1NMBH

The structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
QVQLQQPGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a complex between the NC10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the NC41 antibody
pubmed doi rcsb
molecule tags Complex (hydrolase/immunoglobulin)
molecule keywords N9 NEURAMINIDASE
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmbH00
2BSED 1HHKA 1SEQL 4NQCD 4EXKA 1KJ2A 3OKLA 3MGTB 1U95A 2IH1A 5DO2D 4Q9QL 3LS4L 3WUWA 5BV7B 5EIIA 3AVEA 4RWYH 1JHLL 1NGXB 5DRWB 1ZSDA 3VFUA 3ARGC 4RGND 3C6LA 2L7UA 1EH9A 3GO1L 3GKWH 2NTFB 4XNMB 2PXYA 1NGQH 4HF5L 3QQ3B 4NJAH 1AGEB 5M94B 4PY7A 4QT5B 3SJVE 3TIEB 3GJFK 3VFPB 4YK4B 4P23C 4LKXA 1G0XA 4Y1AD 4OZIB 1LO5B 3BKCL 5IT2H 3AFLA 1KIQA 3LV3B 1F4YH 2XTJC 5I1AA 4I5BA 3ZSTA 3SO5A 4PGZA 2YBRB 3RKDC 5JMRA 5JW4Q 3V8OA 1AQDB 3C60C 1QYGH 4KTDL 3TT3H 1IKNC 3QDHA 1QYGL 4Y5XC 1SJEA 2AXFB 2OXGA 2DQIH 1A4JA 4G3YL 5GRXG 5FV2A 4FHBD 5EOCJ 1YEIH 4Y19A 1RVFH 4L5FL 3O6LL 5CBAB 3FFCD 4XPGH 3S7GA 5D1QC 1BWWA 5DJZA 4UT6L 5GS3A 1B9ZA 3H9SD 1XIWA 4NFCA 4WHDA 3BP4B 1OHQA 5C0DA 2P48B 5INDA 4ISVA 3U2SA 3PE9A 3BKYH 3FT4A 1N0XH 4GG8B 1KEMH 3TWCL 1JGDA 2AAVA 3WL9B 3G5ZB 4NWTL 2R0WL 1VESA 1KTKE 4AENA 2AJZA 4I0PC 1OW0A 4L29B 1TMCB 5I73B 2LV4A 4LGSB 3EDDA 4GW4B 4LQFL 2W60A 3T0VA 1CGYA 3EOBB 5FAAA 3WD5L 3SDCD 1BZQK 4ONOA 5C7XL 1HXYB 4QTHB 2EDRA 5DMKA 4IHOB 3O3EB 3WIIL 3RY6A 4CRPA 1LP9A 3QQ3A 5CGMA 1LO0H 1W72H 1VADA 3QUMB 4JY4B 5BCAA 3QCTL 1INEL 3QPXL 4NRYA 4Z7UF 2DQGL 1FSKC 1RZKL 3RWFB 4I5BB 4OZHE 4PP1C 5I15L 3TA3C 4HUNB 4YAQB 2PW1A 3P4OB 3QNYA 4HXBH 4JFEB 3JTTA 3O4LB 1NGWB 5SX4H 5IROC 2V17H 3C60A 5C0CB 1YEKH 2X4SB 5I1GL 3GSRB 4RAVB 1KC5H 3FONA 1A6VH 2QHRL 4NBXB 5A16B 2OTPA 2AEWA 4I0PD 1EGJL 1WC7A 1YY8A 1NFDE 3M1BA 1RIHH 5DJZB 1IL1A 4BKLA 1T6VN 5K59F 4HWZB 2W0FA 3NFPA 5GGUA 1XIWB 5EZIL 4G80A 1S3KH 3I3DA 3T1FA 3DHMA 4U6YA 5SV3A 3VFOB 2NY3D 3V0WH 1MCSA 1OM3H 5JLZA 4XPTL 4PJBA 3RL1A 4R4FL 4Y8AA 4YHPA 3WL9A 3VXOB 3MJ8B 2DM2A 3WSQH 3G5ZA 1CLZH 5I8OH 4AENB 1EUUA 1K4DB 4UILL 4EN3D 4KKBD 5TE4L 3UZVB 4M48H 4RNRB 3HNVL 1BFSA 4N0RA 3QZWB 1OB1B 1ROWA 4K9EH 5FCUL 5BW7C 5EC2A 1L9NA 4LSRH 5FB8B 3FFDB 5DJ8B 1E4KA 1CE1H 1CIUA 4HJ0D 4JZNA 5HHQA 4JAMB 4HWUA 2X70B 4WHCA 4WEBL 3NABH 1A9EA 2IBGA 2MCPL 3OKEA 2FB4L 5AZ2L 4LDEB 5E6ZA 1NGZB 2J4WH 3UYRH 5L2KB 5KVDH 4PJ9B 4NQCA 4PG2C 2EYRA 4NBZB 1ZT4A 1PYWA 2HVKB 5IB2A 2YK1H 3S98A 4Z7UA 4TUJA 4P46A 1R3IH 3MFFA 1CFQB 1UWEH 2AI0H 2D03H 2XZCL 2C3VB 3QNYB 1TNNA 1I1RA 3FB8B 1NGWA 5CD5C 4XWOD 2NR6D 1DUZA 1A6UH 3QUZD 5JPNA 1W0VA 1I9JL 3LKOA 3WUZA 1D9KA 5BVPL 2AJUH 1SY6L 1UH4A 2HTLC 3X3FL 4LVHC 4LSPH 3C6SA 2H2SC 4WUUB 1WTLA 1WF5A 1LK3L 3BP5B 1I3UA 4JRXE 5HHVL 3TVMD 5E9DA 3MNWA 2VXVL 3T4YB 3TPKA 3FZUC 5ISZD 4FQQB 1ZKAA 1YEFL 4ODXA 4XX1G 3ZYIA 4FMKA 2VLME 4NUGL 3EO1A 3O6KL 3Q2CA 4PV9B 4AQ1B 5GGTH 1N64L 1S5IH 2BVOA 3GMOB 4KH2A 3VGAB 2HT4D 1NANI 5J8OA 4G7VH 1SVCP 4GRMA 4EUPB 4PGCB 5K9QG 4XCCH 2H32B 4PR5A 3RDTB 1FL6A 3DI2B 1T80A 4HKXB 1KULA 4U1KA 4MDIB 2A9NL 3BVNB 3IDYB 4TSAL 3LKNA 1XCQA 4QRRE 5ID0A 2OTUA 3OR7B 4C58B 2VISA 2C4XA 1ORQB 5C0JB 5J56B 4D0DA 3O4OB 4BSWA 3L5IA 3H3BC 5IVZB 5J0BA 3GMPA 1VFUA 3KR3L 5BOPA 2RCSH 3FO2B 1I8KB 3IFPA 4YHLL 4PG9A 3TBVA 2BOCB 4K07A 1U92B 1IRAY 2X4TB 5DDHB 4BH7A 5K9KA 1K5NA 4GRWE 1DVFC 3V5KA 3B2UD 4Q2ZA 3QCVL 4BFGA 3RFZC 2OQJB 2PW2A 4XP6L 3IDYC 1KC5L 2V9TA 3ZDXE 4LMQE 2X6MA 5K9OB 3C6SB 1IC5H 4WWKA 4JJ5A 1BFVL 1SJHA 4JRXB 5LBSL 3CUPB 3O4LE 2GK0A 3MNWB 2XZZA 3MV7D 3RY6C 1BX2A 2PYFA 1BQHG 3TBTB 2JLLA 1MWAL 3ECBA 2NY6D 5HGHA 5IFHL 2VC2L 1J12A 1V5JA 2A6KB 4YDIH 4JRYA 2HG5A 3TA3B 5B38A 4OLZH 2IQAA 2WBWB 5F71A 1EUTA 3VG0H 4HMCA 1JHTA 5HGAA 3S3SA 1VHPA 1NCTA 1P4IH 4R97C 4F15C 4OJFL 1FJ1B 3FCTB 1WWAX 3CVHA 5IESL 2XN9B 4JM4H 4R90H 5GGSB 3MRKA 1L7TH 4JDTL 2BVPB 4U49A 3DXAD 3FB6B 3ULUD 4KTYA 2LABA 1K3IA 2ZOKA 5D7LE 3UTQB 4BZ1H 5C0JA 3D2UA 2IFFL 2B8OT 1XIWC 3LSOB 1FZOA 2APBA 4WFED 4I2XE 3UBXB 5I66B 1R24B 3EYVA 4UTAL 1JRHL 5IJVA 2JE8A 3NPSB 4JM2A 4I3SL 1J0YA 1QFWH 2CDGA 2Y5EA 5ESAB 4XBPA 1OD9A 2VLRE 4ODUA 2ATKA 4R0LA 5FCSH 4Z7VF 2R2BA 4XAWH 2A0LC 1QPPA 1G7HB 2BCKA 2R29L 1KCUL 5DGRA 2ATPB 2VDLH 1QFUH 4OGAD 3IFOA 4JFPA 2DLFH 3MODL 4HS3A 3RY5A 3SDCB 3OHXB 3FT3A 3B2UC 2CIIA 3MV7A 1ZSDB 4ZNEA 4NZRH 4JFDD 3V6BR 2B4CC 3ARGA 4P5MB 1UWXH 4XPFH 4M43H 4JHBA 1F3DJ 2LU3A 2NCMA 3BIAX 3BKCH 1RZGA 3TZVD 1OTSD 3OV6A 1MHEA 5DUML 4F7EB 2E7HA 3HZYB 1UQSA 3T8XB 4M7LH 4NUJB 1W8OA 5KAQF 4HKJB 5F7EH 1ADQL 3S37L 5DO2C 4YDJB 3FCTA 5I6XB 3NTCH 3PXHA 1FRGL 4LVHB 1BQLH 4BFIA 4KKLC 1QKZL 5C08E 1MWAB 4EQ2A 3DSNA 5AZEL 3KPPA 4XMPH 3SQOH 4ODVH 4X99B 3O11A 3RWDB 1T3FB 3BUTA 1JWUB 4ZOAA 3BW9A 3SE4C 5IMMA 5KSUB 5ECJE 3SOBL 1YEGH 3DIFB 4LL9A 4QOKD 4G42A 3BRGC 5F96L 3OX8B 2VZTA 3LIZL 5I1IL 2Y9RT 4N9GA 1J5OH 1DQLL 2Q1EA 5ESAA 5BMFL 5HDLA 5BVJB 5JXAH 3U2SB 4GG6E 2Y5TB 3U4AA 5F3BA 3P4NB 3HTLX 1T0MB 1A7NL 4PJ9D 1R3IL 3I2CL 4WFGD 4M5YH 4ZFOB 4MLSA 3PL6C 3LPGA 4I18A 4JDVB 5FYKU 3O4LD 2XWBB 2XZQL 3VE0A 5SX4I 4BSVA 3ELAT 2VSDA 3NIDF 5IHBA 3GMLA 3QDJB 2QL1A 1A4KB 4ODWA 3SBWC 5E5MA 2V9QA 1RZGB 3MRMB 4P9HH 4OKVB 3BI9X 4HPOH 1J8KA 3RWEA 5KSVA 4L9LA 5ILTL 4XI5C 3H9YA 2IF7A 1K9TA 2XWJA 3X14B 1TCMA 3HKFA 3MRCA 1JP5A 1KCRL 2OM5A 4P2RA 4XVTL 1ND0B 4M61A 1GPOH 4CU6A 1AQKL 1WIPA 3CK0L 4ODBD 4MX7B 1KELL 1MIML 4JFEA 1MWAH 1MWAA 5C0CA 1BQHA 2VXSL 2UY6A 5HYJB 3BKML 3L3GB 5IGXL 4FFWD 5EU6D 3NN8A 1JWUA 1AIFB 4N8CL 3UO1L 4EOWH 1AE6H 3EO0B 3ZL4L 1FYTA 2X89A 4WTWA 3GMQA 4HUXA 4X6DA 4NKIH 1A8JH 3SGEI 2K1MA 1Z0MA 5C3LD 5D2LB 2H8PA 1OTUD 1IEBA 1IKFL 2XV6B 5CKAA 3UPAA 3UJIL 4RGOH 2XY1A 3QI9A 3ARQA 4Y4KD 4UT7L 4ZXBB 1WBYB 2N1KA 3NCFB 5JNYA 4JY6B 5JLZB 3T0BA 2YR3A 2IPTL 3QXWA 3BMVA 3MJ8A 2P5WA 2XQBL 3SDXB 4WHTA 1A02N 5ETUA 5JOFB 1T7YA 5HDQL 5ICYB 5C0IB 1KIUA 5J11C 1YEEH 3V5DB 2EH8L 4JN2B 4O5LL 4HLZH 3QSKB 1G1CA 1EHLL 3WNMA 2EEBA 4LOUD 3QDJA 4JZNB 4OZHB 2F8OA 3ULSA 1EHNA 1L4IA 3MROA 3CVHL 3LZFL 4NN7C 3RNKA 2ZSVB 1UFUA 2VLKA 1JVKA 4MS8D 1DLHA 1HEZA 5DYOB 2EIEA 3OAUH 5D1ZB 1A7NH 1CFQA 5L2KE 3O0RL 3C8KA 1NANH 5F9AC 4LLUB 3FO9A 1AD0B 2VDKH 1QNZL 1OP9A 3KPQA 5EIVA 5I8KL 2DWEB 4MA8H 3U7YL 1S7QA 3QIWA 4DKFH 1H3PL 3DYOA 2AJ3B 4C59B 1KB5L 3NN8B 2W9DL 2WWKO 4I77L 4DUWA 5ALCL 1AY1H 3F8UB 3QZWG 3S96B 5B8CA 1FN4B 2J3SA 1Z9LA 4QNPF 1CDUA 2FJGB 2AJXL 1BZ7B 2DYPA 5GS2D 1FFOB 3MLYH 1ADQH 4LEXL 2F54B 4DFIA 3T3MF 2OK0L 2X1OA 4WDIA 5H2BB 1FH5L 2AW2A 1W2KT 2DI7A 1WBYA 4P2OC 1L9MA 2EE2A 3QWRD 4JY6A 4XVJH 3HFMH 4X4MA 3GUTA 3T2NH 2I07A 2KPNA 1KGCE 3MMEA 4KV5F 3MBED 2BVTA 1WSST 1L0XA 5KJRL 4L4TA 2VN7A 1EO7A 4G6FB 4OZHF 1DEDA 4G8GD 4U1KB 4QHKI 3S37X 3F7VA 4P59H 4U1LB 1D5ZA 3EOAA 4R2GD 3TPUA 2SEBA 4Y16A 4GO6B 3BD3A 3RWIA 5C08D 4X80L 1NC2D 3S35H 2NY6B 3LAFA 3MXWL 4TRPH 5DQJA 3OKOB 3A6BH 5DC4B 1FIGL 4HXAL 4ZFFB 4BZ2L 1KTLA 1BBJA 4JDZA 4PG9B 3UP1A 2VLKB 1MCNA 3DGGA 2DBJA 2J1KA 3QDGE 2EC9T 3BGAA 1E6JL 4HPYL 1AKJD 5DYOA 5L8KB 4ZUSA 2FLBT 3R8QA 1F6AB 1ZVHA 3ILQD 4KUCD 1PSKH 5C0GA 5D2LF 4KQ3H 3KPQB 1NCCH 4MVBD 1T66C 2D7NA 1JYXA 4PJDA 2DQCL 3QIWB 4EDXB 2O61A 3HE6D 4U6XB 4MA8L 2DICA 3T04D 4JG0L 2VDKL 3SGJC 4D2NA 3DRQB 1DQDH 3DMMB 1T5XA 1A64A 2A6JA 3ZKSD 5T1LA 3TIDA 1BX2B 2PYFB 3KPTA 2HT4C 3FRPA 1A1NA 1BFOA 3V0VA 4E42A 1T2QH 2X89D 1HQRB 4TSBH 4JDTH 4WW2A 3GNMH 1MFEL 2JJUA 1BHGA 3U79A 3U9UB 1RZ7H 4BZ1L 4S0TD 4GXUM 1NQBA 5DFTA 1ZT7A 4TPRL 3TH3T 3UC0H 1H3VA 4X9FA 4J4PA 2B1HL 3HHRB 1RZ8A 4OZGA 1FVDB 4YEFA 3MOAH 1E28B 2EC8A 3F58H 1LEIA 1BFVH 3CGTA 5CJOL 3L1OH 1LEGB 2DQCH 3AY4C 4WEUD 3PGDB 4PRAB 1AGDA 1Q9OA 5HPMB 5EO1A 4Z0BL 5SWZD 4PGEA 3T0EE 4JFQA 2EE9A 2HJFA 4YXKH 4LKCA 3LDBB 5ICXB 5H37H 1NGYA 3PDGA 2Z8RA 2CGRL 3FO0L 4EI5D 5IB4A 4MQ7B 3U7WH 2BRQA 32C2B 5JQHC 2ATPA 1MQ8A 3LD8B 3NVQA 5I1CL 3EZJB 4RRPG 2CMRL 4P5TB 4PJ8B 4YO0B 1JPFA 2VXSH 1K8IA 2AABL 2Z4QB 2CIIB 2XKSA 5JMOC 3U46A 4MWFB 1K6QL 5CD5D 3DTXA 1KPVA 2M8XA 4GUPA 4O2CB 3HMXL 5L2JB 3D9AH 3B5HA 2ZUUA 3WMSA 2VERN 5HHPA 1WAAF 3RJQB 4E42B 1DL7H 2ZZUT 3EFFB 5B4MD 5GGTL 1WITA 4LCIL 3D85A 3O8XD 3ZDZE 3KPSB 5JA8B 2AJVH 1MRDH 1QFWM 1EEQA 1UKSA 1A22B 3U9UA 4QRQA 4LPXA 5E8NA 1X44A 4X7TA 4XCYA 4G9DB 4F2MB 4JFEE 4FOMA 4YZFF 3LMJL 2HP4A 3ARBD 3G6DH 5DD3L 1SM3H 3MLYL 5ACLA 1AR1D 4K71C 4LIQL 4OGZA 5EOQL 1B3JA 4UIMB 4FQJH 3CX5J 4YQXH 3SQBA 4U7MA 4OUUB 1N59A 4UIKH 4Z7VB 1ODAA 3PGDA 4PRAA 4NM4H 5AAMA 1JPTL 5HI3C 1KLGA 1VEOA 4KVCH 2A6DA 3A67L 5FOJA 1FG9C 4OCWL 2YKLL 3RUGA 3ULVH 1F97A 1M1SA 4Z77B 3GZKA 4NN5B 5JPMB 1JNNH 3PABB 3NACH 5HGGS 1LO2L 2YXFA 3WFBH 5J6HB 4XNXH 5FM5M 1UVQB 3NA4A 4QRUA 2Y1VA 2R0ZH 1T1YA 2QV2A 4K3HA 5AZEH 2Z4QA 1EEYA 5C0RL 1QLFB 4P0DA 3TO2A 3V4VH 5TPWL 4WGWB 3BYYA 1X4ZA 4JFXB 4ODWB 1ZEAL 1V3JA 2F74A 3PWUB 2K3TA 4Y16C 1Q9LB 5EFIA 4XCFH 2H26A 2P5EB 1KIPA 4DUXA 4RISH 3WV0A 3BJLA 1T5WA 4KTEH 4QHUB 2XWJB 3R1GL 1I4FB 4NQVA 4NP4L 3I02A 2NXYC 3DETC 2VZVA 1VACB 4H88H 1W72B 5MEPB 2FJFB 1NAKL 1UZ6F 3UAJC 2L0DA 3BZEB 5BRZE 4MX7A 4NJ9H 3HNVH 1V7NH 3O45A 1XGUA 4JHWH 4XT1C 3UJJH 3GMNB 4HCRL 1UXWB 4FQHA 1HOCB 4FXKA 1AIFA 5BO1H 3LRGA 4LSRL 1NCBL 4PRIA 3QP3A 4LCUA 4C83A 2OP4H 5GISL 2EKSB 3T4AB 4KHTL 1S7RA 5CIPH 3U1SH 4LARH 4WI5A 1FZKA 5JQ6H 4J6RL 4U2ZA 1J1PH 5DRXA 2F5AH 3CFJA 5ERWA 5CD3A 3WKNA 4NO2A 4KUZL 2JELL 5JXEC 1GAFH 5J6HA 4F7TA 3MRBB 1RIVL 4C56D 1IGYB 4LQ1A 2F58H 1JIBA 2KZWA 4Y88A 1A3QA 3UTZA 5ETUB 4ZXBC 1MIMH 5ICYA 1JPSL 1S7SA 1S8DB 2VLLB 1UJ3C 1YUHB 3V5DA 3Q6FB 4OB5L 3QG6B 5DMGD 4ESKA 35C8H 1NCDH 2YD6A 3L3IA 4RFNC 5ICZB 4Y4KA 1Q94B 2XG5A 5ADOL 1NBQA 2XZQH 4TTDD 1MRCH 2XXCB 5JHDB 1JWMB 3L3JB 3QIBD 4NQVB 1UKQA 1OGTA 5I1KL 3VW3L 4I2XA 2HA1A 1HKLH 4PGBB 3I2CH 3RIFK 2BFVH 2JCCA 4JFYB 1YPZF 5DD0L 1RUQL 3MCG1 4DWHA 3BXNB 2J8HA 4ZO9A 2G60L 4FFWC 4LCYB 3PDOA 3IGAA 2R8SH 3ZKMC 5LGHH 2JIXA 1ZGLA 2YA0A 3GMNA 4RAUA 1OLLA 2D0HA 4YR6B 2F53D 1X5XA 1MREH 4KK8C 2EZ0D 3FQNB 4TQEL 4BH8B 2W0LA 1H8NA 1WK0A 1RIUL 2Q86A 3BKYL 1ZLUH 5AYUL 3PWPA 1OWRM 1RD6A 4OIBA 3ZTNL 3GM0A 5DQDL 4WDIB 4YHMH 1FRGH 4GAYB 3PG2A 5JOPE 4X4YB 3K8MA 4FS0A 4FFYL 4JO1L 2NY4C 4L5FH 1D9KD 2ED9A 1IGYA 3LRHA 3SQOL 4X80H 5HGBB 1MCKA 4P9MH 3TBSA 4LNRA 2FGWL 3VA6A 2ZCHH 2ZCHL 4G6AD 4X6BA 4BZ2H 4OUOA 1EJOH 2DQDH 1R3JB 3RWIB 1NGQL 3REVA 3PGCA 3VMPA 2P49B 1EVTC 4KHXH 2HH0H 3K2UH 3OJMB 2YRPA 5J1SC 5DQJB 1J18A 4FQLL 4QHMA 2DN7A 4P3DB 1YN6B 4P9ML 1T7WA 3I6KB 2D7QA 1IBGL 4N5UA 2VXTH 4JFYA 4R2GC 2VDPH 2D7OA 5E6YA 2BFVL 5C3TA 3EYSH 5BZWA 3OKLB 3CSBA 2OTWB 1V3MA 2DQUH 4E41B 3QUKB 5DS8B 4OCRL 1EHXA 3ZSSA 3HAEA 1NFDB 3QJFB 4PTTB 5CJQH 2F5BL 5E70A 5D1QB 2ICES 3WLBB 1NGPH 5C0ND 2F53B 4KROB 4TYUA 4WI9A 5C1MB 5ENWA 2Y6SD 3SN6N 2X4QB 5GS1A 3SKNA 5E6IC 1NL0H 5I1DB 1P53A 4LSSH 3VJ6B 2Z35B 4R90L 5D7SH 4LKXB 2EIBA 1T0PB 1LO5A 4FXLA 4MNHB 2JB6A 5I74C 1ZANL 1A7QH 3D69B 3EOYG 2VITB 1WIUA 5K59E 1BWMA 3OB0K 2R2EA 4L4JA 1UM5L 1UB6A 2AGJH 4WO4A 3OPZH 4HMDA 5TQ2L 3F7QA 2PNDA 3BPCA 2B4CL 1N8ZB 1JZ5A 5JQ6L 4X6BB 3B3IA 3IF1B 4ODTH 1CBVL 1LK2A 4JQXC 4XPBL 3T0XA 2R1YA 4NRXA 5HYSB 4PJ7B 4U33A 3EBAA 4NQCE 4JFDB 3JV6A 5ACZA 4NC1C 2R4RH 1YN6A 1CDGA 3BPOC 4ZS7L 4JRWA 3HZMB 4XMLL 2PCPA 1XF2A 2XQBH 4GG8A 5EUKB 3IDNA 5LGJB 3QUML 2CIKB 1ZHBB 2C3WA 1KJMB 2E9BA 1NGYB 4LSQL 5TDPB 5IF0B 3VXUD 2HKFL 4OF5A 3OF6D 4Z8FL 1KG0A 5BZWB 1OSZA 4J3XA 1MCOH 2Y06H 5SX5K 1AHWB 1WFNA 1TPXC 3CFEA 3FQUB 5EOCH 1V7NL 3HAEB 3V95A 1RZFL 3LQMA 1BZ9A 4RQQA 2LTQC 2GCYB 2ZOLB 2HMID 2B7DT 1AQKH 5JW4R 2GI7A 1TJHH 1IAOB 2VYRE 4NQDD 1HSBA 4APQC 4KKAD 1F4XH 5E56A 4CVXB 3RX7A 4UT9H 1LP9B 3BKMH 3VFSB 1KTRL 3CSYB 4N0UB 5E1HB 4OLEA 15C8H 4QHKJ 2DQTH 4NGHH 2WBKA 1WCBB 1BD2D 7CGTA 5LKNA 2ZSWA 3LB6C 1PG7L 1BD2A 1IFHL 1B4RA 2WIIB 4UTBL 5CZVH 4PJIE 2GFBA 2IBZY 1CYGA 3FQTB 5E8NB 4HX1A 1U8LA 3IDXH 2GTWA 4F2MA 2K7QA 1C7SA 1NMAL 2WBJA 1N8ZA 3KHQA 5E8EA 4HFUL 5EB9A 2PYEA 1S7WA 3C8DA 5KZCB 3L6FB 1J86A 2AERT 2VDOH 3GSVB 4G9FE 1PX3A 5FHBH 2PXYC 4UIMA 5D1XB 3HE6B 3WFHB 3BT2H 1H8OA 3D39A 6CGTA 5T5FH 2C7UA 3VXNB 4KZDL 3O3AA 2VN4A 4HV8A 3W11C 3SDXE 1YNKL 2DM7A 4P2CG 3DX9A 4KK6D 4AL8L 1QVOB 3TV3L 1VGKB 4V2BA 3D39D 5F3HB 2CJUL 1B2WH 5HVFB 4PP2B 4ONFH 5JHLH 2AK4A 3X3FH 1OD7A 5DJDB 1FVEB 3VXUE 3V5HB 2MOVA 3OB0H 1ZLWK 2DQIL 4G3YH 3SDYL 5E08L 4M00A 5MP6L 4QRSA 1ONQA 3QEUA 5I73C 5DJ8A 4DKEL 1IAOA 4YQXL 2EDEA 3K0WA 4R7NA 5EA0H 5D7LA 1SM3L 2F74B 1HKFA 3SEPA 5E94A 1P7KB 2VXUH 4BQBA 5TE4H 4KROC 1M7IB 1WCBA 3AB0C 4QHUA 4X5WA 2I9LB 1B88A 2ZUQC 5DQDH 1LD9A 3U7WL 1E27A 1NBZA 2V6HA 1BOGA 1VSCA 4S10A 4NO0D 1DUZB 3QXTA 4V1DB 3LKOB 1MAKA 1XGUB 1PEZA 5HJ3B 3PJSA 2FEEI 5SV4A 4BYHA 3TVMA 3VXUA 3O81A 3HB3D 3ZDZF 1JGVL 3WJJA 2NNAB 5MEOB 1I1YA 5J57B 4F57H 3QXAA 1OF2A 3ORJA 3SJVA 4CJ1A 1TZGL 1K8DB 2DDQL 2YPLD 3DURA 4XNYH 1RV6X 4ODXB 4Z7OE 4DVBA 3OAZK 2ZG3A 4P2QB 2QQKH 4PJEA 1P7QD 5CUSL 1KLUB 5HVHB 1NC4B 4X9IA 5D1ZD 4EI5B 3MJ6A 4W68A 5GRVK 4DTGH 5B39A 1JYWA 4QRPB 4ZOCA 3D39E 1A7RH 1H3UA 4NO2B 2DKSA 2R2CA 3NCMA 2F19H 3FOMB 1CBVH 2Z91B 5TE7L 1YY9C 3V5HA 5DWUH 35C8L 1QPXA 1A14H 1BBDH 1A7OH 5KTEH 3LKNB 5KTEL 3EYOB 3MCKA 5EC1A 2IWGA 5GPRA 2FATH 1I7UA 2F54D 4DVRH 4QRRA 1A5FL 1BD2E 3THML 2JK5B 1TJIL 3BE1L 4K3DH 1B6UA 2H6PA 5HHNA 1A14L 1BBDL 3QIUC 2N56A 3E2HC 4M02A 4Z0XB 2A0LD 2UUDK 1AGBA 4XP4H 3SO3C 1IAMA 1SYVA 2A9MH 2EDYA 2OZ4H 2JCCB 1MHCA 5DK3A 1OAXH 3P73A 1U93A 4WV1C 3FRPG 4U05A 4IEFB 2W9EL 4U1SB 1R3KB 2CRZA 4URTB 4YDVA 5J7CC 4APQB 4DGVL 3UMTA 2Q76A 5E9DE 1GIGL 3QQNA 4HT1H 4JJ5B 3UDWA 1G6RA 4JVUA 4LRIA 5DRWA 2IQ9H 4JRXA 2ZP0T 4NKOB 1QO3B 1NKOA 1WWCA 2BXYA 1MCWM 5EU6B 2X4RA 4NO5A 3NPZB 5EO0B 2R0LL 2XQYK 4QXUL 4LVNC 5HHOE 3S35L 3FB7B 2PXYB 1YDPB 4CJ0A 3ECBB 5F7KC 4JZJB 5B3JE 2OR8A 1U9KA 2IQAB 3FT2A 4L8BA 5KS9B 1JHTB 1E0OB 4E5XB 4NQDB 1RJZB 2EDQA 1K2DB 2PO6C 4DAGL 5D8JH 5AUMB 2Z91A 2QR0A 4J3UA 5E7BA 5MERB 5A43C 4JFDE 4OTXH 4MMZC 1QSFE 4WU7A 1X5KA 2IEPA 4S1QL 3QWRA 3SGDI 1XF4B 2YMXL 3RVXD 4MB4A 4AL8H 1VFBB 4U1IB 1R3JA 1JPST 2EDLA 4WGVB 3R4DA 3LSOA 4YGVA 5CBAA 2D3VA 3FHAA 3OAYK 4N0CC 4XVJL 3EO9L 3JUYA 5FKPA 2HT2C 4WY7H 3WO4B 4Q9QH 2YKLH 4JM2B 5CSZB 5I1LA 4F7MA 1JZ4A 2AJUL 3O3DB 4PJ9C 1S5HB 1AGBB 4NKQB 5DEGB 4WTXA 1JGLL 2FRGP 4PJBE 1NCWL 2WQ8A 4XVUD 2F9BT 3AU1B 3NAAL 4M62L 4ALAL 3IJSA 2BVEA 5FEBA 3MLSL 3HCVB 5EOTB 1G7PB 3IJHA 1A3LH 5T5NF 4DZBB 4HIHB 1T04B 4KJPC 1PBYA 1UM4L 1N6QH 4HS3B 4ZPTB 2RB8A 3KPLA 2P5ED 3OHXA 1CR9H 4OF6A 4GAJH 2V5RA 3H9SB 5FO7A 4NIKB 1NFDA 4WFHE 1CU4L 4PB9H 1GZQA 1J0ZA 3OBAA 3SE4A 3UTTD 4XHQA 2ZKHL 3TCLA 1UA6L 1OARH 5I1KH 2W07A 1ACYL 1PQZA 1UADC 3EAKA 3TM6A 5FKAA 1YMHB 1FV1A 5KS9F 1WGOA 4ORGB 4N0CD 1UQSB 4DN4H 3O6ML 3G6JF 3RU8H 1ED3A 1MF2H 3L3DB 4YUEH 2JB6B 1CLOH 3F5WB 4BK5A 2Q6WA 1A9BB 3WSQL 4UAOB 4OD1H 1FFNA 5FDWB 4JCMA 1RZFH 4TUKH 4K7PY 1BMGA 1T2JA 4D9RD 2AABH 1HXMB 4M48L 5DEZA 3DMMC 4MD4A 1KIRB 4X99A 1DANU 2GJJA 4KY1L 4M9PA 4K2UH 4U1NA 1WC7B 2AV7A 4YGVB 1LVEA 4JLRB 2Q7NA 1J1PL 2X1QA 4ZS6C 4U6VL 4FZEH 2FNBA 3P77A 1F45A 1UZ8A 5EOCL 3EGSA 3VD3A 4F7MB 3W0WA 5DD1H 2NZ9C 3T1FB 1MCOL 2Y06L 1S5HA 1F3RB 2IMMA 2J88L 3PWPE 4O51A 3VFOA 2ZUQB 3HNTL 2J6EH 4JRYD 2XRAH 4WTZG 1RUML 4HCRH 4U6HA 1II4E 1NMCB 4P23D 3UCRA 2X40A 1XGPA 4CVWA 3HC4H 4PPTA 5T3XL 2OJZL 3RL2A 4XC1L 3VH8G 3CDCA 3ZDYF 4U6VH 3FQUA 2GTZA 3TT1H 5C0NC 2CDEB 2BY3A 5FGBC 4BSVB 2FH8A 3PHOA 4Y4FA 2AGJL 2ICWA 2QQNH 3DUHA 4D9LH 5F1NB 4TNWF 3CFDA 4JR9L 4Y19E 3ZKMD 4GKZA 4MGXA 3KXFB 4PREA 2N7AA 1D5IL 3DGCR 4HEPG 1HIMH 3VXPA 2APWA 2O26U 5I1HH 1FO0H 1MFCL 5EU6E 5GS0H 4GKOA 1IM3A 3MR9B 1XMWA 1HH9B 3UTPD 2VO5A 4HLJA 1ED3B 3C2SA 1NDGA 2JIXD 1PJ9A 1DFBL 2ZWLT 4Y7MA 4ELMA 2AK4E 2MHAB 1QSFD 3ARBB 4YFLF 4ETQB 1HZHL 3BP7B 3FQTA 2X09A 3EJYC 5GGRA 3AM8A 3MTRA 1ZWIB 2GTWB 1NL0L 4HPOL 1UM4H 3TJEH 5JPNB 1BQHB 1PZ5B 5E8EB 1KLFA 5C07B 4HZLA 4Z95L 3W9EB 5KVFH 4FQCH 3L6FA 4OF8A 3ARRA 3KDMA 2APXA 3LQAL 3RIFF 1ZA3B 2Y07H 5DUPH 1MQKL 2CK0H 3D39B 4MNQD 5ABDE 4DCQA 1YPZB 4JY5L 4FZ8H 3DX7A 3SCMD 3BAEL 4RDQG 5TH2A 4NFDA 4WU5A 4WI7A 1QRKA 5E8DL 3B83A 4UBDD 1G6RL 4L8SC 4GRMB 1CD1A 4O9HL 3AS0A 2XG4A 3O6FD 1RJLB 4WCYL 5C0AA 4PR5B 5C2BL 1BIIB 4LP5A 5A3IC 1A21A 4J8RA 2Y25A 4L3AA 1SYSB 3KWWA 2FBJH 4R8WH 1TVDA 1VKXA 4NCDA 4PJAA 3H9HA 2B2XL 4TUOB 4APQD 1XAUA 3E0GA 4C56B 4FQLH 1NUGA 4P2QD 5FYLD 1VB9A 3GSWA 5EU3B 1BIHA 1YC7A 3MROB 4OFVA 1WFOA 5B21A 1MFBH 3H6JA 5CWSA 1I8KA 4XAKD 1P7KA 1T7VA 2DLFL 4Z7NF 1IGTA 4R4BB 5C86A 1P69B 1GGTA 4R0LC 1XF3B 5D71H 2VQUA 4YPJA 4MJIA 1U92A 1DLHB 2GYSA 4QRTB 4JREC 3SCMC 1KXQE 5E2UH 2MHAA 3BO8A 3MXVL 2XKNB 3CPLA 3BZFA 1U3ZA 4P4RA 3QFJA 2CMRH 2OQJA 2PW2B 3DRTA 2BERA 5DSCB 1LWRA 1MFDL 2Q7YA 5FUCC 1GSMA 5J4MA 1QFUL 4PRDB 5HJ3A 4KGLA 2NW3B 1YN7B 3O9WC 2AJ3A 5HY9A 3GSNA 3MSPA 4XZUB 4PJCF 3S96A 5B8CB 4GMTL 4ODHL 1GC1L 1XR8A 1MOEA 1I1YB 4PJXF 3O0RH 4L4VA 3BEVB 5ANMB 4QRPD 3QUZB 4PLJD 2XY2A 3QEQE 1VPOH 5FA4A 3TBTA 1VENA 1RSFA 3VW3H 5F7NC 3EYQC 3U7YH 1NC4A 2Z9TA 2ZNXA 5JDJA 3D3VE 5E1AB 5HGAB 4XC3H 2DL2A 3GK8L 2FCBA 2WUCH 5IQ9A 4AH2B 4NQXA 4HUVB 4ZDHB 1CG9A 4BUHA 4P2OD 3G5YB 3OWEA 3BE1H 1JTTA 3UROR 3KLDA 3EOAB 4B0MM 4O2FA 3H9HB 4TUOA 4C56E 3MA9H 4R97B 4F15B 2G2RA 5FK9B 2BZDA 1S9YA 4PRHE 2C4FU 2NR6C 4KMTH 1DQTA 4MA1C 2J8UB 2LTQB 5I8EA 5I66A 4OI9A 4TSBL 1R24A 1IT9L 4MJ2A 5KG9B 1WFTA 2J6EL 5IJVB 4XP1H 1MHPL 3S5LA 4JZJC 1Z3GH 1B90A 4NN7B 5CP7B 4YXHL 1HHGA 5KSAD 4HGWB 2OP4L 4W6XB 5IBTH 5DVKA 2VXQH 3MLRH 4KK6C 4X9HA 1ZE3C 3DUUB 1JI2A 4NKIL 4K94C 4PIRF 5TF0A 1Y6MR 3DRTB 2X4UB 5CJBA 1FQ9C 3H7BA 4YHKL 6FABL 1DBBH 4JFPB 1EEZA 5EU7C 3SDCA 3WNOA 3ARXA 1ZT1A 2FYYA 4X6EB 1AI1H 1QO3A 3RDTD 1XR9B 4KVNL 1QBML 2PKDA 4MNGE 3FAXA 4LSDA 1FP5A 4RRPA 1OQXA 3DETD 4GJTB 2EYSA 3T3ME 1M7XA 2ICEB 4FG6D 4HBCL 4RZCA 1R3HB 4DN4L 4M93C 1EPFA 4AG4H 5ILTH 4WW2B 3WS3A 4NQDA 2VLKD 4EDWH 3GHEH 4S1DD 3NGBC 2FIRT 1WEJH 4M6MH 4YXLH 4C4KO 1BQUA 5SWZE 5HGDA 4ODHH 1S5IL 3GSNL 3VI3F 5DHYA 3TO4C 3OAZH 4O2FB 2E27H 4EI6A 3QG7L 4UNVA 5FK9A 4KK9C 1EXUB 4XCFL 1F11A 2QKIB 2EEAA 3Q1SL 1RZ8B 5AD0B 4OLVL 4Q0XL 5IQ7L 1P4BL 4HSQA 5ITBH 4M8VA 4XNQB 4ALAH 4MDJA 1IC1A 2KBGA 4KRPB 4TSAH 5DXWA 3HMWH 4KJWC 1CDCA 3MV8E 4HGWA 4PG2A 3FZUD 4LKCB 5F6HI 2CUIA 3P4NA 4OCYH 4LASH 1AY1L 2I24N 4OCYL 1JNLL 5L8JB 5IQ7H 5DRNA 4DJMA 1WV7T 1ADQA 1L6XA 2R56L 4GSDL 5EOQH 2OR7A 4JB9L 2I5YH 1J05A 2IH1B 2WINA 2WNGA 4PJDE 2VABA 5MENB 3WUWB 3T3PE 3KPLB 5EIIB 4HZAA 2YPVL 3VE0B 2YD4A 3W5NA 1X5YA 3O2WL 1RJYB 3WO4C 4I3GA 1QUNA 1RY7B 5IWLC 1B6DA 4HFUH 1UH3A 1CF8L 5FM5O 1TENA 3EFFA 4WWID 5IBUB 4MAYB 1AP2B 4NN6B 1S9XB 1R3LA 5FUCE 3MZTA 4R2GB 5DUMH 4B50A 3EIFA 5HHOD 4DZ8B 2ZPKH 2MCPH 3WDIA 3IXTA 3JWDH 3WS6C 1ITCA 1IQWL 2DRUA 1DEEB 4QRQB 4M6OL 4XH2A 3FKUS 3KYNB 4NZDA 5LG1A 4XCYB 2O5YL 3CDYA 5FDWA 3CMGA 1ZA6B 2QSVA 25C8H 4G8EA 1DQJA 5HYJA 2AJSH 4ZUUB 1A4JB 1INDH 3PHSA 1N7MH 4X6CE 2CGRH 3VD9A 1Z5LB 2W0KA 1JK8A 2NLJB 4OM0L 1CE6B 4PYHA 5C09D 2AJYH 4LLQB 2H32H 4W4OA 2NY0D 3ZE1F 2IQ9L 3X17A 4HQQH 4LPUA 1KLGB 5BS0E 3KLHD 3D9AL 2A6DB 3PQYE 3QNXA 5BRZA 3ZKXB 1KCUH 3U4BL 3I6GA 3V7AG 4HJGB 5D7IA 3V0WL 1DVFB 1OAYH 5DRNB 2NY3B 1WUNT 3VRIB 2P5WB 5AG8A 3U36A 4Q58C 4JHAL 2OXHA 4JKPH 4DOHB 2WBJC 3MRLB 4RMRA 3VCLA 4Y1AB 4JFFA 5I76A 1H3TA 4QKXB 1IT9H 1F3JB 4LCCA 1OAUH 3MBEB 1F4AA 4MA3B 2ARJA 1AHWC 1JGEB 4Z18A 1RJYA 5GJSL 5K33A 4JFXA 2GSIA 2NZ9D 3QNZB 4Y2DC 2P45B 2IFFH 2BHUA 5EFIB 1FCCA 1KIPB 5F44A 4NQDE 3G08A 4P46C 5TQ2H 1VADB 2ZSVA 2VLKE 1IM3B 1T1ZB 2NY4D 3C9NA 1HH9A 5INCA 2YSSB 2JKXA 3UZEA 2XIDA 3I75B 3ARBA 3KYNA 4WENB 5I18L 1AD0A 3TBWB 4KZEH 3QCTH 3VXSD 1CK0L 5E2TH 2VRAA 2BNQB 1J8HA 3BWAA 2ADGB 5CUSH 4ZUUA 3I6LE 5C07A 2VSCA 4MNGB 2KQNA 4U1MA 1UXWA 4WRLA 3L9RB 3QIBB 3CFKB 4EBQH 1GXEA 3WDJA 5C70A 3ARDB 3WFCH 1XZ0B 3O41A 4LQFH 4ZG1A 1P4LA 3X13A 4NM8H 2EKSA 3T4AA 2DQHH 4NQSB 1LHZA 3QHFH 5IG7A 1TNMA 4JCLA 5I16A 4NDMB 2DB8A 4WU5B 2V7NA 1F00I 2DQJH 5I1JL 1GL4B 3VFGL 4Q6IC 5J9PA 1MI5B 3MV8D 5DURB 3CXDL 1FYTE 1IAKA 2BDNH 5T3ZD 2GSGA 1BIIA 3VXTB 4A6YA 3BH9A 3OGCB 4LHJB 1BVLA 4DKEH 1QKZH 4NOBA 4U1LA 3RRQA 4K8RL 4HUUA 1TITA 5IIEB 1NDMA 3QZWA 4C56A 4F37F 1JGEA 3FFCB 4NYLA 4IRSB 3HAEG 5E2UL 4LPVA 1E6JH 4HCRA 4HPYH 4NO0A 5IT2L 4ZFFA 4H1LA 3FHQA 1IGML 1JN6B 3F12B 2B2XH 4WFEE 3LKQB 3UXFA 2MKWA 4JGMA 3C5ZC 3GHBH 4OT1L 1F5WA 4HF5H 5C07E 2KZ1B 4L8SB 1TZIB 1XGTB 1ZXQA 5HI5D 4LRNL 1X5LA 4G6MH 3B9DA 1OVZA 1KJ3H 3F62A 4O9HH 5I30L 2VXVH 1MUJA 5T5FL 1F6AA 1I9EA 4OCSL 5FUZL 1VGEL 4P4RB 1ZHNB 1GCFA 2R2HB 2H41A 5AWNH 5DSCA 1CICD 1F2QA 1C1EH 1G7QA 3R0NA 4EDXA 5IVXB 3BPNB 2X4PA 3I84A 1EBPA 2EICA 3K46A 4S1SL 1Q0YH 1G9EA 1H5BC 4CUCA 4ONFL 5DD0H 3VH8B 3OAUL 4EEEA 3DMMD 4NKDB 1XGYL 3X13B 5ITBL 3TIDB 5LWYH 3PWPB 4MZ2A 3CFBA 3TFKC 4GG6A 5SWZB 2NXZD 4O02H 5DHVA 4PGDB 2VWEE 1Q0XL 4NGHL 2X10A 4JFFE 2O5XH 5GGRY 5KSAA 3CNKA 1BREA 3FN3A 1MQKH 1QACA 4R3SB 4F80A 2NTSP 2ITCB 5I71B 1JV5B 4PGCA 3HI5L 4R26H 4UNUA 5ALCH 5CP3A 4AH2A 3C09C 3CX2A 3UTOA 4YX2H 2NY5H 4MS8C 1KXVC 4Z95H 3VI4F 4Q97A 2YK1L 4ERSH 3MZGB 5D9SB 5IK3A 2BVQB 1ZT7B 4MDIA 3MLVH 2XZAL 2ITDB 1QR1A 1NH6A 4K7PH 3MRFA 4FA8A 5IVNA 4D0DB 4Z78B 2XQYG 4P5TD 3QO1A 4PJ8D 4RMTA 4OIAA 3JV5A 3Q5YA 1IFHH 5C0AE 5CJ5A 2CLRB 2JF1A 1AE6L 3NCJL 4P3DA 1LEGA 4X6CA 4N1EA 5JDSB 3S5LB 4LLWA 1JCKA 3TBVB 1S9VB 1CXEA 1UXSB 5JTWA 4UT9L 4FQIL 2BX5A 4PB0L 4LFHG 1OW0C 2JELH 4A2MA 5LJYH 4NQED 4YC2C 3G9VA 4M03A 3RP1A 1T66D 1JZ3A 3V5KB 2C5DC 4JJHA 4J1UA 3REWA 3UJTL 4MQ7A 3VXQB 1I1FB 1MELA 5EH1A 3KXFD 2X4UA 5I9QC 4NCC2 4O4YL 4M6NL 4P9HC 4ODTL 4IMLA 1OTTD 3RX8A 2X4PB 5KSBF 3JWOH 2V17L 4RMQA 4WWKB 2RIKA 4PRHB 3VD5A 3ZE0E 3MFGB 1MAJA 3LEYL 1WISA 3CLEH 4HK3J 5D1QA 4RMSA 2J88H 3L3KB 1OT1A 3OF6A 5KSAC 3CFBB 2VLRA 4XVTH 2X4QA 4HG4J 4IJ3C 2X05A 3SKNB 4POUB 2ICEA 2R9HD 4FRWA 3MQIA 4AIZA 5I1DA 3B2VL 5HD8C 4L4TE 1ZEAH 4R3SA 3QBTB 3IDIB 4N8VB 5GHWL 1N5AB 1NGPL 3ET9F 3ZKQD 4I9WE 4XNUL 2NY3C 4EQ3A 1QHPA 5IK3B 1C08A 2O5XL 3ZTJH 5DHYB 1KBGH 3P40A 3TA3D 2AKRA 3QWOB 5ALBL 1G9NL 5IEHA 4NRXB 1G84A 2E7MA 1A2YB 1UA6H 4MD0B 1VPOL 1CU4H 3EYVB 3OB8A 1DUYA 4KVCL 1DDHA 1QSED 4K71B 3OQ3B 1S9KC 4LLWB 4WHYH 1Q0XH 4ZO7A 3WNNA 4JRYE 4U1HA 1UXSA 5JIIA 2PCPB 5T33H 1N2RB 4ISVB 2EECA 3ARTA 2WWKT 4R0LB 5FHAL 2GT9A 3OMZA 4OCSH 5FUZH 2B1AL 5GS0C 1MSPA 3O6FA 2N7BA 2ESVB 4GAJL 3VA2C 2AV1A 4XXCA 5I0ZA 3BDYL 1FORH 4OD2A 3IFOB 1YYML 5KVEH 2YPLE 1J05B 1EJOL 2WINB 2XTLA 3N06B 1FZJA 4H1LG 1MAML 3IAQA 5L8LB 3CIQA 3QISA 3IJYB 2ZOLA 1G7LB 3U4EA 1QSFB 1A6PA 4RFEB 3C5JB 1IM9A 4LVEA 2PUQT 3NH7L 4Y89A 3ARGB 4P5MA 2EIDA 4O58L 4CVXA 3EDKA 4KJWD 3FRUA 4XVSH 4J3SA 2P5EA 4K7FB 3IVKB 3V4UH 1RURL 1FNSL 1DL7L 3QUMA 4JY4A 1R3LB 3VGAC 1YNTB 3WIHL 1S78D 3IFLH 3STZA 2AJVL 4M7JH 3MGOA 3BGMA 3AUVA 3C5ZA 1SY6A 2PETA 4QYOA 2X42A 5I71C 4HBCH 1GIGH 3ES6B 2QQLH 1U8QB 4HT1L 3S4SA 1YMMA 3OKNA 1ZA6A 3PWLA 5EG6C 3C60B 3PV6A 4JFOA 3DBXB 2X4SA 5IEHB 1DLFH 3ILQC 4M5ZH 2YEZA 2OR9H 3HE6A 4MXQD 4XPTH 1WWWX 4X6DE 5GS1C 3CLFL 3DIFA 3H9SE 1TCRB 5IEKA 5T3ZE 2E7BA 2WM0A 1FC2D 5DMIL 4M1CD 3S3JA 1YNLL 3WNPA 1K3ZA 5E24E 1O0VA 4OIIL 2HKHL 4N9GB 5C0CE 3C09B 2FEEL 4HIXH 5HYSG 4GAFB 1CCZA 4F7PB 2BRRH 3QNXB 5BRZB 4Q7DA 4XAWL 4YDLB 3PP3K 4S2SB 4KZEL 3ULVD 2WAHA 1T0MA 4LAQL 5CBEB 5EZOL 4P2RE 3DHJA 4JDVA 1XH3A 1QFWL 1QEWB 3ESUF 1OSPH 5KVFL 2I9TA 5LGHL 4K3GA 3TJHD 3WEXB 1S7SB 4S11A 43C9A 1NCUA 4UZGA 5ALBH 5GZOC 1FC1A 3DX8A 5FYKL 4XMKH 4YDIL 1DANT 2NY0C 4HUKB 3MBEA 1QSFA 3IAPA 3R8BB 2NYYC 1IC7H 5ICZA 2B1HH 2X70A 1INEH 2OSLA 3C5SA 1NSNL 4OKVA 2YD1A 4MNQE 1YYLL 5DFVD 1OSPL 4HC1A 4PJIB 4POZD 1JFQH 2FO1A 2YSSA 5F1SA 2ARJQ 1QLEL 5I19L 1MY5A 4UI2A 3JVGC 4IM8A 4P2RB 5JW5A 2QLVB 1JF1B 5A2IH 1Y0LB 1P9MA 1INQA 4TUJB 4MYWB 3M8OL 4POZC 2FHFA 3EDJA 3LKRA 4OFDA 5HHOA 3DUSA 1TDQA 1IC5L 1XF5A 3IGAB 1ES0A 1KNOB 3UBXI 1D9KB 1UCBH 4MJIE 5JW3H 4IIQC 2ZG1A 1KENH 3E3QC 1EZVX 4BK4A 4YHIB 4YEEA 3PP3H 3CSGA 1I75A 3TYGL 5J1AA 3EDFA 1LDPL 3BUYB 3O41B 3ALPA 5IFAH 4NZTH 4WO4D 4CADA 2ZPKL 3UX9B 4FQQA 3SPVB 3ARYA 4LARL 5DMIH 1MCEA 4ZFZA 1JUFB 5C0CD 3OG4B 4F7PA 1JGUH 4FZEL 1FIGH 4HXAH 3Q3GB 4OZ4A 5HHMB 5GRWA 5JNYB 5EUOE 3KLAB 1CF8H 3IDGA 1RUAL 4KKLD 5KBNC 3QIUD 1IAKB 5L88L 3KPRB 3VXRB 2GSGB 3VXTA 12E8L 5JUEL 4A6YB 1T6WA 2J8UF 4PRID 3PDDA 4LNRB 3R1GH 1EV2E 5C0IA 5JO5A 1G9MC 1CDYA 3UAJD 4HUUB 1HQ4B 2AJYL 5IW6B 4O58H 3REVB 3MBXL 2EE6A 2VZSA 4K8RC 5T3ZL 3Q48A 1KXTB 1DN2A 4N8PA 4OZHA 5FGRA 3ULSB 3H3PL 1NCNA 3C5SB 1HCVA 2CJUH 3GMPB 5F9JA 4HKBB 4IMKA 4Y2DA 5GIRA 5IR1A 3G6JA 4JG1L 4M7KL 1CZ8L 2OX5A 3I6KA 4NQTA 2VJXA 4YE4H 2IH3B 2GKIA 1Y0LA 2Y36H 1MHCB 4MB3A 1HYSC 4G6AC 2EDFA 4UDUA 1K5NB 1QFOA 2DM4A 2Y4SA 4ELME 4GMSL 2EDDA 1CQKA 2EZ0C 1G7IA 4JFED 4OSUH 4GLRH 1RHHB 4HK3N 1DBAL 3QUKA 1JNJA 4M7KH 3P0GB 3RGVD 3UYRL 3JXAA 1JZ7A 1M05B 3DROA 5EU6A 1FGNH 1MJ8H 3VXSE 1MI5E 5I2IB 1NAML 3WLBA 4PLOB 1N64H 2PTUA 3BGFC 5GQBA 2MPAL 1KJ2H 4JRXD 4GG6B 3RZCD 5GS1B 8FABA 1HCFX 3SKMA 5D7JB 4AEHH 2QSQA 3MUHL 2I26N 4Z7QF 3ROLB 1GHFL 3N1QC 4X7DC 3X11A 1DQQB 4V1DD 3IDGB 1AR2A 4TTDC 3WNKA 1JYVA 4O2EB 3HMXH 4WEBH 3QULA 2VITA 4IRJD 4A6YH 2D9QB 4LIQH 4L4TB 3QRFM 3TZVB 1YEEL 5C0AD 3UTTE 5DMJB 1D5ZB 4M3JA 1MRFH 1NBVH 3IF1A 4LLVA 1VFBA 1LK2B 1C8PA 4UV7H 5DQ9A 5CEZL 3MRFB 3SE3A 1E4XH 1MEXL 2A6IB 2E6JA 4MAUH 5HYSA 4LLAA 3CAFA 1P5UA 4RWHA 1CL7L 4LDLB 3UPCA 3B2VH 1NFIA 4OCXL 4Y2DB 1KTLB 4MD5A 4QGTA 3CDGA 4LP4A 4XMLH 1P7QB 3VFGH 5JDSA 3KHOA 3VG9B 3P9WB 5F21B 5EZIH 3U0WL 2J5LB 5TDNB 4BQ9A 4P2OA 5EUKA 5LGJA 2ATKB 3QHFL 4ZUSB 3LEYH 1ZHBA 4LGRB 1MCFA 1QSZA 5C09E 2FZ3A 3G6JE 4UDUB 5I17A 1E4WL 4N8CH 4EOWL 4IDJL 1WBZA 1EGJH 3RHWK 4HDIA 4HIHA 5FYJU 4G9FA 5HDBF 3OKKB 4LOUC 4PJDB 2YWZA 5I8CB 2PYEE 8CGTA 1I8IB 43CAB 3QIWC 4IBLT 1LDPH 2HJLA 1G9NC 5C0BE 4GH7B 1NLBL 1OAZL 1T5XB 2QSCL 3S97C 1RZ7L 4OFYA 2BC4A 5E8PA 2VLRB 4GQPH 3VFSA 3ZYZA 3WKMH 3CSYA 4N0UA 3SE8L 4KRPD 1BECA 4PJ5D 3SDAA 2P1YA 5GSRA 5HYQB 4LVOC 3X11B 4Y4FD 2XA8L 5FO8B 2VIRA 4YX2L 5KW9H 4GLRI 3NZ8B 2V2WA 3MRQB 4YDJA 1X6LA 1FDLL 1FVCA 4D9QE 5F7UA 1MHPH 2WBJB 3MLTA 3VFRA 4KKAC 1KIRA 1S7WB 2VLMD 5A1AA 4Z7QE 1NAMA 2VC2H 1A6WL 1NCCL 3L3OB 3W81A 1CDBA 1EEUA 1IGFH 4MJID 4TTGA 2B5IB 2QADC 2C7UB 3VXNA 4YBHA 1KTDA 4XMKL 2BY1A 5KOMC 1P7QA 4KXZH 2FR4A 5IB1A 4HIXL 1PG7X 3DX9B 3G5VB 3O2VL 5CMAB 1XCTA 5F96H 1XGYH 5BV7H 3VMNA 2Z31A 1NFKA 5HVGB 2Y5TA 4LAQH 2ID5A 3SKJL 3F6IA 2AK4B 3CJJA 1QLRA 4G6ML 4BUGA 5DJDA 5JW4M 32C2A 4FP8H 1IBGH 4HDIB 3FB5A 4G9FB 3VWKA 3PGFH 4M4RA 1U58A 4BFBD 3WXVH 1INDL 1MFAL 2XWBA 2CDEA 3EO9H 2HTKC 4QRSB 2EDKA 2KDGA 1BOYA 3D2UD 1DTUA 1F02I 1G7LA 4NHUA 4LMQI 2FSEB 3C5JA 2ARWA 4KHXL 2PF6A 2QTEA 3OXSA 2YPLB 3MUGB 2CH8A 1SHMA 4Q9CA 1H5BB 3HA0A 3IFLL 2ZCKH 3CCHB 3MRMA 3JWDL 1I7ZA 3N9GL 3SDAB 2RFXB 4IRJB 4XP5H 1KB5A 2XN9E 3ARDD 1JWSB 2VIRB 3KPSA 4ELMB 3OSKA 1ITBB 4JO3L 1F4YL 3K4ZA 3MRQA 3WE6A 3MGOB 4MNQB 1QQDA 3EOTL 3BGMB 4CGTA 2PO6B 4WW1A 3D48R 2A73A 3NGBB 4G7VL 1T20B 3OKNB 3O2VH 3PWLB 3VFRB 4L8DB 3TV3H 3V0AC 5H94A 4DKFL 1CLYL 1HSAB 3NFNB 4X7SL 2BDNL 3VXUB 2HLAB 1LQSR 3P0YH 4J3VA 1OGAA 4OZIE 3EO0A 5IP4A 3NH7H 4OUUA 1T22A 4MA1B 2HTKD 4C4KT 4PJAF 1IGFL 5CEYA 1PKQB 4K94L 3TESA 3WXVL 3SDAC 1R5VB 5T33L 4HJJH 1IEBB 2G5RA 7FABH 1IAIH 1QBLH 2WIMA 4PFEA 5DZLA 2VWEC 4NNXA 3HZVA 2A9ML 1LEKA 3GBLA 4DEPB 3PABA 5DVMA 2AEQH 4R9HA 3DV4B 2P5EE 3QA3A 2WP3O 1JNHB 3FB5B 3KWWB 3BAEH 4HWNA 3G04B 2EKJA 1RU9H 1MIEL 5GRJH 3QG7H 1L6ZA 3VD7A 5B8CC 4UU9B 1U8PA 2BSTB 4PJEE 4NHUB 4OLWH 5EU5B 4XBEL 1U3YA 4LCWA 2X4OB 2YPLA 4FXGA 4R7DB 5DFWH 4OBRA 4JPIB 3CCHA 2VR5A 1I7ZB 4CNIA 5SWQB 2H6PB 5HHNB 1GGYA 4IJ3B 4AEIL 4JHAH 1I4FA 4WUUD 2CLVA 4U31A 1HEZB 4YBLC 3ZE0F 2G9HB 3IS1X 1TVBA 3TO4D 3WE6B 4EZMA 1V3LA 2V2XB 5LBSH 2R1WA 2X7LB 4LLUA 4OFYD 1XF5B 4PJXB 2C3GA 3HPLB 3P4MA 2DS4A 3MYJA 4EVNB 3RVUC 2OCFD 3IDJA 4X5XB 3KNBA 1PY9A 3HS0B 5EN2B 1L7IH 2EXYC 4PJCB 4XBGA 1JGVH 2CD0A 1TVHB 3GRWL 3HE6C 4IS6A 5CJXC 1AGFB 1R5VA 4Z9KB 2Y23A 5L9DL 2F54A 1T21A 2HMIC 3BH8A 4L3ED 3HE7C 3J7HA 2V5SA 3MLVL 1G7JB 1RZIB 3LH2L 5HHXL 5ESQB 3RZCB 4L8BB 4ELKA 5E2WH 3HZVB 2BY0A 4FTVD 4CN1A 4QEGA 5C07D 1O7SA 3O3UN 5AYQA 3MMEB 5E7FA 1CG9B 1KCRH 3UTZB 1FNFA 1BGXL 4AEIH 2VE6B 3KR3H 2NY4B 5KN5A 3F7YA 3KGRA 1S9YB 3CK0H 3U48A 4DN3L 4OD1L 1J8HD 4D9RE 3WFBL 3WJLA 3AXLA 3LRSB 4UB0L 4JPIA 1ZGLM 3KYAA 5FKPB 3IETB 4OCWH 4Z5RB 3V6OA 4HKBA 5CSZA 4HC1H 3E6HA 4ZYKA 4DQOH 4D0BB 3DWTA 4TNVK 5B22A 4U6TA 5JA9A 4AM0A 4GW5A 1P9MC 1S7XB 2BNUB 4PRIE 1KACB 1HHKB 4PJXA 1QBAA 4ZFGH 1CR9L 1P2CB 1U95B 4JANB 4X7SH 3OKMA 5CHNA 2ICWI 4XNXL 2FYYB 4K23L 2ZCLH 3LEVH 3VFUB 1GZQB 5MHSE 1I85A 1BJMA 4W4OC 4OGXH 2CXKA 1PQZB 4P5KA 1AGFA 4Y19D 2ZUXA 3QAZB 5JIPA 1RMFH 2X1PA 1FV1B 3SGKA 4QOKA 1NEUA 4UIKL 4OCNC 4FQXC 1RZIA 2GJ6D 4G5ZL 3ROLA 3WHE0 4UDTA 1FNGB 2Y36L 2CLZA 2BVYA 3HRPA 4NZJA 1KCLA 2GITB 1YEHL 4LAJH 1FFNB 2IG2H 2DQTL 2H9GB 3L3HB 2XI9A 5ESVA 4DEPC 5F72S 2DTSA 3VGDA 3X3GH 2D7TL 4JKMA 3PGCB 3AXLB 1H0DA 3M17B 2A38A 1E28A 5IWLA 1AGCB 2DIJA 1CXHA 5BV7L 3GSXA 4HS6A 4MQTB 1AD9B 1IVLA 2ADFH 4H8WC 2IAMC 3L1OL 3N0PB 4JFQB 5IFAL 2HJFB 5E2TL 3QIUB 2WW8A 2W9EH 4LSQH 5EO9A 4TNWK 3S6CA 4QXUH 3VMOA 2VZUA 1K6QH 1JZ8A 4YFDB 5I17B 5JHDD 3VG9C 3MRGB 1P2CA 3MRDA 5HBBA 1HKLL 2RGSA 4GRWF 4P5TA 4PJ8A 2XXMB 4YO0A 4LHQB 1X5GA 3O9WB 3OGOE 3OXRB 5DMYA 4GXVL 1W0YT 4YPGA 5DMKB 5F70A 2UVEA 1MHHB 2BC4B 4GS7B 1T7XA 3AMLA 1MFEH 4XXDA 1LE5B 5D5ME 5BXFA 4QF1A 4EUPG 5GSRB 5HYQA 1JPSH 1FDLH 4NRYB 1I8LC 3V7AE 3KLSA 4WO4C 2IPUG 1DEEA 4M1GL 2GITA 4LLDB 2EH7L 1SQ2N 1KCVL 2ERJC 4KUZH 3GRWA 4KK5D 3I50H 5GGRB 3MLUL 2X2YA 4G7YL 1CT8B 2DQFA 2HWZH 4G8EB 3BPCB 2PO6D 4OIIH 4OFPA 1I3RA 1NBYA 2GUOB 4XNYL 3GK8H 1J8HE 1A7RL 1JK8B 2NLJA 4OAWB 1IL1B 3BIKA 4KJQD 2EDXA 1KTDB 3K3QA 2E7CA 2UYLA 4ZTPL 1R5IB 2ZUVA 3DX7B 2H2PC 2LVEA 4G80B 1IGIH 3AREA 4ODSL 4XWGH 3BESR 3T0EA 3HZMA 2QADB 2DJUA 1DN0A 4F9LC 2GY7B 3RNQA 1CGUA 5EO9B 1UM6L 4PJBB 1ZHKA 3G5XB 1KEML 1HE7A 1U8KB 5D7IB 1MVUA 3M07A 4NNPL 1W8NA 1I7TB 1EVUA 3CDFA 1FFPB 5TF1L 2OI9B 3E6FA 2QADD 3STLA 3VCLB 4KQ3L 5D5MB 5FF6B 4RNRA 4PJAB 1MFBL 2E7LC 1F3JA 2A9NH 3MC0A 4LCCB 4Z76A 1BZ9B 4FMFA 4M8QB 3OXRA 2GCYA 1AXSA 4KAQH 1PFCA 4YPGB 5ELIA 4OGXL 4M5ZL 3O8XB 3OKDB 2GAZB 3WIFA 3V4VL 1E4XL 1I85C 1UWXK 5EORH 2H26B 1IGCH 4WIQA 4JEGB 4YHLH 1N5YL 3EUUA 2BSRA 4E9LA 1YYMH 5KVEL 4MJIB 4QRTA 4W4NA 2MMXA 3SCMA 3PQYD 1CLCA 3GM8A 5BS0A 3BO8B 2CUMA 3K8KA 5HI4D 1U8NA 5D72L 1JNNL 3ZDYE 4IOFD 2HJKB 4HX1B 3LEVL 3DECA 4JREB 3PGFL 4FFVD 1IM9D 1GGBH 3WFDH 5F97E 4XP9L 2BHZA 2G5BA 2NW3A 4IOSD 4U1MB 3V2AR 1CTNA 3B5TA 3H0TA 4MMXC 5EA0L 5DJ2A 4FQHB 1V8HA 1OGAB 2MNUA 3HFML 2XZCH 4TVSa 1F13A 4GRWB 4KU1A 9CGTA 4UINL 3I85A 1KN2H 4I0KA 1J1OL 1JF6A 4FZ8L 5CINH 5C0BD 3QDGA 2FO4A 4PV9A 5AEAA 3BRFA 4N8VG 1E4XI 2CK2A 4QY8A 5DUBA 5ERWB 5BV7C 5J06A 3RTQC 1C5DB 3MACH 5BZDA 3GHEL 3MRBA 4DQOL 5I75C 4H26B 4OLXH 4TVPE 2IBBA 4LPCA 1C5CH 3RZWA 2E7LA 2OTUB 4PLJC 4LHUD 3KAAA 2CO6B 1WCQA 2J8UA 3NCBB 4BSWB 4FXGB 4YK4C 1URLA 3BRDA 3BGFB 1OL0A 3L7FB 1CFNB 5KG9A 2N4IA 5EBLB 3IFPB 5EU4A 3UBXG 1JGUL 4U3CA 3MRPB 3CMOH 3C2AL 4XHJC 3P9MA 4QXTB 2QSTA 3KPMB 1SJXA 3SE9L 5DGQA 2UVFA 3GIZL 4NNPH 2E9IA 2DD8L 3BXNA 4ZQKA 2R2HA 3MJ9H 3VDAA 4XC1H 3HPLA 3L5JA 3H7BB 5DJ6B 3FL7A 4NQUA 4JO4L 1MCWW 1PLGH 1ZGLB 3IDJB 4X5XA 2Q87A 1D6VL 4BH8A 4FFVC 3EYUL 3LH2H 5HHXH 1TVHA 4KUCF 5CSBA 5GGTA 4PB0H 1K8DA 5ITFA 1HWHB 5SWZA 3QEHB 1KCSH 2ORBL 4BJLA 1KLUA 3ARFB 3FJTA 4NQEA 3GSOA 3HE7A 4PJHA 3U30B 1J88A 4QY8B 5DUBB 3W9DB 4JZOB 3DVNB 1UM5H 2WQRA 4HH9A 1RAMA 5E6ID 1KIQB 1A5FH 5A40E 3ZTJG 3RGHA 2NMSA 5HGDB 5D9SA 4KPHH 2EXYD 4RISL 5LAXA 3RUGE 1YEKL 5I1GH 5ID1B 1Q9KA 2IFGA 4OQTH 2DL9A 4HXBL 3BHBB 2A1WL 5EC1B 3OZ9L 3BZDA 3GMMB 2C1PB 4PV8A 4RA3A 5FYJE 2J8OA 4XNQA 3JWOC 4QXWA 1Y18A 1Q0YL 4UV4H 4LCWD 3TWCH 5EU4B 5GRJL 3ARFC 3NIDE 3TNMA 1HNFA 4POYA 3HR6A 2P4AB 4M7ZC 5FO9B 3VWKD 4ODUB 4K94H 3KPMA 4M62H 3QDME 1FNAA 3U83A 3MV01 1R5WA 3ARBC 3GSQA 3LB6D 1IAIL 3VXQA 2PYED 5JXAL 2AJZB 3WFDL 1TETL 4JGUA 5F8RC 5MENA 2BP3A 1TQCB 4PRHA 5LVEA 1RK0B 1TLKA 1JRHI 3EOBA 3SOBH 2DYPD 2X4RB 4NO5B 3LN5A 1FL3A 4YE4L 1Q8MA 1HINH 3HZKA 1RULL 3CSPA 5ITFB 2P7TA 4L3CA 1IE5A 3MUJA 4RIRA 5I1IH 2WSKA 4MJ5A 3INUH 3MV11 4F3FB 3GSOB 1M6OB 2FHBA 1LO4H 3MYZA 4RX4A 4JZOA 1AO7D 3FO1A 3IDIA 4HKJA 4KKCC 4DZ8A 2LFGA 1AO7A 5FYLH 3MXVH 3KJ4C 4XH2B 5F89B 4PBXA 4I48A 4X6FB 1ZVSB 2EXWC 3B9KA 5MERA 4ENEC 3T1WA 5EBMA 1DE4A 1G7MB 1JYNA 2E3VA 2NYYD 1DQJB 1Q1JL 1FLRL 3GSRA 4RAVA 1IAII 1GGIL 2ZCKL 2XWTB 2VMFA 3DVGA 3RKPA 4U1IA 3EHBD 5DJ0B 4PJGA 3DI3B 5TGBB 3ARSA 3WXWL 5IMMB 1YQVH 2NY6C 4KAQL 2M26A 2A74B 4HK0B 5FYLL 2Q8AH 2CKNA 3UTTB 3VGGA 3M17A 5DRZA 3SBWA 3JV6B 4R96B 5DEFA 1AGCA 3T2OA 3MODH 5CAYB 4OZGE 2W0FB 3NFPB 1FHGA 3ULVC 4B7LA 1IEAB 4I3SH 5CP3H 1DBJH 1A6AA 3RAJH 3CZJA 1XF2B 3K1DA 4ZNCD 1KSRA 4U3HA 1MI5D 5DURD 4ZSOA 3VRJA 1VDGA 2ESVA 3MNZB 4JKLA 5LGKA 1S78C 4YC2B 4DGVH 1OSZB 3IJHB 1WIOA 2H45A 4U0RB 3PP4L 3CFEB 3FQXA 3K1KC 4GKNA 5IROA 4LSUL 3IJYA 3O9WA 5HYEA 3RIAK 3SE3C 3NA9H 4GBXB 4KMLB 3IDXL 3LN5B 4M1GH 3UDWC 1IJ9A 1MREL 2VDNL 4M1DH 3QNZA 3TCLB 3FRUB 2EIZB 3PIQB 1MHHA 5T1LD 3X12B 1KN4H 1WT5A 3IVKA 3RVWC 4QTIH 1REIA 5EZLB 1U6AL 3GB7A 3GGWB 4L1HA 5F7DB 1JPGA 1AGEA 3BP6A 3RVTD 3MRCB 2V7HA 2DLGA 3L3DA 1CGXA 4YHZL 2Q3AA 4ELMF 3F5WA 2WIIA 2F8XC 4P46B 1QBBA 4I48B 4X6FA 3I75A 2D7PA 4QYOB 1NCBH 3JWDC 2R4SL 1QSEE 5IFJA 3S4SB 4OQTL 1CT8A 4XRCA 4N0FB 3ZMRA 1S7VA 1DQML 4C55A 4S1DC 1BJ1J 1I3RB 4NC1E 2YS4A 1C5BH 5FGCB 1HIML 4XPAL 1QSVA 3GSVA 2DTMH 2AV7B 2CR3A 5IJKC 1RHFA 2FH6A 4E41E 3BIKB 3RVVC 4BFEA 1W0WB 4CVZA 3O3AB 4F7CB 3MLPA 2C9AA 5C8JA 1UZ8B 2GJ6B 5BJTA 5C2UB 3QDAA 3MRRA 4LSTH 1DN0B 2R0KL 3FTGA 3CH1B 3PL6D 5J9PB 4P4KB 4H20L 1TTGA 4G8GA 4NZUH 3OAYH 3LD8C 4WHTB 5C6TL 1XH3B 4KK8D 3BH9B 3CC5B 4X4ME 3QO0B 4HQQL 4XTRC 4Y5XA 3C8HA 1MCPH 2XTJB 2J12B 2IG2L 4Z76B 3OR7A 2HT2D 3OPZL 2C1OB 4M6OH 3GJFA 4RCAA 4PREB 1Z2KA 4NO0B 3X12A 2DQEL 4FNLH 3U0WH 1AR1C 1QSEB 1MJ8L 2EDNA 5EZLA 4K7PL 3LKQA 1BM3L 3JTSB 4KFZC 2YUVA 4NJ9L 4XVUC 4QRRD 2NY1C 5EBWB 2BOCA 2EEDA 4OSUL 4LPYA 2VR4A 4MCZB 4PY8J 5E99H 1JNLH 4JKKA 1ORSA 5HPOA 4ETQA 4UV7L 5CEZH 3BP7A 5HHOB 3VFTA 1BOGB 1PD6A 5L7XL 5IFJB 5C0FB 4PY8I 3O4LA 4XRCB 3ARGD 4AMKH 3TO4B 3SKUD 1F3DH 2FD6H 5JXED 2FD6L 4GSDH 2W1NA 4UINH 3H0TB 3ARUA 4MB5A 1VEMA 1U2HA 3M45A 3O2WH 4PJCE 3BT2L 3GKZA 3M1BB 1FN4A 1JF5A 5D1XC 3ZE2E 5JOEA 4JQIH 1YPZA 4RAHA 1ZVYA 4NUGH 3DURB 2Q3ZA 4CN6A 1B0GA 5F7YC 3RGVA 4FTVE 5BJTB 1C1EL 2XTJE 2W91A 4MA7L 4NN5C 5F1IB 4EI5A 1J1XH 4Y16D 1IGCL 2AQ2A 1P4BH 3GI9L 1HN1A 2HLFD 3NTCL 3VXRA 2P5WE 1A6TA 4OGYL 3CVHB 5T3ZH 4BQ6A 3QI9C 2X1WL 4J8RB 3NCYS 1SYSA 3LN9A 3SDDD 4NPYB 2YD8A 4XMPL 3RWHA 3P2TA 1S7UA 4QNPE 3QI9D 2OBGA 5EC2B 1WBXA 4W6WB 3FFDA 4WUKL 1QA9A 3D2UB 4UTBH 5D70H 5TQ0H 1EK3A 1I7UB 3GSWB 3MRIB 4ONGH 1FGVH 4G43A 3Q0HA 1QSEA 3TYGH 5B3JF 3JBG7 2JK5A 4M7LL 5GIRB 1UM6H 2ZNWA 3E1F1 2O5ZH 1IGTB 3OKYA 4R4BA 2EYRB 2P44B 2CDGB 1A6ZB 4E0RA 4KI5C 2P42B 3MV9A 3MBXH 1ORSB 5I75B 2VXQL 3MLRL 2APTA 5C0GB 1MCHA 5C0FA 1FNEB 4YXKL 2AEIT 2B0SH 4PLKC 1FL5B 1I1AB 1HILA 4PRDA 4APQA 5I8OL 1KGCD 3MLWL 1B4JH 2HWZL 3FO0H 1U91B 3DROB 1QBMH 3TFKD 3VXME 3BP5A 3P11H 3MOAL 4K7PX 5EO0A 1RQ5A 2VAAA 1YECH 3T4YA 4L4VB 4LU5L 5J3HD 3ARDC 5CILH 1S3KL 5FA4B 1B0GB 3RGVB 3MA9L 4AIZB 4LEOA 4ZMAT 4PJ5A 4ZTPH 3PL6B 5F1IA 5D6CB 3FT2B 4HAFA 3EJZD 2HRPL 5KVGL 5ADOH 3C5ZD 4JM4L 5DVNA 4P57B 1U3JA 4G9FD 5TE7H 3QULB 3WHE1 3RPKA 1GOHA 2DIBA 4PRPB 4GXVH 4BFIB 4RBPH 1T2QL 4WU7B 5CJOH 2G2RB 4OLUH 4EIGB 1WBXB 4BQCA 4JN1H 3GMMA 2C1PA 1FVDA 3QQ4A 3NA9L 5BQ7B 2I27N 3GI8H 5I8EB 4NNYB 5ADPL 3HG1D 5IMKB 4JE4B 5D7JD 1MCDA 3TNMB 1MCJA 2J2ZA 4PGEB 3W39B 4WTZA 1X4YA 1HHGB 1N2RA 5FO9A 4RX4D 3UZQA 3FN9A 4H1LH 1FO0A 3I9GL 5DT1L 5GSVA 2DDQH 2JJTA 5C08A 5DEGA 5CJ8A 4XC3L 2EDOA 1YECL 3C87A 5CJQL 2NXZB 4PJHF 4RMUA 4LPWA 1IILE 2A2QT 3DOSA 3IJSB 4BA8A 3PP4H 2GHWB 4KI5D 5BO1L 4PRBA 1YMMD 3IFNH 5CEXA 1HILB 3VI4E 4MXWL 3RTQD 1A7BA 3VFVB 1D9KC 1K8IB 2OJEA 3IB4A 1H8SA 1QTYT 4FQ1L 1Q38A 2B5IC 3CUPA 5C6WH 1JI1A 1OP5K 4HBQA 4D94A 4ZUTA 5GGVY 4KKNA 2WUBH 3QFJD 3WYRA 2FLRT 2EYSB 2E8ZA 3QIWD 4L9LC 5FKAB 4MJ5B 4KTDH 4RZCB 4GQ9L 1M6OA 2FBJL 3X14A 5L0QC 2FX8L 3VFPA 3S9DB 1G0DA 4XGZA 4Z7NE 5KJRH 5F9OH 2NXZC 3STZB 3WXWH 1WZLA 4MVBC 5SWSE 5I6XC 1N0LA 3T08A 5TE6L 1IQWH 1G6RH 3TCXA 1N3NA 1B2WL 1BQSA 3OL2A 5E2VL 3ES6A 3VFWA 4I18C 1QD0A 3NCCB 1F6FB 5K9QI 1RMFL 3L3GA 5I8KH 4MLIA 3RBSA 4QWWD 5D96B 3T2PA 1TIUA 4KROD 4JO2H 2MPAH 1FYTB 2CK0L 5BQ7A 4L9DA 4MDJB 3UEZA 5IMKA 2YC1B 4K23H 3MJGX 2FR4B 4Z7VA 1IEAA 3BP4A 4P48A 1RULH 2Z31B 1SEQH 5C2BH 1EAPB 4JB9H 3QI9B 2MTPA 2X41A 3LKPA 3QDGD 4Q6IA 4U3XA 4TQEH 2OL3H 4NSKB 5T3XE 1I9IH 2CDFA 4RWYL 1EHAA 2BCKB 5DF0A 3W2DH 4EKXA 1AKJA 1YJDH 4L29A 5DLML 1KYOJ 3QEGH 1JZ6A 2P5WD 2VR9A 1BVZA 2GTZB 1Q9WB 5DD6B 4K3JH 3GEWB 3TNNA 4JN2A 1P1ZB 3GSNH 4AIOA 2FB4H 1T1WA 1HXYA 2HFGL 4QTHA 2DQEH 4GKZB 3GIVA 5CZVL 3P30L 2YD2A 4EN3B 4L8CB 2MWCA 2YUZA 4F7EA 3DLQR 4YDLC 3MR9A 2XT1B 2VH5H 2VQ1B 4MAYC 2V7HB 4K55A 5IBLD 5FA3A 1Y6KR 4PJEF 1Q72H 1GAFL 2VAJA 3U30C 2H1PH 1QQDB 1MVFA 1INQB 5D1ZA 1LO3L 2HT3C 5L88H 1RUMH 2BNRA 4YAQA 5IBLC 2V5TA 4HAGA 5J12C 1AI1L 3SO3B 4AG4L 4N0FA 3BDXA 5H94B 3ILPB 4KHTH 2FEDC 5CILL 1T3FA 4QCIA 3T3PF 2Z0BA 1HHHB 2QSCH 2JJSC 1A0QL 3KDMB 5IB3A 2GK2A 4Z8FH 4Z7OF 2BVUA 1CE6A 4G42B 3BUYA 3ZL4H 5KSBA 3LPFA 1BZ7A 2DYPB 4IIQB 3EFDH 2BJMH 1A7PH 3BPOB 4HWZA 3K80A 5JR1L 3SPVA 5D6DC 1T0NA 4M6AA 1EMTH 3T0AA 3MJ9L 4U6YB 1UYWL 4YBLB 3D3VB 3RL1B 1BAFH 3I6GB 4P4KA 3DXAA 1LNUB 4UUJB 3TJHC 4AEEA 2R15A 4F7TB 4TVPL 4ZFOA 1UCTA 5IGXH 3RU8L 1DBKH 3MRLA 2XPGA 5DI8B 2M1KA 1A7PL 2CRMA 2IAND 1VKXB 1Q9WA 4JFFB 5DD6A 5CGYC 1HQ4A 1FZMB 4X4XA 2BSTA 3GIZH 5C71A 3RQ3A 1W72L 3RVWD 2HFTA 1S7TA 1D5BB 3T77B 1MEXH 3GJFB 1ZANH 1Z9MA 2AEQL 3LEXB 3RVTC 1I7RB 4J3OC 2H3NB 2Z92A 5F7WC 1PAMA 1E6OH 3GNML 5CWSB 4OZIF 2BSSB 3QUXA 4OCRH 3V6OC 4X7CC 5EBWA 3DGGB 1ZT4B 3N85H 4HJJL 5DVLA 3BN3B 3MLSH 1OAQL 3QPQC 4M61B 3L5WB 1VGEH 2HYMA 3BZFB 5D1ZC 4YJZL 3MPCA 1LE9A 1RI8A 4JG0H 2NX5D 4ZO8A 1YEFH 1SMOA 3CFIC 5DZNA 3ILPA 2ADGA 4CW1A 2NY5L 4U6XA 3TH2T 1NAMH 5IB3B 1YEDB 4PB9L 3GMQB 3I3BA 4HUXB 4X6DB 3QIBC 1XZ0A 5T1MB 5KSBB 1P4LB 1KT2B 5LCVH 3ME0A 2H8PB 1BFOB 1DBJL 5F7FA 3RX5A 1NLDL 4OZFH 5D7JA 4D3CL 5E6IA 5IKCA 1I9IL 2QBWA 1KFAH 4IRZH 3Q6GL 2VDPL 2BOBA 1FBIH 4EUPA 5DFVC 2F8VA 2H32A 3HUJB 4IDLA 5IVXE 1XGRA 5IB5B 3GDBA 5HGBA 4YWGL 3FQRB 3OGCA 4JG1H 3G5YA 5H35A 2DQJL 5I1JH 4WY7L 2X4NB 5GGQL 3RTQB 5IIEA 1IGMH 5GGQH 3F7YB 1BQLL 4NYLB 4TVPD 1S7TB 1D5BA 4LCCC 4JHZA 3CFCL 4WI4A 4MSWA 4ODVL 2NY1D 1CFSA 3U7AA 3D5OF 3P4LA 5CEZD 3RHWF 3MJ9A 1X7QB 2HFEB 3CDGB 4KI5E 3QUXB 4UILH 1AGDB 1Q9OB 1RZKC 5C9JB 5TDNA 3R06A 1ETZB 3C60D 2VL5A 4L3EB 2IAMA 4U7SA 5F9OL 4WFFE 5F1OB 4NC0B 4I4WA 3D25A 3K2MC 2BNUA 4LSTL 1S9WB 5F7LB 4Q2ZB 1EX0A 1KENL 5IB4B 3B6SB 3QPQD 4MXWH 1U8MB 1HHJA 3OKKA 1I1AA 5GRUL 3BPLB 1OAKH 5IVXA 5I8CA 3MLUH 4G7YH 2BNQE 1QNZH 5I18H 2EYTA 3KYMB 4UV4L 4Y0GA 1KPVB 2FATL 1C12B 1YA5A 5JW3L 2AK1L 4F8QA 1Y6NR 5DHVB 1PDKA 5HGHB 1RZJH 4OB5H 5IW3A 5HI4C 4LEOB 4PJ5B 5E5UB 2Z35A 2OYPA 2WZPD 2JB5L 3PNWA 5HHME 2EDHA 5IFHH 3K74B 1JTOA 3GUTB 1K4CB 2ITCA 2V2WB 4G6KL 1ZLVH 4FQXA 3HUJA 4XP4L 4GG6F 1QLEH 5EDXA 1XGRB 5IB5A 4Y5VA 4FQXD 2R2EB 4JPVL 3L7EA 4WFHD 4JR9H 4LVOB 3UC0L 1VFAB 4OLZL 3ZT7A 2Z8VC 3BPLC 3FB6A 4X8XA 3RTQA 3CD4A 4U4BA 1CGWA 1QR1B 1G1YA 4ZAKB 5F7MC 5J89A 5IESH 4R6UA 4H8WL 4RGMB 2JJVA 3D85D 4Z78A 5SWSB 4MSWB 1N59B 5ACZB 5DK2A 1X7QA 5C0EB 5GRUH 5D6DA 3DYPA 3GSXB 5D1XD 1IMHC 1S9VA 1WVZA 4ETYA 1BF2A 5C08B 4L3EA 3HG1A 1RZJC 4QOKE 5TDPA 3LKSB 2ERJB 1AHWA 3B6SA 3MNVA 4LDOB 4XB7A 1QHOA 1I3GH 1UZ6E 2VABB 3FT3B 2OJEB 2WP3T 2OL3B 1PKOA 4L4TD 5HYFA 1LMKA 3S36X 3TO2B 3BEWB 2OMBA 2LQRA 2VUYA 3L3KA 3MLXH 1TQCC 4XXDB 5HI5C 2AJSL 4ZFOL 4ZOBA 2FX7L 1MRFL 3CXHK 1F8TL 2RFXA 3OJDA 4IRJA 3V4UL 1HQRA 5KSBE 5D7KD 2ZUYA 2DF3A 1DCLA 4NUJA 4XGZB 1CGTA 1NUDA 4N8VA 2Q8BH 3IXTB 2VL4A 1KJ2L 3RZCC 1EFQA 5MEPA 4FQXB 4X0KA 4D0CA 2YN3A 3HPJA 5KVMC 5CCKL 2NY2B 2CRIA 1DP0A 1J0JA 4I8DA 5F9WB 1GHFH 3MUZ1 4TULL 4Y4HD 1X5IA 3VFWB 2GJ6E 2O5YH 1SY6H 2I5YL 4Y4HA 2VDRH 3GKWL 3B4NA 4LFHD 2R9HC 5MI0C 5MEQA 3WJLC 4CDHA 3VGFA 5E8DH 2W9DH 3LS4H 4MA7H 3RUGF 2YC1A 5FYKD 1XFPA 1WZ1H 4M4PA 1H15A 2ZG2A 4AEHL 4YDKL 3AREB 4YDKH 3WNLA 3VDBA 4NM4L 2R69L 3PF2A 4MJ6B 3I3EA 3CFJB 3G5XA 3NACL 2X1XR 3HG1E 4NNXB 2R23B 4WI2A 1J87A 4I77H 4Q6YA 5EZJA 2CDFB 5GRVL 3ULVL 3H3PH 3MREB 1LK3H 2YPVH 3LVEA 4OLVH 3QA3B 5F9WC 1AH1A 4I18B 1AKJB 3TJEL 4HFWB 3LPWA 4OLYL 4HC1L 5E00B 3QEQD 3BISA 1ONQB 4IOFC 3K8LA 5IHUL 4UU9A 3U46B 4NC2B 1P1ZA 1U42A 5F7HA 4EUPH 2X4OA 12E8H 5JUEH 3VXRD 5IW1A 3WO3B 5E99L 3DTXB 5DA0B 2GSIB 4DAGH 3GIVB 3MLZH 2X9XA 2VDML 1CVSC 3V52H 1Q94A 1WTGT 4HWBH 3HI1B 4Z7VE 1RFDL 3WFEH 5SWQA 1EDQA 2IBZX 4Y8DC 5JHDA 1QZ1A 1YNTA 5CEZE 2IANA 2FX7H 3T0EC 3MUY1 2HFFA 1ZV5A 4MHHI 1T83A 1ZTXH 1EHLH 1OTUC 2P8MA 3HPJB 4NO3A 2BNRB 3O9WD 4H20H 3LS5L 2X7LA 5KVDL 4LCYA 1U8QA 4B53A 1BGXH 1U8JB 4Y5YA 4X5LA 3DBXA 1J8HB 2BJML 2LU4A 1ZLWH 1MJ7H 1HHHA 3MOQA 5MEQB 3SGEH 2WWMD 3BJ91 4KVNH 3IYLW 1UYWH 2FWOB 5IBTL 2R0KH 4Z7WE 3IKCA 3WFCL 4P2RD 3QUXD 1A1OA 4FTVB 5EIQA 5GS0D 2EXWD 4QGYA 3WCYA 2V7NB 4WI6A 1HDMA 3GMRA 3SE9H 4QTIL 4U0QB 4X4YA 1OP3H 2R23A 4JGJA 3ZLQC 3DO3A 5HHMD 3TYFB 4QRUB