1NMBH

The structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
b'QVQLQQPGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTLTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N9 NEURAMINIDASE
publication title The structure of a complex between the NC10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the NC41 antibody
pubmed doi rcsb
molecule tags Complex (hydrolase/immunoglobulin)
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmbH00
2K7PA 1NMAL 3KPPB 3IF1B 2VXVL 3KYMB 2O5XH 5BV7C 1FSKB 1U8HB 2R8SL 2HRPL 3IKCA 1JF6A 2ATKA 2P24B 5DUPL 5FKAA 4Y19E 2YRZA 3GBMH 4Y4KB 2ZUWA 1GC1H 2UWEA 3MYZA 2DJ4A 3B9KD 1NSNL 6FABL 5D7SL 2YOCA 4MCYB 1MI5D 1U2HA 1VACA 2R2CA 1AC0A 5C0IB 3ZE1F 1IL1A 1EGJA 1Y6NR 3OBAA 3QHZH 3EDKA 3DUUB 4ELMA 4PLNC 1JCKA 4K9EC 3NPSC 2IAMD 4WNQB 3BW9A 2EH7L 2OR9L 2CDGA 2VLKB 5EUOF 2E9WA 3L3GB 2KQMA 4F7PA 3BKML 1BQLH 1OWWA 1GOGA 5EWIL 4U6XA 3VH8G 4HV8B 4QHMA 5TPWH 5MERA 2OSLB 3TVMD 2Y23A 5B38G 3TNNA 2RQ8A 4HIIA 5A1AA 5ID1A 3B9KA 4N9GB 1K8IB 3F7RA 2I5YH 5IVOA 1D9KC 1X4YA 4OZGE 4LPTA 4Y5VC 5EUKB 1FL5B 1EO7A 4WHTB 1FO0B 3O41B 2BHZA 5JQHC 1XZ0B 2BC4A 3WUWB 2PYED 4DN4L 3S88L 2WBWB 2IAMA 1RURL 3QUZC 3SJVB 5ILTL 3WXWL 1FBIH 3ULSA 3P30H 4OLZL 1QFOA 2Y36H 2HFEB 5DURD 3RVWC 5BVPH 3VFUB 2EDWA 4E0RB 1RUAH 4K3GA 2BXZA 5ECJE 4H5SA 2EZ0C 3PWLB 3BZDA 4GAGL 4I0PC 4XCFH 2HLFD 4RFOL 2XZAH 2JE8A 2DBJA 1TTFA 4HS3A 4CVZA 1RUPL 1JF1A 4YUEL 5C9JA 2IFFL 4LVHB 2HP4A 3OAUL 3VD7A 4ELKB 4ZS6D 1RK1A 2MFNA 3F6IA 4X5XA 1CICB 5JZ7D 5IEKB 5ISZB 4YR6A 1KJVA 3PWVB 1ZLUK 1S3KL 1Q72H 3U83A 3MZTA 1MFBL 4Z7OF 3MNVB 5B39B 4ZDHB 3MV8D 1G7IB 2XFXA 1BIIA 5LGJA 1HILB 2M26A 3I6KA 1QZ1A 3CSGA 4J3VA 3O8XD 4LFHD 4D9QE 1X5AA 2P47B 4ZUUB 1NBVL 5I1AB 2HJLA 4G42B 1XF4B 3PGDB 2IH3A 2L7JA 2VXQL 2ATPA 5EZOL 1J9CT 1MHEB 3GSNA 3CX2A 3FONA 5MENE 4KI5F 2OK0L 2ZKHL 5F7DB 3RVUC 2DQEH 4O02L 3GMPB 1FYTD 4V1DA 4QYOB 3O3DB 4M1DL 1FVCA 3THML 1A6TA 3IU4H 3OKKB 4G7VH 1PLGH 3MV8A 4EXPX 1C5BL 3M8OL 3MJ8B 1XGTB 1AD0A 1MQKL 3WIIH 2X44D 3O8XA 1FNAA 4OKDA 5ALBL 5GGTL 12E8L 3REWB 3WFEL 1WF5A 4Z78A 1ZVSB 3LRHA 2Q76A 3LSOB 3VXSD 2NY4D 5IP4A 5HDBF 4C56E 1L0YA 2DYPB 4IMKA 1TVBB 1FE8H 1QFWL 4QXGH 3V5DA 2FJFA 1JGVL 4Q2ZB 3TBSA 4HXAH 4NJAL 4R4ND 2ZUQC 5DR5L 1OAUH 1FNGB 3ULUL 2IPUG 4PG2C 3V4VL 4DK3A 3HE6B 4YFLI 4L8DB 1MJ8L 2EYRA 5FAAA 3QA3A 3HNVH 4MNQD 1QA9A 2NZ9D 4XPTH 1EAPA 4M7LT 4HUXB 3G5VB 4ZTOH 4JPVL 1IEBA 2GTWB 2D4DA 1JNHA 1WQVT 1GZQB 1P4LB 3QISA 2FGZA 4U1NB 4MVBD 4QOKD 3B3IB 4M7LH 1CFQA 4Y5YB 3CSPA 3MFGB 2WWKT 1FLRL 3EYOA 4OZFG 2Y4SA 2ZSWA 3A6BL 4K94H 5FO7B 1IKFH 5HGBA 2R1YB 3PNWB 2CKBH 4KMQA 3QDGB 1MSPA 1V7NL 3G6JB 1RZJL 4MAUH 2X7LA 5FYJD 4OI9A 2H9GB 3CMOL 2NY3D 1OOAA 3NZHL 3KPLB 3O9WB 4MNQA 1AGFA 1CFTB 3HRZA 2IWGA 3SE4A 3O3BA 1M6OB 2PYFB 1GHFH 3BGFC 2O5XL 1T83C 2Z31C 4KUZH 3W0WE 4QOKA 2LVEA 2NMSA 3HPLB 5DFTA 1MELA 3MROA 5DQJB 2CKNA 3TCLA 2F53E 4JKPH 4P46D 3UBXI 2OLDA 3GBML 5F89B 1CDGA 1GC1L 3KPNA 3ARBB 1BD2A 4Q6IC 4U4BA 3W9DB 1KB5B 5D1XD 4X6DE 5IB3A 2BCKB 3HCVA 4F3FA 4U1LA 3O45B 1EBAA 3V6ZA 3EO1B 5C71A 3QHZL 3O2DH 3SGKA 1M7XA 3BEVB 3BVNA 3MRGA 4EZMA 5F9AC 4WI7A 4WHYH 4EVNA 3CVHA 2CRIA 3T8XB 1OT1A 1XH3A 2NNAB 1NC4D 3HR5A 3WS6A 5IIEB 3W81A 5I1KH 4NWTH 4BFIA 3NCFB 3K81A 3IRZA 4KDTA 1U3HB 3X12A 5CMAA 2ICWJ 2GI7A 4B7LA 5J4MA 2IMNA 3PWJB 3HNTH 5TPWL 4PGEA 3BZFA 5TQ2H 5C0NC 2XWTA 2BXYA 2VUYA 3GSVA 5HYJA 2FH6A 1R3HB 4XNZB 3UPAA 2I5YL 5IJVA 2RFXA 5HI5C 4TPRH 2FD6H 2XY1A 4GW5B 3RWEB 2MQ3A 1TVHB 2JLLA 1T0MA 3HZMB 4MA8H 5HGAB 1DLHA 1A6AA 5D1ZC 5HVFB 4JFDA 1U8MA 2X2YA 3IGAB 5J12B 1FBIL 3RWCB 3P30L 3DUHA 1DQMH 1TIUA 1FVDB 3TPUB 2VLJB 2D03H 3QXVA 3D85A 4XPBH 2Y36L 3HUJB 1LDPH 5BVPL 2BNRD 3FFCB 1RUAL 3KAAA 1MWAA 1IZJA 4XCFL 1ED3A 4OM1H 5GRXG 1J05B 1I85A 4DKDC 2YSSB 2HTLD 4QO1A 4QRPD 2XZAL 1AGEA 3OKNA 1ITBB 5J3HC 4NO2A 5M95B 4MQXD 4MD0B 3QXTA 4WRLA 4JFZH 5FECA 5H8DA 1PSKH 3BP7A 4N8VG 1Q72L 3E2HB 1J0KA 3TP4A 3VDBA 4ORGB 5FB8B 1EEZB 5T33H 4G6JH 4NKMB 4D3CH 3L3JB 4PTUA 5EU5A 3T0EC 1KCLA 3C9NB 4LCWD 2ED7A 4JM2C 3VXQA 4GBXA 1KUMA 2BNRA 5CZXC 4LSPH 3SKOA 1F3JB 4E41B 4PRAB 3RWDA 4JREC 5TH2A 2DQFB 4HGWA 1CXIA 3CC5A 3KHOA 1W8NA 3PL6C 1XGRA 3EOTL 3D18A 2RJMA 3HG1D 2J8UE 4CW1A 1A6VH 4FG6D 4MQ7B 2NY2D 3U79A 3HC4H 2IQ9H 3TN0D 5KVGH 2XKNB 3NIFF 3PXHA 2DQEL 1T1XB 1XR8A 3HI6H 4HKXA 1XGYL 1MCPL 1VFAB 4HZLB 4UOJA 1PQZB 4X6CB 2P5WD 1HK6A 3UTQA 3WFHA 3VGAC 2ZOKA 4XT1C 4J8RA 1PKQE 3IU4L 4G7VL 1DQTA 1PLGL 2FZ3A 4HIHB 3SE9H 1MHCA 4ZFFA 4RSVA 2XT1B 4POUB 3OGOE 3S5LG 4KQ4H 2CR3A 5DUMH 3VG9B 3WIIL 3TZVD 1C16A 5IB5B 4YBHA 3P4MA 2C3WA 2XWJB 3BPLC 3QZWB 4X8JA 3HG1A 5KVFH 4G8GD 2QKIA 2VDRH 3KPSE 3NACH 5DRWB 1FE8L 4QXGL 2R0ZH 3VXMD 2HJFA 4HXAL 4ESKA 4MA3B 1IT9L 1OAUL 1RFDH 1UT9A 3F5WA 3V5HA 1S9WA 1GH7A 3VWJA 3RWJA 1NC2A 4P2RE 2Q3ZA 1Z9LA 3SGEH 3B9EA 1HXYB 1U9KA 3LKPB 3QWRA 4HPYH 4NFCA 3HNVL 5HPMA 5HHNA 4XPTL 2IQAB 3MV9B 4ZTOL 2MOVA 4K3HA 3VRLF 1NDMB 3C60D 4XP1L 3TZVA 3ULVC 4GKSA 4M7LL 3KLHC 1S5HA 5D2NE 4G8GA 3BSZH 4K94L 1IKFL 3W5NA 1M7IA 4QGYA 3BOVA 2A74B 2CKBL 4Q6YA 3LRSB 3VXMA 1FL3B 4GAYA 1CE1H 4MAUL 4NUJA 5AUMB 5JXEA 2CIKA 4O00A 1ZA6B 2Z4QA 1ZLWH 4KTYA 1WBZA 1K8DA 1QSEE 1MIMH 4ZQKA 1C1EH 1GHFL 2HFFB 4KUZL 1JYXA 4KK8C 2MKLC 3D69B 5C0JB 4YDJA 4PJGA 5J13B 4YHLH 2AEQH 1U42A 1JUFA 1ZWIB 4XCEB 1ZEAH 4XI5D 4XNXH 2EKSB 1T3FA 4TUJB 4HHAA 1KCKA 1NFIB 3RY5A 3FTGA 4WDIA 2Y72A 2JCCF 5HY9A 4Q9RH 2WP3T 3EIFA 4WGWB 3MRNA 3SN6N 3FB8B 3VXTB 2X4NB 4QTHA 1HQRB 3BQUD 1JGDB 2ERJB 5EFIB 1G6RB 3O2DL 5GS0C 5JIHA 1FFPA 1S8DB 3EBAA 5IROC 3K8LA 2XTJC 3NIDE 5I1KL 4YXLH 1KB9J 4AMKH 4PJAF 5E6IB 4NYLB 5I76B 3PWPE 3QIBC 5A3IC 1N2RA 4LPXA 5A43C 2W9LA 1ZOXA 5EU6D 5IV2B 2I9LA 2H1PH 3VWKD 1URLA 3HNTL 4OIBA 4NKDA 3D0LA 5TQ2L 3OKDA 2W9DH 1CXLA 3KPQB 4LVNB 5IVZB 2VC2H 1X5ZA 2DM7A 4CU8A 4PJ5E 5FHAL 4PUBH 4TPRL 4U1HA 2CD0A 5DRNA 4LSRH 1I7UA 1KIQB 3ESVF 2ED8A 4MA8L 3T0XA 3CZFA 5D7IA 2N7AA 4Z0BH 4C83A 2DN7A 3E6FB 1FNEB 1T5WA 3T2NH 4PGCB 5D7KD 1DJSA 3VFRB 1G84A 5L8LB 3QJFB 1QP1A 1Q94B 4RGMC 4L8SC 1DQML 3QULB 5KW9L 4QHLB 1H3VA 2D03L 3S4SB 4XPBL 3RY4A 1KACB 3TO2B 1WT5A 3BP5A 4NPYB 3VWKA 1LDPL 3T2QA 3TEUA 4OFDA 1GSMA 1ZA3A 4ODHH 5BOZG 2V5MA 4NHUA 4OM1L 1ZV5A 3S3SA 1UXSB 3L95A 1FC2D 3QFDB 3M45A 3CUPA 1FGVH 1U8JA 4ZO9A 1XMWA 1CFVH 3BDXA 5TF1H 2P43B 3DROA 4JRXD 1MCFA 4GUPA 2HVKB 2Z93B 3LN5B 5CJOH 4JFZL 2YUXA 1XF3B 1YMMD 5DEGA 4I2XA 4DVRH 3UTOA 4KZDL 2WWKO 3L3IB 1PSKL 2IEPA 3S35X 1F11B 2OI9B 4R3SA 5E4IA 4FQXB 1I1RA 4CRPA 5T33L 4G6JL 4AEEA 1NAKH 4D3CL 4G9FA 1CDUA 1NCBH 1XEDA 5AYQA 3SGDH 4OZIE 1H3GA 5IMKA 5LG1A 4LSPL 1E27B 4QRRA 3QT2A 1D9KD 4JAMB 4YE4H 4EUPB 2F8XC 3V0VA 2VE6A 3SGJC 2VLRB 5GGRA 5FM5M 5CBEA 1A6VL 4G7YH 5EU4A 5I71C 2IPKB 4JRXA 5IF0B 3HC4L 5DC0A 2IQ9L 3MUGB 1HH6A 5KVGL 3MUZ1 3QUZD 3HI6L 4W4OC 2FBJH 2ITCA 5F6IC 5TDNA 4A6YH 1AP2A 2EYSB 4AIOA 1F90H 3BP4B 3RVWD 1XGQB 1ZHKA 2YPVL 4OF7A 5DVKA 3FOLA 4EXKA 2LFGA 1K2DA 4HLZG 4LMQI 2EZ0D 4YO0A 4I0PD 1JFQH 1UXWA 4KUCD 4KQ4L 5DUML 1A6ZA 1I8MB 4ZO7A 4MA7H 1AXIB 2OL3H 1W72H 3U9UA 4O2EB 1RJYB 5I8OH 4WFGE 4BK5A 3K74B 4LEOB 2VABB 2V7NA 4HUWA 2ZWLT 1D3CA 4I5BB 3RU8H 5KVFL 1F2XK 2VDRL 1KN2H 1OAKH 2ICEB 3NACL 3QEGL 4JFQB 5TGBA 3VFTB 1BM3H 2BY1A 4PJIE 4AL8L 1RPQA 1UA6L 5DHYA 5FOBB 1KPVB 4C4KT 1RFDL 5CIPA 2UVEA 2F5BH 3V4UH 2P8PB 5I1HH 3VI4F 5MI0C 2GUOB 4HPYL 3GRWA 4RRPG 3P11H 1JZ8A 4I0PA 1ZLSH 1CU4H 4CVXB 1EHLH 1EVUA 1UQSA 3GM0A 4QHUB 5EC1A 2ADJA 4HXBH 3VXPB 3QDJA 1LK3H 4JANA 2IF7A 3MRDB 1GYAA 3RVUD 4G6KH 1NPUA 3L3DA 1KJMA 3BSZL 4NO0D 2ZUVA 3LQZB 3CH1B 2OYPA 1FC1A 2VL5A 2NX5B 3ISWA 3WEXA 5DT1H 2X89D 3MRMA 1CE1L 4JZNB 3EO0A 3HI1A 1G9NH 2BRRH 3ARDB 3QRFM 1PG7W 4JFFA 1A1NB 4U3CA 5B3JF 5CD3A 3ULVE 4UIKH 1LILA 1XR9A 1MIML 4KVNH 5DMGC 5C2BH 4P99A 3TA3A 4LLAA 3Q5TA 5HYQA 2AK4D 1C1EL 2W0PA 4L3AA 2VXTH 3MGOB 4UDTA 4XXDA 1WWAX 4YHLL 2AEQL 2X5PA 2Z8VC 1OW0A 3QEQD 1ZEAL 4XNXL 1VESA 3FT4A 3FHQA 5KS9B 1P7KB 3VRJB 2BNUB 2X89A 2CLVB 2H26A 4J1UB 4U1GC 3IXAA 5F7WC 3WIFA 4R7NB 5I73B 1YEJH 2E3VA 1T03H 2EYTA 1JGEB 1A8JH 3T1FA 2ADFL 3SCMB 2BVPB 3MV7D 3T08A 4YXLL 1IC5H 4L4JA 4AMKL 2E27H 2R9HC 4POYA 4NKOB 5DSCA 4OFVA 4Y4HC 5C08B 4I18A 2H1PL 5JQ6H 4OIAA 3V0AC 2W9DL 2NW2A 4HX1A 3DV4B 2VC2L 3OXSB 5DGRA 1ORSB 1UACH 4PUBL 3BPNC 4JKLA 4QEGA 4L4VB 1DQQB 2G75B 4LSRL 4WV1A 4R7DB 4MDJA 2E7LA 5GIRB 1K4CA 5E9DB 1HHKB 4Z0BL 4RDQG 2Z31D 3T2NL 4P0DA 4M8QA 3MV7A 1NANI 4XAWH 1I8LA 3BRGC 5J6GB 4I0KA 3TBWA 1YJDH 5HGDA 1U8QB 1JHKH 3PWPD 3DXAE 2I26N 1YEKH 1IC1A 3OV6A 3PV6B 2AV7B 5I2IB 5T5NF 2E6JA 1VENA 3VXNA 3ELAT 5IWLC 4ODHL 3T04D 2BZDA 3E3QE 3QQ9C 2IALB 3PXJA 3V9FA 2DQDH 3JTSA 5JOEA 4GG8A 2ADIA 3JV6A 4LPVA 3I85A 1FGVL 2Y25A 3NOIA 2AS5M 2VAJA 3ZL4H 3IFOA 4RAHA 1HYRC 1XGPA 3RWFB 1CFVL 35C8H 4Z9KB 5TF1L 3Q1SH 1I1YB 4K7PX 1JWUB 5CJOL 3UZVB 3KLDA 2Z31A 4DVRL 3M1BA 4UNTA 2IANE 4O2CB 4V1DE 5I16A 3MLWL 3P9LA 2VN7A 2EDQA 3HN3A 1N26A 1KTDB 1VFMA 3T1WA 3H9HB 2D4FA 1PEZA 1Q9LA 5I9QC 4HS6A 3BN9C 1NAKL 5C0ND 3BHBB 4P57B 1D5BA 1AIFA 5BXFA 4HWEH 3UPRA 1NCBL 4BKLA 1FAIH 2R23A 3EGSA 3PWNA 4Q6IA 4PRHE 3GMMA 4BFGA 1TTGA 1QO3A 5HI5D 4DKAA 4YE4L 2HKFH 3QIWA 3LKNA 1FFNB 4J3SA 4V2CB 2VDQH 3F7YA 3O81A 4YDKH 4G7YL 4EQ3A 1HWGB 5D1ZD 1QR4A 1BJ1J 3QH3B 2B1HH 3P77B 3FO1A 5IBUB 5EUOA 2NXYC 2FBJL 4IRJA 3GMRB 4A6YL 5F9JB 3C5ZC 2CO7B 5BV7H 1WTGT 1F90L 1BX2A 4F7MB 4XCCH 4YGVA 2X4QB 4OJFH 3NBNA 4AZ8A 5T3ZE 2QTEA 5KZCD 3MFFB 4K07A 3CX5K 3F7VA 1JFQL 3GMNB 4YWGH 1FN4B 4PRPA 1XFPA 1IM9A 1DFBL 3IDUA 1WUNT 1W72L 5J3HD 5I8OL 1UH4A 3LEXA 2Q3AA 1UVQA 5KSAC 1L7TH 3SDXE 4PREA 3PQYB 2GJ6D 4R97B 3UO1H 4DOHE 5J7CC 5D1ZA 4LF3A 1KN2L 1OAKL 1H8OA 2AEIT 3BI9X 1BM3L 2WIIB 3C8KB 4FXLA 1EMTL 3H0TB 3T0ED 2F5BL 3LD8C 5DD1H 3V4UL 5I1HL 1X6NA 4JM2D 2C3XA 1SBSH 5CZXD 4PJEB 3TBYA 3P11L 3DHMA 2E9JA 1CU4L 1ZLSL 2MTPA 1A1OB 5LGKA 1EHLL 3CLEH 3PL6D 1QLEH 4D0CA 3G6JF 4HXBL 3PP3H 4N0YH 1LK3L 2XRAH 3L5WB 3KPOA 2J88H 3FB6A 4Z7VB 3PJSB 1BLNB 2R69L 3LQMA 4RX4D 4G6KL 1WV7T 1J1OH 3IJYB 5KAQF 5E8EA 5TDPA 1DBMH 3BJLA 1C08A 2X4UB 4IRSB 1BD2E 3BGAA 2PW2A 5DT1L 3FT3A 3MBEA 2IBBA 1KJ2A 3U4EA 1G9NL 2BRRL 3MRKA 3T0EA 1Y0LA 2P8MB 5I8EA 2CKBB 5GRUH 3S7GA 4I3GA 4UIKL 1I7RB 4KVNL 5EOTA 5C2BL 5I1GH 1JGUH 4RWHA 3WFZA 4ZFZB 3UCRA 2VXTL 3IJHB 1A7NL 2VB5A 3AB0B 4NN5C 4MWFA 5ICZA 4NQCE 3B83A 4X83A 2P46B 3U48A 1KF9B 4Z77B 4X5WA 3BRDA 2X1XR 4LKCA 4APQB 4QRUA 3NCYS 3UTSA 5HYJE 3U0TA 4EN3B 1I8KB 2EIBA 1KT2A 5BZDA 4QY8A 3AS0A 1YEJL 1T03L 1YY9C 5F1KC 3BEWA 5HHME 3ULVD 4PRDB 3L7FA 5J1SC 3F8UB 4NNXB 4XAKD 4JFDE 3MLRH 2E27L 3O11A 2I9TB 4TVPD 3KLHD 3H7BA 3CFBA 5DHVB 5C0BA 4OB5H 3V6FB 4D0DA 5JQ6L 3CFDA 3BMVA 4W6XB 1K85A 4U2ZA 5DHXB 4Z18A 4HGMA 4X98A 2X10A 3HZYB 2BSTA 2BVEA 4JLRA 1UACL 3A67H 3UTZA 2YRPA 1A4KB 2N1KA 4NRYA 1RD6A 4WFHD 3HUJF 4F57H 3V52H 4ISVA 1SJXA 5E8NB 1VHPA 2WANA 1JTOA 5DK2A 5LXGH 2UWEB 4JQXA 4R4BA 1L7IL 4KK8D 4XAWL 2DTSA 5EBWA 1YJDL 1GJIA 5I1CH 1JHKL 1Q9KB 1EEUA 3IRPX 1YEDB 4LVHC 4P3CH 5C0GA 5IFJA 1XIWB 1YEKL 4JZOB 3G9VA 5SWQB 2HVJA 3NN8A 3FB5A 1CICC 3MREB 4C4KO 3T4YA 5HSFA 4KXZH 1A1MB 1NUFA 1TMCB 3BW9B 2X40A 5J57B 3UAJC 4NQSA 4IJ3B 4ZFOA 2DQDL 5GS0D 1EERB 4GQ9H 1V3LA 5ID0A 2HN7B 3ZL4L 3VGGA 2A6KA 2XTJD 1L4IA 1YA5A 35C8L 3R0NA 3Q1SL 5SV3A 2DLTA 1PG7X 3B9KB 5J11C 3QIBD 5A3ID 1MI5B 3MRLA 1QACA 1YMHA 2N7BA 4PJCE 5DJYA 1QLFA 3TYFA 1P6FA 1Y6MR 4JFPB 4ODUB 4HWEL 1FAIL 2BC4B 4H1LH 1PYWA 4HWBA 1AGDA 5IKCB 2QR0A 3ULSB 1G0XA 2HKFL 3RUGE 1LD9B 2CGRH 4Z7QF 2VDQL 3SY0A 1ZGLA 4QXUH 4YDKL 2FYYB 2IBZX 3LKQA 4JQIH 3TVMB 1ITCA 5IJKA 1OVZA 4PGDA 2B1HL 1DEEB 3CDCA 3CVIH 1IVLA 2LE9A 2F54A 2Q7YA 4CVZB 1P2CB 1YDPA 5FGBA 1A02N 5BV7L 2C3HA 4X4XB 3GKWH 5DQDH 5C6WH 3GSUA 4XCCL 3CDFA 4ORZC 4OJFL 3PE9A 4OKVA 4RMUA 2J8HA 2PYEB 3DX9A 2AV1B 4YWGL 3HAEH 4G6FD 1ZGLM 5C0FA 3HE6C 1BQHB 5E94A 2XFXB 1BIIB 3UO1L 3TIEA 1MLCA 1OY3B 5I8CA 3U0PA 1ND0B 4QCIA 2QQQA 2IH3B 2CMRH 4M43H 3PP4H 4Y5YC 3JVGC 5DD1L 3H9SD 3IXTB 1SBSL 1B0WA 4BH7B 1RJCA 2AJSH 2GYSA 4Z0XB 4X99A 4KRPB 1G0DA 3CLEL 4MX7A 1J0HA 1KCSH 1QLEL 1A6TB 4ZFGL 4N0YL 1AE6H 2XRAL 3MV8B 5GRJH 2J88L 5IW1A 1T1YB 1CFNB 1DUYA 1J1OL 1UM4H 3SGEI 5I66B 4XBGA 4BZ2H 5T1MB 3CSYA 3RFZC 1DBML 4B0MM 3GHEH 4Z6AT 1ONQB 5FA4B 2DD8H 1PBYA 5I75B 4ENEC 2FO4B 2ZPKH 4N1HB 4KKNA 4WU7A 3OXRA 1U8IA 5FKPA 4OV5B 5GRUL 1FG2A 5F88A 4BQ9A 4UAOB 1MCHA 1JTPA 3D1MC 5F9WC 1QFUH 1FYTB 2FJFB 2JJUA 5KBNC 1WZ1L 3SGJA 3P0VH 3RWHB 5I1GL 1JGUL 2ZNWA 1ZHLB 4NKIH 1CD1B 4ZSOA 4BSVA 1OLZA 5EOQH 4W4OA 2H3NB 5CINH 3U7WH 2DIBA 2YUWA 1OAXH 4ETQA 1CGTA 2YD9A 4W4NA 1AQDA 2HFGH 3QXAA 1MCJA 4NN7C 1CF8H 2Q1EA 2DQHL 4XVSH 5EU7E 2NY4B 3VXSB 1XGUB 2ZG3A 1KPUA 3ARFC 1CXFA 3NCYP 2E6QA 3OKOA 1T2JA 3BZ4B 4F8QA 3NH7H 3WD5H 1LK2A 1YQVH 4L4TD 4XNZC 4F37K 4Y5XA 5SWZA 5FM8A 2X7LB 3MLRL 1HKLH 4LHUB 4DCQA 3P3YA 1UH2A 1UWXK 1R5VA 5ERWA 3C09C 1A21A 3ARGC 4OB5L 1HZHH 5F6HJ 5C0CA 5I0DA 5GXBB 2OTWA 3W2DH 4EKXA 4D8PA 2NY5C 4QOKB 2XN9D 1SJEA 5ETUA 4AEHH 1IAKB 4S2SA 1J8KA 4LGRB 4F15B 2R4SH 1DN0A 3HE7C 1JV5B 3V52L 3L3HA 1G7HB 5DMGD 5DQ9A 4M61A 2OBGA 3RTQA 5LXGL 3ALPA 3T3PE 3OQ3B 3EYSH 2CPCA 2WBJA 2B39A 4N1CA 4O5LH 1NAMA 4U1LB 4NM8L 5I1CL 3JWDC 4KDWA 2VH5H 4P3CL 2NY3B 3MRGB 4G9FE 4EVNB 1J11A 1WZKA 4JN2B 4FRWA 2BNQE 3ARRA 4ONFH 3HR5B 4L8BB 1R3JB 4N90E 4QRRE 1AO7D 3NIGE 3TESA 2CDEB 3I6LD 1ZT7A 3WKMH 4GQ9L 5I18H 4XGZA 3EAKA 3REVB 5I1LA 2VDNH 2UYLB 4P46B 3BZFB 1AXTH 3DO7B 1EGJH 1QG3A 4GW1B 2APVA 2R9HD 5D1XB 4NZJA 2RFXB 1JE6A 3P4OB 3ULVH 4Y4HD 4Z95H 3ILPA 1LP9B 3MO1B 3GEWB 3HPJB 2FECL 1OP3H 4JKKA 1DLHB 3W9EB 3ZT6A 2JCCA 3MJ7A 1DDHA 1NC4B 3RBGA 5EO0B 3D6GA 4I4WA 1KCUH 3IDIA 1LGVA 1JHTB 1FZOA 5LQBH 1FNFA 4O2FA 4PJ7B 1GRWA 1NFDE 3TGXA 1FV1A 1DVFC 2H45A 4HG4K 3NGBB 3RI5K 3V7AE 1U93A 2CGRL 1HHGB 1LEKA 5JXAH 4QXUL 4RMRA 3KLSA 2F9BT 1QVOA 1MWAB 4PJAA 5IMOB 4CL7A 2GKIA 4X4ME 3RQ3A 3SGDI 3ZKNC 3CVIL 4GS7C 1MAKA 1XF1A 1G7JA 1FZMB 3GKWL 4UZGA 5DQDL 5BO1H 5DJ0A 4UNUA 3IS0X 1KXTB 2YBRA 3BDYH 3K8KA 3QQ9D 3GJFK 4ZXBA 3G08B 5CEZE 4JE4B 3HS0B 3TWCH 2ZUUA 5F3BA 3QDJE 5DYOB 1OTUC 1ACYH 1YY8B 3BDBA 5EU5B 3MTRA 4OBRA 2BNRB 2E8ZA 3ULUF 1W72B 4UOW0 5J6HB 1CG9B 4MAYC 2VZVA 3VD3A 4R4FH 5DEFB 5TH2B 3N1FC 5SX5K 3WN5A 5GS1C 4F80A 4QRPB 4M43L 3BN9D 3D18B 3PP4L 5CSZA 1C5CH 1P84K 1D6VH 4GKNB 4JFFE 1LDSA 2CDFB 4MZ2A 5IWLA 1S9XA 2AJSL 2X4PB 4OCWH 4RBPH 4J8RB 1KCSL 3I75B 2PN5A 1AE6L 2Y5EA 5GRJL 4ZFFB 2DQTH 4HW6A 4YH6A 4LCWB 2NXYD 1U6AH 1UM4L 4TNWK 4BZ2L 4RGNC 3C5ZD 3DIFB 3GHEL 3GSNH 1B9ZA 5ITBH 1AXSA 3EJYC 5DJDA 2DD8L 3T09A 5J13C 4X8JB 3IDMB 2ZPKL 2NY2B 2QV2A 4PD4K 1DBJH 1TJIH 2OJEA 5D96B 3TN0B 3D48R 1PFCA 3ZHKA 1QFUL 2ZUTA 4Q0XH 5KS9F 3MRBB 3P0VL 2P5WB 3HC3H 4FOMA 5GRWA 3F5WB 5KSAD 4NKIL 3RWJB 4PLJC 1MH5A 2VWEE 4JG0H 2BY2A 4MJ6A 4YAQB 5FDYA 2E7BA 4G9DA 5EOQL 3TF7C 5FGSA 4S1QH 3IDYB 1ZLVH 3GIVB 2GHWB 2GY5A 5CINL 5C09E 1JNLH 3TZVB 3U7WL 1OAXL 1HSBA 1FRGH 5TE7H 4IOSD 4ODVH 2HFGL 1F4HA 1CF8L 1YEHL 5FYLD 1A5FH 3ZKXB 3EYUH 4WW1A 4G8GB 1X7QB 4MZ3A 3STLB 4OZ4A 4HIEA 4AYFA 3GFUA 1M7IB 1MCLA 4Y8AA 4OZFH 2JIXA 4LLMA 3NH7L 3WD5L 1YQVL 2Z35A 3O3UN 4KQ3H 2MHAA 4NQDD 4B7IA 4NUJB 1HKLL 3C6LA 5MEPA 1PZ5A 2C7UA 1K8DB 1E0OB 3OKEA 1D6EA 1HZHL 3EUUA 4FTVA 3QUKB 1TCRA 1ZMYA 3C60B 4ZOAA 5K59F 5F1NB 4M1CC 3W2DL 4BFEA 5JORB 4DKEH 4L9LC 2CQVA 2J12B 4FQ1H 1QEWA 2VR4A 4YDJB 4AEHL 1HHIA 4PJGB 4HQQH 3OZ9H 1QSZA 3MCKB 1T3FB 4JO4H 4JFEA 4C56B 4LKXA 5K93A 4WDIB 1NCTA 1BFOB 5HY9B 3FQUB 4NQDA 3QPQC 3MRNB 3EYSL 4IOFD 5GZOC 4O5LL 2VMFA 4ALAH 2J5LB 5J0BA 3EFFA 3DMMC 5L2KD 2FR4A 1IQDA 2VH5L 2WUBH 3KPPA 4O9HH 5J8OA 4YFDB 4JY4B 3KYMA 5J9PB 1NBQA 4ONFL 5FO9B 5INCB 3GSQA 1N5AB 3ZE1E 5F3HA 2P24A 3WIHA 3WKML 3RL2A 1YY9D 4JVUA 2GFBB 4S1SH 5I18L 3VCLB 2VDNL 1A64A 5DRZB 1AXTL 3D0LB 4KVCH 4F9LC 2BP3A 4MCYA 1S7XA 3L3KA 5EUOE 5C0IA 1EGJL 2YMXL 4NNPH 4RMQA 2NY0C 2EDKA 4PV9B 1I7ZB 4JGUA 3ULVL 1J88A 3CVHH 5DRNB 4Z95L 2QQKH 3BQUB 3KPMB 3DUUA 4DKFH 5L2KA 5IW6A 3FKUS 1QFPA 3BPCB 4WNQA 4C83B 4PBXA 2VLKA 4MCZB 1R3IH 4OI8A 2BNQD 4ODTH 4U33A 2NLJB 1IILE 1KCUL 4PRPE 1VFOA 2EICA 4N90D 4U7SA 1XF5B 4HV8A 5LQBL 4M1GH 3ARYA 2AJUH 4P2YA 3KXFE 1U8KA 2OSLA 5EU6B 3WBDA 1I8IA 3BGMB 4JPIB 5JXAL 3ARXA 4N9GA 3VFVB 1K8IA 2DI8A 1Z9OA 3DECA 4OZHF 2V2WB 4NQXB 1QHOA 3B9AA 4TSAH 5EUKA 1FL5A 3L95B 3QYCA 4WHTA 4X6DB 1FO0A 3O41A 3N1GC 2ZUXA 1CICD 5BO1L 3WUWA 4DUXA 3QFJE 4NDMB 3O4LD 2BY0A 1RHFA 4NCC1 4CJ0A 3BDYL 3SJVA 5BV7B 5CEXA 1T7XA 3UAJD 1DEDA 4JO1H 4I9WD 4D9RE 2XZCH 3TWCL 1DANT 4X80H 5F21B 4FQ2H 3ECBA 4HK0A 3VFUA 2AQ3A 4E0RA 1ACYL 3ZYOA 4WTWA 3GDBA 3PWLA 4BQCA 4PJEF 5CD5C 2VZ3A 4G6MH 3CX5J 5I19H 4R4FL 3ZO0A 2ESVD 4TSCH 5DMYA 4ELKA 3ALWA 2CIIB 5GGRB 1C5CL 1MCCA 5EZLB 2C1PB 3KPRD 1CICA 5IEKA 4OLYH 5ISZA 4JRXB 5T1KB 1HI6B 3NPSB 1M05B 1YMMB 4RA0C 4CNIA 3VGFA 3N1PC 2ITCB 1KEGH 5B39A 4ZDHA 3F7QA 3K1KC 3UXFA 3ARQA 4OCWL 1G7IA 4ODBD 4M3JA 4KI5E 5D2LE 3S98A 1HILA 1J86A 43C9B 1CD8A 3NCJH 2DQTL 1K2DB 2IJ0C 4KPHH 4LSUH 4ZUUA 2VUOA 1U6AL 3EDJA 5I1AA 4G42A 1A6ZB 1XF4A 1F6LL 3PGDA 5BS0E 5IQ7H 4ODSH 2OZ4H 2ZOLA 4PJFE 1D9KB 4OLVH 3GSNL 1MHEA 3UTSE 4Y5VB 5ITBL 5GJTH 3LVEA 5F72S 2L0DA 3VXOB 1CYGA 2KUTA 3VGDA 4QLRA 3TBVA 2V7NB 4HUWB 4KRMB 3GMPA 3TO4C 1DUZB 1DBJL 1TJIL 4UB0H 4EI5B 4QYOA 3QUZB 2FRGP 3O3DA 3P4NB 3OKKA 4AK1A 3HE6D 4XP9H 3ZDZF 3WLBA 1WWWX 3HC3L 1CE6A 1CS6A 1RVFH 1X5GA 4OD1H 5A40E 3MJ8A 1XGTA 3WFDH 1YYMH 3BT2H 4JG0L 3RNKB 5C0BE 4S1QL 2WQRA 3BPOB 3UTTE 1JNLL 2XV6B 1VKXB 3UYPA 1ZVSA 2KZ1B 1E4WH 1FRGL 2JK5B 3LSOA 4HS8H 4RFEA 5E8PB 2C4XA 4X9HA 5TE7L 2GAZB 4ODVL 3G5ZA 1AQKH 2A6IA 1MJ7H 4LSQH 4A2MA 5FIEA 4TUKH 4NT6A 1A5FL 5HHOD 4EEEA 1TVBA 3EYUL 4HKZB 4BH8A 1HIMH 1KJMB 1VPOH 1KNOB 4Q2ZA 2WMPA 1GOFA 4HJ0C 32C2B 4P5KA 4Y2DB 4KQ3L 2X6MA 3HE6A 3MRMB 4L8DA 3EO0B 3D3VD 3HC0A 2R56H 5LKNA 4ZS7L 1PKQB 4XBPB 1MJUH 4HKBB 1OGTB 3HZVA 4HUXA 3G5VA 2GTWA 1GGBH 4I48A 1Z9MA 3B9DA 1GZQA 1P4LA 4U1NA 1WAAE 3B3IA 1JZ5A 4Y5YA 3JVGA 4ENED 1WEJH 2K9UA 4FQ1L 1R24B 2GK0B 2ED9A 2IGFH 5FO7A 3DSNA 4XXDB 1RIUH 3SO5A 2R1YA 3PNWA 4XC3H 3QDGA 4HQQL 1HSAA 3OZ9L 4NO0B 5IVNA 1B88A 3G6JA 2B1AH 1MRCH 1TQCC 3P0YH 4KY1H 5D1QC 2H9GA 3SE3C 4ALAL 3KPLA 4M00A 1CFTA 2GW5A 5FEBA 4H0IA 2WUBL 1G6VK 3UBXA 4O9HL 5KSUA 4JVPA 3T1FB 4C57C 3MSPA 1M6OA 2YD1A 2PYFA 1RV6X 3RX8A 2NTSP 1NCWH 2A73B 2AK4B 3NFNB 3HPLA 5DQJA 1OAQH 3UP1A 5DSCB 5C7XH 2ITDB 3ARFD 1JK8B 4PJXB 4S1SL 5F89A 5C0RH 5KSVB 3ARBA 3QEQB 3A6CH 4KVCL 3W9DA 1KB5A 4HX1B 3DRQB 2BCKA 2ZUQB 2UUDK 4NNPL 3JSSA 5FCSH 1FZKB 3KJ6L 5I6XC 2DMBA 2F54E 3BEVA 4K7PY 3CFIC 3QP3A 3CVHL 3ARGD 2QQKL 4DKFL 3KGRA 1MVUB 4YHKH 5HYIA 2NNAA 1S9VB 5IIEA 3FO9B 5K9KB 5DD5H 4NC1C 4PJHE 2JELH 3AU1A 1R3IL 4M8QB 3NZ8A 4ODTL 4PTTB 1U3HA 4X7DC 4JRYD 5HGDB 4NQVB 3T4AA 3HE7D 3PWJA 2JB5H 2AJUL 3ARFA 3FQXA 2IPTH 2E5EA 2SEBB 3VXNB 1U8PB 1R3HA 1FORH 4ZUTA 2J1KA 1BVZA 1EUUA 3JTSB 5F93C 3OJVC 4GG8B 4GW5A 4BQBA 5JA8B 4JZJC 3JV6B 1TVHA 3HZMA 5HGAA 5C6PB 3ARGA 4RMWA 4OSUH 1RZ7L 4LMQE 2X42A 3IGAA 7FABH 3BGFB 2HYMA 2Z31B 1ROWA 3RWCA 4JO1L 4KROC 1FVDA 3TPUA 2VLJA 2XZCL 4HWNA 5AZ2H 3HUJA 4X80L 1CLZH 3AROA 4FQ2L 1B4JH 3PWPB 4CGTA 2QHLA 3WCYA 3KXFD 1D5BB 5TDOB 4E41D 3HAEB 2VIRB 2R23B 5KSBE 3PWNB 1J05A 4Q6IB 3JBG7 2YSSA 4NZDA 4WFFE 4G6ML 1KLUA 3O3EB 3NVQA 4G6AC 4XCNB 4ZPVB 5GJSH 1BF2A 4PJ5B 4TSCL 2E9BA 2O5YH 2XOTA 1AKJD 4RMVA 4MD0A 1JNJA 4LSVH 1CBVH 3U4BH 2CSPA 4GO6B 1HHJB 4OLYL 5E4EC 2Q86B 4FXGA 4KJWC 4HCRA 2VDLH 3IFPA 1KEGL 4ORGA 3IDXH 4UV4H 3LKSA 4NP4H 1EEZA 4K94C 3VXUD 5C0DB 5FB8A 2ARJB 5E56A 4NKMA 2EDRA 1DVFD 5DFVC 4P2QE 4ZSOE 3C9NA 1BJ1H 3TH2T 1FIEA 2W0LA 2DS4A 3NIFE 3NCJL 3NFPB 1CGUA 1F3JA 3KNBB 4PRAA 4E41A 5IFHH 4LSUL 3ZKND 1N7MH 2Z91A 5IQ7L 4HLZH 2OZ4L 4ODSL 4OLVL 1J0YA 2APBA 4KKCC 5GJTL 4GMTH 4MQ7A 3QDMD 4EDWH 5HYFA 3CXHK 4KGLA 5L7XH 4GG6E 4PREB 5D1ZB 1VFAA 1CGWA 4UB0L 4APQC 4X6CA 4Q9BA 2FEDC 3MOAH 5CFHA 5BRZD 4Z7NE 4EN3C 4CJ1A 4CBPA 4XP9L 5SWZE 4HIHA 1OTUD 1RVFL 1YN6B 2NY1B 4WO4C 3W39A 1BJ8A 1I4FB 3MV9D 3WFDL 1YYML 2DLHA 2R0LH 5L8KB 3BT2L 3PABB 3P9MA 5KZCB 1OGAD 1ES0B 4MAYD 4EDXB 5IB5A 2P5ED 2XWJA 1A47A 1BIHA 3QZWA 5BS0D 5B21A 4HS8L 4ONGH 5CP7B 4HF5H 1RUMH 1AQKL 3FB6B 1MJ7L 2D0GA 4LSQL 5GQBA 1P7QD 1H3TA 4TUKL 1S78D 5DRWA 3PDGA 2GJ6B 1HIML 1VPOL 1NCAH 4QNPF 5TDPB 5MP6H 2V7HB 3AVEA 3D2UD 4MA3A 5B8CC 1U58B 2PW2B 3RP1A 5BRZA 1HOCA 2A6DA 1HXYA 2C3GA 3LKPA 2R56L 2IMMA 3TT1H 1JRHH 2IQAA 3MV9A 1MJUL 4JM2B 1CWVA 3QXDA 4P9MH 5CEZH 1NDMA 1KXQE 1OGAA 1GGBL 4RGND 3GSRB 4JREB 5EOTB 3MCG1 3KLAB 3EJYD 3PL6B 3A0OA 3QUMH 4OV6F 4EBQH 1VEOA 5A16B 1WEJL 3LQAC 1RZ8B 1F4WH 2IGFL 4NOBA 1I3UA 5JHDD 1RIUL 3MJ6A 2NY7L 4KGJA 2VOTA 4LQ1A 2A74A 3B2UC 4XC3L 3LRSA 1KENH 1FL3A 1RJZB 4G80B 3EOAB 3OSKA 4LKCB 1NLBH 5IUSA 3NCMA 4QRUB 2B1AL 2E6PA 1MRCL 1XCTB 3P0YL 4PJIB 4PLJD 4KY1L 3RI5F 3CU1A 4PP2B 4Q74A 4P4RB 3CCHB 4XX1E 5BZDB 1FZJB 2A2QT 1MY7A 2JCCE 3L7FB 5A2KH 2J3SA 4L3EE 3D69A 3K0WA 3BPLB 3U30C 3VFWB 2A6JB 4HUVA 1P9MA 5HDLA 1OAQL 1J8HE 3JUYA 1ZWIA 4XCEA 4LPYA 3MQIA 4TUJA 2R2HA 5C0RL 1AI1H 3A6CL 5E95B 5IMLB 1A14H 3OX8A 1RIVH 4PJAE 4PGBB 3FB8A 5SWSE 3VXTA 3G5XB 1HQRA 5JPMB 4KI1A 1G6RA 1GZPB 3DX8B 4PJ7F 2VDPH 4NRYB 3VH8B 4O4YH 4YHKL 4ISVB 1Y18B 5B38B 5DD5L 2ICWB 3GB7B 2JELL 2YPLE 5ADPH 4M1CD 5E6IA 4NYLA 4R4BB 5I76A 1WBYB 4QHKI 4WI9A 2B0SH 3ROOB 5IV2A 4LVEA 4IS6A 4YHIB 5C0GB 2JB5L 5GSVB 1T80A 1I3RB 6CGTA 4LLUB 2IPTL 3KPQA 3NN8B 3UTPD 1YECH 2FWOB 4XWOC 2EH8H 5IVZA 3T0BA 1JWMB 3QPQD 5C0AD 1FORL 5GZOD 3S36H 2V5YA 3FFDA 4NRZB 4OF6A 4OGXH 4QRTB 3OKYA 3ORJA 3DMMD 1KIQA 5DI8A 1X5YA 7CGTA 4Y89A 5KVDH 5ID0B 4OSUL 3B6SB 1FNEA 2A6KB 1T04B 3QJFA 4HC1H 4YEFA 3LOWA 3U7AA 7FABL 2FNBA 1Q94A 4PYGA 3QULA 4QHLA 3S4SA 5AZ2L 1WIOA 3TO2A 1CLZL 3DYPA 4NPYA 1B4JL 1YYLL 3H42H 3U6RB 5E2TH 2WLYA 3HZKB 2A0LC 2YXMA 4W81A 4U0RB 2NY0D 4KRPC 1AGDB 4R90H 3QFDA 4WI6A 4WUUE 3WJJC 5GJSL 2RBLA 1FNHA 1F4XH 4YHYB 2PR4H 4FFYH 4JFHE 4YBLC 2HVKA 2Z93A 3SY0B 4LSVL 1ZGLB 4IM8A 1QQDB 1XF3A 2G60H 3TC9A 3U4BL 3LKQB 2XTJB 4QT5B 2RCSH 1F11A 2KPNA 2VDLL 3P9WB 3GMQB 3QIBB 3IDXL 4UV4L 4FQXA 4NP4L 3KS0H 3GSUB 5E99H 4M3KB 2WW8A 4F9LA 3N85H 1KXVC 1P84J 4OKVB 2ARJQ 5IFHL 4EUPA 1K3IA 5I0ZA 4JFYA 1N7ML 2DQCH 2VLRA 4PV8B 2CRMA 1MPAH 1S9KC 5C0FB 4JDTH 3HHRB 4GMTL 4WWKC 3OB0H 1CXKA 4EDWL 4GXUM 2IPKA 5IF0A 5E94B 3MUGA 5L7XL 1KULA 5DWUH 4HIXL 3JWDH 3IDJB 4IHOA 4HKJA 1IFHL 3BUTA 1UM6H 1R5IA 1DBBH 2EYSA 4RGMB 3MOAL 5HYEA 4L8SB 2VERN 1QRNE 3BP4A 2IANB 4Z76A 1NLDH 1I75A 4P3DB 1FGNH 3K4AA 1JPFB 1QBBA 2R0LL 5CD5D 1I8MA 1HWHB 3L5XH 3INUH 4PD4J 1QYGH 4FTVE 4RBPK 1RJYA 4MX7B 4PRHB 3B8YA 4G6FB 4GLRH 4ONHB 4ONGL 2VABA 4HF5L 4URTB 4I5BA 5ELIA 1RUML 4M7KH 5GGTA 4Y88A 4JFQA 5LJYH 3VFTA 3QCUH 1A9BB 1OQOA 3MJ9H 1NCAL 3DPBA 5FOBA 1OSZB 3SPVB 1KPVA 4JFEE 4PJBE 1MFEH 5MP6L 2DTMH 2IC2A 2UY6A 4Z7WE 2P8PA 4N0UE 5HHPB 4AG4H 2AGJH 2GUOA 1Q1JH 4QRSA 5CBAA 5ICYB 3H9SB 1JRHL 1U8IB 3HLAA 3OXRB 5GGSY 3TT1L 4CVXA 4P9ML 5CEZL 4QHUA 3TJHC 5JTWA 4ZYKA 4MHHI 3QUML 4GSDH 4EBQL 4YNYB 4DGIL 5B3JE 5E5RB 1F4WL 3SDDC 3TO4D 5I71B 2OR7A 4RNRA 3LQZA 2K3TA 2MPAH 4UDUB 3PHOB 1JGLH 2PCPA 3RVXC 2NPLX 4XXCC 1I9RH 4U0QB 1KSRA 3IJSA 1KENL 5F6IB 5ACZA 4UNVA 1NLBL 4JZNA 2FSEA 2K1MA 1T1ZA 1AQDB 1D5IH 1CL7H 1A1NA 1KEMH 3IDGB 3NFSH 3PDOA 1HQ4B 1IGMH 3SCMD 2IH1B 2GEEA 4WTZA 2CRZA 1OPGH 5BW7C 2VLKE 1NFKA 4XVJH 1K9TA 4U6TA 4KC3B 2VQ1B 2AEPH 3MA7B 4KV5E 4YZFF 4K8RH 3ZTNH 3RIAF 1MCOH 4HJ0D 1AI1L 5KS9A 3L3OB 1P7KA 3VRJA 1A14L 2BNUA 1RIVL 2CLVA 5EIIB 2GJZB 4J1UA 2HG5B 5MI0B 1Z0NA 5ETUB 1JZ6A 1JGEA 1WCBB 1NCUA 2EDEA 4O4YL 3SCMA 3QUXC 4S10A 5IW3A 2BVPA 3F62A 3ILQC 1KLFA 3UZEA 2Z8WC 3SJVE 3P4LA 2E7HA 4L4TB 5D70H 1NAMB 2B0SL 2A38A 4X6DF 5C08A 5DJ2B 2VQTA 2WUCH 5IESH 1X4ZA 3T0AA 2PO6C 3DV4A 2EH8L 1W0WB 1NCNA 3OXSA 2UZYB 4RCAA 1ORSA 5D1QD 3CFKB 2CLZB 1OF2B 1BGXH 3S36L 1CQYA 1DQQA 4OGXL 3QCVH 4PJ8C 4R96A 5E03A 2XN9B 2EIZB 4FABH 1N6QH 5GIRA 3ZTJG 5E9DA 1SEQH 3VXRD 4GJTB 1HHKA 5KVDL 3DOSA 5I1LB 1BOYA 5ISZE 2Y7QB 4HC1L 1RU9H 4NQED 5J6GA 5HYSG 2ZJSH 1U8QA 5E1AB 1JYNA 1NBZB 2XQBH 3S96B 1JF5A 5I2IA 2AV7A 3H42L 5DC9B 3VD4A 1EEYA 2FATH 2VITB 5E2TL 3Q0HA 1DDHB 4LSDA 4WFEE 2IALA 3ARZA 3EOBB 3SE3A 3TH4T 3IDIB 2A83B 4U1GB 1AO7B 1F4XL 2OQJB 1JPST 4FFYL 3RWFA 4WIQA 3WJLC 1DE4A 2JJSC 1BQSA 3BN3B 4D0BB 2G60L 4NN6C 4O2CA 1JPSH 2RCSL 2BMKB 4KJYB 3OJ2C 2AJ3B 1IZKA 1KTDA 3H9HA 4V2BA 4Y4HB 3BHBA 4P57A 3MUHL 1N6VA 4U6HB 2WBKA 4HWBH 5DJ0B 5E99L 4XNQA 3N85L 1X3DA 1G9NC 4XCYA 5HVGB 2CUIA 2DQCL 3BPNB 3TFKC 1MPAL 1FFNA 1TCMA 1GGIH 1F4AA 3DSFH 4JDTL 4XWGH 5ICXB 1JPTH 1REIA 4JFHD 3QH3A 3P77A 5DWUL 3BXNB 3JWDL 2G2RB 3QIUC 3GMRA 4G8FB 4UMGA 1UM6L 5F9JA 4KROD 1DBBL 1MUJB 4HUNB 5DJZA 4UV7H 1X5KA 2ZNXA 4MLSA 5DRXB 1NLDL 2MJWA 2VZ1A 5IR1B 5CSZB 4P23C 3QUYC 2P48B 3MFFA 1FGNL 1HHHB 5CHNA 2ADGB 1H0DB 3GMNA 2J8UF 1BBDH 1FN4A 2PKDA 3X3FH 1WJ3A 3L5XL 3INUL 4G6AD 1QYGL 2XZZA 1B3JA 2LU7A 2P45B 1PEWA 1TENA 5CCKH 4X9FA 4NFDA 3V6OE 1JI2A 1YC8A 1LEIB 3PQYA 1J10A 5KN5B 4M7KL 4YHPB 3RUGB 2M1KA 4KJWD 2YKLH 2H32B 3QCUL 4BELD 3MJ9L 1DQJA 4GAFB 1MFEL 3OR7B 4MJID 2DTML 5DFVD 4UT9H 3H0TA 2PTVA 5E00B 3BFOA 5I9QB 1UZ6F 4AG4L 2AGJL 4CU7A 1AHWC 1Q1JL 4PJEA 3QHFH 5K33A 1A1OA 1IKNC 3QB7C 2C4FU 4FQLH 1F5WA 4JQVC 1C12B 3RWGB 5ADOH 5IBTH 4KKCD 3BD3A 2Q8AH 3L5WA 3PJSA 4FFVC 4X7EC 4GSDL 2ZG1A 3VD9A 3G5YB 1BLNA 4NZRH 1GOHA 1I9JH 4DZBB 3IJYA 4DZ8B 2EDJA 2MPAL 1PAMA 4APQD 2X4UA 1JGLL 1YJDC 2FEDD 2NXYB 3RZWA 4IRSA 1I9RL 1UEMA 4PRNB 2XG4A 4LAQH 4EN3D 1U92B 2W60B 3C5ZB 3HMXH 5CJXC 1HSBB 3TBTB 3DYMA 5DZNA 3ETBF 3VFSB 3GIZH 4WO4D 2P8MA 5IG7B 3KDMA 4NHCH 2CKBA 5JOPE 2AXFB 1CL7L 1KEML 3NFSL 3QO0A 1I7RA 2QQLH 1IGML 4PJXF 1X5HA 4OZ4B 2BSSB 1OPGL 2OTUB 4HIEB 3ESUF 1NBYB 5FA3B 5DJ6B 1CTNA 2G9HB 2P49B 4ZFZA 1V3MA 3LIZH 4XVJL 5MEPB 5KSAB 3I02A 3IAPA 2AEPL 4JM4H 4K8RL 3ZTNL 4ZUVA 4Z77A 4KWUA 3OKEB 4APQA 1MCOL 2C3VB 1NGYB 4JDZB 4EN3A 3CFCH 1FP5A 5TJWK 2WAHA 2UV3A 1RZKH 3LD8B 3Q48A 2R2BA 4WO4A 1MCBA 3PHQB 3U46B 2DBLH 4PRDA 5FF6B 5CSBA 4MQSB 1OTTC 4M7JH 1OSPL 3O2DA 1FVEB 1BAFH 3VMNA 5JHLH 5D70L 1TPXC 4NQDB 3MA9H 4LNVA 3STBA 2VLJE 5DHVA 3HUJE 3EFFB 3V6FA 4DK6A 2WUCL 5IESL 3B2UD 3AREB 3FFCE 1TZHB 4RFNC 4DW2H 5EOCJ 4XPHH 3HZYA 5E08L 1TQBC 3GSQB 1DZBA 3V8OA 3H7LA 1U2CA 4LK4A 2COQA 1LEGB 1QSFD 4HT1H 1BGXL 3NIDF 1A4KA 3QCVL 2RHEA 1UZ8B 5F3HB 3RL2B 2VDKH 4FABL 1N6QL 5E8NA 1SEQL 3AM8C 4ACPA 1S7XB 3L3KB 1RU9L 2ZJSL 1Q9KA 1YEDA 2GTZB 1KIPA 5D8JH 4F8TA 2FHFA 1XIWA 4NN5B 1SVZA 4JZOA 2XQBL 5SWQA 2UZXB 3M17A 5L2KB 2DOCA 3MREA 5AYUH 5IW6B 3PDDA 1FYHB 3BAEH 5E5MB 1A1MA 2FATL 4PRID 4ZFOL 1QTYT 4Y1AD 4EI6B 1QSFA 2EC8A 2VLME 4TOYH 2HN7A 5K9OA 5C3TA 1U8KB 1NANH 1I8IB 2EDDA 5JW5A 2O5ZH 1B4RA 1JPSL 1MI5A 4X6CE 5TQ0H 5C70A 3JV4B 3MOBL 4G8EB 3FOMB 3FRUA 1CGVA 1I1CA 4JFPA 4IDLA 4Y4FC 1ZANH 2BSED 4ODUA 3AUVA 3QJHB 1KGCD 1WFNA 1XAUA 4HWBL 5HI4C 2XIDA 2Q20A 2X4TA 4EI5C 2O61B 1EXUB 4QWWC 5IKCA 3MRPB 5CEXB 4Y1AA 2BNQB 4WFED 1Q8MA 1NKOA 3FHAA 1LD9A 1LO0H 1GGIL 3D9AH 3DSFL 3ECBB 4HK0B 1JPTL 2FYYA 3TVMA 1FLTX 2Y1VA 2YN3A 1DEEA 3SQBA 5CZKA 4UU9B 3BPOC 5HGGS 4FFWC 2C5DC 4MXVF 1JZ2A 1P2CA 3JWOC 4FMFA 3FO2A 4OD3H 4X4XA 3LPGA 4UV7L 1TJGH 3VFOB 2AW2A 2NY6B 4BK4A 1KOAA 2WIMA 1MQ8A 2J4WH 2A0LD 4N0CC 2PYEA 3CXHJ 3D39D 3O4LB 2AV1A 1BBDL 4KRPD 3X3FL 1FL6B 4XP6H 1BEYH 1SEBB 1L6ZA 4DVBB 4CNIB 4Y2DC 4WUKH 4ZODA 4J4PC 5CCKL 4U1IA 3WO3B 4OT1H 1BQHA 3BESR 3F65A 2ZCKL 3MRIA 2APFA 1NFDB 4JM2F 1BFVH 2BSRB 2YKLL 3ET9F 1ND0A 4XHJC 4LEXH 5J11B 4MA1B 2ZOLB 3RKPA 3FT2B 4UT9L 2DRUA 4ZOBA 4X7TA 2ESVB 2AP2A 3IXTA 2MSPA 3TBVB 4FQHB 5DJXB 3KPRB 2XWBB 4BH7A 3QHFL 4OQTA 4ZUSB 3D39A 4Z0XA 1JNNH 5AD0B 1WWBX 4FQLL 3WJJA 3T0DA 5ADOL 3RIFF 5IBTL 5C07D 4PJIF 4WWKD 3WLBB 1CE6B 1FNLA 4TUOA 1YN7B 2XICA 5FGCB 2GSIA 4NZRL 1T1YA 1CFNA 1I9JL 1T5XB 1N4XH 5I66A 1DP0A 5F1IA 5T1MA 4CVWA 1U36A 1W0YT 1ZTXH 1JRHI 1ONQA 2QEJA 4HIJB 4LAQL 5FA4A 5B22A 3HMXL 3NMEA 4LOUC 4RFEB 3IVKA 3MRCA 2FO4A 3GIZL 3G5ZB 4NHCL 2A6IB 4OV5A 4GRLC 5CUSH 1ZKAA 4NT6B 3BUYB 4BH8B 2QQLL 1E4JA 4YPGA 4X4YB 5D2NC 1FFOB 1QUNA 1FYTA 2P4AB 3CFJB 3C87A 1UEYA 3RWHA 3Q5OA 4LFHG 3FQTB 4P5KB 1MCWW 4LHUD 4WHDA 2VISA 1ZHLA 1CD1A 3LIZL 4CADB 1N64H 4WHCA 1E4KC 4UQ3B 4C59B 3HC0B 1IGYA 2NW3A 5E2JA 2W59A 1XF2B 4JM4L 3HZVB 2H3NA 4JDVB 4I48B 5IVXE 2VL4A 3ULVF 3CFCL 3LN4A 3QNXB 1RHHB 3GMLB 4MHHG 1RZKL 3VXSA 4BQ8A 3L5JA 1XGUA 2HMIC 4N0RA 5HHOB 4IRZH 3BZ4A 2DBLL 1JIBA 1M4KA 1EDQA 3TJHD 1DSFH 2PTUA 1KBGH 1HSAB 3VA6A 1OHQA 4M7JL 3L9RA 3CJJA 1A9EB 4FNLH 1BAFL 3I9GH 1P1ZB 4LHUA 5JHLL 1BECA 4HMCA 1UB5B 2EXWC 4JR9H 3MA9L 3D3VB 3EZ8A 1BOGB 3SDDD 4P2OC 4BSWB 3RVXD 5EULV 3UBXB 5KSUB 4S0SD 3S35H 4XC1H 1Q9OA 4ONOA 3K1DA 4DW2L 4KKAC 4XPHL 5IT2H 2FO1A 4WCYH 1IAKA 4HT1L 3QCTH 3UJJH 3B2VH 1JV5A 2I25N 2VDKL 1EUTA 1G7HA 5EO1B 2GCYB 5F9WB 4LLWA 3BMWA 2VQUA 2CLRA 4RAVA 4M5YH 4YDVB 2VZUA 1P53A 1IMHC 1T21B 3GUTB 4X0KB 2FEEL 1NGPH 4FA8A 4P5MB 5D8JL 3OWEA 1V3KA 3GGWB 1OP5K 2R0WH 3OR6A 4JN2A 4NO5B 4XXCA 5AYUL 2IG2H 3DLQR 3BAEL 4L8BA 2WQ8A 2WK2A 4HSQA 4MNHB 1R3JA 3MGAA 2LAAA 3AU1B 4QHKJ 4Y7MA 1BHGA 4JJHA 2CDEA 3NZ8B 5D7LE 3WNMA 2VLRE 1BQLL 4TULH 2V5RA 4NN7B 3S97C 1U8OB 3T4AB 4HJGB 4TOYL 3FQWB 3REVA 2UYLA 3QUXD 4P46A 4Y19D 2V2TB 3ARFB 3FQXB 1OT2A 3ILQD 4M4RA 8FABB 2H8PB 3ARTA 3DO7A 2O5ZL 3C08H 1JMZA 5BW7A 4R9HA 4OLXH 4GW1A 1QRKA 5D1XA 1RZIB 3P4OA 4ZUTB 1EHAA 1QLRA 5BJTB 2XYCA 5TQ0L 1K5NB 4F9PA 1LP9A 3C09B 4M7ZC 3MO1A 3LDBC 3HPJA 4LHQB 5T3XE 1ZANL 3G6AB 4J3WA 3S37H 3ARGB 3W9EA 1I7TB 2DIJA 2PO6D 3AGVA 5HHVH 3LQAH 1NC4A 4TNVK 4KAQH 5EO0A 1JHTA 2AJZB 5E8OB 4PJ8D 4PJ7A 2V6HA 4ZMAT 3MNWB 5LCVH 3S34H 2NY1C 1EFXD 1LO0L 4JRYB 3WLWC 2KH2B 3D9AL 3HE7B 4XNMB 4PLOB 1HHGA 3ZE2E 1UJTA 3QUXA 4Y19A 1EIBA 5IMOA 3WL9B 4GRMB 1A6WH 3V2AR 1FO0H 1TITA 1KLUB 4LVOC 1J0IA 1NEZA 2FJGA 1FZMA 4OD3L 4QF1B 3GBNH 3UPCA 3QEUA 1TJGL 5B3NA 2AAVA 2J4WL 5L0QC 4LL9A 1EZVX 4FXGB 3G08A 3LV3B 4XP6L 1U8NA 3HS0A 1BEYL 3IFPB 3LKSB 4WUKL 5IHBA 3L7EB 1KFAH 5DYOA 4OT1L 4MNGB 1YY8A 4X6FB 4RIRA 4XRCB 1S7WA 4IIQB 1W72A 3C5JA 5EPMB 3KXFB 5J6HA 1F00I 1BFVL 1CG9A 1UGNA 2NX5E 3MRQB 5DEFA 4AEIH 2DMCA 2Z91B 4LEXL 2APWA 3T65B 4K3EH 4QRPA 5CJBA 3RJDA 3OB0K 2PTTA 4GKNA 3S9DB 2CDFA 1AKJB 3DV6A 4GLRI 5CGMA 3VJ6B 2JKXA 3SDXF 2X4PA 1JNNL 3Q3GB 4N9OB 5IB1B 2AERT 3TFKD 5GSRB 3HRPA 3I75A 3VXUB 5ANMB 1VEMA 1DVFB 4F58H 1IGTA 2VXSH 3F6LA 3W39B 1RUKH 4LCWA 1YEIH 1RJLB 5T1LD 1N4XL 4RWYH 1QR1B 2M2DA 3QIUD 3P9MB 5F97E 2VJXA 4D9QD 3DIFA 5KJRH 1ZTXL 4GS7B 1ZAGA 3MLUH 4UI2A 4P23D 3IDMA 3QUYD 5F7LB 3QDMB 5MEND 5CUSL 3HR6A 4ZUWB 3L1OH 3TN0A 2BVTA 5L88H 4ZPTA 5FV1L 3IKKA 3MRBA 3X11B 2P5WA 3VI3E 5BRZB 3OHXB 5D71H 1HOCB 5EU3B 1N64L 2A6DB 5IFAH 5TE4H 1B2WH 3K80A 4JY6B 4YBQC 4YAQA 5C08E 3CZJA 5D2LB 3QXDB 1CL7I 3GIVA 3QIUA 1F6FB 5FYKE 1OGAB 3LMJH 4MAYB 4KU1A 1CR9H 3MLXH 2P5EB 5F71A 5GS1B 5GRVL 5BS0B 4L4VE 1JBJA 4P23A 5DS8B 3QUYA 1X7QA 3STLA 1TJHH 2UVFA 5E9DE 1P7QB 1TTUA 5IHLB 2QQNH 4GXUN 4IRZL 4UILH 4C56D 1DSFL 1KBGL 1H3PH 4FNLL 3D2UB 2DIAA 3I9GL 3ZDYE 4FFVD 5CGYC 1UWXH 3CDYA 4JR9L 5LAXB 4K7PH 1X5XA 4HGKC 5D6CA 2Q8BH 3QUKA 3S35L 4CDHA 4XC1L 3C60A 4RGNB 5F1NA 2E8YA 5JORA 5IT2L 4XPFH 3O4OC 5I1EH 5JO5B 5AEAA 4L8CB 4WCYL 3BYYA 2W65B 2HFTA 1OARH 4HUVB 3QCTL 3UJJL 3B2VL 4JKPL 1NCDH 4YX2H 3MCKA 1IKNA 5JHDB 4HEPG 2R2HB 4C56A 1JZ3A 3DJ9A 3MXWH 1BFOA 4JQVA 3FQUA 4U0RC 4YDLC 3OX8B 1A3RH 1OQXA 1PVHA 2BVYA 1X6LA 4M5YL 1OM3H 3BWAB 1T1WB 1MCKA 4HH8A 2QHRH 1NGPL 3DVNA 4YHYC 4NCDA 4KMLB 4LP5A 4I3SH 2GITB 4W6YB 4JY4A 1BFTA 5J9PA 5FO9A 2IG2L 5INCA 3DX6B 3C8HA 4NWTL 1N5AA 5CJXA 1NMCC 1UJ3C 5HHQA 5EBLB 4MQTB 1T89A 3FQRA 1C5DB 4TULL 4L9DA 3W0WD 4IS6B 2GFBA 5BMFH 5ACMA 3VCLA 9CGTA 3KJ4C 2F53D 3O2VH 1U91A 5DRZA 1OTTD 2OMBA 3GI8H 4PS4H 3DHJA 3U7YH 3EJJX 3C08L 2BOBB 3RX7A 4OLXL 2D0HA 4PV9A 2WNGA 1I7ZA 1J87A 3FFDB 3OF6D 3E3QC 3BQUA 3KPMA 2FD6L 5DI8B 3EDFA 4QGTA 1DQLH 3ZZ1A 3S37L 3BPCA 1D7FA 5C6TH 3WSQH 5F1SA 5KOVC 3NPZB 5HHVL 3LQAL 1IJ9A 4MCZA 4KAQL 5I15H 2NLJA 1E28A 2W9EH 4UINH 5AG9A 3F12A 1XF5A 1MRFH 4L9LB 3V0WH 3W0WA 1YPZB 4KHTH 5EU6A 5LCVL 3BGMA 3S34L 4JPIA 3PQYE 4PJDB 4P4KC 2F58H 5F70A 4PJCF 5MHSE 5DJ8B 3VFVA 1ZE3C 2GY7B 4KFZC 2V2WA 4NQXA 5C0AB 1A6WL 1FO0L 2KDGA 4X6DA 1S9YA 3DMMB 3GBNL 3QPXH 1UCTA 2QJDA 4NDMA 5T1KD 2EXYC 3RUGF 3RZCB 4PJEE 2BK8A 5AAMA 2DM3A 3NA4A 3O3AB 1FJ1B 5JUEH 3GJFH 2D3VA 4IMKC 4PJHB 1KIRB 2F74A 3I84A 3MYJB 4H8WH 3WE6B 1KFAL 2J7LA 2YRLA 4Z7VE 4UIMA 1JZ7A 1I9EA 1F3DJ 1PX3A 1PGRB 5FUCE 3VGEA 1I3VA 2EEBA 2NY0B 4AEIL 4JFYB 1CD0A 5SX5H 3X3GH 4K3EL 2HLAB 4J3TA 4Y4FD 5F7NC 2CIIA 5EZLA 2C1PA 5D4QA 5HI4D 4HCRH 5T1KA 5GGQH 3B9VA 1HI6A 4EI5D 1M05A 4QWWD 1YMMA 5F7FA 4IHOB 4HKJB 5FDWA 5JW4N 1ADQH 1R5IB 5DJCB 3V8CA 4C54A 1WBXB 1TZIB 4Z76B 5L8JB 3NABH 4YHOH 3RVVC 43C9A 3SE9L 2A9MH 1EVTC 2VXSL 1RUKL 1YEIL 4RWYL 2DWDB 4FFWD 2AEWA 4RMSA 2J6EH 3BISA 4K71C 1D9KA 2FL5B 5KJRL 3RVTC 4Y5VA 3WHXA 1INEH 1G7PB 1D5XB 3VXOA 3WYRA 2L4OA 2AJVH 1ZT1A 4MB5A 3MLUL 1T4KB 3KYAA 4N0CD 4C58B 1BFSA 1CIDA 1F8TH 1DUZA 2JB6B 3L1OL 4EI5A 2QADC 3DGCR 3S37X 3DX7A 3QUZA 3P4NA 4PFEA 4P3WA 2R0ZL 4Y2DD 4OCXH 4J4PD 3FRPA 3U0WH 5DO2C 1HEZA 3F7PC 3PIQB 3SHSA 5D71L 2Z92B 5IFAL 5TE4L 1B2WL 3RNKA 4QRSB 3V7AG 5CBAB 3AS1A 3HLAB 3QG6B 4XHJD 3SGKC 1BWMA 1S5IH 2B7DT 1M7DB 2ZUYA 3E6HB 3LMJL 5GGRY 1VKXA 1C7SA 4ZYKB 2YD4A 3B5HA 1A0QH 4WJ5A 2JK5A 3N0PB 1CR9L 2NYYC 3MLXL 5E8PA 1QNZH 2GAZA 3WS6C 4M03A 5GGVY 5KG9A 4HKZA 3ZMRA 2J8UA 1Z0MA 3QBTB 1TJHL 1KNOA 4RNRB 2BOCB 4Z5RB 2QQNL 4UILL 2PCPB 3KPSD 5H94B 32C2A 4GG6B 2UWEE 2X1PA 4KMTH 3IJSB 4N5UA 4Y2DA 3OL2A 1H3PL 3VG0H 5ACZB 4J4PA 4MD4B 5CSGA 2FSEB 4LLYB 1T1ZB 1MIEH 1PKQA 1HXMA 5D9SA 4XBPA 4HKBA 1SMAA 1OGTA 4P2RD 3PDOB 4K7PL 1PG7H 1VFUA 3AS3A 3ABZA 4ELME 2Q8BL 3RDTC 3OJMB 5D5MB 4BUHA 4YDIH 2BY3A 2EE2A 1SJHB 4LOUD 4XPFL 5I1EL 1H5BB 4RGOH 1R24A 2GK0A 3OB8A 4GRLD 5ENWB 1CLYH 1D5ZB 1OARL 4P9HH 4U1KB 1NCDL 3OPZH 4NO0A 3TO4B 3W82A 3JV0A 2PUQT 1J12A 1Q9WA 1F3RB 3MXWL 3FQNB 4E9LA 4OLUH 4Q9RL 1A3RL 1MI5E 1X44A 1OM3L 4OCRH 3BP6B 4DGVH 2QHRL 5FUZH 1I85C 4P2RA 3BE1H 4I3SL 1I3GH 4MJ5B 1QSED 1M71A 1PD6A 2DDQH 3HA0A 3NFNA 2A73A 2AK4A 4B50A 2Z8SA 5GRZA 4GRLA 3OTTA 3T3PF 3K3QA 2HMID 1U8LA 2ITDA 1JK8A 5BMFL 4PJXA 1V5JA 1V8HA 1ZHBB 2FEEI 3GSXB 3LHPH 4XB8A 5KSVA 3O2VL 3QEQA 3RJQB 3GI8L 3DRQA 4PS4L 3U7YL 5EG6C 4PG2A 4QHNB 3OGCB 4GBXC 1G6RH 1FZKA 2EXWD 5ESQA 4OLEA 4R96B 4P2OD 1LHZA 3ALXA 3FO0H 1MVUA 2R2EA 3NIGF 1S9VA 3FO9A 5K9KA 1DQLL 3IFNH 5C6TL 3WSQL 2AJYH 4KKAD 5DD6B 5DXWA 3T77A 4WI3A 3VE0B 5I15L 3BIBX 4PTTA 4UT7H 2QSQA 5CEYA 1U3ZA 4IMLA 1MF2H 3TT3H 2W9EL 4UINL 4NQVA 1MRFL 4H1LA 2VYRE 3V0WL 1EO8H 4HH9B 1WFTA 2PNDA 4KHTL 3D0VA 2F58L 2SEBA 3T2OA 1EEYB 1U8PA 2AXGB 2N4IA 4H20H 1TQCB 4PJ5D 5D1QB 5A2JH 3EW3B 1RIHH 3E0GA 4P2OA 2HT3C 3BZEA 2ORBH 1AH1A 3WDIA 2HRLA 1DE4B 3VXRB 5FFLA 1NFDF 1T83A 3JXAA 2LTQB 4OF8A 4CKVX 1R0AH 3T0VA 2HA1A 3FB7A 4NQEB 5JUEL 3KWWB 1CGXA 2W0KA 2YPLB 1KG0B 4H8WL 2Y06H 3PWPA 4NBYB 3MV8E 5TDOA 3HAEA 2VIRA 3VWJC 4XNQB 1BBJB 2YUZA 3O3EA 4LASH 4XCNA 4XCYB 4ZPVA 3GNMH 3FCTB 4PJ5A 5I6XB 2DL9A 3X3GL 1JHLH 3CLFH 2V9QA 1HE7A 1HHJA 2Q86A 3OAUH 4KK9C 5GGQL 3B5GA 1JWSA 1FYTE 1JTTA 1ADQL 5C0DA 1QOKA 2ARJA 1UWEH 1S7SA 2NY1D 5DJZB 3WLWD 4J3OC 3NABL 1ULVA 4YHOL 3MODH 4U2YA 3PHSA 2A9ML 3NFPA 5JXEC 1CIUA 4YFLF 3KNBA 1QBLH 4F7TA 4EUPH 5CHNB 3RY6C 2EE6A 4OZHB 1MRDH 2J6EL 4MA7L 1VGKB 1UYWH 1XCQB 5EIVA 2OL3L 1INEL 4JZJB 4FZEH 3SKNB 2AJVL 3OKLB 1TNNA 4U1MB 3VXSE 4F7CB 3RU8L 1R3LA 5IM7B 1EJ6A 5KVMC 2OK0H 3V6BR 1YNKH 3TM6A 1BZ9B 2V2XB 3Q6GH 3WS3A 1DQJB 4LLQB 1P6AB 5T3XH 4OCXL 4WEBH 4KROB 4KKLC 3U0WL 1YN6A 1BVKB 1I4FA 3G04A 5JIIA 3B43A 1C8PA 3PABA 4MNQE 3L5HA 1ES0A 4QNPE 4EDXA 3A6OA 1S5IL 4L29B 1A0QL 5CP7A 1Y6KR 1QNZL 2DQGH 2X9XA 2N56A 4QOKE 5ESVB 3SDAB 5GZNC 2P1YA 5TFSH 2OMNA 3NCBB 4GAJH 4WFGD 2X09A 3SDCC 2GJ6A 3BH9B 5E4EB 3AREC 3BO8B 1LQSR 4X7CC 2D0FA 4WU5A 2V7HA 2CO6B 1U58A 4KMTL 4RDQF 3FN0H 3VG0L 1CTOA 2YD7A 3ZKQD 4MJIB 5FYJE 4HDIB 1MIEL 3KDMB 4JM2A 1TZGH 1EK3A 1PG7L 1U41A 3QO0B 5EU7C 3GSRA 1ZT4B 1QKZH 2ZZUT 3TIDB 1F45A 2RB8A 3KLAA 3OAYK 5E2WH 4GKZB 3PL6A 2LQRA 3K7UA 5A16A 4HFUH 3SQOH 4RGOL 1RZ8A 2IBGA 4POZC 4CU6A 1CLYL 2ZCLH 3I02B 5E08H 5IGXH 3JWOH 4P9HL 1FLRH 4RX4A 1CCZA 4MJ4A 1ZS8B 4OCNC 2XQYK 4ZUVB 4NUGH 1RJZA 4G80A 3EOAA 3QNZA 3O6KH 1RZGB 1XCTA 2V17H 5GRVK 4PJIA 4OLUL 3QEHB 4OCRL 4PJBB 4JHWH 4DGVL 4YBQD 4PP2A 1LP9E 4KRNA 2R2BB 4WO4B 4P4RA 2V9TA 3CCHA 5FUZL 1FZJA 4Z7WB 1A7OH 4N0UB 3QO1B 3BE1L 4J23A 1NDGA 1I3GL 5JPNB 2DDQL 1IC5L 3OJDA 3VFWA 2A6JA 5CJ8A 4RAUB 2DF3A 4WWID 5IMMA 4PJ7E 3LHPL 1MCRA 5JW4Q 4BFBD 2CK2A 4YK4C 4MXQC 5IMLA 1CLOH 3BWUC 3QAZC 4PGBA 4OF5A 4ZAKC 5B8CB 2VLLB 3G5XA 5CGYD 1G6RL 2UUDH 4M93C 5JPMA 1IGCH 1KCVH 1GZPA 3DX8A 3VH8A 3FO0L 2DJUA 1Y18A 5B38A 5EOCH 2ICWA 3IFNL 3DUSA 3Q5YA 1CDYA 2AJYL 1E6OH 3GB7A 2X4RB 4MB4A 3GSOA 3ZTJH 4U49A 5AAWA 1WBYA 2FBOJ 2XPGB 3H9YA 4UT7L 3ROOA 1MF2L 3K2MC 4PR5B 3TT3L 3WNPA 3CU7A 1SM3H 1SY6A 4YHIA 3PWUB 1KIPB 3IU3B 5GSVA 2NY6C 1I3RA 1EO8L 3D87B 5FYKH 4OD2B 4LLUA 3M17B 2FWOA 2BNRE 2PXYB 1JWMA 4H20L 4NRZA 4QRTA 4X8XA 4XH2B 1F2QA 1MLBA 4QRPE 1QSFB 3VMOA 1RIHL 1ZVHA 1TVDA 2MQCA 3ZSTA 2ORBL 3B6SA 4PBWD 5K9OB 1T04A 2H2SC 2Y6SC 5JW5B 3U82B 4OUUA 1R0AL 4K3DH 4MA1C 4GQPH 3U30B 4J3UA 3MPCA 3FRUB 5DMJB 2Y06L 3U6RA 3N1QC 4KTDH 1K4DB 5BQ7B 2X1WL 3DXAD 3HZKA 1OCWH 4LCWE 3DETC 2X4TB 4XZUB 4PRIB 3WMSA 4LASL 4H0GA 4Y1AB 3GNML 1BZ7B 1C7TA 1JHLL 4NZUH 4W70A 3CLFL 3KS0J 4WVRA 3HG1E 1QQDA 5IROA 2B20A 4QT5A 4NWUH 3CIQA 4BZYA 3V95A 3ES6B 1UJ3A 1W0VB 3GMQA 3QIBA 2IAND 1NGXB 4V1DD 2P5WE 1NJ9B 1UWEL 1IE5A 4I77H 3FO2B 3FL7A 2R15A 1L9MA 4P4KD 4OCSH 3ZKMC 1CQKA 3AXLB 1CFSB 3MODL 3H2WA 3DXAA 3HB3C 5BCAA 1QBLL 2DQUH 4GRWE 1MRDL 1WLHA 2BVQA 4PRHD 4PV8A 1UYWL 3I3BA 1KTLB 4OGAC 3CSBA 4U1IB 5C0EA 3TA3C 4KRLB 4PY8I 4FZEL 1X5FA 3EOTH 1L7TL 2BRQA 2EXYD 4NO3A 3MRIB 4LPCA 1IAII 4G8GE 1L0QA 3J7HA 3IDJA 2HWZH 4OF3A 1YNKL 5D2LF 4KK5C 3Q6GL 2VRAA 4L8SA 1BWWA 3JZ7A 3VXME 1XGYH 1MCPH 1OW0C 2IANA 4WEBL 5T3XL 3LKOB 4PJFF 4X7TB 5H2BB 4P3DA 2CK0H 2LAGB 4P4KA 3RGVC 5IB4B 1JPFA 1UCBH 3T3ME 5F44A 5T3ZD 3MMEB 4O51A 3D39B 5INDB 1KJ3H 4PRHA 5EB9A 2DQJH 1SYSB 4ONHA 1X5JA 2FHBA 3GZKA 2DQGL 5ALCH 4TUOB 4YBLB 4PJGE 5TFSL 4QXTB 4GAJL 4YHMH 4KZEH 2GSIB 5J56B 1A9BA 1S7UB 5JOFB 2FHCA 5F1IB 3SPVA 1OSZA 2NZIA 2VWEC 2KL6A 2W91A 4I18C 4MLIA 2EIDA 3FN0L 1YNLH 5HHPA 3RVVD 5E24E 2R1XB 1IT9H 2YD6A 3IVKB 3MRCB 4OZFA 5ICYA 3H9SA 3V7MA 2FB4H 4H88H 4ZNCD 1TZGL 2CR6A 4YPGB 2O26U 4U3XA 4WV1C 1QKZL 3RVTD 1YEGH 2E7LC 1IGIH 5E2WL 3RGHA 4XP1H 2VISB 4WGVB 4YNYA 5HHXH 3P40A 5C07B 4HFUL 4WWKB 2W07A 3SQOL 4HK3J 1I8LC 4DGYH 2X9WA 2ZCLL 3KYNB 4J3XA 4UDUA 5IGXL 2QADD 3JWOL 3PHOA 5F96H 3SDXA 1IGYB 1AJ7H 2NW3B 4LRNH 1FDLH 1N59B 4NUGL 2OXGA 2QSCH 3O6KL 4HUUB 2V17L 1BP3B 4J12A 5DO2D 1BD2D 2DM2A 1GGUA 3LN4B 5EO9B 4AIZA 2GQHA 4M9PA 5M7QA 3FZUC 1WAAF 3IDGA 4JHWL 5JDSA 1HQ4A 4YZFE 2ICES 1A7OL 2IH1A 5D7IE 4TRPH 1DL7H 3CNKA 2NYYD 3L9RB 2EC9T 1FFRA 4JGMA 4WI5A 4XMKH 1IEHA 2VQ1A 5F1OB 3MA7A 4CMMB 5E5UB 5EU6E 4LDLB 4X7SH 3MGTB 4X5LA 3FAXA 3L3OA 1XT5A 4NQCD 4UUJB 4Z7UB 1CLOL 5EIIA 4NRXB 1Q9OB 2GJZA 4Y16C 5FYKU 1TXKA 2HG5A 4M5ZH 5HYJD 2D9QB 43CAB 3A67L 3D5OF 1IGCL 1KCVL 5T5FH 1WCBA 4Y8DC 1FIGH 1YPZF 4MDIA 2NR6C 4F57L 3MBXH 4PJDF 3RDTD 3QIWC 1A4JA 5I17A 5EOCL 1CXEA 4LLWB 1E6OL 3AS2A 5HHMD 4I2XE 2CLRB 2LU3A 5D7KE 4L4TA 4RAVB 2D31B 5DHVH 4JFDD 3IDNB 1MEXH 1SM3L 4LPWA 4IRJC 5DD3H 5DJ2A 5K9QI 3SDDB 5FYKL 3D85D 4ZNEA 3HMWH 2OM5A 3OR6B 4H26B 1RAMA 1T20B 4NQCA 1W0WA 1J5OH 1J1XH 4KDVA 3EDEA 3CFKA 2CLZA 1OF2A 4PJHF 2XN9A 2EIZA 5FHAH 4Q9CA 3L5IA 5IHUH 2IADA 3DURA 2F8VA 3MLSH 4IIQC 3RDTA 4JRXE 2Y7QA 2YXFA 4FP8H 3VD5A 5EC2A 4PJ9B 1YMME 2X4OB 5E1AA 4FN0A 4K3DL 4MJ2A 2O93L 1QLRB 1NBZA 2B5IB 4OGYH 3C5SB 3S96A 4YFEA 1EZVY 3LAFA 4PLKC 4AT6A 5KW9H 4KTDL 2VITA 1UFUA 2ENYA 3GJFB 3X13B 1OCWL 3VFMA 4GBXD 2YA1A 3EOBA 5JIPA 5MEOB 4N8VA 2A83A 15C8H 1AO7A 3DRTA 2OQJA 2FLBT 4N0FB 5GISH 5CLTA 4U6VH 2XKUA 4NZUL 3GSWB 4D0BA 1F13A 3QSKB 3QUXB 1A2YB 1W2KT 4XX1G 4JQIL 4Y19B 4H25B 4AM0B 4NWUL 4KJYA 2BMKA 2AJ3A 1WCQA 3ZE0F 4KZDH 3T2PA 5KSBF 4JJ5A 1NEZB 4Y4HA 4I77L 2B4CH 2FJGB 3NAAH 3R1GH 4U6HA 3QEUB 1YZZA 1IARB 2YEZA 3MBEC 4OCSL 3MRHB 4A6YB 2VZSA 2EDFA 1IQWH 5IQ9B 2PO6B 2DQUL 4LCYB 1U8NB 3U1SH 4PJ8B 2HT3D 2DLEA 5J1AB 5ICXA 1NKRA 5E70A 3LKRB 1EFXB 4RIRB 2OZ4A 3BXNA 3OAZH 4KI5C 1S7WB 4I3RH 3S5LA 1SVCP 2DL2A 2G2RA 2OL3B 3C5JB 2HWZL 4G8FA 2UY7A 4KK6C 1MUJA 3K4ZA 2CMRL 3DGGA 4K8RC 5DRXA 1MCIA 5IR1A 2Z0BA 1PJ9A 2JTDA 2PTTB 4NFBA 4OZGB 3VWJD 1AD9B 2FH8A 2CK0L 4PJCA 1HHHA 1NC2D 2ADGA 3DV6B 2YPVH 1H0DA 1UCBL 3QWRD 4LCUA 4GG6F 1KJ3L 3C6SA 1WSST 2VKWA 2E9IA 3RL1A 2DQJL 4PRBB 1LEIA 1UZ6E 2AQ1A 5F7HA 5ALCL 3ZDXE 5KN5A 4YHPA 3RUGA 4D2NA 4KK9D 1IGTB 4R0LB 4Z7NF 4LP4A 4YHML 4KZEL 2H32A 3IETB 4NN6B 4ODWB 1OP9A 1EX0A 4MSWB 3QEGH 5D5MF 3OR7A 2ZG2A 5I74C 3QQNA 5C3LD 1PKOA 1U95B 2VXUH 4LDEB 5ESAB 5E00A 4AL8H 1UA6H 1N8ZA 5H37G 1YNLL 4JO3H 1KPRB 4JHZA 5JXED 2AK1H 2FIKA 4OQTH 2FJHA 4FQQB 2DM4A 2FB4L 4GW4A 4H88L 2YPKB 3AAZB 4ZPTB 1YNTB 4HWZB 3EYFA 1C12A 1YEGL 3RWGA 1IGIL 1B6UA 2AK4E 2NXZC 2OS7A 1AC6A 4JQXC 5HHXL 1EPFA 3G5YA 4U6YB 4M6NH 4DZBA 4DGYL 4DZ8A 3SE8H 3IFLH 4PJXE 1MCNA 5F96L 1AJ7L 4LRNL 3UEZA 1LO2H 5T1LB 2D7TH 1PW3A 1FDLL