4P2RE

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
245
Chain Sequence
SGGKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 245
sequence length 245
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rE01
4Y5VA 3VD7A 3C8KA 2X09A 2OK0L 3BDYL 3B6SA 4GAYB 3VFWB 4KMTH 1AQKL 1J86A 1Q9LB 3PP3H 5J12B 3D0LB 3FFCD 4QRQA 2PXYD 1G6RL 2E9JA 4NGHL 3HC0B 4NZRH 4XWOD 3VFUA 4HWBH 1GGUA 2NTFA 1PY4A 4P2CG 5LBSL 4AMKL 5F6HI 3EJZC 4FFZH 5JDSA 4MX7B 2DL9A 1U0QA 2BOCB 4TOYH 3L3GB 3NIFE 1CGTA 2EDXA 4UQ3A 4U1KB 1DUZA 1YPZE 2YOCA 3HAEG 4BQBA 4HJ0C 1JZ6A 4CVZB 4JY5H 4I4WB 4S0TD 3GJFH 3B2VH 4LSVL 4X4XB 2YS4A 4O5LL 2FYYA 5DS8A 4HW6A 5E2VH 3VXTB 4U1LA 1WIPA 1CG9A 5GIRB 1BBDH 5JR1H 3V52L 4JO2L 3QIWA 2NY3C 4NP4L 2GUOA 5A2KH 3PDDA 3BKJH 4NKMB 4RAUA 5CJOL 4U7KA 4DZBA 4MAYB 4UIMB 3ALWA 2N7AA 1A7PL 2EDFA 3HB3C 1YN7B 1DVFD 1JNLH 3S36L 5J6GB 4MS8D 4OV5B 2HRPH 4KI5C 5ID0B 5LQBH 4S1RH 3IF1B 1GOGA 5JPMA 5CWSB 4ZXBD 3CLFL 4KROD 1C12B 4RRPA 1KJVB 2P42B 3AMLA 4XGZA 5GGSA 3U9UA 3X11B 2QHRH 4G9FD 4Y4KC 1IEBA 4JQXC 5D1ZB 2A9MH 4XRCB 3VFGH 3ARSA 2Y9RT 3F5WB 4ZO9A 1P7HL 1S7TA 4R2GC 3UBXI 4XPGH 1DQQB 5ICXA 1FAKT 2H26B 3J7HA 4OIBA 2P5EE 1BBJA 3MZTA 4N1HB 4G9DA 3MRKA 5EOQH 2WMPA 3E6HA 1RIUH 2B2XL 2E7LC 4NN7B 5D5ME 1UKQA 1S5IL 1H3TA 5F88B 1GIGH 2CR6A 3FQUA 4JFOB 1QBAA 3H9SA 4JPVL 4E0RA 4OCSL 4S1DC 4LPUA 4JM2A 4WTWA 3ES6B 1FZMA 3AC0A 3BZ4B 2E6PA 3CSBA 1MJ8L 2V5YA 1H15B 2YD9A 3SDAA 4TVPE 3D25B 4HKXA 3QI9D 3P9LA 3X12B 3T2QA 2YEZB 4HMCA 5C1MB 1Q38A 5D7IE 4HHAA 2WP3O 1D5XB 2R56L 4PRNA 1ZWIA 2FEEI 3NCBB 5F70A 1DE4A 4TVPL 4DAGL 2I9LA 2Y5TA 5EBGA 4CW1A 1GGTA 1Q9WB 4HS6B 3KPLA 1RFDL 1UZ6F 1JNHA 2OYPA 2EDTA 5I1GL 4RGND 5FA4B 1Z9OA 3WJLA 5FYLE 1AXSB 2CGRL 4OD3L 3WLWD 2M2DA 2CO7B 1BVLB 2NY4B 1KXVC 3SDXE 1BFVL 1DN0A 4QGYA 4D0BB 1YECL 2ZJSL 2QJDA 2P8MA 2EDLA 5JQ6H 1ADQL 2EKSB 3VXMB 3VJ6B 4Y5XA 2YD4A 5D2LF 4JQVA 4N1EA 3HAEB 5FYLL 1G7PA 3BZFB 1BLNB 4TNVF 4BFBD 1ZVHA 5HI4D 4QNPE 4JRYB 3TNNB 1S7UA 4X9GA 5JLZA 3U4AA 4E41A 2XN9D 1KV3A 2AI0H 2J88L 3B9KC 5I76A 1CFTB 1A7RL 4L8CA 3BIKB 1UACH 2VH5L 4MYWB 1MCCA 4OIAA 4ZS7L 5C0RL 1IC4H 3ROOB 2IBZX 3FHQA 1A3QA 4HIIB 1NC2B 4QRRA 1CDJA 2P5WD 2ICWJ 4BH7B 3TIEB 5CWSA 2UZIH 1RZJL 5A16A 5CINL 3K2UH 4RWYH 3C5JB 4GUPA 4M00A 1RIHH 4IMKC 4DKFH 5D1ZA 1SYVA 1BZ9B 4ODWB 4XRCA 5EO0B 3FMGH 4HD9A 3VXUB 2J4WL 3BMVA 4V2BA 3F5WA 4NUGL 1BJ1J 1YC7A 1TZGH 5F8QC 1HSBB 2H26A 1IAIH 1L4IA 4ALAL 3EYFA 5ALCL 2A77H 1I3UA 4HT1H 3VXRB 5CIPB 3VFSA 3V5DA 1L7TH 4BZYA 2GJJA 4Z76B 2B8OT 3GSXA 5MEQA 2OTUB 1ZA3B 2OR9H 2C1PA 1IQWH 1RUKL 2UZXB 4MXQC 1IM9A 3V0AC 1JPST 4OI9A 4KKCC 4WHTA 5DMIL 4WWID 3T3PE 2L7JA 3BXNB 5EOCJ 1E4WH 3VI3E 1RUMH 1HQ4A 1NCWL 1C7SA 4YHIB 1QNZL 1YN6A 4FZ8H 1IQDA 5E6ID 2ORBL 1MREH 4OFDA 4M3JA 5FB8A 1N5YL 4HMDA 1HHKB 2QADD 4M1DH 5FDWA 1M7XA 1AC0A 1AO7E 1RJYA 3B5TA 1RK1B 2H2PC 5KW9H 3OJDA 2UVFA 5DVNA 1OGAA 4ZUWB 2HLAB 3LB6D 4HFUH 3ZYIA 3WS6C 1EEZB 4NO3A 1S7RB 1RULH 4TUOB 2XOTA 4R96A 1X7QA 4QXGL 3TO2A 2ATPA 3MA9L 3LZFH 4GW1B 3RUGE 1IFHL 4L1HA 5HDQL 3EDJA 1MELA 3HZKA 2JCCF 4MQ7A 4FXLA 4NJAL 4OI7A 1MQ8A 1AP2B 3C2AH 1YEDA 1KIQA 2Z93A 1N4XL 4PLJD 5I1AB 1QLEL 3VGFA 1AGFA 1W0VA 2EIZB 3FOMA 3G5YA 4G80A 1IAMA 4HCRA 2QBWA 4QYOA 1HQRA 3ARXA 1E6JH 3FT2B 3E3QC 3QIUD 3WO4B 3TBYB 1NC2A 1XF3A 4C59B 1FVEA 4L8SB 3STZA 1AD9B 12E8H 4YZFE 3RWGA 3GI8H 4UNVA 1AR2A 2VUOA 2P5ED 2VYRE 3CVIH 5C0JA 5FIEA 3ARFA 4NQCB 4RMUA 4LPXA 2QSCH 5D70H 3BKML 5DMKA 1MCFA 5I75C 3ILQD 3ARZA 4KKNA 1T04B 5T5FL 1U9KA 2AJYL 3MBEA 4OFYD 2PUQT 3RL2A 2OP4L 3MOBH 1IM3B 5EU6A 5LXGL 2EICA 3OAUL 1AI1H 3SKJH 1A6UL 4GG8B 1L9NA 5CJQL 2A73B 3T0AA 5F72S 5KSAD 3H9SE 1CXHA 4TVPD 1UWXH 1MWAH 1OM3L 5I6XC 4P4RB 4JO3H 3P30L 1QBML 1EX0A 2H1PL 4KRPC 4WI8A 1RZ8A 3RIFF 5KOMC 2OR7A 1DBKL 4NWUL 3RTQB 4FFVD 4P5TD 5IK3B 3NPSC 3DOSA 4AH2A 4DKEL 1IRAY 1PG7W 3C8HA 4MMZC 2H32H 2VDMH 4ZFGH 5MEPB 1D9KC 2VR5A 3F7YB 4TQEL 3NCJH 4X80L 3MV01 3BE1L 5BO1L 1ZHNB 5I8KL 5HYFA 2DQUL 1NMBH 5FYLD 4MQSB 2I27N 4LBEA 2MQCA 5D2LA 3L7EA 3I84A 2R1YA 4PJ9D 4G8EB 1XR9B 3DVGA 1XCQA 3L9RB 2I5YL 1QSFD 4PJ8A 3LSOB 2C3GA 2W9DH 2X4QA 1G9NC 1F97A 3ZHLA 5FYJU 5IEKB 3RBSA 2HT4D 1T7WA 1ZT4B 2E7HA 1P69B 4BH8A 2A6DA 2FJHA 4NNXA 4UTBH 5J6HB 5C0DA 3VCLB 4CDHA 2MJWA 4ZQKB 5JMOC 1G84A 3GSQA 4DGYH 1CICC 1E4KA 2DTMH 1A6AB 5IB5A 4E41E 5L7XL 5T1KB 5DQ9A 4FFYL 1XGYL 5JNYA 2DQCL 4GRLB 2NX5B 4EDXB 3D85D 3RWIB 5KTEL 3SDYH 1Y0LB 1DBBL 4CMHC 1NGYB 1CE6B 3ZSSA 1JFQH 4QRRE 2IH1B 1JMZA 3NCFB 4OLUH 1AD9A 5F7EL 1BQHG 4BELD 2DD8H 5FK9A 3BT2H 5EH1A 3VFRA 5IR1A 4NCC2 3C60A 1BVKB 3MZGB 3JBG7 4OLXL 3VXOB 3V8CA 1H9VA 1RPQA 1ZOXA 1F3JA 1HIML 2Q8AH 1ACYH 4U6XB 4JFFB 4MQXD 5FYKH 1P2CB 4GLRI 3GO1H 5FEBA 3IETA 4I3GA 4LFHG 3KXFB 1J1XH 3U9PH 2NW2A 2XQYK 1BPVA 3U0PB 1S3KL 1GZQB 2W91A 3DETC 5F9JA 2WK2A 4GG8A 1B90A 4OF7A 3MJ8A 3I02A 4OUOA 1QG3A 3CFJB 3GMLA 4XNQB 5L0QC 2YZ8A 4YDIL 1ERNA 35C8H 1QZ1A 5CZXC 2QQQA 3EO0B 1T2XA 1I1FB 1ZTXL 2CRZA 2V2WB 5FCUH 5BRZB 2E27L 2GT9A 1KN2H 4WY7H 1NGZA 4UDTB 4X98B 2XPGA 5IK3A 4IIQA 1SJXA 2CIIB 1KLUB 3M17A 1YA5A 4R7DA 1R3LB 4K3JH 1TJGL 3S96A 2IPUG 1IC5H 1EJOL 1QKZL 4OKVA 1F3DH 4R3SB 4F33B 1G7IA 1U6AH 1XR8B 5J1TC 3VFMB 1VGEH 3CPLB 4HXBL 1A0QL 5DHVB 4P2QA 4YHLL 5HHQB 1HE7A 4FS0A 3RP1A 3V95A 3ZE1F 2BSRB 4J23A 2D03H 2JCCA 1HK6A 4QWWC 3SY0B 1I8LC 1PW3A 1UEMA 2Q3ZA 4X7SH 1MI5A 4ZPVB 5DFVC 4LVOB 5CBAB 5HYQA 1IGCL 5TQ0H 1I3RA 4OLWL 4PJAF 3QXTA 3QIWD 4XP4H 2CKNA 5LCVL 5SWSB 2XNAB 3HCVA 4G6FD 1MUJA 5ENWB 1NMAL 1LO0H 1ONQA 3T4AA 4DW2L 5BZWB 3VW3H 1NCNA 3MXVH 5E1HB 2MPAL 2OSLB 3LDBC 3FTGB 4LLYA 2VTFA 1MHCA 3MRQB 5JXEC 4KK9D 4X6CB 5HHOE 2C7UA 3LD8B 5B38A 4JKLA 3QUZD 4P99A 4KY1L 4X5XA 3ULVF 5GHWL 4R7NB 5DHYA 3TYGL 4Q74A 1SVCP 4BJLA 2DQHH 1J8HA 3CVHA 2NXYC 3SE3C 2K1MA 5FF6B 4ZUSB 1N3NA 2P8PA 3WXVH 3IRZA 4GW5A 1N64L 1PG7L 5I2IB 3L5WA 5DEGB 5DEFA 2UYLB 3UTQB 1MQKH 3OF6A 4UBDC 2K7QA 3HC3H 3QI9B 2J5LC 4C56B 4TVSa 3ZKXC 3HI5L 3M8OH 2NW3B 3VWKC 2EDKA 1BQHB 4U6XA 1TVHA 1XIWB 1MSPA 4JZJA 3U46A 1TVBB 3H9SD 3KJ4B 3KXFA 5E2TL 2EH8H 3DWTA 4JM2D 3SQOH 4EI6A 1WC7A 4GBXB 1G7LA 2XTJC 4YQXH 5EU6E 3SGJC 2WNGA 5CBEB 4OZIA 5FA3B 4RNRB 3UO1L 3MRJA 4JJ5B 4P9HL 5F7MC 3U7YH 1GZPB 5EIQA 2F74B 1DJSA 5GISL 4YHZL 4UT7H 1NPUA 1R3HA 3K4AA 2IMMA 4F7MB 5D2NB 1KN4L 1N6QH 1DLHB 4Z18A 4QXTB 3MLVL 3MO1A 3RY4A 3VG0L 3C09C 4BFEA 5HY9A 2JK5A 2A0LC 4ZD3L 3SO5A 5HDBF 1GGBH 4FP8L 3T3ME 1BF8A 1HHGB 1C5CL 5I1DA 1Y18B 4JFDB 3DVNA 4ZO6A 2EDOA 5KSUA 1OAXL 3HS0A 3ARPA 1KFAH 4S0SD 4R3SA 4AT6A 3MJ9H 5TPWL 2ZWLT 2ZP0T 1I7TA 4MCYB 4OLYH 2CUMA 3NFNB 4M7JH 3E8UL 5GZOC 3QDGA 5D2LE 1YMHA 4G7VH 3IAQA 4GXVH 1BGXH 4IRZL 1WLHA 3MSPA 1FE8L 4QXUL 4P2RB 2FZ3B 1NCAL 2Q76B 2PYEB 4WJ5B 5K33A 3QCTH 3HRPA 1H8OA 4HG4K 3PDOB 2ZCHH 3HC4L 3IDYC 4WTZA 4E41D 3OGCB 1G9NH 3SE4C 4FZEH 1A2YB 3RZCA 1KB9J 1U3HB 1AHWA 1MF2H 4NQXB 4M93B 3MRQA 2ADIA 2EECA 3SO3B 4A2MA 4DKDC 4X6DF 1IGFH 2XQBH 3RPKA 3GEWB 2FGWH 2H45A 4QRRD 2C5DC 2J7LA 1QSEB 3DSFL 5GGTL 3MV8A 4QTHA 5KSBE 5MERB 2EKJA 2AJUH 5FM5O 4DK3A 5H37H 2UVEA 1SQ2N 1DDHA 3VGGA 2ZSWB 5DD1H 4G6KL 4U1SA 3G08B 3R06B 3QWRA 4H25B 4JN1H 4RFEB 5E6IB 2PW2B 1Q1JL 3FKUS 4GAGH 1P84J 4OM0L 3WIIL 1QRNB 3UTSB 1FBIH 2A6JA 2CDGB 4NHUA 1CVSC 4BKLB 3MRHA 3OSKA 5C09E 4JKPL 5I18H 1Q9OA 1YPZB 3EYSH 4LCWB 1ACZA 4XMLL 2KH2B 2DB8A 4BQ9A 4MLSA 2VNCA 4LSRL 3CC5B 1VFMA 3X3GH 3QNZB 1IM9D 2DLFL 2HJKB 1ZT1A 3QFJA 4F58L 4U1JB 3OBAA 3G5XB 3ZTNL 5AD0B 1UA6L 1KPUA 2D9CA 3S34L 2CDFA 4ZOAA 1WZ1L 3F7VB 4PJFB 1JWSB 3QXDB 5DUBA 3GI9H 2YK1H 4OGYH 4W6WB 5HJ3B 4UUJA 3I3DA 4F7MA 3JVGA 5D2NA 1DLHA 5IVXF 1OP5K 3VRJB 5ABDE 3Q6GH 2NY3D 1LWRA 4K94C 1MH5B 4IHOB 4Y4HA 1J18A 5F6IB 4DEPC 1KJ3L 1HHGA 1HSAA 5DJYA 5TGBA 3TCLA 4D9QE 4MD4B 5I30L 2X9XA 1TDQA 1OGAD 4DOHE 4HKBB 4PJAA 5GGRA 4FQ2H 1LO5A 4IRSB 3C6LC 2UY7A 1W72H 5TE7H 4MCYA 4OFPA 4TUJA 5CHNB 5IF0B 4X8XA 5I1HL 2DBLH 3PWPA 2JJSA 1BJ8A 4HK0A 1FL5B 3DNKA 3CK0H 4YH6A 1JK8A 5ANMA 2NY0C 4KXZH 1MI5E 1UM6L 3BKYH 3AB0B 4PJBF 4P2RA 2FZ3A 4X6DB 4J3TA 3OB8A 5FDYA 5D5MB 4EUPA 2AXHA 1KG0B 2R29H 2VAJA 5HHOD 1C8PA 1U92A 4M6NH 5DK2A 3T0EE 4C4KT 2IGFH 3C08L 5AEAA 1U8QB 4DN3L 4L5FL 4M7LT 1FV1A 2MNUA 2IG2H 1U8HA 3VWJB 2K3TA 4UT9H 4LEOB 1UVQB 4MB3A 1FGVH 1FO0B 1D3CA 4NNPH 2KZ1B 3PQYB 4LSUH 3MLWH 1UJ3C 2BHZA 2QV2A 3GZKA 1MFBL 2H2SD 4M3KB 2Z31B 4APQB 1J8HE 3ARQA 2P7TA 3FONA 1RUPL 3BUTA 4JO4L 3KYOB 5HI5D 1ZLSL 1ORQB 3ARFD 4OGZA 3MRCB 2VISA 4EXKA 4X0KA 5BVJB 4K2UH 3ULUC 5L8KB 4JFQB 1T5XB 4QOKA 4M62H 5JMRA 2BVEA 1E27A 5LGJA 1AFVH 1QFWM 4H26A 5BJTB 1FIEA 3BH8A 4XVSH 3MBED 1CDIA 3RA7H 4PREB 1QRNA 2ZUQC 3LIZL 4ONFL 1A3LL 5EU6D 5GGVH 3NIDF 4P5KA 4TN9A 2GW5A 2X4TB 5FM8A 5BZDB 5HPMA 3NOIA 1SBSL 2Y4SA 2GAZA 4LPTA 3PWVB 1JHKL 4N8VA 4ZYKB 3AM8A 4FG6C 5EZLA 1DEDA 4U6HB 1T2QH 3RKDD 4OZIE 3VFPB 3WFHB 4QRSA 1UCBL 1P5UA 3VXQB 1T1XA 1I9IH 1HXMA 2A83A 2LAGB 4WW1B 4XNXH 4BQ8A 3PG2A 3BUYA 2E7CA 4LLAA 3GMMA 3HLAB 2HJFB 3KYKH 3GSNH 4FQQB 3QEHA 1PZ5B 1RJZA 3G5VA 4W4OA 1B9ZA 3QQ9C 3FN9A 4E42B 4PFEA 1J0KA 3QXUA 4H0HB 3VG9B 3TLRA 2ITDB 2B7DT 2QQKL 3WIFA 2O61A 4GJTB 1J0HA 1JV5A 2ARJQ 4HH8A 2CIKB 4XNYL 4CJ1A 2VXSH 2PF6A 5GRZA 5I1LB 1DQLH 3LEYL 1DQDL 4NZTL 1KELL 5JOEA 4YHNB 4LCIH 1QBLL 1JRHH 2MTPA 1U8PB 3TZVB 1KEMH 4PJ8D 4UQ2B 2Q7YA 1VADB 4U1NB 3QDGE 4D0DA 2ARJA 3UJJH 4DQOL 4PD4J 5GS1C 3TT3L 3LKSB 5DJ6B 5GGQL 3SKNA 3WS3A 4L3CB 2BY0A 1O5DT 5ITBH 2Z0BA 1U8KA 1UM4L 4I8DA 1QQDA 3JTTA 1TJHH 3TA3B 1OB1A 3EFDL 4XCCL 2HG5B 5J57B 5DRNA 3EJYD 5FHBL 3ILPB 4P0DA 5EU7C 4RFOL 4AIZA 2ARWA 1FN4A 32C2A 1BVZA 4FQ1L 5C8JB 1F42A 1X5YA 2PR4H 4RGOL 5LGHH 3FT3B 5HHPB 4JG0L 1OF2B 3QWOB 1KIRA 5E8DL 2Z31A 1K4DB 4EJ1C 5FECB 2K9UA 3CZFA 2YD5A 3KYOA 1FFPA 3C60D 1LEKA 4XH2A 5EWIL 2C4XA 2Y6SC 3VGAB 2GITB 1YY8B 1WBZA 2FWOB 3F7RA 1AO7B 3PGDA 1OCWL 3P9MB 4FQLL 2BY2A 5IG7B 5EFIB 1CVRA 3RY6C 1IAOB 2HH0H 3DV6A 4S1QH 5IJKC 1FRGH 1T89A 4A6YL 1LP9F 2R1XB 2XG5A 5CKGA 1JNNL 2H2PD 4PV8B 2Q3AA 4W6XB 4NCC1 2I9TB 5IVXA 4O2FA 4MJ5A 3SGEI 3QFJE 5H35A 1CL7H 3RUGB 3BRFA 5EORL 4ZFOA 1HYSD 1JPFA 2HJFA 1MJUL 1T22A 3NTCL 5E00B 3TN0A 3K46A 4G6FB 2V5TA 2YBRB 2P4AB 4HUNB 4JAMA 4PRIE 2GJZA 1OW0A 5HYJA 4PJEA 4AL8H 1SVZA 1TZIB 1PVHA 4JY6A 5HGDB 4R6UA 3S6CA 1SJHB 1K6QL 4LP5A 1XGRA 2KL6A 4RISL 1NAKH 3MGAA 3BDXA 3QUZB 2VR9A 4K94H 4J7RA 1N5AB 2ZUWA 5ESQA 4P2QD 3L5XH 3HE7A 2J8HA 4PJBA 3PNWA 5JA8B 3TV3H 3I3BA 1CGSL 5JUEL 2NY5C 5L6YL 3RVWD 1MI5D 2IJ0C 2R2EB 3C5ZC 4C58B 3OKMB 3NZ8A 4JFPA 1N0XL 3MRMB 5B3JE 5DJAA 4HEME 5EOTB 5C2UB 1UFUA 4G8FA 4K3DH 2H41A 1NBVL 5MENE 3T0ED 4HWBA 1X4YA 4P23A 1PSKH 3KG5A 4I18A 4IRJB 4PJXF 2D7QA 5TDOB 1FJ1B 3ARDC 3MBXH 4XVTH 4XXDA 4RQQB 1AXTL 4MVBD 3TO4C 4X7TB 1I4FA 2OJEB 4HC1A 3S5LG 5HYIA 4Q9BA 4PB9H 1GHFL 1TZHA 1OP5H 1CGVA 1FIGH 1J8HD 3ZMRA 1OAKH 3BEVA 4YE4L 4JRWA 3W39B 4HQQH 3WLBB 1MY7A 3GJFA 3BGMB 4RMRA 3DXAA 2X6MA 2AV1B 3FB7B 4RMWA 4NQDE 5CUSH 4L9DA 2ZKHL 4KZEL 3IDXL 5DRZB 4GKZB 3OF6D 4MNGB 2FBJL 3IDMB 4UINH 5F1SA 2X1XR 4FQCL 1NGPL 4HWUA 5CD3A 1RSFA 4XVJH 5D7LA 1YY8A 1IZKA 4QOKE 2V17L 3QCVL 1MJJB 3DROB 3WFEH 3D6GA 3QHZH 4U1IB 1EO8L 3ULUH 3WE6A 1VACA 4G7YH 1BHGA 15C8L 3OG4B 1TETH 3NIGF 1Z9MA 4G3YH 2R1XA 4HUWA 1QEWB 3L3KB 3H42H 5I1KL 3JSSA 3U83A 1EIBA 4LLWB 5DD6A 1MFAH 1RUAL 1TTFA 1N59B 5BW7C 1BQSA 2W9EL 3X14B 2ZUYA 3QQNA 4ZDHB 4NQTA 1BOGB 1TTGA 4OCXH 4KK6D 4DCQB 3QIBB 5IHBA 4L8DB 3GHBL 3VGHA 4PJHF 5FCSH 3V7AG 3DX6A 3HI1B 2JE8A 3V5KB 2LTQB 4OQ1A 1VHPA 4G6MH 2EXYC 1BP3B 1BIIB 4PJ5E 4N0RA 2I25N 3G6AA 1PX4A 4YAQB 4U3CA 3BN9C 1CICD 4N0YL 1LQSR 3U2SA 5EOCL 3HZYA 1NANH 2WWMD 2AKRB 1QPPA 1INQA 2IAMC 1KPVB 2KKQA 2WBKA 3QDGD 4PJXB 4Y2OA 4ODHL 4TSBH 2OJZH 1JPSH 1C1EH 2N7BA 3UP1A 3ZT7A 2JJVA 2DKSA 4D9LL 1K4CA 4OCWH 2VE6B 1XZ0A 1V3MA 5JW5B 2HTKD 3O3BA 4K8RL 4HIEB 3Q0HA 3THML 3BZDA 3CXDH 5C0BA 1JUFA 5JHDE 1ZS8B 2GIYA 1VEMA 2R0WH 1N2RA 3PV7A 4XCFH 1BFOB 3OXSB 2AJSL 3BPOC 1EBAA 3I2CL 3QRFM 3UCRA 4Q9RH 5BVPH 1X5GA 3PHSA 4JZNB 4FQIH 2GTZB 3BEWB 2VLLA 3P73A 4ZFFA 1JYXA 2ZSVA 3S5LB 1CLYL 3MOAH 2GHWB 3NGBC 2ZPKL 3TYFB 3C9NB 2AV1A 3LV3B 4H1LH 3EO9L 5EIIA 3QWRD 4GRWE 4MNGA 3RWFA 3L1OL 1WUNT 1OQXA 1R0AL 1LP9A 1Q94A 3L3IA 4ZOEA 3PWJB 2NY3B 1F58H 4KJQC 1CWVA 4P3CH 1LDPL 3UC0H 5HPOA 1U93A 3N50A 3BJ91 3BX7C 4YC2C 1ZLUK 1CFNB 2G2RA 1DBJH 4YGVA 5EUKA 1T4KB 3BPCA 3PXHA 5FOBA 1LEGB 2VDLL 3AXLB 3QZWG 1KGCE 3HUJB 5FGRA 4YNYA 3QFJD 4O4YL 5CGYD 1AGCB 3SKMB 1A7QH 3LAFA 3TBSA 3IAGC 3BRDA 3OKKA 1Z3GL 2NZIA 4YJZL 3GRWH 5KANG 2ADJB 3KJ6L 1U8JB 3EYUL 2ZOKA 3HFML 1CU4H 4QWWD 4NO5A 5DD5H 3BAEL 4Y4KB 3C5SB 1SEBA 4ELME 1Z9LA 5HVFB 1GC1H 2MQ0A 3HG1A 4R2GB 3V4PL 5MI0C 5IMMB 3EYQD 4Y4HD 5HHOB 3LKOB 5HYJE 3DURB 4PJEE 5TE6H 3HMWH 5T33L 5IQ9B 3EW3B 1FNGB 4JFYB 4YAQA 4JDTH 2JELL 1ZT7B 5IB3A 2BNUA 4LAQH 5AZEH 3O3EB 4ODBD 4N8CH 5CKAA 5HXMA 3QUMA 3PWPD 4NOFA 2EDDA 5B8CA 2VL4A 3BDBA 1W0WA 3CX2A 5E2UH 5DGQA 3BSZL 1PD6A 1JGUH 1S9YA 2RGSA 4I0PA 5C0FA 3K4DA 2O5ZL 5KN5A 2NY5H 5HYSA 1P1ZB 2DYPA 4CADB 1WAAF 2F8OA 3FB6A 4LCCA 5AYUH 3CFDA 2DQEH 5IB2A 1FVDA 4OZGE 4PR5A 4YEEA 3SBWA 3GMPB 2OI9C 3MJ7A 2VITB 4UIKH 3CFCL 5IB4B 4YUEH 5DTFB 2FHBA 4KHXH 5F7YC 1RZ7L 1CCZA 1NUGA 1URLA 4NM8H 2R2BA 3QJFA 3D69B 4NQDD 3QHTC 5T5NG 1XFPA 2GTZA 4NRZA 4WO4C 4M1CD 4JLRB 3QQ3B 5GGUB 3N1PC 3MV11 3ZYZA 1KTRL 2OTPA 4FFZL 2XZCH 3ARGA 3DXAE 5DWUH 2H3NA 3QUXC 2ED8A 4QOKD 1IT9L 2X4RB 5TF1L 4HC1L 4N8PA 2IANB 1R24B 1YEGH 4Q0XH 4WCYH 2LU7A 3EOAB 4PRPA 5IW1A 5HYEA 1LNUB 2BSED 3GIVA 5IP4A 1JYNA 3V4VH 5ISZA 4RA3A 1JVKA 5T5NF 3INUH 5AWNH 5DFTA 4HIHA 5A40E 4WUKL 1J1PL 1BBDL 4YHOH 3B9KB 3UX9B 2W92A 2EC9T 5DK3A 3V2AR 4HXAL 4UT6L 1N8ZA 1MCQA 3OX8B 4QF1A 4WI5A 1NJ9B 3SKMA 5E24E 1U58B 3E6FA 5C0IB 4PJHA 1E4XL 4JO1H 4XBEL 5GZOD 5GS2D 3NN8B 6FABH 4LMQI 3QZWB 4LHUG 4WWKA 3DTXA 1MLBB 1YEEH 1JNLL 1R5VB 2HRPL 4ZMAT 5LQBL 4S1RL 5DGRA 1INDH 4PJ5D 2Q6WB 3P0YH 2VWEC 5HBBA 4J3XA 1NL0H 4NC1C 2DQTL 4HV8A 4PTUA 2YR3A 1FNEA 4ZFZA 2BMKA 3UYPA 2V7NB 4K8RD 5EDXA 5JQHC 1H5BA 3QO0B 5L88H 2E7LA 2AJ3A 1I3GH 5IQ9A 1KOAA 3U4EB 4HUKB 5KSBB 1GXEA 4XWGH 1MWAA 5E2WH 4AQOA 1FPTL 1HHHB 1CXKA 4XPBL 1CFSA 3HMXH 1D6VL 4CAGA 4K7PX 1MAKA 5HD8C 3SCMD 4JY4A 3L5HA 2H32A 5GGSY 1T0PB 5JHDD 2VUYA 4X4MA 3ZSTA 1P1ZA 3UTZA 4FMKA 1FGNL 5CLTA 4CADA 2X89A 2FLBT 3GIZL 4POUB 2OM5A 5C09B 1LK3H 3P4NB 3F12B 5C0BE 3RWCB 2VL5B 3NVQA 4XPAH 3FOLB 4HUVA 4D0CB 1FG9C 2ESVA 1MCLA 5F1IB 1VERA 4JG1L 3FRUA 3T04D 3FAWA 1RHHA 3QH3A 1S8DA 3N85L 2HKFH 5D1QC 5IROA 1J7VR 3H3KA 2GSIA 3T2NH 3TVMA 4LEXH 5CMAA 4I77H 2X9YA 3PJSA 3WIHH 1XGPB 4CGTA 4FQXA 5A1AA 5E94A 2X4RA 5J13C 2FJGA 4CNIA 2ATKA 4L9LA 4XX1E 3MX0A 2H6PB 1VESA 4LNRB 5ESVA 3Q3GB 1A9BB 5JQ6L 1KGCD 4L4VE 4BSVA 1YUHA 4BYHA 1K2DA 4PIRF 5DXWA 4YDLC 4HUMB 4KK8D 7CGTA 4G43B 4GO6B 5DEZA 2YXFA 4OJFH 4JVWA 4N0CC 3TIDA 1IKNC 1BAFH 4MCZB 1IVLA 1RVFH 5DMGC 3S4SB 2UWEE 2VXUL 3QUYC 4MA8H 5CD5D 4GQ9H 3TBTA 1OTSC 1UACL 3VFTB 4YHKH 3CXHJ 3TN0D 1MLBA 5J0BA 2YPLE 3KPQA 3FO1B 5HYJD 2EYRB 3LN4B 5IGXH 3HRZA 3BP4A 4IDJH 4IOFD 4LHUB 1T0NA 1HDMB 5I75B 3V0WL 3HE6A 5I66B 4ORGA 4Z8FH 4GSDH 3QEGH 5I8EA 1HWHB 2R0ZH 1RIHL 3H0TA 3OHXA 4GG6F 3MMEA 4NSKB 4CVUA 2OL3H 3NAAH 3JV0A 2W59A 4QHNA 5SX4H 3HE7D 1S7VB 1XF5B 4ZODA 1PJ9A 5TDPB 3S3PA 3OPZL 1JWMA 3K1KC 2HT2C 1WAAA 3PL6A 1ZLUH 4P2OC 4FXKB 4LIQE 1AQDA 3V8OA 3UTTE 3ARVA 5JIIA 5I6XB 3U48A 3BVNA 3VGBA 2W0FB 2J8UA 4KRPB 2ZG2A 3B5GA 1Z5LA 1R3KA 1BMGA 4GKOA 4P23D 5DUMH 4KDTC 3NPSB 1C5BH 1OWRM 2DQGH 4LIQL 1D9KB 5C0EA 5CSBA 2YN3A 3QUML 3WFBH 3H7BA 2XQYG 4LASL 2WUBL 3S3SA 1S78D 3FO2B 2ED7A 5GS0H 1ZGLA 2I60H 5DVOA 3VD3A 4Z7QF 1F8TH 4H8WC 1FYHB 4BM7A 3DGGB 3DXAD 4O9HL 3QO1B 3VE0B 4FG6D 1VFAA 4LLVA 3T4YA 4UZGA 3QULB 3BIBX 4U0RC 1XGPA 4KAQH 2YMXL 3SDCC 4PGEB 3MLUL 3RWEB 3KPTA 4U6YB 1EXUA 1KCUH 5D7LD 1FG2B 2DICA 5D93C 4CKVX 2MWCA 1MHEB 5D7JC 4AENA 1WFNA 4QHUA 3NIGE 1L7IH 1S9WB 1FL6B 1G0DA 2R0LL 3GSUB 5ISZE 2E7BA 1CICB 1M7DB 3V0VA 4Z7WB 2WIIA 2IBZY 3I9GL 3EOBB 1EHXA 5DJDA 1NDGB 4Z7OF 4QRUA 4AYFA 2VZUA 1WTLA 1FYTA 4CMHB 4HJGB 4R0LA 4HS3A 4X6FB 3TBWA 3DPBA 2VLJA 4PJHE 5L2KA 3U6RB 4KK5C 2X4PA 1QPXA 1E6JL 4PS4H 3MRLB 3SN6N 4YDKH 3IGAB 5J1AB 4I0KA 4OZFB 3P3YA 3FO1A 1AGEB 2Y07H 4MNHB 3DHJA 3AS1A 4LHUA 3GSOA 3U7WH 1MIEH 5AZ2L 2FX8H 4P57A 3GB7A 4NZDA 3U1SH 1ETZB 4F7CA 2VAAB 1LO3H 1A7BA 1S7VA 5J3HC 2VKXA 2IFGA 2ZZUT 3JXAA 4KV5F 4A6YB 5L0QB 4ODUB 3W0WB 2F53E 3BZEA 3KPSB 2ZCKH 5C07E 1H3PH 2HVJB 3MUGB 3K1DA 5C70A 3QCUL 5C0BD 1BOYA 3IJYA 1F4YL 2Y6SD 3UZVB 3KLDA 2QQLL 2YC1A 1MWAL 3BHBB 4K7FA 1RZGB 1Q72L 3DMMA 5F9OH 4NWTH 4POYA 3MJ9A 4X6EB 5D7SH 3CMGA 2NNAA 1CF8L 5FFLA 1U42A 3EO1A 1IAII 2W9LA 2ESVE 3ESVF 1I7ZB 5GRXG 2N1KA 4XXCA 5HHME 2V7HA 5KZCD 4KQ3L 2X4OB 3AREC 4XB8A 1WCBB 1JPGA 4D8PB 1K8IA 5F6HJ 2HMIC 1QSVA 4PRIB 1XGQA 4U0QB 3VFVA 4B53A 3G5ZB 3KPNB 5EC1A 3MNZA 2VRAA 2ICCA 2X4UB 4L4VD 1MRDH 3SE9L 5HHVH 4YWGL 3TJEH 2D0HA 3OKOA 4PRBB 3W5MA 2E7MA 3GMQA 3LDBB 4M7LH 2KQMA 3KPMB 1TVDA 1EAPB 4B5EA 1I1CA 3S88H 2D7MA 5IESH 4LK4A 2HT3C 2AXGA 4NCDA 2OTWA 3ARBC 2Q86A 1I1AC 5AG8A 2NXYB 2BNRA 4DGYL 1NAMH 5MENB 4KJPC 1FFNA 4IM8A 3HG1D 4GG6A 4K7PL 3LH2L 2J5LB 3QJHB 3NA4A 4HPOL 3DX9A 4YIQB 5JPNA 2OZ4A 3CSYB 1UXSB 3ZKXB 1P4IH 3E1F1 2C3VB 3SGKC 2VXTL 3KS0J 1LE5B 3VWKB 2Y23A 5BS0A 1WBYB 1MNUL 1QYGL 2DD8L 1ZLVK 5BXFA 3D87B 5M94B 1DQML 4NQDB 5IM7B 1R5WB 2XTJB 1A9EA 1B4JL 3CZJA 2ICWB 4PRAB 2EH7H 3GO1L 1JGDB 2J6EL 2X4NA 3MROA 4XPFH 1T83C 4I0PD 4PRDA 3RIAK 5IHLB 5M7QA 4ODUA 2P43B 1OD7A 4EN3A 3F65A 1FHGA 2DTSA 2ZUXA 3KPSA 5ALBH 1M7IA 5DK0B 2HVJA 3A6CH 3SKUD 2VDOL 3O4OC 3U0TA 2J8UE 3C09B 1SYSB 4QGTA 1KSRA 1ITBB 1BEYL 5IT2L 1EHLL 1I1RA 5FCUL 1JYWA 5FHAH 2E9WA 1KN2L 3JWDC 4JKMA 1F6FB 4OLVH 3D9AL 2R4SH 4U4BA 4ODSH 5EZJB 2VQ1B 3VFOA 1W72A 2K7PA 5B22A 1QBBA 2R2HB 5EPMB 4EI5C 3MGTB 4OGAD 3CFBA 1I7ZA 4JR9H 4ZUTB 2DKMA 3ARGD 3RRQA 1NLDL 1WCBA 1UWGH 4FFWC 5E0QA 5HI3C 4I48A 3UTPE 2QL1A 1U6AL 5FKPB 2Y72A 4LLQB 4ODXB 3DX7A 2YWYA 3NCEB 3I6LE 4PJ5B 1MEXH 5ISZD 2H8PA 4AY0A 2CLVB 3DI2B 3P4MA 3ALPA 1G9MH 2QR0A 3QA3B 4LARL 1EFXB 4OCRL 5L9DH 2FEDD 3IDYB 2ZCLH 1FNAA 2FECI 3ECBA 4D9RD 4WGWB 3DLQR 4EQ2A 4NC1E 1E28A 3T1FA 1LO0L 1QO3A 3MRFA 2BERA 1V8HA 3H6JA 5JO5A 1B6DA 3ETBF 5TH2A 3OKEB 4WWKD 4IS6A 3UPAA 5FUOH 2FR4A 1LDSA 4HH9B 2EXWD 1U8MB 2VLJE 3H2WA 5L2KE 1I85C 4Z5RA 1KNOB 4UI2A 3QJHA 4RX4D 2AGJH 1YMMB 4NKOA 1RK0B 2LU3A 4HKZA 3VFNA 3NA9L 3QSKB 2VB5A 5A43C 2NR6D 2CH8A 5D6DA 1NBZB 4Q9CA 3V5HA 3ULUF 2IPKB 2YKLL 2PO6A 5DJCA 1ZHLB 3U82B 1AJ7H 1CGYA 2F53D 3MYZA 4QT5B 3T8XA 4K3EL 1RMFL 5EUOB 4DGIH 4GRWB 3RPIB 3GSNA 5IWLA 3ZDYF 3F6LA 5JIKA 5IHUL 3DX8A 2HLFC 1YEFL 4J4PC 4NO2A 3SQOL 4RBPK 5I1CH 3RX7A 1XF2A 2X89D 1BZ7B 5DMJB 3U7YL 1TITA 4P46C 1DLFH 4J1UB 2P8LA 3GUTB 1A14H 2O5XL 1A1OA 5D9SB 4WVRA 2ESVD 4X5LA 3WSQH 5ILTH 2FATL 3OJMB 1YYML 4DEPB 4XP5L 2X9WA 5ID1A 5HHMD 4JFXB 3P9WB 3SEPA 1WWCA 4F57L 4M6OH 5C0CB 4LHJB 5KANI 1XF1A 4U3XA 5GRUH 3TVMD 3QUKB 5GQBA 4HUXB 3C6LB 3L5IA 4ELMB 1TMCB 4FQXD 4Y4FC 4P4KA 5JW4Q 1OSPH 4MMXC 3HPLA 5I1IH 2FX9H 2NY0B 2F54A 4I13B 4YBHA 4YXHL 3DO3A 5E8NA 3JWNC 2NY6D 4GXVL 4ODTL 1EFXA 3IXTB 4HWZB 3CUPB 1T66D 2EZ0C 5LAXB 1A7NH 4JFEA 5I8CB 3OKLB 3QDME 1HN1A 5MP6L 5IKCA 4ODVH 3GMNA 1KLGA 4RIRB 3RVVD 5K59F 3HZVB 3HHRB 1KIPB 4MNQA 4HPYL 3GK8H 1UJ3B 3V9FA 3OKNA 5F89A 2BNRE 1IGFL 4MA1C 1JN6A 4OZGB 2Q7NA 3S3JA 3O6FA 5DMYA 1KTDA 2NMSA 3RVTC 5MHSE 1RJCA 1BD2E 3HE6D 3IRPX 1WEJL 2DOCA 1E6OH 5DJ0A 4OAWA 2NXZD 4HIJB 2ZUQB 4UTAH 1HEZB 5KVFH 4RMTA 3LKNB 5C7XL 3VH8G 1KENL 1YYLL 2IQ9H 1FBIL 1LE9A 5C9JA 3UEZA 3OMZA 2QKIB 2OZ4L 2BFVH 3CFKA 3RPIA 3MODL 4M43H 4P5MA 1HYRC 4O02H 4OF0A 1MY5A 2CJUL 4KQ4H 4DTGH 1MLCA 3FQWA 1I9RH 2VSDA 1NMCC 4F7TA 3QEQB 2PXYC 1TENA 4NQEE 1YDPB 4P48A 2MCPH 3RWDA 3SDDA 3ME0A 1ZA6B 2MQ3A 5CCKH 4XWOC 1NFIB 1CD1A 2J2ZA 4W4NA 4JHWL 3D39A 5DRWB 2V2TB 2QLVB 4U7SA 3EZ8A 1Z0MA 3RFZC 2A74B 2VLRB 1JWUB 4TNWK 3W2DH 1KLFA 3BWAB 3MCLL 3LN5A 5A2JH 5CIPH 5C0CA 2P48B 3ORJA 1JHLH 2Z92A 4YDVA 3NCYS 3VRIB 1NGQH 1G0XA 2ITCB 2X4SA 5E8PA 4PY7B 4FQHB 5EA0L 1ZLVH 1JHTB 4F8TA 1PBYA 3I6LD 3IFOB 2AJZA 2R0KL 1MFEL 1R3IH 4WV1C 4HWEH 1PLGH 4P3WA 2DWDA 3QNYB 5AYQA 1H0DB 3CSGA 3W9DA 3BKCL 5GS1B 4W6YB 2HFTA 2YPKB 3N0PB 1R3JB 3IJSB 3O45B 5D4QA 4XCYA 4NKDB 1UM5L 1NBYA 5E03A 4Q9QL 4U33A 4N9GA 1ZHBA 4Z7OE 1DVFC 4U6VH 2A2QT 1MAMH 3TT1H 3N9GL 4Y7MA 5EBLB 5E70A 4ZXBC 1HINL 1FYTD 2IGFL 4KROC 2FLRT 1F6AA 2VLJD 2VZOA 5L2KD 5E99H 4IBLT 3BP5A 3FQNA 5ESAA 1UJ3A 5IB1B 4UT9L 3I6KA 2A1WL 3LKQB 4MJIB 1FGVL 1RD6A 3O2WL 1FNLA 1JGEB 4LSUL 1JCKA 4GRMA 2R8SL 1CFQB 4KTEH 3C6SA 3SQBA 5CJ5A 1NCCH 1NKOA 1P6AB 2HKHL 1LO2L 1A5FL 3O3DB 3TBVA 2EO9A 4K2UL 4S2SA 4NT6B 5GSVA 3ZT6A 1DBML 5KVGL 1AFVL 1U95B 4MJ6A 1KJMB 2E5EA 3FZUC 4KHTH 4NJ9H 3WHE0 3IDNA 4XVSL 4N0UB 5E5MA 4KUZH 1A6VL 4AM0A 1TIUA 4Q6IC 1YEIH 3TH4T 1D5BB 3VH8B 1SMOA 3VD4A 3RU8H 5I15H 1I8KB 3NFSL 1OL0A 2FGZA 2VOTA 4L4VB 5DQJA 3MRIB 3NCCB 2AQ3A 1YDPA 1CD9B 1F4XL 3DMMD 1KEGH 4GKNB 4X8JA 1S5HA 3QG6A 2JLLA 1UEYA 2D31A 1KB5L 3PWUA 2V2XA 4J6RH 4RGNC 4BZ1H 2NZ9C 3OKYA 4CVWA 2O5YL 1T2JA 3BWAA 1NC4B 3G6JB 2UWEB 1KCKA 4JDZA 3ZDZF 2ADGA 3FQXB 4MA3A 2BP3A 2HVKB 5TF0A 1L6ZA 5FO7A 1QLRA 4MDJA 4E5XB 1CT8B 4YHMH 1D5ZA 1U8IB 2BNQA 4LKCA 3RGVA 5CP3H 2YPLB 1NUDA 1OSZA 4NQVB 4NC0B 1OTSD 1EEUA 4BUGA 2JKXA 1RZFL 5T1MB 2VDPL 2WW8A 3C8DA 2MHAB 2XV6B 5GZND 4LSSH 2F54E 5DR5H 5EU5A 1KIUA 3CFEB 4F7PA 5L2JB 2RFXB 3BP7B 5GJSL 4C55A 5BV7C 3ARDB 3UJJL 1VFOA 4RBPH 3VXSA 3E2HC 3GSVB 3O81A 4PB0L 3TO4B 1NCDH 1NCBL 5DD3L 1T3FB 3L3HB 3UPRA 4ERSH 4YXLL 4TSAH 5ITBL 1Q0XL 4JFEE 1Q9KB 3UTTB 1DFBH 3QRGH 4H1LA 1DSFH 2G60H 2BNRD 4N5UA 1WWBX 5D8JL 4POZD 3QXVA 2NYYD 3LQAC 4XBPB 5F7WC 5IMKA 4MXWH 5E08L 1RJLB 2GK0B 1DEEB 5TFSL 5I1JH 3LMJH 5C71A 1BD2D 1HNGA 2B4CL 4GQPH 3NABH 3TWCL 1AD0A 4Z6AT 1YEHH 2NY1D 1X4XA 5BS0D 4M9OA 1QVOA 3O6LH 3O3AB 3P11H 2VZ1A 4LF3B 5IFHL 5H94B 3DBXB 4Y16D 1DUYA 2GJ6B 2Q8BL 1U8NB 2G9HA 4HAFA 4FTVB 1BM3H 1F11A 1YY9D 2OXHA 3OV6A 1B0GA 1LILA 1J1OL 3KPOB 2JB6B 3GRWA 5IHZB 1IGTB 2CMRH 3DYMA 3KDMB 1K8DB 2V5RA 3MRRB 3OXRB 4GAJL 1CLOL 2HH0L 4EN3D 2AK4B 3P4OB 1B0WA 4KPHL 3MV9A 5KJRL 4PG9A 1J5OL 2AK1L 43CAB 1QD0A 4YBLC 4XAWL 1A7OL 2C9AA 4NRYB 4ZUVB 5MEOA 5E6IC 4I2XA 5T3ZE 1ZHKB 3O0RH 3UJIH 2QADC 2YUVA 5FYKU 1FZJB 4Y2DA 4EIGB 4JHZA 3D39E 1MCNA 5FAAA 5D1XA 4ZOBA 2BDNH 3L3OA 3L5JA 4LRNL 3GMOA 3A6BL 5T3ZL 3LB6C 1WBXB 3V6FA 2IAMB 3H3PH 4LLMA 4AQ1B 3HNVL 1OLLA 3QPQD 2WZPD 3IFNL 7FABH 4E5XA 1SJVA 2DM3A 5FKAA 4AEEA 5J06A 1NAKL 3C5ZA 1G0YR 5AAMA 1OAUH 1QFWH 4BA8A 4NQSB 5D96C 4V1DA 4ZS6D 1IKFL 3REWB 3CFEA 5L2JA 3ZLQC 4PLJC 1BX2B 4CVXA 1PFCA 5I1EL 3BPOB 2XKNB 3NCMA 4AIOA 5IJVB 4HZLB 1E4JA 1OAQL 5E4IA 1A1NA 3FO0L 8FABA 3QIUC 3F6IA 4NKIH 3LEXB 4XZUB 4L4TE 3QEUB 2F53B 2NPLX 1I9JH 5C07B 4NM4L 3NGBB 1EDQA 1P7QA 5DHVH 4HSQA 1J0ZA 2QHLA 1KPRA 3L3DA 1YEKL 3QFDA 3TC9A 1C5DA 4IOIB 4NKQB 4LKXA 1QTYT 1S9XA 3REVA 3ILQC 5CZVL 1ZANL 1A4JB 2R69L 3OR7A 4UILL 2IH3B 3JZ7A 3U0WL 2W60B 4YC2B 4X7DC 4UINL 3RX8A 5DRXB 2HFFB 1Z6JT 4LF3A 4PJCF 4DJMA 2C4FU 2PO6D 1KBGH 1MCOL 4ZAKA 2XA8L 3S9DB 2PTTB 2C3WA 1CD0A 3DHMA 4FTVA 4GMTH 3GJEA 1TCRA 3QT2A 1F90H 4M1GH 5KSAC 4OQTL 1OARH 3QHZL 2JB6A 3UBXA 4F3FB 1HXYA 4YX2H 3KPPA 4YFLI 4XBGB 1NKRA 3M1BB 3GFUA 1CIUA 1TETL 2DWEA 2IC2A 1TCMA 1QLFB 2AK4A 5C3LD 2XWJB 4G3YL 5F71A 1KCSL 4FFVC 2IFFH 4P5TC 5HGAA 1MPAH 3HPJB 4WFGE 4JM4H 4GT7A 4GXUM 4JPWL 3MREB 2BRRH 2CRYA 5INCB 5MI0B 3AVEA 4YHPB 2ZOLB 5DYOA 4Y19A 2I07B 1AY1L 3EFFA 5GRJH 5CEYA 1PYWB 4G6JH 4FOMA 3WN5C 2A6IA 4MQTB 3WD5H 2GSGA 3WUZA 2CKBH 5K9QG 3HMXA 3FFDA 4JN2B 4PJ9C 3DRQA 3QXAA 4P4KD 3ARBD 3ZYJA 5SWZA 1HI6B 2DMKA 2F54D 1LK2B 4MD5B 1I8IB 2SEBB 1VPOL 5IVZA 2BSSA 4IMLB 2HWZH 4FXGB 4NUJA 3FQTA 4ZSOE 2EDWA 1CL7I 3NZHH 2HT4C 2DJ4A 4PY8I 4PJDF 3GBNH 2AXFA 3PV6B 3UDWC 4OCWL 2X1QA 5DVMA 1F5WA 4JFED 2OI9B 3W9EB 1KTLB 2JF1A 5K59E 1JZ8A 5IEHA 2WBJA 2C1OA 4G8GE 4PG2C 3VXSE 2HFGL 4OCNC 5BV7H 4DVBB 4O51B 3FB5B 4Q97A 2VLKB 4WO4B 3MRGB 3WIHA 2OQJA 2R0WL 3KYMA 4YPGA 4ONHA 4Q9RL 4JB9H 4ONGH 3OZ9H 1FNSH 3QUXB 3O6FD 3BQUC 5F7NC 1A6WL 5F1KC 4Z77A 1P4BL 3QPXH 4ELKB 2DQFB 2W65A 1T5WA 4MQXC 1VFBB 1KCRL 3MRNB 1PQZA 2R23B 1S7SB 5CP7B 3W11D 1UH2A 4M4PA 5KG9A 3VXNA 4KVNL 2OK0H 2ZNWA 3BDYH 4LNVA 2Y06L 3B2UD 3JV6A 4Z7UE 1AQKH 4P3CL 4XT1C 5C0AE 4HDIB 5H2BB 4Y5VC 3CX5K 5EU4B 4K07A 4NGHH 3U7AA 1DBJL 4F2MA 2UZYB 2XFXA 2YRLA 2RCSL 1I7UA 1QLFA 4FFWD 4G42A 4AMKH 1GOFA 3MV9E 2XWBA 4HJJL 2CDEB 3D39D 3GRWL 2B1HL 3R0MA 4I2XE 3CU7A 3SJVE 2OL3A 4WW2F 3ARUA 3VXPB 4QHMA 1UZ8B 3EDFA 4XC3H 4YBQD 3KLAA 3BI9X 4MD0B 5INDA 4LGSB 4O5LH 4XCEA 1G7HB 1T20A 1QA9A 2Z35A 3GNML 4Z7VE 2G5BA 1RY7B 1IEAB 2AQ1A 2FIKB 4J8RA 4JO2H 4S11A 4NP4H 3GSWA 5TE6L 4UOW0 4IEFB 4PJDB 3RL1A 5A3ID 4UU9A 4M61A 1G7MA 5HGGS 4JDTL 1AR1D 3FQRB 5CJOH 4J3OC 1P7KA 1GAFH 3QIWC 1RURL 4ZG1A 1LVEA 3K4ZA 1LD9A 2X2YA 5CEXA 1A7PH 1MCKA 3V79C 1ND0A 4Y5YA 3S36H 4WU7A 4NO0A 1WT5A 4JPKH 5E2UL 1JGUL 4KZDL 3HR5A 4M48L 1CDYA 2PTUA 3CLFH 3LRSA 1IZJA 1M6OB 4KK9C 4L4TD 4HS8L 4V1DE 1PKQE 4R90L 3FCTB 1SJEB 5K9KA 3AROA 1FFOA 2G75A 5AYUL 2B0SL 5F7LB 4PGBB 3T2PA 1KJ2B 3O8XA 2YHGA 2DLGA 3A6OA 1INEL 3FB5A 5D1QB 4WO4A 2Z8SA 1WSST 3VRLE 4BFIB 1NANI 2B2XH 4WI7A 4PRHA 1NFKA 5IBUG 3FN0L 4PJCA 5FYJE 4WFEE 2HFEA 4JPVH 2EYTA 5IIEB 5J13B 4OCSH 5HSFA 4TUKL 1K5NA 1NUFA 4QRTB 4FN0A 5DWUL 3L7FA 3D2UB 3U36B 1MJ8H 4O2EB 4NHCL 4JM2C 1FNHA 5FYJL 4YPJA 4YDLB 1FORL 2YSSB 4Z9KB 5AUMA 5DSCA 4JZOA 3ULSA 1BZQK 4PJ7B 4NYLA 3SDAC 5LG1A 3OJVC 2R56H 4WFGD 1I8MB 2A6KA 5DUPH 2L4OA 3QUYB 2YUXA 3IKCA 5IVOA 4LPCA 3T0VA 3O4LB 4TVPH 4DAGH 1EZVX 1HHJB 3DUSA 4CMMB 1VCAA 2XG4A 1RFDH 5I1GH 3IDJB 3A67L 4WI3A 4JO1L 4D3CL 2CGRH 3QDMB 1BFVH 5ITFA 4PLKD 5IV2B 3WMSA 3PWLB 3EGSB 1YECH 2VZSA 2ZJSH 4RMSA 5IBTL 4Y19E 3WJLC 4MD0A 1ADQH 3BW9A 3R1GH 4RAVA 5GSRB 5TDNB 1C08A 3CCHB 4PLNC 5FYLH 3OR6B 3UXFA 4M7ZC 3RGVD 2BNQD 5B39G 4P2OB 4LDLB 5L88L 2CLRB 5DA0B 2NY2D 4Y5XC 3PABA 3RJDA 2GTWA 5ECJE 4JQVC 4BSWB 2J88H 1YNTA 2KZWA 4JGUA 1MRFL 1NGXA 2VH5H 3N1GC 4PV9A 1ED3A 1HH9B 1OVZA 4ZS7H 5C0RH 1MVUA 4UDUB 3NFPB 5C2BH 4M9PA 3VXSD 4ETQB 3G04A 3LN9A 3FO9A 2FEEL 4GW4B 2AV7B 4AEHL 1RZJH 5CINH 1A4KA 1C16B 3LQAL 3UZQA 3GMRB 3BPNC 5SWQB 1EAJA 1I1YA 1JF1A 4F9LC 4OSUL 1XH3A 3CH1A 2J4WH 4NUGH 1MJ7L 3MTRA 5JORA 5K9OA 2NY7L 5I9QC 3EOTL 1XT5A 4G8IA 4NQEB 1HHIB 4YDJB 4U0RB 1HWGB 3RI5K 3SDCB 3IU4L 1FZKB 3UJTH 1EGJH 3QDJA 5E6ZA 5D93B 2XXMB 3WUWG 1I7RA 3R4DA 2GFBA 2DM7A 5D7JB 2H9GA 5IBUB 3G9VA 1RU9L 1IAKB 3B3IB 4WNQA 5F3HB 4FQJL 4LRIA 5C0AD 1LO4L 5DMIH 4AG4H 2CD0A 4WU5B 3T65A 4L3EA 1NCWH 4EKXA 1NAMA 1QNZH 5F96L 2WWKO 2ORBH 2AEPL 3MV9D 3JV5A 2NLJA 1N5YH 4MWFA 4RZCB 4U1HB 1WITA 4MSWB 2BVPA 4WW2A 3QUYA 5EO1A 2R4RL 1AIFB 2X42A 4PJIB 3Q48A 5DD0L 5HVHC 2CK0L 2GCYA 3SJVD 3PE9A 2D7TH 3HNSH 4XP6L 1UH3A 5I17A 1G7QB 3ZL4L 4ZPTA 1CGUA 1G7JA 3ZHDA 4Y2DD 4LDOB 2X7LA 3G9AB 2M26A 3RDTD 1JZ5A 4MHHG 4ESKA 5D1XD 1KT2A 2FL5B 4M6ML 2F15A 3LQZA 2FJFB 4DN4L 2WV3A 4XMKL 3KWWB 5IGXL 4QXGH 1V7NL 1Z0NA 4ONOA 3MA9H 3MCG1 1V5JA 2CSPA 1IFHH 2R9HD 4BQ6A 4K7PY 5HDQH 5EBWB 4Z8FL 2YD6A 4JDVA 4ZO8A 1AGDB 4NJAH 1QSZA 1T21A 5C08B 2RQ8A 3T77A 3D5OF 1T1YA 3NAAL 3GHEL 1N4XH 3IDIA 1GGIL 1I75A 3GGWB 1QLEH 2FX7L 4F9PC 3ZE2F 1LEIB 2DLIA 1MIML 4WUUB 4HX1A 5B39B 1XF4A 4V1DD 1D5IL 3L95B 4JRXA 1CXEA 1HH9A 3P0GB 1KF9B 1KUMA 3IJHB 4KWUA 4WDIB 4YEFA 3O9WD 4JPIB 2L7UA 5EO9A 2DQIH 4EVNA 4MAUL 2P24B 2DIJA 3I6GB 2CUHA 1FDLL 4JCLA 2ADFL 5T1LA 3DUUA 5C0GB 1ZGLM 3FZUD 1W2KT 3MRBA 1AKJA 4OI8A 3RNQA 3JTSA 2H2SC 3ROLB 3BKMH 1ES0A 1KB5B 5FO9A 3AREB 5FYJD 5HI5C 2F5AL 4WFED 1CBVL 3ARFC 2AJYH 1PEWA 4UMGA 3LPGA 4DKAA 4NFBA 4GAYA 4P9HC 2OP4H 4TULL 4M4RA 3CDGB 2J3SA 3VFWA 3OAUH 5LXGH 4WEUD 5BOPA 1TQCC 1A6UH 1Q9LA 1UCTA 2EEBA 3CMOL 4O2CB 3NBNA 4LLUB 5CJQH 3MBEC 3D0LA 4JE4B 4QRPB 4OGXL 5TQ2L 2VXVL 2DLTA 3TGXA 4PJGE 3U30C 3HC0A 4WHCA 3MACH 1OM3H 2B1AH 3P30H 1QBMH 3RIAF 3WUWB 3WNLA 4PTTB 2QQNL 3QR2A 1DBKH 3OKDB 4NWUH 2NZ9D 4MX7A 2BOCA 3L3GA 3WNNA 4DKEH 1IL1B 2AABL 3RKDC 2B5IC 1HILB 2JIXB 4U1KA 4ZNEA 3O2DL 5E8OB 3ARBB 1I1AB 2EEAA 4CVZA 4X80H 4I4WA 3BE1H 4HGMA 5BO1H 2BOBB 4X4XA 5I8KH 2IF7A 1DP0A 2DQUH 2P1YA 3VXTA 4HF5L 5GIRA 3KAAA 1QSFE 5IFJB 3MV7B 3JV4B 1JGLH 3R8BB 3D3VB 1WK0A 4Y19D 1CZ8L 4WHDA 5JDJA 1F13A 4NKMA 2AJXH 2FO4B 3LKPB 5F7UA 2I5YH 2VLME 1D6EB 4MAYA 4UIMA 5HGBB 1UQSB 5C3TA 1YN7A 3KLHD 1KCLA 5J6GA 1WVZA 5DT1L 4KU1A 4WHYH 2R2CA 4OV5A 3Q1SL 5DLML 3B9EA 2Y36L 3GDBA 4OCLC 5ID0A 4PJ8C 3IF1A 2AERT 1C12A 1KJVA 4L8BB 5C08A 3X11A 2R1WB 4Y1AB 4K3GA 5IW6B 5IMLB 1ZSDB 5IMOB 3X3FL 2FIRT 4X83A 2FD6L 1ZEAL 1UB5B 5BMFH 5L7XH 3O4OB 4WI2A 4FFYH 1XGYH 4O00A 2KUTA 2DQCH 1T7XA 1DQQA 4FQPA 3TJHC 1E4KC 1DBBH 3MJGX 3EJYC 1J87A 2WBJD 1VDGA 3MNVB 5F88A 1NFDF 4EOWL 3D0VB 4JFOA 5F7EH 4N0FB 1A6PA 4WEBH 1PG7X 4OLXH 4EI5B 3ES6A 2WAHA 1HIMH 5F9OL 3BZ4A 3LS5L 4NWTL 5SX4I 1OGTB 2FSEB 3DUHA 1H15A 3MFFB 4X4YB 1EA9C 3C60C 2IWGA 3FRPG 5CJ8A 3MGOB 4JFZH 4ZTOH 3D25A 1S3KH 3X12A 2FB4L 5J8OA 5FOJA 1BQLL 2YEZA 5J4MA 2BZDA 3IXAB 1D5XA 1NEZG 4WFHE 4YDIH 1CK0L 1ZTXH 5DJ2B 3BD4A 5E1AB 1WQVT 3S37X 3WHE1 3JWOL 5CSGA 2E27H 1F2QA 1Q9WA 4HS6A 4OBRA 5HHVL 5KVEL 3WJJC 3WDJA 2GYSA 5FA4A 4AZ8A 4L3EE 4QY8B 1AXSA 4ENED 1BVLA 2PW1B 1X5IA 2XIDA 4D0BA 2Y1VA 1HH6B 5D6CB 43C9B 4CU7A 1HYSC 4IIQC 5J9PB 1EJOH 1HKLL 1QKZH 4I3RL 3WYRA 2EKSA 5E9DB 3VXMA 3VJ6A 4XNUL 3HAEA 3P2TA 4PGJA 5CJXA 4F7EB 3BZFA 3DO7B 5IFJA 1BLNA 4HXBH 1A0QH 2X70B 1L0XA 4YHLH 4I9WE 5TE4L 5DJZB 4JRYA 3TNNA 3SGKA 1U91B 1IGCH 3SHSA 1CFTA 3BIKA 3MLRL 4OLWH 3ZE0E 3KPRB 3ROOA 3RVWC 2EE3A 4HIIA 3MLTB 1NMAH 2BSTB 4BH7A 4DW2H 3TIEA 2DKUA 2HJLB 3OGOE 5IW6A 1L9MA 5FGCB 1NFDB 3T0EC 4I5BB 2V5SA 3C5JA 5ACZB 3AU1B 4NO0D 4KY1H 1BZ9A 4ODWA 1CS6A 1NQBA 4OFIA 4XPFL 3GSRB 4ZOCA 5EO0A 5EN2B 5GHWH 3VXUA 4P46B 1RUQL 3TYGH 4OZ4B 4OB5L 1HSBA 1GYAA 1A47A 4MVBC 1XGTB 3HZMB 5ALBL 3UTOA 1K3ZA 3VXRA 5CIPA 3LOWA 1F00I 1PG7H 2CXKA 1QFHA 2IADB 2VMFA 3O8XD 4P3DB 1WZLA 3MCKB 4Z76A 2OTUA 3CJJA 1ZA3A 2RR3A 1YJDL 1FLRL 4Y4FB 1A3RH 1VB9A 3SE8L 3BXNA 3NACL 3MGOA 4YHIA 3W82A 1JYVA 5IVNA 4HKJB 1UC6A 4JZJC 3UO1H 3S35X 3X13B 1LHZA 4P9HH 1NLBL 1Q0YL 1HHKA 5K9QI 5GISH 4YHZH 1RK1A 1IGJB 4K9EC 5DDHB 1NEZB 1KN4H 1A6ZB 3MLVH 3VG0H 1B0RB 1SY6H 5ACMA 4ZUWA 3T0BA 2HLAA 4KKLD 1S7WB 2BCKB 2ZCLL 4ZD3H 3MRDB 1EEZA 3DYOA 2FH8A 1C5CH 1S7RA 4TUOA 4ZSOB 4KK6C 3VD5A 4MA1B 1OAXH 3WCYA 2IALB 4D94A 5E9DA 4C57C 4GW1A 4R97C 5TPWH 2VLMD 1I85A 4KKBC 1M71B 4NPYB 5DZNA 4XVUD 2EO1A 4G8GB 4OLZL 3BIAX 3PGCB 1AP2A 3E8UH 5CFHA 2DQJL 1FH5H 4XCNB 5I1AA 4IRZH 4J3VA 2EIZA 2WWMC 3QQ4B 4QXUH 3WKML 1NCAH 3RWHB 2BHYA 2NTSP 3KHQA 3FT2A 4OM1L 3IVKB 3STLB 3TBYA 3HC4H 4L8SA 4X6CF 1K85A 2XZQL 2HTKC 5T1DL 1NFDA 3BQUD 1NMCB 1TXKA 4NQCA 4TSCL 3FFCB 5ETUB 2PXYB 3QDAA 3AU1A 5A2IH 3LS4L 3DSFH 5GGTH 3R8QA 1UWEL 1DANT 3RZCC 1AHWC 2VDQL 1GPOL 1T04A 4Z7UB 2AS5M 4HGWB 1XGTA 4L3AA 5C0AB 4X9BA 4KGLA 4MXVF 3BFOA 1IM3A 4G6KH 2F5BL 1FL3B 5HVGB 5HDLA 4G5ZL 2A73A 3S98A 5KS9F 3B9DA 3PHQB 5CP3A 4HEPG 5F1NB 4Z78B 1W8NA 4UV7L 1Q1JH 3IDGB 4DZ8B 5ERWB 1RZIB 3WIIH 4OM0H 1V3LA 1GVIA 1W0YT 4P4RA 4WV1B 1TJIL 4JKPH 3RTQA 1A8JH 4WFHD 5GRUL 3V6OA 3F58L 4XMLH 3SJVB 4LSRH 4HKJA 1CN4A 1IGYB 2DLFH 4LL9A 3F7YA 5MEPA 3DV4B 1OSPL 2VQTA 1PZUB 4F58H 3ZTNH 4PP1C 1UA6H 4Z7VB 5GRWA 3S34H 1ZHNA 1WZ1H 4L3ED 4XMPL 1DVFB 2VXQL 5CGYC 3WFZA 5KSVB 3WFDL 4GOSA 3O6KL 4OZHB 4ZXBB 4G8EA 1OGAE 2VQUA 5FGBA 4KROB 1XR9A 3GBML 3L9RA 1EMTL 2XZAL 1YNLL 3RNKB 4G9FB 3MRDA 1J88A 1F2XK 2APTA 3JVGC 1KJ3H 2VN7A 2ICES 3LSOA 4ODVL 5DJXB 3HNTL 4F37F 5I30H 4WGVB 4I9WD 1G6VK 4Z0XB 3EYQC 4Y4HC 3OWEA 5F9AC 1U36A 1LMKA 3VXME 5IEKA 1ZT4A 3Q6FB 4U1MB 2YUWA 5I1HH 5J6HA 3VCLA 4ZQKA 1ZXQA 4HGKC 3OB0K 2EC8A 4JRYE 4LCUB 1A6AA 4H5SB 1UB6B 5J56B 1UM6H 1YNKL 5T1KA 2WP3T 5J11C 4GRLA 3OTTA 2OMNA 2NX5A 2JJSC 5E56A 2VABB 4EDXA 3RWIA 1Y0LA 2UV3A 4LOUC 3ZE2E 4DVRL 1X5FA 5HHNB 1NGYA 4Q6IB 1CE6A 4M7KH 2IH1A 3C08H 1T03L 3B83A 5EZIL 3ULVC 1MFCL 1SBBA 4HCRL 4JRXD 1BVKA 3VXOA 4RMVA 5KS9B 4XI5C 4O02L 4KQ4L 2CKBB 4JFFA 2PYFB 3TNMB 1MFBH 1P2CA 1F4WL 5LWYH 1RUPH 1AGBB 4JO4H 5T1LD 3U0PA 4IJ3C 4RGNB 1GZQA 3SOBL 1HZHH 3RVUD 1MCEA 1FFQA 1AKJD 2Z4QB 4X5WB 4M1CC 3S37L 1MHPL 4I0CC 3T0XA 3EAKA 4LCYB 3CFJA 4XNQA 3SDAD 3NIFF 4CU8A 3EO0A 1I1FA 3LIZH 2AVGA 1YPZF 4LSTL 1A3LH 4ONFH 4W70A 2V2WA 5BRZA 3FL7A 4UDTA 4X98A 2VC2L 1MHHB 1SBSH 5CSZB 1B2WL 3P77B 4LLDB 2CIIA 1U8LB 1JHKH 1NDMB 1KLUA 1UZ6E 1R3LA 2ENYA 4PJFF 2Y25A 5BV7B 1UCBH 2XN9B 3UZEA 4AEIL 2ICEB 4MDIB 4KDWA 3E2HB 3BH9B 3AM8C 2CRMA 4F33A 2KDGA 4YR6B 1XR8A 3MLZL 1A6TB 2BVOB 4FHBD 3VFMA 2MKLC 3CPLA 4XP9L 5DHVA 2P5WB 1VGKB 4C54A 5HHQA 2LABA 2BSRA 4JQIL 2YPVL 3SY0A 2QQKH 1Z9SA 4ZPVA 1V3JA 4W4OC 5CBAA 1VKXB 1CQKA 1J12A 4XNYH 4XAKE 4XPTL 5SWSA 2XNAA 2BC4B 3LEYH 1EK3A 5ENWA 1DQDH 4NZTH 1KELH 5BZWA 1QBLH 4K8RC 5E6YA 1MVFA 2OSLA 3FTGA 1N26A 3IU3B 4MAYD 4CN4A 2F8XC 3SPVB 3MXWL 4PP2B 1G6RB 5DZLA 4X6CA 1TNNA 3EYOB 4DQOH 1IGML 5D5MF 4LPYA 4UOW1 1S7QB 5C6WH 2LVEA 3TT3H 3AY4A 4R7NA 5GGQH 5ICYB 3MLXL 4H0GA 1GSMA 3H9HB 1T1ZB 3RWJB 2EYSB 3SCMC 2P47B 5FF6A 1U41A 4ZUSA 3GKWH 5D1ZD 3EFDH 4XCCH 5FHBH 5I2IA 5DEGA 4HUUB 4YBLB 2UYLA 3UTQA 2FBOJ 4YK4C 3QI9A 4FQ1H 4S1SL 4C56A 3EUUA 1X5AA 4NQCE 4Q2ZB 4GH7B 5K93A 4KTDL 2VJXA 2NW3A 1KYOK 2QADB 1BQHA 4JG0H 2CKBA 4OZFH 1XIWA 2C4FT 3O41B 3RJQB 5JW4R 5E8DH 1TVBA 4XB7A 3T09A 3S35L 5EWIH 4GBXA 3VGDA 2DBJA 1ZLWK 5CBEA 3B8YA 3KHOA 5FA3A 4RNRA 2FCBA 2APVA 4JJ5A 4PBVC 1GZPA 1MCHA 1OCWH 2AEQL 2ILLA 2F74A 2JJTA 4J6RL 4BZ1L 1OTTD 4A6YH 4QXTA 1JNNH 1P4LB 4MHHI 5EC2B 5C6TL 3V6OE 3L3JB 4P2YA 1T89C 5D96B 4GAFB 2XWTB 3RKPA 4LSPL 1SM3L 3LHPL 1Y18A 2WINB 4JFDA 4KK8C 5EORH 2D3VA 3PUCA 4MDIA 2LVCA 1T0MB 5DR5L 3WKNA 4R9HA 1MJUH 3NTCH 3QIUB 5I19L 2VIRB 1F02I 1JZ3A 2D4DA 2NY4D 1RQ5A 1S7XB 3NFNA 5BQ7B 5CD5C 3BO8B 4P2QE 4JREC 2AAVA 4ZO7A 5T3XE 1NUNB 2JCCE 3TN0C 3GM8A 1K6QH 2P5EB 3VXMD 3LEVL 2YRPA 1DFBL 3ET9F 1OW0C 4RISH 4Z95L 1WFUA 2G60L 5HGHB 2Q76A 2PYEA 3BP6B 4M03A 4WJ5A 5FUZL 4IOFC 3UYRL 4PLOB 1CGSH 2BJML 3PDOA 4JRYD 5T3XL 5L6YH 2YXMA 4JEGB 1GH7A 1ZVSB 3OGCA 3GJFK 4U6TA 2Z8WC 1A2YA 1XCTB 1U3HA 3HE7C 1N0XH 1REIA 4NQXA 3B4NA 3S8WA 2F19L 3MLYL 4FABL 1NC2D 5KSAB 1S7QA 1QSEA 3P11L 4KVCH 5MERA 4QHKI 4X7FC 3MLSL 3KVQA 4PGDB 5D7IB 5E4EC 2CPCA 5JXAL 1AXTH 2ZSWA 4P23C 3DIFB 4GKSB 4I18C 4P5TB 3FT4B 4OBSA 2FDBP 4KRMB 3G08A 1GHFH 3R06A 3T3PF 4H25A 5D72L 4ZUUB 3VI3F 1CTOA 1FAIH 4RFEA 5E6IA 2PW2A 3PDGA 4YE4H 3CVHL 4Q7DA 3UTSA 4EBQL 1S78C 4M8QB 3VXRD 2CDGA 4BKLA 2ZKHH 4KZEH 1WIOA 4OD1L 3IDXH 3WN5B 4JFFE 3FHAA 2FBJH 1J05B 1YPZA 4LCWA 3SDXB 3MNWB 4CBPA 3KXFE 1NGPH 1MFDH 3CC5A 1BECA 4PJ9B 3QNZA 2HJKA 2VZVA 4KFZC 2FHFA 2V17H 3QCVH 4U1JA 5AD0A 3G5XA 4AEFA 1EO8H 1CGXA 1QSFB 3OB0H 9CGTA 3F7VA 4PJFA 15C8H 4I3SH 1JWSA 5F7DB 3QXDA 5HJ3A 1ORSB 3K80A 1IILE 3OAYK 3VRJA 1IBGL 2RAMA 5I1KH 5IQ7L 3TH2T 4NFDA 4K9EL 1FZOB 1MH5A 4IHOA 4TRPL 3RUGF 1RUAH 5I8OL 5IFAL 2W9EH 4QKXB 5FXCH 3MA7B 4MD4A 2PCPB 2PKDA 4QHLB 5KVDL 4HKBA 3PIQB 3D85B 3FB8B 3KR3L 4Y0GA 3QIUA 4IRSA 5KBNC 1FVCB 5CHNA 5IF0A 2XRAL 4LGPB 4ISVB 1FL5A 1UXWB 2Z91B 4XAKD 2GKIA 4O58H 3RAJL 3NH7L 4NKIL 1F3RB 1QR1B 2HN7B 4B41A 3UMTA 3BQUB 4YZFF 4X6DA 5D5MA 1F3DJ 2CR3A 1KG0A 2HYMA 5SWSE 3TJHD 4ODHH 3IFLL 3HI6L 3MR9B 2CLZB 1U8QA 2CXGA 4HZAA 4D9LH 3MUJA 1AE6H 1EVUA 3VWJA 4LEOA 1UVQA 1U8OB 1XGUB 4K8RH 1FO0A 3JUZA 3SKOB 3THMH 1EUUA 1V05A 3P4LA 4XC1L 3PQYA 3WV0A 4Y5VB 4UV4L 3C8KB 5I71C 3B6SB 3MV8E 1JP5A 5FV2A 4TYUA 4APQA 2AJSH 1F90L 1ORQA 4BZ2L 4JM2F 4NBZB 3I2CH 1YEJH 3MRCA 4NQCD 5BVJA 1M4KA 4JFQA 1T5XA 3I50L 4U2YA 1NSNL 4HIXH 4WHYG 3F8UB 4YXKL 3VFUB 4N5EC 1F4HA 4MXVE 3H9ZA 4RMQA 3K0WA 5BJTA 1WFTA 5JHLL 4C56E 1GGCL 1CLYH 1DL7L 1ADQA 4PREA 2ZPKH 2IFFL 3O2VL 3EO9H 5JDSB 5BZDA 4JM4L 2X4TA 3L1OH 4UQ3B 1DUZB 2P45B 1R0AH 3PWVA 4U3HA 4ZYKA 1BF2A 1YQVH 3D18B 4M6AA 4NZJA 4U6HA 4G6JL 3VFPA 5E8EB 3WFHA 2FYYB 4XP1L 5DS8B 3WFCL 3VXQA 4U1LB 4WW1A 1CG9B 3G6DL 3RTQD 1UYWL 4GRWH 3HLAA 3QIWB 3V4UL 3RHWF 4FQQA 2GUOB 1PZ5A 1JPTL 2W0PA 4XPHL 1QR4A 2E6JA 4O4YH 4LU5H 5D2NE 1RZKL 5EZOH 3U4BH 1MCBA 4RAUB 5HHXL 4E42A 2ITDA 1Z3GH 2JB5L 4DZBB 3UROR 3HFMH 3EYUH 4OFVA 3ZE1E 3BAEH 3MA7A 3BPLC 1GOHA 5DC0A 2CIKA 4JFDE 3MQIA 4J2XA 5T3XD 5JPMB 5I1LA 4XGZB 5GGSB 4PJAE 4M8VA 3U9UB 3V4PH 2FNBA 4YHNA 3ZKMD 1IEBB 4OIIL 1U8PA 3TZVA 1EGJA 4UQ2A 1VADA 3PWPE 4U1NA 2Z91A 1S7TB 5T33H 3N06B 4IDLA 5ANME 5CJBA 5ICXB 3LKSA 1BBJB 1DCLA 5DJ6A 4G9DB 3MRKB 4L3CA 1KB9K 3E6HB 3O6ML 4M5ZH 4P2RE 1HCFX 3ULVE 3PGFH 3FQUB 3TA3A 2CRIA 3BSZH 3H9SB 1QFWI 2HG5A 4E0RB 2BK8A 3ILPA 1MFNA 2O5ZH 4JM2B 2DMCA 5T1KD 2NX5D 2ERJC 1FZMB 5B8CC 5C8JA 1PKOA 3FT3A 1U2HA 1D7FA 4I0PC 5HHPA 3ULVL 3SDAB 1EERB 5ADPH 1QSEE 3CGTA 1OF2A 3H9YA 4HBCH 4LSQL 3QWOA 4HKXB 3CFCH 5FECA 1K4DA 4BK5A 3P9LB 1P84K 4Z7NF 4LCCC 1RZ7H 4HHAB 1SMAA 3EZJB 4MB5A 1CFVL 3CDFA 2GITA 1X6NA 3SBWC 2FWOA 4PRNB 1ZWIB 3QHFL 1AO7A 4JFFD 1DE4B 3P9MA 1JGVL 2I9LB 2Y5TB 3KXFD 5C9KA 4CW1B 5IG7A 5EFIA 3LPFA 3KPLB 1SEQH 3BOVA 1IAOA 1JNHB 1QRNE 3UTSE 1CR9L 2E6QA 1OQOA 4NBYB 1IT9H 5TF1H 1G1CA 4HC1H 4RFNC 4OGAC 4PV8A 4LCWE 3RI5F 3ARGC 5D71L 1DN0B 1WCQA 2I9TA 2DIBA 3D18A 3Q5YA 4M7ZB 4XC3L 4DGVL 2P8MB 5I0ZA 5E8EA 4UB0H 2YN5A 5BRZD 4Y5XB 3RUGA 2DS4A 1V7ML 1MCJA 1U2CA 5HDBE 4WUKH 1J1PH 1G7PB 3B9VA 3HUJF 1YC8A 1OLZA 2FRGP 4V2CB 4PJFE 5E00A 3B43A 2PNDA 3CD4A 4S10A 5E5RB 4HXAH 4UT6H 4KI5F 4GS7C 2YBRA 1P53A 1S7UB 3LRGA 2NQCA 5H8DA 4KKBD 5JLZB 2FEDC 4E41B 5A2FA 1UWXK 1TZIA 3H7LA 1E4XH 1GAFL 5I76B 3DVFA 5HGDA 4XBEH 4L8CB 1SJHA 1XEDA 5DFWH 3K3QA 4EZMA 4MGXA 2DAVA 5DQDL 4R8WL 3QUZA 3BPNB 4QRRB 4JPKL 1N5AA 4LQFH 2KPNA 4WI6A 3LKRB 3MLPA 4WWKC 5A16B 1MAJA 2DQTH 2R2EA 3TFKD 4GUPB 2EXWC 2P44B 5I9QB 3OKMA 4JHAL 1SYVB 4R4FL 3MRMA 2EE2A 5EOTA 5SWSD 1J0YA 2N56A 1O7VA 4I1NB 1EJ6A 1OAZL 1FPTH 5FM4A 4IRJA 1H5BC 3EYFB 4X6DE 5TDOA 1FJ1A 4XPBH 1OP9A 3RZCD 2NR6C 3MUY1 3VFSB 1RHFA 1D6VH 4RQQA 3V5DB 4X7TA 2OJEA 4FNLL 4LMQE 5MEQB 3GSXB 3MV8D 1FLTX 2C1PB 3OAYH 1FQ9C 1IM9B 2OLDA 3ISWA 3W39A 3WLBA 5I73C 2ZG3A 4WHTB 1FGNH 3GIZH 3BGMA 3FB7A 4UAOC 4K23L 3PQYE 1HQ4B 1JZ2A 2DQDL 1IC7L 1RIVL 5DRZA 4X4ZA 4GKZA 1YN6B 3IDMA 1IQDB 1WGOA 2A9NL 4C56D 5HVHB 4JG1H 3OQ3B 2YWZA 5FB8B 3QG7L 4NZUL 1FO0L 1H8SA 4MZ3A 3N85H 5DUPL 1MJJA 3DROA 5FDWB 4U1IA 1XIWD 1RJYB 3AFLA 1E0OB 3NPZB 4PP1D 1A02N 2VDRL 3DJ9A 3FN3A 3OJDB 1KC5H 1JIBA 3T3MF 4GBXD 1OGAB 5IROC 1I3VA 1QOKA 3KLSA 3EYVB 3TVMC 1QEWA 3L3KA 4LFHD 4X9IA 1G1YA 4NO3B 3ARTA 1MRCL 1IC1A 4FQXC 4LLWA 4R96B 5CEZH 5IVXE 1N59A 1X7QB 3TO2B 3X14A 4ZDHA 2ATPB 3IS1X 4L9LC 1BOGA 3R1GL 3HZKB 4MQ7B 4DCQA 3QIBA 4L8DA 2NY6C 4XHQA 1YEDB 1KIQB 2Z93B 4OCYH 5GRVL 3HI1A 3RY5A 1T66C 4M5YL 3V5KA 3ZTJH 1AGFB 1W0VB 3FOMB 3G5YB 4G80B 4JFDD 5JZ7D 2IPTL 2VXUH 4EDWL 2VR4A 1OPGH 1BIIA 4M02A 3SGDI 4QYOB 1HQRB 4ZFOL 3PP4L 3RVVC 5C2BL 1CE1L 2AKRA 4F9LA 1XF3B 4OT1H 1KPVA 4B50A 1FVEB 4CUCA 3STZB 3LKRA 4LOUD 4PD4K 4PJBE 4PJXA 3RWGB 3V0WH 5C0JB 3K81A 3ARFB 2VE6A 4P2RD 5KSBF 2F9BT 2PYED 4R26L 5JW5A 2R15A 1MCPL 2LE9A 5DMKB 1X5ZA 3ULVD 4HIEA 1TQCB 3HE6C 1OY3B 5J1SC 3OPZH 3MBEB 2W0LA 3Q5OA 3VD9A 4XI5D 3RL2B 3RX5A 1ZS8A 2NXZC 2BVYA 3U30B 5EU6B 4KMTL 1U3HD 3WDIA 1BFOA 3OXSA 3UJTL 1EGJL 2C3XA 4JZNA 3PL6C 1QSED 4NZRL 3BEWA 1FFRA 4HWBL 5E95B 2B5IB 4HBQA 3P40A 1EBPA 3S5LA 3AS0A 4LIQH 3TYFA 4AG4L 1RZ8B 3C9NA 1EZVY 3LV3A 3QUMH 4LASH 4JVPA 4TOYL 2WUBH 4AH2B 2WSKA 3CU1A 4A2LA 1N7MH 5CILH 3NIDE 4JY5L 1QRND 4O9HH 3PWJA 1MCWW 3UTSD 3B2VL 5D7LE 1P9MC 5E2VL 2HTLD 1CFNA 4LCWD 5JR1L 1T4KA 3S4SG 4LBEB 2D7TL 1UJTA 2W38A 2EC9U 3HNSL 2YMXH 5D2LB 1LEGA 3L7EB 3MLUH 1AH1A 2R1YB 3AXLA 4JANB 2ZUVA 3BKJL 3HUJA 2YA0A 5BOZG 3DVGB 1XCQB 3EYVA 1AGCA 1ZAGA 1ROWA 3ZKQD 2MFNA 4PJ8B 2R0LH 4B7LA 2ADJA 1U8JA 2X4QB 4Y4KA 3C5SA 4JQXA 2WIMA 5B38G 3CDCA 3I9GH 4F9PA 4BH8B 2A38A 2A6DB 2FJHB 4NNXB 5C0DB 3AGVA 1KXQE 2QHRL 5IMMA 2WLZA 3GSQB 5HHOA 2BXYA 2A9ML 3LKOA 3VFGL 4HG4J 3DURA 5IB5B 5DQ9B 5JNYB 1FNGA 4JFYA 4XPGL 1ZT7A 5JW3H 5EOQL 4IRSD 3O3EA 1RIUL 4R0LC 4PY8J 2DQIL 4CN1A 1GIGL 2AEIT 4HK3N 3W5NA 5FK9B 3VFRB 5IR1B 5AZ2H 3C60B 1F3JB 3VA2C 3ZDXF 4G6AD 5CS7A 4Z0BH 2QSTA 3IETB 2NW2B 5DC4B 3GMPA 2VITA 4PUBH 5IB4A 1J8KA 5DTFA 3VWJD 5F9JB 1SY6A 1KYOJ 4RDQG 3MJ8B 3I02B 3LCYA 3GMLB 3QCUH 3J8F7 3PQYD 3D69A 1A1MB 1F4YH 4OFKA 2QQLH 4F15C 3MACL 2Z31D 4APQD 5ADOH 1Q72H 2APFA 2B1AL 3QQ3A 4JLRA 5GGUA 2FHCA 4C4KO 2GT9B 1NGZB 3RBGA 4OZIF 4RWHA 2XPGB 4IIQB 2VSCA 3M17B 1CF8H 5LVEA 5F7HA 2IANA 1R24A 4MNGE 4R7DB 1LP9E 3EOAA 5JIHA 3DMMC 1LNUA 3S96B 4OLEA 4DOHB 4RDQF 4KQ3H 4OKVB 4KKAD 4XNZC 1G7IB 4TPRH 3B9KA 4XXCC 4LP4A 1JGLL 4P2QB 1MCIA 3VMPA 4JANA 2JCCB 3OX8A 4RGMC 3SE9H 1NJ9A 2AJXL 1MI5B 1Y6MR 1U58A 5C0IA 5HYQB 2AI0L 2D2OA 4OZFG 4YWGH 4R4NC 1I3RB 2CQVA 4WTZG 1X9QA 2P49B 3NN8A 3QZWA 5EULV 4Z7WF 5DO2C 4P59H 4DUWA 1IC4L 3HCVB 5GGTA 1MUJB 1R5VA 4LVHC 3T0EB 1ONQB 5GZNC 3T4AB 4IMKA 3EJJX 5KVMC 1O0VA 5DVKA 4LLYB 2Q6WA 2UZIL 3CSPA 3HG1E 3K2UL 1MHCB 5I74C 4RWYL 2C7UB 4DKFL 5B38B