYEE 3ZO0A 4LSSH 3IRZA 1K3ZA 1MFAH 1QFUH 1XGTA 1RIVL 1KNOB 4UIKH 1IEAB 2DLHA 4J6RL 5F1OB 2HTLC 4CU7A 2X44D 5IWLA 3QNXA 5GGSB 3VE0B 1FL5A 4CVXA 3GSVB 4N9GB 3LN4A 2NQCA 2AJ3B 4P2RE 5GS0H 1S5IL 1FRGH 2RIKA 3E6HA 1B0WA 3GIVA 3QDGA 5E99L 1KCKA 3LKSA 4KXZH 4U0QB 3TYFA 1ORQA 1BQLL 4XP5L 3A67H 4ERSH 3QWOB 1L7IL 3RIFF 3WDJA 2IQAB 5B38G 5GS1C 3HI1B 3SCMD 3IFLH 5DJ6A 1RK1B 1FIEA 35C8H 2AK4E 1A9BA 4P48A 1BJMA 1LE9B 3G5ZB 1Q0XH 1WBZA 1PEZA 1FZOB 5CEXB 1MF2H 3K1DA 4P5KB 3QG6B 2Q7YB 4PJ5B 4JFPB 4JKLA 1WWCA 1LE5A 3BPOB 2JJSC 2VL5A 4WUUA 1DANT 3PDOB 4G6FD 5TJWK 5CSZA 1KTKE 1S7XB 1F45A 5IK3B 4JY5H 1MWAA 3UPRA 3CSGA 3DX7A 4ZUSA 2QSTA 5LKNA 4EBQH 2FD6L 3REVA 1WFOA 1B2WL 1NMBL 3MLUH 3UZQA 3OKEA 3TFKD 1MQ8A 5KVEL 3F7QA 4I8DA 1EDQA 2X41A 3KPOA 1DCLA 3LH2H 1NPUA 3DX7B 5FKAA 4PV8A 3K3QA 5E2UL 3MACL 5A2KH 5GXBB 2ATPA 4XNZC 4G8IB 1NANI 3WIIL 2RBLA 5DR5H 1AE6H 5F97E 1YPZA 5HI3D 5T1DL 4FQIH 1MNUL 3UTPE 4P46D 3IF1A 5FO7B 1P7QA 4KWUA 4M1GL 2VDNH 1WIUA 1UH2A 4S1DC 1OOAA 4NZJA 3SE4C 1MJ7H 2IPUG 3LKOB 4XCFH 5C1MB 3MYJA 5GGUB 1RIHL 4HS6A 3X12B 5DMIH 2C1OB 1Z9OA 4O58H 4OZFG 5C6TL 5C07A 4WCYL 3C60C 4XP9L 3EOAB 3SQOL 1YY8B 4JFDD 3BPOC 4MNQD 1ZLVK 5J12C 3HC3H 5I1IH 5M95B 4YLQT 3NCYP 4G6ML 1K6QH 3T4YB 4WTZG 1KYOK 5E8EA 4UZGA 2XKNA 3QFJA 1SJEA 4P9HC 1F97A 4FXGA 1NBZA 4MZ3A 3D3VD 4CVXB 3MV7D 5AAMA 4CMMA 4J2XA 4HIHA 4M7JL 4M3JA 4HLZH 2RQ8A 3OZ9L 2A1WL 1SHMA 4DEPC 5J1AA 1HHJB 1I1AD 3RHWK 1XAUA 2LU3A 3GRWL 3VXME 3LEXA 1Z2KA 4HDIB 1HOCA 1JGEB 1MLBB 5EC2B 5EU4A 3N9GL 4NC2B 5I71B 4NZDA 5J6GB 3IS1X 2VITB 5DJ2A 1II4E 4BFEA 4GSDL 4XMKH 5TF1H 4L29A 3QPQC 1IBGH 1AGBA 3RDTC 4RCAA 5INCA 4QRRD 4P4KC 1P7HL 3RWJB 4CMHB 3G6DL 3IAPA 1WLHA 1FFRA 5CJOL 4ELMB 3CDYA 4UINH 4HWEH 3MO1A 2ESVB 4OUOA 1I7UB 5IEHA 4Y4FB 4L4TE 4YBLB 3V8OA 2FH6A 2JJWA 3RPKA 3O0RH 4N0FA 2V9RA 1HWHB 1D6EA 4L9DA 3HZKA 2EIZB 4RAUB 3FO1B 1LDPH 4A6YA 4WUUD 3HE7D 5EIQA 4ETYA 1G7IA 32C2B 4I0KA 5HHVL 1AQDB 4H0IA 5JHDE 4PJCE 2ARJQ 1N2RA 4LQFH 4Y16B 5I6XB 5BVPL 1WC7B 3QO0A 5E6YA 2KDGA 4DJMA 3LB6D 2YSSA 4ZSOA 3MGOA 2HRPL 4CN4A 3CK0L 3CH1B 3G5YA 4FG6D 5F88A 5CLTA 2D4DA 1S9VB 1NUGA 1J8HD 2UV3A 3IFOB 4KMTL 2CDFB 1CGUA 3BDYH 1OP5K 4M93C 4KH2A 4NJ9L 4MAYB 1N6QH 4PRPA 5B4MD 1AGCB 3HN3A 3PWPB 1N59A 2QADC 4WI7A 2VSCA 3TVMA 1IQWH 4PGEB 2OL3B 5E7BA 3FONB 3DMMC 4ZUWA 4I2XE 3LN5A 3KHQA 2OQJB 1RUAH 3EYOA 1TQCB 4HWBL 5BOPA 4F33A 2ITDB 5CP7A 4DVRL 2ZCKL 3PWUB 3P9WB 2MQCA 5BRZA 1IFHH 2ICWJ 3MZGB 5EZIL 4GLRI 5TE7L 5E1HB 3QEHA 2NR6D 2AK4B 4LVNB 4OCNC 4GRLA 4AEIL 4NC1C 2AJYL 1T04A 4AEHH 4MJ6B 5E95B 3T77A 3LIZL 5GJSL 4X4XA 1XF3B 2I25N 3WNKA 1S7UB 1I4FA 2VKWA 1Z9LA 5DD3L 1E6OH 3H7BA 4G43A 3BYTA 3ZE0E 5HI4D 4F57L 3QFJD 4S1SH 4OQTH 3G04A 4PJ9C 3QPXH 4O4YH 3HMXL 4LIQE 3OAYH 4LSRL 4XBEL 1Q72H 5MP6H 5D8JH 2DLEA 4JO3H 2DMBA 3PWNB 3DX8A 1QQDA 2EYRA 2IFFH 2W0LA 4TULL 3WL9A 4UV4L 3TCLB 1QLRA 4ZFOB 4PG9B 5CIPA 1R0AL 2ADFH 4PJ8D 4DVBA 2KQNA 1RK0B 4TVPH 2FX9L 1FVEB 5BZWA 2P5WB 1W72L 5DA0B 5GPRA 4NN6C 1BQUA 4PJ5A 1TENA 3RWHA 1FVEA 1U36A 3AS3A 3BRGC 2EE6A 4JR9H 3ROLA 5D1QA 4DVBB 4ISVB 5CHNB 3TH3T 3GHBL 12E8H 1HNFA 3MV11 4ZNEE 1B9ZA 1NCCL 4XCCH 2A6DA 3UTZB 1VFBA 1EEZA 4QGYA 4Z77B 1QSZA 4LCWE 4M02A 4R0LB 5FV2A 3TIEB 4CW1A 1GSMA 2VIRA 2Q1EA 1P7KB 1I9JL 3MRKA 3LQAC 3FFDA 1BVKA 2F5BL 4KKAC 3MJ7A 2EDOA 2Q7NA 3VFWB 4MA8H 1GYAA 2WINA 1Y6MR 2QL1A 3NZ8A 2I60L 1FV1A 4XHJC 3ILQC 1UFUA 1F4XL 4NRYA 2EDDA 4NQDA 2BSTB 3PGFH 4I13B 3WFDH 4GAJL 2UWEB 2GJ6E 5CSZB 5CJ8A 5EUOE 3QUML 1YNLL 5IB3B 1UVQA 3MJ6A 3NIGE 2J8HA 3MJGX 4NKDA 1T1YB 1IC4L 3U36A 3BKCH 1DQDH 4IIQB 3VH8A 3GJFH 4BKLB 4YDIL 3MRLA 3MV8B 1E4JA 4OF0A 3KYKH 1T20A 4NO0B 4N90D 5E8OA 3RU8H 5LGKA 2LU4A 4G8GB 2W9DL 4D0BB 3UYRL 3IKCB 3ARBD 3PNWB 2IMMA 4ODTH 5HHXH 1I8LA 4ELKA 5HDBE 3VFOA 3V8CA 5A3ID 1BQSA 1NJ9A 3BO8A 4IMLA 4OZFH 4C56A 1T89C 5SWZB 1CXKA 2C3VB 2VXTL 4R97C 1PG7L 5HBBA 2V2XB 4GG6E 4HXAL 4P5MA 5I30L 4ZD3H 5BRZD 4DCQB 2OJEB 5SWQB 4X7TA 5DS8B 2Q6WA 2XZAH 4GKOA 1S7RA 2DLFL 1T21B 2DQCL 3NFSL 3VWKC 4JPVH 4YO0A 1FSKB 3SDYH 3V52H 3EUUA 5HXMA 3HAEG 1KPUA 1TETH 3OR6A 3RQ3A 1XF3A 3GFUA 4XWOD 5L2JB 4FMFA 1J0ZA 3O6KL 4IRZH 4OAWA 4P2YA 1WSST 3QNXB 1U8QB 3BZFA 3QWQB 2HAZA 1JJUA 2IADA 4AIOA 4POZD 1SBSL 4I18C 3CDCA 2ATKA 1JP5A 1G9EA 4NFBA 4HF5H 2X70B 5C0EB 4UIMA 4Q6IB 1OHQA 2WBJD 2VDQL 2DQUL 3TT1H 1AXTH 1A2YA 3P0YH 2Z8WC 3GI8H 3DIFB 5L8LB 4NHCL 1R3JB 2WBJC 5D2LE 4CU6A 1RUPH 2DM7A 1RJLB 4K7FB 4U1SB 4QRRE 5KS9A 3REWA 1OLLA 3MOAH 5F9WC 1IILE 4PLNC 1B4RA 2EDBA 5TGBA 3LKQA 5HTSA 5MERA 3IETA 4RGMC 2CJUL 2Z9TA 3D85B 3FCTA 1DBBL 1A7QL 2YHGA 5D2NE 2H2SC 4NT6B 3RPIB 3BP4A 3MRNB 4PJ5D 3MJ9H 1FZMB 1QNZH 3ZKND 2F19H 5DZLA 3UEZA 2XZQL 4I2XA 3TVMC 4MVBC 5D1QD 4CDHA 1P84J 3ES6B 4JFZL 3QWRD 4BUHA 1A14H 4KVCL 1Z0NA 1CDIA 1MLCA 5F7KC 2EDFA 4EUPH 2CUHA 3Q0HA 4XC1H 1P4LA 2FIRT 4LHUB 1HILB 1NUNB 1IKNA 4IS6A 4XBGA 1XCTA 3WCYA 5LQBH 3JTSB 2ZUQC 1KB5H 1S7WA 2B2XH 3RHWF 4LPTA 3OKOA 4PB0H 2PTTA 4PTTB 2BVQA 3EJYC 3GHEH 1MIML 5HPMA 2YD2A 3QIBB 4NQDD 1A2YB 2DBLH 3KPRB 1FE8L 3TO2B 3GK8H 3KPQA 4WU7B 4UIMB 4XVUD 5F7FA 4HUKB 3UZEA 3QH3A 3GIZH 2ILLA 1R3KB 4YHML 2VJXA 3BPNC 2VLJD 3IETB 1U8JA 4XNXH 1JNNL 3VFGL 2F54B 4XP6L 1HIML 1EAPA 3FQWB 3L95A 3HPJA 4XH2A 4POZC 5JPMB 1TTGA 3Q6FA 4X98B 1ZKAA 3NPSB 3DI2B 3UTSD 3FOLB 2YUWA 3PV7A 3ARGC 4C4KT 2HG5B 5E9DE 1LO5A 4GW4A 3BP4B 4JO2L 3B5GA 1BX2A 4U0RB 2AJUL 2CMRL 5GRJL 3OXRB 3VXQA 3VD4A 1S7VB 3LPGA 4LLDA 2XQBL 4JGJA 5I8KH 1WCBA 4HD9A 2KZ1B 3VFVB 4PRAA 1GZQB 5FYJD 1S9XB 4FTVD 2JB5H 5B8CA 4OAWB 1SJHB 1MPAL 3OAYK 5E8PA 2C4FU 4IRSD 5I73C 2XYCA 4I3SL 3LKRA 3LKPB 1BMGA 2ZUQB 4WU5B 5FM4A 3VA2C 5DK0B 2IMNA 2WIMA 3FT3A 4XNQA 1T83C 5FYJE 4F3FA 3QP3A 5T3XD 2HLFD 4ZAKB 3C6SB 1RZ8A 3CGTA 1JNLL 3DRQA 3MLZL 3TBVA 2WBJA 3C60D 2DYPD 2XWBB 5I8EA 4OQ1A 3WXVH 2Q7YA 1W0YT 5ALBL 3WNPA 3O2WL 2JELL 2AI0L 3TBTA 5EUOB 1OSPH 3QUXC 1RUKL 1BZ7A 5DQDL 5GRVL 2H8PA 4DK6A 1AQKL 3AY4A 1ZGLB 4WFGE 1RK1A 4G9DA 4QXGH 1H9VA 2DQFB 1XF1A 3TJEL 3HI6H 4XPFL 4YXLL 3RTQC 1KELL 4PTUA 1BJ1H 3W9DB 3H6JA 3QIUB 4UAOC 5JW4R 5IEKB 3OAZH 4NRZB 3VRLF 1K4DB 1YN7B 2FJFA 1MCCA 4TVPE 4OJFH 3WUZA 3MRHA 3T8XA 5I1EL 4EDXB 3KWWB 1Z9SA 5IT2L 2YD5A 1HZHH 1KYOJ 4QT5A 2H45A 3WUWA 3SGKC 1NCWH 4X7DC 2FGWL 2WUCL 1JI1A 5JIHA 1K8DB 2IBGA 3QDHA 4XWOC 5DQ9B 3QQNA 2KPNA 3L7FA 3QDJB 4WENB 1S3KL 5IB3A 3MMEA 2BNUB 2ICCA 1QA9A 2DKMA 5ID1A 2X4QB 4Z7NF 3MV9D 4N0UA 3GGWA 4UDUA 3C8KB 1NCBL 2JLLA 1L4IA 4JRXE 2VXUL 4H20H 1MCPL 2PCPA 3OJDB 3ZE1F 4CADB 4PJDF 3NFNA 2EC8A 5F7EL 3MV9E 1PD6A 3RVUD 1FNGB 5DHXB 5HHQA 1JHTB 2XA3A 2ITCA 2PW1A 5FGSA 2O93L 4G6AC 3AY4C 4JZJB 1FBIL 1T1WA 1UB5B 1W0WB 4PG9A 4YBHA 5CIPB 1YEHL 1KENL 3ZDYE 1J1PL 3SPVB 3ARFA 3IDMB 1JI2A 4J8RA 4D9QE 5EH1A 2W0FB 4ZTOL 3T09A 5JW4N 3S98A 1XF2B 5LBSH 4FQ1H 1C08B 2G60H 2EEAA 1X5KA 3L5HA 3EO9L 1CIDA 3WUWG 2CKBA 3TA3B 1AY1H 4F7MA 1X4YA 5CJQL 2HT3C 1BFOB 3JWNC 4OV5B 1YN7A 3WYRA 2VZSA 1QLRB 2WUBL 1AGFA 1KEGH 4WDIA 4TUOA 3SKOB 2AJSH 1KN2L 1X6LA 4FQHB 1OPGH 2YPKA 1T7VA 1ZVSB 3EO1B 4IRSA 1RZIA 2YD6A 4WW2A 3DMMA 4OB5L 4PJBE 4MX7A 2KZWA 4LKCB 1U3HD 43CAA 1FPTH 1H3PL 5KW9H 3OXSA 2D7NA 1KFAH 4Y2OA 1MOEA 4YH6A 3BUYB 3PWJB 4S1DD 3NZHH 3LRHA 3CFDB 4HZAA 4P59L 4Z7WB 3DYMA 2OXGA 3WLBB 2VZOA 4YHKH 5DVLA 2OQJA 3V6BR 4TNVF 5I18L 5C08E 1DBAL 1D5ZB 3RAJL 2D2OA 1P53A 2XI9A 4G6KL 3W39A 5FGCB 3KNBB 5BO1L 32C2A 5JMOC 3IVKB 4JCMA 4X5XB 4OGAC 4XGZB 3DYOA 1J05B 4J3XA 5JIKA 3TJHD 3B9AA 4K8RH 2GAZB 5ACLA 5IVZB 1MCWM 1AO7A 4LGRB 1ACYL 5CJXC 5F1IB 1AGEA 5MEOB 4AJ0A 2ZPKL 2A38A 3P9MA 1BAFL 4PJ8C 3VDCA 3ZYIA 3GJFK 4NRXA 5C0CE 4JKPH 3O2DA 3P4LA 4MNGE 3W0WE 1AO7B 3CU1A 2Q8AL 3FQNB 4FFWD 4PJHF 4H1LH 2NY5H 1EK3A 3DBXB 3B6SB 1KJ2A 2OI9B 4JRXD 1JGLH 5DMGC 3JV0A 3CUPB 5JORA 4OKDA 1TJIL 3ARRA 3KNBA 4LAQH 4NKOB 1GC1L 5JDSB 1B4JL 4H25B 1X4ZA 3NGBB 4U2ZA 1U8JB 3U79A 5AG9A 3NIGF 2RCSL 4OI8A 4OT1H 3U4EB 2D9CA 1EFQA 3TH4T 5J6HA 1DE4A 4M5ZL 2BSRA 1U8OA 5E8DH 4LLWA 3O41A 2L0DA 4EQ2A 5I15L 3TF7C 3ARQA 3G9VA 1MIEH 4X5XA 3BD3A 5E2WL 4Z7UE 1A9EB 1QSEA 4FQCH 4LCYA 1BM3H 1ZANH 2YMXL 5DT1L 5KVDH 1A6VH 3NCJH 1MCLA 2Z8VC 3E8UL 4AT6A 3ARFD 1U8HA 2NMSA 4WVRA 5C7XH 5F1IA 1EBPA 2AV7B 5LXGL 2EDTA 5IKCA 4XPHL 3SDCD 4KPHH 4HLJA 2NCMA 5EU6E 4NBZB 9CGTA 5I9QC 5MENA 2PYFB 4MNGB 3RWIB 4WV1A 3VFRB 3W0WB 4MXWH 4ONFL 1FL3A 4C59B 5F9JB 5ISZD 1U3JA 2IJ0C 3LD8B 2IWGA 5IVXA 2B1AH 3SE3A 4TSAL 2NZ9D 5E5MA 3WDIA 1GHFH 3RJQB 4JQXA 1FVCA 4GQ9L 2BNRD 3T04D 5FYKE 4EZMA 5C0BA 3RBSA 5DD1L 3SQBA 3EYSH 3DMMD 2YBRB 1F3DH 3RI5K 1EHXA 1BIIB 2FH8A 3DRTB 1U3HA 3QNZA 2KQMA 5HVHB 1W8OA 2OJZH 2ED7A 3CFDA 3VWKD 4PJDA 3FFCA 2VE6B 4Y19B 5GGRA 1UJ3A 4K7FA 1I85A 1NBVL 4DZBA 5DLMH 1XEDA 2GJJA 1DBML 1RJZA 4LKCA 1A6WL 5FK9A 4NUJB 1V7ML 3EOAA 1V3JA 3ZMRA 4FFWC 4QRQB 4F9LA 4ONGH 1UYWL 4JJ5B 4RWYL 4X6CA 4KI5C 2WQRA 3TA3D 2Y5EA 4Y8DC 4DGVH 3D2UD 4J4PC 2V5SA 5A1AA 5CD5C 1A0QL 2HT2C 3FO0H 3D39E 4LRIC 1DQJB 2NW2B 4M4PA 3U48A 3MC0A 4HIIB 4NNYA 3QJHB 4XNMB 1FNFA 1F13A 4JFDB 1LO2L 4LHUD 4OM0L 1F4WL 3GSNH 4PGDB 1DEEB 4L8DB 1QO3A 3VCLA 1KPUB 4LSTH 4WWID 5A40E 5FDWA 4JZOB 1MI5A 2XNAB 4K9EH 1EFXD 1QTYT 1NDMA 1Q9OB 2ZG1A 5E4EB 2P5EE 4K3JH 5FM5O 5F7YC 5F93C 3D69B 4DCQA 2CDEB 4LNVA 2W1NA 3S96B 3CFIC 3QIUA 4GRWE 4OFPA 4GS7C 4S11A 1JGVH 1A6TA 1I3RA 1AI1L 2XACC 3FT4B 3L7FB 5FV1L 3H3PL 1FLRH 1FDLL 4OTXL 4RSVA 5IW1B 3EOTL 2AP2A 1JZ6A 4HIXH 2EXWD 2IALA 2FX8H 3L7EB 4APQB 3UCRA 2O5YL 2P8PB 3FAXA 1L9NA 4N5EC 3CH8A 3UROR 4LSSL 5EOTB 4JPIA 2WWMC 1MFAL 1QFUL 1SVCP 4KI5F 3JV6B 1RIVH 1TCRA 4HSQA 3PDOA 3CU7A 1GAFL 2OM5A 3DVIA 4UIKL 3QEUA 1QKZH 1ND0B 4J6RH 3JV6A 3QWOA 3CVHA 5EU3A 1NGXA 3AREB 1ZHKB 4QGTA 2VL4A 1TVBA 3MREB 4F7TB 1QSED 4U1IA 1S5IH 1FRGL 2GCYA 4QTIL 5FDYA 1FFOB 2EKJA 3MJ7B 3WEXB 3BQUD 5HHOE 3A67L 3HB3D 4ERSL 3SDCA 4NNYB 4N8VA 2WBJB 5JA9A 4NDMB 4PJHA 5I16B 4NC1E 2Q86B 4HCRA 4GKSA 1NMCC 5JOFA 2HFFA 3IFLL 4MA1C 35C8L 3HNVL 1VEMA 3WIHH 5FGBC 4XBPB 5JNYB 5MEQA 4ODHL 2V6HA 4I4WA 4TNWF 5GS1A 1MF2L 4XMPL 2QQKH 5KTEL 5JLZA 4YPGB 5C0BD 1IC1A 4KJQC 1BZ9A 1URLA 3D0VA 2O61B 4Y19A 1CK0L 3C6SA 4OGZA 5EOQH 4L8CB 3T0VA 3JWOC 4K9EC 3DVNA 3FO2B 4X9IA 1JWMA 3D5OF 3P2TA 3G5XB 4HS3A 3MV8E 3GMPB 1CGSH 1KJ2L 1AR1D 1XMWA 3LKRB 2BK8A 5ID0A 3SCMB 3KPRA 1QLEL 5IW3A 1XIWB 1UEYA 1KPVB 3TZVB 5J8OA 3FOLA 1PYWB 1PEWA 5HY9B 3UP1A 3MRJA 4LAJH 5KSUA 5KVEH 5L2KA 5FECA 2XWJB 4LLDB 2UYLA 3LH2L 1FYTB 3QDMD 1ZXQA 3SDXB 5HGDA 3MACH 4RA3A 3P4MB 4OCSL 3DTXA 1YMHB 2GEEA 2ZSWA 3WIIH 5IVXF 4LHUA 5DR5L 1AE6L 1FAIL 4CRPA 4CMHC 1QSFB 4NQTA 1MNUH 4KTEH 2CLZB 3T1WA 1G9MH 3HPLB 4LCCA 4M1GH 2VDNL 4MCZB 1IM3A 1AXSB 4G6JL 4XCFL 5T1MA 3T2QA 3IDIB 1CT8B 1RIHH 4NKQB 2AXFA 2OTPA 3FTGA 3C87A 5C6TH 3IXTA 1T3FA 1G0YR 1PY9A 4WCYH 5B3JE 1IM3B 4QCIB 4PP2B 1UZ8B 1YQVH 4NPYB 3O3DB 5DMJB 3HC3L 4PJDE 2Z93B 1KCUL 3BHBB 1U41A 3O3AA 4G6MH 3RDTB 4QRRB 3RL1A 4CL7A 5CMAB 1JHKH 3QQ3B 1TVHB 4MLIA 4OZHE 3RWCA 4WHDA 3WS6A 2YWYA 3ARDB 1XIWC 3S35L 4Y4FC 1MCDA 3SDXA 1S9WA 3OZ9H 1KTLA 2A1WH 2B0SH 1T6VN 1G7LA 4JM2B 3REWB 4V1DA 2RR3A 5A2IH 5KG9B 3QXTA 3TGXA 3CFJB 4M4RA 4KK9C 1FNHA 4KZDL 5I1JH 2FCBA 3BQUA 3C09B 4XP1L 2IH3B 3H9ZA 3NH7L 3LQZA 4DFIA 4WTWA 2YPLA 4X9HA 1Y18B 2XFXA 5CJOH 4UINL 4AG4H 5HHPB 1OGAB 1GCFA 4HMDA 4U1SA 2ICWB 3RTQB 5DQJA 1KGCD 1IL1A 4EUPA 4NHUA 3TIDA 3L5IA 2RHEA 4GRWB 5CWSB 3CVIH 1C1EH 4C83A 4NO0A 2X70A 4JPKL 4YUEL 1EHAA 5C0EA 5HI5D 5HHVH 3S37H 1FFPA 1IZKA 3U36B 4EI5C 4ZXBA 1A1NB 1FIGH 4LQFL 4LASH 1FVDA 5I1LA 2BVTA 5KSVB 4RMRA 2QSCL 4BSJA 4EKXA 4NN7C 1MJJA 2YS4A 5BJTB 2HRPH 1VGEH 4YHIA 1V5JA 1OQOA 4KAQL 4XNYH 4D9LL 3PWPE 5GHWL 5EBLA 1P2CB 2DI8A 4J7RA 5E8EB 3BE1H 1CBVH 3KLAA 1I3GL 2E6QA 2FSEA 3QDMA 4KMTH 4K3DH 1ZA6B 3BDYL 4WI5A 1DUYB 3ETBF 4QRUB 4R4NC 2XZCL 1YY8A 3ZKXC 4OZIB 1VADA 4WW2B 2HJFB 1WZLA 4YDVB 4PPTA 5C9JA 4P2RA 3RKDD 5BV7C 1S9YA 3MGAA 4R4BA 1MAKA 5JMRA 2G75B 4OGXL 4JM4H 1RUAL 3BGMA 4HCRH 3ZDYF 4YX2H 4ODUA 4PJ9B 4DZ8A 2EIEA 3HA0A 2CKBB 3L7EA 2ITCB 3OKKB 2HFEA 4BQ6A 1IFHL 4J1UA 4BKLA 5I75B 5C3TA 2BHZA 4Q7DA 2AV1B 5TE7H 5E9DB 4NQCB 3N1MC 4NKDB 5KSBB 1H8OA 4DQOH 4NO2A 4AEIH 2AJYH 4JLRB 4AEHL 1RZ7H 3ULVL 3QUMA 4ZOCA 3OAUL 5GJSH 1DBJH 4P23C 3S96A 2OTUB 1G0DA 3VGEA 4HJGB 3GZKA 5CFHA 4LFHD 3FQXA 2OTUA 5I66B 4H26B 2BCKA 4FS0A 3FZUD 4NN6B 3GSNB 2AXGA 2R2EA 3MLVH 4XXCA 4S1SL 5HDOA 1OAQL 1ZTXH 4L8DA 4OQTL 3CSYB 1KG0A 1EJOL 2DS4A 3H9HA 3DOSA 3QPXL 3VMOA 1V3KA 3HMXH 3MLPA 5IJKC 4HIJB 1CVRA 2Y7QA 5MP6L 1M7DB 4FZ8H 5HYEA 3AFLA 4Z77A 5I2IB 2V2WB 2IFFL 1BF8A 4M48L 5DJAA 4TULH 4QNPE 1JMZA 3SO3C 5IHZB 5SWSD 2VAAA 2CDGB 3F5WB 5IK3A 4JG0L 3RWEB 4YXKL 1KLUA 4Z9KB 2ADFL 4P2RB 3VFSB 3LCYA 4TVPL 4LSDA 3IDGA 2FX9H 3VFMA 1N0XH 5IMKA 1DVFC 3U7AA 8FABA 3HR5B 1W72H 4PGBB 3U9UA 3V9FA 2EO1A 4JG1L 4F15C 3V4UH 3OKKA 2YPLD 4FQXB 3C8DA 3LHPL 3ARSA 3GHBH 4ZUTB 4HG4K 2E6PA 12E8L 3ZKSD 1CF8L 1NCCH 4P2QD 4XCCL 2PTUA 3CAFA 3ULUF 2AKRB 5MEPA 1DR9A 5E2JA 5FYJU 3VXNB 4IRJC 3ECBA 4C58B 5ITFA 3U30B 2NYYC 2OL3L 2LQRA 4NO0D 3EOBA 2P5EB 5ALCH 4KK6C 1LO4H 3JV4B 1SY6H 5E5MB 1BHGA 4I18B 1UQSA 2QHRH 4MA8L 1U8NB 4N1CA 1XZ0B 5L0QB 4KK6D 2I60H 5D2LB 1F4XH 1YC8A 1GOGA 5HD8C 4NZUL 2KH2B 1BF2A 1RZJH 3JXAA 1MCIA 4NUGH 2NXZB 2ZUXA 5F6HJ 4ELMF 1MCSA 1M7IA 3QNYB 2YZ8A 3QUMH 5CZKA 2VERN 1LD9B 3FQRB 1K5NA 4BFGA 3BKCL 1DQDL 3BIKA 4Y5VB 5HHMB 5C09D 1QUNA 3KYKL 4YHPB 3SO3B 3OHXB 4MB4A 2JCCF 4IBLT 5DO2D 1AGDA 4ODTL 1N64L 3P30L 3U0WL 5BS0E 3TVMB 4MB5A 4D3CH 4DOHB 1AXIB 5D7JD 5FYJL 3BW9B 2VXTH 3OGOE 4M8QA 4NO5A 1U9KA 5I30H 2CDFA 5FOBB 4G9FE 4I0PD 4X8JA 3DX6A 2DLFH 1OGAE 2YRPA 4JPVL 3L5XH 3RZCB 5K9KA 4O02H 3V52L 3WD5L 1J8HB 3MV7B 5K9KB 1JWSA 4L3CA 3QDAA 4IRJB 2QV2A 2XWTB 4K3HA 2B1HL 1CGVA 1FNLA 1KIRB 3WFHA 3O6KH 4IRZL 3ULUE 3HPJB 5DJ0B 5DFTA 3NCBB 3UO1H 3UZVB 3C5ZA 4LCWD 3L9RB 1SBSH 3DO7B 4XPTH 3OBAA 2OMNA 3HE7C 4YZFE 4HF5L 2BSED 3HS0A 3CFKB 4PJBB 1R3LA 3ARGA 4Q97A 5JHDA 1JPGA 1J05A 2DQUH 1AXTL 3BQUB 3GI8L 1WFUA 3I6LE 5BXFA 1FL6B 4LLUA 1ZT7B 3OG6B 1LD9A 1U3ZA 4CNIA 5BV7H 1KB9J 3HUJA 1GPOL 2Y07L 3D6GA 1ZS8A 3B9KA 2YKLL 1CT8A 2HFTA 3PGCA 4L3ED 3WNMA 4PG2A 1DBBH 1A7QH 1HH6B 5I8CA 1DEDA 3KVQA 4L29B 5SWSE 2NX5A 3PG2A 4HEME 4OF5A 3MJ9L 1QNZL 43C9A 2OXHA 1JYVA 2F19L 2XKNB 2XZQH 2Z31D 2BX5A 3Q48A 4JFZH 3VXSE 3H8NA 3BMVA 5IMLA 2EXWC 3QJFB 4P2QA 4KVCH 2BP3A 2BVQB 3MLSL 4PJGB 4MX7B 4HMEA 3STZB 3OSKA 1SEBA 4AENB 1PQZA 4G7VH 2OP4L 2E7CA 2X6MA 4Y5YC 4IHOB 5LQBL 3CMGA 1KB5L 4G8EA 4YHNB 3I2CH 4EJ1C 2R29H 2WIIB 4FRWA 3SKNB 3VWJA 1K4CA 2ESVD 2AEWA 1CFSA 5I1CH 3GHEL 1MIMH 2AJZA 2QKIA 3ALPA 1REIA 1FE8H 4QRSB 4LIQH 5C0FA 1NC2D 3GK8L 3X12A 1X5HA 1XZ0A 5EO9A 1ETZA 3RVVD 1G7QB 3INUL 2HFFB 1S7XA 5ICYB 4YHMH 1EZVY 5D5MF 3DYPA 1JNNH 5FKAB 4GBXA 3HCVA 3VFGH 4XP6H 4JY4B 5ITFB 4X7CC 4OZHB 2BXYA 4O2FB 4OD3H 1GIGL 1XGQA 3PWLB 4PGCA 1DQQA 4X4YA 4OBRA 2PCPB 3OJDA 2VZ3A 4JY6A 1JF1B 5D7JA 5JDJA 5JQHC 5HYQB 1O5DT 3UXFA 3AXLB 4Q6IA 1JRHI 4JO2H 1YMMA 2APWA 2Q86A 3ARYA 1XF5B 2AJUH 1T22A 4ORGA 3V5KB 2CMRH 1I1FB 2Q76A 5E56A 2XPGB 4RMQA 4P9HL 3LV3B 3G6AA 1IT9H 3TYFB 3QUXB 1M4KA 4PJEB 4OLUH 1MPAH 5J57B 3RVTD 5MI0C 1JE6A 3OAZK 3ZTNH 3DXAE 2VLMD 4GO6B 4NYLA 3C5ZD 5D7LE 2PW2A 4LCWA 4ZFFA 1PX3A 3NCEB 1JUFB 1MY5A 3H9SA 2HJKA 3HNSL 4PJEA 5D1QC 4XI5D 1YNTB 3FFDB 2R39A 5C9JB 5C2UB 5DJYA 2P5WD 2C4XA 2V2XA 2VISB 1AD9B 5F7MC 3CIQA 3WFEH 4QXUL 1IAKB 1E27B 5FYLH 2ARJB 3HC0B 4U6YA 5ALBH 3O2WH 5E8NA 2JELH 2AI0H 1OSPL 3WNLA 1IGCH 1RUKH 1NQBA 1CLZL 4N0CC 3T0EE 1AQKH 3VXMD 4M6NL 5KSBA 5E4IA 2HVJB 4QXGL 1VHPA 4N9GA 1J12A 3E3QC 4L3EA 5TF0A 4F7CA 3TJEH 1T1YA 4YXLH 4JFHD 5BW7A 4MD0A 1KELH 3QEGH 4NJAL 1F3JA 1MVFA 2A0LC 1HYSD 5BS0D 4JEGB 2Z31A 5EDXA 5EOTA 4PJCF 4DAGH 4EN3A 4XCEA 4OJFL 5HYSA 5I1EH 1PKQA 4WO4A 5EUKA 1NBYA 5BZDA 1XGPA 1NCWL 1TNMA 1B0RA 2XQYG 1IM9D 2FHFA 4QO1A 1FO0B 5DF0A 3W82A 1OP3K 3QJHA 3JTTA 4X6BA 5H37G 1X5FA 4TQEH 1X5ZA 2QBWA 3VWJB 1FG2B 4OCRL 1S3KH 3V7MA 2I9TB 4U7MA 4CGTA 2A6DB 1HEZA 3STBA 4YXHL 1KOAA 1QPPA 4H20L 5D1QB 3SY0B 3F62A 5DVKA 1Z6JT 5IBTH 1MJUH 3NACH 1DN0A 5EFIB 1CLOH 3O6FA 5GGRB 5BRZB 1HDMA 4W70A 4F58H 3FQUA 2FATL 3QHFH 1BVZA 1RUQL 5I8CB 4P3CL 3HUJE 1YEHH 2QJDA 5DRWB 1QR1B 4RMVA 2DQEH 4HX1B 5F9DC 1J1PH 4JJ5A 4YHYB 2XOTA 3O4OB 5H94A 1N59B 3HAEH 1MHHB 1GC1C 3X13B 2YUXA 4U1JB 5J89A 4FQ1L 5I1DA 4YAQB 4TTGA 3BRFA 3ARDD 5F9JA 3MV01 1CGYA 3MOQA 1AY1L 4LBEB 2IGFL 3FMGL 5HDLA 1KEGL 5JW5A 3CZFA 4PGEA 4DN4L 1KN2H 1OD9A 3ELAT 4XHQA 5BMFL 1UXSB 1KJVB 3OKMB 3WJJA 2F8XC 4QHNB 3HMWH 4ZUUB 3NA4A 5KW9L 4XVTH 1U42A 4P49A 2OLDA 3TN0A 4BH7B 1ES0B 3KPPA 2DWDB 3QUKA 4RFOH 4YBLC 3BVNB 3ALXA 5K9QG 1D5BA 1PY4A 4L4VD 3NZHL 4NQSA 4KJYA 4P59H 1CD8A 3JWDL 2VTFA 5AAWA 4N0FB 3QXAB 1KTDB 3OQ3B 3TN0B 1RHFA 4BH7A 2OCFD 4PV9A 1DBAH 5T1LB 1YEFL 3HG1B 3BISA 2EO9A 1PGRB 4QWWC 3HUJB 4G6KH 5FECB 4GT7A 1IAII 2VABA 3M1BA 3P9LA 3RVVC 1FJ1A 3D87B 5FKPA 1CQYA 4U6XA 3AVEA 4M9OA 4YR6B 3WHE1 3UPCA 5ICXA 4M1DH 1KC5H 4YIQA 2X42A 5HDBF 3F8UB 1QFWH 2ZPKH 1FFNB 5JO5B 1BAFH 1CXLA 4BQ9A 4R6UA 5IFJB 1I1AC 4V2CB 4MAYC 4AYFA 5DD6A 1H3VA 1FO0A 3EOYG 5DUBB 2ESVE 4JHAL 1IM9A 2Q8AH 3P4MA 3MBXH 3VW3L 5JHLH 4PJ7A 2C9AA 2YD1A 1JGLL 4QRPE 3V6OA 2NY0C 1S7SB 3DXAA 3MRQB 1L0XA 4LAQL 4PRHB 2UWEE 4R2GC 3O3DA 5AYUH 3FT2A 1HNGA 1KPVA 1UB6A 3OKYA 2VQ1A 4N8VB 2RCSH 3VFUA 2VRAA 2ZZUT 4OT1L 2EZ0D 1A6AA 4R7NA 2G9HA 3JVGA 4POYA 3FB7B 5IM7B 3ET9F 4W4OA 1DLHA 1UWXK 2X4OA 4DOHE 2HMID 5E8DL 5IB1A 4OV5A 2LABA 4JFDE 4R7DA 1JYWA 3NPZB 5I15H 1UXWA 1MIEL 2Z31C 1NGQH 2JK5B 3MUJA 2DRUA 3SKMB 4OZ4B 1RZKL 4MXQC 3JUYA 3U0PB 1EXUB 3KPSB 1BM3L 1ZANL 2YMXH 4N90E 2XV6B 5DT1H 1JGDA 1QSFA 4XZUA 1A6VL 3NCJL 3E8UH 3VFSA 4AIXA 1CZ8L 3MV7E 4JFFB 4HWNA 3SPVA 5C7XL 4OF7A 4PJFB 3WN5A 4XCEB 5LXGH 5J9PB 4HFUH 4KPHL 4MJ4A 2AABL 3FB5B 2IAMC 4N9OB 2IFGA 1RU9H 4KTYA 4G3YL 1KLFA 2CO7B 2B1AL 4GUPA 4TSAH 3GJEB 1R5IA 5EBWB 1JYXA 5FB8A 1TLKA 2ADIA 3QULA 4RRPA 3OR7B 1G7JA 2BSSA 4FXLA 3EYSL 3UPRB 1G1YA 3MRBB 4TN9A 4B5EA 2CIKA 3VJ6A 4TNWK 2OJZL 4EXPX 4ZO9A 5DVOA 1HKFA 1UC6A 2FR4B 1NBVH 1G84A 4PGCB 4LLVB 1MJ8L 4LLQA 2JE8A 1FZKA 3JSSA 4JFED 3F7YA 5D71H 1OW0C 1C7TA 4N68A 3A6CH 4AM0B 4UBDD 4ONGL 4RWYH 4Q2ZA 3EJYD 4UILH 1P1ZB 2A74B 3TCLA 1WWBX 5D96B 4L9LB 1A0QH 2OSLB 4MMXC 3HRZA 1NSNL 4OZIA 4NQEE 4L8SA 1EXUA 2WSKA 4Y4KA 4QHKJ 2VLRB 3U46A 1LO2H 3BEWA 2NTFA 3C6LA 3PHQA 4MYWB 3NIDF 3FQTA 4UQ3A 4D0CB 3CLFH 4LSTL 1LEIB 4EI5A 3KYOB 1LK3L 4K9EL 1BZ7B 4KGJA 1LE9A 4Z7VB 3HC4L 1P2CA 4L1DA 2V7NA 3PABA 3WDHA 1XGRA 4K3JL 1KUMA 1I8MB 2JJTC 4BQ8A 2VWEE 5EO1B 1A21A 1X9QA 2BSSB 4FOMA 3L5JA 3H3PH 4D94A 2HLAB 1FDLH 4OTXH 3BUTA 3EOTH 3CX2A 2CKBH 5IOPB 3MRPA 1G7QA 3DXAD 2FX8L 5JXEA 5E00B 3DX9B 4WI3A 4XCYB 4JFOB 4UUJA 3MFFA 2IH1B 5TDNB 1C12B 1HQRB 5FYKD 1VCAA 1MHEA 3MCG1 3MNWB 1LEKA 4L4VE 3MUGB 1T5XB 1U8PB 2H3NA 2VR4A 4M00A 4QF1B 5KZCD 1JBJA 4S1QH 4WW1A 1GAFH 2YC1B 3LV3A 1QKZL 1UWGL 4W4NA 3T1FB 4QRUA 4UB0L 5F7UA 4NO3B 1UWXH 7CGTA 3AXLA 4R7NB 3HG1E 3HE7B 1Q8MA 2MNUA 4JFFD 1AHWC 1QSFD 3MGTA 3ZL4H 5IB1B 4QTIH 2ERJB 3B9KC 3BJ91 1LP9B 3QBTB 4G8GE 3F7VA 5EU7C 3BN9D 1VFAA 4Q74A 4RGOH 3VFTA 4WGVB 3FL7A 3FT2B 5MENB 5KAQF 4LPUA 4IMKC 3HNVH 3WIHL 2E7MA 4ODHH 1OTTC 1H3XA 3VG0L 5DHYB 4Z7QF 4ZO6A 1N26A 1NFDB 4XMPH 2QQKL 3MUHL 4FTVE 4Z95H 1MHCA 3TIDB 5KTEH 4OI7A 1IGYA 4BH8A 2FBJH 1EV2E 2Z93A 1QSEB 3AAZB 3AM8A 5DK2A 3TV3L 3H0TA 4OZ4A 4I1NB 1C5BL 5GZND 1UZ6F 1V3LA 3D18B 3T2OA 1CK0H 1QEWB 1A4KA 1TQBC 5EOQL 4YGAB 4HGWA 1P5UA 2ZG3A 3IDIA 5EPMB 4U33A 3QG7H 1CGSL 4LMQI 1KJ2H 3BP7A 3ZTJG 4F2MB 5CINL 1QLEH 3D18A 3STZA 4JFEA 2BNQB 3U2SA 2XIDA 5DUPL 5ETUA 3PGDB 3CFJA 3DVGB 1QYGH 3C5SA 5IMOA 3T1FA 4HHAA 4YHLH 1P4IL 1FGVH 4M61B 1IEHA 1OB1A 4D9RE 3K7UA 4QY8B 4OCSH 5L6YH 1XCTB 4Y4KD 1J0YA 1OB1B 4WU7A 3PP3H 4PJ5E 4PRDA 1FAIH 1ZHLA 4EI5D 5HYJE 2DJ4A 2DWDA 3B2UD 4JN1L 5EFIA 2VLJB 4ZPTA 4D9QD 4KTEL 3VD7A 1WT5C 4Z7NE 1G9ML 2LFGA 2X9YA 3RFZC 5CEYB 4RGNB 4YR6A 1EHNA 5IB5A 5GISL 3K74B 4MB3A 5F72S 1MY7A 4IOSD 4G6JH 5JW5B 2QADD 2GFBB 2JCCB 1T1ZB 3PABB 5IVXE 4ZUTA 1S7TA 2CUIA 4HLZG 1WAAF 4NSKB 2Z0BA 4UU9B 1YQVL 1J11A 1KCUH 4NGHH 4I5BA 1WZ1L 1R6VA 3K4AA 2NY2C 2DQHL 3GMOB 1JCKA 1JHKL 4KJPD 4XTRD 2A74A 2QR0B 3BH9A 4YDJB 2F53E 2NLJB 3S35H 2X05A 2AJXH 3D85A 3IXAA 1NCUA 1OQXA 2A83A 1UXSA 3DHJA 2B0SL 4XTRC 2A0LD 3ULVD 1HSAA 4LLMA 4MNHA 5CLWA 4C54A 4WFHD 1AD0B 4M62H 5DJXB 1JRHL 2MFNA 2HVJA 1FFOA 1YEIL 3MCLH 2R2EB 5DEFB 3CFEA 3ARBC 5I1JL 4KZDH 1CWVA 4YBQD 4XP1H 5T5NF 3ZKMD 4ENEC 3NH7H 3GMPA 1HHGB 4NKIL 4ONHA 2DF3A 4KU1A 5IV2B 3KS0J 4I9WD 2D7QA 2FIKA 4KVNH 1WBYA 4AG4L 3QUZC 4XVUC 1KPRB 1XF4A 1Z0MA 5DXWA 4HUNB 3TFKC 2VYRE 3ARFB 3IDMA 1ZLUK 4LP4A 5ICZB 5C71A 5C0JB 4G8FA 1OM3L 3QIUC 4UAOB 5DJAB 3EAKA 1ZHNB 5EO0B 4D0BA 3WUWB 2C3XA 3CVIL 1C1EL 1N5YL 4UUJB 4PP1C 4U6HB