4P2RE

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
SGGKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 245
sequence length 245
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE01
5CEZH 4TUJB 3OJDB 3V6FA 1P2CA 1UM6L 3H2WA 3E3QE 5FM8A 1G7HB 4LLAA 3OZ9H 2NXYD 4GBXB 4KHXH 1XR9A 4F37K 4JO1H 3WFDH 4TRPL 4YDKL 3DX8B 4NC1C 1WT5C 3HLAA 3BDYL 3ARUA 3FB5B 3EO9L 3GMNA 4W4OA 4LU5H 1XGUB 1YMHB 1MRCH 1CICA 5HPOA 3W11D 2F19L 3MRLA 4ZOCA 3ZT5A 3LKSB 3VXSA 4NQED 3RGVD 4NQEE 2PUQT 3NCYP 1YEDA 3KPQB 4POZC 1BBDL 1LK2B 4NO0D 2N56A 3TLRA 4NJAL 1R3HA 3C9NB 4X4ZA 2ADIA 5FUCC 5HDBF 3SEPA 4OKVA 1Z0MA 5H2BB 1JGLH 1U8NB 2ORBH 1WWAX 2YK1L 3DGCR 4HUNB 4BZYA 4CKVX 4XGZA 3QCUL 1JTOA 3QHFL 5J56B 3PF2A 4OF8A 5EH1A 1RUAH 2ZJSL 5F9DC 2DI9A 2DLTA 2P47B 5FYJD 5FYJE 4YR6B 5BZWA 8FABA 4N9GA 4Z18A 2PCPA 4K3HA 4OI7A 1IQDB 3MV9A 3S34H 3D2UA 4BFIB 4F8QA 2HN7A 1E4KA 1FZMA 3MFFB 3H7BA 5L8KB 4WGWB 3BD4A 1SJEB 4GAFB 2Y9RT 2XOTA 4Y19B 3G6JF 5GISL 1D6EB 5D71H 4LVEA 3NN8B 3QHZL 4NQUA 5DUBA 5L2KE 1ZANH 3QUYA 4MX7B 3R8QA 5D6CA 4MMXC 5DA4A 4H1LA 1WITA 4BZ1L 1IJ9A 3CX5K 1A6WL 3DO7B 1YEKL 2BZDA 2XWTA 4CU8A 4XPBL 3BPOB 5D2LB 2PW1A 3M07A 3MLSH 5GPRA 3OQ3B 4JFHE 5I2IB 3VU2A 3FB6A 4PRPB 5JW4R 1PBYA 2BSRA 3DHJA 2BSSB 1OTSC 4HK3N 1EEYB 4G8FB 4JVUA 4HS8L 3WLWD 4FQXD 4OLUH 4PTUA 3EDFA 4GRLC 4P5TC 1P6AB 3K80A 2WIMA 3MTRA 3U30C 5ADPH 3BPLB 3IJSB 2DJ4A 1FV1A 3RKPA 1X6NA 3HNVH 3L1OL 4I3RH 2F5AH 4PUBL 1TCRA 2VNCA 3A0OA 1QSEB 4QT5A 5EOTA 5IWLC 1TENA 1TTUA 3CSYA 4IRSA 2X1QA 2WAHA 3RAJL 3FQRB 1KPUB 1CGXA 4U6TA 3MGAA 1MVUB 3V5HB 4U1MA 5ID0A 5ACZB 2ICCA 4ZTPL 3U79A 3IFNH 5T3ZD 4KJPC 5E8NA 1D9KC 1FNSL 1H3WM 3BISA 3QIUC 1D5ZA 3QQ9D 5MEQA 4TVSa 1T89A 4JPVL 3AM8C 3GSRA 1JRHI 1U8OB 3VXUB 3O11A 1ADQL 1T1WB 1CDYA 4NCC1 4XC3H 1QO3A 5EC1B 4PJFB 3TT3H 1VFMA 4CADB 4YGAB 4EUPG 2WM0A 1VFBA 2ZPKL 3H0TA 5CBAA 3QULA 2XA8H 3G08B 2RGSA 3VG0H 3DI3B 4KKLD 4K3JL 2KKQA 4JFOA 4MQ7A 1KJMB 1MQKH 3MJGX 3UBXG 4C4KT 1HHKB 1KF9B 1UKQA 2EIEA 3DGGB 5JNYA 2Z31A 2LFGA 4R8WH 4A2MA 4DUVA 5T1MB 4HHAA 4ZUWB 1YC7A 2CMRL 1M71A 3BUYA 1CVSC 5IEKA 5T1DL 4BFEA 4PJ9A 4YJZL 5E8OB 4D94A 3QUZD 4OCXH 2Y25A 4G8GE 5FO7B 5ANMB 3NFSL 4QRQB 3O0RH 3FO1A 2ED8A 4XNZC 1NCDL 3MNWA 3MV7E 3U9PL 3VWJA 5C2BL 1SJHA 2R0WH 1KXQE 5C09A 3ULUF 4TTGA 5DJZA 1S7VB 1HSBB 2Y5EA 3REWA 5EIIA 3O9WD 5CIPH 1FE8L 3FTGB 4N90D 2OL3L 1ZLSH 1L7IL 2VDPL 1CLOH 4HIEA 2CLRA 1IC7H 1J1OH 3MYZA 3L5HA 3ARGC 1SY6A 3LKQA 4LDEB 2GK2A 5CJXA 2OQJA 3GIVA 4ZOEA 2OSLA 2VXTH 5DZLA 2E8ZA 3S88H 3BP4A 3QG7H 5DD0L 1FL5B 3WIIH 1KJ3H 4HC1L 1OT2A 1RFDL 2YN5A 2WIIA 1MCNA 2IANB 2ZUQB 3WJJA 4MXVE 4APQC 4Q7DA 2B1AH 1DQQA 4ZUTB 3S96A 5MERB 5EZOH 4M8QA 2JCCF 1TZIB 4WHTB 25C8L 3MJ7B 4DN3H 5IESH 1JYXA 1OCWL 3LQZA 3HFMH 3BFOA 4IMLB 3VFPA 1EEZA 5E00B 4LCUA 4OLZL 3MA7A 1Q9OA 2DLHA 2ID5A 4J7RA 1MLBA 2D31A 5DHVB 1DQJA 3O8XD 4M6AA 2AJ3B 2HT2D 2MFNA 4GG6F 3NZ8B 1CF8L 3DURA 3SKOB 1AGFB 4GRMA 3UAJD 3NCJL 1L7TH 5C0ND 5H35A 4CNIA 3TJEL 4J4PA 1FNEB 1F4XH 1AFVL 1IC5H 2IQ9L 4JRYB 3LH2L 4K3EH 3BKCH 5DRWA 3OKEB 4WO4D 3BQUB 4EUPB 4WFED 4WFEE 3HUJF 1BZ9A 1I1AA 2MWCA 1MCRA 3HRZA 1MI5D 5JHDD 4NQSB 4OBSA 3HC4H 3LPWA 3LRSA 5IROA 1QLEH 2CDGB 3UBXB 2VISB 1P84K 3I6GA 2E7BA 3BT2L 1YN6A 4X98A 1J0KA 4GS7C 1FGNH 1X6LA 3D69A 1TJHH 1XGTA 4NN5C 4MA8L 1A1OB 1NLBL 3N9GL 3RQ3A 4P2QB 2VLRA 2R0KH 2OR9H 3ARYA 4EZMA 5HYEA 4YC2B 1PDKA 1HDMB 3CFEA 4KI5E 5EOQH 5HHME 1N5AB 1RUQL 5DJXA 4JGUA 2D0FA 4MJIA 5DMKB 1I1FB 4IS6A 1IGYB 5D1XB 5IV2B 3OMZA 2UYLA 2KDGA 1W72H 3DXAD 1I85C 3GSQB 12E8L 2YD4A 2CK2A 3IDNA 1IGFH 1IGML 1S78D 1BM3H 4Z8FL 4Y88A 3BE1H 3BDBA 4NNXB 5I17B 1HWHB 1UZ6E 1LP9E 4JFZH 5K9OA 1AKJD 3T0EB 3DTXA 1OT1A 5GGRB 3TIEB 1NDGB 2APBA 2A83A 3MLVL 1A4KB 2H32A 3U6RA 1MHEA 3UTTB 4AYFA 1INQA 3QNZA 1YY8B 4HD9A 3KPRD 5FM5O 4UOW1 5E08L 3KR3H 2Y07H 4QNPE 1NFDE 5FYKH 3RU8H 4AEIH 2FIRT 2VLJA 4JZOB 3X3FH 1AD0B 4GW5A 4QRSB 3RL1B 4DJMA 4S0SD 1P9MA 5D70H 4O9HH 4HIHB 4W4NA 1JHLL 3CDYA 3S5LA 5T5FH 1G0DA 1X3DA 4RMSA 4YWGH 4F7PB 4U1IB 5DJYA 3U1SH 4XTRD 4A6YB 1S9WB 1NCBL 1FFPA 1ED3A 1OVZA 4P5KA 2KQNA 3FHAA 1GJIA 4QRRE 2JIXD 5C0CB 3V5KB 4R90L 5GZOC 4Y1AE 5HVGB 3HNSL 4OLYL 2MCPL 1B0GB 1K4CA 3RDTB 5JO5A 5KSAA 3CFBB 3LCYA 1AO7B 3PQYE 5DEGA 4AK1A 1FVDA 3UZQA 4J3WA 4PYHA 4Y5XA 5FFLA 2IBZX 2NLJA 5C0BA 4FQHB 4MVBD 4D3CH 4U2YA 5DJ2A 2HMIC 2HT3C 2YPVH 4MXVF 2KL6A 2QADB 4LVNC 3VI4F 4LKXA 2DQCH 1MSPA 5B3JF 1RZKC 1D9KA 2AJSH 1EERB 2E9IA 1A6TA 3QIUA 4EI5D 5CCKL 5BQ7A 2H6PA 5BS0D 2DS4A 3AM8A 4V1DA 4J12A 4P23C 4AEEA 4MA3B 3BZ4B 2BNRB 3JV4B 3RP1A 5EORH 4TUJA 3OJDA 1RZJC 4KRPD 1RJCA 1YPZA 4AT6B 1DQTA 3S4SA 1BHGA 1SY6L 2W60B 3JWOL 4JKPH 5CJQL 2IMNA 5M94B 4DOHB 1TITA 5C6PB 1J05B 3FB5A 3MCG1 1YMHA 4WY7H 1H5BC 3LB6C 2EDWA 1T0MB 1WC7B 4N0CD 3VI3F 4WNQB 5TDNB 1J12A 3LKSA 4ORZC 2HWZH 2IH1B 3LDBC 4MAYD 2C5DC 2P44B 2FZ3B 3TVMB 2XICA 2AJUH 4LARH 3ZTNL 3TT1H 3WN5B 1EFXD 1UM5L 2MPAL 4U7KA 4ZODA 4Z7NE 2DBLH 3C9NA 4EDXA 1BGXL 1MVFA 3LKRB 2IALB 1EMTH 2ADJB 4NQVB 1U8NA 5JXEA 4HPYH 3DYOA 3HE6B 2VDOL 4JN1H 1UWGH 5I1LB 5F21B 4ENEC 4NKMB 2WANA 1P5VA 1DDHB 4YHZH 3MRRA 1EO5A 1I9JL 4UAOB 4WI8A 4R2GD 2VDRL 2YKLL 2D0HA 4KTDH 1XCQB 3IDIA 1CXEA 3BW9A 3L3JB 3PABB 4J3VA 1MNUL 1KIQB 2PO6C 3Q2CA 4L4VA 5HHOB 3BDYH 3UJJL 2DDQL 5FECB 4HLZH 4K9EL 3VE0B 1CFNA 3IETA 3NAAL 1SJEA 5GGUB 3SDCD 5KANI 3A6BL 1FZJB 2Q8BH 5DF0A 1CE6B 3NN8A 1W0WA 3OKYA 2CR3A 4MX7A 4OM1H 4GQ9L 5E6IC 2VR9A 1DBMH 4PP1D 4M6NL 5IF0B 1BZ7A 3EYUH 2XG4A 4JM4H 2FGWH 2BMKB 1NMBL 2OZ4A 1G6RA 4JR9L 2CLVB 3D18A 3G5YB 4S1QL 5D2LA 4APQA 4OCNC 2YK1H 2D9CA 4JQIH 1HHIB 3QCTH 4XCCL 3ZDZE 5J12C 5I2IA 4A6YH 2C4FU 1IC4L 4JAMB 4PRPA 2ENYA 4CRPA 3C08L 5GJSL 3GO1L 4MDIB 5KSBA 5KOMC 2BSSA 1JNLL 1WCBA 1KN4L 3ZKND 1ZLVH 1KELH 5MENB 4PJCB 5T3XD 3MRMB 3D48R 3MLZH 2FJHA 3GHEL 3ILQD 4H88H 4WFGE 1QSEA 3HS0A 3WD5L 1AGCB 5ISZD 3RIAK 4Q6YA 1M4KA 3CK0H 1BJ8A 5F93C 3WJLC 1KPUA 3V5HA 1TETL 5ACZA 3QHZH 5EBWB 1ZE3C 2VQ1B 4TUOB 1OTTC 3N0PB 3U7AA 5DZNA 1MREH 3RWJA 1U93B 3ARTA 1U8OA 5ALBL 1NGWB 3W5NA 5IB2B 1T1WA 4ZG1A 4N8CH 5HJ3B 3Q5TA 2NR6D 4HBCH 2CRZA 4NQXB 4CADA 1F58L 2OXGA 2QTEA 3AGVA 2VLME 2W0KA 1WIUA 3G08A 4XCYA 4OI9A 1UWEL 2QQKL 2LTQC 1C08A 2VXQH 2FR4B 3H3BC 1JGVH 2YPLE 3S9DB 1HHKA 2OMNA 5TDOA 3DGGA 3L1OH 4GFTB 3GKZA 3EFDH 5KBNC 5C0FB 1NFKA 1AP2B 1S9KC 5J1SC 4NQDD 1A9BA 3BYTA 3QUXC 2QSCL 1ERNA 1Y18B 3SOBL 6FABL 1J1XL 1GGIH 4P3CH 5TPWH 1R5VA 4ZTPH 1C5DB 4IRZL 4L3EB 3MREA 2A6KB 3SE3C 1CXHA 3TZVC 4QRQA 1J0YA 5FKAB 3NPSC 5ITBL 4K8RD 3MBEC 5LCVL 1J8KA 1UJ3C 4YHKH 3B9EA 1GGUA 3M8OL 1DEDA 5HHQB 2XN9B 4ONGL 3QB7C 1S7VA 1HSBA 3GK8L 1I9EA 3RJQB 1I85A 2UVFA 3RVXD 1IVLA 3TO4B 1VESA 2OM5A 4HT1L 5I74C 2R9HC 2IJ0C 4RNRA 4HKXB 5I73B 4DFIA 4HUWB 5DQDH 1JPTH 1FP5A 2C4XA 4JPKL 4TSCL 4IOFD 3T0BA 3HE7B 3VRJB 1N2RB 1UEYA 1UH3A 4YLQT 4YXHH 3C5ZC 5CFHA 4GSDL 4M62L 2YRZA 1A6UH 4M9PA 4HFWB 4XHJD 1MEXH 1HIML 1IAIL 4PFEA 1J88A 3EYQD 3UC0L 3CJJA 4LSSH 2FEEL 3QDJB 2IANA 5K9KB 3LEYH 2QSVA 2KZWA 1AHWB 1F97A 3LPGA 1VSCA 3OF6D 1RZFL 2GCYA 5I1DB 3QYCA 3FT2B 2IMMA 5IVXE 3D1MC 3SQBA 2FLBT 3U9PH 5IFHH 2PXYB 4ZDHB 1TZIA 2P48B 1NH6A 4WHTA 2HKHL 1IKNA 1A6PA 5D96B 4HZAA 3VFMB 1N8ZB 1FFRA 1SQ2N 4IMLA 5BZDA 5E00A 5A2FA 4M1DL 4DQOL 3EDKA 5FGBA 4K3DL 1V7ML 1CD0A 3EO0A 1AXTH 1GVIA 43C9B 4PJGE 3WHE1 1OPGL 4R7NA 4UDUB 3NZ8A 2WQRA 5E2UL 1FYHB 2LAAA 4M7JL 1AGFA 1DBJL 2VUYA 4LLWB 4WUKL 5E8PA 3TEUA 1FNEA 5CZVL 2Z8VC 4JRYA 4G5ZL 4HC1H 2NY2B 3OKEA 4XRCB 1VADA 2FHFA 3QDAA 4EUPA 1QBLL 2VZUA 1WBZB 1J7VR 2XTJC 1CFQB 4P23A 1IGCH 1KIPB 4PGDB 4ZAKB 1HH9B 1U91B 3BSZH 4KK5C 5HPMA 5IBLC 1MCSA 3CDCA 1CCZA 3NCMA 4NQSA 2YOCA 25C8H 5DFVC 1CXKA 4LCIH 3UBXA 2VISA 4MMZC 2NY5H 4HQQL 4P2RB 2X7LB 3IAGC 1JGUL 4JFPB 3OKOB 5FYKE 4OV5B 3Q5OA 2A6DA 4L8SC 3WNKA 4ZO8A 4CUCA 4Z7OE 1OGTB 5D1QC 5HGBB 3NCJH 3VD5A 2OZ4L 1G6RL 5JIHA 1P5UA 4OZIB 1KB5H 2QKIA 4P2QA 5JA9A 1BFVL 1MIEL 1N5AA 2AERT 3DIFA 5DMKA 3RVTC 5GHWL 1QSZA 2YA1A 4E0RA 4NRZB 1KN2L 5D1XA 2V5TA 2MCG1 3P9MB 3IFLL 4RFNC 4UU9A 3GSQA 5D1ZB 2EDBA 3ZYIA 1U8IB 1J8HE 1QPXA 1JWUB 3AC0A 5I17A 5I18L 1SEQH 2RJMA 4Y5VB 4K94L 1RJYB 2JK5A 3T0EA 4M1GH 3ZL4H 4HCRA 4JFYB 5FGSA 5GGRA 3TIEA 3KXFE 5FM5M 1JHKL 1KCVL 1NDGA 5D2LF 1A4KA 4U7MA 2LVCA 2X4NA 3UTTA 5JZ7C 1YNKH 1YY8A 3U7WH 2J6EA 4XHQA 3RUGB 2P5EE 4M7ZC 4QRTB 5CWSA 2CK0L 1KLUB 2QSTA 2ADFH 3BEWB 1CU4L 1NLDH 4G8IB 4JZOA 5E6IA 4HUKB 4JY6B 1AD0A 2MTPA 4U1JB 4OZFG 5KW9H 1EHXA 4QRSA 5IM7A 1TNMA 4S1SL 1ROWA 5BRZA 1I1YA 3QEQD 3WO4C 2ATKB 1K4DA 4HIHA 2N7AA 1F3JA 4OT1L 2AV7B 2NX5B 1LO3L 3SDDD 5TDPA 2XWJB 4F7PA 4JY5L 4U1IA 3S36X 1G1CA 3TCLB 1N0XH 4RMUA 2R69L 2IAMD 1FNAA 3FFDB 5D7LB 5MP6H 3MLRH 5AWNH 5T1KD 3GMPA 1LDSA 3SKUD 3V0AC 1FFOB 4XBEL 4X9GA 2FHCA 4F9LC 5C0CA 4HWBH 1XGYH 4XI5C 1WBXA 1WGOA 4EIGB 5FF6B 1B0GA 3RDTA 4IIQC 3WSQL 4XNXL 4Z9KB 1YJDC 3CFBA 4M48H 3VGDA 1AO7A 4MCZB 3OGOE 4Y4HC 4OIBA 3A6OA 4P2OD 1P69B 3RVUD 1PG7H 1LMKA 3MNZB 4ZOAA 4FQHA 4PJFF 3QA3B 3HKFA 1GAFH 3WJLA 1MCOH 4I0KA 4Z0BH 3IXTB 3GSNA 3MLXH 5E9DE 1DJSA 5TE6H 4PTTA 1CGSH 3TPUB 3UCRA 2CKBH 2HLFC 3G6AB 5DQ9A 3MA9H 5KVDL 4PJ5B 2BNRA 1G7IB 4NQCB 4G3YL 2R0LL 1RIHH 4H8WH 4AT6A 4I2XA 2W60A 2DI8A 4UTBL 3RY5A 3VFTB 5LXGL 5F1NA 2BHZA 4Z7VE 1J1PH 1J05A 4MA1B 2XXCB 4KQ3L 3LQAH 3PXJA 4NSKB 3X12B 5HD8D 4PRIA 3VRIB 4WEBL 2MCPH 3ARSA 3LEVH 4HWNA 5CJ5A 3MXVL 1KB9K 1T0MA 1WC7A 2VXVL 5SX5H 5EU7E 1DVFC 4WNQA 5TDNA 3L3GB 4U3HA 1TZHB 2IH1A 3P11L 4PJ7B 1E6OL 2FZ3A 4G6JH 4OZHB 2Q87A 4JRXD 5CGMA 2QQNL 1X5YA 3WN5A 1E6JL 1HQ4B 4X5LA 1DBKL 1RHFA 4NPYB 2IALA 4E42B 5E2TL 3I6KB 2ADJA 3EOAB 4TPRL 4EN3D 1S5IH 1CFTB 4M02A 5J7CC 3V0VA 5CCKH 3AAZB 4OF7A 3SE3A 2H2SC 4FXLA 5I1LA 4Y8AA 2NY6C 4YXKL 5BO1L 1FORL 3MBEA 1DDHA 2A74B 2IGFL 4OFVA 2D03L 1QSFB 1A1MB 3CH1A 2LABA 4LFHG 1CLYL 4ZNEE 1KC5L 1MCEA 5EU4B 3QDGD 1XCQA 2D7QA 2Q8AH 2XTLA 5C2UB 3D3VB 4OF3A 3PABA 1A6ZA 3SKMB 5I1EL 3S6CA 4QWWD 4X80L 2B4CC 4PJAE 2BVQB 3LKPA 1YUHB 4LEOB 2I9TB 5FECA 2EDTA 3VE0A 4Z7OF 2W65A 2ZNXA 4KZEH 4POUB 3I75B 1MF2L 4CDGC 1FZJA 2H45A 1CE6A 3QUKA 2AABL 4DN4H 1MCQA 3IGAB 4KROB 3C6SA 3K0WA 4OZFB 4FFZH 5GS1B 1XF1A 2FX9H 5HDQH 1ZV5A 2DQJL 5C08B 3GBMH 2OTUB 1OAUH 3MCLH 1UM5H 2MPAH 5EZLA 4JG1H 4ZS6C 4LEXH 4LLVA 2RBLA 3QIWB 3VFGL 5C0JA 2BMKA 5E99L 3ARFD 3U46B 3G5YA 5CSGA 5CEYA 3UYRH 3GMQB 2J88L 4QHKI 4PJIE 4I0PD 4O51B 4JAMA 1OHQA 43CAB 1BBJB 4AJ0A 3JV0A 3O6KH 1MPAL 1YDPB 3AS0A 2BVPA 3FHQA 4I18C 4WFFD 5EIQA 1MHHB 2DOCA 5MENA 4PJCA 3LY6A 1LNUB 1NANH 1LO5A 2AAVA 2F53E 2BY3A 4CVXB 4MNQB 1HXYB 5DWUL 4ETYA 5JW5B 2GHWB 3B4NA 5HHVL 5LAXB 3LPFA 3WEXB 2VUOA 3STZB 4FNLL 2F54E 4MSWB 3P4NB 1QA9B 1S8DB 2XWBB 3K3QA 1NUDA 2VABB 1A02N 1FZOB 5EBWA 3ARBD 2AI0H 2VQ1A 1ZT4B 4GQ9H 4QTHB 3FN0H 1D5XB 2YMXH 5T33L 1CL7I 1U93A 2LQRA 1A3LL 1NGWA 1U3HB 1NMBH 3PDOB 3BKJH 5HJ3A 4DVRH 5EUOE 2VO5A 2DBJA 4YEEA 4NQXA 4YUEL 3ULUD 5F1KC 1IILE 2UUDK 1IC4H 5HI4C 4HCRL 1KENL 2JELH 1KJVB 3C08H 5GJSH 3C5SB 5F6IC 1FSKC 2J6EL 5HI3D 1RUKL 4FQLL 4X0KB 4XBGA 1ZT1B 5HDOA 5A16B 4U1LB 2ILLA 5C0FA 1MWAA 4X5XA 4PRHD 4PRHE 1AP2A 4IM8A 1U8MB 2ZUXA 4F7MB 4DCQB 4YQXL 5I30H 3SDXB 3QUMB 2IBBA 3BJ91 4U6XB 3C8HA 3RY4A 1BD2E 2D0GA 1Y18A 1TETH 1I1CA 4PJ8C 1LVEA 1C5DA 4L3EA 1E4XH 2VDKL 1Z9LA 2AEQH 1T04A 3VGEA 4O5LL 2A6KA 4LGPB 2A1WH 5SV3A 4HF5L 4C57C 4XVUC 5KSVB 2VTFA 3L3DB 3OBAA 5FA3B 5FKAA 3PWNB 3U2SB 1TCMA 3HA0A 4WTWA 1OP5K 1U95A 1MAMH 5ESQB 3N1PC 1DBBL 5HHQA 2XN9A 4Z7VF 1DL7H 1EGJA 1JWMB 4AZ8A 4RA0C 2H1PH 2V5MA 3PP3K 4TSAL 4HJGB 3E8UL 1BWWA 2R1YB 4KVNH 1J9CT 4HKXA 4YK4C 1ODAA 3BEVA 3KYKL 4LRNL 3ME0A 3ECBA 3T4AB 1A7PH 5BJTA 3GSNL 4I3GA 4AMKL 1EHNA 3IDYC 4HAGA 4XWOC 4JFFD 4XWGH 3HE7A 4JFFE 3VRJA 1N2RA 2HLAA 5HGGS 4JANB 2RCSL 3V9FA 2VWEE 4MS8D 1H3PL 4JKMA 4KK9C 3JTTA 3AFLA 2CGRH 1VGKB 4XH2A 3SOBH 5KJRH 1J1XH 3QDJA 2PTTB 4KKNA 5F70A 5C0GA 4IRZH 3T0WA 5K9KA 1XF2B 1YEJH 1F13A 3DETD 3TYGL 4LVOC 1FG2A 1CICD 4LF3A 5J6HB 2Y5TB 1NMAL 1UEMA 4OGAC 1RAMA 2PXYA 4ZDHA 4BA8A 1I3VA 3VXSE 2E7HA 4ONGH 1UM4H 2HJFB 2XFXB 4TVPL 5H94B 3QJFB 4RRPG 3LVEA 1CS6A 1FVCB 2I07A 4KJWC 5EU6E 1OTUC 5F1IB 1JPGB 3KYNB 4UDUA 4AEHH 4RGOL 2JJVA 4Y4HA 1HN1A 1GZQA 3STLB 4L4TA 3E1F1 3I6LD 2WNGA 2X1XR 3I6LE 2DQUH 2X4QB 2BDNH 3VXME 3TBWA 1QVOB 2AQ2A 4XRCA 3MV9D 4F9PA 2NNAB 4D9RE 1IC1A 1WBZA 1CFQA 2YD3A 2E6PA 4KDVA 4KTEH 3MGOB 1U42A 3HI6L 4U7SA 3RTQC 1KIPA 4KV5F 4PS4L 4ZAKA 1HH9A 1U91A 1I8IB 3FZUD 4HG4K 2HKHH 4RSVA 1XGRB 3QUYD 1WLHA 4GRWB 4MD0B 3MRBB 2AXGA 2NXZD 1JYNA 2JJSA 3RZCB 4C56A 4P2RA 2X7LA 4GAYB 3TBYB 1X9QA 2XPGB 4P99A 3SJVD 1EPFA 2EO9A 1I3RB 4OV5A 3KLDA 1JPST 1RHHB 5JXAH 4U2ZA 4HPOL 2EICA 1DVFA 1OGTA 1ZA6B 2NXYC 4NBZB 3UXFA 5KZCD 3JVGC 1KEMH 4GT7A 4AG4H 4OZIA 5E2VH 5CZVH 2X05A 3PGCB 4MLIA 4AIOA 3MROB 1QFWM 4R4FH 3UPAA 3W11C 1MFDH 5SWQB 3WHXB 1O7VA 2X4PB 1OAYL 4NRZA 4CN1A 3RGVC 3MMEB 4PJXB 1MELA 5D1ZA 5AZEH 1ES0A 4JFDD 4N0FA 3KYOB 1U8IA 3VXQB 4FABL 3U9UB 1JWUA 3INUL 3W0WD 5IT2L 2EYRA 2FJGB 5I71B 3L3KB 1GRWA 4JFYA 4H20L 1VACB 4AQOA 5C92A 2D7MA 1LEGB 4QRPB 1PEZA 2RHEA 3U36B 4LP4A 3GI8L 3CFCL 3RUGA 3BMWA 1NSNH 1ZAGA 4QRTA 3D39B 1KLUA 1S3KL 3BEWA 3U4BL 4G8IA 4PLNC 1G6RH 4K7PX 4JY6A 2B7DT 4U1JA 1RURL 4KDWA 3TA3B 2D7OA 1RIVL 1TPXB 1BFVH 4UT6H 4Z7WA 5J0BA 5FUZL 2VXUL 1JF6A 1MCBA 5HXMA 2AV7A 2NX5A 1S7RA 2HFGH 4AIZB 2XWJA 5GHWH 3RBSA 3CLEL 3TCLA 4IBLT 2W92A 3IFLH 4OLXH 5IMOA 3DX9B 4IEFB 1FFOA 5GRJL 3O3DA 3FB8A 1QNZH 1X4YA 1MWAL 4I18A 5FF6A 1UXWB 3PWLA 2OJEB 5I18H 4IOIB 3BI9X 1B90A 3V79C 1NGXA 4BYHA 1E4JA 4M3JA 5J9PB 2AJVH 4QCIB 4PP2A 1DUYB 3MNZA 4HMEA 3VWJD 4WUUA 4FQQB 2J5LC 3QXAA 3WLWC 3NIFE 5C09E 4FQXC 5K9QG 2G5BB 3TV3L 5AEAA 4Z7UB 5HYFA 4BSWB 4LSUL 5FV1L 1KGCE 1RU9L 2AJXH 4Y5YC 3RWFB 4YHPB 4JFXB 1ZKAA 1GGBH 3L3IA 3TPUA 3WNOA 3G6AA 2B2XH 1GPOL 4P49A 4WV1B 1EGJL 2ZG3A 4JGJA 5F7YC 1G7IA 2BERA 2IADB 4S10A 3SDAB 3QQ9C 3MV8D 1MRDL 1BOGB 2WP3O 4U1GB 3VDBA 15C8H 2Z92B 5DHXB 3X12A 4JO3H 5M7QA 5KN5B 5FO8A 3VRIA 5CP3A 4E9LA 3SGKA 5CD5D 4NM4L 4JREC 2Z8RA 1KJ2A 4U0QB 3B9KD 2XNAB 1TZHA 3V6BR 4OZHA 1OF2B 5BXFB 2EXYD 4KKLC 4ODHH 3NZHL 3VMPA 1HQ4A 1RJZB 4WI6A 2VLKD 3X3GL 5FGCE 2J2ZA 3LSOB 2GJ6E 3KPSA 4ZYKB 4E42A 5IQ7H 3I6KA 3EOAA 3OAYK 4BELD 4CAGA 1CFTA 4DVBA 3V52L 4NJ9H 1IEHA 4AENB 3AAZA 3PGDB 5FXCH 5KVDH 1K8DB 5JUEH 3W2DL 4RGNE 1Q0YL 2A74A 1N5YL 3IFOB 1RSFA 2X89D 2NY3D 3QUZC 1A1MA 2R0LH 1TNNA 4Q2ZB 5EU4A 1F8TH 2FB4L 4TNWF 4XNYH 4J4PD 1YJDL 2AGJL 5C70A 1GGTA 4W68A 3SKMA 1RV6X 2BVQA 1YUHA 4JO2L 4LEOA 5IBTH 4C54A 2I9TA 2DLEA 1DLFH 4LLDB 3U82B 3TWCL 5EWIL 4OCRL 3I75A 3O9WC 3MXVH 3IU3B 1P7HL 2ZSWB 3IGAA 4OZFA 1IGJB 1G7PA 2AJZA 5C9JB 2GAZB 4P0DA 5C08A 3P0VL 1ETZB 1MIMH 3NOIA 1DBKH 2RQ8A 4QGYA 2OBGA 3QIWA 1PG7W 5D2NB 3BZFB 3MUZ1 4HBQA 2R29H 4NC1E 3WO3B 3PNWB 5FHAL 3FO9B 3GMQA 4O51A 5L88L 43CAA 5K59F 1BBJA 3FFCB 1HK6A 3RX5A 1OAXH 4P5MB 2HKFH 2J8UF 4ELME 1CLYH 1MHHA 5J13B 2OK0L 5IKCB 3V7AG 5TE4L 5A3ID 2VLRE 5FUCE 2GTWB 4MNQA 1HXYA 4MJID 4MJIE 3WEXA 3T0DA 2CIIB 4K2UH 3STZA 1PKQE 4FRWA 4MSWA 1QA9A 1D5BA 5DURB 3GBNL 1S8DA 1NBZB 2R15A 2GJZB 3DUUA 2XWBA 1MJUH 2VABA 4D2NA 1FZOA 4P9HC 1RZKH 3L3HA 4XC1L 4JDVB 1FO0B 1D5XA 2DQJH 1TVBB 3O8XC 3UZEA 2HT2C 2CLZA 4FMKA 1F42A 5A2IH 2GK0A 4NWTH 4BH8B 3UAJC 1RZJH 3PDOA 1QLFB 3QHTC 4Z76B 2PF6A 5C0NC 1YEFH 2IH3A 4NGHL 4OSUL 2WBJB 5DJ0B 1IQWL 4G6KH 3UX9B 1ORSA 1T6VN 1KJVA 2C3WA 1UFUA 1YMMB 3S37L 2ESVB 3QFJB 4OZIF 3C5SA 2VLJD 4WO4C 1RK0A 4Y0GA 3OAUL 1FPTH 4LASH 4U31A 4OJFL 4X0KA 4JHZA 1ZT1A 1UCBH 4H25B 5HGHB 5A16A 4U1LA 4KAQL 1HHHB 1JN6B 4KJYA 1U8MA 4DCQA 3IDXL 5JR1H 3SDXA 3QUMA 3AY4C 1NMCB 3VFSB 5BCAA 5F7UA 3JVGA 3OJMB 5IGXH 2C1PB 4YX2H 2E27L 4XT1C 5DRNB 4X9BA 3HN3A 4CU6A 3L3DA 5FA3A 5KSAD 3BPNB 1EA9C 1U8JB 3PWNA 4QEGA 1A3LH 3QO1B 4ALAH 4MAUL 2H8PB 3QDHA 3MR9B 5GRUH 4ZFZA 2K1MA 5C0BD 1PSKH 1CD1B 4R0LB 1KIRB 3RUGF 4M6OH 3KJ4C 2GITA 5ESVB 2C3HA 2ZCKH 4HJGA 2R1YA 1V5JA 1LILA 5LBSH 2KZ1B 2DM7A 2F8VA 1NAMH 1GH7A 2P8MB 1A2YB 3RWHB 3WNPA 4V1DE 3C6LB 3TBVB 3UTQA 4YHYC 4CU7A 5LQBH 1S78C 1Y0LB 3MBXL 4L1HA 4YQXH 1D3CA 4M4RA 1YPZE 3RZWA 3P4OB 4GBXD 5B22A 1HEZB 2PTTA 5CGYD 3V8CA 1XF2A 3EOTL 2C1OB 1RULH 5GGQH 2WV3A 5J6HA 1AR2A 3WXVL 5B8CC 2Y5TA 1DEEB 2EDJA 3RIFF 1DBBH 1Y6KR 3QAZC 5C0EB 5ITFB 2XFXA 4HFUL 3FB7B 2J4WL 1AGEB 4WWID 4CVWA 1AH1A 4DEPC 3CIQA 1FVCA 1OSPL 5C8JA 3LN9A 4J23A 5HVHC 5F1IA 5JXED 1JPGA 2B8OT 4XTRC 3HZKB 5ESAA 3GSNH 4O2CA 1V3LA 1BJ1J 5CKGA 5IB1B 5BVPL 1IM3A 3W9DB 3PP4H 3LRHA 4FQXA 7FABH 1SVCP 3S35L 2EEBA 1QVOA 3GMRB 1SBSL 3JUYA 4JHWH 5JPMB 3CSBA 4L4VE 4WW1B 1QQDB 4X8XA 3TYGH 3RNQA 3SO3B 2DICA 2R56L 2EYSA 4MVBC 4FQIL 3MGOA 4XCFH 3KHOA 4QOKE 1NMAH 4HJJH 2DKUA 1V05A 4PJ7F 2YXFA 3HG1B 2BK8A 3I85A 4Y19D 4OZHF 3TBSB 1T22B 2QSQA 3MLWL 2BJML 3TH4T 4MD0A 4EI5C 5ICXA 3RZCA 4IMKA 2R4RH 2XPGA 3WIHA 4ZPVB 4JZJB 2XZCH 5CJ8A 1RHHA 2AK4B 4EQ2A 4KRPC 4ZXBB 2ZOKB 4RGOH 2XXMB 4X7FC 3T4YB 1ZA6A 4PRPD 3NCBB 4PRPE 4Q6IB 3N1MC 4RDQG 5LGJB 2MQ0A 2PYEB 2VIRB 1F3DJ 5KSBE 3MOAL 3PGCA 3C60B 5KVFL 4KQ4H 4EXKA 3ZE0F 3MROA 3GUTB 4X6EB 1T1YB 4N0CC 3AS3A 3SCMB 5SWQA 3OPZL 2X4PA 3LHPL 4M7LH 4MAYC 3BPCB 1QSED 2BY0A 2QHRH 4IHOB 2BNQB 4LCCB 4PJXA 3WIFB 1N64L 4PJEF 4RWYL 3KYOA 35C8L 3VXQA 3PGFH 4MXWL 4KKBD 4N1HB 4U0RC 2QEJA 3QEHB 5DT1H 5DJ6B 1HYSD 2V2WB 3O6FB 1OM3L 2Z93A 3L3KA 1L4IA 1WK0A 1OAQH 1NDMA 3VXUD 4QRPA 1MLCB 1WZLA 3ZKMD 3U36A 1CFVL 5DTFB 4OM0H 4R2GC 4EBQH 2PNDA 5BV7B 4X6FA 3HMXH 5GGSY 2X4OB 1QBMH 4FXGB 4NZJA 4KWUA 1IEBB 4JFEB 3VGAC 1G9NC 4GW1B 1JP5A 4KRMB 4BSVA 5FHBH 1CK0H 3BH9B 3TA3A 4Q74A 2R1WB 3SDCC 4RMWA 4NFBA 4PRNB 5IMKB 3JWDC 2AW2A 4MNGB 4AIZA 1S5HB 4MQSB 4XP5L 4ZUSB 3BO8B 4XNMB 5CKAA 1RVFL 4UIMB 4TNVK 3DX9A 4PP1C 3R0MA 1XAUA 1G6VK 4RRPA 3QQNA 2ERJC 2IWGA 5JTWA 3WLBB 1N6UA 3GBLA 5EIVA 3NPZB 2H3NB 4DTGL 3BRDA 5IT2H 2OJEA 5C7XH 1EEUA 3QUML 3BKYH 3W5MA 3EYSH 4F33A 4KUCF 2EE2A 4QCIA 3VG9B 4XXDB 4FQQA 1ZK9A 2P5WB 2ZCLH 4EDWH 3ZKNC 2G5BA 3IJHA 2OCFD 3CFCH 2OMBA 4Z7UA 1KLGB 3QRGH 1PKOA 3RWFA 4YHPA 4JFXA 3OKDA 4RFOH 3ILQC 3FQXB 1T03L 1HI6B 2DQFB 3T3ME 1A1NB 1IT9H 3PWUB 4WV1A 1R6VA 3NIGF 3T2OA 1D6VL 3FT4B 4LNRB 1NQBA 3CLEH 1FRGH 3SDYL 3SDAA 4G7VH 3ZT6A 1BOGA 3WFCL 1VGEL 5GRJH 2ATPB 2G75B 1MWAH 5KN5A 3VMNA 4M61B 5FDWB 2IAND 4WO4A 1A7OH 2IANE 2ZUTA 4CMMB 2NR6C 1W0VB 5ILTH 1XF5B 5H37H 2XNAA 5DD3L 3K46A 5E56A 4PB9L 4XB7A 2G2RA 1DR9A 2HJLA 2XY1A 1OF2A 5BXFA 5JHDA 2DN7A 1Z6JT 5TQ2L 3SPVB 4I3SH 1LO0H 3AY4A 5IQ9A 3TV3H 3D0VB 3AMKA 3O3AB 3LSOA 1CDCA 4ZYKA 5IJVA 4LL9A 1V3KA 2ZWLT 3WS3A 2Q7YA 1GYAA 2VXSH 4TUKH 3PGDA 4AENA 5AYUH 4HIJA 1K8DA 3CVHB 5L2JA 3C09C 1AGBB 2VN4A 4R3SB 4B7LA 4U1NB 1QYGL 4S11A 3AMLA 4JRYD 4JRYE 4K8RC 3W82A 1MFCH 4HDIB 4LLDA 5L7XL 1HCVA 2LVEA 3BQUD 2CJUL 3CFJA 3NTCH 3CDGB 3DXAA 4WHYG 3IU3A 1T66D 1FCGA 1QRNB 5FOBB 3RVXC 5FYJU 1IGJA 1EJ6A 1RIUL 3QXVA 4LSTH 4NNYB 5C9JA 1WFTA 2YD2A 2GAZA 1YQ2A 1ETZA 3S36H 5MI0B 2PN5A 2P42B 4X7DC 1TQCC 1U8QB 3S3PA 3BZFA 5DK2B 2NZIA 2EIDA 3PNWA 3FO9A 4IOFC 5T3ZL 1OAZL 5EBGA 2E7LC 3KPNB 1O7SA 1JPSL 4R97B 1IAII 3FFCA 4DGYH 2FEEI 4XHJC 1Q0YH 3WIHL 1CT8A 3U0WH 2YBRB 2DWDB 3EYQC 4P5MA 4OQTH 3WBDA 5I9QC 3SE9H 3OGCB 1MJ7H 3MLYL 2B5IC 3C2SA 4P2QD 4U1SB 2DTSA 3L5XH 1MQ8A 2GTWA 4FZ8H 4LIQL 4YH6A 4JO2H 1PYWA 1AC0A 2V5RA 5E2WL 5KVEH 3QZWG 5D1XD 4PPTA 4GOSA 1IBGH 5DD1L 1NBZA 2GJZA 3SE4C 4JJ5A 2JIXA 5LG1A 5DHYB 4FFVD 4JDVA 1FO0A 3MFGB 4GRWF 1FLRH 1WZ1L 1BP3B 5TE7L 3GMOB 3BVNB 3T0ED 5C07B 5CUSL 4UTAL 5C6TH 4Z76A 3P30L 5MEOA 2KUTA 5CILH 1FH5L 4Z95H 2WWKO 3UTTD 2WBJA 3UTTE 1B2WL 5DJ0A 1FHGA 5C0AB 4NRXB 4X7SL 2JJTA 2X1OA 2APVA 3DMMB 3QFJA 1EAJA 2YZ1A 2K9UA 3R06B 3H42H 4PJDB 4XP6H 1DN2A 1NGYB 1N7MH 1UENA 2A6IB 5HGHA 5BRZE 2ICES 4X9HA 5HDLA 3NMEA 4GO6B 1JN6A 4PJXF 5EUKB 4Q9QL 5IMLA 3VFSA 4ODSL 4PBWD 4DKEL 4RMVA 1LEKB 2BOBB 4KGLA 5C0CD 1MRFH 2C1PA 2G60H 3AREB 3D25A 3ZYOA 3OKMB 3N1QC 5DRNA 3RDTD 4E41E 1P4IH 3EAKA 4GXVH 1AY1L 1U8JA 1TZGH 3TNNB 4JKLA 3QJHA 4LLMB 1AO7D 1AO7E 1JYVA 1CLZH 4MAYA 5FA4B 3G6JB 2R0ZH 3MR9A 2ZKHH 4R0LA 1RD6A 1NCAL 4IDJH 3GRWA 3X11B 2DJUA 1PFCA 5ESVA 2B4CH 2QADD 1A7RL 3NFPB 5EZIH 4PGEA 2PR4H 2HYMA 4ODTH 1IM9B 3O4LB 1GHFH 3IFPB 3ZHDA 4DZ8A 3L7FA 5B38G 2P8MA 3MLUH 3Q5YA 1A2YA 4M6MH 3RWHA 3GJFK 3TBVA 2BNRD 3DJ9A 4P9HL 2X41A 1FL3B 1Y0LA 4PY7B 3NACL 5A43C 1I9RL 5EB9A 1MCPH 5EO0A 3P4OA 3NIDE 4LLUA 4I2XE 4M93B 1TJGL 5IB4B 1QUNA 2QJDA 2VDQH 4XMKH 3JV6B 4WWKB 4PRIE 2UWEA 5J89A 4TVPD 4YFDB 4HUUB 1KTDB 5HGAB 5D93C 5KS9B 1KACB 2MOVA 5C0EA 5ITFA 3TVMD 4JG0H 1Q1JH 5E5RB 3FB7A 3RPKA 1AGEA 4XPTH 1GGCH 4Z7UF 2CQVA 1RZ8A 3TN0B 1LO2L 4NC2B 1CR9H 3SDDC 3QZWB 1ZLUK 3F58L 2X40A 4HJ0D 4Y4FB 5L6YL 3HE6D 5F7EL 4PG9A 3HZKA 3OXRA 2IAMC 4K71B 3O2DA 3VW3L 3NFNB 5DRZB 5I75B 1F6LL 1AJ7H 5JOFB 5AUMB 1G9EA 2C3XA 3S97C 3W9DA 1HZHL 4G6MH 1A7NL 4NCC2 5DVKA 3Q6FA 4N1EA 2E5EA 2D7TL 3GMRA 1T1ZB 1IAKA 5JPMA 4P2OC 4WW1A 5HHOD 3RVUC 5IEHA 1UH4A 5ISZA 4WDIB 3P73A 5HGDB 3QNXA 1XH3B 4JQVC 5DD5L 4CW1B 3LKNA 2J7LA 3TBSA 4L3CB 4JY4B 3BWAB 4UUJB 2A9NH 1MJJB 1X5IA 2WINA 1BPVA 1A7QL 1KJ2H 1MJ8L 2EIZB 4P4RA 2UZYB 1U9KA 4ZPVA 1XIWB 2MHAA 4JZJA 2AK4A 3O2WH 2DD8L 3ROOA 4ZXBA 1RMFH 5GS0L 2ZOKA 2WZPD 4XP4L 3T4YA 1NKRA 4X4MA 4FN0A 4Q6IA 5LGJA 2VIRA 1JZ2A 4Z5RB 5HD8C 1NGQH 5CZXD 3ZE1F 1NCUA 5LGHH 2DQTH 3GUTA 3QEGL 4X6EA 5EOCH 1KEGL 4FQ1L 5MEND 5MENE 4WJ5B 5EU7C 3SCMA 4L29B 4JB9H 1Z2KA 5F9OL 5E03A 3BPCA 2V2TB 3QH3B 3T2QA 4IHOA 2BNQA 4LCCA 3WIFA 3O4OB 3TYFA 2FX7L 4FQIH 1JJUA 4NIKB 4Z78B 4OTXL 1ZHNB 5GS2H 4F15B 2ZG2A 5I1HL 1KV3A 3RWGB 4EN3C 1CXLA 1LE9B 3ZKXC 1FIEA 5D72L 2IG2H 2FSEB 5DJ6A 3V4PH 1EJOL 5B38B 1ACYH 1CE1L 2V2WA 1MFEL 3O6FA 4RAVB 2Y7QA 3TGXA 2FLRT 4ETQB 2BC4B 4G9DB 2DMCA 1JFQL 2C9AA 5JQ6H 3KS0H 3HR5B 4OBRA 1RK1B 5EULV 4NRYB 1MLCA 3X17A 4U05A 1FO0L 5DTFA 3WHE0 4MGXA 3WXWL 1YN7B 3U83A 2JCCB 3K8LA 1MFNA 4UT7H 2X4OA 2XTJE 4FXGA 1P6FA 5C0RH 3HPLA 4HS6A 4MXQD 1S7WB 3ARXA 4JFEA 4WCYH 4QWWC 4GW1A 2I9LB 5I1KH 3BH9A 3MOAH 5L9DH 1T20B 1CFBA 5DD6B 3O6LH 2R1WA 4PRNA 5IMKA 2C3GA 5FB8B 3O6MH 5L2KB 2V9RA 3HRPA 4DAGH 1DSFL 4ZUSA 5I0DA 3BO8A 4XNMA 4PV9B 2E7LA 5IFAL 4HX1A 4UIMA 2Z91B 4KZDH 4OD3L 1N64H 3C8DA 4J3UA 4MXWH 3SHSA 3UPRB 3UBXI 1U8PA 3VJ6B 4L3ED 5IG7B 1R24B 3ARFC 4L3EE 1ZHBB 5I8OH 1R3IH 2V17L 2EXWD 4I0PC 4YNYB 2AXHA 4JGMA 4K71C 4XMPL 2CDFA 2DQGL 3CUPB 4PBVC 4N5UA 2ITDB 2HH0L 4GMTH 4XXDA 3HC0B 2JB5L 1CFVH 2P5WA 2XN9D 2XN9E 3GIZL 5TQ0H 5L0QB 1KLGA 3LS4L 1KT2B 4L4JA 1N6QH 2DI7A 4MLSA 3TO4D 4F58H 1YA5A 1A1NA 1G9ML 2R23B 3GRWL 3O2VH 3UJIL 1NCTA 3FT4A 4LNRA 2WBKA 1BECA 1S7SA 1PW3A 3FOLB 3ARBC 4JM2B 3HE7D 5MEPB 1NCWL 2RAMA 4BZ2H 3MX0A 5FK9A 5EC2B 1MH5B 1U58B 4HK3J 2ATPA 4NQTA 5DUMH 3MCKA 3QDJD 5FDWA 1RUML 3IDMB 1W0VA 2ENSA 1XF5A 3ULUC 4M5YL 1YEGH 2VDNH 3BZEB 4GAGL 5DEZA 1G9NL 4GAJH 5GXBB 2PXYD 1U3YA 5CHNB 5F3BB 2GT9A 4XCEB 4Y89A 3D0VA 3MRDB 3O3AA 3OKLB 5F9WB 5E8DH 5HI3C 3VFWA 3L9RB 2AEPH 1U0QA 5GGSB 1AQKL 4NHCH 1OGAB 1T7VA 1NCCH 4ONHB 1IMHC 3CVHA 2DQEL 2I5YL 5HBBA 3L5IA 1D6VH 1ORQB 4G8GB 4NO5B 1AGBA 3DECA 3LD8B 5IHZB 4R3SA 3TPKA 4MJ5B 3QPQD 4ZFOB 1F90H 4L4TE 5FCUL 1EUUA 1VFUA 1KIUA 2DLFL 3N85H 2G9HA 2Y6SD 1ZT7B 3O2DL 4LLYA 2YRLA 3HB3D 3MV7B 4UV7H 3T2NL 2NY2D 2RB8A 4KMTL 4TULL 2WSKA 1CDBA 4HDIA 3MGTB 5DVNA 5FYJH 1UACL 3CDGA 4MD5B 5GGTA 4PG2A 1HKLL 5DD3H 1QRNA 5FOBA 3MJ9A 4JFDB 4ZAKD 4NNYA 1QG3A 4UQ2A 2F5BH 4BKLA 5TQ2H 3D85B 5K93A 2BSED 4KC3B 1V8HA 1BX2B 4FZEH 5DK2A 4C56E 4P2RD 4P2RE 4MHHG 2VE6B 3KPNA 4JCMA 1J5OH 4GW4B 4MS8C 3VWKB 4XVSH 1ZWIB 5DUPL 1FNGB 2YBRA 1FCCA 1VCAA 5IB5B 3OGCA 3T3PF 3DETC 4W4OC 3UTPD 3QIBB 4FTVE 2HP4A 3V4VL 4L8BB 1CICC 2YHGA 1ZEAH 4LCYB 1JVKA 2EH7L 3A67L 4R4BA 2DRUA 2V7NA 3WL9B 3PV6B 3GI9H 3P0YH 4IOSD 1QLRB 5D1ZD 1FIGL 1A8JH 3MODL 4XBPA 5DHYA 1NL0L 1MFAL 2FO4B 3T08A 4HK0B 4UIKL 2EH8H 1C1EL 1I8KA 2LU7A 1KCRL 1YQVH 2VKWA 3GMOA 3BVNA 3OL2A 5C07A 1CGYA 2R8SH 2DM4A 4RMTA 5TGBB 4PD4J 3PV7A 4XVJL 4C4KO 2YD7A 4Z0XB 1DUZB 1FBIL 3ULVF 4ZQKB 1B0RA 5C0AA 2J1KA 3DMMA 3CSGA 5IHUL 5J57B 3IS0X 1Q9KB 1E4KC 3S3SA 4AH2B 3UP1A 1NGYA 4PBXA 1NEUA 2A6IA 3A6CH 4KU1A 5CLTA 4Z7WE 3QPXL 3SGJA 1S7QA 4ZFGL 2NX5D 5C3LD 2XV6B 1PD6A 2ADGA 5EFIB 3FZUC 4LSQL 5EUKA 2Y36H 3QUYC 1OARH 5GGVY 3U0PB 4HXAH 3ULSA 5F9WC 4QXGL 5DD1H 2NXZC 1SM3L 1X5JA 2BHYA 5D7LD 4F57L 5I6XC 4QY8A 3PL6B 5AG9A 5F6HI 2BOBA 1LEKA 3HAEH 1A5FH 5D7SH 1EX0A 5HHXL 1EZVY 2DJSA 3OKMA 4LHUG 1G7JA 3DVGA 1HXMB 5D7KD 1NKOA 5EN2B 4LLMA 4I77H 2ARJB 3KYAA 1KCUL 5DJ8B 3G6JA 3DV4A 4ODVL 3ALXA 4JRXA 2Z4QB 4NZRL 4WUUE 5JMOC 4MWFA 5JA8B 4WENB 5GGRY 3X11A 3ZDYE 5HHMB 5D5ME 5GSRB 2Z8WC 4OGXH 1PLGH 4GG8B 4EQ3A 3IF1B 3ZE2F 1JI2A 2I60H 3NFPA 1QKZH 1DQDL 3T8XA 1IM9A 1VPOL 3O4LA 3IFPA 3P77B 4JPIB 4HKZA 2B39A 1A47A 4PJ5D 5CS7A 4N0YH 1FL3A 1ZHLB 1TQBB 3W39B 4NQCD 3UO1L 1LP9B 1DQML 3CXDH 3QDGA 3O3EB 4P46B 2OTWA 2DF3A 4IDLA 5I1CH 3QFDA 5CINL 4YPJA 3R1GL 4IRJB 3REVB 3R4DA 2FD6H 3UDWC 3JV6A 1P7QB 4WWKA 2N4IA 4XP1L 4ZOBA 4HUUA 1NFDB 1KTDA 5HGAA 4CJ1A 3SKJL 2BCKA 1BIHA 4PRBB 3IVKB 4HS3B 4QRUB 3V5DA 2BY2A 2VL4A 1JIBA 1JUFA 3FCTB 3WCYA 1ZHKA 3TN0A 1UWXK 8CGTA 3KPSE 3QZWA 1U6AL 1A7RH 4Y4FA 3E6FB 3T65B 3QWOB 4XPGH 4WI7A 2BOCB 1LDPH 4I0PA 2HVKA 4PY8J 4QRRB 3I02B 4XP9L 5F7NC 5B39G 3EDJA 5AUMA 4MDJB 5JPNA 3IU4H 4U1HA 2B0SL 4Y1AB 4P9HH 1QSFD 1IL1B 2EO1A 1CG9B 3CVHL 3PQYB 4U4BA 5DR5L 3WFBL 3D3VD 5ACMA 1FGVL 2GI7A 2IF7A 3B3IB 4ERSH 4I9WE 2E7CA 1UVQA 1WEJH 4WDIA 5EO1A 3VWJC 5TF1L 3U0TB 5I15H 3VA2C 4RDQF 3BYYA 3WNMA 5INCB 1BOYA 4JY4A 2A6JB 5ADOL 4KROD 1ADQA 4UUJA 1F2QA 4ZFFA 1VEOA 2EDLA 5C08D 2BFVH 5C08E 4YFLI 5GGTL 2EIZA 4M5ZL 4XZUB 2DQHH 3LEXB 3MJ9L 3JWOC 4GKZB 4KFZC 1C7TA 4LRIA 3QIWD 5CJXC 2VZSA 4O4YL 3B5HA 3PHSA 1F4YL 4IJ3C 4EJ1C 3VRLF 4DZBA 4PB0L 3BKML 1A64A 5E4EC 1MHCA 3KPLB 2Y4SA 5C9KA 3VXTB 1YEEH 4RMQA 1I3GH 1VDGA 1I8MB 1T2QL 2DM3A 4LHUB 3BP5B 2X5PA 2ICWB 4ZUUA 3WJJC 4KY1L 5CD5C 3MUY1 4RZCB 4KPHL 4WJ5A 4KK6D 2HFEB 5FYKU 3B9KC 4L29A 4NUGH 4YPGB 1YEIH 2GKIA 2Q3ZA 3O45B 1H9VA 2IPTH 4JQXA 5I1JL 2UUDH 1V7NL 4MNQD 2V2TA 2C7UB 2BRRL 2QL1A 4LOUD 2EXYC 5I0ZA 4MB4A 4Z78A 2M2DA 2OI9B 1ONQB 5DD5H 2VRAA 4HWEL 3RWGA 5TH2B 1I7ZB 4L9LC 2XKSA 4FG6D 4YXLH 4LSRL 5HYSG 4OLVL 3FAWA 4RAVA 4K23L 1NUNB 3C2AH 3OB0K 2BC4A 4G9DA 2HAZA 3HR5A 1RK1A 4WRLA 4NRYA 1U3HD 4KKAD 2WK2A 2VQUA 2NY3C 4KUCD 1YN7A 2JCCA 4WW2B 2DD8H 4MA7L 3KLAA 4J4PC 4K9EC 1CBVH 2FL5B 1S7WA 4LSPH 2I9LA 3HNTH 1T20A 1BFOB 4KTYA 5DD6A 4HWUA 2VC2H 1OP5H 1WZKA 5I1GH 3IAQA 5FB8A 3F8UB 3OX8A 5EO9A 5F3HA 4YZFE 3V0WL 5F9OH 2F74A 1H3VA 2VB5A 4NZTL 4Q9RL 2XQBL 2R2BB 2Z91A 3MRKB 4P57B 2EYTB 5DA0B 3PP3H 1IE5A 3DVNB 4OTXH 5IROC 3SDXE 1EVTC 4JE4B 1QFOA 2BVOB 3UPRA 4BQBA 3DYPA 4WU7B 3VJ6A 2YPKB 5IG7A 3MZTA 4ZMAT 4RISL 5JLZB 1INEH 2VDLL 5TFSL 1MFEH 5B39B 3HMWL 2NZ9D 3QG6B 4NWUH 5J1AB 3CSPA 4FP8H 4AL8L 3HUJA 3CUPA 2ITDA 4LFHD 4H26B 4HGMA 1TJIL 5ALCH 1UA6L 1OLLA 1OW0C 5A3IC 4U3XA 4OAWB 2R4SH 5FUOH 2X6MA 3AS2A 4OCYH 2W9EH 2X4UB 3ZDXE 4PJDF 5EBLA 1BQLL 4P59L 2W07A 4NYLB 1KG0A 1WAAE 4TOYL 3NA9L 1SMAA 2WWMD 1CYGA 5MEPA 4OLWH 5JIIA 3GMLB 2A38A 5GRWA 5EC2A 1MH5A 5CIPB 1YNLH 2YUZA 5I19H 3DV6B 3B9DA 2YUWA 2DYPB 1WBYB 1R3KB 4JHAL 5GQBA 2XZQL 1LEIB 2V17H 2WUCL 3BXNB 4ISVB 4LGSB 5I66B 1K3ZA 3T1FB 1LO4H 4NM8L 4W6XB 4HWZB 3BZEA 1UZ8A 1QR4A 1IGIL 5CHNA 4MCYB 2O5XL 3P4MB 1MCIA 3JTSB 2YPLB 3MRDA 3OKLA 1P9MC 2XI9A 3I50H 1VENA 2ICWJ 3L9RA 2GIYA 3VCLB 1OWRM 3DNKA 5GGSA 3SJVA 1FAIL 4YGVB 1OGAA 2BVYA 1RY7B 4KHTH 4ONHA 1L0YA 2DQDH 1ORQA 1T7XA 1HQRB 2BNUB 5IHZA 5HYSB 2FYYB 4E5XA 1N0LA 1ZSDB 4X9IA 1M7IA 4ZS7H 1ZT7A 2VDMH 3CZFA 1IGTA 5KSAC 3LIZH 3PWJA 4FQPA 1G7QB 4YE4H 3MGTA 3FMGH 4Y5XC 2DIBA 3GKWL 2O5YH 3Q1SH 4Y16B 1CTOA 5GIRB 4U3CA 3VFVA 2CDEB 5T1LB 1PAMA 2NW2A 4JFDA 5KS9F 4GAGH 4XAKD 3UYOD 1G9NH 4O02H 4Y4KB 3W0WA 1F6AB 5DJDB 5T3ZE 4F7EB 4ONOA 4JN2B 1OOAA 1ZS8B 3JWDH 1B88A 1BX2A 5ID1B 3RX8A 3RZCD 1A7BA 2VSDA 2FX8H 2VE6A 3UDWA 3ARDB 4TSBH 1H0DB 1ZWIA 1L9MA 2I5YH 3RWEA 1FNGA 4GBXC 1EAPB 3F12B 3RJDA 5CGYC 4LIQE 1I8LA 5IB5A 1RZGA 1JZ3A 3MOBL 3ULUL 3QIBA 3KPTA 4L8BA 1B6UA 3O2DH 4FQCH 5IVXB 4UT9L 4LCYA 5GJTH 1OP3K 3T2NH 4XPAL 3VMOA 4RGMB 2WP3T 3RA7H 1UKTA 3CPLA 2CXKA 3IDUA 5IJKC 2VOTA 1LHZA 3GJFA 4PR5A 1UACH 3WL9A 1S7XB 2BVTA 5FO9A 1OLZA 2XG5A 5T3XH 3FOMA 3LS5L 4OIAA 4X6DE 1JTPA 1QFUL 4XNQB 2PTUA 5E5MB 4PJGB 3TIDB 1QEWA 1BQHG 5JHLL 4Y2OA 3FO0L 5F1SA 5JXEC 2YSSB 1KLFA 3MO1B 2YWZA 3I2CH 5TGBA 3GHBH 1R0AL 3H9HA 4QRPD 4QRPE 4HMCA 4B0MM 4Z0XA 2FBOJ 4G6AD 1UYWL 4ZQKA 1W72B 1JF5A 3AXLB 4DW2L 1IKFL 1YYML 3EFFA 5JW3H 3D39D 5L8JB 1H3UA 4UDTB 4N90E 5I1IL 3IKCB 3F5WB 4MJ6B 4AH2A 2ZCHH 4EKXA 3D9AL 3TA3D 3RVVD 2VAAB 3BIAX 3EUUA 3O3BA 3WKML 2X2YA 1KFAL 1ZTXL 2ZUVA 2HRPH 2XZAH 3U0PA 3OR6B 4O58H 4KUZH 4HLZG 3MV8A 1NAKL 1DTUA 3GSVB 4EOWL 1A6AB 5DFTA 3PL6A 5J11B 1FIGH 3MODH 3ZYJA 1HINL 4ODXB 3HCVB 1S9VB 1Q72H 2GEEA 3NABL 3BPOC 5E7FA 4H5SB 1KCRH 1HXMA 1P1ZB 3B9KA 3MRFB 2ARJA 1MHPL 5JORB 4P4KB 2Z4QA 1TFHA 1AI1L 3CAFA 1MCFA 2VLKA 3CU1A 4NN7B 5GSRA 4K8RH 3BPLC 1A22B 4GG8A 3IF1A 1N4XH 4L9LA 5IHUH 4JPIA 3ESVF 4UINL 1OAKH 2EDNA 2IBGA 1W8NA 1KTLB 4K94C 1J8HB 2X89A 2XRAH 3W39A 5I76B 4KKBC 1XFPA 1LP9A 3O3EA 4P46A 1HYSC 1A3RH 2CD0A 2KBGA 3OAYH 3SDAD 3MXWH 4FFYL 1SM3H 2HA1A 3CDFA 4EXPX 2VSCA 3KXFB 4L5FL 1YECH 1QFWL 3X13A 2R39A 5CSBA 3ZKMC 3MUJA 2WLYA 4YHNB 2DIJA 3LB6D 2VH5L 2P5EB 1NFDA 1KCSH 3ARPA 2FJFA 1KBGH 1F4WH 1MCJA 4N5ED 4PRBA 4HS3A 1P4LA 4QRUA 1MI5E 5JHDE 1R3LB 4P2CG 1EFQA 2LU4A 2QV2A 3EKCA 4YHML 3QP3A 1XGQB 4YHIA 3T65A 1QBAA 1YNTB 1JI1A 2FBJH 3QWOA 1JPFA 4TQEH 3ARWA 3SBWA 3I02A 1X5LA 4ZTOL 4YDLB 4MDJA 2PW2B 4LAQH 4Y1AA 1BQHB 1CL7H 4TNWK 5F9JB 4RIRA 4JM2F 1TDQA 3IS1X 1CZ8H 1CG9A 1OW0A 4YIQA 3ES6B 3GSWA 3R1GH 5IVZB 1EO8L 2NY4B 3U0TA 4Q0XL 4XP1H 1WFOA 4XCNA 1PX4A 1MAKA 5E9DB 3DXAE 1SHMA 5INCA 2A6JA 4QTIL 4QXTB 4CMHB 3KPPA 3KGRA 5IB3B 2OP4L 4XZUA 5GS0D 3LEXA 4R7DB 4AEFA 3RY6C 1Q94B 2W1NA 4RAUA 2X1PA 4D9LL 4FQJL 2AK1H 4GKNB 4Z7VB 1JZ7A 3FFCD 2W0FB 3KPLA 4XP9H 2CIKB 3WS6C 3KPRE 2B0SH 1YYLH 3CLFL 4LHUA 3BP5A 5CJBA 2ZUQC 4RZCA 4RAHA 4NHUB 3VH8G 3STBA 2F58H 3E2HB 4YPGA 3K2UL 1GOHA 1K3IA 3CFDB 5DMYA 3O45A 1FGVH 5FCSH 2HFFB 4UILH 2C7UA 1EHLL 2EEDA 4D0BB 2UZIL 1X5AA 1M6OB 1BVLB 1IKNC 3HC3L 5BMFL 2JLLA 1ZGLP 1L0QA 5DURD 1ONQA 4I48B 1BEYH 2L0DA 5FDYA 4FS0A 1I7ZA 1TIUA 3MLTB 5IMMB 2MJWA 5FGBC 1NBVH 3IDGB 4OD1L 5A40E 1AE6L 3V7MA 4UV4H 4DGIL 1INDL 5F96L 3ET9F 3MJ9H 3DSFL 4YHLH 2OJZL 2LAGB 4WW2A 4PB0H 4NOFA 4QXUL 4TYUA 5CJOH 2WBJD 2FL5A 3G04B 4KI1A 3C8KB 2AEIT 2AJYH 1YMMD 2NY7L 2ESVD 1T2QH 2UVEA 3QFJD 1BFOA 2GSGB 3WE6B 1RZ7H 3BQUC 3JZ7A 1CGTA 4NN6B 1CGUA 2A9ML 4G42B 4JDTL 5BS0E 4YO0B 1T66C 4HXBL 5KSUB 1JNNH 5I16B 3Q3GB 1D5MB 4UB0L 3DUSB 3MRKA 4P57A 1G7HA 2OS7A 3DVNA 1BLNB 4B50A 4LSVH 4P9ML 4GBXA 1NFIB 2BVOA 3T09A 5LWYH 4NZUH 3DX8A 5JLZA 4PJIB 4G6FB 1T7WA 1XGUA 5B39A 4HH8A 5J1AA 4U6VH 5D8JL 3THMH 3B2VL 3NVQA 2O5ZL 2ARWA 1F11B 1I4FB 4GH7B 4H26A 2B1HL 4N68A 3R8BB 1CQKA 5IJKA 3KPQA 4ACPA 1R5IB 2BX5A 5F72S 1LK2A 2F53B 4XVTL 2DTMH 3U7YH 4K07A 4Z7QE 4M9OA 4OAWA 1MCCA 4YC2C 4KVCL 1FFNB 2Y06H 5H2BA 1WWWX 4OCWL 4X7EC 4YAQB 2F8XC 2F54B 5D1XC 4OZGE 3M17B 3SE8H 3MRCB 4NYLA 5DDHB 1JCKA 1Q0XH 4OIIL 1B4JL 3EYOB 2A77H 3SQOL 3C6LD 1PZUB 3GMMB 1NGPH 4FFVC 4NZTH 4RFEB 4S0TD 3NH7L 4Q9RH 3LN5B 5GRYA 1UM6H 3K7UA 1ZGLB 4YR6A 5I8EB 3DV6A 3T0EC 5E6YA 2DYPA 2A0LD 1IQDA 4TRPH 5CEXB 4YDKH 5EUOB 4BFIA 5F88B 2X42A 3OWEA 3EO9H 3BXNA 4ISVA 4LVHB 5AZ2L 3MFFA 1LEIA 1B4RA 5I66A 5C0DB 3T1FA 2UWEE 2OR8A 3RIFK 1C5BL 1C16B 2F19H 4Y19A 4QHLB 4BQ9A 4Y2DB 1D6EA 2X1WL 3CU7A 3H3KA 4DGVL 3V7AE 3VH8B 1JF1B 1BBDH 4KI5F 1ZA3B 3C5JB 4XXCA 4NJAH 3DO7A 4YDJB 3VCLA 3NGBB 1F2XK 5CEZL 4YGVA 4KJQD 1VKXB 1U2CA 5EBMB 1R3JB 1BD2B 3OZ9L 4KHXL 4KKCD 4LBEB 1HQRA 3WFDL 5HYSA 5JDJA 3QCUH 2FYYA 5D7JB 4I4WB 4CN6A 1UZ6F 3QHFH 1EEYA 4G8FA 1LP9F 1ZSDA 4LU5L 2FH6A 5BW7A 2ZJSH 1MRCL 2JJUA 3RDTC 1NJ9B 1T83C 3IJSA 4OCMC 3CFKB 5T3XE 1ND0B 1UXSB 3VFUB 4Q97A 1U92B 2DMKA 4XMLL 4Y16A 1T0NB 5GIRA 3PHQB 5ETUB 4QNPF 3DRTB 5ABDE 5ISZE 4NM8H 2O26U 1NFDF 3FQRA 2CDEA 5SWSB 5T1LA 1F4HA 1MVUA 3HG1D 2QADC 5GISH 1JGLL 3U4EB 1NC2B 4FMFA 4PGBB 2AKRB 4JDZB 4Y4KA 1F6AA 4F7EA 4LCWB 4JN2A 4X6CE 1NC4B 3BD5A 4BZ1H 5ID1A 3AUVA 4GQPH 1A6WH 1YEKH 3VXUA 3ARDA 1P2CB 1RUAL 2KQMA 4XPBH 2AK4D 5EC1A 4ZXBD 4PJFA 2EE9A 3ULVD 1SYSB 1XT5A 4X4ME 1EAPA 2A73B 2PYED 3GMNB 4HS8H 1KJMA 3C60D 4WI4A 5IVXA 1Y6MR 5D71L 2WMPA 3SCMD 3VXSB 2D3VA 5LKNA 1ZANL 4PUBH 1YEDB 1MCLA 3ZLQC 5T1MA 4ZUWA 2FCBA 3GKWH 4PLKD 4M4PA 3TVMC 1S7XA 2BNQD 2BNQE 4NQDE 3WN5C 3VD3A 1R3HB 4PJBE 3S7GA 3RAJH 2ADIB 4I8DA 5E8OA 5E5MA 4OKVB 3MUGB 2IC2A 2X9WA 3TIDA 1JE6A 1N3NB 5EU6B 3ZTJH 5FO7A 3LQMA 5ANMA 4HJ0C 3I3DA 1KB5B 2YSSA 3MLSL 3MO1A 3HE6C 1FNSH 2EDXA 4W70A 3O6FD 3JSSA 4JPVH 3BESR 4QGTA 4P2YA 5DEFB 1ADQH 5JZ7D 3Q6GL 4UAOC 3EYVB 1W72A 4OV6F 5ADPL 5BZWB 8FABB 3CC5B 3QI9B 3VXMB 3H9YA 3AXLA 3HNVL 3FTGA 4I3RL 2F5AL 5CMAB 2ZPKH 3IKCA 1JYWA 4MJ4A 4JFED 3D2UB 4JFEE 2HN7B 4MJ6A 5JIKA 5FYLD 1FZMB 3BDXA 2N7BA 4K3JH 3ULUH 1UG9A 2VAAA 3RY6A 4XPAH 5DUBB 5HYJB 2NYYD 5D7IE 3IFNL 3T0XA 1PQZB 4Z7NF 3OR6A 1FL5A 2CMRH 3GSVA 5T1DH 3WS6A 1T7ZA 5D9SB 1PY9A 1WF5A 4ODXA 2QLVB 2I24N 4OZGF 1S9VA 2ZNWA 4UNUA 2PW1B 2CXGA 4H5SA 3TT3L 1WIOA 1CGVA 3FB6B 3NFSH 4XNUL 2K7PA 4ZUTA 5JORA 5MERA 1NCDH 1LGVA 2XA8L 3ILPB 3VG0L 1R0AH 5C2BH 4WW2F 1M05B 5CZXC 1MQKL 2P5WD 3MJ7A 1UYWH 1BF8A 5F7HA 3FQNB 5B3NA 4HV8B 1FE8H 2OL3H 2CPCA 4R8WL 1L7IH 2VDPH 2V2XB 2NCMA 5EOTB 4JVPA 2V5SA 5DHVA 4IRSB 1FNHA 2AJ3A 4X99B 2PKDA 2W9DL 1J8HA 3SKOA 5K9QI 3GSUB 4U1MB 4OCXL 5ID0B 3BN9D 5I76A 1ZTXH 1GC1C 1ZOXA 4CDHA 5MEQB 2J8UB 3QQ4B 2CUMA 3B2UD 5DD0H 3GSRB 3KXFA 4B41A 1RFDH 4OFPA 3O11B 2H41A 1J86A 4LPVA 3ZDZF 4MJ2A 3BQUA 4YHNA 2CKBB 1GOGA 1T4KB 4YDVB 1VFBB 2IPKB 3H0TB 1ZLSL 1GOFA 1MHPH 4MXQC 2DL9A 2IBZY 5CBAB 4ZUVB 1FC2D 1IC7L 1J1OL 2M1KA 3AB0B 3ZSTA 2CDGA 1OCWH 2R2HB 5JIPA 3TH2T 1CTNA 1XGQA 5JNYB 2Z31B 4OLZH 2VXTL 3E0GA 1AGDB 1YNTA 3QG7L 2JTDA 3BUYB 3WIIL 5E70A 4PJ9B 5DQJB 1CF8H 2V6HA 2VYRE 3UTSD 1A1OA 2PW2A 4ESKA 1BQHA 3RWIB 3KAAA 3WNLA 3QR2A 1BFTA 3TJEH 4CVZB 2B1AL 2EXWC 3ES6A 1AFVH 3FO1B 5EZOL 1CVRA 1HDMA 2IQ9H 3LH2H 1QFWH 5C3TA 2EKSB 4PJHE 4DN3L 1I1FA 5DJZB 1FN4B 4J3XA 1IGYA 5IESL 5IV2A 3HFML 4X7CC 2P24B 2VH5H 1EV2E 4WI9A 5FOJA 3EDEA 1QRND 1QRNE 4QXTA 2EIBA 2HRLA 2CLRB 3I3EA 3TO4C 2NY1B 3PWVB 1VFAB 3G9AB 5DI8B 3WDIA 4PREB 4NNXA 2Z9TA 3LKQB 5I73C 4R7DA 3BT2H 1P7KB 1Q94A 3ARQA 3GIVB 1L7TL 2OSLB 4N0UB 3BP4B 4NDMB 3HE7C 1F4XL 4C55A 4GKNA 4H1LH 4MA8H 4WHCA 4Z7VA 4K3EL 2BY1A 3BKCL 2CIKA 3CCHB 1NLBH 4M1CD 2NW3B 3N9GH 1AHWC 5DVMA 3RL1A 1A14L 4B53A 5IW6B 3KJ6L 3PIQB 3QBTB 3QEQE 2HFFA 4J3SA 3BGFB 1RUQH 1U2HA 2YN3A 4D0BA 3HC4L 2PXYC 1TTGA 1M6OA 2DKMA 1BVLA 4LPUA 1QLEL 5D96C 5FGCB 3LQZB 4U1KB 4A6YA 2GJ6B 1S9WA 3V6OC 3VFPB 1WISA 4I48A 1EEZB 3RWCB 4LCUB 3JBG7 3MA7B 12E8H 1FGNL 2C4FT 2YD9A 3K1DA 2ZSVB 1TJHL 1BIIB 5KAQF 3V5KA 1IGMH 1MLBB 3IDGA 3EBAA 4JLRB 1AQDB 4S1RL 4Z8FH 4YBLB 1T83A 4MQXD 4RGNB 3IAPA 5A2LH 5C07D 3QPQC 3MLVH 2Q7NA 1MY5A 2R0KL 2AXJA 2Y6SC 3G04A 3C8KA 5E08H 3HB3C 5C0AD 4EEEA 5C0AE 4X4YB 2NY2C 3CLFH 3DMMD 2GSGA 2Q6WB 1UT9A 5HDBE 4F9PC 1W72L 3FO2B 1DZBA 5IVXF 1OQXA 4G42A 4YO0A 3CD4A 1BZ9B 1I1AB 4GUPB 5I16A 4MA3A 1JBJA 3BZ4A 1IGFL 1JHLH 3HRZB 3JV4A 3Q3GA 4ZAKC 3LN4B 1D5MA 1EHLH 3DUSA 3BE1L 3LRSB 5C6WH 4JFZL 1BLNA 1OSZB 5D6DC 1FYTB 3S4SG 1NCBH 4X98B 1NFIA 1B3JA 1WTLA 2JJSC 1NUGA 4PJGF 3RI5F 3LQAC 1XGTB 4DK3A 4PJIA 4R90H 4JHBA 1HNFA 3GJFH 3ARED 3HNSH 4OLYH 5HHNB 2EC8A 2Y07L 3KR3L 5FGRA 5C0IB 1F11A 1I4FA 4ELMB 4AEIL 4PLJD 3X3FL 3OV6A 3TVMA 4JRXE 2F53A 1BQUA 4M8VA 4CN4A 1VA9A 2VLRB 5DK0B 5D70L 4O9HL 3O3UN 3LKRA 1FFNA 5T5FL 5ELIA 4NQVA 4YWGL 3MQIA 4YAQA 5CGTA 1IM9D 3U1SL 1PKQB 3HE6A 3O4LD 1C5CL 3O4LE 3BIKB 2A9MH 3M17A 1VB9A 4JDTH 3MRCA 5DDHA 1CLCA 4NKMA 5D1ZC 1U41A 3GMMA 3LMJL 4RFEA 3GDBA 3LN5A 4UB0H 3QDGE 5K9OB 5I8EA 1SY6H 3JWOH 4Y5VC 4JJHA 5CJQH 2BXYA 3L3JA 2AEWA 1KIQA 2R2CA 3VGBA 3TESA 5F88A 5HHOA 2AXFB 4D3CL 4PRDB 4WWKD 5C0DA 5GGUA 3QNZB 4XX1E 2YPVL 1C16A 4QHLA 2DQCL 3CNKA 4PJEB 2AJSL 3VH8A 1UQSB 4GW5B 1JF1A 3ZTNH 3N1FC 5IF0A 3TN0D 1BGXH 4YDJA 5EORL 3F65A 2ZG1A 1VKXA 5EBMA 4Y4FD 5DJYB 4LLQB 2CLVA 1L6ZA 3ALPA 1HHIA 2VDOH 4JKPL 3BIBX 1FFPB 3LZFL 1N6VA 4MDIA 5D7JA 4I4WA 5FEBA 1I9JH 4WY7L 4WFFE 4GRLB 4P5TB 2VDRH 5JO5B 3U30B 2YKLH 3NCEB 3UYPA 2AVGA 3MRMA 1ND0A 1UXSA 1FVDB 1WTGT 2HWZL 4I1NB 1MNUH 1KTRL 4LARL 2AJUL 1AGCA 2NLJB 3TT1L 3UJJH 2DDQH 1T0NA 3PHQA 5ETUA 5IOPB 3DRTA 4K9EH 4D8PB 2FECL 2DBLL 3NAAH 4DUXA 5SWSA 5IIEB 1EMTL 3A6BH 5GGVL 3B8YA 5F7MC 4RA3A 4HIIB 4FFWD 3U4EA 4PGBA 1S9XB 2EEAA 2AKRA 4HPYL 2DIAA 1WCQA 4R96B 1D9KB 3QIUB 4LCWA 4TUOA 1NC4A 4JN1L 1UWGL 2IPUG 2H6PB 4M6NH 4V1DB 3VD9A 3QRFM 1JGDB 2CRMA 2NQCA 4YHZL 1BWMA 5IW1B 1XIWD 5IB2A 4BJLA 3OTTA 4JR9H 1YPZB 4S1QH 2ZUSA 3S4SB 4KTDL 4XCCH 3ULUE 1SYSA 3HPJB 2A73A 3GO1H 4MA1C 1JNLH 2D2OA 1KN4H 3SGKC 2FR4A 1KPVB 5HYIA 2IFFL 2Q8BL 3T2PA 3GHEH 1CWVA 4OM1L 2EDKA 1E4WL 3WD5H 1DBML 3VFOB 3WFZA 1KYOJ 4XMLH 4EDXB 3EYUL 3V4UL 1XMWA 3ALWA 2FGWL 4JM4L 1JGEB 4K7FB 4NFDA 3MUGA 2W0LA 1N3NA 5EU6A 2XKNB 1KB5A 4JQIL 3QCTL 1QRKA 4A6YL 1ZVSB 3SN6N 5IHBA 4XNZB 4NO2B 2JF1A 1H8SA 5ALBH 1TMCB 5DEFA 3MRRB 2XA3A 5IHLB 3EYVA 4F8TA 1KELL 2RIKA 3SO5A 2JCCE 5E94B 3S35X 3CC5A 3QI9A 3IDIB 3VXMA 3MLZL 3BW9B 5CMAA 1F58H 2HG5B 4H88L 4L4VB 4GLRI 3BMVA 3TO4A 3VGHA 3Q0HA 2H32H 3ARGB 3U4AA 1CFNB 3IETB 1UWEH 3CK0L 2QQKH 1FFQA 4QOKB 4HUWA 4WTZG 5L2KD 2YUXA 4GG6E 1W0WB 5HYJA 4KROC 1PQZA 5GS1C 1MREL 3OJVC 3L5WB 4LSDA 1BZ7B 2QSCH 3BAEL 4HFWA 4FXKB 5D9SA 4OCLC 3QIWC 6FABH 3K4DA 4N8CL 1G6RB 3MLPA 3D18B 4APQB 1CDUA 1UJTA 5M95B 4HBCL 2ARJQ 1AHWA 4JFHD 4ZD3L 4BUGA 5I1DA 3FT2A 5ITBH 4UNTA 2WBWB 3HUJE 3ILPA 1JZ5A 5LCVH 5KSBB 2P46B 1WCBB 4GXUN 1QOKA 1M05A 1SEBB 3Q6GH 3M8OH 5AAWA 2VXQL 5IVNA 3VFMA 1JGVL 3GK8H 1N8ZA 2XYCA 3V6OA 3FQNA 1I7RB 4PJAF 4KK6C 5BOPA 4HV8A 4J3OC 2FJHB 3EFDL 4HWBA 4ELKB 2V2XA 2WLZA 3HS0B 1XR8B 4HT1H 43C9A 1K5NB 2V9QA 4LOUC 4X5WB 4X99A 3HZVB 3GSUA 3KPMB 1GGIL 5TPWL 4P3CL 4JPKH 2W91A 4LLWA 4TSCH 3MZGB 1T7YA 4FG6C 2X4RB 1T21B 4JM2D 3RWJB 2J8UA 3QQ4A 1F6FB 5ENWB 4GSDH 4M62H 1QZ1A 1HIMH 1IAIH 4YHKL 1U3HC 3UC0H 4KKAC 4PJIF 2OLDA 3MV9E 3D87B 2CKBA 2AS5M 1T4KA 4YDVA 2IPKA 4XNUH 1RZFH 1ULVA 4PGDA 4ZUVA 4XCYB 2C26A 1C08B 1A6VL 2Z0BA 4LPWA 5DQDL 1JPTL 5D6DA 2R2HA 5J6GB 5TDOB 4GS7B 4M1DH 3VDCA 4DQOH 4K3DH 1V7MH 1AGDA 4JFPA 4P3DB 3OKOA 4NN5B 3SJVE 4YXHL 4RBPK 3VXOB 1OGAD 3K2MC 1OGAE 1A9BB 1OPGH 1A6UL 1MEXL 4TNVF 5DQJA 5E2UH 2KPNA 4B7IA 4M7JH 2W9DH 5I1AB 5HGBA 4LSSL 4G8GD 3RWIA 1R5VB 3LEYL 1DBJH 3MREB 4QHMB 4WUKH 4CVZA 1OY3B 4DFHA 3W81A 1M7DB 2NZ9C 4G5ZH 3MV7D 3VD4A 2EKSA 5IFHL 5EUOF 4OQ1A 1FN4A 5ACLA 1QBLH 2P24A 3P9MA 3HI5L 3PUCA 3QO0B 4JFDE 3OSKA 1AXTL 3PWVA 4JPWL 1VFAA 5DI8A 4RNRB 4PREA 3W0WE 3D85D 2V9TA 4Y5VA 1RJYA 4U6HB 1P7KA 4HQQH 4N0UA 1GC1L 1JGUH 3CX2A 2WWMC 4NDMA 1EIBA 3VWKD 1X5KA 2MSPA 3CCHA 2NW3A 3CFIC 3DVIA 4AIXA 2OZ4H 3VI4E 3B9AA 5IVOA 5B3JE 4NNPL 1WZMA 5IW6A 3QIBD 1IGCL 3PIQA 2GCYB 1Z0NA 2ATKA 3PXHA 1H3XA 3BSZL 1MIEH 3ARRA 4MD4B 4LCIL 1KN2H 1MCDA 2NY5L 4U1KA 2GJ6A 5BZDB 3FFDA 3PHOB 4ZSOB 5D7LA 3RWCA 5E1HB 1RJLB 2ZSVA 1BIIA 3EO0B 1H8NA 2D4DA 4JLRA 1AQDA 5DXWA 4R7NB 2P49B 4K94H 4MCZA 2E3VA 1JHKH 1KCVH 3VI3E 5E8PB 1KB5L 4CJ0A 1O0VA 1T80A 3QA3A 3PJSB 5EA0L 2VZOA 3IXTA 4LVNB 4X4YA 2HTLD 1UB5B 1C12B 2CK0H 3E6HB 1VADB 1CU4H 2M8XA 2Q6WA 1Z9SA 4W6YB 4QHUB 1C7SA 3EJZD 3FO2A 5AD0B 1A14H 3P4LA 4S1SH 4HAFA 4P23B 3KJ6H 4GUPA 4PJ5A 5HPMB 3V95A 3LN4A 4OT1H 1LO3H 3PWPB 5GZND 4NQCA 4KRLB 3GSOB 4JY5H 3JWNC 1SEQL 1OSZA 4W81A 1FYTA 2H2PD 2R69H 1T3FB 3CXHJ 3MV8E 4M1GL 3VFTA 3ZL4L 2EKJA 2KH2B 3F7PC 1RZIB 3PL6D 4IMKC 1L0XA 1WT5A 3RZCC 5IUSA 4XBEH 4NSKA 3BP6B 4S1RH 3RPIB 1YNKL 2R2EB 5DYOB 1H5BB 3U7WL 2BVUA 3WSQH 2A6DB 4XNXH 5HHNA 3BWUC 3KVQA 3MRIB 5C0IA 4ELMA 3L3GA 2ADFL 3LDBB 5HVFB 1NLDL 4PJ7A 1JNHB 5KW9L 2EE3A 2X09A 2QKIB 5K33A 2DKSA 5DK0A 1FAKT 2VLKE 4KI5D 5HHMD 4WI2A 4NPYA 2Q1EA 3DIFB 5DO2D 4E0RB 3IJYB 1PKQA 1N0XL 1CDHA 3OXSB 3BIKA 4UU9B 5MP6L 3MLRL 5AWNL 1OWWA 5E1AB 1YZZA 3VXPB 3MOQA 4HWBL 1XGYL 1QSFA 2CO6B 2YD5A 4G3YH 4LPCA 1N59B 1UWXH 3NCCB 5IBUG 4WIQA 4M48L 4P46D 3MRQB 2EDHA 2JK5B 5I71C 4UTBH 3D3VA 5LXGH 1QSVA 3RL2B 2PO6B 4IRJD 1BVKB 1PG7L 3QT2A 2AXFA 4KQ3H 2X4NB 1P7QD 3K8KA 4PRDA 4WEBH 1A4JB 4G6AC 1GAFL 4DKFL 1MCOL 1NAMB 4Z0BL 4Z77B 3MLXL 2VXVH 3DBXB 5CWSB 2EZ0D 1IAOB 3AVEA 4PJEA 4YBHA 5TE6L 3P11H 1CGSL 1X7QB 5E6IB 3UPCA 5CEZD 5GS1A 1E6OH 5CEZE 1N26A 4MZ3A 1UQSA 2CKBL 3DX6B 2QQNH 5IM7B 3RBGA 3MA9L 5E8EB 1E6JH 2OTUA 5BRZB 1I1YB 3TA3C 3RVVC 1TPXC 1K4DB 1F3JB 5TDPB 5E2TH 4TPRH 1RIHL 3GEWB 4H8WL 4LLQA 3U46A 1WUNT 2W9LA 1C5CH 5J12B 2YD1A 3V6ZB 4QRRD 3GMPB 4YXKH 4KXZH 1J1PL 5BO1H 1FORH 1MFBL 1BREA 3KG5A 1S9YB 2WW8A 3EJJX 3LQAL 4XPHL 1YDPA 2IGFH 4Y1AD 3LMJH 2D03H 1WBXB 2XIDA 4E41B 5F71A 1CN4A 4GRLA 3LEVL 4P5TA 5DHVH 1KC5H 4EI6B 5DJAB 5CAYB 1LNUA