3RDTD

Crystal structure of 809.b5 tcr complexed with mhc class ii i-ab/3k peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
199
Chain Sequence
b'FEAQKAKANKAVDHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
publication title A role for differential variable gene pairing in creating T cell receptors specific for unique major histocompatibility ligands.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 199
sequence length 217
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3rdtD01
2GJJA 2EC8A 1QFUH 4X9IA 3ZTJG 2GJ6E 2NXYD 3GB7B 1S3KH 3EYUH 5ESAA 3RBSA 4HS8H 1MCNA 4RMWA 3UROR 4GRLC 1ZLWK 1A7OH 2HFEA 4PBVC 3S35H 2IEPA 1CICC 1MI5E 4ZYKB 1R3LA 4WFED 4Y19A 4GQ9H 3WJLC 5JZ7C 4QTHB 4ZTPL 2MHAA 5KANG 3GRWH 4NQEA 1CQKA 4LFHG 1JGDA 2CKBA 4P5KA 2VO5A 5J9PB 4JR9L 1AE6H 2YKLL 2AJUH 3TJEH 3FQNA 5T1MB 4M6NL 1JPSL 4G8IA 1J0JA 4MDIA 2H8PA 4PRAA 3RL2A 1ETZB 3TYFB 3L3OA 4H20H 2X10A 4G6JH 5HHOA 1CF8H 5D7IF 5JIKA 4D3CH 2ATKB 4RMUA 5DA0B 4YO0B 4KV5E 4FZ8L 4ZFOB 2B1HH 1OOAA 2DYPB 2EIZB 4R4FH 3ILQD 3HI5L 1U8JB 3DX8B 4J12A 4X5WB 2J6EL 3RNKA 4NKMA 3GI8L 3D39E 5D6DC 4JN1H 4HCRA 4X4ZA 5T5NG 4N0FA 2ZCHH 5DJYA 2NR6D 4OZFB 2EIBA 5D2LB 1B2WL 4CVWA 3GGWA 1DEEB 3ESUF 4KZEH 3QUYB 1D9KA 1XFPA 4D0BB 1G7MA 4PGBA 2X41A 3QIUD 1LWRA 2D9QB 3L9RA 1KCSL 4LSPL 1LHZA 4OZ4B 3TP4A 3G5XA 1AD9B 4CNIB 4POUB 4QXTA 3LEXA 1HK6A 3CFEB 1PKOA 1OSZA 4R7NB 2EDJA 3EYOA 2G2RA 2A2QT 5J6GB 4PGZA 4XCFH 3VWKA 4RWYH 4JGJA 4N0UE 5DUML 3VFWA 4DZ8A 1JZ3A 2XTLA 4EIZC 2QHRH 5IROC 1NFDA 4AENA 1OLZA 1H8OA 1T1XB 4MA1B 3QQ9D 1MCWM 4F3FB 1Q9LB 4GRMA 4NWUH 1EHLL 1HHIB 1T1YA 1PBYA 3QZWA 3CIQA 2XRAL 3C5ZA 3QQ3B 3UO1L 3KWWB 4Z7UE 2NW2B 4CMHB 4Q0XL 4M9OA 1K6QL 5I8EA 2NX5B 1UB6A 1C5CL 3DPBA 4UDTA 5ENWB 4F7EA 3AFLA 4UOJA 5DD1H 3FOMB 2KZ1B 5F7UA 4W81A 1CVRA 3UJTL 4LCCA 4ZS7H 3BPNB 4OLYH 3E1F1 5MI0C 1DBJL 4MXWH 3FB6A 2P8MA 2UY6A 2Y7QB 2O5YL 4HPYL 3HPJB 5K9KB 5L2JB 2CO7B 1EJOH 2R23A 5B39A 3EOBA 3B9KD 4M43L 3L3KB 3LB6D 2OJZH 1WZ1H 2H45A 2ICWI 3FOLB 3FT4B 4RIRB 1XGQA 5EU6E 2HH0H 4X5LA 4X6DB 3KLDA 5EZIH 3NN8B 5MEQA 4IMLB 4YGVB 4U1NB 4YR6A 3MLXL 2AEPL 2WBJA 4NQVA 3FFCD 4QF1A 2D7TH 2HJKA 3M8OH 4HIJB 1KCVL 4R97C 4YAQA 1NGXA 1CBVH 1KJ2A 5BXFA 1B4JH 2CPCA 3VXUB 5B8CB 2UWEA 5TE6L 4HT1H 4X0KB 1RIUL 5D7SL 3O9WC 1MH5A 4K2UL 5D1XA 4OD2B 3NZHL 2ARWA 3OKKB 3B6SB 4I0PB 5FYJE 4ERSH 5SWSA 3DV6B 1WCBA 2EDNA 4K3DH 4WV1B 4BUHA 3RX5A 4PJDB 5I1DA 3VFTB 4AK1A 2X6MA 5CD5C 1RZ8A 4YBHA 4UILL 5HDBE 1DUYB 3DNKA 4RMTA 4FQHA 1N6QH 4OIIH 4XNYH 25C8L 4DKDC 3BGMA 1UWGL 1C8PA 2Z8VC 4P23C 1EEQA 4IRJB 1NJ9A 2EE3A 4CN4A 1IEBA 4OGYH 4ODBD 1KLGB 4MDJA 3SDCA 3OSKA 2Y06H 3C5SB 4N9OB 5J3HD 1NGWB 1X6NA 3MODL 2C3VB 1Z5LA 4YHIB 2G60H 1JTTA 4AT6B 1ORSA 1PQZA 2EO9A 3PL6C 4AH2B 1CE6B 5EZOH 3IDIA 3O81A 1KTRL 4P2OD 1AKJD 1JK8A 4R0LB 1F4HA 4JANB 2QQNL 4TTGA 1MHPH 1N4XL 3V79C 2FEDD 2EXYC 1ORQB 1P2CA 5GISL 3VW3L 3HAEA 4PYHA 1JMZA 5HVHC 4ODVL 2R0LL 3N50A 5D2NC 4PJXE 1LEKA 3RDTC 1TETL 4PR5B 4Q58C 4E42B 1UWXK 1IJ9A 4M7LT 5SV4A 2GHWB 3C2SA 1LP9B 1ROWA 4G8GD 1M05B 3PXJA 2IAMB 3FN9A 2V2XA 3KPSB 5FUOL 4BQCA 5HYIA 5KG9B 2ARJQ 4ZNEA 1VHPA 4LF3A 1M7IA 3TNNB 4FFVD 5KZCD 3KLAB 4DAGH 4L3EB 2CQVA 4P4KC 4MXQD 4EUPG 1I1AB 1CDJA 2FWOA 1GGCH 5CEYB 5GGUA 3BH9A 3CXHJ 4G42A 2X1QA 3HR6A 1UACL 5LGHL 4Z5RB 2VDOL 3O0RL 3CLEH 1FIEA 3Q6FA 2HFGH 3CUPA 3NFNA 2ZP0T 4PYGA 3T3PF 5HGDB 5DC9B 4D9LH 3P73A 2NY6B 1RULH 3WXWL 2Y36H 3TV3H 4LGSB 4PRIE 1DN0A 2NTFB 5C9KA 3ZT6A 2R29H 5EOTA 4MZ2A 3HZMA 2FBJL 2HRLA 3R4DA 3VFSA 1O7SA 3KJ6L 3ALXA 4N68A 4OLXL 5JXAH 5E95B 1F4AA 5CJQH 3SDYH 3CZFA 1X6LA 5IT2L 4K9EL 3T2NL 4FQXA 2VWEE 5K9QG 1MWAL 3ZE2E 1KB5A 3VXRB 2BVUA 5ICYB 2JIXD 1OAXL 4ODWA 2AAVA 5GZND 4LCUB 4P46A 3CC5A 1CLCA 3ULVC 4N8PA 1C5DA 3PIQA 3TFKD 2PXYA 3C60D 3ZO0A 4H8WL 1MLBB 2VLLB 5IVZB 2Z8RA 5TQ0H 2YD8A 3U0WH 3GMRB 1CFQA 4XPFH 3ULSB 5IESL 4MNQE 2DLFL 1WWCA 2ZG1A 3LOWA 3TT3L 4WO4D 3PGCA 2I07A 1FNLA 3SE3C 2F54A 3HFML 3QDAA 3RAJL 5IMKA 3IRZA 3ROLB 1HQRB 3P0YH 4RFEA 3TM6A 2F8XC 3Q5YA 2YUZA 4KPHH 4NHUA 1KOAA 4RGNC 5AZ2L 1MIEL 4MA7H 1J0IA 1A14L 2CJUH 4U1KB 4Y16A 2Z93B 2VDQH 2Y4SA 4P2YA 3CK0H 1T7ZA 1NUGA 4N0RA 3RL1A 1JRHL 1EDQA 1GIGH 1MFEH 3UZVB 4NQTA 3DVFA 1VDGA 5B38G 1MQKL 2H9GA 3CFJB 3I75B 3U1SL 1IKFH 5DYOB 3FMGL 2VSCA 4G6FB 2EC9T 4MVBC 3TF7C 3VXSD 3SDDA 1C16A 4OZGE 2VITA 4G6KH 2ARJB 2HTKD 3PHQB 5E8NB 2VLME 1XH3B 4RQQA 5DK0A 2IFFL 3OB0H 4MSWA 3VU2A 1TJGH 4Y88A 3ZDXF 2H2PC 1QR4A 3DMMA 5F71A 3OX8B 3IDGA 4D9RE 5EORL 5I66B 1BIIB 1XGRA 2XN9D 3UZQA 3TH4T 1WAAF 4HH8A 1NCBL 1V8HA 4NN7B 4QYOB 4S0TD 3GFUA 2Q7NA 1I7UB 3BUYA 4HDIA 1UM6L 1U8KA 3VWJB 3PWVA 3FN0L 4Q2ZB 1FG9C 4EUPA 5MHSD 3OF6A 4NFCA 1RJYB 2B4CC 3UTTE 4ZNCD 3NIDE 4R4BB 4FA8A 1BEYL 3WJJA 4GOSA 4R2GB 3RJDA 1FNEA 3M17B 3MCLH 1DQMH 1KEML 5AZEH 3TCLA 1X5JA 1N8ZB 5DD6B 4DN3H 5L9DH 2UUDH 1VCAA 2ZG3A 4CAGA 3GHEH 5T1LB 5GS1B 5IHBA 4PJIB 3QUXB 4JO4H 1ACYL 2VLJE 1T66C 2IGFL 4K3EL 5ID0B 5IVXF 5FKPA 1TVDA 3MACH 1RJCA 4OZHA 43CAB 3WO3B 4XWGL 5FUZH 3LQZB 4Y2DD 5DZLA 5I75C 5F72S 3BKJH 3AVEA 3BHBA 3PDDA 2RCSL 3D9AL 4EDXB 3WE6B 1IEHA 1CL7L 5EC1A 1A64A 3BD4A 1A3LL 4PJEB 5D4QA 1YEEL 2W0FB 5DK2B 1B0GB 5AWNH 5IG7A 5CP7B 4M4RA 4Z0XA 3W9EB 2IBZX 3OJMB 3LD8C 4JFED 1BFOA 1DBAH 5DR5L 5F88A 5C0NC 5HBBA 4CU8A 1MUJA 3ARGB 4XVTL 5FGCE 4QGTA 4WUUE 1NLBL 4RAUA 3BDYH 1IT9L 4NQCD 3U4BH 1FZJA 3IDYC 3B43A 3M1BB 2EYSB 2WWKO 4RMVA 5EU7C 5FAAA 5I0ZA 4XC1L 1ZLUK 5I73B 4R26H 3FO9A 3D39A 2CIKB 4HIXH 3ARZA 3LEYL 2DD8H 2VDKH 3P30H 4P2RD 5D1ZD 4JFOA 3CXDL 4J4PD 4XTRD 5F1NA 3IF1B 3KGRA 2X05A 1OAZH 3TVMA 1GZPA 4X4ME 2EIDA 1S7SA 3ARFD 5JO5A 5FYKL 3IFNH 5BVJB 1I7RB 3K2UL 3TBWB 4R4NC 1ZGLP 1MFDH 4G5ZL 1RUQH 4MHHI 3TIEA 3HZYA 3MUHL 5D7LD 3PQYD 2AJ3A 3Q5OA 3S9DB 5B38A 1U92B 4HEPG 2VDRH 5DJAB 2CKBL 4LQFL 2B7DT 4X4XA 2HMID 4TUJB 4LHUG 3SJVA 4LRNL 3VXTA 5AG8A 1UVQA 2HFFA 4JDTH 2IPTL 2AEIT 4ZO9A 4I18C 4GAJH 2YXMA 4OSUH 3QISA 4QRRB 1A9EA 5CEXB 5GGRA 3GEWB 4JM2A 3KPMA 1FH5H 3EZJB 1FORH 5FIEA 3JTSB 4Z7UA 1K4CA 2P47B 4Y5YA 2CLRA 3P0VL 3VCLA 4BSWA 1NCAH 3WFBL 4L8SB 1MRDH 1BZ9A 4FQCL 3G5VA 2M26A 4GKSB 4OLZH 4PRPB 1LO5A 1KV3A 1NFIA 3U6RB 3D3VD 3UJJL 4EN3C 5BZDB 3T0XA 1GYAA 3QI9A 3VFPA 5C2UB 1MFBL 2YRPA 4Z78B 4ZUSB 3QRGH 2VQTA 3RGHA 2VQ1A 5CJXC 3PDGA 5LGKA 1WFOA 3P2TA 1N2RB 5D6CB 4ZXBA 4MXVE 5HYSG 3U7WL 4XBEH 5DEZA 3TESA 1NGZA 4JKWA 3MLTB 3AU1B 4MJ6A 1GC1C 3BE1H 4TVPL 4ZUTB 1WF5A 3LSOB 1XGPA 4K3JH 4OLEA 4EI5A 3HPLB 2ICWB 1WK0A 2QQKL 1R3JB 2YWZA 4L4JA 2VXQL 5C0BD 1TFHA 4HX1B 4PJBB 5GGTA 4QT5B 1HINH 3LKNB 1UKTA 2XKNB 4DVRL 4NRZA 5F1OB 4QXUH 2OXHA 1YNKL 4DUWA 5IV2A 3IAQA 2XWJA 3O6FC 5EU5B 3NA9L 1VERA 2IG2L 2R15A 1S7TB 1BHGA 4JREB 4JFHD 5KSBB 4ZTPH 3HC4H 2YRLA 1EMTL 2A74A 4XRCA 3W5NA 3RQ3A 4P57A 3ARDA 4NNXA 4JR9H 1OM3L 4G9FA 3PGDB 3ULUC 1I85C 5L2KD 4UTAL 3PWLB 3D25A 5D2NE 1DFBL 5IQ9A 1F8TL 1UM4L 2EDOA 3WCYA 3EYSL 3P4OA 1MCFA 2W9DL 2C1PA 1V3JA 3MBEC 4Y5XC 1UH4A 1JYWA 5DRWB 3SOBL 4CVUA 3IDMB 4U7SA 3SKOA 4FZ8H 2UZIL 1KIPB 3CCHA 3HI5H 1B4RA 4H25B 1FYHB 1M7DA 2MSPA 2J6EH 5H37H 3GI8H 5J0BA 3BEVA 4KV5F 5DMKA 2F74A 3P77A 1AXSA 1G6RA 1OTSD 2GAZA 2P43B 1B2WH 2PO6B 4J6RH 3MRJB 2BSRA 4Q6IC 1K5NA 1KJ2L 5DEGB 2FBOJ 3W9DB 1SJXA 2D0FA 2W65B 1KCSH 4LSPH 3T0DA 4LHUA 3AC0A 1MJ8L 1EX0A 1HWHB 3HZKB 5E7BA 1BZQK 1WGOA 2NY0D 3IETA 1U3ZA 5EOCH 4Z76B 3L5WB 1A4JA 1V7NL 4WHTA 2WINA 5DUMH 3PE9A 5L0QB 4HH9A 2R56L 1LILA 2FGWL 3EO1A 4BH7B 5IOPA 5CSZB 3EYFB 4PB9L 3PWNB 4NRYA 1EVTC 3MRKA 1EHLH 3RWJB 4MMZC 3C6LA 5D7KD 4IHOB 2XRAH 4P9HL 1TIUA 4OF7A 3KR3L 4U0QB 3ULVE 1MCWW 3QDJA 5FO7B 5IHZB 3BMVA 1JNNL 5DUBA 1CG9B 3MRCA 4GS7B 3IU4L 5HHMD 4GKNB 3HN3A 3V6OA 3WS6A 1QG3A 5E8OA 3UJTH 4X7EC 1U2CA 4LKXA 3RTQC 3RWIB 5HHPB 3W2DL 1HHKB 1NFKA 2NW3A 1IEAB 2R2BA 3C8DA 1FP5A 1NCDL 3MUGA 3I02B 4K7FA 5HDOA 5C6TL 1ZA6A 4HPYH 4RGNE 1JYXA 1U91A 4WI2A 4JRYD 4FQ1L 4M43H 4ZS6D 5I8CB 4ONOA 4WCYL 3NMEA 4HUVA 5F7DA 3BVNB 1TZHA 2EDYA 3WNLA 1UENA 2JK5A 4JZJC 5FYKD 3RVVC 4N9GB 3UPRA 4PJ9D 4ZFGL 4L4VE 2AEPH 4CUCA 1WBYB 2LTQB 4PJAE 4O4YL 1K9TA 4Y19D 3DBXB 1YJDL 5GZOC 1DDHB 3EDFA 5JLZB 3RP1A 3ARPA 1WIPA 1CZ8L 6FABL 2AEQL 4I3RL 3RWCB 1UJ3A 3QIWA 1RZJC 2YZ1A 3DRQA 3BXNB 5EOCJ 1RIUH 4XP4H 5D7SH 3GM8A 4C4KT 2K7QA 2A6DB 3HG1D 4P5MB 5BOPA 1LO2L 2D7NA 4Y4FC 4I48B 4K94L 1AGCA 1F97A 4LVNC 4TTDD 5C7XL 1Y18B 1XF4A 2HN7B 4LSTH 1IAIL 3AREC 4L8BA 5GIRB 2E9JA 1HOCB 1TTFA 2C26A 2Q87A 4EDWL 1R5VA 1BBDL 4PJFB 3EAKA 1QSFE 3CDYA 1NBZA 1TVHA 4PBXA 3VFRA 1Z6JT 3WO4B 4UILH 2XKUA 25C8H 5CIPA 1UWGH 5DDHA 3EJJX 2DM3A 5B3NA 2HT3C 4NC1C 3ILPA 3BZFA 3ZSTA 1ZHNB 3MGOA 2XZAL 4HMEA 5FUCC 1FL6B 1KB5L 5HDBF 4UBDC 1RZFL 2GTZA 3MODH 1OP5K 1AP2B 1IVLA 1A47A 4QRQB 5D1QD 4PJ8A 5IMOA 2CDEB 5T3XE 1N4XH 5BS0D 1AHWB 4ZO6A 3CU7A 5GISH 3VW3H 4ODVH 5EZLB 5HGBB 3LEVL 2VXUL 5DMJB 2IH1B 1Q0YL 1TETH 2X7LA 1D6EB 3HCVB 3TN0D 2WK2A 2CMRL 1P7QD 1OB1A 3D0LB 3IDUA 4M8QA 1G7LB 3UTTA 4PJXF 4J8RB 3A6BL 5FUOH 4PP1D 1G7IA 1WWAX 4KTEL 4L5FL 1P69B 2PUQT 3ARSA 3MRNA 4WGVB 4UAOC 4FOMA 1ZT4A 4GW1A 3QPXL 1FVDB 1F4YL 4O2EA 5EFIA 2CKNA 3KPQB 3F5WA 1NCCL 1QFWL 5EU7E 2P42B 3HA0A 5CJOL 5FA4B 4QHUB 4H1LA 3BDBA 1UACH 5LGHH 2CUHA 2VDOH 3O0RH 3IAGC 4IS6B 2R2EB 5JXEA 3QJHA 5KOVC 3QDGE 4PREB 2IPUG 4JRXA 4X99B 2VZOA 2HKFL 3MRDB 2P7TB 3GNML 1NDMB 3MLUL 4NKOB 2FBJH 3MYZA 4XB7A 3GO1L 4OLXH 5TJWK 5HGHA 4DFIA 1TTGA 2I9LA 4WUUA 4P3WA 4K9EH 5IT2H 3T2NH 2B8OT 1UKSA 1MWAH 4KRPB 3VGBA 2R4RL 1OAXH 3WNKA 1AI1L 3QEQB 2CR6A 5C0DB 1KENL 2A83A 2PN5A 3FKUS 4BFIB 1EFXD 2APWA 1KJVA 4U1LB 1NMCB 4H8WH 4L29B 1TLKA 4DCQB 5FGSA 4P4RB 1J05B 2JCCE 5CWSB 2DLFH 3TT3H 4JHZA 5JOEA 3HFMH 3RAJH 3D69A 1DQJA 2YD5A 3IS0X 1HSAB 4UV7L 3BUTA 5SWSD 2QR0A 1G9MC 4LMQI 3BRFA 3H9SD 4PIRF 1CFNB 2C4XA 4HUMB 1KPUB 1M1SA 4DGIL 3DV4B 5F9WC 5E0QA 5AZ2H 5EZJA 3MMEA 1MIEH 1S5HB 1A14H 4O00A 3VFVB 3OPZL 4Z7WA 2I60L 2I26N 1NBQA 4X98A 4WHCA 3D18B 4RMSA 4HUWB 1JRHH 1AGEA 2V5YA 5KOMC 5E08L 4NDMA 2P5EE 4YXKL 4P3DB 5AAMA 3SDXE 1MQKH 3PWPD 4PY7B 5CBAA 3MV8B 3QB7C 4E41E 3F12B 4CVXB 3U1SH 3FMGH 3T4YA 3V4UL 4PBWD 1G7QB 1S5IH 2BY3A 2HT4D 1AQKL 1C12B 3C09B 3H9HB 3IJYA 2GITB 4PTUA 1OGAD 1NANH 3OAZK 1QHPA 5IVOA 1JWSA 1LEGA 3KPPB 5JOPD 3UCRA 1DBBH 2YC1B 3CFBA 2IFFH 1CXIA 3BOVA 4KJWC 3W0WA 3KPRB 5TGBA 2LAAA 5D7JD 1MRCL 3O8XB 4OZGF 3HE6B 1BP3B 4LHJB 5FECB 1MHCB 3JUZA 4XCYB 3VH8A 5EORH 2X1WL 5F3BA 1NCBH 1ZE3C 3QULA 3GBML 3ZTNL 5C0AE 5J1AB 3DX9A 4L1DA 5DQJA 1HH9B 1T0MB 4J3VA 2OR7A 2X40A 3AS2A 3ULUE 2XY2A 5CGYC 1T22A 3MNZA 5GJSH 3FN0H 3JWDH 5CSGA 5BV7L 5E8PA 5F44A 2ATPB 2O5XL 1QSED 4M6OL 5HI5C 3MRFA 4GAGL 4LCWA 4MJ5B 1S7XA 4WI7A 3T8XA 2ITCA 4JFFB 4LAQL 5I1CH 4ZFZB 2AV7B 1IQDB 1UWEL 3NIDF 3RY4A 3O4LE 3E2HB 3HUJA 1JN6A 1JMXA 4BZYA 3KXFB 3AY4C 4XCEB 1CI5A 1ACYH 3CH1A 1KB9K 2IGFH 4K3EH 5GSVA 4RDQG 5CP3A 2XFXB 3C5JB 3K2MC 2EH8H 4XWGH 3JTTA 5JHDE 5HYJA 4X6CE 4MA8L 1P9MC 1RVFH 1BQLL 3GSWB 1FVCA 3H42H 2ZOKB 3D0VA 4G7YL 2RCSH 3D9AH 4JY6B 4LLYB 1CGYA 1CL7H 1A3LH 1CDYA 2W9EH 3RKDC 5JR1L 4FQXD 5DQDL 2XOTA 4QY8B 3QAZB 5HI3D 5JPNB 1NEUA 3RZWA 4L8CB 4YK4B 1UQSA 2A6JA 4QRPD 3MREB 3DTXA 4XVTH 5IFJA 4GBXB 2R9HC 1IT9H 1Z3GH 2ADGB 5I1AB 2AXJA 1KYOJ 2EDDA 1WBXB 4E9LA 4JDZA 4XC1H 3VXNA 4ELKA 1CN4A 3LEYH 5HVWA 2J5LC 1ZHKA 3BGAA 2FL5A 4NYLA 3CXDH 3IXTA 2YPVH 2RBLA 3RVXC 2JB6A 5TDPB 5L8JB 1B88A 3O2VL 5FYKH 2EZ0D 3K2UH 1MF2H 4PPTA 1OLLA 4I4WA 4M7KL 1XCTA 2FLRT 2VLKE 4E0RB 5GRJL 4G5ZH 3PHOB 3T0ED 1RIHH 5FYJL 2X2YA 2VNCA 3ES6A 1YPZA 5IEKA 2BRQA 2CKBH 4K71B 2BFVL 4LQFH 1H9VA 3CMGA 4TQEL 1WT5A 2VTFA 5HD8D 3JWOH 1UH3A 3RWDB 4JPVL 4LRNH 3MV7E 2IPTH 5EBMB 4UDUB 2V2TA 4KY1L 5A16A 2BNRE 2C3HA 4OGAC 5EBLA 2YRZA 3MV9E 1ZT7A 3BYYA 3U48A 2YSSA 3MGTB 3ARVA 2AGJL 3IKKA 5J13B 3P0VH 3S5LB 5I8OH 3WFBH 2VQUA 4UUJB 2Y1VA 1KG0A 2GW5A 4FQCH 3RY6A 5EUOE 5JW5B 3DARA 3HZVB 5M7QA 3UYRL 4D8PB 3O3EB 3UJJH 5KANI 1J8HE 1KACB 4S1QL 1G6RL 1FYTB 1XZ0B 5GRYA 1VSCA 2X70B 5F9JA 4M7JL 4X9FA 4P2RB 4KJQC 5D1ZB 1ZANL 2FO4B 1OVZA 4X4YA 4KJYB 3FTGA 2GJ6D 3U7WH 1VGKB 1CDCA 1OTUC 4F15C 3QH3A 2VR5A 4PRHE 5C0RL 4TVPH 5CHNB 3CX2A 1DJSA 3HI1A 3C9NB 4OZFG 2QQKH 4UI2A 2HG5B 2VXQH 4NQDE 1YEDB 1EZVY 4MXVF 4PJAA 1MI5D 4WW1A 5CKGA 3TLRA 4NC1E 3SE4C 4QO1A 2NY1B 3A6OA 4JAMB 2AV1A 3L7FB 5EPMB 3UMTA 5JDJA 1S9YA 5FUCE 3WHXB 4F58L 5C0GA 3TH3T 5HHQB 4GRWB 5EIIB 3UYOD 4WI8A 1QTYT 1YNKH 2IH3A 2CIIB 3NA9H 4OCSL 2IG2H 1U36A 5DHVH 4HHAB 4C56B 5FEBA 1OTTD 4EI6A 1Q9KB 4M1DL 4WVRA 5BQ7A 3WNNA 4MQ7B 3OAUL 3FO1A 4M93C 1EMTH 1MLCA 1NSNL 5I16B 3DURB 2X4SA 3MRBB 1OM3H 3X3GL 4HV8B 3BSZL 3RWGA 2D3VA 1F8TH 1UM4H 3ZKQD 5T33H 3EYSH 1FNSL 1YMMB 2W9DH 1GXEA 3D39D 3SDAB 3SOBH 3X11A 5E00A 1MCLA 2J8UB 4QHMA 1SJVA 4FRWA 3QQ4B 2VAJA 4HS6A 4PJHA 2Z31A 5A3IC 2ESVB 1WJ3A 1NC4B 3TVMD 3VRIA 2VISB 4L4TE 4X83A 4QOKA 3V95A 1YN6B 5C0CB 4P5TA 2AW2A 1MREL 4LLWB 5KS9E 1FAIH 1FC2D 1N59A 2QQQA 4LLMB 4UT6L 5E8EA 3S37L 1NBYB 3U0PB 2CDFA 3I9GL 5EB9A 1KJ2H 1ZHBA 3MRHB 3R0MA 4KXZI 3PWJB 3TO4D 1MJ8H 5HDQL 3RVWC 1I3GL 3TZVC 1U0QA 2DRUA 4IIQC 3DO7A 2EDBA 3NCMA 1MFNA 5E5MB 1V7NH 1MEXL 4WW2C 2IANB 2R56H 3H7BA 4KQ4H 2FGWH 4PUBL 1NMAL 4PB9H 1G7JB 3L3DA 3O4OB 1JPGA 3TA3A 4BFGA 4P2QB 5IB2A 1MFCH 4MJ4A 2IADB 5KSAA 3D2UB 4P9HH 3KR3H 4WEBL 4QXGH 1JNNH 1A6AA 3BAEL 3DETC 2OTWA 1S7WB 3IU4H 5C1MB 1RZGA 2P5WE 3ULVF 3W2DH 5MENE 2JJTC 1NCDH 2ZUTA 2Y5EA 2E7BA 5DSCB 1UB5B 2YPLA 4ZAKB 1YN7A 5E6ID 5EU6D 3HAEH 2VE6B 2FJHB 3D85D 5TDNA 3MLZL 2O61B 5C6TH 3RVUD 4AYFA 5I71C 3LRGA 3MGAA 4ZMAT 3RVTC 1CGTA 4FQ1H 5IBTL 5IKCA 1RK0B 3MA7B 2N4IA 3RUGA 5HPMA 4PS4L 4FTVB 3WFDH 4LKCA 3DXAD 1QRNA 4XWOD 3VFGL 5CJ5A 4HKBA 4MAYD 5C0JA 1AQDB 2I5YL 3O11A 4HJJL 2AKRA 4DN4L 4ZFGH 3PG2A 2XNAA 3QEGL 4O4YH 3VDAA 4Z7OE 2VSDA 3BZ4B 3G5ZB 4WWKA 1T4KA 4JO3L 1YJDH 3AB0B 4Y1AE 2BVQB 1G7PA 5FYJD 4J7RA 1CZ8H 5DJ6A 1JGEB 3VXQB 1MY7A 2AEQH 6FABH 1Q0XL 4XPGL 2ZZUT 4XI5C 4KVNH 2AJVL 3QFJE 5MERA 2HRPH 1U3HC 1T83C 4YDJA 3REWB 4X8JB 3SKMA 4WFFE 3ARBC 4K94H 3U9UA 1A1OB 5C7XH 4YDVB 1IAIH 2X4UB 4XH2A 3EGSB 1YNTB 5LCVL 1C1EH 1IL1B 2GI7A 3BQUB 4EDWH 4QRTA 1BBDH 2P5EA 5DRNA 2CLVB 4LLQB 1B3JA 1F2XK 1GAFL 3WIFA 3MJ8B 3SE9L 3MRPB 2B0SL 5HHMB 1I3UA 5C0EB 2BSSB 2O5ZH 1X7QB 2PYEA 4FNLL 4RISH 5HYEA 4JFDB 1INEL 1R5WB 4H88L 4XAKE 3K8MA 5E94A 2Z4QA 3RPIA 2K1MA 4NHCL 4KKBC 3KPNA 1KB5H 3RGVB 1PSKL 4AIZA 3NCYP 5F3HA 1YY9D 1J1PL 1ZS8A 2CRIA 3W5MA 2BMKB 3VFUB 4AM0B 4KUZL 5HPOA 4MJIA 3GMMA 1JWMA 4ZTOL 4A6YA 2OBGA 4HKZA 1MVFA 4R6UA 5ESAB 1ADQA 7FABH 5C0AA 4LIQE 3LEVH 3VFMA 2VXUH 1OP9A 1Q0YH 2HFEB 3GM0A 1W72A 1TCMA 3UJIL 2AJXL 1PAMA 1R3LB 5J7CC 3HE7D 2MHAB 2XQBL 2W9LA 4KKLD 4XPAL 4NQEB 1KCKA 1JGDB 2CKBB 4P5KB 5D5ME 3A6BH 1WEJL 4BK4A 4KTEH 2KPNA 4L5FH 5C6PB 1E4KC 3FQNB 4C57C 5T5NF 4APQC 4G8IB 1F45A 3T0BA 5ACMA 3QPXH 4MDIB 4QHNA 4DEPC 1F4YH 4QWWD 3RL2B 3RFZC 5GRWA 5C07E 1DTUA 3L3OB 1QFWH 4YHPA 3CFCL 1IBGL 2W59A 5HHOB 1R5IA 5CJOH 4FG6D 4NZTL 3QPQC 1MAML 4U3HA 1I75A 4JFXA 1UZ8A 4PRID 1BMGA 4OM0H 2BHUA 4MNGA 3O2DA 4NN6C 3I6KA 3UTZA 2X4QA 5BO1L 5A2KH 3RNKB 3U7YL 1HXYA 3DSNA 4NKMB 2NQCA 3WNPA 1EUTA 2HKFH 2OCFD 3UX9B 3GNMH 5DJYB 4U7KA 3N06B 3MLUH 3EDEA 1U58A 3GO1H 4I2XA 4PRNA 3GGWB 2NY7H 1E6OH 2ERJC 4YEEA 1D9KB 4WJ5A 1OL0A 2NY5H 1G7MB 4PGBB 1CCZA 2R4RH 1J0KA 3L9RB 2YEZA 4R96A 1AI1H 4ENEC 3G5XB 1UG9A 1UGNA 4MNQD 1KENH 1K2DA 1WLHA 3LEXB 4QXTB 1OSZB 3UDWC 3EYOB 2G2RB 1P7KA 3IVKA 3CMOL 3G08A 2NZ9C 2AK4A 2WLZA 3VFWB 3VWKB 4DZ8B 3T1WA 2VZSA 4HC1A 1G9EA 4IRSA 1NFDB 1QLFB 2R0WL 4HFWA 3I2CL 4GQPH 4GRMB 4YXLL 4UV7H 4XMLL 3S3SA 3QNZA 1T1YB 3ROOA 3WN5A 2JCCF 2DQEL 3QZWB 3C5ZB 1CLYL 4DGIH 1UB6B 3RI5K 3MJ9A 4F7EB 1K8IA 1FL3A 1AO7A 3U2SA 3OPZH 4HBCL 2I60H 3W11D 4LCCB 2ICEB 5E08H 5CJ8A 4YXKH 5DRXA 4PGJA 3MV9A 2C4FU 3GMPA 4FQ2L 3FB6B 2P8MB 4PG9A 2J8OA 2EDTA 4EKXA 5CAYB 5IMLA 2AEWA 2VLMD 3BO8A 5EN2A 1L0XA 2C4FT 1CYGA 4GRLD 5B39B 1QZ1A 3QSKB 2X4OA 1AQKH 4PFEA 3SDXF 3CNKA 1CICD 1XGQB 2VJXA 5EUOA 4D9RD 5JZ7D 3QUYC 1TXKA 5MEQB 3UTQA 2X4RA 4HQQH 4JKMA 3VD9A 4YR6B 3BZDA 5CD3A 1MRCH 4Y4KA 2WBJB 4NQVB 2HJKB 5BZWA 2Q20A 5FHAL 1HKFA 4YAQB 4ELMA 1NGXB 3KVQA 4JHAL 1KJ2B 5BXFB 1XR9A 1BWWA 2CRMA 1KIRA 1Y6MR 8FABB 2UWEB 1LO0L 1MH5B 5D1XB 4BYHA 3IB4A 4X9BA 3I6LE 4MA1C 2E8YA 1J1XL 5CJBA 5SWSB 1WCBB 2O5XH 4M6OH 3SO5A 3GRWA 2WUBL 4GAGH 5I1DB 4YNYA 3VXOA 4LVEA 2VLJD 1XIWC 5SWZE 4WU7A 1YC7A 2VR4A 3ULUF 1RZ8B 4LRIC 4NNPH 4CMHC 4LAQH 2DDQH 3H3BC 4FQHB 1FE8L 4KROB 3CDGB 3BGMB 5I74B 4B7IA 4YDKL 1NJ9B 3IS1X 2A1WH 4IJ3B 5KVEL 3ULVL 1IEBB 3GJFH 4N1EA 4RNRA 4KKCC 4MDJB 3SDCB 3BPNC 4UIMA 3TJHC 1WZKA 2Y72A 1XEDA 2IPKA 5IJVA 1Z5LB 5AD0A 5T1KD 4S1DC 1J10A 3RI5F 1ORSB 2PR4L 1MELA 1BQLH 4G7YH 3IDIB 5IB4A 4FFZH 1JK8B 4WUUD 3I50L 1I1FA 2PTUA 1ZV5A 2GJZA 5JR1H 5DQDH 3VG9B 5JIIA 4MD5A 4X6CF 1MNUL 4YHNA 1P2CB 3B2UC 3HAEB 3R1GL 2AQ3A 4HF5L 5EIQA 1LEKB 4X6FA 5JQHC 2V6HA 4JG0L 4MB4A 3WHE0 1JE6A 5DVKA 5IR1A 1EPFA 3FAWA 1UA6L 1D5BA 1N64L 1U42A 3DIFA 5DFTA 1S7VB 3T0VA 5B8CC 5SV3A 4LF3B 4ZUWA 3NFPA 3ISWA 3RZCB 4JZNA 2A77L 4OI7A 4PV8A 2YD1A 4GMSL 4JQIL 4I0PC 1EH9A 1Q8MA 4O2CA 2FH6A 4WHYH 2I24N 4WGWB 4DKEL 1OWRM 2Q3ZA 2FWOB 4WV1C 1GGTA 4M7KH 3JV4A 3SKNA 3GIZL 5GGUB 1CGXA 3BH9B 5GRJH 3B5HA 4G42B 2W38A 3OZ9L 1NMBL 5FYJH 3Q6FB 3FRUB 3V0WL 4U6TA 3NFNB 2BFVH 3FRPG 5KSVB 1RURL 4TQEH 3P73B 2ZJSL 4JPVH 3IJSA 2CXKA 4KY1H 1DN0B 1I1RA 4U05A 2V5SA 3A0OA 4Y0GA 1X5GA 1PYWA 5EOTB 3HZMB 3VFSB 1KTLA 3QDME 3O45A 3CZFB 4GH7B 2AGJH 3ZYJA 3WUWG 3AS3A 1KB5B 3L6FB 4R0LC 2G5BA 3DLQR 5J56B 1BPVA 2VRAA 4ODWB 2GFBB 4LPCA 4P46B 3CC5B 5EU3A 1CD9B 2P5WA 2KQNA 4GAFB 5DJZA 1C5DB 3PIQB 3O9WD 5MENA 2PXYB 3EHBC 3UYRH 5T3XL 5DFVC 4ZSOA 2GEEA 1CFQB 1WV7T 3QIBA 4S1QH 1FN4A 3PGCB 2I07B 2Q8AL 3SGDI 2DOCA 1DANT 2F54B 5CD5D 2CK2A 4TSAL 5IMKB 1ZANH 2IAMC 3VXPA 1QKZL 1RV6X 5IM7A 4PJCE 2DQIL 4RFEB 4P23D 3LH2L 4KI1A 1MQ8A 1MAJA 1KNOA 1A6UL 2PF6A 4NHUB 5ISZA 5C0RH 3B9EA 1BD2A 4LPVA 4Y16B 1GCFA 3PGFL 4IRZH 1I1AC 3T2PA 4FMKA 3WL9A 3QWOA 1ZTXL 1ED3A 4IOSD 3RL1B 3PL6D 4GAYA 4Y1AA 1I8LC 3W39A 4F58H 4YFLI 3MNVA 5C09E 4D2NA 2H9GB 5H94A 3X13A 4MZ3A 4OCSH 2EXYD 2ED7A 1E6JL 2F53A 2NY6C 1EVUA 4IOFC 2DAVA 3IFLL 4M1DH 3RDTD 3SDDB 1C16B 5F7NC 1EBPA 4JQVA 1NSNH 2VITB 5E8DH 1IGYA 1X5ZA 3X3GH 4RQQB 5DK0B 2PW2A 1CFSA 1JP5A 4MSWB 1B6DA 1JZ4A 1T89C 3BSZH 3DO3A 2FEEL 3R8BB 3DMMB 2UZYB 2V9TA 1FNSH 2DWDA 2FGZA 1XGRB 5ANMA 4NQUA 3IKCA 3MOBL 3S4SG 4B7LA 1BJ1J 3BUYB 2N7BA 4HDIB 1U8KB 8CGTA 5E9DE 1MJ7H 3T2QA 4EUPB 4KH2A 2NXZB 2J8HA 1MREH 4K8RC 1IC4H 1FNEB 4UT6H 3S37H 3S6CA 2AQ1A 3UTOA 1Q9OA 1DQLL 3TCLB 2E6QA 3LMJL 1PJ9A 2RHEA 1CTNA 2LU7A 1P9MA 3ZYOA 1DQDL 5C08E 2NTSP 1H15A 5KS9F 4XCNA 5HDQH 3FT2A 5FKPB 1I3GH 1XR8A 1FFPA 4UQ2A 4OZHB 2W0PA 3L3HA 2WBWB 2FRGP 1DSFH 1QEWA 3BHBB 1DVFA 3QCTL 5HYFA 3O3AB 1OF2A 1YMHA 2ED9A 5EC1B 3WUWA 3EDJA 4PUBH 3ULVD 1JCKA 2VLRA 1NMAH 5IG7B 3HRPA 4GG8A 3B9VA 5CIPH 4Z0XB 2HLFC 5IQ7L 3N1PC 4N5EC 1BFOB 5F88B 5DMIL 1GC1L 1MUJB 4JO1L 4MB5A 3K7UA 3X17A 3JWNC 4RAUB 3F7VA 4WEBH 4EXPX 1FZJB 5ADOL 3BWUC 3BAEH 1F3JA 2WNGA 4KKAC 3H9YA 5DJ0A 2YHGA 3FO9B 4L9LA 3WSQL 4NQSA 4RRPG 4A6YL 4RGND 1SJHA 4XGZA 4NN7C 4JFOB 1UEMA 5F1NB 1FDLL 4OZIA 3TVMB 1GZPB 1PFCA 1S7SB 5JO5B 2G9HA 3VWJC 3MLZH 2BNQA 1MHHA 5E5RB 4GW4A 4TNVK 1W72L 3S3PA 4L4VD 5IBTH 1SM3L 3IRPX 4R2GC 3TIEB 3O3DA 1A6TA 3HZYB 2BOCA 4PS4H 2AJ3B 2VAAA 1RUAL 1EO5A 1FGVL 1KIQA 5B38B 4MVBD 2DMKA 3L95A 5BV7B 3VFGH 5L6YL 4YHML 4X4XB 2I5YH 4WFHE 5IHUL 4HJJH 5GS1C 2ADIA 4DN4H 3QUXC 4MQSB 4Y7MA 3SJVB 3VXTB 3QEGH 1UVQB 2HFFB 3KHQA 3OJDA 5EULV 1I8MA 3NTCL 4JO3H 2E9BA 2NZIA 1K8DA 1A9EB 3FQTA 1VPOL 5GGRB 3IAPA 4G6AC 4JM2B 3KPMB 3EBAA 1QO3A 2H2PD 1K4CB 2AJVH 4H1LH 4Y5YB 2CLRB 1ZAGA 4Z7OF 1QSFD 5D2LE 5ACLA 1BFTA 3VCLB 4BSWB 4JB9L 2YD4A 4M00A 3FB5A 1BZ9B 4F33A 3O2DL 3G5VB 1EXUB 5K93A 2APFA 1LO5B 3ARGC 2QL1A 1NFIB 3MA9L 3BW9A 1GAFH 3SE9H 3QI9B 3VFPB 2X42A 2B0SH 3WYRA 4FNLH 1XT5A 1INEH 5I73C 2VQ1B 1NEZG 5KTEH 4NHCH 4FFYL 4LSVL 1PSKH 4ZXBB 4MD0A 5I1IL 1J1PH 5T3XD 1TDQA 2VH5L 3MLWL 4TUKL 1NGZB 3SE4A 5SX4I 4MJ6B 4KUZH 1T66D 1XGPB 4EI5B 4FP8L 4NCC2 4ZTOH 2NX5E 43C9A 4JFYA 3DVIA 1BFSA 3QIUA 4HC1L 2DKUA 2XYCA 5T3ZE 4TNWK 2V9RA 4NRZB 5EOQL 3OWEA 3BGFB 4NFDA 3MFGB 5IV2B 2XWJB 5DVNA 2G75A 4ONFL 1KCLA 4PJGA 3WEXB 4QNPE 4OD1L 5IW1A 1CK0H 4TNVF 5JMRA 5IWLC 4U1IA 5C0ND 2H26A 4LSQL 1A6ZA 2XQBH 4OIAA 2IFGA 4XRCB 2A74B 3MJ9L 5ERWA 3WFCL 3BWAA 4P57B 3ARDB 2GSIA 1WEJH 3WNMA 4G9FB 1KTKE 4YFLF 3PJSA 5DK3A 1SEQL 3C6SA 3D25B 3QP3A 4X6DE 3OMZA 3MRGA 3DYOA 5IQ9B 3PP4L 4L8SC 5D5MF 3P4OB 3QDGD 3CFCH 1HYSC 2FATL 2QSVA 4MHHG 2C1PB 1BQHA 3LKPA 4JY5L 2P24A 3VD4A 4NZTH 1FLTX 4YUEL 3HMXH 3GBNH 3SKOB 5E99L 1T0NA 3VXUE 2KL6A 3CCHB 1Q72L 4R4ND 4M1GL 5BO1H 2Z8SA 1M7DB 1HHGA 3VXMD 4YBQC 3BEVB 5DMKB 2F74B 3P77B 3B9KA 1AXSB 1IC1A 1G6RB 4PJDE 2GAZB 1XAUA 1C7SA 1IAIM 1IILE 2BSRB 4NZRL 1K5NB 3HMWL 1F3DH 2LABA 2YUXA 5H37G 4LHUB 1A7OL 4WW2A 5IUSA 1KELL 2JKXA 3N1FC 3FFCA 3IETB 4CW1A 4GQ9L 4WWKD 1Z9OA 4YZFE 4JRWA 3CMOH 1A4JB 4RWHA 5F7EH 4WHTB 3WDHA 3GRWL 4KK9C 2WINB 3U83A 2F5AL 1PY9A 4DOHE 3EO1B 1E0OB 3ET9F 4JREC 3V52L 4X5XA 5IOPB 3VMOA 2R0WH 5DHYA 4NRYB 4UOW0 3I2CH 5D7IE 3MRKB 1ONQB 4YXLH 3BZEA 5DJ2A 1FGNL 3C6LB 4EN3D 4KAQL 4XMLH 1N26A 1XGUA 5CBEA 2FECI 3QDJB 5AYUL 5CP3H 4D94A 1CLYH 4H20L 2P5ED 4BZ1L 4D3CL 1KB9J 3MRCB 1R0AL 4PGDA 4E41D 4DZBA 3LPFA 4HBCH 2B1HL 1EA9C 5E8OB 4NKQB 1NEZA 4R4FL 4LKXB 4B5EA 2NW3B 3SY0A 2R2BB 3MRQA 1LP9E 1LE5A 5ELIA 3MNWA 3MUGB 4M4PA 3KPSE 4FQ2H 5FK9A 2VC2L 3QDMA 3ZL4H 4K7FB 1WISA 1AGDA 3CD4A 3STZB 1DBML 1ZA6B 5ETUA 3RIFF 3CFIC 1U91B 4L3EE 4P2OA 3TWCL 1AKJA 3O6FD 3DJ9A 4HUVB 1H8NA 3NZ8A 4KDTC 4POZC 5F7DB 2PO6C 5BJTA 1TZHB 4HIEA 2JK5B 3MBXL 5C0AD 1KPVA 2IPUK 3UPRB 4NZUL 2ED8A 1FNAA 2I9TA 1CTOA 1SYVA 1U3HA 1F3DJ 1VESA 3ULUD 3K4DA 5F1IA 5FHAH 5J1SC 3FQUA 4JHAH 2PW1A 4G8GA 5DURD 3NIGE 1IC5L 4YPJA 2DI9A 1UJ3B 2IALA 3QIWB 5B3JE 3DRQB 2Q86A 4C55A 5L0QC 1LO0H 4U6HA 3P4MA 4JPKL 3AROA 1GOFA 3MBED 1D3CA 1AGCB 1J1XH 1XF4B 4UNUA 4L8BB 3VXRE 4EJ1C 1E4XI 3O4LD 3INUL 1CDBA 2WUBH 4UMGA 1R5VB 1KFAL 1A7RH 3V8CA 4D9QE 4DQOL 1NBZB 1PG7X 1TVHB 3VFRB 4NQXA 1RZKC 1IGIL 1FE8H 5CIPB 5K33A 5DDHB 5JHDD 5F97E 1JF6A 4YDKH 1D5XA 3ILPB 3BZFB 4GS7C 1KXQE 5KVEH 3ULVH 4MXWL 3MGOB 1EHAA 4LNVA 1LNUA 5ICZA 3TEUA 3ZHDA 2LVCA 5LAXA 1FZMA 3K4ZA 4WI4A 3TCXA 1EJOL 2PR4H 4PJ8B 3RIAK 5IMOB 5E2UL 2OJZL 4LL9A 5FM4A 3SHSA 1OPGL 4F7PA 4FXGA 2JIXA 1MNUH 2A73A 3S5LG 2B5IB 3R1GH 2YPKA 3U82B 4HF5H 4UB0L 2X7LB 1AH1A 1HI6A 3JV6A 3C60A 5TE4L 1OB1B 2LTQC 2BNUA 1MJJA 5GQBA 1Z9SA 2P8PA 4WO4A 1RHHA 4M8QB 1UA6H 3UTTB 1GGYA 4JKPL 3QDHA 1N64H 3MZTA 1G7IB 2ZCKL 3ORJA 4ERSL 2VLKD 3MRNB 1ZT4B 2ZUYA 4K3DL 3W82A 4GG6A 1BWMA 4GW1B 2A77H 1H5BA 2I27N 4O2EB 3HI6L 5EFIB 4JQIH 3RTQD 5DJ8B 3F5WB 4XBGA 5I30L 1N6QL 5IB3B 3GIZH 4H1LB 3MV7D 3OZ9H 5F7MC 3WO4C 1NMBH 1HCVA 4OGYL 2BNRD 3V0WH 1BX2A 5D8JL 3MV9D 4TPRL 4X7TA 3QJHB 3VDBA 1RURH 4XX1E 4YGAB 2ZJSH 3SGJC 2JJSC 4JRXB 1J87A 5AUMA 3NGBC 1NC2D 1TPXB 3SGEI 2FCBA 2KZWA 3RVVD 3O2WL 5DC0A 5FGCB 5HGHB 2I9LB 4RAVA 3R8QA 5GZOD 2B4CH 1B9ZA 2FIRT 1CFVL 1J8HD 1AHWC 5CZKA 4BFBD 4PJIE 2A83B 5DVOA 4UU9A 4K3GA 3RIAF 2XN9A 1TJIL 2LVEA 4Y4FD 5SX5K 4OCRL 5T3XH 5J9PA 1IAKA 5LG1A 3ARED 1FNGA 5DTFA 4F9PC 3OXSA 3BX7C 4LIQL 2NMSA 2Q8AH 4PRHD 1ZVSA 2HVKA 4TSAH 3D69B 3OKEA 1DQJB 1VFOA 4PJEE 1QKZH 4NQDD 1IM9A 4PD4K 2W0LA 2QR0B 2CD0A 2DQIH 4JHBA 2HT3D 1YY8A 3LH2H 4MAUL 1A6UH 4LPTA 3SKUD 1PZUB 1F6LL 3MMEB 1FFOA 5EZJB 4IOIA 3S34L 4X7FC 4UBDD 3PGFH 2EIZA 5E6YA 1YEGL 4PJCF 4Z7WB 2XV6B 3QA3A 4LLAA 4X98B 1ZTXH 4B41A 5I19L 4NDMB 3ZYZA 3LV3A 5CBAB 3TV3L 4LASL 4PP2A 4Y2DA 4OKDA 2DQCL 4J3TA 5D2LA 1E6JH 1QNZL 2NY3B 3T4YB 4D0BA 5IEHA 4NUJA 3IJYB 4PTUB 4NO3A 5C0IA 3X3FL 2V2WA 1JWSB 1LEGB 3CVIL 4JFEA 3CFBB 4R7NA 1I9IL 4KRPC 3W0WB 3ZHLA 5TE7H 5TGBB 2YWYA 1DP0A 1PY4A 3VH8B 4LLUA 5F3BB 4M6ML 4L4TD 3QULB 2CK0L 1NMCC 3MOBH 5DQJB 2DWEA 4QRRE 4RDQF 5C3LD 1XIWA 4J4PA 3BP5A 1G9NC 4D0CA 4V1DE 5ALBL 4YHLL 1T22B 3MNZB 3BRGC 2Y07L 3ARFA 2AVGA 3ZKMC 4Z7VA 5E8PB 4KPHL 1J7VR 2OK0L 4ZUVA 3MUY1 3MRFB 3DI2B 2FNBA 4WDIA 4LCWB 1S7XB 4ZUUA 1EUUA 2ITCB 3T8XB 3Q2CA 5ADPL 1DQLH 4WFGE 3G5YA 4PRPE 5D7LA 1RD6A 1GIGL 2H2SC 3HUJB 3L3JA 4Y4HC 1JN6B 1DQDH 1JPFA 2AK1L 3JV0A 5GSVB 4O51A 2HAZA 2VKXA 3JTTB 1U93A 5HYJB 1JBJA 2KBGA 4F9LA 2X4NA 4NO0D 3QCTH 3DHJA 1FVCB 3D0VB 4HUUA 4G6ML 3CDCA 5J12C 3QXDA 4I3SL 3MCG1 3SGKA 3D5OF 4YDIH 4HW6A 1SY6L 5IQ7H 3G6JF 2Z8WC 3QJFA 4HD9A 4BSJA 5DMIH 1GC1H 1UQSB 3LPWA 4NGHL 2A6JB 4JO1H 3DTXB 5LVEA 3O6KH 5IFJB 4HJ0C 4X6EA 5MEND 3B5GA 3SCMA 4PJ5E 2W91A 5ADOH 1MWAA 3D3VA 3PHSA 3O8XC 1WQVT 4JDZB 3HE6C 3V7AG 4ODTL 3VXNB 1RK1A 3LS5L 3UBXA 3WSQH 3REVA 4GUPA 4A6YH 4RBPH 2XWTA 1ZHKB 2FL5B 2ID5A 5E1AA 4NYLB 3IXTB 1NGPL 2ENYA 1T6VN 1FDLH 2JB6B 1JHKL 4Q9RL 5FM8A 4U1JA 2OTPA 2VXSL 4YBLB 1NAKH 1N6VA 4I4WB 2Q8BL 5GS2H 1XCTB 5L9DL 2QSCL 1SM3H 4G80A 3PP3H 1D7FA 2E7LA 1RUAH 1YPZB 1FGVH 4X9GA 4Y1AD 2YD9A 2YD7A 4JPWL 3MACL 4YHMH 2ADJA 3E2HC 1X5XA 5IHUH 4M1CC 4PV9A 3QFJD 1IGTA 3RU8H 2V2TB 5D7IA 3NTCH 5A16B 4UINL 4WFFD 1TZGL 2BHYA 3B83A 5EBLB 2DF3A 5DS8A 1VPOH 1ZT7B 4KJWD 4KI5C 3F7QA 2YSSB 3MJGX 3H9ZA 2E9IA 2ZUQB 4K3HA 5L2KA 4BQ9A 4JB9H 4HKXA 4JPIA 3QAZC 3OXRA 1VEOA 3U4BL 1KG0B 3RNQA 4XAKD 3QXAA 4HIIA 5CGYD 4ALAL 2WANA 1M05A 1TENA 4GBXC 4R26L 4OCNC 5IW6A 1JZ8A 4HIXL 5CKAA 3KLHC 1VADA 5HI5D 2DD8L 2Q6WA 3MOAL 4Z0BL 5F9JB 2AJYL 3TNNA 1L7IL 4FFYH 4LSVH 4X4YB 3FTGB 4KMTL 5I1IH 2EIEA 2VH5H 3MLWH 4L8DA 2AERT 5FHBL 5FYKU 1FO0L 4XT1C 2FD6L 3HI1B 1U8NA 2R1YA 1JHLH 5DGRA 4PJAB 1E27A 4HC1H 4LP5A 5DMGC 1K3IA 2AV1B 3CSPA 5EOQH 1S9YB 1RJLA 3GSUA 3RKDD 2IH3B 2YA0A 4GAJL 1MCJA 4YWGH 4ONFH 2HT2C 2VDLL 3B8YA 3EO0A 4NNYB 4OD1H 4EI6B 4OJFH 4POYA 5BQ7B 1EERB 4LSQH 3U79A 3ZDYE 3FO1B 4LNRA 5GJTL 4XXCA 1AD0A 4KK6C 3MJ9H 2F19L 2R9HD 3WFCH 1JGLL 1MLCB 2X4SB 5DI8A 5C07D 2BVOA 3MXVL 1BBJA 4DTGH 4QNPF 4H5SA 3T3ME 3GSQA 5ID1A 1SEQH 5CCKH 5J13C 2OI9B 3RWGB 3PP4H 3H3KA 3EYQC 3OQ3B 3LIZL 3RVXD 2FATH 2P8LA 4W4OC 4JY5H 1FQ9C 4X6DF 3AM8A 9CGTA 3X11B 4IMKA 1QPPA 3QUZB 4AY0A 4QHMB 5E99H 4HS6B 4PJHB 2Z31B 1Q72H 4M1GH 2Y23A 4XNMA 3VRIB 1U8QA 5KSUA 4U1KA 4QOKB 5TF1L 1VFUA 4KQ3H 4P5TB 1RZJH 4K07A 4JRYA 4O58L 1N59B 5B39G 4OV6F 5E8EB 3DYPA 1WIUA 4PJFE 2CDFB 3OHXA 3CZJA 5F21B 3SO3B 4NZRH 5FA3B 1HINL 1UYWL 2HA1A 4PRBA 3HMWH 5I75B 1ZHBB 5EA0H 2X1PA 4K55A 4IDLA 4OGAD 4QXUL 3MRIA 3V0VB 2FR4A 1ACZA 5IBUB 4PJ9A 5I1LA 4PJDF 2NY1C 1KELH 1OGTB 4OV5B 3HC4L 2BY2A 4U6YA 4HAFA 2F5AH 5E4EB 3H7BB 5CMAA 2NY4B 5FCSH 3V52H 3HG1A 4YZFF 3L3DB 1N6UA 1JPGB 3TA3B 1FGNH 3FJTA 4KAQH 1J1OH 5IB2B 5KSAB 1HXMA 4KK8C 4Q9QL 5AYUH 4FS0A 1ZLSL 5FGRA 4KJQD 2QLVB 4BZ1H 2OTWB 1R0AH 1F42A 4HUXA 1RZGB 1AXTL 5ACZA 1YEKL 4K9EC 4OFIA 2MKLC 4N8VA 3L3IA 1TVBA 3SDAC 4Q9BA 2YXFA 1MFAH 1RUMH 4YIQA 2VC2H 2YPLB 5FKAA 1YN7B 1IKNC 1EGJL 2E7CA 2F58L 5TDNB 5IFAL 5D1QA 4WU5A 5ESVA 1DBMH 3ZYIA 4LOUC 2H6PA 4J6RL 3TWCH 1LP9F 5IKCB 5HGAA 1IGFL 5BS0A 3STLA 5ID0A 3RUGB 5HPMB 3I6GA 4LKCB 1QRNB 3FN3A 1INDL 3HAEG 4HKBB 1J5OL 3MBXH 1TCRB 5C0JB 5J06A 3O11B 4FFWC 4NZUH 5H2BA 5EOCL 3TN0A 2XNAB 1NCUA 1WFUA 2DIJA 2ADFL 3QFDA 1P7QA 4WWKB 1T4KB 3TC9A 5I17A 3I6LD 2A6IA 3V5KA 1G7PB 5DK2A 2W0FA 1U41A 5DJ6B 3RRQA 5A1AA 1IC5H 5GHWH 1J86A 5SWZD 5MERB 2MCG1 1A7NL 2Q7YA 4OQ1A 4JPKH 5DHVA 4YDJB 3SKMB 3ALWA 3U9UB 2C7UA 2HFTA 3NIGF 4XH2B 3ZKXB 2YUVA 1CT8B 5B3JF 3INUH 5EO0A 3QEQE 1KFAH 4QRTB 2H32A 1I1CA 2EDQA 4PLKC 5A3ID 3WBDA 4DQOH 4FXLA 5DRNB 1CD1A 1Y0LA 1IGIH 3DYMA 1QSVA 2OLDA 4PG2A 4KHTH 2PYEB 2A9ML 4XHJC 3OR7A 3BPOB 2WSKA 2Z4QB 2BVEA 5E94B 3RPIB 4NZJA 3KPNB 5F70A 4AIZB 5F3HB 1T3FA 1JNJA 1H0DA 1ZS8B 4FHBD 1RAMA 4JVUA 4ZAKC 5E2UH 2X9XA 4LLDB 4MJIB 1MOEA 3RVWD 3TZVD 1QVOA 3GMMB 1JWMB 2R69L 4A6YB 4D0DA 3BP6A 1OPGH 5GXBB 4HKZB 4MMXC 4KU1A 2BX5A 1QYGL 1MCKA 3P4NA 3NCBB 5FV2A 1FC1A 1EFXA 4UB0H 2OMNA 1W0WA 3DHMA 1GHFL 1W72B 3DXAE 5TE4H 2M1KA 4V1DA 2V7HA 3QCVL 3MV8E 3VGAB 1B0RA 1YYLL 3MRMA 5FGBA 1LGVA 3BIBX 1KGCE 1AY1L 1QP1A 3AB0C 5GRVL 3WS3A 4XP4L 4KGLA 1N3NA 4JKPH 4Y5VA 4JEGB 4ZFOL 3HC0A 4HGWA 5JTWA 2ZCKH 3DETD 4LSTL 2EYRA 5F93C 4PRPA 3P4LA 5HHXH 4QHNB 3H9SA 3HI6H 2C5DC 1T7VA 5I30H 1JPTL 3KPRE 5JHLH 1R5IB 3TT1H 3BQUC 5E2VL 1UZ8B 2J4WH 4OGXL 4P59L 4ESKA 5D8JH 3WMSA 4MNGB 3GHBL 1OD9A 3RVTD 5C0FA 3I6KB 4TPRH 2X4QB 3UTZB 1EAPA 5I1JL 3PWPA 3LN5A 3QDMD 3DROA 5CFHA 1BF8A 1GGIL 4FQJL 1HXYB 3LSOA 1J9CT 3HPLA 2VABA 1WAAA 3DUUA 3RGVC 5F9AC 1ZK9A 3DSFL 1WICA 3O2WH 1U58B 3BH8A 1OGAA 1ZWIA 4I2XB 4PRNB 4WJ5B 3T04D 4JFFE 1LEIA 4PJ5A 2YEZB 4R96B 3WUZA 1CFVH 3QWQB 3ZT7A 5I1EL 5D7JA 4XI5D 3KXFE 3RWEA 1L6ZA 1KN2L 1U3HD 4ONGL 1HQ4A 3EJZC 1P7KB 4Q7DA 1TJIH 3G08B 3LN9A 4OCRH 2AK4B 1EEZA 4CU6A 1F02I 3GZKA 4KI5E 4IRSB 4PJIF 5EWIL 4LIQH 3QG6A 4HFWB 5IVXA 2XZQL 4UV4L 5CZXC 3QNZB 4MWFA 3ROOB 1QSEA 3WN5B 4R7DA 4L3CA 4MAUH 2YBRA 1SEBA 5GGSA 2R0ZL 4LQ1A 4KKBD 15C8L 1K8IB 1FL3B 5FV1L 4PJEF 3S34H 1AO7B 5C09D 5KAQF 3U2SB 2J2ZA 1HDMA 1YEGH 1PKQA 1ZVYA 5I19H 4GLRH 5DGQA 3MLSL 4WI9A 3PV7A 5DRXB 1QQDA 3BIKA 3F7YA 3GMPB 4NSKA 4LASH 4PG9B 4KK5C 5KBNC 1S8DA 2DQCH 5JPMA 1NGYA 4P2CG 5M94B 3BO8B 5F8RC 5FYLE 4JGMA 1QNZH 5EN2B 2CSPA 3IFPA 1LK2B 2VL5A 5F7FA 1HIML 5EO1A 2VDPL 2B2XL 1JGUL 2X4OB 3IGAA 3KJ4C 1I9RL 3P9LA 3X3FH 3CVIH 4XBPA 1D9KC 4NPYA 3UTQB 2X4RB 2IQAA 4QRPA 1I9IH 3MROA 5CD3B 4MX7A 1CXHA 4O02H 4Y4KB 2VIRA 2YA2A 3EZ8A 5BZWB 1C08A 1IAOA 4ELMB 5LWYL 4APQD 4M6MH 2LAGB 5E9DD 2Z92A 1XR9B 2CK0H 1A6PA 1KIRB 2DQFA 3VWKC 1E4WL 2OSLA 4YHLH 5ALBH 3QPQD 2FX7L 2Y07H 2WIMA 5EU4A 4HWEL 2OK0H 3BJ91 4LPYA 4YNYB 3VXOB 4BJLA 5C08D 4WUKL 4WU7B 3C5ZC 3FHAA 5ADPH 3T0EA 5B4MC 2D4DA 1WZLA 4QHLA 4QKXB 2EC9U 3I02A 1MCOH 2KKQA 2AK1H 2QHLA 4RNRB 3IYLW 4LCCC 1FYTE 5BW7A 2V5MA 1QACA 2IPKB 5EIVA 4GKZB 5IJVB 5AD0B 1S5IL 1BQSA 4RGOL 4ENED 4G6MH 5IB4B 1NGQL 3BVNA 4WRLA 5FO8A 2GJZB 4I3SH 1DBBL 1JNLL 1SY6H 4MD5B 5F6IB 4YHNB 2NZ9D 5LXGL 1S78C 1F4WH 4FMFA 1OAYL 3LHPL 4NGHH 1OW0C 4X6FB 5GGQH 2FDBP 2WW8A 1ZXQA 1TQCB 3EIFA 4GRWE 1H3TA 5CLTA 2EECA 5D70H 5IR1B 2WBJC 4DKFL 4PJBF 4ODTH 1S7UA 4PY8I 3LS5H 4C56E 3TBYA 3EUUA 4DUVA 3DIFB 2GT9A 5GJSL 2DMCA 2BC4B 3JWDL 1NGPH 1IM9D 4ZUWB 3NFPB 2GJ6A 2FYYA 4JZNB 5D1XC 5F96H 1JHKH 4BSVA 4Q9RH 2BVTA 4PV8B 1I9JL 3KYKL 2M2DA 4OUOA 1MRFL 3N1MC 4O2CB 5KSBF 2VXSH 4QXWA 3CSYA 5C71A 2XQYG 5I1CL 4HGMA 4WFHD 2WMPA 1DL7H 3JV4B 3D1MC 2Q8BH 3SKNB 4BZ2L 3NCEB 2DYPD 2QSCH 4JZOA 1MI5A 3T65A 3OB0K 3MLPA 1YMME 1KF9B 1MSPA 1RJZA 3E6FA 4KROC 2CUIA 2XTJB 2PYFA 5I74C 3EDDA 2EH8L 4JPWH 2UZXB 2J8UE 4M03A 4IJ3C 4N0CC 3IJSB 2ESVE 1RVFL 3SDCC 5FDWA 1BOYA 3H42L 1VFAA 1T1WA 1KXTB 3JVGA 3QUYD 3V6ZA 4UINH 1TZGH 4FQPA 2W9EL 5C0CE 1KTLB 2ZUXA 4WTXA 2DI7A 4N8CL 3O45B 1KSRA 2R8SL 1QBLL 4HUKB 2AI0L 2EYTA 2G5BB 3QO1A 4ZDHA 3VG9C 4XNUH 5EU3B 1Z3GL 4K8RL 2P5WB 4AMKL 5TDOA 5DJZB 3VGGA 5MENB 2ZNWA 1KCUL 2UUDK 4ALAH 4HWZA 2D7OA 5JOFA 4XB8A 4ZSOB 1W0VA 4V2CB 3QIBB 2ZOLA 3EYVA 2K3TA 4X7DC 1FN4B 3MOAH 1XIWD 2IANE 2YPVL 3KPOA 4Z0BH 2AJYH 5F9WB 3B5TA 3CFKA 3VXPB 1L7IH 5IM7B 3J8F7 2NX5D 1BFVL 4KMTH 4KC3B 4P2QE 4U6VL 5DHXB 1MF2L 3LKSA 1KNOB 5FOBA 5B21A 4GT7A 3RZCC 5T3ZD 5FHBH 1REIA 1GL4B 5ISZB 1FO0H 4KKCD 4M9PA 1FRGL 2FD6H 3TJHD 1BD2B 1FNHA 1GGBL 1RIHL 3B9AA 4QRUA 3WL9B 3QWOB 4S1DD 1ED3B 4N0UA 4GAYB 3TO4A 1AGFA 5FYJU 4Z8FH 4Y1AB 1I8KA 3JWOL 3W39B 4K94C 3MNVB 3ARYA 3G04A 5H94B 3OJ2C 4YX2L 1DLHA 2VDLH 2F53B 3B2UD 5TQ2L 3V4VH 1QPXA 3B8SA 5I8KL 3WDJA 3GJFA 4FZEL 4AIOA 1L9NA 3MO1A 5GJTH 1YDPA 4ZOEA 2F19H 3ZKNC 4CVZA 1JGLH 3KPTA 3LN4A 1IGYB 5I8OL 3MXVH 2NLJA 2BSED 1YUHA 2PW2B 3WXVH 2YR3A 1CFSB 4FTVE 3ZDYF 4RFNB 5L8LB 1W0YT 3SCMD 3FONB 5MEPA 3BKMH 4X80H 1J05A 3VXUD 4P46C 5HXMA 3LIZH 2VB5A 2DWDB 2LU4A 4MCZA 4XZUA 1BGXL 5ANMB 2Z91A 1T7YA 3T3MF 2PXYC 3IKCB 1OD7A 4JG1H 3VE0A 4FXKA 4I0PD 4JJHA 1TQBB 1R24A 4KHXL 2ZWLT 3TNMA 4TSCH 5E6IA 5EU6A 3D85A 5CS7A 4M3JA 4LMQE 5TF1H 1Z2KA 4Y4HA 5F7WC 1QSZA 4O58H 3V6FA 4OTXL 3D18A 1Q9OB 3SQBA 2BOBA 1UYWH 4Y16C 3DXAA 4MAYA 2DQGH 2A0LC 2J7LA 5HY9A 1H15B 4XCNB 3FT2B 4OUUA 2O26U 4JFDE 4JHWL 1XR8B 1FFPB 4UQ2B 1MCCA 1G7QA 4PJFF 5A2JH 3L3HB 2WM0A 4JN2B 4XVUC 3BIAX 2IBBA 4NM8L 3O41B 1QEWB 5ABDE 1DVFB 3E6HA 1YMHB 2EEBA 3WUWB 2FIKA 3K3QA 2VLRB 4WEUD 3MV11 4GG8B 3EHBD 3NA4A 3SDDC 1SYSA 2PNDA 2AXFA 1WSST 3G6DL 5GGSY 5DFVD 1JVKA 1HNGA 3MC0A 3RKPA 1JTPA 5T33L 1ZGLA 4Q9QH 1ZLSH 4XVSH 3F7VB 3AS0A 2IAMD 3Q48A 3KPSD 4RGMB 4NUGL 1F3JB 3DMMC 5DJ0B 3BJLA 2W60A 1PX4A 3DGCR 4L9LB 1AXTH 1X9QA 1YEKH 3FQWB 4NQSB 1SJHB 4L3ED 4XGZB 1XF3B 1V05A 1ITCA 4NQEE 2VXTL 4J3UA 5JA9A 3DUSA 1I1AD 4OZIB 5CZVL 1EGJH 1U3JA 2F58H 4NKIL 2G9HB 1Z0MA 5IFAH 1FAIL 1UADC 5HVGB 2BNQB 1MHHB 4NC2B 4PJXA 4JY4B 4GW4B 2NXZC 3WJJC 1NDGA 1IGFH 2NXYB 1G0XA 4HAGA 3O3DB 1A6TB 2XFXA 2BOCB 2NY6D 5HHOE 2VAAB 4IOFD 1SQ2N 4JFZH 4AG4L 1KIQB 3L95B 4CJ0A 1INDH 4KJPC 1J5OH 1KCRL 2BHZA 1S9XA 2ADIB 1ZSDA 3DX6A 2R4SL 3GSWA 4YQXL 4GXUM 2LE9A 2YN3A 3OJDB 1IM3A 2ADFH 1I8MB 2RR3A 4M7ZB 1F4XL 3HE7A 3HB3C 4EQ3A 4KQ4L 1K8DB 3FQTB 3VXRD 4OT1H 35C8L 3FFDA 1J0ZA 2F8VA 5DEFA 2COQA 1A7NH 4D9QD 3AS1A 1SBSH 1MFCL 4MCYA 3NCCB 2ADGA 3FB5B 4F33B 4QXGL 3MR9A 5F9OL 3FB8A 4TVPE 3BW9B 4RZCB 3S4SB 4H1LG 4PRIA 2KDGA 5F1SA 4AEFA 4F15B 2A9MH 2L0DA 5IGXL 4K8RD 4GSDL 1NFDE 4LGRB 1VA9A 4MD0B 1F00I 2WWMC 3Q5TA 1XF2A 1C5BL 2JLLA 3K4AA 4H0IA 2R69H 2LFGA 4BKLA 43C9B 2M8XA 3WFDL 4JFYB 3TIDA 5A2LH 3QIUB 3CGTA 2BJML 1QYGH 4MNQA 2XA8L 4G8EA 4G6FD 3SBWA 1UCBH 5BV7C 3MQIA 1INQA 1GHFH 2G75B 5HJ3A 2Y5TA 4PJGB 1BLNA 2HLFD 4M6AA 5IW1B 1T03H 3QCVH 4N5ED 4U1IB 1YYLH 1BVLA 3CVHA 2H26B 1A6ZB 1AY1H 4KVNL 2HRPL 5ERWB 3BWAB 2GSIB 5JQ6L 1JV5A 4OF5A 4JM2C 3IFOA 4WNQA 2OXGA 4B50A 4KKAD 4HSQA 4Y5YC 3C6SB 4YJZL 4F57L 1C1EL 4D8PA 3CH8A 3MRGB 5EBWA 2JB5L 1JPTH 1AR1C 4HZLA 4OZFH 3V8OA 2XWBA 3VRLE 1BQHB 3LKPB 5KVMC 2P24B 2O5ZL 2JELL 5K9OA 4RISL 3VWJD 1P4LA 2FO4A 4OGXH 5E2VH 4P59H 5L7XH 1A9BA 3QI9C 1T0NB 3GHBH 4LSRH 5I1JH 2UWEE 2BCKA 4LBEA 4OZGA 4R2GD 1GGIH 4FQJH 4OCMC 1A4KA 1HHGB 2C3XA 2X4PA 4KRLB 3B3IB 3ZE0E 1NBVH 4GRLA 4ZXBC 3VFOA 3NPZB 3B9KB 1RSFA 3DSFH 5T1LD 1CICA 2ORBL 3QUXD 4C83A 5EPMA 2IQ9L 5I1GL 4EI5C 3WJLA 2E7MA 1KJ3L 1PD6A 4LLVA 1A7QH 7FABL 1CGWA 3ELAT 2HJLA 2X89A 2N1KA 2D7PA 4G6AD 3TBVA 5I1EH 1A3QA 2R0KH 4OFYD 3FFCB 3GMNA 1Q9KA 2AJZA 3U30B 1KN2H 3MLYL 1QLEL 4ONGH 2YD2A 3BGFC 3VH8G 3PDOA 2W0KA 1JRHI 2AJSL 5EWIH 1Z0NA 4X5XB 1B6UA 1T2JA 1FJ1A 5DHYB 3ARGD 1JF1A 2XXMB 3BZEB 2XZQH 5DJ2B 3ARDC 4UV4H 4J3SA 5IF0A 4KI5F 5CBEB 3OKOA 2VLJA 2X44D 1LVEA 3CDFA 1WWWX 4ZO7A 2R1XA 2R0ZH 4BQBA 3GSXA 15C8H 4L9DA 5EUKA 1NANI 3GJEA 5D6DA 4U0RB 1IKNA 4PGDB 4DZBB 3F58L 4OM0L 3UTPE 4V2BA 1NEZB 3MLSH 3SY0B 1AIFA 3MRQB 3MNWB 4AL8L 4LEXL 3P9MA 1BECA 1T5WA 3L5JA 5FK9B 3QDMB 2ZSVA 1KTDA 1AGDB 5T1KA 4ZNEE 1NBYA 3U0PA 4XP5L 3O6ML 5ETUB 4YPGA 4P2OB 1AKJB 1VB9A 1E6OL 1HIMH 2NY7L 2VDPH 2B2XH 1JGUH 2CDGA 2HWZL 3EJYC 3VXME 2NY5L 2A38A 1I9RH 3BP7A 3NZ8B 2EEDA 5BJTB 4HIEB 5IROA 4ONHA 1KPVB 2HJFA 1RZ7L 4XPTL 4QRRD 1OP3H 1QLRB 4KDVA 1L6XA 4W6XB 2I9TB 1P7HL 1SYVB 1U3HB 4V1DD 5A2IH 2AXGA 5F1IB 4X4MA 5LWYH 3FQUB 2PW1B 4G8GB 4GJTB 1G7JA 2IALB 3TO2A 3GSVA 1E4WH 4MD4A 2Q86B 1WFTA 1QBBA 3K8LA 4X7SL 1HYSD 3P4MB 2RAMA 4WFGD 5KZCB 1HHHA 4PRPD 2FX7H 3BESR 1G1YA 1NCNA 2JJVA 4HWEH 3C6LC 5F8QC 1FZKA 4WUKH 1CL7I 1J12A 3QHZL 1Z9MA 4NQXB 2J88L 2AXHA 4YBQD 4KRMB 1ZLVH 1DQTA 3V0AC 3MCKA 1D5XB 5CGMA 1JIBA 3V6OC 3WS6C 4DK6A 2NYYC 4QGYA 1LNUB 2F54E 5ICZB 5LAXB 1FZMB 2QADC 3QHFL 3RBGA 4RGOH 3HMXA 3K74B 2OZ4A 1WZMA 3W81A 4FTVA 1NGQH 3A67L 1U95A 4F7PB 4AEEA 2QTEA 4FXGB 5IVNA 4PJ5D 2JIXB 1JNLH 4JGUA 4HQQL 2A73B 4U1HA 4BH8A 4KK9D 5LXGH 4K23L 2YPKB 4W68A 1OAYH 3LHPH 3IU3A 3LKQA 3O9WA 2Z35A 1HI6B 3JV6B 3C60B 5ICXA 2WIIA 2C3GA 4WI6A 2OMBA 3P40A 2BNUB 3T0AA 1MJJB 5GS0C 4DKFH 2P8PB 5BMFL 1UXWB 4WO4B 1RHHB 2GTWA 2CLZA 1P4IL 2XA3A 4NO5A 3KHOA 4UT7L 4GRWF 3QIWC 5C3TA 1ZLWH 3WLWC 4GG6B 4P23A 2HLAA 5FOJA 4F2MB 1VACA 1H5BB 1I9JH 1PDKA 3KYKH 1GH7A 1U8LA 3MJ8A 1MRFH 3MRPA 4XBGB 1M4KA 4NNPL 4P9ML 1ZVHA 4OKVA 2DDQL 2BSSA 1CFBA 2DBLL 3E0GA 4H26A 4UQ3A 4BZ2H 4NN5B 3T0WA 2A1WL 3PL6A 5C8JA 4OFPA 2JJUA 3FB7B 1BX2B 4QCIB 4AEIH 3EDKA 5F1KC 4X7TB 1N5AA 2EE2A 2BMKA 3AUVA 2C3WA 1EO8L 5AUMB 3I3BA 2H1PL 4POZD 4PTTA 1TZIA 2PO6D 1PX3A 4FFZL 5D2NA 3VXSB 3RDTA 1G9NL 5DT1L 4N8CH 2J8UF 4PJ8C 1KEGL 3T4AA 3DX7A 4RAVB 4OCXL 2R8SH 1QBLH 3TBSA 2AI0H 3OAYK 3LKRA 1WBZA 4PJ7F 1U8MA 3MLVL 3D87B 5J1TC 3OKYA 3V5HA 4S1SL 4K8RH 4AMKH 2B5IC 4OFKA 4UU9B 2XN9B 1KCUH 2ICES 3IDXL 2IBZY 1Z9LA 4OZHE 4RFOL 1IAKB 4P4KA 1BQUA 3QT2A 4OF8A 1FNGB 5DTFB 5BRZE 3OXSB 3PABA 2OR8A 1TJHL 4FQQA 2MTPA 2PTTA 1ZVSB 2HVKB 1J8KA 3OKEB 1IM9B 1JUFA 1RZIA 1BFVH 3HLAA 4Y2OA 1YY8B 4U6VH 1WIOA 3IDJA 4PRDA 1J0YA 1FFOB 1LDPL 1NL0L 1FRGH 4IOIB 1JJUA 1GGBH 3O3BA 5FO9A 2R1WA 3GBLA 3S36X 3QA3B 4CN6A 4I77L 4HK0A 4GXUN 2DQHL 2DQTL 5F89A 3VI3F 2E27L 5IBUG 3LV3B 5D96B 4E5XA 4PP2B 1R3KA 4Y2DB 4YX2H 5JXEC 4N5UA 1GZQA 3L5IA 5TQ2H 2QBWA 1ZEAH 3BKCL 5I8KH 2Q1EA 3VJ6A 1TPXC 4FZEH 5IEHB 2CGRH 4M62L 4NUJB 3AXLA 1MCPL 1ITBB 3FL7A 1N0LA 5C86A 4NO3B 5C0IB 2FLBT 1VFBA 2V2WB 1ERNA 4M3KB 3DECA 4JFEB 1F6FB 3HR5A 4HBQA 4OBRA 3SE8L 3SE3A 4MGXA 4NQCB 4S11A 5I6XB 3CPLA 4R3SA 3VGHA 4LLUB 3SJVE 5I0DA 5JMOC 1BGXH 1QLFA 1QR1A 2DWEB 1UCTA 5FB8A 4CU7A 4HEME 4U33A 4KHXH 1XIWB 3LQAC 3BP5B 4D0CB 1F11A 1QOKA 3HHRB 2FJGA 3ARFB 3VI4E 3TBTA 4Z7VB 2EKSB 4JO2L 4ZUVB 5CEZE 5INDA 3VRJB 1BZ7A 4ZPTA 4WDIB 4IRZL 3HRZA 4L4VA 4KWUA 3FQRA 4ZUUB 2ZPKL 3N9GL 4OTXH 2ICEA 5I2IA 2YK1L 4CDHA 1XMWA 3G5YB 5D7LB 4JLRA 3PQYB 4YC2B 4F80A 1OHQA 3L3JB 1HH6A 3KYOA 3OR6A 1JPFB 3TYGL 5J6HA 3LRHA 1RQ5A 2DJSA 4JHWH 4B53A 4O51B 3V4PH 2BXYA 3T2OA 1U93B 3FQXB 4G7VH 2X4NB 3KYNA 5E2JA 4NM8H 3OGCA 4HUUB 2H32H 5E8DL 2NY3C 2JE8A 1OW0A 3QXDB 1U8PA 2D9CA 1QSFA 4U31A 2DQDL 3QNYA 3G6DH 3QJFB 2BRRL 5DLML 5FYLL 2CRYA 4OCYL 1D6VL 1LDSA 1KPRA 2BDNH 1RUPL 4X6EB 1CE1L 4F8QA 3SCMB 3QUMA 4TYUA 2OL3A 4PGEA 8FABA 5IB5A 1MWAB 3D3VB 4QRSA 1EJ6A 2NY2C 4NUGH 1RK1B 1EEYA 1IRAY 3UBXB 3REVB 4JDVA 4GUPB 2XWTB 4W4NA 5E1AB 1MJ7L 2VXTH 3KNBB 4PJ7B 2IMMA 1X4YA 2MPAL 4G9FE 5CZVH 2GSGA 5EBGA 2DN7A 4P48A 4NKIH 2XI9A 3UYPA 4R90L 3QHTC 4U1JB 1IC4L 1OAKL 1A6VL 1LQSR 3CDGA 1UWXH 4I5BA 3OKMA 2ZNXA 2CR3A 5C0BB 1EO7A 1N5YL 5DVLA 4G80B 3CVHL 1HZHL 4AG4H 1IAII 1QBML 3CFDA 1KCRH 2ADJB 4OCLC 4NT6A 4CGTA 4DOHB 2R4SH 4PV9B 4YQXH 1FIGH 1IGTB 1DSFL 3FCTA 2SEBA 1S9VA 1WWBX 3DGGA 2YZ8A 5EO9A 5D7IB 3BYTA 1F4XH 3PUCA 4HWBA 2OTUA 1CWVA 3IDNA 4DVBA 2ZG2A 5DS8B 4KRPD 35C8H 4LARL 3OKDA 1P4BL 3QEQD 5DA4A 5E03A 1D5MA 5A43C 1Q1JL 5L2KB 1QA9A 4LCYB 4P49A 4X6BB 1RU9L 2BVPA 4HKXB 1KXVC 4JFQB 4HLJA 4JPIB 3P11L 3OXRB 2GK0A 3L7EA 3RNQB 1CD0A 3QXAB 3QDGA 1HHJA 1ZHLA 1NPUA 1MCEA 2EH7L 4HIIB 4BK5A 5F9OH 2YD6A 3ZMRA 1I1YA 3ZKMD 1F6AA 5IW6B 1S7VA 1VADB 1I7TA 3U0TA 4GKOA 2Q6WB 4UNVA 3RZCA 2FJFA 4NO2A 4NIKB 5IGXH 4GSDH 1JZ2A 2OQJA 5GS3A 4OQTA 2XPGA 3VXMA 1NAMA 4G8FA 2H2SD 4KKNA 4Y4HD 3ZT5A 1C5BH 1O0VA 4L8DB 1IE5A 1NFDF 1U6AL 3QDJE 4R9HA 1JWUA 1U8NB 3FRUA 3K8KA 2R1YB 2D03L 5FF6A 1P1ZA 1BF2A 4I18A 4YBLC 2V17H 4PLJC 4OF0A 1AC6A 4NFBA 5KSVA 1E27B 12E8L 3MV8D 3OKLA 2BJMH 2JCCA 3V6OE 1KGCD 1RJLB 3GSUB 2XA8H 2DICA 1KBGL 3TGXA 2NY0B 1T04A 1Y6KR 1QFWI 4WTZG 4LU5L 1PVHA 1WT5C 2WV3A 3EO0B 4M02A 2DKMA 3L6FA 3NIFE 4LNRB 3VG0L 2ILLA 1AD0B 4XP1L 3LAFA 4HJ0D 2GFBA 1DR9A 5JQ6H 5DI8B 2BVOB 3KPRD 5E24E 1UXSA 2XKSA 1BBJB 4EN3A 3O8XD 3HE6D 4I0CC 4ZD3L 2ZUQC 5CINL 4DKAA 4H5SB 3GSQB 5ID1B 5FCUH 4F57H 2IJ0C 5HI4C 5CJXA 4HFUL 3QEHB 2JB5H 1L0QA 3SDXA 3FHQA 3AGVA 3RY6C 2P8LB 4E41A 3GK8L 3OB8A 2JELH 5FXCH 5I76A 3LS4H 5KTEL 1MHEA 4JJ5A 4ISVA 1KT2A 2ICWJ 3AAZA 5B22A 4RSVA 2YMXH 4BQ6A 4XNMB 3VRLF 1L4IA 1U8QB 3MJ6A 4LSUL 5KSUB 4JFFD 1JHTA 4XXDA 5A40E 2QSQA 4K7PX 4JRYB 3BD3A 3ZE1F 2UWEF 3O6FA 4M1CD 3KYMA 2ORBH 1GOHA 3KXFD 4NCDA 3OHXB 1A2YA 3NCYS 4UIKL 4TRPL 2IQ9H 5I1GH 3VD5A 3ZE0F 1KJ3H 4PRBB 3SQOL 3MRIB 2FR4B 1WTGT 2DQUL 5DQ9A 4DFHA 4KI5D 4PJ9B 5I1LB 1KIUA 2X1OA 3PNWA 1FL5A 5HDLA 4GMTL 5KW9L 1CK0L 1RZKH 1YC8A 1I3RA 3MLYH 1QLEH 1I85A 4Y19B 5HHVL 1GPOL 2OJEA 2XZCL 2H41A 4CMMA 4G43A 1QHOA 2HVJA 4U6YB 3U9PL 1X4XA 5CMAB 2AJSH 1FHGA 4NBXB 1WC7A 3HG1B 1DLFH 3MBEA 1NLDL 4Y5XA 3NCJL 4GBXD 1I8IA 2A6KA 2H8PB 3KLHD 4Y8DC 4PRAB 3O4LA 4HKJA 1HXMB 1FFQA 2PETA 3MUJA 2CUMA 1PZ5A 2OI9C 3T77A 1WITA 5HVFB 5LQBL 1LE9A 2KH2B 5H35A 2MWCA 3HMXL 5JHDA 4X6CA 3GBNL 5E4IA 3F58H 4HUXB 2OZ4L 5FYLD 3EFFA 5ACZB 4N90D 3EOYG 4C54A 1SVCP 4O5LL 4XNQA 4N8VB 3L3IB 1TVBB 3THML 4OLWL 1HEZA 4AL8H 4LEXH 4Q6IA 3QUZC 4YIQB 1KULA 5FKAB 2R2HA 1MCRA 2Z31C 1M6OA 4N0FB 5D1QB 4WU5B 5ESVB 4XP5H 5DMGD 3O6MH 2C1OA 1XCQA 2H6PB 1GGUA 4QLRA 5DD0L 2F5BL 4P5TC 1ZLUH 2RFXA 2HWZH 5HGAB 1T21A 5T5FL 5JUEH 5BS0B 3ECBA 1A22B 2HT2D 3STLB 1BOGA 3I6GB 3WKML 4MS8C 3CX5K 4O9HH 3SO3C 4MA3A 2QQLL 1RZ7H 4WTZA 4XPTH 3U36A 1HILA 5ILTL 4KK6D 5BRZA 5H2BB 3TN0B 2AABH 3O3AA 5F7EL 5F6HI 3QFDB 1P7QB 2QKIA 3GSOA 5I17B 4JRXE 2A6IB 3V5KB 4S1RL 4AENB 1NKRA 4NBZB 1U8HA 5AEAA 4CADA 3QXWA 5JIPA 3EYQD 4X7SH 2BSTA 5DJDA 5E4EC 2Q7YB 2VLKA 2NY4C 5DHVB 3OGOE 2EDXA 3QNXA 2C7UB 3VMNA 3RTQA 3UTSE 3TA3C 5I8EB 2JF1A 5EO0B 2E7HA 4UDTB 5KSAC 2H32B 4NWTL 3A6CL 1ZT1A 1FYTD 3QWRA 3QHZH 1EV2E 1CD1B 2J88H 3MV7A 3DVGA 4KUCF 1Y0LB 3ZKSD