1NMBH

The structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
QVQLQQPGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (hydrolase/immunoglobulin)
molecule keywords N9 NEURAMINIDASE
publication title The structure of a complex between the NC10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the NC41 antibody
pubmed doi rcsb
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmbH00
4AL8L 2OM5A 3V6BR 3UX9B 3QNZB 1Z9SA 3RY6C 5C2UB 4U0RB 4NYLB 2BRQA 1E4KA 2YHGA 4Z7VF 3S88H 4R7NB 3WUZA 5F1SA 4MQTB 3GJEA 3VA6A 4MNQA 1I75A 3VFWB 2ZCHL 4ZFFB 4NZTH 4X9GA 3FAXA 4GAYA 1SM3H 4WY7L 3DYPA 2ZJSL 3UZEA 2BHUA 1I3VA 4TVPE 4W81A 5T1MA 1BIHA 3C87A 3IXAB 1BP3B 3ULUE 4WFGD 1WFNA 3DECA 4MAYA 1VFAB 5F7FA 3QHZL 4AIXA 4NRYA 5IK3A 1KCRH 4ZFZA 3S96A 1ONQA 2APBA 3HA0A 2D9QB 2VSDA 4KROC 4OTXL 4ZTPL 3QQ3A 2FB4L 5EA0H 4N5EC 4RFOH 3IDUA 1QSEA 2VKWA 5B3JE 4HIHB 3VI4F 1IEAA 4LKCA 1OT2A 1UB5B 1JMXA 4LAQH 3OKEB 2VZ1A 5FA3A 4LBEB 4NC2B 5IEKA 5JLZB 2X4SB 3BD3A 2NTSP 4Q6YA 1D6VL 3ZDZE 3QG6B 1MHHA 1QRKA 2YD5A 2IH1B 3D3VA 5I1DA 5LCVL 3KPPB 5FGBA 3SCMA 3AREA 1PX4A 1L7TH 3AB0B 3K7UA 1Y0LA 3RU8L 3I6GB 3ZZ1A 3O8XC 1EUUA 1IKFH 4ALAL 3FN9A 5I8OH 5HDBF 2J1KA 1IGTB 5GISH 2R0WL 3LN5B 4YHZH 1GC1H 5HHQB 3MV8E 5E95B 3ORJA 1B3JA 1TJIL 1FV1B 4Z7UA 5DS8A 5C9KA 3GB7B 5DDHB 1S7WB 1EEUA 1HXMA 1YJDC 2JIXB 3S3JA 5HGBB 4ERSH 5IB3B 4OFPA 4P5TA 3BGMB 1N7ML 2FEEL 3VGGA 2Y7QB 1M7IA 2NPLX 2R2CA 3EDFA 1FE8H 3IF1A 2AK4E 5CP3H 3VH8B 1MQKH 3VFTA 2F53E 4LNVA 3L5XL 5D5MA 2CLZB 3DO7A 3MROA 4X80L 4U1SA 3VXRA 2GJZA 1L7IL 5HHVH 4HEME 4IRSB 4U1GC 3MJ9H 4W4OC 1FPTL 2EDFA 1JHKL 2UUDH 2CLVB 4LSPL 3OB0K 4QHMB 1BIIB 4DW2L 2MKLC 4K8RL 3SDAD 4KAQL 2F54E 3UAJD 4LDLB 4CJ0A 4TSBH 1BD2B 3PWUA 3L3KB 3QDGB 2BSSA 3UYPA 1JNLH 2NY0C 1XGRA 3O3AB 3FONA 5TE7L 3UPCA 3ISWA 5EOQL 2BJML 5ESAA 1CFTA 5SX5K 4XP4H 1S9WA 4I2XE 3ARBC 5D2NA 1Q72H 2CK0L 3ARQA 3HC4L 5CGYD 5JR1H 4JG0H 3GJEB 4QWWD 2C3VA 5FYKE 1NDGA 2HT3D 5GSRB 4FABH 4LMQI 5D7JC 4GAJL 3QUZC 2F15A 4PJ8D 1Q9WB 3SE4C 2HT2C 12E8H 4GAYB 1EK3A 5T1MB 2DL2A 3MACL 2ZOLA 1V8HA 2VN7A 4HIXH 5I1AA 4MAYB 1DQDH 2VR4A 3RIAK 1P9MC 3EYOB 3DOSA 3DSFL 4NRYB 5IK3B 5CKAA 1GXEA 4S1SH 5BVPH 3BEWB 4ZFZB 5L0QB 3S96B 2QADC 1ONQB 1YEKH 2A9ML 3PWJA 3V5DA 1MI5D 2BOBB 3PHOB 3B6SA 3MYZA 1X4YA 2X09A 3O4OB 1TNNA 1A0QH 1KB5A 4KZDL 4QRRA 5J6GB 2C9AA 1KPRB 1PKOA 4ZFGL 1N0LA 3MFFA 1IEAB 3U36B 3ZTNL 1MFAL 1FLRH 1GSMA 3VFGH 2EO9A 2HT4C 5IMOA 1LVEA 1QLEL 3KPRA 5FCUH 2EE3A 5FA3B 2DDQL 4JQIL 6FABL 5IEKB 4L9LB 4X7DC 1BVKA 2BY2A 5D7IF 1MHHB 3V4VH 4K7PL 4JQVC 4F80A 3GSQA 1IM3B 4J4PA 3D3VB 4YFLF 3CDYA 1FBIH 4HSQA 5I1DB 3O6FC 3SCMB 3AREB 4NWTH 5BMFH 1HZHL 3GMNA 5J12C 4CNIA 1LO0H 1Y0LB 2HJFB 2J5LB 3S6CA 1IGYA 4NQCD 1F2QA 4P23D 1DP0A 3QUXA 4P0DA 3QEQD 1TVHA 1I8LC 3V0WH 4P9HH 1UZ6F 4LU5L 5BS0B 4RX4A 1DBAH 3RP1A 1Z5LA 1T7XA 1OTUD 2DD8L 1VPOH 5D1ZC 3U1SL 4WI5A 5FYJU 2W0KA 4PREA 1KC5L 2HFTA 5EU5B 1MRCH 1NJ9A 4Y1AE 4F33A 5DI8A 5GHWL 4Z7UB 2ORBL 5TPWL 5EU6A 1RIVL 5GIRA 1L6XA 2C4FT 3EFDH 1HXMB 3L9RA 1YEFH 2XN9D 3G6JF 5JOEA 5I75C 4NFDA 5DMJB 4XHQA 5C0JB 1QA9B 1M7IB 3SN6N 1F3DH 5CCKH 1KLFA 3GHBH 5FYLE 3VFTB 1IC7H 5D5MB 1SJHA 2AJYL 2W9DH 4NCDA 3DO7B 3MROB 2F9BT 4R26H 3SO3B 1LP9F 1W72H 2O5YH 4U1SB 1CZ8L 2GJZB 5DJZA 3VGFA 4EDWH 1AKJD 4MD4B 2HMID 4OCWL 1YYMH 3TVMC 5A3IC 4JQXC 2YMXH 3SJVA 3T0DA 3QEUB 4U6XB 4M48L 1X5AA 5L2KA 2NTFA 4H0HB 3PWNA 3HG1D 4OAWA 2XWBA 5T3XE 2NY5H 2EDJA 3PWUB 4J3TA 2BSSB 5EBGA 1KEML 4P2QA 4W6XB 1XGRB 3FONB 4YO0A 1EIBA 1ES0A 1ZHLA 1MCCA 5ESAB 1JTPA 5IESL 4IIQB 4JN1L 3QQ9D 1AGBA 5HHOD 1S7UA 3VD5A 4WEBH 2FATL 3T0XA 5D1QB 1A7QH 4PJ5D 4AY0A 3NACH 1QP1A 2C3VB 5EO1B 1EEQA 1NDGB 1P53A 3UTQA 5KZCD 2ZNWA 2EE2A 4LVHB 5IHLB 1KB5L 2D0GA 4F9LA 1IEBB 4BKLA 3Q5OA 5CP3A 3NA9H 4UBDD 5BRZD 1OGAE 2ZOLB 1TQCC 3ARRA 3KPSD 4N90D 5I1AB 3EFFA 4U2ZA 5DHYB 3TBYA 3MJ9A 4JFPB 3BPOC 1OWRM 3FL7A 4EUPG 2ZCKH 4Y5VA 3RPIB 1UXWB 3PWJB 4YHYB 3D39D 1D5BA 3NGBB 1EJ6A 4N8CH 3B6SB 1H3PH 4P9MH 2DWEA 3C6LD 1KB5B 1KNOA 2UWEB 2ZWLT 1SM3L 4N8PA 3MFFB 3IGAA 3NH7L 5C71A 3NIFE 5IMOB 3WMSA 1DUYA 3KPRB 4F9PC 4NQED 4NQSA 1NCCH 3MBEA 2R2EA 5MI0C 1ZGLA 3SGKA 4ONHA 4OD3H 4PV8B 1MVUA 1BVKB 3EUUA 3RPKA 1MY5A 4WTXA 3L3HB 4YK4C 3UPRA 4NO0A 1LP9A 2VO5A 1GJIA 4Y4HC 5EA0L 3MRIA 4RFOL 2Q8AH 5A2KH 2ENSA 3GMNB 4CNIB 4RBPH 1GZPA 1CDIA 4QT5A 1P4IH 1J86A 2CKBH 4LAQL 5GGRY 4I18C 1TVHB 5E94A 4MA1B 3E1F1 1EO5A 2EICA 4KKLD 4U3CA 5IBUB 4QNPE 7FABH 4Z78A 3ARFC 1I7UA 5F7UA 1H8OA 2FWOA 3QO0A 4G8GA 3U2SA 1EA9C 4OT1L 5HHXH 4G6JH 1NJ9B 4F33B 5DI8B 3MA9H 2FECL 4V1DE 3NZ8A 2DLTA 5EU6B 3EW3B 2EECA 5KS9E 1C1EH 1KXTB 2DQUH 4JCLA 3D85D 3L9RB 2O93L 2AW2A 1E28A 2DS4A 3C6SB 4XVUD 1IC5H 2K3TA 3I84A 2PNDA 2J7LA 2EYSA 2X9YA 3UZQA 2E6QA 5CP7A 1IKFL 3LQMA 3R0MA 4A2MA 5I8OL 5GISL 1SJHB 4YHZL 1GC1L 5DC9B 2BVQB 2GYSA 7CGTA 4JRXB 5DJZB 1JPFB 1IC4H 3SKJL 3W0WA 5IHZB 5LGJA 3OX8A 5DXWA 3RKPA 1OAYH 4KGJA 1DN2A 2GUOA 3O6KH 5CJBA 5LXGH 2EXWD 1UGNA 1FFQA 3PWNB 1SJEB 1NANH 5DVLA 1FE8L 1FNGA 5EOCH 3QDJA 1JP5A 1U8PA 2IPTH 1XF4A 1OAUL 5IIEA 1MQKL 2IANE 3MRQA 3S3SA 3X12B 5ADOH 4P2QB 4GRWE 3GMPA 5AZ2L 1A9EA 5C08E 5E99H 4E41A 5D70L 4XZUB 5HHVL 3RJDA 1VSCA 5CJXA 3MJ9L 5T3ZH 2R8SL 4JO1L 3CLFL 1ZS8A 3S9DB 1S7UB 1UM4H 1P5UA 4GRMA 4YHPB 2AQ3A 4G9FA 3D48R 4JDVB 2YPVH 2DIAA 1OSPH 3O0RH 4X4YB 2BFVH 1A7OH 1FVCB 4TSBL 3D0VA 4P4KB 4Z7NF 2VLRE 5BQ7A 1JNLL 1NFDB 1KJVA 1QFOA 4HIIA 5I8CA 1W72A 3RQ3A 3TJHC 4XP4L 1AI1H 2BVPA 2NZ9D 4S0TD 1RIHH 2BY0A 4RGMB 4RDQF 1Q72L 5JR1L 1G7QA 4JG0L 4UOJA 1D5BB 5FGRA 1MFDL 1YMHB 1G1YA 4D9RE 3A6OA 5DMIL 1KNOB 5JW4Q 2BOCA 4HS8H 3HPLA 1S7QA 3IGAB 2F5AL 1YJDH 2EC9T 4P2CG 5CEXB 4D9LH 4DZBA 4NQSB 1S9XA 2R2EB 4TTDC 1ZGLB 1FO0H 1I1AC 1JGEA 3I6LE 4ONHB 1DQDL 3GHEH 1FAIH 4MLSA 3PQYA 4WVRA 4Z5RA 5BVPL 1YEKL 4JCMA 4QXTB 3UPRB 4MHHI 5B4MC 5DJ0B 3MRIB 1A0QL 3QNXB 4NRXA 4JJ5A 5DD3H 2YEZA 5EFIA 1LQSR 3T65A 1WIPA 4MQSB 4OJFH 5FCUL 4N1EA 2EE9A 4GBXC 5KSVA 1TTUA 5EIQA 3MCLH 3JV4B 5H37H 5E70A 4GG6B 3NN8A 4Z78B 3LRSB 1CIUA 4QHUA 5HY9A 1DZBA 2APVA 3V4VL 3BUTA 4G8GB 3U2SB 3O4LA 1FBIL 3OB8A 4O51A 4NWTL 3NZ8B 5BMFL 2Y5TA 3CFEA 2ICEB 1YMMD 4X8XA 3ARZA 4XGZA 1LO0L 3K8MA 4NZJA 3GIVB 1WFUA 1E28B 1GGCH 1OCWL 1U8OA 5IF0A 1A7RH 5C0BA 4JANA 4OLUL 3V0WL 5KVGH 4C83B 5HJ3A 5HI3C 1OP3K 1CE1H 3C5ZD 4NJ9H 1NAMH 1VPOL 1F4AA 4ZPVA 3UDWC 2YPLD 4KJPC 4D3CH 2KH2B 4YAQB 3V7AE 4C58B 1F6AA 1MRCL 2JJTC 2OZ4L 2DMBA 3QXTA 3VWJC 3W0WB 1J8KA 5LGJB 1SJXA 1XGUA 3OX8B 3LKPB 3VFUB 2X4NA 4Y8DC 5CUSH 4M3KB 4N5UA 4QYOA 3QIBC 1LWRA 2GUOB 4LHUA 2CKBA 1NUGA 1YEFL 2HFGH 4WHCA 2V9RA 4XB8A 4TYUA 5FUOH 5EIVA 2RB8A 1FNGB 2LAGB 1FYHB 5D8JH 3QDJB 2AKRA 5SV3A 1U8PB 3GHBL 1XF4B 2VLMD 5IIEB 3MRQB 1P4BH 2EE6A 2CUHA 4FQXA 1SHMA 2W9DL 3GMPB 1A9EB 3QA3B 4R26L 2O5YL 4EDWL 4F7MA 4X6CA 2ESVE 1DFBH 2DL9A 3KXFD 4ZSOE 5ID1B 1EEYA 3DIFA 3GI9H 5DC0A 1KLUB 3VXNA 1YYML 3S97C 3ROLB 1K9TA 2YMXL 4H88H 4LLDB 4POYA 1NCBH 1F42A 4PUBH 1BJ1H 1JNHA 2PYEA 3N06B 4PRNB 4FP8L 1CFSA 1IGJA 4I3SL 4ACPA 3BIKA 5HHMB 5KANI 3U79A 1A3RL 3D0VB 1QBBA 4XAKD 1YPZE 2NY5L 5BQ7B 4Q2ZA 5F96H 3SDXE 5D1XD 2Q3ZA 2XWTA 4HIIB 3RVVD 4B53A 5I8CB 2VDQH 4UIMA 2Y06H 3GFUA 3D5OF 1FDLL 4WEBL 1MWAH 2D4FA 5SX4I 2E9WA 4LVOC 3NACL 3TIDA 4QHLA 3SE9H 3RWJA 1JV5B 3MRGB 3DTXA 2DLGA 5KVFH 5EH1A 3UTSD 5SWZD 3V7AG 4BQ9A 1G7LA 1JWUA 3VXME 1O0VA 4WUUA 3HPLB 1FFNB 4OD2B 3NA9L 4QHNA 4NKDB 4JDZA 3LEXA 3RZCD 1D9KD 4DZBB 5C0DA 1IILE 1S9XB 1CLOH 3HR6A 3WUWA 1OARH 2YOCA 1G9NH 1MI5B 3HI5H 3GSNH 2OTUA 3GSOA 1NMCB 2XV6B 3QPXL 2VQTA 4DEPC 1GPOH 3DETC 1LO4H 1WSST 2OQJA 5FGCB 3QCVH 2BNQE 3U30C 5MENE 2WLYA 1S7RA 4PJCF 3RNKB 4N8CL 1H3PL 4P9ML 4NRXB 3UO1H 1QNZL 4DZ8B 4KMTH 4JJ5B 4UNVA 3MGAA 5EFIB 2HJKA 3VD9A 3T65B 4M3JA 4HUWA 2QSVA 1ZLVK 4JHWH 5KSVB 1CICD 2H6PA 3NN8B 3BPLB 3KNBA 3DGGB 4OD3L 4QHUB 3VFRA 5HY9B 3O8XA 3RKDC 1A2YA 5E2WH 3BD5A 3H9SA 3D2UA 4FMFA 5ID0A 1ZWIA 3O4LB 5C0NC 4JFDD 1EPFA 2NY4B 5DO2C 3FQTA 2DQEH 2Q8AL 2EYTA 2JB6B 3MO1A 5HI5D 4XGZB 5E1AA 3THMH 1HSBA 5ECJE 1P4IL 4X7SH 2CKBL 1U8OB 5IF0B 1MCJA 3HUJA 5C0BB 2G60H 5HJ3B 1OTTC 1FO0A 7FABL 2VABA 5C6TH 3FB5B 3CFKA 3C8KA 2MTPA 4R97B 3VW3H 1YA5A 1WQVT 3BP5A 4P3DB 5HHXL 1F6AB 5I9QB 4XT1C 3EJYD 4U6YB 3E6HA 4W4OA 5DF0A 4CL7A 2FHFA 4ZYKA 1XGUB 1A6PA 4Z0BH 4D0DA 3KJ4B 2X4NB 4UTAH 2QHRH 2DQUL 5J57B 1N4XL 1T0PB 5GGSA 2CKBB 3TZVA 3S37X 3G9AB 2CRYA 3O2WL 1IGMH 1IC5L 1ZSDA 3LRGA 2WQRA 5CZXD 1ZA6A 2AKRB 3MV9A 1AKJB 1V7MH 3RWEA 4FQXB 4KDWA 1LK2A 5KSAD 1BREA 3P30H 1IMHC 2VZSA 4F7MB 4LRNH 1IC4L 3SBWC 5C8JA 2VN4A 3DIFB 2ZOKA 2AJXH 2YD7A 5J3HD 1OAYL 3BDYH 4KXZH 2OX5A 1L9MA 4HJGB 5FHAH 4P2RA 1OW0A 4XMLH 1PSKH 3O6KL 2AJZA 5D7JA 3QUZA 1XCQB 1JNHB 3IFOA 2PYEB 5LXGL 1TJGH 4ZS6C 1CFSB 2IF7A 2UVFA 1P7QA 4X99A 4ZUWA 1EBAA 3SE4A 4HULB 3MRJA 4MCYA 5EOCL 5HDQH 1NAMA 4XI5D 4ZOBA 4PRIA 2J6EH 2D4DA 2LTQB 4PBXA 4PJ5B 2XWTB 5E99L 1J05A 4UIMB 5E03A 4U4BA 5T3ZL 3WHXA 1RULH 2DMKA 1Q94A 5EPMA 5BOZG 5JW3H 2EEAA 1HXYA 3O6LH 3TIDB 2YPVL 3DTXB 1FSKC 1OSPL 3KJ6H 4UV4H 2AS5M 2BFVL 3D69B 2YXMA 4U1LB 2VIRA 3FQXA 1A7OL 4WUUB 3FKUS 3QUKA 4FHBD 2IBGA 4QHNB 3BWAA 4K9EC 5D72L 4AEIH 2X1WL 3H0TB 3WUWB 3D39B 1BGXH 1KPVA 1MAKA 1NC4D 4L5FL 1AI1L 1VACB 3BP7B 2OTUB 1RIHL 1WC7A 4S0SD 5JQHC 5L8LB 4JQVA 3CX2A 1JPST 2OQJB 2BZDA 3OG6B 3O6FA 3NIFF 2R29H 4KY1L 2PO6C 3R06A 2QKIA 2XZZA 3MRRA 1JNNL 3HAEH 4NQEB 5FM4A 3OJVC 1I8KA 5KAQG 2RAMA 4HS8L 2HJKB 1GGUA 5E24E 4HUWB 3WFCH 1QQDA 1CVRA 1AO7E 4D9LL 4MXWH 1I8LA 4WO4D 3TPUA 4YDVA 3I85A 5BVJB 1FO0L 2VLKD 2VLJD 1ORSA 1FAIL 1HE7A 3KNBB 3VFRB 2UZYB 5GGUB 1A2YB 1MWAA 3H9SB 3D2UB 5ID0B 1ZWIB 2GCYA 1KXQE 3SPVA 3I9GH 4PJGF 1OTSD 4HMCA 4FFYH 2PTTA 1EXUA 1UCTA 1CG9A 4NBZB 5E1AB 5DD3L 4NQDA 1QHPA 4LIQE 1QSFA 4F37F 2LU3A 4FQLH 3OHXA 1KPUA 3LB6C 4OJFL 1EFXB 3HUJB 3R1GL 1HKFA 4J3OC 5EOTA 5F89B 3FMGH 5D93C 3MCLL 1FO0B 2VABB 3OR6A 3RVUC 4MJ6A 3BIBX 3RAJH 1LEGB 3GSNA 4BYHA 3CFKB 3C8KB 5D6DA 1U3YA 1EO8H 4R7DA 3T0ED 3E6HB 3EYQD 3MRFB 2KL6A 1ZE3C 1S7SB 5F1OB 1AR1D 1FORH 5GGSB 3TZVB 3PL6C 1A7RL 4U7SA 5JXED 2FD6H 1ZSDB 2WBKA 1CE1L 4QRQB 5DRXA 3UBXB 1DUZA 1ZA6B 4Y2DC 4NJ9L 1NAML 3MV9B 3REWB 2H32H 4Z7QE 5K59F 5CSGA 1NGWB 3RWEB 1MCFA 3E6FA 4D3CL 2ZKHH 4FTVA 5BZWA 1M4KA 3C5JA 4JR9H 4DKFH 2PXYA 3TV3H 3RFZC 2XKSA 2ZOKB 1NDMB 1DQML 1V05A 5CUSL 3OKLB 5D96B 2AVGA 2AJZB 2HFGL 5D7JB 1KIUA 1U8LA 3KPNA 1CFBA 5FUOL 1P7QB 1A9BA 3HTLX 3HCVA 4X99B 4ZUWB 3SE3A 3EHBD 4KDTA 3MRJB 4MCYB 1NAMB 4OF3A 4PRIB 3OKMA 2N7AA 1ZVHA 4B5EA 5IMKA 1WV7T 2VERN 3U9UB 4ZAKC 1DFBL 4QHKJ 2P5WE 3GI9L 1Q94B 1KELH 1DL7L 3EBAA 1HXYB 4H88L 2QADB 2JB5L 1FJ1A 3BPCB 3UTPE 4N0UA 1NCBL 5E6IC 2XZAH 4PJGA 4PUBL 2YKLH 4MXQC 2D2OA 2GJ6A 2VIRB 3S5LG 4WWKD 4JZJC 4OFVA 2D7QA 2CUMA 4KRPD 1TCMA 3BWAB 3RBSA 3RBGA 1HIMH 5I1HH 2ADIB 2VDQL 1HWGB 3VFMA 5I1EL 1BOYA 2Y06L 1MWAL 1WC7B 2CIKA 2K9UA 1FCCA 2B5IB 3ZKNC 5L7XH 1J0IA 3SE9L 4MMXC 3O6FB 4U6HA 3R06B 3ELAT 3K0WA 4NN7C 1T20B 1I8KB 2X6MA 2IAMA 1Y6NR 3RWGA 1XH3B 5LQBH 3NTCL 1QQDB 1T2QL 5B8CC 1C5CH 5ILTH 5M95B 2J6EA 4I18A 1CLOL 4YDVB 1RUMH 1ORSB 4ENEC 4ZOCA 1OARL 1G9NL 3D18A 3GSNL 3MV7D 1ZEAH 4DGYH 1MWAB 1ZOXA 1GPOL 3IU3A 1LO4L 3O45A 2ZUQB 3CZFA 4MYWB 2ZZUT 2GCYB 2VXQH 3QCVL 3TYFA 3SPVB 4K3HA 1YEEH 3WKML 4V2CB 1FAKT 2J8UE 2PTTB 4Q9QH 1EXUB 1LO2H 3G6AB 3UO1L 1CG9B 2WP3O 4O5LH 3TBVA 1JZ6A 5GJTH 1QSFB 3OHXB 1KPUB 4DQOH 5BJTA 2E8ZA 3S34H 4JHWL 5EOTB 3UTOA 4OKVA 5IVXE 1FIGL 4OCYH 2A0LC 3EZJB 2AEIT 1I3RB 4CW1A 4P3WA 4MJ6B 3GSNB 2C1PB 2GK2A 3QWRD 4JFFA 5E2WL 3FQNA 1AXTH 3MNWA 5EUOA 2EXYD 3PE9A 3B83A 4R7DB 3U7AA 3GGWA 2LFGA 2NZIA 1FFOA 4GG8A 2DQGH 3CFIC 1DEEA 1LMKA 3Q1SH 5C09A 2B2XH 5CLWA 3GMQA 3VMNA 5ISZD 3HAEA 3ECBA 1MHEA 4I8DA 1N26A 2GT9A 1RVFL 4FQIH 4NNXA 4YXHH 3VXQB 2HFFA 5ENWA 4X7SL 1NGQL 4X4ME 5EU3A 4PJFA 3Q5YA 2G60L 4KJQD 5C6TL 2WIIA 3BE1L 4G43A 2FRGP 3E6FB 1QACA 3TF7C 3VW3L 4FTVB 4NC1E 5ERWA 4LCWB 3C5JB 5SWQA 4OB5L 2PXYB 5A40E 4P4RB 1TPXC 2WP3T 5JHDE 2R4RH 1KCUH 2YA0A 2X9WA 3TH2T 1HH9A 5D2LA 4UTAL 1J1XH 5DD6A 3DI3B 4GW1A 5DRZB 1WAAE 3MRDA 1NMAH 1UZ8B 1GRWA 1U8LB 1RK1B 5TDOA 1IGML 4YHKH 3HCVB 3BX7C 1FRGH 1V7ML 3BGFC 3OKMB 4NO2B 4FQJH 4GRLC 4I0PA 5BZDB 3NCFB 1MJ7H 1OQOA 4L4VD 1JYVA 4PJBA 4XBPA 1BJMA 3SKNA 3BPOB 4MSWA 3ARWA 3VXOA 3PV7A 4W70A 5FHAL 1HCVA 5F6IC 4N0UB 5LAXA 2X89D 1PSKL 1MCOH 5DJCA 1YPZF 2GJ6B 3AXLB 1VKXB 3ARSA 4X6FA 1TJGL 2X9XA 5DHVH 3SDXF 3QUMH 5HDQL 3K4DA 3GZKA 2H32A 3CLEH 1H3TA 1RZFH 3QG7H 2MOVA 25C8H 3KHQA 4P5MB 3HN3A 5MI0B 4Z7OF 3V5KA 1I1AA 3VFMB 4ETYA 4EN3D 2VTFA 2YD4A 3BZFA 1W2KT 3PQYD 1RULL 3UTSB 4YXKH 1G7IA 1I9EA 5SWZB 5HGGS 5JW3L 3QIWC 3O6LL 1D5ZB 4KRLB 3MXVH 1F5WA 4I1NB 3ZKXC 4ELME 3KJ6L 4UV4L 5D71H 1O7SA 3H2WA 2FHCA 1D9KB 1F3DJ 4JO3H 4HKXA 2IAMB 4JFOA 1S5HB 1U0QA 3RWGB 1N0XH 1MUJB 5CEZH 4C56D 1CGVA 1QD0A 3I3BA 4RGNE 2MPAL 4I18B 2DYPA 3P9LA 4AEIL 4GBXA 1R24A 3EO0A 1OAZH 4LLYB 1U8HA 3BMWA 4G3YL 4UILL 1ZLWH 3FQRB 1BGXL 1SVZA 4IJ3B 5ETUA 3E3QC 3O45B 3CZFB 1ZANH 5TF1H 1ZHBB 4OZGB 5E8OA 2FJFA 3TNMA 4XNQB 1LEKB 1T1ZA 1LNUB 4ONGL 1U8JA 1A14H 4XBEH 4FFWC 3MLYH 5MERA 3RVWC 5D9SB 3BISA 3WFCL 2Y6SC 5FECA 3JUZA 5BJTB 2I26N 4MXWL 1CXLA 3JWOH 3LMJL 3DX7A 4IRJD 5GRUL 1I8IA 1MJJA 2FLRT 4L4JA 5HYIA 5AUMA 1NGZA 4HQQL 5ITBH 3W81A 4XP5H 5F1NA 5K9QG 3UDWA 4JFFB 3FQNB 1DEDA 3MNWB 3WKNA 5EUOB 2WUCH 3GGWB 3WLBA 2JJTA 1JJUA 4JGUA 3L1OL 3L3DA 5EBWA 3VWJA 1BBDH 1DEEB 1KJ2H 3NZHH 3GMQB 3DROA 3IAGC 3HAEB 3ECBB 4QXGH 2P5EA 5E9DA 4C4KO 3HNVH 4U7KA 2OSLA 1UG9A 4LHUD 4NNXB 3FJTA 2HFFB 2PTUA 2NXZD 4FQLL 3QIBA 4JM2C 5EU3B 4PJFB 3FMGL 4M5YH 3X17A 5J1AA 1ZLUH 5GZOD 4U1MA 3DMMC 2FL5A 2WIIB 2IPKA 3DVGA 3V4UH 3FZUC 1FYTD 3RAJL 3GSWA 4POUB 4K9EH 1EO8L 4YWGL 2YWZA 5SWQB 4OZ4A 5ACZB 2NYYC 1RZ8A 5DGRA 5CJOL 2YXFA 3QXAB 1HH9B 1A6VH 5D2LB 1WEJH 3WFHA 2NX5A 2X41A 2VSCA 4YBQC 5DD6B 4GW1B 3MRDB 3OF6A 3BH9A 1FORL 1D5MB 4L9DA 4IOIB 4L29A 5TDOB 2FD6L 1AQKH 5DWUH 1PEWA 1PKQA 3S35L 2DI9A 3I50H 5DK2A 1IVLA 4Q7DA 3RWCA 2GW5A 4I0PB 2DBJA 4YHNB 1CGYA 1OAQL 1EO7A 1IARB 1JF1A 2ZKHL 4QTHA 4DKFL 4JR9L 4PJBB 3ZKQD 2KPNA 3JWDC 3TV3L 4C4KT 1DANU 2A1WH 1YN6A 3RUGE 3ARYA 3VXOB 1G9MC 4KROD 2HTKC 3V0VA 3CVIH 2WNGA 4GFTB 2GIYA 2BSED 3K3QA 4N5ED 5DJCB 3BDBA 1FFPB 4X6FB 3MLPA 3SKOB 4XNZB 1BQHA 2H32B 3MYJB 4HAGA 1P7KA 2APFA 4PB9H 3V5KB 1I1AB 4YBLC 3BZFB 5DJAB 4JLRA 2GSGA 4G42B 4U1IB 5I8EB 1KCKA 4PRHA 1G7IB 1KELL 1Q8MA 1UWEH 2XTJC 1AXSA 5TJWK 2AJ3A 3QISA 2EDHA 1FP5A 1ED3B 3Q48A 2XZAL 1FGNL 4DJMA 2YUVA 1X5HA 2YKLL 4P2OD 1QBLL 4HKXB 2P49B 3LN4A 4Y5YC 3QFDA 4JFOB 5FYKU 3KYOA 2AK4D 4OI8A 3HRZA 4NP4H 2GI7A 4U6TA 3LV3B 1C5DA 2F53D 1NC4B 1HIML 2DLFH 2DYPB 3P9LB 4Q0XH 1R24B 3EO0B 3VXUA 1U8HB 5FKPA 3O8XD 3AMLA 4LAJH 3TO4A 4ODTL 5D7LA 1XCTA 5ETUB 3GM8A 4P46C 1W8NA 3TYGH 5L7XL 4P99A 2FDBP 4TVPH 1XGTA 3JVGC 4HHAB 5E8OB 2FJFB 3TNMB 3TFKD 4K71C 4U31A 3ULUH 1T1ZB 1CT8A 1UEYA 2GK0A 4N8VA 2F54D 1U8JB 4WO4B 1EAJA 3VRJA 5E5RB 2Y9RT 5FHBH 3QUMA 3EO9H 5EUKA 5KOMC 5LQBL 4OF8A 1C5CL 1D5IH 4NO5B 1Y6KR 1RZ7H 4Y4FD 5FECB 2PTVA 3DX7B 3KVQA 3GEWB 4J3XA 1I8IB 1MJJB 1RUML 1CQYA 5AUMB 3EYSH 3FFCD 1NGZB 2CK2A 4JRYA 3CAFA 5F1NB 1CFNA 1ZEAL 1E4XL 2AXGB 3KPQA 4O2EA 4TQEL 4DGYL 4M7LL 3VDBA 3BT2H 3F65A 2GHWB 3HZYA 5FYKD 3WLBB 3WXWH 4OFYA 3L3DB 5EBWB 2VDMH 3ULVH 2IEPA 5IBLC 3DROB 1J8HD 4Q9QL 4J6RH 1LO2L 4R2GB 5JA9A 2H1PH 2P5EB 4B50A 4NNYB 4O5LL 2OSLB 5GJTL 3QO1A 4HKZA 4XMKH 3FCTA 4DQOL 3AU1A 5F9JA 3S34L 2AXHA 4TVSa 4Q74A 5E6YA 3DRTA 4OCYL 2XQYK 2XRAH 4U1MB 3T0EB 2IPKB 3T1FB 1PGRB 3MRKA 2NY0D 4NPYA 3MLZH 3UTTE 4GS7C 3N1QC 1A3QA 1AXTL 1UJ3C 1JRHH 2BK8A 4OZ4B 4M4PA 2DQGL 1MCEA 3SBWA 4UQ3A 5TF0A 4L3CA 3Q1SL 1C08A 1EEZA 3ARBD 5CLTA 2WANA 3GMOA 3RTQD 5IB2A 3CMGA 3PGDB 4P2RD 3WFHB 3WSQH 1Z6JT 4KTEH 4FQIL 2CLRA 4YXHL 1Z3GL 3G08A 3BH9B 2AI0H 1HYSD 4WU5A 3EYVA 4L29B 1H5BC 3JSSA 4U05A 3VJ6A 3B8YA 1WBXB 5DK2B 2IC2A 3RWCB 4MJ4A 1CFQB 4XHJD 3V5HA 3WNOA 1LGVA 4HUUB 1JF1B 1Q9KA 1LO3H 3LVEA 2R56H 4QTHB 2LQRA 2K7PA 1N3NB 1KJ2A 4K7PX 1VEPA 4NKOA 2R4RL 1YN6B 2L7JA 4L8DA 3HLAA 5DEFB 2EDOA 4EXPX 5FV2A 4LVOB 3V0VB 1JYNA 2B8OT 5HVWA 5K93A 5GS2H 1ZV5A 2IMMA 3WFEH 5GSVB 2UYLA 4NQCE 5CEYA 3S4SA 1XIWC 4YHKL 3QEQE 3UJIH 5C0IA 1FRGL 5EZOL 1BQHB 3UZVB 5EDXA 4UB0H 1P7KB 4FQJL 1RJZA 2XKNA 1BVZA 2NY3B 1MJ7L 3QEGH 1EFQA 2BXZA 4OM0H 2GSGB 3HE7C 1DQJA 2YPKA 4PRHB 4PJXB 2M8XA 4NQXB 1AXSB 3V0AC 1D7FA 1Z9LA 2VB5A 5HGHA 4WI3A 5C2BL 4BA8A 2QEJA 1MCOL 2PO6A 4NM4H 1R5WA 3TO2B 1MPAH 3LSOB 3CVHH 3LN4B 3QFDB 3FT4A 3KYOB 3QUML 3HRZB 3WS3A 4XC3L 3RWHA 1C5DB 3IFLL 3CLEL 5BV7C 1RZFL 4WFFE 3QG7L 3L6FB 25C8L 4I0KA 5IVZA 1A7BA 2FJGA 5T5NG 1WGOA 4Y4KC 1NLBL 2GY7B 2BSRA 1SYVA 3VXUB 5FKPB 3GRWL 3TO4B 5D1ZD 4KDVA 4HWEH 5D7LB 4YXKL 4PJAF 3GKZA 5MEQA 1H15A 1OVZA 4OD1H 3DUSB 1VB9A 3MXVL 4ZUSA 3RDTA 5D71L 1RK0A 4KI5E 4JKPH 2APTA 2GK0B 4JO3L 4OBRA 3VRJB 4CMHC 5DHVB 5T3XD 3BZ4A 1YEHH 1N0XL 3QUMB 4EVNA 5EUKB 5CEZL 1KIPA 5FYJE 2HLFC 4BFIB 3DXAE 2PN5A 1FVDA 3HG1E 3FN0H 3G04A 1AH1A 4GAGH 3AS3A 2Z92A 4AIZB 4JRYB 3ULSB 3LEYH 4O2EB 1HHIA 1BEYH 2AJVH 1OLLA 5B38A 5HHOE 1ZANL 5TF1L 4XVSH 2F8XC 4LGPB 1FNHA 2ZNXA 3K74B 4HGMA 4FQ2H 5E2VL 3TVMD 4X7CC 5A3ID 4WW2C 2F58H 1A14L 4XBEL 4LLVA 5T1LA 3MLYL 4X9HA 2CGRH 4HKZB 3FCTB 4UINH 4XCEB 3AU1B 5F9JB 3PL6A 4Y2OA 3JWOL 3S98A 5BRZE 3DRTB 1SEBA 5A2LH 3F7VA 3MRLB 1RZJL 3KPSE 4Y2DA 5ITBL 4XP5L 3MRKB 4NPYB 1JZ5A 1QFWM 4LLWA 2VYRE 2R2BA 3QPQC 5AZEH 1J1OL 5EN2A 5BXFB 1LE5A 4OGYH 4OKDA 1VFBB 4UQ3B 1BBDL 4L3CB 1EEZB 5DQDH 1KFAH 3GMOB 2EDBA 3JTSA 4QHKI 3BQUD 4PGCB 3NBNA 4X7FC 3HNVL 1ZT1A 2CLRB 3QEHB 4L4TE 3G08B 4Z6AT 2EIDA 3K1KC 4RISH 4I3RH 4LVNC 1T21B 1RV6X 4WU5B 4YX2H 3QDHA 5C0AA 5HYSG 4M5YL 2VR5A 5K9OA 1QRNE 4M8VA 4JAMA 4WI8A 3V4UL 4YHIB 3HC0A 3T2QA 3AGVA 4K9EL 3ZHLA 2EKJA 3KLAA 3V5HB 2YD6A 3HHRB 4HXAH 4P57A 5SX4H 1Q9KB 2C3WA 3VFOA 2W65A 4OZHB 3BWUC 1DVFC 3AFLA 5JNYA 1T1WA 4NKOB 1IAIM 3BPNC 4JHAH 3VXSA 5BCAA 4FXGA 1A6VL 3HLAB 5DA4A 1WEJL 3ZSSA 3EIFA 5EO9A 1AY1L 5FYLH 5E6IA 3F58H 4PY7A 2E3VA 1SMOA 3IJYB 3S4SB 1AQKL 2UYLB 3MC0A 5CEYB 5DWUL 1YEGH 4JZJA 4M7LT 5C0IB 3I50L 2X4TA 3BOVA 3QZWA 1RJZB 5ICYA 2XKNB 3MLWH 4HGWA 3RI5F 5EORH 4A2LA 3MOBH 3B3IA 5LKNA 4FFZH 3M17A 3TJEH 5IJVB 1CYGA 2YPKB 4RFEA 3MLXH 3L5WA 3MLVH 5HGHB 3V6FB 3QJFA 4GKSA 4Y4HD 1GHFH 4CGTA 5JO5A 1SQ2N 1R5WB 4XC1H 5AYUH 2NY6B 3MV8A 4LP4A 4ZUUA 4OCNC 3C60C 1CTNA 5TQ0H 3WS3B 1OD9A 4G7YH 3MUZ1 4JKLA 1EZVX 2G9HA 2FJGB 3LQAL 3PGCA 4PB9L 2BSRB 5DQJA 3ARFD 3B9KA 4Q97A 4OLXL 5FDWA 5CGMA 1B0RB 5KSBA 1RIUH 1XGQA 4Z18A 1UWEL 5MEQB 1H15B 3NMEA 1ACZA 4R4BB 4ZUSB 3NIGF 3RDTB 3NCMA 2AQ1A 1RK0B 1JGDA 1BFTA 4I5BA 3GMMA 3MLUH 1R5IA 3OR7A 5T1KD 3NFSH 3BZ4B 3ZE2F 2N1KA 1NEUA 2VE6A 3OAYK 4MJ5B 3RGHA 1XMWA 1FVDB 1E0OB 1HH6A 2DLFL 4N9OB 3G04B 4Q0XL 5C08D 1OPGH 2HWZH 4BFBD 3T4YA 5LJYH 3UYOD 3SGJC 2Z92B 4DOHB 1F2XK 5SWSE 3V8OA 1TETL 1KG0A 3BESR 3IKKA 1BQUA 3CDCA 4OCLC 1QTYT 2GFBA 4PRAA 5B38B 3T2OA 2X2YA 3TYGL 4TVPL 3U4AA 1YNLH 3JWDH 3KLSA 1HQ4A 4ZXBD 1ACYH 3GJFK 3GIZH 3MJGX 3ULUL 3WJJA 4HMDA 2R9HD 3CVHA 4IRJB 4LLVB 4UDUA 3PWLB 5FHBL 1MLCA 1D5IL 1DQLH 2BNRD 1RZ7L 3PL6B 4PPTA 4M7ZB 3WLWC 4HJJH 1SEBB 1F90H 3EYSL 3F7VB 3IU4H 3CPLB 5B22A 5E2TH 5IW1A 4HXBL 4D0CA 1A4KA 1MCDA 2H2PC 2W9EH 4JHZA 4LLWB 3BT2L 4WFED 3RWDA 2R2BB 5EN2B 3WXWL 3AB0C 1LE5B 4D9RD 5IR1A 4OZIF 4JFZH 1W0YT 2NXZB 2VDML 3OXRA 3ULVL 1HYRC 3G9VA 4J6RL 4BJLA 3JTSB 2H1PL 3C2AH 1ZT1B 2PETA 3QIUD 4UQ2A 3GI8H 4XMKL 2NY2D 4TUJB 1UKQA 3U6RA 4J3SA 3IDMA 5K9OB 4M1GH 4URTB 3NCYS 4JAMB 5DMGC 1G9EA 3HC0B 3MLZL 4YIQA 4GRLA 3KLAB 3FQUB 4ORGA 5F71A 4P57B 1JRHL 2W65B 2FIKA 3DRQA 4UT6L 1HKLL 1T1WB 1IL1A 3WD5H 1WISA 3VXSB 3FB6B 4FXGB 4OIIH 4U49A 5H2BA 1GOHA 1D3CA 5BOPA 1BVLB 4R0LA 5EBMA 1MLBA 5E6IB 2AI0L 4PY7B 4Y16D 1PAMA 4PGDA 4YJZL 4JM2F 3L7EA 1RU9H 4JZJB 2H9GA 4PJEA 2X4TB 4IRSC 4BSVA 5ICYB 4TTDD 2R56L 1U3HB 3B3IB 4KI1A 1F3JB 3MRBA 4FFVC 2BERA 1G0YR 3G5VA 1BJ8A 4G6AD 4M1DH 1BLNA 3QIWA 2R1WA 5B4MD 3BYTA 3O3UN 3QJFB 1YMME 4GKSB 5KVEH 5CD5D 2P8MB 1VENA 5JO5B 4GRWH 2LV4A 1J10A 3BH8A 3MV8B 3LS4H 3SQOH 1PG7X 5DD1H 4ZUUB 4Y1AA 1CQKA 3UJIL 1T4KA 3UEZA 3K2UH 4MNGE 4UB0L 2JCCF 1FNLA 3PGCB 4HWBL 4JPIB 1U93B 3B9KB 4OM0L 5HI4C 3GKWH 5KSBB 2IWGA 3CX5K 5I18H 3ZE1E 3OKYA 5MEPB 1QPPA 4K8RC 3LDBB 1JGUH 1B90A 2F53B 1BMGA 1JGDB 4HWZA 4NM4L 1IEHA 3GMMB 1K8DA 4IOFD 3CVHL 3RL2A 3OR7B 1R5IB 1A5FH 3VMOA 1DQQA 2VE6B 1AP2A 2VAJA 1DBBH 4MAYC 3WE6A 3I75A 2HKFL 1T83C 2EZ0C 4HG4K 4J1UB 3PWVA 1C16A 3T4YB 5L0QC 2ESVD 4ZMAT 3QHFL 4APQC 4HWEL 4L8CA 2UZIH 4KJPD 2G2RA 1A3LH 3KXFE 4PRAB 4JO2H 4AYFA 3O4OC 1QKZH 2DTMH 4OD1L 3FT3A 2J4WL 4XCYA 2FCBA 2H2SD 2IGFH 4JKPL 1KJ3L 3EOAA 5C0CA 4MNQE 4Y4FB 5I8KH 4KUZH 5E9DD 3CVHB 1EHNA 1YEHL 1PYWA 3QIBD 1KLGA 1MLCB 4O02H 2YC1A 1VA9A 4L9LC 2YK1H 4JM2A 3FN0L 4LCYA 5D4QA 2VR9A 4MNHA 2E7BA 1L0XA 1JI2A 2YUXA 4ZQKB 1RUKL 4QRPA 5IW1B 3LEYL 5FGBC 3SCMC 3AREC 4ONFH 2AEWA 1BEYL 2AJVL 4D0CB 5HYJD 4XXDB 4X7TA 3FRPA 3RWDB 3W39A 3VG0H 4MDIA 2BVYA 5IR1B 1RQ5A 4EOWH 2J5LC 3OXRB 4FQ2L 1EJOH 2DJ4A 2NX5D 4NC0B 3MX0A 4H1LG 3HFMH 3ARVA 1BZ7A 3AC0A 1QSEE 2JF1A 4JEGB 3KPMA 4UQ2B 4J3UA 2CGRL 3GO1H 4UINL 3NA4A 1IT9L 2Y4SA 1AXIB 3U6RB 4OZFG 3MPCA 2MQ3A 3IDMB 5CILL 4M93C 4PRPA 4M5ZL 3VGBA 3O11A 3T0WA 3HS0A 1CD8A 2X1XR 4KK9D 3BGFB 4YIQB 3RTQB 2JCCA 1INQA 4ORGB 1IJ9A 1E6JH 2I25N 4ODUA 5AZEL 2G5BB 1UM5H 4LPYA 4O2FA 5T5NF 4YDKH 3D3VE 2FIKB 1JI1A 4AMKL 1T2JA 3WFZA 3P73A 4JFEA 1CK0H 1MIEH 4R0LB 4GOSA 1MLBB 3IDIA 5EBMB 4CU6A 4RISL 4KVCL 2R15A 4QCIA 4YX2L 1MREH 3D87B 4PJHF 3LIZH 2AABH 1S78C 4HT1H 1EHLH 3EGSA 4I77H 3SO3C 4PJEB 3RJQB 4BSVB 4HXAL 3KWWA 3UCRA 4AENA 3MRBB 1EVUA 4XMPL 3DETD 3G5VB 4JFDE 4JHAL 1J5OH 2F5BH 3QIWB 2R1WB 4NKMB 5FYLL 3ZKXB 3PJSA 4GT7A 3CUPA 1NMBH 5JHLL 1U41A 3BH8B 1RUPL 3ILQC 1EGJH 4Y1AB 2ATKA 1YEGL 1T4KB 4V1DA 4N68A 1U36A 1I85A 4IIQC 4IDLA 3DVFA 2NY1B 5KS9A 2FBOJ 4Z76A 5EORL 5D1QC 1YNKH 1TJHL 3RIFK 3MOBL 3K4AA 5HGAA 1JL8A 4FFZL 2SEBA 3RKDD 3TJEL 4GXUM 3VXRE 2BVTA 5FUCE 3MLXL 3DYMA 5C0ND 4P46A 1O5DT 4LVHC 3CFJA 1BPVA 1HHKA 4MD5B 5GZND 3LD8C 4MAUL 5AYUL 3BIAX 4Q9CA 1VESA 1ADQH 4X8JA 1JZ4A 4Y5XC 2X4OB 2Z91B 5DK0B 5TQ0L 1AP2B 4G7YL 5IB5A 2Q8BL 1A1NA 1S5IH 3WE6B 4IDJH 3I75B 1OTTD 3WNNA 1C16B 1DBKH 4YHYC 3NCCB 3LN9A 1RIUL 1T03H 4OCSL 2CDEA 4KI5F 4LGSB 3NGBC 5ACMA 3GUTA 4BZ2H 1QOKA 5I1KH 5D2NE 4LCCA 4M7JL 3P11H 4XCYB 2IANA 3HI1B 4NWUL 4NQTA 3EOAB 1B2WL 5JW4R 4X6DF 3MLUL 1QEWA 1WF5A 1FVEA 3NFSL 4PG9A 1PYWB 1HNGA 1KLGB 4ODHH 1I4FB 5JZ7C 4LLQA 4LCYB 4PJHA 4MNHB 2HWZL 1B6UA 4ZD3H 2AERT 3QRGH 5ALCH 1AGDA 4KWUA 1NCAH 1MFBH 2VZTA 2QLVB 5HDBE 5CMAA 1JZ8A 4QOKA 2Q86B 4X7TB 1UJ3A 1DANT 4OLYH 4X9BA 2VQUA 4WW1A 4MDIB 1P1ZA 1YNLL 2VLRA 3JWDL 4Y19A 1OGAB 1ACYL 3GIZL 3LQZA 5T5FL 4MA1C 1BZ7B 4Z0XB 4QRRE 4JKWA 4PJ7F 1DQLL 4OUOA 4TUOA 2V7NB 5KSUB 3KPRE 43CAB 1A7NH 1H5BA 3SDCA 4JREC 5FUZH 1HCFX 4HJJL 2VZOA 1F90L 3IU4L 3UBXI 3O11B 4Q58C 3HS0B 3T8XA 1INQB 1RJLA 2W9EL 4PFEA 3E2HC 3MRMA 4YGVA 3BQUB 4JM4H 2B1HH 4JFZL 1MHCA 1QHOA 4WW2F 3C2AL 4WENB 3M8OH 3E0GA 3V6OC 3GI8L 4KV5F 3QFJA 1AO7D 1NBVH 1FZMA 3JTTB 5DJ8A 3CFDA 4QKXB 5C6WH 5IVNA 1XIWA 4PY8J 4M1GL 2OTWA 4M03A 4I13B 2DQJH 2VLJE 4MZ2A 4AL8H 1A02N 5CWSA 4PJ9B 1CLCA 3WS6C 4HLZG 4WIQA 3FOLA 3WD5L 3HE7A 1MAMH 1YC7A 2GAZB 4G6MH 5EC1A 4Z7WA 1HEZA 3QRFM 4OV5A 2PO6D 2ZSWB 1T04A 3PJSB 1U3ZA 3CUPB 4WY7H 2ZJSH 3LKNA 2XY2A 2P46B 3P2TA 2EH8L 1RU9L 2HN7A 1GC1C 1IZKA 4NM8H 4V1DB 2F19H 4HX1A 1I8MA 4CKVX 3IAPA 4WFHD 5DLMH 3IJHA 4R4FL 3CXHJ 3VXPA 5KS9B 2E7CA 4Z76B 1ODAA 4J23A 1RD6A 5HGAB 2SEBB 5TH2A 1A4JA 4LARH 4OTXH 4ZUTA 3T4AA 3JXAA 3BMVA 4M1DL 3P4NA 4P46B 2ZG1A 3CFJB 3KGRA 4JY6A 3KPTA 1HHKB 3SJVE 4F9LC 5I16B 4WGWB 3GBNH 4P4KC 4RMUA 3NPSB 2GTZA 4X8JB 4UTBL 3LS4L 3SQOL 3O3EB 5C9JB 5DD1L 2A83A 5L2KE 4I4WB 5IB5B 4YR6A 5DD5H 3K2UL 1T66D 3BD4A 1JK8B 3T2PA 1D6VH 4P2QE 4ZNEE 3DPBA 4RGMC 2JK5A 3RVUD 4L8BA 1KN4H 3BZEA 1JFQL 2OR7A 2KDGA 4ZO7A 5I18L 3F7PC 4FOMA 4MWFA 3GUTB 4P3CH 1GGBL 5IBUG 4LCCB 3QH3B 4JPVH 5T1KB 5E5UB 2IANB 5DUML 4GRWB 4WW2A 5T1LD 5C08B 3ZYOA 3RU8H 1EGJA 1FVEB 1A5FL 2A73A 4MMZC 3BKCL 3PWPA 3IDNA 1P69B 1P4LA 3QULA 2R0WH 4KH2A 1AGDB 2P5WD 4MX7B 2OJZH 2UZIL 1A3LL 4ZXBB 5CMAB 3OJDA 4QOKB 4JO2L 1UJ3B 5KG9A 4WW1B 1QKZL 4JRWA 2DTML 3ALPA 1BM3H 5F3HA 1P1ZB 5GS0D 4WU7A 2VLRB 3BHBA 4Y19B 3TLRA 1WICA 4KUZL 3T2NH 1ADQA 3LQZB 4KHXH 5DJXA 2I60H 3TT3H 2NNAA 2ERJB 3KPOB 4O02L 4LP5A 5C0AD 5JIPA 2YK1L 5E4IA 3G6JE 5I1CH 1H5BB 3SDCB 2GY5A 1PY9A 3ARDA 4X80H 2LU7A 5E8EA 3T8XB 1E27A 4DGVH 3VXMA 1BFOA 2GKIA 4ZAKD 3MRMB 3DSNA 1JHKH 2FHBA 3QIUB 4H0IA 1LP9E 2R0ZH 4IRZH 4EOWL 2AXFA 5JOPE 1DVFA 5JIHA 4XCNA 1EJOL 1WVZA 2YRPA 4J3VA 5DSCB 4OI7A 3STZA 1G1CA 1J0YA 4ZO8A 5JPMB 4OIAA 4KAQH 1UCBH 1WBZA 3GO1L 1FZMB 1N59A 2YUZA 4X0KA 3CFDB 4HV8A 3SY0B 4XCCH 1CLYH 2BNQA 1F6FB 5MENA 5TE7H 2ADFH 4OUUB 4ZFOA 5FAAA 1WTLA 4HIJB 4RNRA 2CRMA 1XGPA 2A74A 1E6JL 3BDXA 3MV7E 1UM5L 1DDHA 4G8GE 1S7XA 1NH6A 1QLRA 2XA8L 4YDKL 5F7DA 4GMTH 3O9WD 2KUTA 1QBMH 3FOLB 4Y16B 3HE7B 4JFQA 3VFSA 2ED9A 4EDXB 1NGXA 5H94A 3IYLW 1HEZB 4Z7WB 1OP5K 1CK0L 2BC4A 35C8H 3O3DA 4OV5B 1T04B 1FIEA 1ERNA 1MREL 1X7QA 3OL2A 3LIZL 4Z9KB 2AABL 2HN7B 4H8WC 4HT1L 5EU7C 2C4XA 1I8MB 3IJHB 3VXPB 4ENED 4NYLA 4RAVB 4R7NA 5TH2B 4ZO9A 4ZUTB 5C3TA 3VFWA 3P4NB 1J5OL 1JWSA 2F5BL 4ZFFA 1T3FA 4JY6B 4KXZI 4CN1A 5FOJA 1NMBL 1MFAH 2GTZB 4LEXL 1EGJL 4CMHB 2A83B 2VAAA 3OTTA 2MMXA 4JQIH 1OOAA 5CGYC 1VFAA 3QDJE 4FXKB 2HT3C 1YEIL 4HUMB 5HPMA 4AEFA 1S9YA 2JK5B 4PJ8C 4L8BB 4PJIA 3SGJA 3BZEB 1KV3A 2AP2A 4E41E 5BO1H 5JHDD 3K46A 2CMRH 4XWOD 1NCWH 2B20A 4MWFB 4EI5D 2RHEA 1J0KA 2BVEA 4G9FE 3BRGC 1JUFA 1ADQL 2NY5C 1UB5A 2VXUH 1AE6L 2ESVB 2A73B 1K4CB 4LBEA 4LU5H 4A6YH 3D0LA 3CMOL 1F00I 3PWPB 3UYRH 3IDNB 3L5IA 1H8NA 2XZCH 2DD8H 4IDJL 4YFDB 1NMCC 3QG6A 3QULB 2DKSA 2WW8A 1DBKL 5SX5H 4HAFA 1T03L 5I0DA 1NEZA 4X98B 4BZ2L 3OJDB 5I1KL 3F8UB 5F8RC 5F3HB 2ZUVA 3MUHL 3P11L 4GUPA 3BHBB 3JV0A 4HUKB 4RA3A 3X3GH 4JN2A 3ZT6A 1KCVH 2X1QA 3CCHA 2VLLA 4NUGL 5DJXB 3TN0A 3PHSA 2NNAB 4ODHL 4F7CA 3BPLC 4G5ZL 4ZD3L 43C9A 1IGTA 2AJYH 3QRGL 5HHQA 2ZUYA 3ARDB 5ALCL 1KUMA 4BH8A 4ZFOL 4GRLD 5E8EB 3FT2B 1E27B 1X5ZA 4QF1B 3VXMB 1BFOB 3PQYE 3U0WH 2X4RB 1A6WH 3GB7A 5DDHA 5FO8A 4PTUB 1KTKE 2WV3A 5FGCE 5KVMC 2YD3A 4XCNB 1OTUC 3OXSB 4WEMB 5HGBA 3UC0H 4F15B 1MAJA 1WBZB 1Z9OA 4RGND 1QUNA 4X0KB 1N59B 2ADGB 4HV8B 4NIKB 1A7NL 5FUZL 4R97C 2BNQB 5MENB 1PD6A 4YHOH 4M8QA 4B7IA 4ZFOB 4IRSA 2QQKH 4JN1H 4F57H 3CDGA 1XGPB 2WSKA 3RZWA 2QQLH 2FATH 1DDHB 4JM4L 3KJ4C 1S7XB 1QLRB 5F7DB 2B1HL 1WIUA 5EZJB 1T89C 3HC3H 2AAVA 3QDMD 1A6ZA 3M8OL 3MRPA 2BC4B 3O3DB 2COQA 5FM8A 1MCHA 5IB4A 2ZG2A 4FQXC 4NHUA 5C0BE 1GH7A 3O3AA 2E7MA 4GW4A 3TP4A 3MZGB 2AXJA 5E4EB 3SDDB 4L3EA 3H7BA 4Z7NE 4Z7UF 2PCPA 4IMKC 2RQ8A 4RWHA 3P40A 2DQDL 1HSAA 1MAML 4DK6A 4RRPA 5GSRA 2OL3L 1JWSB 1T3FB 4G6ML 1U92A 1Q9WA 4YH6A 3Q3GA 2ARWA 5E8DH 5CD3A 3NH7H 5L88H 4M6ML 3IDJA 5F93C 2LTQC 3K2MC 1MJUH 1MF2H 2VAAB 5D5MF 5GGVH 4NM8L 2F19L 2BHZA 4PJDA 3U7WH 5DLML 5IKCA 3EYOA 3CX5J 1T83A 1UACL 5HPMB 3KHOA 1FYTE 2R0LH 1S9YB 3BEWA 4EI6A 4PJIB 1JYXA 1ZGLM 4X6CE 1GGYA 4APQA 4LARL 1RUQH 1AJ7L 2CXKA 3RVXD 2OL3B 2BOBA 3PHOA 4OCRH 5A16A 3P4LA 3C9NB 2B39A 1JUFB 3REVB 5J6GA 2F8OA 3F62A 4LSUL 1KPRA 3GBNL 2C26A 3RVTD 5DVKA 3U36A 1T0NB 1UH3A 3ZDYF 4HG4J 2PYEE 1NC2A 4YDLB 1QVOA 1AQDA 2LVEA 3D0LB 3RIAF 5DD5L 3I3EA 4L9LA 2NR6D 3S35X 3DMMD 5IB1B 3C6LC 5F8QC 1SBSH 1IM3A 1KN4L 1GGIH 4OT1H 3PV6A 2APXA 1NEZB 1FG2A 3HE6D 1JMZA 4P3CL 5F1IB 1CGSH 4FS0A 5DFTA 1FQ9C 2H41A 2NYYD 3DURA 4JPVL 4LCUA 1UH4A 3T3ME 4LSTH 4GUPB 3CU1A 2HJFA 5F44A 4JN2B 4HUXB 2L7UA 1A22B 2UY7A 3CCHB 2VLLB 4YBQD 3VRLE 1PEZA 3TN0B 1IAOB 4WUUE 5BS0A 4F7CB 1TFHA 4ZS7L 5HPOA 1UWXH 4NN5C 4RDQG 1PJ9A 4PRPD 5F7WC 43C9B 3HNSL 4BH8B 2RFXB 2E8YA 4LHUG 2OJZL 5EU5A 3TCLA 4EQ3A 3SKJH 5T3ZE 5I6XB 1E4XI 2R69H 3Q0HA 2C1OA 1XF2A 5FO8B 1BM3L 4G6FB 4NO3A 4KKLC 4XTRD 2UWEF 2P24B 3OAUH 2VDPL 5DURD 1RZIA 3T2NL 4KHXL 2V5RA 2I60L 5M7QA 4JY4A 2FSEA 2CIIA 3TT3L 5C0JA 4CVXA 1QA9A 1TZHB 4A6YA 5IFJB 4O58L 5I1CL 1OAUH 3ZSTA 5A2IH 4JFYB 2X5PA 2WWMD 2VC2H 4N0FA 5AZ2H 3W9EB 4LHQB 4M8QB 3G5YB 1FH5H 3OGOE 5D70H 4DGVL 1EX0A 4MD4A 3CDGB 2R8SH 4JO1H 3CLFH 2KQNA 5DYOB 3H9SE 2DTSA 2OXGA 2DIJA 4IRZL 2R0ZL 1AO7B 4K7PY 2XTJD 3TZVC 1MFCH 3QEUA 1B88A 5J13B 1A6ZB 2WWKO 3C08H 4U6XA 4CJ1A 3MRPB 1UCBL 3TA3A 2NQCA 2BVOA 4GSDH 5IB4B 1HHHA 3HUJE 4NHUB 4XCCL 1CLYL 3OKNB 4GW4B 2ADFL 2WAHA 2PR4H 4L3EB 1IGFH 3H7BB 4IIQA 3HB3C 3TCXA 1XAUA 3KPLA 3FFCE 5D1QA 2PCPB 2HYMA 4S1RH 4GMTL 1QBML 1OW0C 1AR2A 5D96C 1MFDH 4MJID 5EO1A 1HSAB 5E56A 3WUWG 2W0LA 1U92B 4W6WB 35C8L 1J8HE 5DMIH 3Q3GB 3A6BH 5CD3B 1IEBA 1U91A 2F5AH 3IDJB 4HGKC 4R90H 4Y5XA 4YC2C 3S5LB 1R3LA 2XIDA 2QSCH 4PJDB 3ESVF 5M94B 3UTTD 3I6KA 5IKCB 3MV9E 5DHYA 4TULH 1TITA 4JFPA 1U2CA 9CGTA 3MRHA 1NLDL 5J4MA 3RPIA 4EI6B 4PLKD 1UXWA 2WWKT 4APQB 3GM0A 4BFEA 3QQNA 4OCXH 4RMQA 2YWYA 5A16B 1BF2A 3VFPA 1IGIH 4YNYA 2UWEA 3IXTB 3IFNL 4P2RE 4FA8A 3ZYIA 1QFWH 4PJCE 3RGVA 3WIHH 3WL9A 1P5VA 5C0GB 5L6YH 2DKUA 2EDEA 2FX8H 2ZPKH 3CU7A 1NC2B 1QVOB 1YNTA 1AQDB 4YDJB 2MWCA 4TRPH 4PV8A 4K3GA 4PRIE 2N7BA 2IALA 5A2JH 1HOCA 4XCFH 4AH2A 3LKRA 4NJAL 2CD0A 4R3SA 1MJ8L 2B5IC 3L3HA 5HYQB 2IQ9H 3PV6B 4WCYH 5BO1L 2CMRL 1NCWL 1A7PL 1FG2B 5KW9H 1FHGA 4IOSD 4ODSH 3DURB 4LCUB 1J12A 1PG7H 4QXWA 5DA0B 1OCWH 2ITCB 2VXUL 4XVJH 5GRYA 5AWNL 4FQHA 4PTTA 1TCRB 4OLUH 1NFDF 1CR9H 2V9TA 4A6YL 3UYRL 1AC6A 4XPGH 4WEUD 2Y1VA 3MCKA 2XZCL 1Q0XL 4NZDA 2VITA 2WBJD 4H8WH 4M93B 2ZUQC 3D9AL 2ICCA 1MELA 4X9IA 4K3EH 4WTZA 5FO9B 3TCLB 2OZ4H 5C07A 4PY8I 3L3IB 5ITFA 4E5XA 2C1OB 5H37G 3T3PF 3C8DA 1XF2B 2OJEA 4NO3B 5DZOA 3QJHA 4ZO6A 3MJ6A 3X3GL 1RZIB 4OLZL 1KCVL 4LRIA 2EIZA 4S10A 3C6SA 1JPSH 4JY4B 1MH5A 2FSEB 2CIIB 3V6OA 4CVXB 4A6YB 4LEOB 2MCPL 4WFFD 4LDOB 1AGCA 1G9NC 1T1XB 2A6DA 1CL7H 1XIWD 5D6DC 4AIOA 1NSNH 4N0FB 4ELMA 2BVQA 1MCSA 4JRXA 4KRMB 1UVQA 1JPFA 1MCPL 2LABA 5IHZA 3U0WL 3H7LA 1A6WL 1ZHNA 3WS6A 4NZRL 4KI5D 1OD7A 5DMYA 2P47B 1XR8B 4KKBC 2DQCL 3UC0L 2YR3A 1I9RH 4MB3A 5FYJD 4FP8H 4I3SH 1RSFA 5E7BA 4NQDE 1SJEA 3DXAD 3TA3B 1A3RH 4GG6F 2BVOB 1X5XA 2Z93B 3VWKD 5I19H 3X12A 1P84J 1HHHB 4LDEB 4LKXB 4YHOL 3O9WB 3GSXA 4XZUA 2J8UB 2PXYC 1KN2H 1XF3B 2QQKL 4F57L 4Y4KD 3KPLB 2HG5B 1FDLH 2QQLL 3NOIA 5CAYB 5HXMA 1KB9K 2DI8A 4YHPA 3KYMB 2VL4A 4JDVA 5D7SH 2D0HA 3AVEA 3CSYB 3RL1A 5IVXB 3HC3L 4X4YA 3UMTA 1CVSC 1IQWH 1QBAA 2DM4A 3FN3A 3DV6B 4XPAH 1FVCA 4YXLH 1AFVH 3SE3C 4KDTC 1U91B 3LD8B 4P4KA 4DKDC 1UWXK 4Y5XB 3FO2B 1OP3H 1R3LB 1INEH 1NFDA 3QI9B 3I6KB 3O2VL 1EZVY 4Z95L 1I3GL 1T22B 3MRHB 2Q1EA 3QPXH 3BXNA 1YMHA 2CJUH 2P8LA 2QQNL 4L4TD 2D9CA 3VFPB 4YNYB 1QNZH 2IFFH 1F4HA 3RVVC 5E8DL 3RGVB 4X5XA 4KPHH 3WL9B 4Y89A 3WCYA 3OPZH 3EOBA 5L88L 1QRND 3ZYZA 4U3HA 5CEXA 1MJUL 1MF2L 3IETB 4HH9B 4MS8D 5GGVL 1YNTB 5DUBA 1CXKA 3U7WL 2IALB 2ZUXA 1HOCB 4AH2B 3LKRB 2R0LL 1DBMH 4HK0B 4R3SB 5HYEA 4CBPA 4UIKH 4QXTA 3C2SA 1RUQL 4Y7MA 5DJ0A 3QPQD 1D9KC 4OCRL 5IW3A 5KTEH 3QNXA 2IAMC 5INCA 2V5YA 4PS4H 3ETBF 1ZT4A 2DQHH 4PJGE 4WGVB 5E8PA 4D2NA 3X3FL 5CHNA 1JZ7A 3DLQR 2GJ6E 4FQHB 4PTTB 2CQVA 1QSZA 2X7LA 4G8FB 3JV4A 1Y6MR 1I1RA 4OQ1A 4GG6A 3RUGA 3MCKB 1K2DA 3LRSA 4OGAC 2VITB 4IJ3C 4JREB 4OQTH 1SBSL 1CLZH 4YBHA 1GGIL 3GDBA 4MGXA 4ZOAA 5DR5H 1NCTA 5C07B 3P9MA 5ITFB 1CGSL 4E5XB 3E2HB 1U8KA 2ICEA 3MXWH 2OJEB 4LSTL 3TBTA 1U6AH 4DCQA 3QJHB 1CICC 3GIVA 1BZQK 3WIHA 1N4XH 1J0ZA 2VNCA 2IH3B 2EIZB 3H9YA 3O2WH 1MH5B 5ICXB 3MODH 4C83A 3B2UC 5JMRA 4GXVH 4D9QD 3S8WA 1AGCB 2DICA 2A6DB 3ZT7A 1L0YA 5I30H 2AGJH 3E8UH 2IJ0C 3EOTH 2VWEC 1DR9A 4ELMB 5HI5C 4YAQA 1IM9D 3MNVA 1JF5A 1UVQB 5K59E 2R69L 5EG6C 3LKPA 1ZHNB 3VFUA 5GGTH 4TSCL 2Q7YA 4OV6F 4RGNB 3OAUL 4LPCA 2VZ3A 1PZ5A 3QUYD 4J3WA 5C7XH 2EYRA 1U3JA 1D6EB 1B4RA 3NFNA 1ZLVH 3EJYC 1UA6L 3R0NA 1WZMA 3C60D 5TFSL 3L5JA 5SWSD 3DYOA 2VC2L 2JKXA 5E0QA 4RFNB 2Q7NA 3QA3A 1FH5L 3GSXB 2FGZA 2OZ4A 3VD3A 5ID1A 1TVDA 1MHPL 4H20H 1KLUA 1JRHI 5EUOE 4LSDA 3ROLA 1J9CT 3ZYJA 5FB8A 4LLDA 1MCBA 3PUCA 5CZXC 4LLAA 3RL1B 3MZTA 5C09E 1MFCL 3AMKA 3C08L 3B5GA 4PRNA 5GXBB 1JGVL 2R1XA 2HRPL 4GSDL 2QV2A 3L95B 1CCZA 1FGVL 4I0PC 2BNRE 4PJFE 3LZFL 5J3HC 5D72H 2PR4L 1NCNA 1N2RA 4KKAD 1IGFL 2JJUA 4L5FH 3ROOA 5DVNA 3STLB 2HP4A 4OF5A 4PJ8A 4S1RL 1ZA3B 3O6MH 3BXNB 4WFEE 1JV5A 4QGYA 3MRGA 4KY1H 1R0AL 1UJTA 1MCRA 2P8LB 1JNNH 1Z0MA 5D2LE 2EIEA 3A6BL 4R6UA 4EJ1C 1HI6B 1FFNA 4XNZC 4OD2A 3V95A 4X5XB 1T5XA 4YPJA 5TQ2L 3EOBB 4NKDA 4R90L 3ZKSD 1X4ZA 3WNMA 2QSCL 4GQPH 5DUBB 4X6CF 3DVIA 1MI5A 4TULL 3WLWD 4WJ5B 4PJBE 2H2PD 2V5TA 5JTWA 3HI6L 3RNKA 4OCXL 4GKZA 2G5RA 1RFDH 1ITBB 4LNRB 1IGIL 4DZ8A 5INCB 1QFWL 1ZT4B 3WIHL 5E8PB 1G7JB 5L6YL 2FLBT 5CHNB 4PGJA 4CVZA 3R1GH 2FX8L 2ZPKL 3WIFA 1G0XA 2X7LB 5D6CA 4QEGA 4DVRH 3DWTA 1CGTA 4NQVB 4TRPL 2XACC 3RUGB 1K2DB 3DGGA 3HAEG 1C12A 1I7TA 3HE6B 4KK8D 4XCFL 4WI9A 2VUOA 1FNEA 1E6OH 4X5WA 2VQ1B 2IQ9L 3ARGD 4WCYL 3T3MF 3OGCA 5KW9L 4NQCA 3P9MB 4P23A 1JGLH 1IKNC 4AG4H 3QEQA 4QXUH 1U8KB 4ODSL 3VRLF 2JB6A 4WO4C 1W0WA 2GQHA 3TBTB 4DCQB 2JIXD 2A77H 1PG7L 5IMMA 2GTWB 2Z31D 3WEXB 1K5NA 4XVJL 5IROC 1MOEA 4O9HH 3QXWA 1DLFH 1CR9L 1IAIL 4XPGL 2FZ3A 5DFVD 3FB5A 4BH7B 1OTSC 4PYGA 3TWCH 4HW6A 4H8WL 4IRSD 4P3DA 3OKDA 3MNVB 4K3EL 5GJSH 4U6YA 4ZTOH 2XN9A 1TLKA 3F5WB 4R2GC 2Q7YB 1HINH 1DQMH 4FFVD 2BNUA 1PZ5B 1T89A 1HHJB 4U0QB 1JPSL 2R1YB 2EYRB 4OI9A 1BD2D 1FZKA 3NFNB 4JY5H 3QDGD 3T0EC 1AKJA 4PLOB 1CL7L 5JUEH 1LO5B 3N50A 4R96A 5HYSA 3OWEA 4OQTA 1NSNL 3VE0B 1VGEL 4WDIB 3BW9A 2NW2B 1D5XA 1AR1C 1FN4A 1K4DB 5JXEC 1DL7H 5HI4D 3MBXH 3SDAB 2OK0H 5FB8B 4IMKA 5FGSA 2JB5H 4MNQD 4HJGA 3HG1A 1KCSH 3UTZB 5EULV 3D6GA 4K8RD 1XCQA 3HUJF 4AQOA 2Z8SA 1I9RL 5E9DE 2BP3A 3QHTC 2R1XB 5I19L 3VRIB 1A1OA 1V3MA 1NKRA 1OHQA 1QFUL 4MAYD 3P4MB 4PJ5A 3BKYH 1N2RB 2EZ0D 3LKSB 5I1EH 2BY3A 1KN2L 4OBSA 4X4ZA 4K94C 3V6ZA 3ROOB 5CKGA 4G6KL 5I1IH 3SOBH 4Z7OE 4PJ8B 5K33A 1LK3L 5HYJE 2YD9A 4MQXD 5D7SL 4KQ4H 1F11A 4LSVH 5BRZA 1QSED 3D69A 4U1LA 5D7KD 2OI9B 1IQWL 2WINA 3MGOA 3GBLA 4XPAL 3R8BB 4DKAA 4YXLL 2NX5E 2DQTL 1AFVL 3UTTB 4F7PA 5A1AA 1T5XB 1YEDB 3NTCH 4TSAL 1T2QH 3QQ4A 2NY3C 1INEL 1PKQE 3H0TA 3D39A 4PLJC 4IBLT 3VD4A 3A6CL 4D94A 1VACA 2BDNH 3BP7A 3AS2A 1NBZB 3PP3H 2ARJQ 3D3VD 3C6LA 1CWVA 4WWKC 2VISA 4QRSB 3SCMD 3ARED 2ID5A 4L8SC 1S9VA 3WKMH 1OAXL 2FEDC 4GKZB 2CJUL 3EDJA 4NQEA 3V52H 2IFFL 4YE4H 2VXSH 4KPHL 3OPZL 3EYFB 4CVZB 3WIFB 3VGDA 4H1LH 3CK0H 3OQ3B 5BVJA 4M61A 5D6CB 1FIGH 4ZG1A 3TO4C 5HGDA 4TTGA 1C12B 1J11A 1I7TB 3HNTH 5GGUA 1X6LA 5I71B 4OZFH 1N6QH 1DBML 1FNEB 3QWOA 4X5WB 3S3PA 4UIKL 5AD0A 4JB9L 3OGCB 1K3ZA 1LDPH 4NQCB 4P23B 3QEQB 4LMQE 5KTEL 5T1DH 4NUJA 3GMRA 1W0WB 3WO4B 4PS4L 5IMMB 1RVFH 2DQHL 3DJ9A 3NFPB 5HVHC 2EDTA 4P5TD 5LWYH 1K5NB 1NGQH 4ZDHB 1EFXA 4RMWA 2WBJB 3GMLB 5F89A 3LOWA 4S1DC 1PFCA 5I1LA 2FZ3B 4HJ0D 2Y5EA 3BE1H 1LEGA 4OQTL 3G6DH 3C8HA 2XYCA 1CLZL 3VXRD 4WI2A 3VXUE 5DR5L 3OKDB 1ND0A 3D85A 4OB5H 2AV1A 1JWMB 3MRFA 2XN9B 2X44D 4NGHH 3MXWL 4JDTL 5IFHH 5FYJL 1U6AL 1S7SA 2BNUB 3AY4C 4S2SA 4NHCH 4G7VL 4UT7H 2XNAB 3GNMH 3MODL 2YA1A 2RBLA 1FZKB 3VGHA 4GXVL 4M6NL 4PD4K 4QRQA 2I9TA 3UBXA 3NCJH 5DJ2A 3ILQD 1IBGL 3REWA 5I30L 2AGJL 3E8UL 4H5SA 5BW7C 1NGWA 4RMVA 3EOTL 2I27N 1VGKA 4R96B 5HYSB 1TXKA 3BW9B 1T7WA 1D5XB 4YZFF 4F7TB 1V3JA 4XNUH 2E9JA 5AYQA 4Q9BA 1FN4B 3B9VA 1NDMA 3BP4A 1HNFA 5GGTL 4U6VH 4DK3A 3DXAB 4RGOL 3HG1B 1CIDA 3OKLA 1IFHL 1K3IA 1WLHA 4HS3A 5EZLA 2HJLA 5F9DC 3JWOC 3LPGA 1P2CA 1V3KA 5C7XL 5GS1B 3OKOA 4MD0A 1R3IH 2ZCLH 1EBPA 1RZJC 3MLTA 1A1OB 4U7MA 5HHOB 2AV7A 4OLWH 5E6ZA 4MCZA 1GIGH 1J18A 2ZSVA 4WTWA 4LSQL 5GGSY 5FKAB 3U9UA 2DOCA 3ALXA 1CXHA 3V6ZB 4H20L 4R4ND 5KZCB 4DUWA 2W92A 3EO1A 1U8NA 3BPCA 4HD9A 1F11B 5CBAA 3KYKH 3VI3F 5BRZB 5IG7B 2HFEA 4QRRD 3NAAH 2WINB 3MGOB 2XQBH 3IDGA 3KPSB 1GCFA 4F7PB 3KPRD 1AHWB 4MXVF 3QQ4B 4OGZA 2MPAH 4ZOEA 4ZODA 1YY9C 2X70A 1XR9A 4UAOB 4POZC 2ADIA 3W2DL 4G3YH 4UILH 3X13B 2OYPA 4N8VG 1MCNA 5HBBA 4X6BB 2MCG1 1IGCL 4J4PD 4L4TB 3C6LB 2VISB 3O6ML 5SV4A 1RZKH 1S9VB 3TH3T 4NKIH 1MRDH 1R5VB 1QRNB 2NY6C 3ZTJG 1T20A 5DTFB 4ONGH 3LS5H 3GBMH 2MHAA 3QUXD 1XH3A 5IMLB 5I2IB 1CGUA 3BRDA 4KKCC 5CSZA 1I9IH 3LMJH 4RX4D 4M61B 4M6OL 5GRUH 3ES6B 5HGDB 5E8NB 5DJ6A 4HQQH 4NN5B 3ZO0A 2V2WA 5IT2H 3QWOB 5MHSD 1B6DA 5AD0B 1V7NH 3D1MC 3RDTC 3L1OH 5EU6D 1ZT7A 1RFDL 4NUJB 3G6AA 1CBVH 3GMRB 5MEOA 1T5WA 4PP1D 4OM1H 4PYHA 4GAFB 2N4IA 2NXYD 3P4OB 1FL3B 4DVBB 3LQAC 4DVRL 3MTRA 5I1LB 1KOAA 1I3RA 3HMWH 1HN1A 2C1PA 2XOTA 4WFHE 5HDOA 1E6OL 4N0YH 1RJCA 1YMMA 4JRXD 4YWGH 1YQVL 2X1OA 3QCTH 1ND0B 5IQ9B 3D85B 2AV1B 5CJOH 3W5NA 1JGLL 4WHTA 4AG4L 1UEMA 2MNUA 4QXUL 3SJVD 4IRJC 2PYFA 2A77L 4MNGA 3MMEB 3C5ZA 3VXQA 4MA7H 4S2SB 4CN6A 5L2KD 1F02I 4DKEL 2YPLA 4O9HL 4JZNA 3VMPA 1DLFL 4H1LA 4M7ZC 4F3FB 3LKQB 2I9TB 3S35H 4WWID 2XFXA 3EJZD 5DJ2B 2V5MA 1NQBA 2DQIH 4P2QD 1X5GA 5FF6A 4HUNB 5F1KC 3TWCL 4H5SB 4OZFA 1VGKB 3F6LA 2W59A 1OAQH 3PP3K 4DOHE 4LCWA 5GJSL 4FQ1L 4OZGF 4LSSH 4YEFA 2NXZC 4P4RA 4ZTOL 3ULUC 2UY6A 4I9WD 5DZLA 1X9QA 3BP4B 1HINL 5DVMA 3DX6B 4M43H 4M1CD 1FZJB 1SJVA 5DRZA 5J0BA 3U82B 4HS3B 5EZLB 2HJLB 1UZ8A 1MFEH 1P2CB 1RK1A 3BN9C 3OKOB 4P4KD 3WDIA 4JY5L 4MD0B 3KXFA 3MLTB 5JUEL 5FK9A 2UV3A 2AV7B 4NO2A 5BZDA 4MCZB 4YC2B 2DKMA 5F70A 2ZSVB 5EUOF 2Z8WC 3CFBA 1KB9J 1YUHA 3ULVC 1LDSA 1PQZB 5TE4H 4IEFB 3MBXL 4DN3H 5FDYA 2OK0L 2A6KA 3EO1B 1U8NB 1KCSL 3HR5A 1JTOA 1FGNH 4K55A 3JBG7 5CBAB 2FX9H 2HFEB 3TGXA 1QBLH 2WK2A 3AXLA 1W0VA 1VKXA 3TIEA 4PJFF 3IDGB 1I1FB 2AEPH 4WV1B 5D1XA 1B4JH 4LHJB 3IFPA 4EQ2A 1CS6A 4R9HA 5C0EB 3MBED 3MRCA 2RCSL 5C0AE 4P5MA 2VH5H 2X70B 1XR9B 3BKYL 2CXGA 1U3HC 3IDYB 1U2HA 5CFHA 4ODTH 2ICWB 3UTSA 1CDBA 1U8IA 5SWZA 5I1IL 4NO0D 3SOBL 5JOPD 4E0RA 1A64A 5D2LF 1HHGB 5J6HA 1D5ZA 5I1GL 4KQ4L 1YYLH 2GITB 4LSVL 4PJAE 3ULVE 1J1PH 4QTIL 4F8QA 3RZCA 1D9KA 3TBWA 3VXSE 3HRPA 1N8ZB 1S5HA 2MHAB 3DBXA 1MUJA 4M7KH 5B38G 1OSZA 3MREA 4PP2B 5CSZB 5E08H 3VFVA 2D7OA 4HPYH 3B9KC 4LLYA 1T6VN 3FQRA 1A47A 4PJBF 2FH8A 5DJ6B 5J8OA 3VG9B 1J87A 2PKDA 2FR4A 2BDNL 2V2WB 4P2OC 4AZ8A 4TQEH 1E4XH 4G8GD 4X9FA 4M7LH 4M9OA 3LDBC 4X7EC 5I15L 1ZHBA 4OZGA 4ZPTB 2CPCA 3PIQA 1YECL 4XNQA 1LEKA 3MJ8B 3CD4A 4U1JB 1ZT7B 1LNUA 2GEEA 2VDKH 3V52L 4YE4L 5MEOB 1T5WB 3MA7B 1CICA 2VXSL 5D9SA 4Z8FH 2HRLA 3CK0L 3ARGB 4JGMA 5DVOA 4JFDA 5DRWA 3HNTL 3TFKC 1KSRA 4Z7VA 2VZVA 5JW4N 5DMKA 1N6QL 2ICES 1YMMB 1BFSA 1PLGH 3W0WD 2AK1L 1YY8B 5KSBE 2J8HA 3DHJA 4HMEA 1LDPL 2Z31B 4FG6D 4K94H 1SY6H 4Y4FC 4WHTB 3WJJC 5T1DL 1X5KA 4JO4H 4NBYB 2PYFB 4MNGB 3T0AA 3C5ZB 4F7EA 1Z3GH 1EAPA 1G7PA 5LWYL 4XPFH 2YPLB 4JZNB 4N1HB 4H1LB 3FO9B 4RQQB 3QDJD 2I5YH 2XFXB 5FF6B 2CRZA 5IEHA 4OZFB 2VUYA 2KQMA 5ACLA 3G6DL 5DD0H 4E41D 4F8TA 4TOYL 2CDFB 2IG2L 1WWCA 4JZOA 4U1HB 5ACZA 2W60A 3QXAA 1UFUA 4G9FD 4NGHL 5IFHL 2EDQA 1M05A 1JZ3A 2DF3A 3QZWG 1FNFA 4LLMA 4NHCL 2PF6A 1CE6B 4UT7L 1D5MA 4QRUB 1NUNB 4DGIH 4IOIA 3WBDA 2QL1A 5KSAA 3GNML 5HHMD 3IJSA 2C5DC 1EVTC 3S36H 3NCJL 5EZOH 3KXFB 5FK9B 3MLSH 4FN0A 4GQ9H 3KLHC 3Q6GL 3RTQC 4YHNA 5F97E 2E7LC 1VADA 3CFBB 4MNQB 2KZ1B 1YUHB 5GRJL 4XNUL 3CFCL 1HYSC 2DLHA 4QLRA 1UT9A 2YD1A 2A6KB 4U6VL 4R0LC 2VDOH 1S3KH 5C2BH 3HR5B 2ZP0T 5I76A 4KK5C 4XHJC 2YD8A 3CXDH 1FFPA 1W0VB 3TIEB 1ZAGA 5D1XB 4HBCL 3SKOA 1R3IL 2ZCLL 1I9JL 3IFPB 4PBVC 4XC3H 1HK6A 3IFLH 3MYJA 3MRCB 1RPQA 4OLWL 4GKNA 3NCEB 4S1QH 1GIGL 1NLBH 3QQ3B 3PDGA 3GRWH 3C09C 5TDNA 5DJAA 3RWIA 4G42A 4U1IA 4ONOA 5I8EA 1U8IB 1QSEB 4E0RB 2X4UA 4N9GA 5J6HB 3V7MA 4LKCB 3DO3A 1I7RA 2I07A 1ED3A 1R3KA 4I0CC 3KYKL 3RZCB 4K3JH 3TBWB 3NAAL 1FNSH 1T7ZA 4RMRA 5JDJA 4K23L 1P7HL 3VGAB 2XQBL 2IBBA 4MHHG 3DBXB 2Z8VC 3NIGE 1MCWM 3LV3A 1NC4A 1OSZB 3MREB 2D31A 5ALBL 2NY1C 1CF8H 3VFVB 3ZE2E 1VEMA 4UV7H 4PJEE 1X3DA 2FR4B 3O4LD 5F9WB 2NY4D 1JZ2A 5B3NA 5ELIA 1RZKL 4HHAA 2X4QA 1R3HA 1MRDL 3PIQB 4NKIL 2D7PA 3IAQA 4UU9A 5E2VH 1IKNA 1UXSA 3BJ91 4WO4A 3LS5L 3ZKMD 3GBML 4KVNH 3QDME 2VLJA 2VLKA 4NZUL 2W1NA 4PRDA 1CICB 5C0BD 4NO5A 3LCYA 4AT6A 5IROA 1I9IL 1C7SA 4HCRH 3WNPA 5I74B 5DS8B 4JFDB 1RZJH 5DRWB 4LFHD 3INUH 4Z7VB 4GLRI 2AXGA 3CJJA 4XP6H 5DMKB 5IT2L 3BSZH 4PJXF 1AGEA 1TENA 1J1OH 1F8TH 1V7NL 3U7YH 3WXVH 4P5TB 1GAFL 5K9JL 1Q9OA 4X4XA 5L8JB 3E3QE 1CBVL 3IF1B 4OM1L 4WRLA 4NNYA 1WZKA 1AD0A 4OZIE 4F7EB 2A6IA 1EAPB 1G7PB 3PABA 2HH0H 3RHWF 1KTDA 3BI9X 1MRFH 2V6HA 3P0VL 3VXRB 1X44A 2CO6B 3BKMH 2YRZA 3T0EA 3T1FA 4FQXD 3HMWL 1MIMH 3FAWA 3U83A 5IEHB 4N0YL 1P6AB 4O2CA 3L7FA 3QCTL 4JZOB 2DLEA 3AUVA 2W60B 5JXEA 2VDRH 1TDQA 2YZ1A 3PGDA 1M05B 1AY1H 4LLMB 4MA7L 4U3XA 5ESQA 4FZ8L 4ZNEA 2KZWA 5C0CE 4P59H 2PYED 5ICZA 2PW1A 5KSAB 4BM7A 3IJSB 5F7KC 3V9FA 1CFTB 1WBXA 1S9WB 5D7IA 2DQIL 5D2NB 1NFIA 1CFQA 4HUUA 5KANG 3WFDH 3BQUC 1VADB 3ZMRA 4C55A 1Q1JH 4QRPE 4LSSL 3Q2CA 1N3NA 1SY6A 3SGDH 5DEFA 2WM0A 4M43L 3H3BC 4LPVA 5I76B 1MFEL 2HAZA 3K80A 4WUUD 5EU4A 1T6WA 5GSVA 1ZGLP 5INDA 4YDIH 3OJMB 3QB7C 3S88L 2L4OA 4GKNB 2YUWA 2KBGA 3LQAH 5GGRA 3ARUA 4PJ9C 4PRPE 3V5DB 5T3ZD 4OLXH 2R0KH 5TDNB 3RWIB 3JZ7A 4NZTL 2JCCE 4PJXA 4QRRB 5TE4L 4NQXA 4DN3L 2XG5A 2X4UB 4WWKA 4N9GB 3RA7H 3FTGA 1I7RB 3DGCR 2I07B 1A21A 3G6JA 4L8SA 5ESVA 1R3KB 2BHYA 2FX9L 1OF2A 3B8SA 4ODVH 3TO2A 4EIGB 4JFEE 3LSOA 3QSKB 4MB4A 4M4RA 2AEPL 1BOGA