4P2RE

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
b'SGGKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
total genus 51
structure length 245
sequence length 245
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE01
1BGXL 5FHAH 4JFZH 4X6BA 2CGRH 4LNRA 1SJXA 4C54A 2BNUB 3FZUD 3VWKD 3AGVA 5I18H 5DD3H 5CGMA 2EYRA 3KPPB 3GB7B 3EDKA 1DUYA 4MA7H 8CGTA 4P9MH 4PRAB 4YHKH 5HY9A 3VFVB 1AP2A 2MWCA 5TE7H 1BD2E 2J4WL 2UZXB 1DFBH 3SCMA 3OGCB 4X8JB 3OKMA 4JFQB 3SE3C 2IALB 4OZFH 2HLFC 4LDLB 4RBPK 5T3ZL 2VABA 3OXSB 1L6ZA 3MCLL 1HOCA 1D9KA 1WFOA 4CDGC 3DVNB 1VA9A 5DQDH 2BY1A 2IAMC 5BS0B 4MZ3A 1UB5B 2Q86A 5GRVK 1CGUA 4IRSB 5D72L 4MNGA 1FL3A 5HGBB 4H1LG 1L7TL 4LF3B 4FOMA 4KHTH 1U8IA 4MA1C 3RHWF 4FQCH 3CNKA 2FWOB 3MUHL 1MSPA 4Z7OE 3D3VB 4OM1H 2BHZA 1CR9H 1LO0H 3IRZA 2GKIA 2MNUA 4YPJA 3QXAA 5CZXD 5I6XB 5IB2A 4OM1L 5FECB 1WCBB 2W38A 1PKQE 1KYOK 5ACZB 2PR4L 5DJDB 3QIUA 4NN7C 3QA3B 3VA2C 4FQIL 1QP1A 3NFPA 1QFPA 2E3VA 1RJLB 2OYPA 4X7EC 1D7FA 3DSNA 3MLRL 4HWNA 4YXLL 1OGAE 5DRZB 5EN2B 4NO3B 5EO1A 4HJ0C 1XF5A 4PYGA 4OF0A 4HH8A 4HIHB 1IKNA 3HTLX 3PG2A 1KB5B 4XPTH 5ISZE 4OKVB 4JR9L 5KG9B 1H3TA 3BQUA 5H8DA 2R2CA 5EUKB 3IDIB 3HZMA 1CFQB 1X7QA 4M1DH 2D7PA 1SEBA 4XNYH 1EERB 4YHPB 4LPVA 2YBRA 5AUMA 4KTEL 4JY6A 4OLVH 4NZRH 4U1JB 4OKVA 1T7ZA 3F12B 4F9LA 4GXUN 1HYSC 1QLRB 5D2NA 1DSFH 1AR2A 3MRNB 4KK9C 1HH6A 4M6ML 4L9LC 4I13B 1IVLA 2AEWA 1GGBH 3NACH 5LCVH 1NUNB 1MAJA 1RJZA 1B4JH 4ISVA 3FOLA 1CFVH 2Y25A 3HNVL 1FFNB 1U8LB 1H15A 4JM2F 2NLJB 1OGAD 4N8VB 5FEBA 2NZ9C 1FIEA 2CDEB 4Y5XB 1PAMA 3QO0B 3QDGE 3WS3A 2BOBB 1RZJC 1J12A 2GSGA 1F4WH 1YQVH 1XIWC 1VGKB 2P24B 5F7MC 4CMHC 2FBJL 5CJOH 1MVFA 4UUJA 3VXNB 1H0DB 3CMOL 3GJEB 5ITFA 5DJ8B 4XVJH 4XPBL 4M5YL 5SV4A 3KXFB 4N5ED 2N7BA 5CJOL 5KVDH 4LLYA 3QO0A 1WSST 5DC9B 2X9YA 3MRLB 3QZWG 4QHMA 1UYWL 5DI8B 2JB5H 3CZJA 3AVEA 4XP1L 1U8HB 2E8ZA 5I75C 4N90E 4OBRA 3HS0A 4UBDD 4PG2C 1DVFC 2HTLD 4EQ3A 3KGRA 3RL2A 3FT4B 3UYRH 1G7IB 3OX8A 2IFFH 3QQ4A 4L8CB 4HT1L 2IMNA 3WEXA 4LSRH 1P7KB 3FQNA 3HKFA 3EW3B 3QFDA 3EKCA 1T21B 1E28A 5EDXA 4W6XB 5GGRA 1A3RH 2VSDA 1TNNA 5DRWB 5IMOA 1MIML 4LLUB 1WBZB 1QLRA 3OB0H 3RGVC 1NKOA 1XCTB 3FQRA 1T21A 1FO0B 1A1OA 4I2XE 2ZKHH 3QRFM 2ZOLA 2HFEA 2XKNA 2P1YA 5J12B 4LLUA 5F9WB 3SE4C 2WV3A 2OJZH 1MCSA 1PZ5A 4K94C 4U6YB 3STBA 5C0ND 1ZT1A 3LEXA 4AENA 4EN3A 3PHSA 4I48A 4LGSB 2YC1B 1FJ1B 4HIJA 1IAKB 4LRIC 1NEUA 4ONGL 5B39B 4L4TD 5E2UL 2OTUB 3X3GL 3U4EA 1CE1L 1TQBC 3PGCA 3P4LA 1WJ3A 4JANB 2KQNA 3G6JF 4LASL 3CVHB 1FL5B 1OT2A 1G0YR 1HHKB 2WK2A 1OAZL 4Y5VC 5HGAA 4LHUD 5J6GA 4WHCA 1UKQA 4KTEH 4I3GA 3GK8H 4U3CA 3QAZC 3TJHD 2YK1H 5LBSL 5MEOB 1A4JB 3WXWL 2FEDC 3QEQB 2Q7YB 3AREB 2FX8L 1G9NL 2V5RA 5J0BA 1JP5A 4ZXBD 4EDXA 5BO1H 5LQBL 1ZLUK 3T8XA 4MAYD 1RUKL 4JJHA 3DSFL 3P4OB 3TBTA 4KRPC 3TLRA 3T09A 1CK0H 4Y1AD 4Z7OF 4PREA 4BSJA 4OIBA 1XR9A 2DL9A 1R5VB 3DSFH 4U6TA 4IEFB 3FN0H 3QUXD 1RIUH 4M9PA 2VERN 1ZEAH 2MSPA 4WEMB 3AREC 1IGTB 2W1NA 5MENA 3I85A 5HHXH 5ADPH 3RU8H 5IB3B 4XGZB 3O6LL 3BDYL 1FQ9C 3BD4A 4HKXA 3NOIA 3BHBB 2IFGA 2E9JA 5TJWK 3TIEA 4HIHA 1F42A 1NCWH 4KI5E 3D5OF 3EZJB 1SJEA 4XBGB 3W0WD 5KG9A 1LE5A 1B9ZA 4F15C 1KIPB 2IH1B 3MGTB 4OFYA 3RWIA 1L6XA 2KQMA 3VXSD 4HKZB 3DX7B 3GMRB 4OV6F 2QQQA 1BVKB 4D0CA 2HH0L 3TCXA 1IZJA 5FYJU 3ARDC 2ZUUA 1JMZA 3VFPA 1NAMA 1RUQL 3QI9C 4B50A 4BKLA 4F7TB 1OAUL 2GJ6E 4Y19B 5E8OB 2VITA 1C1EL 4YO0A 1UCBH 5KSAD 3ZLQC 1YMMA 2WZPD 4JLRB 3BRFA 4QHUA 5GSVA 2PCPB 1FZKB 3BWUC 2YPLE 4G8GE 25C8L 4HC1L 1FBIL 2VAJA 1MJ7H 3GHEL 5T5NG 4L29B 5CCKH 5DD3L 2XPGB 5C6TL 4H8WC 4DUVA 3BZFB 4MAUL 5DJCB 1MHCB 1EHNA 1Z5LA 3WO4C 4YHKL 2V2WB 5C6TH 4XBPB 3O6KH 4KZDH 1DLFL 2NW2A 4YHLH 5IFJA 4ONGH 3LRGA 2DRUA 2CK0H 3GJEA 1DQMH 5D96B 5IEHB 2IC2A 3PDOB 4LHJB 1QG3A 3ALWA 2PYFA 2CK0L 1E4KC 1YEGL 2XZCL 3UZQA 2YWZA 3C60B 2NY1B 1SQ2N 3N85L 3TESA 3PNWA 5E56A 4KUCF 2QTEA 4GBXB 1A7NL 4S1QL 3M8OL 5EOQL 1YJDH 3C9NB 2LV4A 3MRGA 3SBWC 4FXGA 2ID5A 3HNTH 5DS8B 4WNQB 5LVEA 1NBYA 4F7EB 3PE9A 5HYIA 1IQDB 1E28B 4OFIA 3I84A 3BKCH 3BKYL 2WLZA 1A4JA 5BQ7B 2AJ3A 3PWVA 4K7PH 4P2RB 5I1LB 1GC1L 5DHVB 3BN9D 1Z9SA 5C2BL 5E5RB 2Z93A 3FN0L 4H1LB 4S1DC 3O3DB 2F8VA 3M1BB 4L9LB 5I8EB 4UILL 1YEHH 4NZUH 1FNEA 2WUBH 2VL5B 2JE8A 3BD5A 3BDYH 3C5ZB 2VN7A 4YZFF 5D7IE 4ELMF 4MS8C 2NY7L 4LSVL 1ETZB 4FZEH 2K7PA 3ARFD 2P5EE 2GITA 3RY5A 3RI5K 3ZT5A 4WV1A 1I3GL 1JMXA 5HYFA 4JDVA 3R8QA 5KS9F 5TQ0L 3IDNB 1QFOA 1ETZA 2P49B 2X9XA 1WISA 3C60A 1NBVH 1AI1H 5D7IB 4ELMB 4RFEA 4WEUD 2FX9H 3P4NA 4NQEA 1TZHA 4ZNEE 4AZ8A 3BZ4A 3N50A 1A02N 5IB5A 1E4JA 4U49A 1KGCE 2WNGA 5JTWA 3KWWB 4CN6A 2YRPA 1HHGA 2XWBA 4Y89A 1ES0B 4ZSOA 4N9OB 5TE6H 2OS7A 2ZUSA 5BMFL 4PRDA 3DLQR 1A1MA 2NY4D 3BMWA 2OL3H 4YHZH 5B38G 4PRIB 5DD1L 1SVZA 5CCKL 3K81A 4PJAE 1P6FA 2G2RA 2VDLH 2IQAB 4WW1A 1QFWI 3L3OA 5C0IB 4LP4A 5I1CH 4G6KL 1XGQA 4QO1A 4OUOA 5DD5L 4OI9A 1I3RA 4X9GA 4U05A 1QR1A 1RUPH 4GFTB 2EO9A 3OB0K 4EI6A 4JHAL 4XP9L 1T2QH 1HSBA 1MFBL 3ES6A 1CTOA 5BZWB 5I1IL 4U1JA 2V9QA 3JUYA 5DT1H 1ED3B 3S3SA 1HKLL 4TVPH 3L3IB 2FZ3A 1UYWH 1UWGH 4PGZA 3RIFK 5INDB 3VFOB 5BVJA 2AXHA 3FO0H 5CGYD 3QXDB 1XGPA 4DAGL 1A6VL 3BGFB 4LSUH 5IJKC 3IFOB 4NHUB 1UC6A 1NBQA 3HLAB 3M8OH 3TVMA 4QRRB 1A6VH 3L7EB 4XCCL 3IVKA 3OAZH 1F97A 2WP3O 4NQEE 1QEWA 2AV1B 4OLZL 1A3RL 1G6RA 4N5UA 3PP4H 3VCLA 4OGYH 2AK4A 4LSDA 1OL0A 2D0HA 3VFPB 1XCQA 5KVEH 2R56L 5TFSL 5E95B 2XXMB 5D7LA 2PKDA 3RVVD 3CLFH 1AHWB 1WK0A 5D1XB 3SGEI 4QOKD 4LCWE 5JW4N 5LGHL 1UWEH 3OJ2C 2B4CH 4XCYB 1UXWB 4M7JL 1IGJA 4NJAL 5EBWA 1MJJB 5H2BB 3DV4B 4NOFA 4QHKI 4UQ2B 3BH9B 3DV6B 4XVUD 2XQYG 4TQEL 2APXA 3HG1A 3SE8L 4ZSOE 3BN9C 4JFDB 3K8LA 1S3KL 4AG4L 5EU4B 5JOEA 1BIIA 2NY7H 2F54D 3G5ZA 2YHGA 4U1NB 4U6HB 3U30C 2DWDA 4MAYC 2ERJC 2FYYB 2PYED 2R4RH 3ZTJH 3EFDL 5C07A 1LQSR 4ZUTB 3UZEA 1P9MA 4I4WA 5HDLA 2NXZD 4A2LA 4JR9H 1QVOB 2X7LA 5J1AA 1XH3B 4BSWA 4LDEB 4GG6E 2E27L 3IRPX 3Q5OA 1ZHBA 1OT1A 5IMKA 5LBSH 5GS2H 4LQFH 1T1YB 1SM3H 3U7WL 3V0VA 2UWEE 3C5ZC 1OB1B 1HNFA 1TTFA 3DROB 3PV6B 4GRLB 2IGFH 3SDYH 3G6JE 1G6RB 4PJBE 2QEJA 4LAQL 5EU7E 2CGRL 3GMLA 1R3KB 4HIXL 3SDYL 2OR9H 3LKNB 4JFED 2AJ3B 1DZBA 4PGCA 2PUQT 3LY6A 3RX8A 2WUCH 4PRHE 4PGDB 2BY2A 4CU8A 3PJSB 1FL6A 5J3HD 3V79C 3SGDI 2B39A 3TWCL 5ACZA 4PY8I 4Y5VA 3DMMB 2CLRA 1KG0B 3D18B 1AXIB 1P4IH 2JF1A 1FNEB 2I27N 4E41B 4XTRC 4PJBB 3X11A 4RCAA 5T3ZH 3V4PH 2J8OA 3NFPB 5KSAC 1Q9LB 4P2RE 4P5KA 4ZO9A 5IBLD 3FQUA 3KR3H 3HNSL 1D5BB 4Y2OA 5IF0B 4KKAD 3QPXH 4F7MA 4O58H 1F3DH 2NY1C 2YPLA 1A6PA 3GBML 4HS8L 4OIIH 4ZO8A 5JMRA 5F7UA 5JIHA 1NGZA 5FM8A 2VLLB 4OD2B 3BZDA 1T89C 1SBSH 3ARBD 4UIMB 3O6MH 1DQQA 2WAHA 1CXLA 2A6JA 3MGOB 1N0XH 1BBJA 1F4XH 3AS2A 4ZXBA 5E00A 2P5EB 1T0PB 3EUUA 3WO4B 1RUQH 3BRGC 1KCVH 3KPRD 2YBRB 1YEIH 1MI5E 3DX9A 4ZTOL 5I8OL 4G6AD 4I1NB 3SKNA 4DKAA 4YHIA 1T1WB 3O3UN 2NY2C 4P5MA 5I8OH 4WFED 2COQA 4GJTB 5E8PA 2NY6B 1IC4H 1ZLWH 3D0LA 4QT5A 4PRIA 5CIPH 3MLRH 2YD3A 1H3XA 4ODXB 5DHVH 1QRNA 5L2JA 4DZBA 2QSVA 3ZDYF 2Z31C 1SJEB 2Q8BL 2QHLA 4XHJD 1TQCC 3FRPG 3OKKA 1WWAX 5I16A 3DMMA 2EH8H 1A6ZA 5DFVC 1XGTB 4RMWA 1A9BB 4NDMA 3KLAA 3TJEH 5HBBA 12E8L 1HXYA 3WE6A 1HHJA 4JFEB 4M6OH 4Y4KB 2XZCH 4CRPA 4AH2B 4XNUL 2IG2H 2HT2D 2Q8AL 3KXFA 4M6OL 1YPZA 3VGEA 5BW7A 4HXBL 4LQ1A 3IDIA 3MXWL 3QWOB 2IG2L 1WIOA 5TDPA 3U0WH 1HHJB 2X89A 1VHPA 3HE7B 3A6CH 4H26B 5CHNA 2IBZX 4IMLB 4Y4FB 1FGVL 1A5FL 1IGYB 4RMVA 1JL8A 3BPCB 2A6JB 3MGOA 3U7YL 5JOPD 3TO4B 1ORQB 4KRNA 5GGQH 3MLWH 2P5EA 3UYOD 5C0EA 2A2QT 3B4NA 3FFCE 4GH7B 3I9GL 1IC5L 3LZFH 2DQJL 1YDPB 1YY9D 3MLWL 5ADOH 3VFUA 1H3GA 5D2LE 4G6ML 4P5TA 1ORQA 3CLEL 2QV2A 3B9VA 2EDDA 4OF6A 2DLTA 5DUMH 2QSQA 4EDWH 1F4HA 3TVMC 3WS6C 4O2CA 3UC0L 5ICXA 2XN9B 4W68A 4I5BA 5ISZD 4LEOA 4LSVH 4OGZA 4P23B 1JGDB 4OCYH 1GRWA 3FQTA 1C7SA 3QAZB 2JELH 1FC1A 1BJ8A 1KJ2H 3I75B 4Z7VB 2QSCL 4WGVB 1BQHB 3B3IB 2EH7H 1C12B 2HWZH 4XPHL 4C4KO 2H6PA 4HK3N 5FOBB 3OXRB 4PGBB 2QSCH 1VGEL 3UTSB 2YZ1A 2IFFL 4NRYA 5IW1B 2V17L 1FZJA 3SQBA 1TCRA 3U4EB 1NGPL 3ORJA 5J1TC 3S97C 3QWRA 4ELKA 1VERA 2XV6B 1CFNA 4M7ZC 2A74B 5AZEH 3CFEB 1RHFA 1A6WL 5C70A 1Q1JL 4WW2A 2L7UA 4C56E 5E94A 4NKMA 5GS3A 1MPAL 3ULSB 1SVCP 1DBJL 4GRLD 3HE7A 4HIEA 5JNYA 3GZKA 5L8JB 3HI6L 4F2MB 4X6DB 4M61A 4L3EA 5F7DA 2F53A 5D5MF 2GUOB 4YHYC 3EYVB 4C59B 2FX7H 4I18C 4NP4H 1GOHA 1WTGT 1LVEA 3STZA 4M7LL 4KMQA 5D1ZD 3NABL 5I66A 4WJ5B 1D5IH 1U3HA 4YDLB 4KVNL 3EGSA 4N0YH 4Y1AE 4AEHL 5FA3A 4YLQT 4M00A 3GSQB 5IBTL 5MHSE 5IT2H 2HRLA 3X3GH 1P1ZB 4L4VA 4O2CB 4KZEH 3C08H 4HKJA 1F90L 3GJFH 3B2VL 1U3HB 3KLSA 2J3SA 3VD3A 3VH8G 5MENB 2SEBB 1KPUB 3QUYA 1TQCB 3WSQL 3DRTA 2PTUA 2BXYA 1YQ2A 2OQJB 3TA3A 3VFVA 1K4DA 4KHTL 3WIFA 1K8IA 1G9NH 1Q0XH 1DQQB 5FKAA 1OAKL 4S1DD 1BFOA 4PJCB 2QQKH 1RUKH 3P0YL 1U93A 4KWUA 3IF1A 3PIQA 3LZFL 2X4QB 1YEKH 1T5WA 5I15H 3FCTA 5DJAA 2B4CL 1H3UA 2JJSA 1I7RA 2FR4A 3W9EB 4TNVF 2I9TB 4L3EB 5F7DB 4PLNC 2GUOA 3MV7D 4QCIB 1EEQA 1T5XA 1ITBB 1YMMB 3X14B 2BVEA 2HG5B 4KDVA 2G5BA 1AIFB 3GJFA 1HIMH 1KEML 4NQCD 3RVUD 4BFIA 4C58B 4G8GD 2HVKB 2XICA 1IILE 4PJFF 1TFHA 4PJDE 3G5YA 4YDKL 1ZE3C 4HUUB 5ID0B 2F9BT 5HYSA 1AJ7L 1R5WA 1YN7A 4KK6D 3BIAX 5C09E 5I71B 4X5WA 4Z7VF 3V7MA 1PG7W 4DKEH 5IHZA 4NPYA 3L1OL 3LKOB 1OP5H 3Q48A 4ALAL 4Z7VA 4MCYB 1NGPH 4XBGA 1HCVA 1UM6H 2AEPL 1CBVH 3L1OH 5T1KB 3HE7D 1N6QH 2NY4C 2UZYB 1XF5B 1H8NA 3H7LA 5CBEA 5KJRL 2EXYD 1DQTA 3PWLB 4HLZG 4JN2B 4UU9B 5I1HL 4ZFFA 1SJHA 1UZ8A 4PUBL 3WFCH 4PPTA 5DJ6A 3ZKNC 1OGTB 1HHHA 1X7QB 1U8QA 1V05A 2H2PD 4JAMA 4M7LH 1GGTA 4P48A 5CJXC 4NT6B 3OKLB 3WJJA 3TC9A 1MFAL 4DN4L 1TZGH 2FHBA 1R5IA 4K3EH 4DKDC 5L8LB 1F58L 4RGNC 1JPSL 5FHBH 4WJ5A 3TN0A 5DJCA 3N9GH 4XAWH 4TSBH 4EI5A 4ZTPH 3LMJH 3RWHB 3HZVB 2HVJB 5E6ZA 1P7KA 3GMMA 1ZLWK 4WCYH 4MD5B 4ONFH 3BEWA 3OZ9H 1C12A 3I50L 1NFDE 3JV0A 3LMJL 2XTJB 3EO9L 1KYOJ 4K8RL 3VWJD 1I9EA 1KJMA 3QXAB 4C56A 3RWHA 1U8OB 35C8L 2HFTA 3HMWL 1Q9WA 1BREA 32C2A 4NKDA 4HGKC 4WWKA 1XF3B 4JKWA 5HGDA 2AKRB 3NN8A 4UINH 1B6DA 3B6SB 5AWNH 4XBEH 2X4PA 1ZA6A 5BS0E 1ZT4A 3AY4A 2R56H 2DBLH 4OZGA 4WGWB 2YOCA 5C2BH 1MUJA 2HT2C 1WWBX 1RFDH 1AGFB 1T4KB 4QHKJ 1D9KB 4UILH 1H8OA 4PJEA 3P0GB 3AU1B 1JGEA 2BVPA 1IEHA 3MLXL 4RWYH 3KS0J 1AH1A 4YJZL 5T3ZD 3LH2H 1DUYB 1YECL 4TQEH 3RBSA 2R4SL 4QCIA 3CVIH 4HAGA 1U8KA 1W0VA 4EQ2A 1KT2A 1AKJB 1WTLA 2YA2A 4HK3J 3BH8A 3L6FB 4XMPH 5KOVC 1AD9B 4LRNH 4CKVX 4HQQH 3QO1B 1HOCB 1IEBA 4KJQC 4V1DE 5ERWA 1RJZB 4JY5L 3ULVD 1BECA 3CJJA 5F71A 5GRZA 5HVWA 1DE4A 3U0WL 2FZ3B 3VXRD 3QIBA 4PJ9D 3WXWH 2P42B 2I07B 2OTPA 3O6FC 2B5IB 4JQVA 2CDGA 5TE6L 4FQXD 1XF1A 5DJ2B 5T5FH 3BAEH 2XZAH 4ZPVA 2VLKD 5DD1H 8FABA 5C0CE 1LK3H 1ZA6B 3TZVA 1MWAH 2DTMH 1XGUA 4AL8L 5JOFA 1YNKL 1OAXH 1YMMD 4PJEE 1OM3H 2R0ZL 5JR1L 1JN6A 4OZHA 5EBGA 4KJPC 3HE6C 1IM3B 3SDXA 4ERSL 3ARDB 3TWCH 4WHTB 2HLFD 2QBWA 1M71A 3IB4A 4DQOL 1P7QB 4IBLT 4Q74A 5TF1L 3BP6A 3EOYG 4GLRI 3O8XC 4Z6AT 4ZFOA 3VFSB 2G60L 3UCRA 3RUGF 4Q0XH 3DTXA 4JB9L 2OJEB 5A3IC 1AFVL 3KYMA 3RHWK 3JWDC 2ZG2A 4MMZC 3J7HA 1XIWA 2WANA 5C0CA 1N59A 3FN3A 3BP7A 2N1KA 4GW1A 1VESA 2IANE 3U1SH 4LSRL 2E7HA 2GJ6A 3MXVH 4OBSA 3KLDA 2ZPKH 1K9TA 4XCFH 5GZND 5TDOA 4LVNB 2H2SC 2O5ZL 1V5JA 1EMTL 3RDTA 2ICWA 3SDAA 4UTBH 4JQVC 5JA8B 4XXCA 4Z7UB 3HHRB 4HGMA 4TRPH 1CF8L 4RISH 5KVGL 1JGDA 2VO5A 4N8PA 1BM3L 1IE5A 2EEDA 1TNMA 3IT8D 3WUWG 4BH8A 4E41D 2H45A 3OJDA 2Z92B 3STLA 1S3KH 3PHQA 3LH2L 4P3WA 1AGEA 1JHLH 3VXUA 3SGDH 3FQNB 5FA4B 4HS3A 2XN9D 2JCCE 2XNAB 3LKRB 1T2XA 3BQUC 4BH8B 1G9ML 4U6VL 3MV8E 1BAFH 3C9NA 1ZVHA 1U3HC 4D2NA 4I0CC 3QDAA 3DVNA 5C07B 3HRZB 4JDZA 1C08B 3G04A 4JY5H 1N2RB 4M62L 4WIQA 4XNUH 3VFSA 4F2MA 3QUZD 2AABH 3NCYS 4KK8D 3NAAH 3MRBA 3QRGL 4K9EL 5F1NA 1CQYA 1NL0H 2GJ6D 4XXCC 3V5HA 5IMKB 4Z7QF 1A1NB 1V3JA 3QFDB 4LPXA 4GSDH 1FVEB 3GMOA 5GIRB 4I48B 4MB3A 2X44D 3CX2A 4WHYH 5H94B 3ARBC 3TVMD 3GSNA 1GGIH 2Y36H 3SOBH 3FTGB 4J1UB 3U7YH 4YGVA 2BNUA 4X6CA 4JO3H 3V4UL 2HLAB 3PL6B 3PGCB 5CEXB 4N9GA 3LN4A 3CXHJ 3OGOE 1DLHB 4EUPG 3CX5K 3GMLB 5ADOL 3GSNB 5A2IH 4MX7A 1PQZB 3EOTL 4BELD 1Z6JT 3OKMB 4JFQA 4ZMAT 1FHGA 2X1WL 3SGEH 2YD4A 2AJXL 1Y6MR 2EDQA 5CS7A 3OJDB 1P9MC 4XP5L 3MBED 1TVHB 3DXAB 3LV3B 5JORA 3G5XA 1I4FA 3PDDA 2FL5A 1K2DA 1TZIA 4OM0L 1AXSB 3MNWB 4NGHH 2Z93B 1BX2B 4H1LA 1TCMA 4Q0XL 3FT4A 5DGQA 4A2MA 4DOHB 1QA9A 4JO4L 3DVIA 3K4DA 3VXRB 1HXYB 1EPFA 3EAKA 3Q5TA 4HCRL 3N0PB 4HIIA 4ZFGL 1G7JA 2Z8VC 4NO5A 4OZ4A 3ALPA 1ADQH 4ZFGH 2IQAA 1QRNE 5TDPB 3PHOA 4NM8L 5B8CB 3E2HB 1IZKA 3B9KB 2FEDD 1E6JL 3HZYB 3JTSB 3UROR 3RWCA 2R2HB 1A1OB 3F8UB 1K5NB 5DVKA 4JGUA 2BVYA 4GUPB 2C5DC 1NCDL 2GW5A 2MHAA 2VTFA 2NY5C 4N9GB 3PHOB 4X7DC 5B8CA 5E8DL 1TZHB 1XGRA 1YY9C 4JZNB 2P24A 1LEGA 1RUPL 4D8PA 4FQQB 5HVHC 4FTVA 5E5MB 4PV8B 1JF1A 1XEDA 1OPGH 1PKOA 4ETQB 3D3VE 4AEHH 4UV4L 4LLMB 3MV01 3PHQB 3O8XB 3TNMA 5FGSA 4L5FH 3L7EA 3VRJB 4NQVB 1U8HA 2Q8AH 3V5DB 5HGAB 3LKRA 2PCPA 5HJ3B 4GRMA 2D4FA 2Q76B 4ZAKA 4XC3L 1YEJH 4UQ3A 1KIUA 4XB8A 3MRNA 3DYOA 1KPVB 4P2RA 4J8RB 5D7JC 2AQ2A 3MUY1 3CIQA 1KGCD 4M7KH 1IL1B 5HJ3A 3O2VL 4Y1AB 2Z8WC 4MDIA 5DC0A 1G7JB 1PEZA 2CUHA 1V8HA 3HI1A 6CGTA 4FXLA 3IFOA 4B5EA 2EDOA 4NJAH 5MENE 1Y0LB 3CK0L 3ARFC 3MRQB 3QULA 4LFHD 5LXGH 3KPNB 2FO4A 4UNVA 2MKLC 3PNWB 1EFXB 4WFGE 4LLVA 2IBGA 5DURD 3SGJC 5T3XH 5I9QB 2Q20A 2W0LA 2KZ1B 5I75B 1XCQB 2VMFA 3SCMD 5E24E 2XIDA 3T0EC 4PP2A 1G6VK 1MREH 2FD6L 4D0BA 4OIAA 4MX7B 4J3TA 3MRJB 1EFXA 2BSTB 4S10A 3RGVD 1KIRA 4F7EA 3UYPA 1ZHBB 2PNDA 5H37H 3WO3B 4HWEH 1M7XA 4JGJA 1DVFA 3NA4A 3WNPA 4E0RA 5E2TL 4HQQL 4AM0A 4X6EB 5CBAA 4DKEL 2KL6A 3DETD 5E2TH 4K55A 2V2TB 5J6HA 3RZCB 5KAQG 3WS6A 4X4ZA 1TJGL 1MPAH 4R2GB 1FLRH 2VDRL 4BK4A 4J8RA 3VXQB 2EKSB 2EYTA 3HI6H 4HGWB 4U1HB 3MJ9H 4XX1E 5M94B 4NM8H 1NAML 4PLKC 3MBEB 5EUOB 1F4YH 2ZJSH 3W2DL 3DYPA 2NX5D 2XZAL 3GM0A 4DGYH 4OV5B 4BSWB 2R29L 4GRLC 4X4XA 1H5BC 1KTDA 4ELME 4POZC 2GSIB 1T0MB 3TBVB 1I9JH 4G8IB 4HGWA 2VISA 4YHZL 3PWPA 5ID1A 2MTPA 1ZA3A 2HTKD 5DQ9A 1NSNH 3OG6B 5F6IB 3BH8B 1JK8A 4K94L 1NGQH 1KC5H 3GSWA 2DQTH 5FM5O 1JRHH 4ZS6C 1Z9OA 4JY4B 3QISA 1CL7I 3C60D 2VXTH 5TF1H 5CGTA 2CRMA 4P57A 5E5UB 3S98A 1ZGLP 3WHXB 4ZTPL 2EDKA 4N90D 4JB9H 4JJ5A 4X4ME 1EFXD 5JIIA 2A77L 1WAAA 3OZ9L 1FNSL 1ZGLA 4LSUL 3NIFF 3CFDA 2JJSC 1MY7A 3ULUH 3SKNB 1XZ0B 3BFOA 1WAAF 4MYWB 3U46A 1U0QA 3VE0B 5E6YA 2DS4A 3GMNB 5EZLB 4FQCL 3BGAA 1K4DB 5JZ7D 1I3RB 2DYPB 1JE6A 1G7HA 2AV7B 2ZUYA 5TDNB 2ZUTA 1AHWC 5FF6A 5AG9A 4R96A 4N0UE 5C92A 5IV2A 3ARGB 3VG0L 4TRPL 4ENED 5MEPA 1V7ML 3UTTE 2ZZUT 2XWTB 4LBEB 1UWEL 1T20A 4CNIA 3QIWC 1DANT 2ZCHL 1X5IA 2ATPA 4LP5A 1CXFA 4ZFOB 4LPUA 3IXAA 3N1GC 4RQQB 1RIHH 2MQ3A 2RAMA 5BJTB 4JRYB 5EORH 3L5WB 4JRXA 1IM9A 3QEQE 1AIFA 2DQEL 4U0RB 2DLFH 2DMBA 2A6DB 1K85A 1X5YA 4U6VH 4OUUB 1R5IB 1YUHB 2GAZB 4KKBD 3UXFA 3ZE1F 4F58H 4Y2DD 4IRJD 2UYLB 4XMPL 2XA3A 3WD5L 5MP6L 5DD0H 2DIAA 2DQHL 3A6BH 2AABL 2OMBA 3ARQA 1D5ZB 3LOWA 5I9QC 4OLVL 4IOIA 4FXGB 3V0AC 1LK2B 3ARGC 3JZ7A 4HBQA 3S3PA 5CBAB 4NUGL 2A73A 1GZQA 4XNQA 1I8IB 1JTPA 5TGBA 2BHUA 4PJ9A 1EHLL 2HJFA 3SKOB 2AP2A 1BVLA 5GQBA 3V4UH 4Q2ZB 2EZ0D 4WTZA 4K7FA 3JWDH 4XC1L 5I1EL 3WIHA 3C2SA 2XWJA 3QEQD 4GKSA 5C0BA 2WP3T 3MACH 4JAMB 4UTAL 4XC1H 1XF4A 3GIZL 1F58H 4K2UH 3WHE0 5KZCD 5HI5C 1LP9A 2R0ZH 4MXVF 4POYA 4POUB 1OSPH 4WFFD 5EPMA 4BUGA 2P8MB 5JPMA 3K3QA 4TUOB 1OP3K 1RMFH 2JELL 5KOMC 4ZOBA 4P3DB 3BKMH 1AC6A 2NY0B 3LHPH 4DFHA 2AQ1A 3IAPA 3Q5YA 3B83A 3GMPA 2JB6B 5IHLB 4O4YH 5GZNC 5IJVA 1UENA 1A14H 1EBAA 1KELH 1V3KA 1DBAL 3MROA 5SWSD 2E9BA 3GBMH 4OIIL 2WQRA 5I8CA 2IBZY 4KQ3L 1T1XB 2PXYA 4Q7DA 3S36L 1IQDA 5DR5L 2DM7A 2AV1A 1IM9D 1NGYB 4RFEB 3QT2A 5IW6A 3V52L 5GS0D 3R4DA 1DBJH 4JRWA 3I6GA 4MCZB 2ZUQB 3K4AA 3MLSL 32C2B 4M5ZL 2CQVA 4OAWB 3DVGB 1T1XA 2NX5B 2MMXA 3KXFD 4YBLC 4IRJA 3WFBL 1A1MB 3B9KC 2ESVE 2L0DA 3PWPE 4NP4L 4U3XA 4KJYA 3MX0A 4OD3H 1A3LH 4L9LA 2RJMA 2EE3A 5DJDA 3WFBH 1P84J 2VKXA 4HWBH 4RISL 1B0RA 5KVGH 3MA7A 4KU1A 3E6HA 2D7QA 1A3LL 1AD0A 2HKHH 4Z7NF 4PJFB 3NGBC 1ZKAA 4I8DA 4ODBD 2OLDA 2EIEA 4WI2A 3G6AA 3EHBC 2CLRB 1U58B 5C0JB 4LCIH 2EXYC 2WBJA 1O0VA 5HI4D 4CMMB 1K6QH 3AM8C 1MCBA 1AO7E 1ACYL 5FCUH 1EEZB 5D96C 4P5TC 4GW5B 2ARWA 4JFHE 4NRZB 4P3DA 4YDVA 1XGPB 1T1WA 3WD5H 4OT1H 4WU7B 1MLBA 2AJZA 4ZUUA 2H26B 5T1LD 5D2NE 4QRPD 1IMHC 4U6XB 1CFBA 1UFUA 3DUHA 1S78D 5JHDA 5L0QB 3CXHK 2FJGA 3TZVC 1VACB 2AJUL 1S9WA 1F6LL 4XXDA 4NUGH 2Y5TA 5JDJA 1U92A 4RWHA 1AO7B 4R26H 3VD7A 2C3WA 1F11B 1BEYL 4G6JH 4D3CL 4HBCL 4YAQB 1GJIA 5KSVB 3TO2B 4E42B 5BO1L 5JHDB 4J3UA 3PL6C 2UY6A 2ZP0T 2A38A 1JZ7A 1A7PL 3ZE0E 2R23B 2G2RB 1GGIL 2Y36L 4HMDA 3S96B 4AL8H 4JFEA 2GYSA 2DQJH 4P2OD 5AZ2L 5B39G 1Q0YH 3QCVH 4WENB 5SWZA 5K9OB 2H2SD 3KDMA 3DX6A 4LBEA 5C08B 2XTJE 4LLMA 3SDAB 5KSVA 4G6MH 3TGXA 1GVIA 3P9LA 4G5ZH 5IM7A 3QDMA 5C0NC 1F3RB 5BZWA 3UC0H 5JHDE 1MREL 4Y19D 1MELA 2VDKL 3GRWA 4NRXA 4QHNB 1HQRB 4OCYL 4WW2B 4QRPE 5AG8A 4Q6IC 5HDOA 3V6BR 3ZKSD 3BP6B 3O0RH 1SEBB 4JHBA 4QRSB 4BZ1H 4PJ7B 5K9JH 1L4IA 4AQOA 3GM8A 3V8CA 3IDMA 5KSBB 2VLJA 4RBPH 3VI3E 1DEDA 3REWA 5TQ2L 5E00B 4XMKL 2BERA 1IGFH 2FB4L 4Z0BH 3RTQC 4ACPA 3BIKB 1N2RA 1P4BL 3BZEB 2VDOL 3CFKB 1EMTH 2CIIB 2R2EB 4M7LT 2CK2A 4PJ7A 4XMKH 4XCEA 4L8SB 3QWQB 4W4OA 3QQ9C 2DMKA 3QZWB 1ZLVH 3MA9H 3ULUD 1RZ8B 5L0QC 3FB8B 1BVLB 1JNLL 1WVZA 1FO0A 5GIRA 1CZ8H 3RVXC 4YXHH 1RV6X 1ONQB 1UEMA 1A7RH 4PB9H 1EZVY 1YA5A 2VZTA 4EI5B 4P4KD 3U6RB 5LKNA 4ELKB 1AR1D 4P23C 4O2EA 4CVXB 3FQXA 4EN3B 4G8FA 4FNLL 1A6TA 1WZKA 3VD9A 4JFEE 2UVEA 1N7ML 4DGVL 2X09A 4BZYA 3HC0B 1SHMA 4C83B 3IXTA 4S1SL 3ARUA 3ARWA 3W0WE 5KSAB 4O5LH 1BQHA 3QIWD 2YPLB 4HPYL 3BQUD 4PJCA 4K8RH 2E6PA 4G7YH 4HWZA 4XNMB 3TNNB 5GJTL 3WCYA 5ITBL 3RY4A 3WJJC 3KYNA 4HUVB 5CZVL 3ZHLA 2A9NL 1ZLSH 1A7OH 3P77A 2W0PA 4UT9H 4X7TA 4G7YL 4J3OC 1RU9L 5KW9H 3SPVA 3PWUA 2VISB 5EZOL 4AEIL 5F44A 2BC4A 3QNXA 4CVZA 3MUGB 1Z0NA 3OAUH 1YDPA 2DF3A 1MHEB 2P45B 2HJLB 3T2NH 1NC2D 3VFTB 3L3KB 2X4UB 3K46A 3DIFB 3C6SA 2EC9T 2GFBA 4JFOA 3DYMA 4NZJA 4YGVB 5DJZA 2Y9RT 1AKJA 4JRXE 3VDBA 2B5IC 1PYWA 5DQJA 4APQC 3VFRB 5IWLC 3MUGA 1K3ZA 2DJUA 2VL4A 5I19L 2YC1A 4R7NA 1PLGH 5LAXA 1J1PL 2BVQA 2WIIB 1MAML 2VR4A 6FABL 3T3ME 3QIUB 3EYQD 1W72B 4YDJA 4MVBC 1O7VA 2GK0B 1VKXB 1RPQA 3CC5A 2I24N 4LSTH 1F6AA 3QP3A 4ZUWA 5C8JA 3OAYK 1EXUA 5TQ0H 5DD6B 3NVQA 1DFBL 2NY2B 5IIEA 5KSAA 1BOGB 4LSTL 5CD3A 4H5SB 3W81A 3CFEA 4XNZB 5DJ2A 1UM6L 5GGSA 3K7UA 1UVQA 1BVKA 1W0VB 1UACH 4MNGE 3D69B 4FFWC 4NNXA 5DURB 3L6FA 1KPVA 4DGIH 5DEGA 4C55A 3IDYB 2ZJSL 5GS2D 4WU5A 5IJKA 2BOBA 4DGIL 1L7TH 2P5WD 4Y1AA 5IVZB 5DMGC 1JUFA 1FN4B 5JR1H 1IGIL 5E8DH 5F7EL 5CILH 3D39D 3EYSL 3KPSD 3IJHA 4H8WH 4G8GA 4ERSH 3L3JB 1F2XK 5JHLH 1BQLH 4HV8A 3RVWC 1IEAA 5MEND 3FAXA 2CKBA 2CR3A 1T2QL 4PJAA 1YEFL 2OXHA 3LRHA 3N9GL 1T03L 3HS0B 1GGUA 1KPRA 3JSSA 4ZPTB 2WSKA 1LE5B 1HKLH 4P4RA 4QXUL 3OV6A 1CT8B 3VMOA 5FOBA 1Q72H 3NN8B 1L0XA 3ZE2E 5CSZA 2QHRL 1A0QL 4PJAB 4PYHA 1KIRB 2X4TB 1EHXA 4DEPC 3Q1SL 2ZSVA 2FATH 2XZQH 5BV7L 1A0QH 3FONA 4U1KB 1PSKH 3UAJC 2ZG3A 1OW0C 4KPHH 3L3GA 2BDNL 3H3PH 2DQCH 3OHXA 5D7JD 4YUEH 5AUMB 2OZ4H 1VPOL 4MQ7B 4YFEA 4KPHL 3CVHH 3RNKA 2F8XC 4XBEL 1I7RB 2FR4B 1M1SA 1UB6B 5DSCA 4R4NC 1WT5A 4G9DB 3QNXB 4AYFA 2F53D 3HAEH 5HHME 1HSAB 2ADGA 2KDGA 4G42B 3O6FA 4JZJB 4X0KB 3NH7H 1JYXA 2IAMD 4IRSC 4PJDB 4PLJD 4U1IA 5IFJB 3D3VD 1U8OA 2CDFB 4TVPD 3VXOA 4POZD 1VEMA 2GSIA 4EN3D 3MLVL 5FO9A 5HXMA 3KJ6L 5B38A 1RZGA 5EORL 1NCBH 3CVIL 3PL6D 1HSAA 1N5YH 1VFUA 3ULVH 1GZPB 1FFQA 2EC9U 5IB1A 1CGXA 4BYHA 5LGJA 2WWKT 2R4RL 3RWJB 1UKTA 3VXSA 2XA8L 1GOFA 4EBQL 5EBMA 1INEL 5TH2A 4EIZC 1UJTA 1MJUL 3CCHA 2ZCLH 5FGCB 3FO1A 2VXSL 4JO1L 1GOGA 3ELAT 3DX8A 2WMPA 4LAJH 4YHOH 1UACL 3WIFB 4NC2B 4ZYKB 3RP1A 5HYJD 4LFHG 5IIEB 3LDBC 2DTSA 3MJ9L 4L3AA 1AXTH 3LVEA 3MA7B 4H20H 4FFZH 4X6CE 3B43A 1MCNA 5ICZB 2R29H 2AEQL 1GAFH 2EECA 1XMWA 2GT9A 5D6CB 1I9JL 5C6PB 3KJ4C 2EYRB 3BGFC 5KS9E 2IJ0C 2HTKC 2MQ0A 1KOAA 4AEFA 1BWWA 4KKCC 1QQDB 4K94H 4Y5YA 4R96B 3C5SB 1MI5D 4HKXB 1EO8H 4NWUH 2M1KA 5JUEL 4GBXC 2FNBA 5I1AB 4N0CD 5FUZH 3NTCL 3WDJA 4WUUE 1AQKL 2GEEA 3C60C 3QHFH 5C0CB 4NWUL 3RWFB 2ZWLT 2LE9A 4OZHE 3H3KA 3VGFA 1KJ3H 5KS9B 1OARH 1U8JB 2YUXA 3FMGH 3NZ8B 1IAMA 1L9NA 2DLIA 2LFGA 1OCWL 4HEME 4KKLC 5GGTH 2A6DA 2LABA 4LPTA 4UZGA 1ZHNB 1F3DJ 4O02H 2FATL 1WEJH 2J5LB 3FT3B 3LPGA 4YHML 3RVUC 1JWMB 3TCLA 3MNZB 4XP6L 1WT5C 3P4NB 4IRJC 3RWDB 4KQ3H 5DMIL 4OZHB 3JWNC 2EIZA 2BP3A 4YUEL 3ARDA 3PDGA 2R69L 3JWOC 4KI5C 4PJXF 1ZSDA 3LRSB 4L29A 3GO1H 4MNQB 1G7HB 3ME0A 4L8DB 4WI8A 3MRRA 3TBSA 1MCDA 3WLBA 3RBGA 5T1DH 3NPSB 4UBDC 4GOSA 3DARA 1BIHA 1N59B 2LQRA 3TN0D 4Q97A 3QUMB 4I77L 4LVOB 4DZ8B 3IU3B 4JZJA 2R15A 4P59L 4X0KA 3WLBB 4L4TE 3JTSA 4DGVH 3QSKB 4LCIL 2Q6WA 3PQYA 2C3XA 4EN3C 4HJJH 1FCGA 1G9EA 3ZZ1A 2DD8H 4OFDA 4XPGH 4DN3L 5JPMB 3LPFA 3SKUD 1RY7B 2YKLH 1EBPA 3ARRA 4NQDA 5BVPL 4J1UA 4P46A 1Z0MA 5EWIH 3TIEB 1OWWA 5C9KA 2XQBH 1BMGA 1MCOH 1ZK9A 5B8CC 3TYGH 1RZJH 5H35B 4OLEA 3U4BH 4FFZL 5I8CB 3PXHA 4PD4K 2BJMH 3BD3A 3O3DA 1FG9C 1I8IA 1IGJB 3I9GH 4ORGB 4LCYA 1VFAB 1XGUB 4YC2B 3ZDXF 3CDGA 1I3VA 4PGCB 4GW4A 2H9GA 2UV3A 4I3RH 4NQCE 4GAGH 1X6LA 3GMQB 4QHUB 5GSVB 1BIIB 3NCYP 3WKML 4NCC1 4Y5VB 4MDIB 3EOTH 1QLEH 1XF4B 2V9TA 1U91B 4EXPX 3T1FB 2LU4A 4KXZI 3BKML 3VXRA 3BYYA 4GW4B 1FPTL 2EYSA 2V6HA 4KDTC 1EA9C 1P84K 1J8HE 1WF5A 4BA8A 3KYMB 4J3VA 3S4SG 2QSTA 4F7MB 3B2UC 5IF0A 5CP3A 1I7TA 1XR9B 2DWEA 2EKSA 2EYTB 2K3TA 3GSOA 3S4SB 3OKOA 4LEXH 3VG9B 2GY5A 4I18B 3QUZC 2DIJA 2BVUA 3DXAE 5DRWA 3QNYA 3QUXC 2Y07H 4OFPA 3MYZA 1Q1JH 2XG4A 4OJFL 4G43A 5EOTA 1WWWX 3AY4C 5LWYL 3HUJB 1PYWB 1F4YL 3OKOB 4Z0XB 5I0DA 4RNRA 5C0AB 4TYUA 3MRGB 3CFCL 5ILTL 3VXRE 5FGCE 3LKQB 1G1CA 4KJQD 1JRHI 2EDEA 5D6CA 4MXQC 4G9FB 5C0FA 4FP8H 4YFDB 2AGJH 2VABB 5A40E 2XT1B 3HR5B 1NGQL 4MJ4A 4W6WB 5GZOC 3RKPA 3KPQA 4V2BA 3EJYD 3IDGB 2VN4A 4TTDD 4HKBB 4I77H 2Q76A 3O2DH 5IESL 4YK4C 4KVCH 3CXDL 2VDPL 3TA3D 4GG8B 1F90H 1UT9A 5D7SL 2WINB 5HHQA 1PKQB 3TN0C 2WBWB 1X5ZA 4NBXB 1KN2H 3AB0C 2J8UF 4GW5A 5B22A 1CD9B 4HX1B 2DMCA 2P43B 4WUUB 3V5HB 3EOBB 4R9HA 3DGGB 4OI8A 5DLMH 1G7LA 1BEYH 3RX7A 5B4MD 1FLTX 1G9NC 5E2VH 3UMTA 3UTPD 1MIEL 2ATPB 1RJLA 4XCYA 1VPOH 4PRHA 3SDDC 2GTZB 5ACLA 1MF2H 3CVHL 4LIQH 1M7DB 2DL2A 1S7VA 2B1AL 3HZYA 3IYLW 1RIVH 4H0GA 2D03H 4L8SA 3ROOB 5LXGL 1D5MB 4M03A 2P5WB 1C16A 2C3VA 43CAA 1A6UL 3QJFB 5J9PB 2Q3ZA 4MJIB 3CU1A 3RIAF 4WO4A 3UJIH 4JFDD 5CSBA 1I75A 4AM0B 1CG9A 3O3EA 1KV3A 3LAFA 2HRPH 4NO0B 2BOCB 3SE3A 3VD5A 4JZOA 4CGTA 4BZ2L 5K59E 3KPOA 3RJDA 1D5XB 1JHKL 5EOCJ 5EO9A 5EBWB 4F58L 5DJXB 4UQ2A 1ZOXA 4AT6A 3CSPA 3CU7A 1EEYA 4ODTL 5ICYA 3WEXB 1R3JA 4V1DD 4P2YA 1C08A 3G04B 4B7LA 1GZQB 3V5DA 3V0VB 1T2JA 5HI5D 1IKFH 1ITCA 1EO5A 2HFGL 4RIRB 3L5WA 4HIIB 4JRXB 3U4AA 4JDTH 3WIIH 2A74A 1CL7H 5DSCB 1NBZB 2VDOH 3C6LA 1FZMB 5F7KC 1FNFA 5JW5A 4MSWB 1HYSD 3WUWA 2FJHB 2Y6SD 3MRHB 1NDMA 5GSRA 4MS8D 5ENWB 4J3SA 3QHZH 1JPST 2XTJD 3B5HA 4LU5H 4DGYL 3QZWA 5B38B 1DVFB 1KEGH 1MFDH 4Z5RA 3OKEB 1OB1A 4QNPE 3QNZB 3WUWB 2YD2A 5D7LB 1B6UA 5DVNA 3VXUB 1S78C 5EIVA 2ITDA 4KKBC 3EDDA 4ELMA 3R06A 4WUKH 1OSPL 2BRRH 5IJVB 5JW3H 5J9PA 5FA3B 3OX8B 1G7IA 3C2AH 3V95A 4APQD 1CD8A 4UDUA 1MCHA 3QIWA 4DKFL 4PRID 4WCYL 3TBYA 1GPOL 1HEZA 3HC0A 1DBAH 3GSUA 3C5JA 5FUOH 5DJXA 1B88A 2OM5A 2Q7YA 2WINA 5HHQB 3ARPA 1Q72L 2RQ8A 3ARDD 3UTQB 5FO8A 1RU9H 2BXZA 1YYLL 5EU3B 3BGMB 4U0QB 1NPUA 3PUCA 1B2WL 3D25B 2YUZA 5FYKD 1T83A 1EGJH 1CGSL 5L2KE 4X7TB 5DD6A 3CFBA 3D39B 3I3DA 2OK0L 2DBJA 2ED9A 2F58H 5KVMC 2HAZA 1S7UB 4RQQA 1QYGL 1BZQK 4N68A 5D93B 1N4XH 2R1YA 5GRUL 3E6FA 2CKBH 1UJ3A 5D8JH 5B4MC 4QRPB 2QADC 2FJHA 4N0FA 4CUCA 3CH1A 3LKQA 3G08B 1FVDB 2XOTA 5FB8B 1Y6NR 5C0GB 1DCLA 1QACA 1ULVA 3T1WA 3ZYZA 3BHBA 3C5ZA 5GJSH 4OB5L 2GCYA 4X6DF 1BQUA 1DJSA 4JZNA 4P4KA 5K59F 4X5XB 1R3LB 5FV2A 4F7CA 3OPZL 5IVZA 4J3WA 5K93A 2HVKA 4X4YB 5I1GH 4JZJC 5LG1A 4G7VL 5DMJB 1MRDH 3H9SB 5GHWH 3INUL 1KPUA 3NMEA 5B21A 4IS6A 2CUMA 1CLYL 4NQVA 1JFQL 4HD9A 1P2CB 1W72A 3MYJA 4XNQB 1D5XA 4ODUA 4NN7B 2B20A 4ODVH 3LB6C 5H37G 4HUWA 1JGVL 1YNTA 3S35X 4XPBH 1INEH 4FQXA 5FFLA 3FB7B 5IW3A 5MP6H 1NGWB 4BJLA 1T6WA 3QUKA 1CL7L 5CD3B 4NDMB 3HNSH 3PWNA 4PTUB 4JFFE 3RGHA 3OBAA 3IJSA 3DUUB 5FCSH 3C8KB 4OD1L 1YEEL 1TETL 3RWGA 4A6YB 3GRWL 4UT7L 5T5FL 3HPLB 4M43L 4R2GC 5D1QC 3S88L 2DQGH 1FORL 5AYUL 3FB5A 5IVXA 2IAND 4GMSH 1OP5K 2YSSB 1OTUC 2AI0L 2H3NB 5C2UB 4DOHE 3DX9B 5CHNB 5D70L 4RX4A 3Q3GB 3FOMA 3IGAA 3IS0X 1BQLL 4QRRD 1SEQL 1W8OA 4KROD 2DJSA 5EC2B 3FB5B 1YEDB 1G7QA 4OCXL 3NIDE 1AO7D 2CRYA 3EYOB 4YFLF 4U4BA 2HJKA 3FOMB 1QRNB 4DQOH 5E6ID 3D9AL 2G75A 3HC4H 5B3JF 4NKQB 1H3PH 4DK3A 3VFMB 5CEYB 1LNUA 1O7SA 1KJ3L 3NCFB 3IDYC 2IADB 2NQCA 3VDCA 5L6YL 3V6OA 2CJUL 2XN9A 3L7FB 3BW9B 4IIQA 2FBOJ 3MV11 1CDIA 1OTSC 3TV3L 5SX4H 5JO5A 4OLWL 1CGSH 2YA0A 3IU4L 3MV8D 1KG0A 2BDNH 3H3PL 3ZTNH 5A2KH 4LNVA 3NFSH 4XNZC 2VR5A 1ZANL 4CN1A 3GI8L 3P30L 5JPNB 2FGWL 5IV2B 3DX8B 3MLSH 2E8YA 4OCNC 4PV9A 3STZB 3P0VL 1UGNA 1FZJB 1P7QD 1T83C 3P30H 1ZHLB 4Q6IA 1UH2A 4OZGB 5FIEA 5IVXE 5I1JL 4NT6A 3T1FA 3V6OC 3GO1L 3W5NA 4L4TA 2XWJB 5C0BB 3S9DB 3AUVA 4PS4H 2W91A 4X8JA 4HJ0D 4CJ1A 2ICCA 1QSEB 2X2YA 4FNLH 1DBBL 1C5CH 4PJGB 3EYVA 4APQB 2CDFA 2PETA 3MLZH 1QD0A 2NR6D 3LKSB 4W70A 4P57B 2X7LB 4V2CB 1QFWM 4JKLA 3VWKA 4NNYB 1H5BB 3EOAB 5HYQA 1QFUH 1FFOB 4R7DA 3QO1A 2VAAB 3RZWA 1BQHG 1U8IB 3DUSA 2VXUH 1CTNA 4U7SA 3CMOH 2MQCA 2O5XL 3VH8B 5L2KA 1NCWL 3L9RB 4DZBB 3UPRB 5TE4L 3DROA 3PV6A 3MNVA 4HUWB 4IDJH 5E03A 5KVDL 4Y4HA 2DYPD 4KJWC 3RUGB 1ZHNA 2OL3A 3QXUA 4PJ8A 3QG6A 3RIAK 4IDJL 5I8EA 2YMXL 3Q6GL 3GRWH 2OCFD 2BMKB 1WC7B 3UYRL 5MEPB 1T5XB 4Z76B 3K2UL 4GMSL 3NCBB 2APBA 5CKGA 3OGCA 4S2SB 3S37X 3NPZB 2QQLH 4E41E 1EJOH 5IGXH 4WFGD 2OP4H 2NY3B 5JUEH 4RGOH 1MIMH 1MVUA 3IF1B 2QQLL 2XQYK 1JN6B 4OSUH 4UIKL 4Z7UF 4XMLH 2V7HB 2YD6A 4EVNA 5I66B 4EI5C 5CEZE 2XACC 1OARL 4NHUA 1MCPH 1OY3B 3DIFA 1O5DT 3PXJA 2C1PA 4AIXA 1G7QB 1L0YA 4E42A 3TVMB 2ARJA 4IS6B 1DEEA 3QUMA 3ZTJG 3HPJA 2MPAL 1G1YA 1IT9L 3KWWA 1DLFH 4LVHC 4YHLL 4X4MA 1A47A 1QTYT 4UV7L 4JG1H 2X4SB 1WBXB 5CBEB 3O11A 2HFGH 5DEGB 4NC0B 4M6NL 4NQXA 4KKLD 4PLJC 5EZJB 5TQ2H 4LSSH 1T1ZA 4MQTB 3P2TA 3T0BA 2Y07L 3VJ6A 4LDOB 3GSXB 5C0IA 2C3VB 3LKOA 3UJTH 3MRFA 4Y2DA 2RCSL 4MCYA 1UH3A 5E70A 3QG6B 2VSCA 4NBYB 4OQ1A 4Y4KD 3UJTL 3S37H 1IAIH 1AGBA 4YE4L 1KXTB 3D87B 4FQ1L 2EE2A 4Z77A 3ARVA 5ITFB 1NCUA 5EA0H 3U83A 4JFFB 3UAJD 4F15B 4WUUD 4OLUL 2IH3A 2OX5A 5FYJL 4CU7A 1HHIA 3LEYL 1LO0L 1NC4A 4E9LA 3QDMB 1FVCA 5CZXC 3AMKA 4H1LH 2WQ8A 1OPGL 4HS6A 4MXVE 5F70A 3BRDA 4ZFOL 2X4TA 3PABA 3QCTL 4KDWA 2L4OA 5FM5M 1TJHL 2Z31B 4PJHF 1MJ8H 4APQA 5JA9A 1LE9B 4GXVH 3E2HC 3VWJB 5F7NC 4IRSD 4AEEA 3L3JA 2P8PB 2F15A 3MV9D 3VGDA 3QDME 2R39A 2AKRA 4Q9QL 3OL2A 4LMQE 1WBZA 3REWB 1LE9A 4K7PX 5F1NB 1I7TB 3T77B 4TULL 1KB9K 3AMLA 1N0LA 2VQ1A 3QA3A 3DV6A 1RURH 5GGRY 1GIGH 5CEZL 2FH6A 3RVTC 3FKUS 2NY6D 1MNUL 5GRUH 5GXBB 4KJYB 3GGWB 3QPQD 4GQPH 5CEXA 3WXVL 1MWAB 1RZIB 1JIBA 2D03L 1BJMA 5HHOA 1FG2A 1IAKA 4P4KC 1KB5A 4UAOB 2J2ZA 1E6OL 4JKKA 4U2YA 1I1FB 1J0IA 1WUNT 2GTWA 5C0RL 2FSEB 4LSQH 1C5DA 1INQA 2BSED 4FABH 3DOSA 2HA1A 2JB6A 3OXRA 4PGBA 1FVCB 1NLBL 3OMZA 5E08L 1M7IB 4UB0L 3MNWA 3QEUB 4FABL 4YBLB 3DO3A 4N5EC 1QO3A 1ZVSA 5DHYA 4YDIL 5J12C 3WUZA 1YQVL 3ARFA 3ARZA 5IB2B 4XAWL 2B0SL 5D9SB 1T3FB 4UNTA 1G6RH 4NN5B 1QSVA 15C8L 1Z3GL 3GSOB 3LQMA 1FIGL 1DQDL 1KB5H 1J0HA 5C0GA 2N4IA 1QO3B 1ZVSB 4MJID 4H20L 3PJSA 4IRJB 5C0DA 2NLJA 4PY8J 3MCKB 1FL3B 5HGBA 1LP9F 1TETH 2ADJB 3CSGA 4WEBH 4ESKA 3FRPA 1Q94A 4LHUA 4TUKL 4X5WB 4Z0XA 1OGAB 1IAIL 1ZMYA 3VFTA 5HHNA 2RIKA 4WW2F 2J8UE 1JPGA 3ARSA 2DDQH 2ZSWA 4MA1B 1JZ5A 5AWNL 5BXFB 5F3BB 4QRTB 3D85A 2CDGB 5CILL 4CDHA 1ORSB 1C5BH 5FUZL 3H7BB 5CD5D 3MZGB 5IEKB 3JV5A 4QHLB 4OZIE 2EDTA 2NZIA 3CFJA 4FG6C 4ZQKB 3WFZA 5JW3L 5I30L 1TLKA 4YDVB 1H8SA 4RMTA 5JOFB 5EO0B 1V7NL 4Y8DC 2FSEA 4WHDA 3TPKA 1YNLL 4PTUA 3MLXH 3KJ4B 5MEQA 1I8MA 4Z8FH 3RWEB 3SGKA 4DVRH 2OJZL 2O5YH 1BBDL 2EEBA 3RDTD 2GJ6B 2HN7B 4Y19E 4QGYA 5DMKB 2VLJB 3C87A 1S7RA 3DJ9A 5D1XC 2ORBL 4GG6A 1PJ9A 3MLYH 4CBPA 5DVLA 3H9ZA 3P9MB 3IETA 5KN5A 1KCUH 1MF2L 1U8JA 4L3EE 2W9DH 5IFHH 5BV7C 4LASH 4HLZH 2BNQB 1KCUL 3CUPB 4GRWB 4Y2DB 4RAVA 1RIVL 4JFOB 4YH6A 3U7WH 3FB8A 4P4RB 4K71B 5MI0C 1AI1L 1A6ZB 5ICXB 1P53A 2VQTA 1CQKA 1LO3H 4D8PB 2VWEE 3T0EA 3T3MF 3PP3H 3BJ91 1YPZF 3TM6A 1G9MC 3RL1B 2ZSVB 3QFJD 4ODSH 4OB5H 5IMMA 1HILB 1NUGA 5BXFA 5F3BA 1U8MA 5D5MB 3BW9A 2YPVL 2WUCL 2JCCF 1FRGH 1DN0B 5GS1A 4JDZB 1I7UB 3ILPA 4D0CB 4GBXA 2AJSL 4JFHD 4UB0H 3G6DL 2YPLD 1RZFL 4OLXH 1KPRB 1WIUA 2DD8L 4GRMB 4RGNB 1IGYA 4ZPTA 4F57L 5H35A 1KJ2A 1FYTB 2IMMA 2E7LA 4Y19A 1URLA 4NUJA 2BY0A 3ULSA 2CPCA 1QBBA 2R2BB 3X12A 3KR3L 2P8PA 2JB5L 2XN9E 3O6FB 2V7NA 2QKIB 3GSUB 1FV1A 3UBXG 3A6OA 2IANA 2VXVL 4L8CA 1X4YA 3LPWA 5D9SA 4Y5YB 2YEZB 1M05A 5FGRA 1MHPH 2DLGA 3MOBH 3BWAA 4RAHA 1IAIM 4JN1H 1HK6A 4PR5B 1KTDB 5FO7B 3RAJH 1FORH 1UCTA 2VZUA 4OFVA 5AYUH 3UPCA 4HZLA 3FQRB 3PDOA 1LDPL 4HMCA 5KSBE 5JLZB 4WUKL 4RGOL 2ADGB 4G42A 3RAJL 1UXSB 1X44A 1MLCB 5JHDD 4W4NA 2W9EL 4U33A 2DN7A 2HMIC 2ZKHL 1X5JA 3ROLA 4KKNA 4O2FA 5GRJL 4NQSA 1NFDB 1BF2A 4RGMB 2F74B 3DX7A 4ZD3H 4FQIH 4JPIB 3NBNA 3W11D 1YMHB 4N0RA 1CICD 3FMGL 3ROLB 3VXSB 2DQFA 4O4YL 1YYLH 3GJFK 2ZOKB 2LAGB 3SEPA 1CVRA 3WN5B 3O6KL 2N56A 5JORB 1EUUA 2J1KA 1T3FA 4MNHA 1XZ0A 1BAFL 4OCRH 5LWYH 4FRWA 3LQZA 4XAKD 2ZOKA 3P11H 1P7QA 1G7MB 1NAKH 1AGFA 1T4KA 1S7TA 3BUTA 3RWFA 2QQNH 1UB6A 1OLZA 4NFCA 3P73B 1AGCB 2WBJD 5EOQH 3DUUA 1P1ZA 1RZ7L 3FT2B 1CDHA 2ZOLB 4YE4H 4HWBL 3KPSB 5J13C 4GG8A 2JJVA 5D1QD 1U8KB 3GBNH 4ODSL 4JPKL 3RJQB 1B4JL 1QRND 3V4VH 1N5AA 3O2DL 4KC3B 4WFFE 4MNQE 3KHQA 4WTZG 1IM9B 5JLZA 4JFYA 3T4AA 5L7XH 4RRPG 2X4SA 5BCAA 3P3YA 3KS0H 4HIXH 5ELIA 1S5HA 3IDUA 4IOFD 5M95B 3BUYB 1ACYH 4NQDE 5FCUL 4H88H 1EK3A 4ODVL 3VU2A 3LRSA 4HDIA 5L8KB 3RU8L 2DOCA 4FFVD 3UTSE 4PJ5B 5I1DB 4OZGE 5IB5B 1BF8A 4MJ6A 3PIQB 3PQYE 3MRCA 3LEVH 2X70B 3LSOA 4NN5C 4ZYKA 4PP1C 5GGUB 4PJHB 3OR6B 3LEVL 5DXWA 5D7JB 4NC1C 2NY4B 3QEQA 1JGUH 5C0BD 2XPGA 3GSRA 1J9CT 4FMKA 3A67H 1A8JH 4HBCH 1CXEA 2DQGL 4JO4H 1D9KD 4HWBA 1NC4B 1A6WH 3GSVB 4KTDL 3CH8A 4R8WL 3G5YB 1NDGB 3WXVH 5E2WH 1FNLA 1TXKA 5I71C 1LGVA 1IM3A 4I3SH 1REIA 1G7LB 1QBLL 1U3ZA 4U1NA 4U6HA 3VW3H 5IGXL 2W9EH 2F19H 1EEYB 2IPTL 4IMKC 5KVFH 3EBAA 2DWEB 3BIBX 4NKIH 1JZ8A 4LLDA 4P0DA 4OSUL 4UIKH 4I4WB 4L3CB 4NJ9H 4F9PC 1FNAA 3UTSD 1WAAE 3D48R 3MFGB 4MLIA 1RQ5A 1F3JB 5IG7B 4UNUA 5A2FA 4O2FB 2C3HA 3PL6A 4TVPE 1IKFL 1IQWH 4NFBA 2BK8A 2F5BL 2W9LA 3WLWC 2F54A 3O3EB 4UV7H 4EKXA 4TTGA 2H9GB 2FHCA 3FN9A 4IIQB 3EOAA 4L5FL 5HYQB 1WIPA 1ZT7A 1QZ1A 5GGRB 4Z0BL 3GNML 3JV6B 4I0PA 3MCLH 2W07A 3MOAH 3DPBA 1S5IH 4MHHG 3B5GA 3ZMRA 5ABDE 3E3QC 2VDQL 4WI6A 4M8VA 2C1OA 3IKCB 5INCA 1KEGL 3HE7C 4QTHB 3TYFA 1QNZH 1KIQA 3X3FH 4M1CC 1VB9A 4PJ7E 2V9RA 4N1CA 1A7RL 1YMME 1KT2B 5DO2C 4JPKH 2FEEI 3CZFB 3VXMB 3MRMA 5DA0B 4HX1A 4HXAL 1ZWIA 3JWOH 1S9YA 3B9KA 4PG2A 5HTSA 2R2HA 3BZ4B 1YNLH 4JFYB 3T4AB 2PYFB 3R1GH 3MV7B 3SGJA 4EVNB 4Z8FL 1OTUD 3JV4A 4ODWB 4QF1A 3NIDF 1KUMA 3LS4L 1WFUA 4WV1B 4WI7A 3RVTD 1VFOA 2NY6C 5CZVH 4OZFB 3QHTC 1XGRB 4HWEL 2J7LA 4ZUVB 1GGYA 1P5UA 4LLQA 5HDBF 2F58L 8FABB 2YMXH 4DUXA 1P5VA 1I1AB 2HWZL 4PGDA 4XPHH 5D7IA 3ZE0F 3TZVB 5H2BA 3HUJA 2MKWA 3ET9F 4BFEA 4I0PB 4P9HL 4LCYB 4XNYL 2NCMA 2R9HD 1GIGL 1PBYA 4UMGA 4JEGB 1R5VA 1EJOL 1I1AA 1MCWM 1R0AL 1ED3A 7CGTA 3BQUB 3D25A 1WZ1L 3MBEA 2DI7A 2XRAL 5EUOA 3HG1E 5I1KH 1JZ3A 5GGVY 2EIBA 2NY3C 3WFCL 1CIUA 1Q8MA 3L3HB 1T80A 1IEBB 4LCWA 1YN6B 1J8HB 1MAKA 1OLLA 4LSPH 1TJIH 4NJ9L 1FSKB 5DRNA 1MFEL 3E6FB 1EEZA 2Z91A 4BZ2H 4LSPL 4UIMA 2Q6WB 1XIWB 5ANME 1J1XL 3MFFB 1BFTA 1YPZB 3BP5B 3NABH 4X83A 1MFEH 3KPSE 3PWNB 3DMMC 2VOTA 3IETB 4HH9A 5FHBL 2FBJH 4M6NH 4XI5D 1AY1H 5FYKE 4DVBB 1Q9OB 4M4RA 1FH5L 2DI9A 5IBTH 5IT2L 2X4RA 1PW3A 1C16B 3NIFE 2Q1EA 4C4KT 3GNMH 4L4VE 4IJ3C 3QG7L 4LMQI 4D9RE 1QSEE 3ZE2F 1MRCL 3T2QA 1HINL 1KXVC 3ULVC 3VFUB 3TBSB 1FL6B 4LPCA 3I3EA 3S37L 4ODUB 3RY6A 5CD5C 5EO9B 1FZKA 2DLHA 4PJ9C 5DQDL 5I16B 1L7IL 3OTTA 1J0JA 1KLUA 5K9KB 1LEGB 1GL4B 5JW4Q 2PXYC 3BVNA 3G5VA 5EIIA 3SDCB 2EDYA 4FQXC 1WQVT 4UT6H 4FA8A 2DDQL 4XWOD 4OCXH 2VYRE 2C4FU 2X89D 4XX1G 2BHYA 4GKZB 5FO8B 3HRPA 3RUGE 1VCAA 3GMPB 3NZHL 1WITA 3HB3C 5IHBA 1NMAL 3HI5L 3MLUH 2NXYC 4C83A 3MRHA 4O9HH 1F3JA 4DKFH 4U1MA 1RIHL 1QFWL 2RR3A 5TDOB 1PZUB 1C5DB 1J0KA 3JVGA 4L4VD 4ZUTA 2E7MA 5DQ9B 5IKCB 5E8EA 3DGGA 4QWWD 1BBDH 4YXLH 5I6XC 3BYTA 1JK8B 4QRRA 1HZHL 2W0KA 3G08A 4MXWH 2ITDB 2CIKA 5E1AA 5DHYB 3ARBA 1HZHH 4OQTL 3F7PC 4M3KB 3VFMA 2OZ4L 1XF2A 4ALAH 3JTTB 1NBVL 5C07E 2JJUA 2P5WE 2P4AB 1Z9MA 3H9SA 1P4LA 4MQXC 1U8PA 3P4MB 3D39E 2R9HC 4PP1D 1GH7A 2GJJA 3QEHA 4YQXL 4HHAB 4U2ZA 1BZ7B 3OG4B 5A1AA 4RZCB 4X6FA 2DKMA 4KK5C 4A6YH 1F4WL 2FIRT 1RK1B 2VDLL 3F5WA 4LCCC 5DZNA 3X11B 5CJBA 2OZ4A 2APWA 3L5XL 2Y7QB 2OTWB 1RZFH 4MZ2A 1X5LA 3DO7B 4NCC2 3VXPA 3C6LC 3VXTB 4OGXL 2B0SH 5ADPL 2LVCA 2A0LC 1MI5B 2VXSH 1FH5H 3DI3B 1RUAH 4KGJA 4J6RH 1CD1B 3H9SE 5DUPL 3EJYC 4TTDC 4NNPH 1DQDH 2D0FA 2VDML 5E8EB 1KJ2L 1K5NA 4XI5C 2ESVB 4ODXA 3TA3C 3FCTB 3RDTC 2GJZA 1AXTL 2R0WH 2VXVH 2B2XL 1E0OB 3ZL4H 3CAFA 2MHAB 3MJ6A 4QYOB 4OUUA 2F8OA 3MCKA 5L9DL 1S7VB 4ZDHA 1INDH 4RDQG 3ZL4L 1KCKA 3I6GB 4MCZA 2ESVA 4KQ4L 1K2DB 1KSRA 4YBQC 3FJTA 2CD0A 1TPXC 4P23A 4I3SL 1DBKH 1U42A 4PJAF 5HYEA 1CGYA 1UCBL 2Z8RA 5DZOA 3LN9A 2VDNL 3BPLC 2W60A 3UBXI 1AQKH 3UZVB 5DK3A 4PJIF 5CGYC 3TBYB 3WFHA 1CGTA 4LPYA 1D5BA 3ZDZF 3QXDA 3RZCD 3GDBA 3W5MA 3F58H 3TO4A 5IM7B 4HAFA 4LGRB 5KTEH 1A6AB 1RULH 4G9FE 4MAUH 1AGDA 1MCFA 1U93B 4FXKA 3DXAD 3WNMA 1NUFA 3NIGF 1NGZB 3FHQA 3MBEC 4XPAL 3IVKB 1RULL 4XPTL 4Z78A 1T66D 3NCJH 3U0TA 1S7QB 3AAZA 1FYTA 4WVRA 3SBWA 5AD0A 4KJPD 1UM5H 4OGAD 2DLEA 1R3IH 2RCSH 1CE1H 3OHXB 3X14A 2B1HL 2IPUG 5KN5B 2N7AA 2FGWH 4CNIB 2ED8A 3J8F7 2M26A 2UWEF 1NAKL 5D4QA 3UPAA 2VIRA 5D7LD 1JV5B 2AJUH 4MJIA 4GSDL 5HYSB 4R26L 4MA3B 1KULA 4L4VB 4U31A 3ESVF 2ADFH 3K1DA 1JBJA 4PR5A 2EICA 5ESQA 3HNVH 1ZV5A 1LD9A 3QQ9D 4PBXA 2VIRB 4UUJB 5EBLB 5F6HI 4KK9D 4S0SD 4ZAKB 2GAZA 4OFKA 4HF5L 5F9AC 1HQ4B 3VI4E 3DRTB 5HI3D 3QEHB 4IRZL 3TEUA 4YEEA 5GGTA 1KLGB 1ONQA 2W60B 5IB1B 4KJWD 5JPNA 5HD8C 3ARXA 1DN0A 5GS1B 3L5XH 3KPTA 3O6LH 3UP1A 4RZCA 4YXKL 4PJXA 1LK2A 4ZFFB 1CFSB 3VFGH 4Q9QH 4KGLA 1EGJA 2EKJA 3ESUF 3GI9H 3GGWA 2FO4B 4TULH 4XP1H 3ZDYE 1OW0A 2A0LD 5FYKU 4WHYG 3O0RL 5F21B 5D1QB 1EUTA 3L3KA 3FZUC 2P7TA 2B2XH 4A6YA 3IDMB 5ID1B 5E4EB 4YNYB 2V7HA 3A67L 5SWSE 4B41A 3ULUF 2Z9TA 4LKXB 3CDFA 5SV3A 2AJVH 3UTTD 2X5PA 1I1FA 5JXAL 1FDLL 2HT4C 1OOAA 3E1F1 1IGML 1J86A 4KMTH 3SPVB 1P4LB 4R7DB 2M8XA 5MERA 5LAXB 4Q9RH 4KROC 3S7GA 5I1KL 4H25A 4XTRD 4JFDE 2IAMA 4NN6B 5I1HH 3D18A 2YD1A 3LIZH 5GRJH 2FX7L 3WHXA 3VW3L 2Z8SA 3BPLB 4JJ5B 3D0VB 5J6HB 3MRPB 1CZ8L 3O4OB 5FOJA 1BQSA 4PJ5D 4U1LB 4X6FB 3ZSTA 4P2OB 1E27A 4AIOA 4N0YL 3B3IA 4KK6C 3F58L 5KTEL 1MFAH 1L0QA 3U46B 1UVQB 1NFDF 2QR0A 1NC4D 1G6RL 5IW6B 5HHOD 3ZKXC 2WIIA 2EDXA 4JCMA 4JO2L 1ND0A 4MB4A 1YY8A 4LARL 3TJEL 4TSBL 2F5BH 2I25N 3TA3B 1J88A 4S1QH 1MCEA 1OP9A 2X6MA 4PJEB 5D5ME 3RWGB 2BFVH 2RFXB 1EDQA 1HE7A 1QKZH 4K7PY 5D7JA 3LKPA 1KBGH 1OAKH 4X80L 3T0VA 5C0BE 1JWUB 4I0PD 1B90A 5DRNB 2NTSP 5CJ8A 4X5XA 1UQSB 1RZKL 4Q9BA 4X80H 3TJHC 3QBTB 4JM2B 1CR9L 4KTYA 5IQ7L 3C6SB 3LKPB 4PJEF 4D0DA 4NWTH 2HT3D 4HF5H 1PG7X 3HUJE 3VGBA 4MD0B 4WFHD 3U36B 1V7NH 4K7PL 1HIML 1KEMH 4O9HL 4RFOL 3MMEA 2YN5A 1ZVYA 3F7YB 5ALCL 1MCIA 5IWLA 3DRQA 3VI3F 4EI5D 2R1WA 4D0DB 5HHXL 4NQTA 4Y16A 1J1PH 1JPFB 4HV8B 2Q7NA 5F89A 1TMCB 4NZUL 1YECH 6FABH 2PW2B 4O51A 1DQJA 3QI9B 1WBXA 3NFNA 2XWTA 4QGTA 4NO0D 5HVGB 5D2LF 3DRQB 5ESAB 1MUJB 4XVTH 3RGVB 5B3JE 2W9DL 4K7FB 2R23A 1KACB 2W92A 4X7CC 5C08E 3MJ7A 2PW2A 5B3NA 5SWZB 3THMH 2OXGA 4J4PA 5IQ9B 2DWDB 4PJIB 4Y4KC 3C6LD 3FL7A 1JPTL 4ODHL 1DTUA 3QQNA 1NDGA 1MQKH 3O2DA 1MCJA 4LKXA 5D71H 3VDAA 2WLYA 2Y5EA 5IR1B 5FYKL 1JHTA 4KDTA 3O2WL 1KTLB 4PRPD 4MA8H 4HUNB 25C8H 4HC1H 4NQDD 1QSFE 2OR9L 1CLZH 1NCAL 1XAUA 2AJSH 3LKSA 5BMFH 1NSNL 1LK3L 3RNQA 2F53E 1MHEA 4LCWD 4KVNH 4NZDA 4OF8A 2CKBB 1KC5L 1K4CA 5EC1A 4PLKD 5JHLL 2D7NA 1BFVH 3I6KB 2HVJA 3E0GA 5DT1L 5I1CL 2I9LA 4NQXB 4KKAC 3BT2H 3IAQA 4QRQA 5KAQF 4G6KH 1NEZG 3TIDA 1RZIA 1I1AD 1H9VA 2VH5L 4NM4L 2C3GA 2PF6A 4I18A 1BFVL 1R3HA 4LVNC 1WZLA 1PDKA 3WIIL 1EAJA 4NKOB 1NKRA 1X4XA 1X5AA 43C9A 3TH3T 3RTQA 3MC0A 1MHPL 1PZ5B 1ND0B 3UBXA 2VQ1B 1UZ8B 2PYEE 2DM3A 1DLHA 1TITA 4RNRB 5C0AA 3RGVA 1HINH 1INQB 4GRWH 1KTRL 3BO8A 5BV7H 3EJZD 4QHLA 3X3FL 1HHHB 4OF5A 1DR9A 1FYTD 4OCSH 2R2BA 4NQSB 3X12B 5L2KD 1LO5B 5I1AA 3QH3A 4M7KL 3EO0B 2JJWA 4K3JH 5EU6B 5GS0C 4X98A 4DW2H 2QQKL 5T5NF 1TVHA 3DXAA 3LV3A 3WFEL 3AB0B 3KPQB 1FSKC 3DO7A 4HUMB 1FGNL 2H32H 4UTBL 2YD9A 3NZ8A 2NX5E 4QWWC 2CLZA 4WU7A 2BNRA 4F3FA 4ZNEA 1T04B 2PTTB 2Z4QA 5C3LD 2MCPH 2FECI 4CADB 3QUYB 5FO9B 5DK2A 4FFYH 1QHOA 5T3XL 3T8XB 1JHLL 3CPLB 1K8DB 1A4KB 4XPAH 4YIQA 2EH8L 4LOUD 2J5LC 1AJ7H 2CDEA 1MCCA 1D3CA 4G8GB 4F33A 1T22B 4Q9CA 1AC0A 3FT2A 1CI5A 2E27H 1VGKA 2OK0H 2HJLA 4GMTL 2X1OA 3MRFB 3H2WA 2ICES 3S35L 1LILA 4NKOA 3CFJB 3LD8C 2BY3A 3EJJX 3O9WC 4FFVC 1IJ9A 4LLYB 4KK8C 4BUHA 1LO4L 1T22A 1A7QH 3MV8A 3SDCD 1VSCA 2BVOB 3FO9A 2ERJB 2AVGA 1TJGH 1GHFL 4MAYB 1A3QA 5CP7A 5HY9B 4MNHB 4FTVB 5E5MA 1FNHA 3VG9C 4LAQH 5GJSL 3I02B 3MTRA 4NO3A 1T7YA 5EO1B 1MH5A 1MLBB 4HC1A 3VRJA 1EVTC 2V5MA 4PJ5A 2DICA 1PKQA 5E6IA 3ZDXE 1JI2A 3RPKA 3INUH 5I18L 3GKWH 4ZUWB 5C8JB 2Z31A 4GXUM 4M1GH 1M6OB 2IANB 4P9ML 1Q9KA 1CLOL 1TZGL 1F8TH 3GFUA 3VRIB 4GKZA 1KJVB 1F11A 1NMBH 1AY1L 4WTWA 4WO4C 5JDSB 3SO5A 2R1WB 1RMFL 4CADA 4E5XA 3WS3B 3D69A 3D3VA 3R0NA 3REVA 5D6DA 4XP5H 1Q9KB 2RGSA 1AFVH 1TVBA 2L7JA 1RVFL 5F1OB 3CDYA 3B5TA 4X6CF 4XZUB 5J56B 3FOLB 1N0XL 3QPXL 3ILQC 1OF2A 5DJ6B 2J8UB 4H0IA 4JCLA 4ZS7H 4XCCH 4JFPA 4KH2A 3T65B 4PRBB 2PO6D 3I75A 4F9LC 1EEUA 5FKPB 3LSOB 4O2EB 5DRXB 3PP4L 3CCHB 2VLRD 2GK2A 2O5ZH 5DRZA 3T0ED 3V9FA 2FJFA 2OSLB 5CAYB 2CRIA 4KQ4H 5DEZA 2D9CA 1T0NA 3DWTA 3CLFL 4JFPB 4OLYH 3VXNA 1WFTA 1BX2A 4HJGA 1DBKL 3BJLA 3O4LD 4ORGA 4E0RB 4GS7B 1CT8A 1M71B 3MODL 1T0NB 3UDWC 3ZKQD 4X5LA 4HSQA 3H9HB 2CIIA 2R2EA 4KI5F 5D1QA 2HN7A 4XWGH 3QUMH 1FNGB 4X7SH 1K4CB 4OZ4B 3RIFF 2NXYD 2MCG1 1G0DA 3KPLB 3PGDB 3W9DB 1U91A 3CGTA 2NTFB 4P59H 5HGHA 3TH2T 4F80A 1QSED 4JO2H 3QDGD 4OLWH 3O81A 2EXWD 5E4EC 3MRQA 3QULB 2XG5A 1NMCB 3OKDA 4TUJA 1S5IL 3N85H 3GI8H 3FFCB 4LOUC 1QSZA 3NAAL 1T0MA 3TBVA 2IAMB 5FYLL 2R0KH 3ISWA 1XCTA 3T0EE 2VZ1A 5HI4C 2ENYA 4CVXA 4LQFL 2DQHH 1KBGL 1I4FB 4OZHF 2ARJQ 2GITB 1JPGB 1Z2KA 2ENSA 2VLRA 3KHOA 4ZS6D 3NACL 3AU1A 5LCVL 4NFDA 3MLTA 4L1HA 4PRBA 3RL1A 4RX4D 5ALBL 3I2CL 3SE9H 5F1KC 5GS0L 2FX8H 3LEXB 4C56D 1UH4A 1CXIA 3C8DA 3U9PL 2OQJA 3AREA 1C5CL 5HYJB 2X05A 3I2CH 5I15L 2A9MH 3PF2A 3IDXH 5DK0A 4Z7VE 4V1DA 3QJHB 4JREC 4HG4J 5INCB 4ZOAA 4HW6A 3AS0A 1OQXA 1T04A 2PTTA 4IRZH 3CVHA 3G5XB 2YS4A 5DZLA 3WKMH 5E9DA 4JLRA 4PBWD 1HHGB 1P4IL 1QLEL 2XWBB 3G9AB 4X9IA 2ZG1A 2NY3D 3CZFA 1DE4B 4NNPL 5DMKA 4PFEA 5MEOA 3OKYA 4X4XB 3QUKB 5JDSA 5FF6B 3EYFA 4HZAA 1W0YT 4WW1B 3P9MA 5DQJB 3BZFA 4QRUB 2X1QA 4M1CD 3GHBH 4JVWA 4LK4A 1OGAA 4W6YB 1UJ3B 5F7YC 2BNQA 3PQYB 3WN5C 4ZS7L 3U0TB 3FTGA 5J8OA 2XFXB 2YA1A 1YN7B 2NW3B 4L3CA 4OCMC 5J06A 4KMLB 1IEAB 4WO4B 5JQ6H 3KYAA 1A9EA 1ORSA 1JPTH 4ODHH 4AENB 3O41A 2G9HB 2BVOA 2J8UA 3FO9B 5T33H 1VFMA 3IDJA 3F7YA 4GUPA 3CFCH 4RGMC 1JYVA 4ZQKA 5C6WH 2H8PA 3WNLA 4G9FA 1RHHB 5C0FB 3W2DH 4NKIL 5T1KA 5KS9A 2BSSA 3OSKA 4OZIA 4RGND 3FAWA 1JWSB 4LL9A 4R4FL 2JK5B 5ESQB 1FBIH 1KFAL 3NA9H 1KIPA 4NNXB 4Z7WF 3RI5F 2VZOA 5GGSY 1D5IL 1DQLL 1HH6B 3Q0HA 1FAIL 1MCLA 4S11A 5D6DC 1JI1A 4JG1L 4JHAH 4XP9H 2KUTA 4BQ9A 2VDPH 1A6AA 1GSMA 4I9WD 4QTHA 3TYFB 4E5XB 3H9HA 5I1IH 3LD8B 1UM5L 3OKLA 4LCUA 2D7MA 3DV4A 4PJXB 1T20B 2OI9B 1OAZH 5ICYB 1TVBB 1YEJL 2VKWA 5A2JH 2CLVB 3LN5A 5A16A 3MOAL 4PREB 3RKDD 2LU7A 1IL1A 1LEKA 4LIQE 4PP2B 4D0BB 4LCUB 3RWCB 1MFCH 1X6NA 4PJDA 4U1IB 1S7XA 5FM4A 1OTTD 3VXOB 1TVDA 1ZTXL 3C6LB 3MRIA 5CMAB 5D7KE 4U6YA 3HE6A 4FQ1H 3QDJD 4L4TB 3SKJH 5KVEL 5EA0L 2JIXA 1MHCA 2ITCB 1QVOA 4LCCB 4YX2H 2XYCA 5ENWA 3UO1H 1NANH 5FDWB 4JFXB 1A7PH 3ROOA 1Y18A 5CEZD 3H0TA 2AXJA 4UDTA 3U48A 3MLUL 5AZ2H 3E3QE 5SX5K 1CE6B 1GC1H 1MFNA 3L5HA 4PJBF 4G9FD 1EAPA 1BJ1H 4FQHB 4LLQB 4JPVH 4L8SC 1JZ6A 3MRJA 3BGMA 3VFGL 4MJ6B 2A73B 3R1GL 3KLHD 4MD4A 4YBQD 1P7HL 4AG4H 2FIKA 4PJHE 2V2XA 2E9WA 1FNGA 1CE6A 5GGUA 3TO4C 2VDKH 2DM2A 1DL7L 4Y4FC 3PWPB 3BWAB 1F6FB 4BK5A 1XGQB 4B7IA 3F7RA 4GKSB 4PV9B 2A6IA 3DURA 4HG4K 4PJ8B 3ARGD 1G84A 5JZ7C 4LHQB 5FYJE 2AJVL 4NQCB 1NBZA 4HHAA 2CLVA 3LN5B 4P9HH 5FDYA 5JXEA 5KZCB 2X9WA 3H6JA 5M7QA 1DUZA 4ZFZA 1SM3L 3L3IA 4M6MH 5EU5A 5IK3A 5B39A 5EULV 1JF5A 5IBLC 1FYHB 1ZS8A 4XHQA 1II4E 4FN0A 3DETC 3U9UA 4P2QA 3SJVA 3QEGL 1ZA3B 1E6JH 4ZFZB 4Z5RB 3OJMB 5SWQB 3FO1B 4P5TD 4PJDF 3TFKC 2D4DA 3MUJA 1BGXH 5FHAL 2QJDA 4R4FH 4YIQB 5BS0D 3IKKA 4TPRL 4JFXA 1YNKH 3RFZC 1CLZL 1NCAH 4F33B 3K0WA 2BSSB 2B7DT 3MRKB 1DQLH 1D6EA 3VH8A 5L2KB 2F54B 1RUAL 1D5MA 3C2AL