3RDTD

Crystal structure of 809.b5 tcr complexed with mhc class ii i-ab/3k peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
199
Chain Sequence
FEAQKAKANKAVDHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for differential variable gene pairing in creating T cell receptors specific for unique major histocompatibility ligands.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
total genus 47
structure length 199
sequence length 217
ec nomenclature
pdb deposition date 2011-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3rdtD01
2Q8BL 4JZNB 1KBGH 4DK3A 4MA7L 2PO6C 2CRMA 3P4OB 1QPPA 5IP4A 4HZLB 4XVSL 3OHXA 4S0TD 4Q6IB 3FN9A 1BFTA 4CDGC 1NAML 1FDLL 4MA8L 1N5YL 4Y4HA 3AMLA 1EX0A 5BQ7A 2DQTL 1C1EH 2VQ1A 4WUUB 1A64A 5HHMB 2ZCHH 2VMFA 3HZVA 4BZ1H 4FQXA 5HDLA 5LAXA 1C5CL 1CE6A 1P9MC 4OI8A 5DD5H 4IOIB 2PXYD 3IJSA 3L3DB 4RGNC 2BOCA 3O3AA 5H94B 5TFSL 4RAVA 3I9GH 3DUUA 3VXRD 3ARFA 3VFRA 1Z0MA 5DO2C 3D25B 2AP2A 1QO3B 5DJ6B 2HJLB 1MHCB 4PB9H 4YXKL 2NY0C 1P5VA 2FL5A 4RX4A 1YJDH 3S7GA 4K7PX 4FG6C 5DRZB 2XZZA 4ZFOA 2PTVA 4O5LH 3IDMB 1KULA 3HLAB 5ITBH 4N9GA 5FM5M 1UWEH 1YPZA 3FN3A 4ZNEE 1D6EA 2NR6C 3O6LL 4OZFG 1OHQA 1S3KH 3RX5A 5C2BL 4HS6B 4YJZL 4NN5B 4AIOA 3WD5L 3MRMB 1NSNL 3MUZ1 4MHHI 4RGMB 5T1MA 3O8XA 3ILQD 4UZGA 1BJ8A 2PR4L 4XPHH 4PJ7B 3D9AH 3ZTJG 2J6EA 5D7LA 5C0CD 3GMPA 4TRPH 1EBPA 4M03A 1WEJH 4MQSB 2VLKE 1XR9B 2GJZB 4JQIH 2FX7H 4GKZA 2F54A 4YBLB 1QUNA 5DD6B 4GG6B 4Y16D 1NCCL 3VJ6B 3VXTB 1OAYL 1JPSH 5LBSL 1JGUH 5FYJH 2EZ0C 4MNQB 2IGFH 5EFIA 5ABDE 3G5ZB 4OD2B 4GRWB 5B4MC 4ONHB 1UCBL 3D85D 3QEGH 3LRSB 2J8UE 4I48B 2W0LA 1FSKC 3LQAC 4G8GB 5GGUB 4WW1B 1AE6H 3KLAA 2V7HA 5K9OA 1NCAH 5C0AE 2UYLB 2P46B 5H2BB 3WEXA 3MV8E 1CD9B 5E95B 4R9HA 5IG7A 2VN4A 5EBMA 2AJYL 3I2CL 3MR9B 3OKYA 4UNVA 3SE8H 4HK3N 3MA9H 3MNZA 1Q9WA 2J5LB 3RVXC 3FJTA 3MA7A 4PJDA 2NPLX 3QUMA 5IB2B 1ORQB 2NW3B 2OL3H 5MERA 4M4PA 1J5OL 4HEME 1P7KA 2K9UA 5C0DA 4AMKL 1GGBH 5E5UB 3R0NA 3QEQD 1WFTA 2PR4H 4XPHL 4U1GB 3RY6C 4MD0A 3U0WL 3ECBB 5D1XD 4HIHA 1YYML 5GS0H 5HY9A 3LKSA 3TA3B 4HIJB 5DUPL 4Q74A 4QWWD 5C07D 2VDQL 3F5WA 3REVA 1I3UA 5J8OA 3L3OB 2XXCB 2A73A 2X9YA 2YEZA 2A9MH 1AY1H 5ALBH 5DQJB 2C1OA 1UCBH 3FRUB 5F21B 5CJQL 5DT1L 3CVIH 5CEZL 4RFOH 3NZHL 3ARZA 2P42B 3D9AL 3GSOB 3MRLA 5E6YA 4KK5D 1CICC 4GMTH 2J8UA 3L3OA 4HS3A 4U1KA 5HI5C 4RMSA 2FR4B 2G60L 4KHTH 1Z9SA 3QISA 1GC1H 4KI5D 4X6CA 2E5EA 1KCRL 1BPVA 1PZ5B 1EV2E 3UTPE 4Z7QE 1CGXA 4LF3B 4KMQA 2ZSWB 3H3PL 5GZNC 2YMXL 4ODXA 3GBMH 3MJ9L 5CKGA 3SGDI 3VA6A 5CD5C 4IDJL 1MHPH 1OP9A 2H32A 5GZOD 4AG4H 2ZKHH 5BO1H 5IVXF 4XP9L 2KL6A 2R4SL 1M7IB 3MLUL 1ZLSL 3MRIB 3BEWB 2Y36L 4ZTPL 3EJZD 3VMNA 3IFOB 5GSRA 2CUHA 2VLRD 3HRZA 1KEGH 4RMRA 1GSMA 3C60D 5EBWA 4KTEL 4R0LC 2R56L 3U1SL 1VKXB 5DLMH 3BZ4B 4G80A 1M7IA 3BESR 3MBEC 4JKPL 1WWWX 1HHGB 4L4JA 3BH8B 4PRPD 4GRLA 2DQUH 1WBYA 5C08B 5F9JA 5KSAD 3T0DA 2I27N 1HKLL 1R3JA 5D7KE 5DJ6A 1VGEH 4OF8A 4U1LA 3VDCA 3JTTB 4YWGL 2ZWLT 1UQSB 1DUZA 5DRZA 2R15A 1T04B 1I3GL 3DX6A 3QUMH 4WFEE 5FYKU 2ILLA 3ARGC 4D0CB 1QSEE 4OCWH 4DQOH 5C0AD 3DRTB 1KPVA 1S7QB 1HNFA 4PD4K 3MSPA 4HLZG 4ZUWB 4OV6F 4X4ME 3S5LG 2RHEA 3CXDH 4Z7UA 3C8DA 2E9BA 5EORL 4ZSOB 3VFPA 1F2QA 2DYPD 2WP3T 1JV5B 4PS4H 4LP5A 1U3HA 3S4SA 2DS4A 2NX5A 2BNQB 1BJMA 1U58B 2A9NH 3KHOA 5DC4B 3DOSA 5JUEL 5FUZH 2F5AH 3GJEB 4HUNB 2EC8A 1OD9A 2EO9A 2IFFH 3EDEA 2BFVL 4Y4FD 5MI0C 3OMZA 5DD3L 1EFXB 3SJVA 1ZOXA 4R7DA 3MJ9H 1T21B 1BVZA 1Z3GH 2W92A 5KSBF 1OTTC 3GO1H 3RQ3A 3E8UL 3QRGL 3VXQA 4YHIA 2CDFB 1FZOB 4PFEA 5EBLA 1ZLSH 1S7UA 1HDMA 2P7TB 3NIDF 4V1DB 3UROR 4XBGA 1YZZA 4WY7H 2J6EH 3TPKA 1DUYA 2BNQD 4IEFB 2JIXA 5DJDB 3RIFK 4X6DB 5IM7A 3OWEA 5D4QA 5IOPB 1F3JA 5CP3A 5CGTA 5CILL 2JELH 1UM5H 4LRIC 3SGEI 4M7JL 1FFPA 3RAJL 3H7BB 2B7DT 4YXLH 1ND0A 2FZ3B 3WFEL 1J10A 1U42A 3AMKA 2UZIH 5SV3A 1T1YA 4YHKL 4HSQA 4HX1A 4WU5B 4X4XA 3AVEA 4FFZH 1AD9B 2EIZB 3LKQB 3LKOB 5FYJD 4FQQB 5IM7B 3L1OL 3ARGB 4PRAA 4QHNB 3V6BR 1ORQA 2NW3A 1Q9OB 3TBYB 4K71B 2OP4H 5EU6E 1GZPB 2DQGH 3UJJL 2V5YA 5HGDA 5HGBB 5ICYB 1MCDA 1I3GH 3Q3GA 3U0TA 4JZJC 3WIHH 3IDJB 1SVCP 5I18L 3A6CH 1T1YB 5IW3A 1NANI 2P5ED 3GI9H 5EA0L 2AQ2A 2ZP0T 3PQYB 5DJCB 3FN0H 1RK1B 5E2TH 3VI4F 1NAMH 1P7HL 5D5MB 3MLYH 4ZYKB 3MBXH 2BDNH 2DQTH 1TPXB 2DQFA 1MWAA 2W59A 3VW3L 1A6AA 1YEEH 1U3YA 3K1DA 5DQJA 3W81A 1PGRB 2GJ6D 3BSZH 2XV6B 5B22A 5E99L 3EOAA 3R8BB 4X5WA 4YPGA 1U8KB 3O41A 5FB8A 2LTQC 4ORGA 2XZQL 3F7VB 4YDJA 4F7CA 4IRSA 4PJFA 4YGVA 2C26A 4MXVF 1OT2A 1BBDL 2EE2A 1FHGA 4Z8FL 1AQKL 5INCB 1G0DA 1MCOH 4CU8A 1ZGLM 3EOYG 4DK6A 4DN3L 1F11B 4ODUA 4J7RA 5BQ7B 2J6EL 3P4MA 4JPVL 2ARJB 3L1OH 3QH3B 4KKLC 4QRTA 3MRPA 5FM4A 3T65A 5J12C 1UG9A 1MCKA 3HNSH 5CUSH 5CILH 4GUPA 4AIZB 3O6FA 4AJ0A 3IU4L 4YUEL 2SEBB 3VCLA 1K85A 3V52H 1ORSB 1OGAD 1R3LA 1AGFB 4MQXD 3PWPD 4PV9A 5EH1A 3F62A 4X8JA 3MR9A 2C3GA 4NO5B 2NY3B 3U7YH 2R0ZH 4JHBA 3PJSB 5T5FL 2IEPA 3HI5L 2FSEA 2P5EE 4R0LB 1DQJA 2J4WH 2JB5H 3WLWC 1E6OL 3DWTA 5H37G 5D70H 1MJUL 4GBXA 1NUNB 2WUBL 3QDGE 3MCG1 3RUGF 5E9DD 4BFBD 2QEJA 3I9GL 1D9KA 4LSUH 4QYOB 3MUHL 5I1IL 4ENEC 1LEKB 1RHHA 4G6KH 5I2IB 3EDFA 1NL0H 1BZ9B 5HHNA 1MCOL 4KUZH 5I17A 4H1LA 2A6IB 3SDDA 2ADJA 2HT2C 3AM8C 2WWKO 2EDYA 3NCYP 5C0EB 4KK5C 5I30H 5C0BE 3Q1SL 1IAMA 3VWJB 2EXWD 4MJ5A 1U8MA 3N1GC 4ZS7L 1R5VB 4K3EH 5E5MB 5HI3D 5TDPB 4OFYA 3THML 5KANG 5EO9A 5D2NE 3BRFA 5TQ0H 1PLGH 3CMOH 2XTJB 3JWOH 4OCYL 4Y5VC 5CWSB 5I1HL 5DS8B 2AV1B 5B38B 1RZFH 4F2MA 1BX2B 3ZTNL 5JLZB 4O02L 1JUFB 5IG7B 3C6LA 3MXWH 5IVZA 4C83A 4Q9RL 2QSVA 2XZCL 3SO5A 1RZGA 4JQVC 2JB5L 1UKSA 1GOGA 4Y4KD 1CLYH 3OPZL 4LHJB 3QA3B 3BXNB 4LQFH 4DVRH 3QCUH 1RJYB 5GZOC 5JDSA 2DBJA 3L5JA 3DO3A 4HZAA 3EOBA 3ULSA 1R3KA 2MTPA 2X4UB 1F8TL 1NDGA 5SX5K 3TH2T 1XGQA 2H32B 2NY4B 2YA2A 4MD5A 4O00A 1RFDH 3IS1X 4NCDA 2ATPB 1J1XL 2YUWA 3WO4B 1P2CA 2VR4A 5EDXA 2XA8H 2QHRH 2EIBA 3HE7D 5F93C 1C5DA 5EPMA 4C4KT 3NIFE 4N9GB 1SQ2N 4AT6A 3V5HA 4ODTL 1AXTH 3AAZB 4AM0A 3SO3B 2VL5A 3H7BA 5J4MA 2YD2A 5C0CA 4HKJB 2Y5TB 3I6GA 4CVWA 1IC5H 4NN5C 3NFSL 3C08L 5CEZH 1CBVH 3HNVL 4OM1L 5E7FA 4HX1B 4M02A 4NUJB 1LO2L 5TF1L 5D8JH 2HJKB 1J0JA 4UQ3B 3NACH 1RUQL 2ZUUA 5JQ6H 2AKRA 4L4VD 2VZOA 4XP5L 4UTAL 2XTLA 2RR3A 4MYWB 4PGZA 3T1FA 2I5YL 1TVHA 3PWLA 4Y4KC 1I7RA 1C5BH 5L88L 1QFPA 1MI5B 2ESVD 4WW2F 2CUIA 3MUY1 4FQPA 4JDTL 5L2JB 3BGFB 4HJ0C 4BSWA 1HZHL 1E4XI 4GS7C 7FABL 3QAZB 4LSTH 5I1HH 5INDA 2F19L 4R26L 1S7WB 3WXVH 5IB3A 15C8H 2R56H 1HIML 3JBG7 3RWCB 3VRLE 4H26B 4MCZA 1LHZA 1AGDB 4RGMC 1WC7A 1CS6A 2MNUA 3HE6B 4K3JH 1BHGA 3LQAH 1CLYL 2EH8H 4UINH 2VUYA 2Q6WB 2Y36H 1OP3K 1LE9A 4N8VA 3QG7L 4N0YL 3GSNL 1IKFH 3WHXB 1F6AA 3G5ZA 1XR8B 43C9A 5DTFA 3X3FH 4LMQI 1D5IH 1I9RH 4Y16A 5IW6A 3SDXF 4WVRA 4JFDA 3RKDC 4A2MA 4WWKD 2YD3A 3O3UN 3GSRB 2XZAL 1KJMA 5F7HA 5FOBB 4OFKA 4P49A 5BMFL 2V2WB 3PGFL 3S36L 3HI1A 5A2JH 3T0ED 3T3PE 4XI5C 5IQ9A 3VRIA 5GS1B 2VXVL 4TSCH 1BQSA 5D72H 4JFDD 3VGEA 3VFUA 3I3BA 1JNHB 4LAQL 5JHDB 4G9FB 3RPKA 4BH7A 1ZVSB 4TSAH 5KS9F 5SX4H 3KPOB 3NA4A 1OTUD 1KJ2H 1CFQB 1CXIA 4LHUA 1KCVL 5SWQB 3KS0H 1NGQL 5GGSB 2APVA 4NKIL 3HG1B 2XRAL 1RIHH 2YPLE 2PNDA 3O2DL 4RAHA 4OIIL 1IT9H 4U1IB 4WV1A 3RDTA 5EUOF 2FIKA 2VUOA 3G04A 4WU5A 4ZXBB 5DK0A 3INUL 5EORH 4YBQD 3RKDD 4UMGA 1I8KA 1U3ZA 5LQBH 3C9NA 4L8SB 4M3JA 2PO6D 3STLB 3CNKA 4D0BB 2XT1B 4HWZA 1PKOA 4PJ9C 3UTOA 3L6FA 2AGJL 4HXBH 1BZ7B 1MY5A 1HHHA 2YWYA 5DK0B 3IYLW 2IANB 5GGRY 1X3DA 2VQTA 4GT7A 1D9KC 3UYRL 4YHLL 1GHFH 1CFTB 3T8XB 2DWDA 2JCCE 4JFQA 4LF3A 1BVKB 1MCRA 3QQ4B 3STBA 5D72L 4FMKA 3DX7A 3AREB 5J3HC 3MUJA 1ADQL 3U46A 2Y5EA 4MD4B 1A1OA 2NW2A 2DM2A 3UAJC 4K94H 1AY1L 3FQNB 2XICA 3U4BH 5FF6B 3GMOB 2IANA 4LDEB 5CZVH 3WFCL 4GKNB 1G7QA 3DVFA 3OKMA 1AO7B 1NPUA 2W9DL 2NXYC 4YHML 4YDIL 4MXWH 2IAMB 1GRWA 1OGTA 1K4DB 3BIKB 4E9LA 4WEMB 5C7XH 1CCZA 2JKXA 4YBQC 5C70A 2C7UB 4MJ6B 3MLVL 4MHHG 4JO1L 4NSKB 4EVNB 3BWAA 4PJBA 1T22A 1AC0A 1FGNL 4GUPB 5J0BA 1LO3L 3QDJE 4F7MA 1ZA3B 3FMGL 4P9HL 3ALXA 4B5EA 1ULVA 3QYCA 2ZCLH 1ZAGA 5D2NB 1UQSA 1WQVT 2E8YA 4MQ7B 3FAXA 4QOKD 3CDYA 4YHZL 5HHQB 3VXOA 1CDIA 2NX5D 4D2NA 1U8OA 4R3SB 5KSUA 2IBZY 4JHZA 5T1MB 5KSVB 4UV7L 4YHKH 1E4XL 2VDPL 5GRXG 5C08A 5HSFA 1UZ6E 3ILPB 2H6PB 3VXPB 5H35A 1KELL 3O9WD 3HPJA 1ADQH 4E0RA 4JHAL 4X7SH 4FQ2H 3BP5A 4XX1G 1KEGL 3RTQD 1UVQB 4M1DL 3WUZA 1A7NL 4HF5L 4Z7OE 1UH2A 2V6HA 4OCXH 1KLFA 4IBLT 4PJIE 3DX6B 2AK1H 5CGYC 2OBGA 3GSWB 4TTDC 3U7WL 1TZGL 5KS9B 2V9RA 5DD1H 1NUGA 5IROC 3WN5C 5BS0A 3GMMA 4U6VL 4Y4HD 4CNIB 2B4CC 4JPKL 3P30L 2H1PH 3QG6B 4P99A 2Q7NA 4JJHA 4MX7A 5I1GL 3DX9B 2QSQA 4YQXL 4P9ML 3EHBC 4H20H 3C5ZC 4Y2OA 4Y4HB 4DFIA 4WHYH 1P69B 1VSCA 1NBVH 4KMTH 5KTEL 1A1NB 4OF7A 1H0DA 3BISA 3HC3H 3CUPB 4BQBA 3U6RB 1L4IA 4TOYH 1F3JB 4WV1C 4KHXL 3FOLB 4PIRF 1KV3A 4P59H 2XKSA 1G7IA 3OKKA 3CFCL 3D25A 3GMLB 3L7FA 1KIPA 3CK0L 4YHNA 1WT5C 2O5ZL 2XYCA 1IE5A 4O58L 4FQIL 3M17B 4WTZG 1NEUA 2P7TA 3RX7A 2VSCA 4FTVA 5E94B 3P2TA 3LPGA 1U8LB 1UH3A 4ZFOB 5GGTL 2NLJB 3VD9A 5DRWA 3VRJB 4JO4H 3BAEH 1GZQA 1RIUL 3MLXH 5GIRB 4Y4HC 4PGCB 2BRRL 3KJ4B 4HCRA 2I60H 2DLFH 5K9OB 4MCYB 1FZJA 4PY8I 1IAIL 4GW1A 3WDIA 1OARL 1CWVA 4X6FA 1YECL 4HS8H 2PN5A 4HDIA 1E4XH 4OGAC 4LVNC 2GY7B 3F7PC 3RBSA 5J06A 1S9XB 1YEIH 2EXYD 4N5UA 5I8KL 4JDVA 4WEBL 5EN2A 3MGTB 5DK2B 5GS3A 1I8MB 2Z93A 1IM3B 3MRDA 1A6WH 5E8DL 3RIAF 3X12A 2E9WA 1WTLA 2P48B 2ZUYA 4PLNC 5KOMC 3K8KA 4PJCB 1YY9C 1D5BA 4P48A 3UTTE 5JZ7C 4GW1B 3JXAA 5JHDD 1MNUL 2BHZA 2N56A 1QBLH 1QHOA 4LRNH 5HBBA 2A0LD 4LSVH 3CFCH 4C57C 1KCSH 4LHQB 1NAKL 1BQUA 4TUOA 3ZE0F 4IRSB 4OD1H 4PLOB 5T3XD 4TVSa 1T7VA 3F5WB 3PXHA 3R06A 5C6TH 2DQCL 5F7YC 1GPOH 4XNXL 2DBLL 3PF2A 4JREB 1JI1A 4R8WH 5C0IA 1IL1B 2V2XA 1FNGA 5AEAA 3QUKA 4FQXC 5GRYA 4TUKH 4ELKA 1GC1C 3QDMA 1UKQA 4XWGL 4JY4B 4JRXA 4RIRA 2LV4A 2HRPH 4H8WL 5T3ZH 3B5TA 1JN6A 2P5WD 3TYFB 5JXEC 3HRZB 1EEZB 1I1AB 4X0KA 3WNNA 1U0QA 3HAEG 3RWCA 5B3JF 4D9QD 5FYKL 4ZXBC 4X9IA 2A6JB 3AFLA 2ZJSL 1UB5A 4M5YL 1AGCB 2WBJC 3BZ4A 4G80B 4X6DE 5EWIH 3V7AG 1JF5A 1O7VA 3ARDA 1RZJC 2AJZB 3TBTA 3MBEA 3T4AB 4NNYB 3Q6FA 4UU9A 2HTKC 3FO9B 4GRLC 3VH8B 3OR7A 1CFVH 3CGTA 3UC0L 1Q9KA 5DC9B 2EE9A 5J1AA 3IXTA 3P0GB 1MUJB 1KJ2A 3QEHB 5D5ME 2HT4C 3VGDA 2DIBA 4OGYH 4P2CG 1JWMA 2IH1B 3PQYE 1D9KB 3TJEL 3MV9A 3VXRA 4LSVL 5C8JB 2BNQE 3FRUA 5KBNC 2XN9D 1DBJH 3VFUB 5I2IA 1NUFA 3G6JB 3EIFA 1BFVL 2OMNA 1I1YB 3NIGF 4X6CE 5GJSH 1RUPH 3FQRB 2P4AB 3MV9D 1CD1A 2Y06L 3BKYH 2HJLA 4UTBH 5HHVL 5KW9H 3WLBB 1DVFC 3MFFA 3EYUL 3FCTB 3ZL4L 2VABA 4IIQB 1CDUA 1SYSA 2BSTA 3F6IA 4EUPB 1QFWL 2VZUA 4DGIL 4X5XB 3RWHB 1RHHB 1CD8A 4R26H 3WXVL 3KPSD 2IMMA 4LLYB 1F4YH 2J12B 1G0YR 3MRHB 3ZE1F 4JRYD 4X9HA 3RWEA 2YC1A 3QXAB 5CBAB 4I3RH 3AXLA 1B0GB 2B5IB 3FT3A 4K3GA 1IFHL 4HUMB 3DXAE 1CDJA 4O2CB 3LPFA 3Q5YA 3NBNA 1EHNA 3BQUB 5EBLB 1P7QB 4YX2H 1LE5B 2JJWA 4S1RH 3B6SB 5FOJA 4ZDHA 3IDXL 5E4IA 1HXMB 4PP2A 5DJZA 3BVNB 3QO0B 4Y4KB 5DVMA 5K93A 3MV01 3G9VA 5E2UH 4F7TA 2ICWI 3OF6D 4NZUL 3GMNB 3Q2CA 2N7BA 1NCDL 4UT9H 4YHYC 3EDDA 5DUMH 3MMEB 4JN2A 2DWDB 1IGIL 1X9QA 1WF5A 3L3HA 3NFNA 2Q8AL 3BKMH 1OGAE 3C87A 5FDWB 5FDYA 1GYAA 1U8QA 4JFED 3LIZH 3RZCB 1SEBA 3ARPA 4U6YA 4XCNB 4M5ZH 4WW1A 4OZIB 4JB9L 5HYJB 1CFQA 2Y72A 1G9NC 3MYZA 1EO8L 3WO4C 1MRCH 3CFBA 1KJ3H 1DEDA 3QFJD 3CH1A 5DT1H 2IBZX 5E00B 1YEFL 1AQDA 4UUJA 3RDTB 4U6TA 1JHLL 2P8PB 3D1MC 4X7EC 1A6ZB 1NEZB 2NY5H 3V6ZA 2AJ3A 5GIRA 1I1CA 2BVPB 3V0AC 3H8NA 2OJZL 3PDOB 3OKDB 4ZODA 4U1HA 2L7UA 4OSUL 3WUWA 4IRJC 4KGLA 1YC8A 4C4KO 3RL1A 5IGXH 4QRUB 1YEGH 4OLZH 1KB5B 4PRHA 2ZPKL 1L0XA 4WNQA 5C07A 5HDQH 1V7ML 2N7AA 3RY6A 1V8HA 3MNVA 1HKFA 3UTSE 3WXWL 2XRAH 4HIEA 3MGAA 3NGBB 1DEEA 5C3TA 1BJ1H 4NRZB 4LNVA 3CFKA 1B0WA 4FFYL 4OGZA 4WTWA 4GXVL 2O5YH 4OB5H 3MLZH 4KRLB 3P11L 2NZIA 1AGEA 1WK0A 4P57A 1MFAH 1T0NB 3SO3C 2FEDC 4Y8DC 3IJYB 4P23A 1G6RL 2CDFA 3U46B 1TZHA 1TTFA 5C0GB 3QDGB 1YN7A 1ZS8A 1AJ7H 2DLEA 2YD8A 1BAFL 1X7QA 3ELAT 1DL7H 8FABB 3NIFF 2NY4C 1TJHL 3QPXL 2HVJA 3U48A 5BS0B 5DA4A 5DJ8A 2FHBA 1VENA 2AXFA 4TULH 3KXFE 2QQQA 5GRUH 3T77B 4PRHD 4J4PA 5F9OL 1FFPB 1T7ZA 3SE8L 1S7TB 4NQDA 4XHQA 4ENED 3N1PC 3WLWD 1PG7H 1TJGL 1QVOB 1R5WA 3TO4A 2CMRH 2QHLA 4X6BB 1HK6A 2C4FT 5D1XB 4PUBH 4KKBD 3DUHA 5GXBB 1CZ8L 5IHBA 2ARWA 1KNOA 5GGVH 4M8VA 1NJ9A 1IQDB 5IV2B 4X8XA 5LGHL 3S34H 2GJJA 2KDGA 2PO6A 5LCVL 5EZLA 2VDLL 1XIWD 4XTRC 1NQBA 3Q48A 4Z7WA 5I8OH 4OLVH 1IGJB 1XGTB 1WEJL 4G7YL 3VH8G 4JRWA 1DE4B 2NY3D 3OKOA 3P30H 3SDCB 5D1QD 4ZXBA 2EYRB 3UTSD 2R0WL 5C6WH 2UZYB 5FCUH 3CU1A 4QCIB 2VLME 1T80A 1UWXH 1YY8B 2X09A 1RK0B 4E0RB 3P0VL 2SEBA 2OR7A 3B3IB 4FQ1L 4QRRE 2LVCA 2FEEI 2A74B 4RMTA 2FRGP 2D7PA 4OCSL 3TFKC 5L2KD 4PJ5A 2F5BH 3BPLB 4RGOH 2E6QA 1BZ7A 3G6JA 5DI8B 2APXA 3U2SB 4WGVB 5EU6D 3A0OA 4WHTA 4YNYA 5I74C 3QRGH 1P4BL 1EO5A 4IHOB 5HYIA 1JP5A 3KYAA 2BX5A 3BN9C 5J9PA 2A73B 5MEQB 1RPQA 4PUBL 1TQCB 5IEHB 3GSQA 3HE7C 4PRBA 1JPTH 5CJ8A 3MRBA 3FO2A 3GB7A 1TPXC 2EDQA 5JR1L 5FO9B 4NN6C 3ARRA 2C5DC 4R90L 3UPAA 4RWYL 2GW5A 1YYMH 5GS0L 5TQ0L 4Y4FC 2VLLA 2XWTA 3WJLA 2J8UB 3GHEL 5CBEB 5ELIA 2WBJA 3VGAC 2NY2B 3D5OF 2W38A 3EJYC 5E56A 5FYJE 5C0IB 4B7LA 4A2LA 1K6QH 1X5KA 4X7TB 1K3ZA 2Y9RT 4PGDB 5HVWA 5DJXA 3VXNB 3LN4B 5AG8A 4HMCA 5E2WH 1I8LC 3HI6H 4LGRB 2WBJD 5I73B 3D3VD 2VLKB 5DFVD 4JN2B 4WFFE 1MFEH 3H9YA 4V1DE 2HKFH 1T20A 2Y6SD 5L9DH 4AEFA 3DARA 5JA9A 3TFKD 4GG6F 3WS6C 1HYSC 3GI8L 4XH2A 4TNVK 1P4LB 2BNRD 4CMHB 3GM8A 4NQEE 2H26A 1KCKA 3LN4A 1M7XA 3SDXA 3KDMB 1ONQB 2JJUA 3QDJD 1KIQA 4EI5C 4KZDL 4OZIA 5HYFA 4HJJL 5JOPE 3VG0L 4DZBA 4QY8A 2X10A 2F9BT 1JYVA 4U1SA 3H0TA 2LQRA 1XH3A 3KPLB 4KMLB 1XGPA 3O9WA 4XP4L 1D5BB 3D3VB 3MUGB 1OAYH 3F58H 5CZXC 4ZSOE 1AQDB 4KI5F 1UZ8A 2IWGA 1FAIH 4FXKB 5CJOL 4FMFA 1BMGA 3K81A 1ES0B 3KS0J 5DUBB 3QUXD 2PUQT 5E2JA 1I9EA 1OB1B 2RJMA 3VFGL 3U0PB 1WTGT 1UT9A 4F7PB 1MOEA 1T1XA 2YR3A 2A83B 2E27H 4NQCB 1MIMH 3CXHK 2BSSB 3MUGA 3O6KL 2B4CH 3FFDA 3IFNH 2KH2B 1S9VA 3SOBL 1QOKA 3ULUH 4F8TA 5C08E 4EUPG 4WRLA 1UXWB 2C4FU 1KUMA 1XF3A 4JCLA 4KKAC 4YUEH 1PY4A 2AJXH 3EYVA 5EBGA 4QF1A 2DI8A 1A6PA 3WJJC 1W0WB 1FNLA 5K59F 4XX1E 2UYLA 1AXIB 1C7TA 1TVBB 1YDPB 2ZSVA 4YHNB 5IQ9B 2F54B 4GKZB 1PAMA 4NRYB 3U36B 3N0PB 1C08A 5FKAA 3KJ6H 5DUPH 1AKJD 4O2FB 4LCWA 2ICWB 3ARBC 5F96L 2X4SA 3C6SA 4Z76A 5E9DE 4AIXA 4YDJB 4I3SH 3BZFA 1FLRL 2BERA 3OAZK 4F15C 1D5IL 1I9RL 2YZ8A 2CKBL 3LPWA 5I1IH 3SGEH 4R6UA 5GGSA 1KLUB 4HW6A 4X9GA 4EN3B 1MJ8L 1Z5LB 5E8NA 3PP3K 3PWVB 4MA8H 4LPWA 1TCMA 4FFVD 1JTPA 3EFFB 3WSQL 5TE4L 1V3JA 4NN7B 1U3HC 3QHZH 1CVRA 2R4RH 3M1BA 1C5CH 3TVMB 5E1AB 4JO3L 4NHCL 4D9RE 3U7AA 1F00I 4RDQG 2OR8A 4YR6A 5I18H 5GGRA 4ZS7H 2HLAB 1T2QL 4FQHA 2Q87A 4MNGB 2IQAB 3ARFC 3S96A 4KDTA 4OV5B 1IM9B 4FQIH 4KI5E 3TVMD 1X6LA 2BZDA 4L3EE 5IMKA 3TZVC 3TT3L 2FSEB 4R0LA 4WUKH 1GGIH 1IT9L 3CX2A 4MVBC 4JFOA 3IXAB 4WI4A 1VFAB 4BELD 4ZFZA 3K2UH 4PRHE 1KTDA 5GISH 4YR6B 4JFDE 2QBWA 1XFPA 2R0LL 3ZKSD 1C7SA 1P7QA 3MV8A 4YEFA 1LE5A 3MLUH 2OQJA 4KXZH 1ZHKA 1WWCA 2R2EA 3GJFB 4Y8AA 5HPMA 3RNQA 2GK2A 5DMKB 4JFYB 1VDGA 4AQ1B 1XR8A 3IGAA 1YEHL 4Z78A 1I9JL 3JTSB 3LEYL 2FX9L 4JGJA 1AI1H 1KEML 2EYSB 3C5SA 3CCHB 1F3DH 1NBZB 1YEFH 3VFNB 4DGYL 4XCCL 3LKNB 4HKXA 5D9SB 5ADPH 3MROA 3RJDA 1RULL 3VWJA 1S3KL 5DFWH 1ZHLA 5D1XC 4PJGF 4ZUSB 4EXKA 2R2EB 5LKNA 3GIZL 3O9WC 3MZTA 4M6MH 4GW4B 4J8RB 3BRDA 4POUB 1MQ8A 5F7LB 1EJOH 1JFQL 1X6NA 4LLVA 3C5SB 1T89A 4F2MB 1NAKH 4QXGL 4ZAKB 2HMIC 5AWNH 1ODAA 1JWMB 2VXTL 5CAYB 1QBBA 3QUML 1I4FA 1IGIH 2IG2H 5C0AB 4WDIB 3UX9B 1HSAA 2IQ9H 3RY5A 2K7PA 1INQA 3S4SG 3I02B 1J0HA 3E2HB 4I2XE 2XN9A 4N0YH 4MAYC 2AI0H 2OK0H 3JWNC 2VH5H 2A9ML 4N0RA 4OLZL 5T1LA 4OZHB 1I9IH 4WU7B 4RDQF 4GAGL 1NDGB 4EXPX 4WHYG 2PW1A 4X6EB 4X5LA 4H1LH 5HDBE 1AGFA 3HHRB 5ERWB 3U4EA 5IF0B 2YUZA 4IIQA 1JNLH 4YE4L 4GAYB 3RGHA 5C92A 1BQLL 2F19H 4HHAA 5DHVH 4P5TD 5F44A 1RJCA 3T4YA 4U2ZA 4HUKB 2Y7QA 1T83C 5F9JB 3FQRA 3OZ9H 4NT6B 3HR6A 4F9LA 4HK0A 2GITA 4DZ8B 2NY5L 3RTQB 5F3BB 3LDBC 2H8PA 3BHBA 3RGVC 4Z0XA 3TESA 1Y6KR 3HE7A 1M7DA 3D85B 1FG9C 6FABL 4RFNC 1VESA 2FJGB 3MV7B 3P9WB 4XAKE 5D1ZC 1N3NA 1PKQB 4XPAL 2FD6L 3OKLA 2VIRB 1ZLUH 4M7KL 2DI9A 1DQLH 3GMNA 4Y1AD 3BW9A 3WXWH 1YPZB 2H6PA 3K0WA 3VXPA 2LE9A 1UEYA 5T5FH 4WENB 4BZYA 1I8IB 4LLQB 4L1HA 4ZPTA 1MHEA 3QIWB 4KFZC 5J9PB 3VXQB 5I1JH 1N6UA 2EEAA 3QP3A 1HINL 3GSQB 5L8LB 3HFML 5ICXA 5BW7C 2AVGA 1J1OL 1JWSA 3BVNA 5FCSH 1MAJA 4CN6A 1CZ8H 2OTPA 4L8CA 1B4RA 3SDCC 4IOIA 2AGJH 3WHE0 4U6YB 1UH4A 2X6MA 2D4DA 5K9KB 4LLMB 5FUCC 5LCVH 5IV2A 4XMPH 4G42A 5MERB 5JZ7D 5KN5A 5KZCD 2YD1A 3L5IA 4MXQC 3HE6A 4HH8A 2Z8WC 2V9QA 3RU8H 3OKEA 1MELA 5TPWL 1SJEA 4XMLH 1F6AB 5JMRA 5TFSH 5C09E 3SDCA 4L8CB 5DFTA 4P3CL 1NCNA 4C55A 5IMOB 1KB5H 1T4KB 1NMAL 3MRNA 4PJIF 1BFOB 3PHQA 1OF2A 3B83A 2GTZA 3CMOL 4M93C 5JPNB 5BZWA 2DLTA 1HQRB 4NO2A 4JG1L 4NWTL 2D0GA 1HH9B 3QIUA 5L6YL 5E8NB 4JLRB 4AY0A 5GGVY 2QV2A 1MCBA 4L4VB 3VE0A 1FRGH 1P4LA 1OTTD 3QUXB 5A40E 5BVPL 3CXDL 3B9DA 4MS8C 2XZCH 4M6OH 1YECH 3KDMA 5D71H 5C0ND 5F6IC 2RCSL 4PGEB 4AT6B 1H8SA 3QUMB 1A7PH 5IMMA 4JANA 4P2RB 4Z77A 3Q3GB 2P5WB 4FQHB 1XGRB 1JGLL 5IEHA 3QDAA 4LSQL 5D7IE 4JFZH 1R3IL 4UB0H 4KTEH 3MLWL 1MLBA 2AXJA 4ZXBD 3WFCH 4FXLA 3PQYA 3CUPA 5DJCA 4Y0GA 4PJHB 3ES6A 1U8IB 1WSST 2DD8L 4HC1L 1EHXA 3BP7B 2OZ4L 5LXGH 1R6VA 5A2LH 4LRIA 2OJZH 3HMWH 1ZXQA 4UIMB 2ZNXA 1MVFA 1JGUL 4IRJB 1UB6A 1ZA6A 5DHVB 3TN0A 1YN7B 1AC6A 3W39A 2IH3B 3K1KC 1S9YA 4YIQA 2OI9B 4Z78B 4R4ND 1AIFB 4ZUTB 3W9EA 5EO0B 5GGQL 1WZMA 4XWGH 3FTGA 2AEPH 5FO8B 4XWOC 2ZG2A 2VC2L 1A7OH 5KAQG 3JV6A 2HYMA 4EEEA 4Z6AT 1N2RB 4OLYH 5SV4A 1DCLA 1T83A 5F70A 3JV0A 3QEQE 4QXUL 2Q3AA 4F9PA 1N6VA 3W9DB 1LE9B 4PJ5D 3VFGH 2AEQL 4HJJH 4N0UB 2V5RA 4LCWB 3B9VA 4CN4A 5IHUL 1FL3A 5CZKA 1NGQH 4HLZH 4M62L 1CF8L 2Y25A 1V7NL 1I8MA 2Z0BA 5C09D 1G9EA 5EO0A 4LU5H 5D1ZA 4LHUD 1KPUA 4ZOBA 5DZLA 1KB9J 1K4DA 3PUCA 4OBSA 3RBGA 5E0QA 3ORJA 5HGAB 1CDHA 4WFHE 1HWHB 1QZ1A 4XP1L 1JYWA 3L3GA 4HPYH 3H3BC 4ODSH 3DYPA 1KIUA 1XF5B 5BRZE 1CXHA 1OB1A 2Q86A 3BPCA 3TPUB 3VFRB 4WHTB 4YNYB 3B4NA 2IPUG 3BP6A 3QUZA 5HHOD 1EHLH 4OJFH 5CD3B 1BFVH 2B1AL 1S7VA 5IMLA 2C9AA 4EI5A 3OXSA 4LCYA 1HXMA 4I18A 5D1QB 1G9MH 3O45A 1BD2B 4LSPH 3SKMA 4F3FA 3O6MH 2EDLA 4M6NH 5IWLA 1S8DB 3MOBL 3D69A 4KJPD 1QNZH 1QR1A 1ZGLA 3TO2A 4HUUB 1P1ZA 3MLYL 4ISVB 1B0RA 4D0BA 2I07A 1M4KA 2OP4L 3VG9C 1GL4B 4F7EB 3C5JB 4D3CH 2EDEA 2BNRB 4AEHL 4WI2A 4O4YH 3QIBC 3F8UB 1S8DA 1Q8MA 2FBOJ 1FYTE 5K9JH 5E8OA 3W5NA 1OARH 3NN8A 2GJZA 3HR5B 1ITCA 1FVEA 3C6LB 3FOMA 4XNZB 5IFAH 3G5VB 2CLRB 4MD4A 4X6CF 5B4MD 1NDMB 2MPAL 1KIRA 3RWGA 1NFDB 3B2UD 4KKCD 5KANI 4QNPE 5JQ6L 4YXHH 1A0QH 3P4OA 5E1AA 4Z7OF 2CDEB 4V1DD 2B1AH 2GIYA 2FJHA 3WIHA 3HMXA 3IDUA 4DUWA 3GMLA 4OD3H 2AJSL 4HPYL 3D3VA 1U91A 4WGWB 5J89A 3DIFB 4W6YB 4KU1A 3MV11 1M71A 5CMAB 4JZOA 5DF0A 4NYLA 2WQRA 4UBDD 3QULA 5JTWA 3V6OA 4JFFB 2FEDD 1MY7A 1KIQB 1QSEA 5C0BA 3U7YL 1W72H 2BOCB 3U0WH 2CDEA 3QIWD 1FG2A 3PGCA 4O51B 4P46D 2DBLH 3DMMB 3BP4B 4WO4A 4HF5H 5C9JB 2DQFB 5ISZD 1FNAA 2BHUA 3GSVA 5DWUH 4N9OB 1BIHA 1I7RB 1CK0L 5CP3H 1QKZH 5A43C 4UUJB 3RKPA 1YYLH 2HH0H 4NZDA 4JRXE 2GT9B 3B9KC 5D2NC 5TF0A 4HIJA 1FZKA 5INDB 2GY5A 1S7SA 5AZEH 4YAQB 3S35H 4L5FH 1HWGB 2BC4A 1N6QL 5I19H 1QEWB 1FN4A 5IB5A 3MX0A 2VERN 2XOTA 3DNKA 4K55A 3W0WA 2YEZB 1TVBA 1YDPA 2Q8BH 3FMGH 4KJWD 2VLJD 3AM8A 5C71A 2RQ8A 3Q1SH 1MH5A 2QL1A 2F15A 3QNYB 3SBWA 2I9LB 3LH2H 4AIZA 3S3SA 5A3IC 3P4NB 3AY4C 3CDGA 4M1CC 1ACZA 4DUVA 5JOFB 3ULVE 4QXTB 4YK4C 3PWPB 4LKXB 3MCKB 5T5NF 1B6DA 2Z35A 2UWEB 5DDHA 1P5UA 5IB5B 5EZLB 1IBGL 4K2UL 1U8HA 1F90L 1CI5A 4LIQL 1LQSR 4OM0H 3K4AA 1FLTX 2D7TL 5EO1A 5FHAH 4DFHA 4O2FA 3E1F1 1JNHA 2VSDA 2NY1D 5IEKA 1A22B 4ONHA 2A6DA 3GUTB 1OAQL 3O3BA 4LNRB 5B8CA 4OZGE 2ARJQ 5L8KB 1YQ2A 3MRRA 3GRWA 5LG1A 3FOLA 1QKZL 3QR2A 3PWPE 4WFGD 3UBXI 3QQNA 1JFQH 3OB0H 3WHE1 3NPZB 4LK4A 1NMCC 1H9VA 3BMVA 2PYED 3EKCA 4JPIB 4R97C 1LDPL 1R3HA 3EFFA 3QWRD 4L5FL 4LSDA 4R2GB 2VXTH 3C2AL 3JV4A 2CH8A 3VFSA 4R96A 1Q9WB 3KJ6L 3MRFA 3QPQC 2GJ6B 4IM8A 4L4TD 4PGCA 5DURD 4FTVE 1VACB 1KFAH 1MPAH 5SWQA 1CK0H 2EDWA 2XQYG 1T0NA 3HG1A 2KZWA 2X4QA 1UJ3A 3OG6B 1MAKA 3QDMD 4PRBB 1QLRB 1DVFD 4G6JH 2MHAB 3T04D 1FL5B 3STZB 4I9WD 3BH8A 4KQ3H 4KZEL 3FB6A 5EU7C 1LK2A 4BQCA 1RFDL 4BUGA 3T3PF 5ESVA 3GSNB 4EDXA 4EKXA 4Z5RA 3VFTA 4QRPE 1I8IA 4RGND 3WE6B 2EKSB 3MJ8B 3RVWD 4JO3H 4NHCH 3O4OB 3WJLC 3PIQA 5GHWH 4JRYA 3O6LH 4LCCB 3MLVH 1FVCA 3RWFB 2NY1C 5FHBL 3DGGA 4FXGA 2WUCH 2CGRL 2HJFB 3IKCB 2IALB 2CJUH 1A2YA 3SN6N 5I1EH 4DUXA 3MGOB 3I3DA 3TBSB 3F12A 2WW8A 4P9HH 4Z7UB 2K1MA 3GSNA 4EDXB 4EQ3A 2ADJB 4WEBH 5F9AC 4YDVA 5FEBA 4LEXL 5C0EA 4F33B 5CSBA 2G5BB 4F9PC 1NFDE 4K3JL 5ID1A 2DAVA 2ZCKH 4Q9BA 4NKDA 4XNQA 1Q72H 4G43A 2B20A 1TNNA 1CDYA 1T21A 4X0KB 3OKMB 1ZA3A 4LSQH 2B2XL 5ITFA 2HTLD 1MHCA 2IAMC 5EC2A 1A7RL 5JXAL 3OF6A 3PWNB 5D71L 5FA3A 2EDFA 2O5YL 4G9DB 5FECA 1CGSH 1H3UA 5K9QG 3BWAB 4PJBB 1KTLA 3DRTA 4G6AC 4N8PA 4APQC 1DLHA 5IB4A 4JM2C 1IKFL 3U0PA 1DDHB 4MJIB 3VWKB 2X70B 1ZANL 3V4UL 3O4LA 5D7KD 2F74A 1XGQB 4XT1C 1S9VB 1EO7A 2JCCA 4L8DA 1IQWH 2R29H 5DJ0B 5JW4Q 5GGQH 3OJVC 2CKNA 3BUTA 3GSUB 3SJVB 2HG5A 1BOGB 1FFOA 2FJFB 2GITB 3T2QA 1W0VA 1GOFA 3VXRE 4UAOC 1DDHA 1Z0NA 2YZ1A 3UTZA 4RNRB 3V6FB 1X5FA 4OF0A 3WLBA 4XNYL 1M7DB 5JQHC 4DEPB 4L3CA 2OL3B 1G7PB 4PGDA 3WMSA 2EE3A 4IS6B 1N8ZA 1S5IL 1ES0A 3O2DH 3SKMB 3BW9B 1MFBH 2VC2H 4I48A 1MCWW 2E7MA 1KG0B 4CRPA 2CRIA 1L0YA 3TH3T 4Y5YB 3WEXB 4JQXA 1WFUA 1CGSL 4Y7MA 3S37X 5JW5A 4YDLB 1RZ8B 2F53B 4LSRL 4DN3H 3HRPA 4FTVB 1T1WA 4XH2B 5IIEB 1D5XB 3KAAA 3WNKA 3ARVA 4ELMA 5E6IC 3QEQB 2F58L 5DEFA 5GRVK 1QFWH 4MWFB 4YGVB 1YJDC 2Z35B 1FYTD 4PJEE 4Y5VB 4RWYH 3HS0A 2XTJC 4HUWB 1HQRA 4NO2B 4Z18A 1UM4L 4FP8L 3V79C 3CX5J 1KN4H 4G7VL 4UOW1 4Y19E 2VXSH 2D7OA 4UBDC 5DEFB 4M00A 4XCNA 4TVPD 1LD9B 4MSWB 3VXME 4L8SA 2GTZB 4S10A 1NGPL 5D7IF 5ANMA 3OGOE 4HUWA 1RVFH 4LU5L 1XGRA 3B43A 3EHBD 2D0HA 3GKWL 1RUQH 3P11H 2NY7H 4YPGB 4XP1H 4G9FD 2WWMD 3LKSB 2O26U 4I0PD 1B3JA 1F4HA 2FB4H 1XIWA 1D6VH 1G6RH 5ISZE 1IAKB 1CXKA 4KJQD 5F9DC 2D9QB 4IRJD 1T5WA 4LHUB 1KB5L 3WUWB 3RGVA 5SWZB 1LILA 3MRQB 4U6HB 3HC3L 5FGCE 5A16B 1QBMH 1HQ4B 4EJ1C 3MRPB 1OLZA 3LY6A 3KPRE 4PJXA 5IFHH 3GRWL 5DI8A 2W65B 4JRXB 4XXCC 3GK8L 1VFUA 5C07E 1UJ3C 3PWJA 3GHBH 3WFEH 3JUZA 2FATL 4UV7H 4OZGA 1AGEB 4XMKL 1LNUB 1NGWA 3GEWB 1REIA 4QTHB 3JWDH 4OQTL 4FABH 3B2VH 3NCFB 2E27L 3X14A 5J12B 2WSKA 2G2RB 4Z7NE 4DWHA 1X7QB 4J3UA 1WWBX 3WS3A 2L4OA 3JSSA 2DOCA 2WM0A 1HHHB 2C3XA 1U8KA 2Q7YA 4L3EA 1IZJA 1OGAA 1JK8B 5IHLB 5FUZL 3T8XA 3PWPA 2X4TA 4JO2L 1X44A 3SDAB 5JLZA 2XWTB 5D1ZB 2Y07H 1U95A 1WCBA 4N1HB 3MROB 2PW1B 4CVUA 3SKJL 1F4XL 1A7QL 1FIEA 1KN2L 5GRWA 3DETC 3O6FC 3L3GB 5J57B 2AJZA 1RUAL 3DGCR 1FCCA 4G5ZH 2YK1H 1A6WL 2WIIB 3EZ8A 3D48R 4ODVH 3G08A 3OR7B 3ILPA 1BBJA 1P7QD 1J0ZA 1MCPH 4LNRA 3W5MA 3EOBB 2CLZA 4ALAH 1KPRB 4U1NA 4Y5XB 4GLRI 3QNZA 3JV5A 3A6OA 1IARB 5JXED 1CTNA 1KTRL 5J1TC 4HKBB 3KPNA 3BN3B 2M1KA 5DMYA 5KS9A 4HK3J 3J7HA 2Z9TA 4ZFOL 2CR6A 1OW0C 3FB7B 1IBGH 1X5IA 5D96B 3IAQA 3QHZL 4U33A 5D2LB 4D8PA 3LEVH 1NMBH 1YMMA 5E03A 4PJ8D 4XP5H 4UTAH 1WBZA 4OLEA 4PLKD 4X6EA 2DLFL 1U8PA 1MCCA 3HUJA 4YHLH 4LASH 4PREB 5KVGL 1LK2B 3V52L 1QSZA 3BOVA 1FFOB 1FBIL 2FJFA 3FKUS 1QR1B 1MJJA 1F4XH 4OZHE 4U0QB 3OSKA 4JY5L 4O2CA 2R0WH 3MQIA 3SKNA 3QQ3A 4PJ8B 2H8PB 1JHLH 3PIQB 1MFCL 4PTTB 5E2VL 5EO1B 3U79A 1T0MB 2VQ1B 1NDMA 2BNQA 3QO0A 3UYPA 3ZMRA 2ICES 1OAUH 3H42L 4CDHA 4HXAH 4JFHE 4DKFL 1HINH 4UIKL 4XAWH 3TIEB 4NM8H 4JO2H 2NNAA 4OSUH 4K3DL 5MEND 4LSUL 3ULVF 2ID5A 1OF2B 1BQHB 4QT5A 1N5AA 2XZQH 2ZSVB 3BGMA 2CLVA 1YN6B 3MFGB 2GCYB 1NGYA 2XI9A 3V8OA 1NAMB 1FYHB 1FYTB 1PW3A 4HAFA 2ERJC 1N0XH 4L4VA 2V5MA 4G6FB 1ETZA 4J4PC 3S3PA 4J12A 1E4JA 4ZFFB 1KFAL 3BGAA 1QLFB 4N5EC 4RX4D 4JQXC 3QB7C 4TVPH 2NNAB 2C3VA 3ZO0A 2B1HH 3CFIC 2A2QT 4Q9QH 1GGTA 1P53A 3TZVD 4FHBD 3ULUD 3QEUA 2NZ9C 4QHMA 1VPOH 1HH6B 3DBXA 2V17L 2C1OB 4ODHL 3I50H 4Y2DA 3BI9X 5J11B 4LVOC 4AENB 2LTQB 2NR6D 3VRJA 3UJTL 4JFPA 1ONQA 3LZFH 5F9OH 3TVMC 1NMBL 1S7SB 5T1KA 1E27A 3HC4H 2M26A 4M7LL 3RWJB 4H0IA 3RL1B 4P46B 2AQ1A 5D93C 2HKFL 1KBGL 4MQTB 4WO4D 4GAGH 2ZZUT 5AUMB 4M61A 4LCWD 1G6VK 5E5RB 4U3HA 4LMQE 3KYOA 5BRZB 5AG9A 1WGOA 4MQXC 4CVXA 1QACA 1MF2H 1TFHA 3WNOA 4RAUB 2GSIA 2XFXA 3BJLA 3TV3H 5EIIB 4NQCA 2G5BA 3PP3H 4N8CH 1QSFE 1TTUA 4K71C 1Q72L 3IS0X 1YA5A 1U8JB 4DAGH 5D6DC 4ETQA 3UTPD 2XXMB 2JF1A 1XGUA 4BH7B 4XNQB 4E42A 2YPLD 2VLJA 2HH0L 3PABA 5JW3H 3P0VH 4CVXB 1S7WA 2EDRA 4AL8L 1M05B 5BVJA 1RZKL 4LIQE 3DYMA 4Z7VE 3V2AR 1OP5H 4QEGA 1EZVY 1KG0A 4BH8A 1S7RA 5HI3C 3T08A 4PV9B 1QVOA 1R5WB 1KC5L 2V2XB 3V95A 5IIEA 1BM3L 1DVFA 1Y6MR 5FGRA 4LVHB 5BO1L 4HGMA 2IGFL 4QCIA 4CBPA 3DTXB 4OT1H 5JORB 4NQTA 1QR4A 1VA9A 4NRXA 4FQJL 3QUZC 1K9TA 5JO5A 2J3SA 1P84K 3G5XA 2LAGB 2F5AL 5I1LB 1WAAF 1KB9K 2IFFL 2R9HD 4ERSH 1XT5A 3OKNB 4I18C 4BFEA 4PJHE 1T22B 4POZC 1DQJB 1OLLA 1KGCD 1F5WA 1KPRA 1BVKA 2XA8L 3BUYA 5D7IB 3WE6A 5D6CB 5C0RH 1JGEB 2DL2A 3B3IA 2QJDA 5C0CE 3SQBA 3HN3A 3ARFD 4FQ2L 3S35X 5DMGC 1AXSA 3SDAC 2MHAA 5JW3L 4M7LT 4R3SA 5KSUB 5L2KA 3G04B 1MJ8H 1TDQA 3GB7B 3UJIL 5AYUL 5EU3B 1H8NA 4L4VE 1I1AA 4NNXB 1PG7L 2VXVH 3ULVH 1K8DA 3MLZL 4JM2F 3SHSA 3CFJB 2QLVB 5HYQA 2YXMA 4W68A 4I3GA 1U8MB 5IVZB 2HFGL 1B4JL 3WKMH 3CFDA 2C1PB 2F58H 1D5XA 2MCPL 3V5KB 3GSWA 2X89A 4Y4FB 1QYGH 4OUUB 1GGCL 5I1CH 1DBMH 2R2HB 4LDOB 3WFHB 3VD7A 1Q94B 2ADGA 3BE1H 2JLLA 2BVYA 5F8QC 1MHEB 1KACB 4R4FH 5I1DB 4KHXH 3VGBA 1H3PH 4HJ0D 4PTTA 3EBAA 3E6HA 2VN7A 3B9KD 4TPRH 4ZUSA 1OQOA 3TNNA 4JFFA 1OVZA 5FAAA 2JIXD 3N50A 5HVHB 5DRXA 1J0KA 4JFEA 2CGRH 3DXAD 1R5IB 1JK8A 1F58H 3MMEA 3MODH 1RZIB 2X1OA 4Q0XL 4NPYA 5I6XB 3CD4A 1FIGH 3U82B 1NAMA 1YMME 1N0LA 3OKEB 5FDWA 4OLYL 4NZJA 2IC2A 1XMWA 5C08D 4L8DB 1A6UH 4XVTL 2C7UA 5IESH 1DEEB 1GIGH 1HSBB 2XWJB 3O8XB 2VDRH 4J6RH 1TJIL 1MSPA 4D0DB 1J8HA 1C16B 4ZYKA 4HQQH 1BGXH 3D0VA 5CBAA 2X70A 3KLDA 1YNKL 1UJTA 1DN0A 2IMNA 4I4WB 4ONFL 2K3TA 3TEUA 3HNSL 1KJ2L 2XN9E 4NC0B 3T0XA 1L9MA 3PNWB 2BY1A 4JKLA 4B0MM 4AENA 4IMLB 4MD0B 1RVFL 1BIIA 2BCKB 4X80L 4DOHE 1BOGA 4PJFB 2YD6A 5H35B 5D7JA 4RSVA 1P4IH 2MQCA 2FWOB 4QXUH 2AXGB 3IDXH 1OTUC 2WBWB 1WC7B 4YHIB 3QDME 1FAKT 1IAOB 1QYGL 4V1DA 1EVTC 4I0PB 4WCYH 5TE4H 3MLPA 3TGXA 1CGTA 3ZDZE 4KRPB 5FYLD 2Q20A 1ITBB 1E4WL 2VKWA 2J8HA 1JPTL 1G9ML 4L3EB 3WIFB 3QI9B 2D31A 5IJVA 3SCMD 4MXWL 3W11D 4GJTB 2AJYH 3I2CH 1H3PL 3KPQB 3DX8A 5ADOL 5CSGA 1CL7I 3L95B 5BZDA 1DANT 3VA2C 5IVXB 3RRQA 1IC4H 3LHPH 3IU3B 4MLSA 3SE9L 4ODVL 5DTFB 1MCHA 1KLGA 3SDCD 1K6QL 2EYRA 3MYJB 3T2PA 5DMIH 2VOTA 5AYQA 3WIFA 4K8RC 3ARGA 5IJVB 4KK9C 3D18A 5T5NG 5C0JB 1X4XA 1XZ0B 3GSVB 4QYOA 1INEH 5CJXC 5L7XL 2XG5A 4RA3A 4ELME 3PWVA 4KK6C 4V2CB 1PG7X 1FFQA 1LEIA 2FO4A 4Y5YC 1QNZL 2FNBA 3FO9A 1PZUB 1CFSB 1RUAH 5ESVB 1GCFA 4M4RA 4ZS6D 1X5JA 4JY6B 2EC9U 1QEWA 4E41D 1T3FA 3H7LA 5FUOH 1PQZB 4HPOL 2CKBB 3FQWB 4H88H 5KSBB 2VLRA 5TE7L 2W91A 4HEPG 3UTSB 2YKLH 4J3VA 1Z2KA 1DSFL 1VADA 1AP2A 2VDML 5DD3H 4P59L 5FGBA 3HB3D 3S8WA 3WIIH 3OJDB 4O2EB 3U83A 2GJ6A 4IIQC 2H41A 1SBSL 4JY6A 2VLLB 3KPTA 4MNGE 1HILA 1FV1B 32C2B 3BZEB 4OAWA 1U2HA 4NQCE 4DCQB 1OWWA 1KJVB 4IRSD 4YFLF 5TJWK 2R23A 4DGVL 1A0QL 2ICCA 1UA6L 3F58L 5DHYA 3WS6A 4ODTH 4M1DH 1CLZL 5IR1A 5K9QI 2PXYC 5F7UA 2FO1A 4U3XA 3WS3B 1NCWL 1RUML 3OJDA 4YHYB 2D3VA 2AW2A 4HMEA 4J8RA 3O3BB 5B8CB 3RL2A 3NFSH 1BQHA 5ECJE 3FFCE 5B38G 1H5BB 3OTTA 2X4TB 1KXQE 3SDAA 2MFNA 4QTHA 2VLKD 4U6VH 3D3VE 1YEDB 3SGDH 3NIGE 2Q8AH 2FBJH 3NZ8B 4FXGB 4NO5A 4X4ZA 2BNRA 3QDMB 1NC2A 4JM4H 1WIOA 1PD6A 3QJFB 3WFHA 1OGAB 1YY8A 3DO7B 2QR0B 5MEOA 1ZTXH 3HZMA 4MDJB 5LGJA 2XPGA 3SJVD 2LU4A 4K9EC 2VZSA 1LEGA 4HGWA 4MQ7A 4Q6IC 3S5LB 3UJTH 2HJKA 5DRNB 4ELMF 3NA9H 5E2TL 3R0MA 5GS2D 3QZWG 3TNMA 5FV2A 3SE3A 2XN9B 3T4AA 3BPOC 2HG5B 3DUUB 4F7MB 4YDKH 4U7KA 3DLQR 1QPXA 4L29B 2VLKA 3CDCA 4BFIB 2AJVL 5FFLA 3IDIB 3L9RA 1JNNL 4NQSB 5AAMA 2AJUH 1UA6H 5FYJL 4HH9A 2Y07L 3C60B 4HGKC 1MJ7L 5I1LA 2HRPL 3S4SB 4ZFGH 4MZ3A 1IAIH 4CVZB 1UXSA 4PJGB 2OTUB 5F71A 3HNVH 5HDQL 3X13A 2A6KA 5FKPA 4GRLB 4KJWC 1FG2B 3PGCB 4O51A 1NKRA 5FO9A 3TZVA 4DVBA 3CSYA 3LD8B 3BUYB 5D7IA 1NUDA 2FBJL 5D70L 5DVKA 1FNSH 4YC2C 4F58H 1FZOA 2COQA 5KSAB 3JTTA 2HVKA 2WBJB 3D85A 1QSED 2R0LH 2Q6WA 2BFVH 1XF4A 1ZHBB 2VKXA 1U92A 4CGTA 2DKUA 3NCMA 4WJ5A 4LLYA 2EDXA 1KCVH 3U6RA 2YA0A 3BD4A 3IDNB 3ETBF 3VD5A 3EAKA 1I9JH 1FC1A 1MCJA 4PJEA 1A6AB 3L7FB 4OTXH 4QRRB 2GTWA 1R24B 3H9HB 5ADPL 3SQOH 5F9WB 3V7AE 3C2AH 3WFDH 4EI6A 3C09C 3DI3B 1RIVH 1BVLA 4Z7WF 3QI9D 5C0BD 3DVNB 1ED3A 4Q9CA 2HFEB 4K7PY 4JFEE 3CC5A 1P2CB 1N8ZB 1YMHA 1OM3L 3BYYA 1DLHB 4DTGH 1L7IL 3OX8A 3B9KB 3ZDXE 1CGVA 4QHKJ 4U1HB 5E08H 1IGFH 4P2OC 5DD1L 4KROC 1LK3L 4JFZL 1SJXA 5ALBL 4N90D 5IWLC 4JY5H 1UWGH 4GMSH 4Z0BH 5EU4B 4WV1B 1A14H 3D6GA 5JW5B 2I9TB 4Y2DB 3IJHB 3T2NH 3HZYA 3QUYB 2VAAA 3OZ9L 5CZXD 2YPLA 5DA0B 1ED3B 3OB0K 4Z76B 4MA3A 3D39E 4GQPH 1KN4L 4G7VH 1NJ9B 3MRRB 4N0CC 4OZHF 3KPMA 3KYNB 1FL6B 1HOCB 4YK4B 5HYJA 4UDUB 3CZFB 5HGHA 3VCLB 4P3DB 5F3HA 5ISZA 4Z7UF 4Y5VA 4L9DA 2MCPH 2P24A 4H0HB 1KLUA 4XC3L 3TWCL 1EFQA 4L4TA 1CQYA 5E6ZA 3KXFB 1QA9A 4R2GD 4NYLB 5BS0E 3O2DA 5I19L 2IG2L 4P5KA 5DR5H 1JNLL 4YE4H 4CJ1A 2E7HA 3O3DB 2Z93B 1XF3B 1TXKA 1E27B 1CFTA 1C16A 2VXUL 2E9IA 4WEUD 1HEZB 1X5YA 4UDUA 5D9SA 4JAMB 3AU1A 4XP9H 1OAXL 3F7RA 2Y06H 1A1OB 3SKUD 3MREB 5IHUH 4DTGL 4D9LL 1RUKH 12E8L 5J1SC 3RDTD 5FF6A 4J3OC 4GW4A 4CADB 3WFZA 4KKAD 2HRLA 4Q6IA 3DMMC 4LL9A 4UV4L 4Z7VB 3S9DB 3UPRA 3DV6A 4R7NA 1T5WB 2IAMA 1OD7A 3MLRL 1WCQA 4HIXL 5B39B 4AQOA 3CPLB 2MWCA 4OCMC 4LHUG 4WI3A 4XZUA 4WO4C 4GG6A 2VDPH 5FYKE 5DWUL 4UT6L 5SWSD 3L3IB 3FB8B 5EOCH 3FT4B 4FABL 2FDBP 3HFMH 2VLJB 1JPFA 4ZUUB 4X99A 3JTSA 3W9EB 5KSAC 3MXVH 2RFXA 4ONFH 5L0QC 3T0EC 5BXFB 4QGYA 4RISL 1T2JA 3HPLA 2YD5A 5DQ9A 3ALPA 2P45B 4ODXB 4PLJC 5J1AB 5CLWA 4KK9D 5FA4A 4PPTA 1LDPH 1HXYA 4FQCH 4C83B 3BE1L 3ESVF 3S37H 4XNXH 4HKBA 3RNKB 5KOVC 1JTTA 5FO7B 4OZIE 2R4RL 2ATKA 1HSBA 4XNZC 3T4YB 2VDQH 3KLSA 3ESUF 5C7XL 4YH6A 3VFVB 5GSRB 4JKKA 4X99B 5ETUA 3TT1L 4IOFC 2Z31D 3C8KB 1NCUA 5T1LD 2JE8A 1RHFA 4I1NB 4MD5B 4ESKA 3LN5B 3AGVA 2YD7A 3MV7A 5T3XL 4QTIL 3N1FC 3GJFA 1WISA 2BXYA 15C8L 4FP8H 4F80A 4R96B 4F3FB 4KKLD 3ARDC 5F8RC 4TSAL 1WUNT 4NWUL 4R4NC 5D5MF 3IFPA 43CAA 4PLJD 3QUZD 2Z4QB 1DFBH 1YNTB 1U41A 2UY7A 1EEQA 5F7DB 3VMPA 2BSED 5DQDL 3WKNA 2OL3L 4KY1H 3EOTL 3BPNC 1UJ3B 3IDGB 4GAYA 4NWTH 3VXUB 1R3IH 3FQXB 5IVOA 3LMJH 1JCKA 4QGTA 1GXEA 3TJHC 4NO3B 5BVPH 2DYPA 4K94C 3SPVB 3GMRA 3PL6C 5KN5B 3D39D 3P3YA 3L3HB 3L95A 4HUVB 2QQKL 1K2DA 3SGJC 1CGYA 4RBPH 1DLFL 1OGTB 2W0KA 1B2WL 1JMXA 2PXYB 3HC0B 5HYJE 4Y4FA 3P9LB 5DRWB 3MPCA 3G6JE 3PXJA 2IALA 2KBGA 4I2XA 4EDWH 3MJ7B 4PBWD 5F96H 5DHXB 5JDJA 1CDGA 4NKIH 2ZNWA 4OLWH 1IEBA 1MVUA 3O4LD 3KPLA 1XH3B 3GK8H 3S37L 1ZWIB 4OLVL 4OIIH 4TOYL 4G7YH 3N85L 1K2DB 1HH6A 1RZKC 2VDMH 3AY4A 4LRNL 1ACYL 2YMXH 1EBAA 5MENB 1RZGB 4JHWH 1A9EA 4NCC2 2QADD 1AXTL 1NBYB 1MLCA 5HY9B 4BSVB 1G7MB 3OX8B 1HCFX 3QJFA 3S88L 3V4UH 5JDSB 3L3JB 3K4ZA 1NBQA 2UWEF 3C08H 5I16B 5D2LE 1CBVL 1JVKA 1AR1C 5ITFB 3PWLB 2A83A 1ZWIA 3BP5B 1LO2H 3QSKB 4TUKL 5DGRA 5M94B 2IANE 3DXAB 4I0PC 4ZO6A 2IPTL 1DSFH 4WNQB 4OCWL 4BZ2L 4L9LA 4J23A 3HZYB 3QUYA 3QWQB 3OGCA 2YPKB 1EERB 1JI2A 2FECI 3IETA 2VQUA 3H9SD 1SM3L 1RK1A 4L29A 3ZT7A 4PRID 1FFNA 2XWBA 4LP4A 1Q0XL 4LLQA 4XCEB 5DJAB 4KXZI 4D3CL 4NJAH 3MODL 5AD0A 3IJYA 4GW5B 1ERNA 3IDJA 1CT8B 4M9OA 1YNLH 4I0KA 2FIKB 4EDWL 3EOAB 4X6CB 2OYPA 1S9YB 4YIQB 1WJ3A 4OD2A 3HG1E 4I77L 4ZD3L 2WV3A 4C56B 5I1AA 3IXAA 4XBEL 1WZ1H 4UINL 2XWBB 4LDLB 4A6YL 3O8XC 3UTTB 2HWZL 3ZKMC 4P46A 4XVUC 1S9WA 1EDQA 2JB6B 4PRNA 3QI9C 3LV3A 1Z9OA 3QIWC 5JHDE 4POZD 1YEGL 3ARDB 2EYTB 1RULH 1MRDL 4KRPC 2AK4B 2BMKB 3MNZB 2I9LA 3S98A 4CADA 4MAYA 1NFIB 4G8FB 4UILL 3MRKB 1ZEAL 3BN9D 4KUCF 5CD5D 4FFYH 3VFNA 3QAZC 4ZPVA 4M6ML 3DX8B 4WTZA 4E41A 5JO5B 2HMID 3AREA 4RRPA 4LPCA 4GH7B 4Q58C 1L7TL 5AWNL 2DLHA 4JLRA 1HHJB 1WWAX 5FKAB 2V7NA 4XNMB 3SKOB 1X5GA 3L5WA 5IEKB 2P5EA 4NDMB 4GXUN 3EO0A 2YBRB 4HWBL 1BM3H 4JHAH 4ZFZB 3L9RB 5BJTA 5GHWL 4PBVC 2RB8A 5FA4B 1CFVL 3L3KB 3UC0H 2V2WA 3BPNB 2Q76B 1UCTA 1SYSB 2BSTB 1ZHKB 1H3XA 2R8SH 3VFMB 5KVGH 1BD2A 3IJHA 4KVCL 3QO1A 4PJDE 4P5TC 3GI8H 5M95B 1WBXB 2W60B 2F8VA 1T7WA 2IADA 3EJYD 1CG9B 5T1LB 3IB4A 2IBGA 2VB5A 3O6KH 5EUOE 5F7MC 3BSZL 3BKCL 4NP4L 3RGVD 4LBEA 4PJ9A 3QIBA 3G5XB 4PJCE 5ANMB 2P24B 2APFA 3QZWA 3TBVA 2A0LC 2IQAA 1IL1A 2J1KA 3MOAH 2NX5B 3UXFA 1HYSD 3QHFL 4K3DH 5FUCE 3QHTC 1NSNH 4TNWF 5LXGL 4X98B 2APWA 1FAIL 5I76B 3U9UB 3GI9L 3C6LD 5TDOA 2ZUQB 5E8PA 1CDBA 3ULVC 4PJEB 1LO0L 4LEOB 4PP1C 1FVEB 4BH8B 3FB5B 3ZKXC 4UT7L 3WSQH 4ZNEA 2DQGL 1OAQH 3TNNB 1OAZH 4MMXC 5I8CA 1PKQA 2D0FA 1PX3A 3FO2B 4UDTB 3GMMB 1XEDA 2XKNA 3GKWH 2O61B 1H3VA 4PJ9D 5TDOB 3CCHA 3W82A 3SKNB 1UWGL 2W9EL 4GMSL 4LVHC 2W0PA 2F8OA 3UPRB 1AE6L 1P1ZB 1U91B 2DM7A 2AJXL 4JO1H 3FB5A 2HN7A 3RJQB 4NQUA 1JWUB 2CIKA 4J3WA 3H9SE 2E9JA 1Z9MA 2NW2B 3F7YB 3QDJB 1MCPL 4U0RC 4N68A 4PRIE 2XWJA 3T0WA 3AC0A 4NT6A 2XA3A 4PRAB 4BQ9A 2EIEA 5CLTA 2Z92A 5BXFA 1RZ7L 3BGMB 6CGTA 1BAFH 2BNUB 3PWUA 4PGJA 1WCBB 2XTJE 3VD4A 4K8RL 3UEZA 3GHBL 1MCNA 3E6HB 3PNWA 1EAPB 4J2XA 3MRMA 4LGPB 1FIGL 2XKUA 3IFLH 4I18B 1NFDA 5AAWA 3W11C 2AABH 1LO0H 3X13B 2MQ0A 3RPIB 2YPVL 4LSSL 3D69B 4NNXA 4MJIE 1A3RH 5D7JC 5KZCB 2AXHA 1XR9A 5ID0A 5ESQA 4LASL 1YC7A 1KXVC 1X5XA 2DMKA 2JCCB 2ZUSA 1VGKA 1YUHB 5DEZA 5T3ZL 4F15B 1FBIH 5IROA 3RVVC 3WN5A 1T2QH 3VGFA 3H2WA 3ARWA 4Y4KA 4JPKH 4UNTA 1W72B 5ESAA 1W0VB 2VDLH 2CDGA 4JZJB 3KPQA 3MXWL 3HAEB 4P4KA 5HYSG 1T1XB 3MNWA 3QUYC 5EWIL 1S7TA 4NQDB 5ANME 1V3MA 2Z4QA 1M6OA 3WDHA 3H42H 1TCRA 5ESQB 3IU3A 1EHAA 5EUOB 5L2JA 1VFBB 3ZHKA 1OOAA 3DVNA 2BCKA 4D9QE 4PJBF 2VIRA 4PJDB 4V2BA 1SJHB 1C12B 2ZUVA 1E28A 3V8CA 2R2BA 3UJIH 2V5SA 2APTA 1JUFA 1AO7E 4O02H 3EO1B 3Q6GL 2RBLA 1INDL 4PR5A 2VAJA 4PG9A 4M8QB 3QA3A 2I60L 2PTTA 3HCVA 1NFIA 4G8FA 1DFBL 3C5ZD 4QHUB 3LRSA 5A2FA 4UTBL 4P2RD 2R1YB 2HFFA 3KXFD 2Y1VA 1SVZA 2X1WL 3CFEB 1DBML 4ZPVB 1G7LB 2VISA 1FNFA 4RZCB 4YFLI 1GZPA 2BY0A 2QADC 3HS0B 4QT5B 5C9KA 3JWOL 5EU5B 3ROLA 2ZOLA 3LZFL 1D5ZA 1N4XH 4JVUA 4MZ2A 4RFEB 2QKIA 5I71C 4FQCL 4KWUA 1JGDA 2A6DB 1I85C 3HAEH 4KGJA 3VFTB 2BXZA 4Z5RB 5BV7C 2FX7L 3VFOB 4L8BB 1X4ZA 4JRYE 4MA1B 3RWIB 1K4CB 1I7TA 1Z9LA 5B3JE 5DSCB 2R0KL 1R0AL 3DGGB 2EDNA 2XACC 4M48H 1JTOA 3VE0B 2VJXA 5C6PB 1A14L 3CLFH 4F9LC 3I6LE 3V4VH 1FCGA 2M8XA 3F12B 2GAZA 1F4AA 1E4KC 2NCMA 2IADB 4TRPL 3TO4D 4JN1L 5DS8A 3BO8B 3PWJB 4CMMB 5TPWH 3QJHA 2WMPA 5FGSA 4Z77B 2OQJB 4E41E 2WLZA 5BZDB 3MJ9A 4S1SH 4KQ4H 4PV8B 1A6VL 4M61B 3W9DA 4YZFF 3V5DA 3TO4B 3PQYD 5KVDL 3MBEB 4X98A 4OLWL 2UV3A 2A9NL 4DGVH 3QFDB 1IQWL 3KWWB 3FAWA 4CAGA 4NCC1 2ZJSH 2RFXB 4WFGE 3VXMA 4CMMA 3CU7A 5C0JA 2XNAB 1MCFA 3K2UL 1ZHNA 2BVQA 4EOWH 4WDIA 3ARTA 3BIBX 5DRNA 1S5HB 2IH3A 4F7TB 5IR1B 2YD4A 5B8CC 2YXFA 4EI5D 2D4FA 4EQ2A 1XIWC 1JGLH 4GBXB 3BPLC 3P0YL 5I73C 1XGPB 1S7VB 4UV4H 2P8LA 3CVIL 1EZVX 1UZ8B 1A21A 4P5TB 4LCIL 1CDCA 3TV3L 2OTUA 1RUPL 3LQAL 4UQ3A 4AK1A 1VADB 3GMQA 3T0BA 4NNYA 4UU9B 4G43B 1OSPL 4GRWF 4IOSD 5F7KC 3AB0C 1JBJA 1CR9H 2G5RA 5KJRH 1RZIA 3QNZB 4Y5XC 1GAFL 1MI5E 4XHJC 5DJAA 1CE1H 5JIIA 4WWID 1T5XA 3HZMB 1CGWA 4MDIA 3N9GL 1IEAB 4XXDB 1CT8A 3I6KA 4GRLD 2AEIT 1QFUH 2P49B 4E5XB 1WZKA 3HE7B 3CLEL 1JE6A 1FLRH 2R23B 3MV9E 4XBEH 2IQ9L 4CU7A 2CUMA 2UZXB 5CEYB 2ZUTA 3PDOA 3EO9H 4CNIA 5T3ZD 2ZKHL 4AZ8A 1MRFL 4YDVB 3QQ3B 4KHTL 4PJ8A 5EC1A 5C0FA 3D39A 2AS5M 2AEQH 3T3MF 1RU9H 4ZQKA 2KQMA 3B9EA 1BVLB 4FQ1H 3RWGB 1NGZA 4MB5A 4B53A 1NC4D 1QP1A 4NZRL 4X6DA 2Q3ZA 1ZT7B 4ZO9A 4PJ7A 3ULUL 4NO3A 5CEYA 2QQLL 2BK8A 1LMKA 4XRCA 4HMDA 2EDTA 4JKWA 4G42B 1PX4A 2DWEA 1CGUA 2GK0A 2FATH 3TT3H 4NKMA 5A3ID 1TVDA 4OTXL 4PP2B 3C5JA 1U3JA 3B2VL 1CICB 2J5LC 2P5EB 3WFDL 4NZTL 1A47A 1CLZH 3NGBC 1MCLA 4C58B 2FLRT 3IDNA 1TZIA 5E8EB 2H2PD 1FYTA 3ARGD 3NABH 1WLHA 4M43L 2CLRA 2IF7A 3SY0B 3F7YA 2ZG3A 2XQYK 2VLJE 1G7MA 3OBAA 1IJ9A 3QCTH 4JM2D 3CFEA 4PBXA 5T1KB 1TTGA 4NFCA 4PS4L 3TN0D 4U1GC 4N8CL 2DQEL 3STLA 4P23B 2MOVA 1J8KA 5IK3B 3ROLB 3DMMD 4LSPL 4DQOL 3CZJA 2FO4B 3SKJH 5MP6L 5CIPA 1MLBB 2X40A 3WFBH 3EO9L 1A4KB 3GNML 1ZT1A 4PGEA 3W0WD 4AEIL 3HPJB 1F4WH 4P5MA 4WCYL 1T7XA 5JHLL 5B21A 1G7JA 4HJGB 4LCWE 5IK3A 1TETL 5I30L 1S5IH 5E6IB 3FT2B 1CXEA 1YUHA 1U8JA 1FL5A 3STZA 3D0LB 2L7JA 2VE6B 4KVNH 2ICWA 4Y2DD 1KENL 2A77H 3MOAL 1FZKB 35C8H 1KNOB 4LLDB 5D5MA 5IUSA 1DQDL 3BZEA 4JGMA 3NABL 2DRUA 1CXFA 3RGVB 2BSRB 4HQQL 1VERA 1Q9LB 4FFZL 5EU6B 3BQUC 4MJ6A 2GI7A 5DHYB 4TVPL 4QNPF 1NBVL 4J3TA 3SOBH 2PW2B 3S3JA 4FFWC 5GRZA 3GGWA 1IGML 1LO4L 3MACL 5EOCL 3ZHLA 1MIEL 4XAWL 1UGNA 2V7HB 2JJTA 5BJTB 1OW0A 4DW2L 3IXTB 4G8GE 2A38A 3K7UA 2IH1A 5ALCH 3IFLL 5HYSB 2C3WA 4GG8A 1WITA 3OXRA 2N1KA 2X5PA 5KSVA 2EKJA 1BD2D 4LKCA 1TQBC 5JPMA 4TNVF 5LWYH 5I17B 1OAUL 4H25B 3BX7C 1XIWB 3B8YA 2IPKB 2X4RB 4KPHL 5DD5L 1CD1B 2QSCH 4Y88A 4NM8L 5D6CA 3DHJA 3KYKH 3NAAH 5FM5O 4PY7B 1FVDA 1QBLL 4MJ5B 1J9CT 3SDDD 3PP4H 3V4PH 2NY7L 1NC2D 5E2UL 4OD3L 1GGCH 3ZYOA 1MF2L 2LU3A 1N3NB 1G9MC 1L7TH 2E8ZA 3SDXB 4HS8L 4W4OA 3OKOB 3QIUC 1EGJA 3EZJB 5HHMD 3TCLB 4QTIH 3LKRA 5A2IH 3TP4A 5I71B 3QXAA 4OCLC 3VFOA 4U1SB 1FJ1B 1PDKA 2ED7A 3PG2A 4HUUA 3ARSA 5B39A 1YQVL 3V0VA 3TO4C 5CINL 3MC0A 5DD0H 3GSXA 3P40A 2H2SC 4XC3H 1KSRA 35C8L 3BKJL 1JF1A 1WZLA 3KPSB 3B8SA 3AS1A 3FQNA 4OUUA 1SJHA 1MREH 1HZHH 3ZYZA 2D2OA 2O61A 3I84A 4YEEA 4QHLA 3EYFB 4JG0H 4P46C 4RNRA 1EGJH 2OR9L 3HC4L 3A6BH 4HCRL 3REWA 3TIDA 1N6QH 2DM4A 4P4RB 3ZLQC 4ZDHB 3RVUC 4CW1B 1NEZG 1I4FB 4KV5F 4PJXF 3MRCA 1SEQH 3SBWC 4PV8A 1EIBA 1RMFL 3H6JA 1INQB 3VXUA 1HHKA 3QFDA 1T4KA 5BV7B 1Q0YH 2DYPB 2FX9H 4NO0B 3V4PL 1KEMH 1LP9F 1A7QH 1FE8L 5DMJB 1HIMH 1HH9A 1L0QA 4KROD 2APBA 1PKQE 3BYTA 4UQ2B 2ED8A 3MV7E 1E0OB 1FZMB 3VGHA 3OGCB 3N85H 1P84J 2X9WA 1ZVYA 2QADB 1SY6L 5GISL 3K8MA 1Q9KB 1JMZA 4F7PA 4DZ8A 2J2ZA 4JR9H 1IEBB 1OSZA 3RWIA 2X4UA 1KJ2B 1J11A 5CJQH 5F7DA 4P3WA 2B8OT 1ZLVK 1DBKH 3SY0A 3NTCH 2P1YA 4DN4H 3T1WA 4I3RL 4JN1H 1JL8A 3V6ZB 1QSEB 1XAUA 3HUJB 3O4LE 4Y89A 5CCKL 1C5DB 2LABA 1LD9A 4P23D 4QF1B 2X1XR 1YY9D 2XFXB 4S1RL 2XQBL 3GMPB 3QG6A 4HS6A 4PJ8C 4Y5YA 4HKJA 1UB6B 1ZA6B 4Z9KB 4FQJH 2DF3A 2EYTA 3K4DA 3VJ6A 1ZTXL 2KPNA 1W72A 3GFUA 1EEZA 1PVHA 1W2KT 3ZTNH 3LQMA 4NBYB 4U0RB 5D7JD 4FZ8H 2PKDA 4LCIH 2H3NA 3PGDB 4QOKE 1QTYT 5D7SL 4NWUH 3C5ZB 3ULVL 1IFHH 4KTYA 2D03H 4OQ1A 2UY6A 1OSPH 4PJXB 1L7IH 5KW9L 4L3CB 3D0LA 3K80A 8FABA 1UXWA 1QLFA 4R7DB 2H2PC 5AZEL 3S35L 1A3LL 1N26A 4BJLA 5J6GB 5AYUH 1AGDA 1F11A 4ODUB 1XZ0A 3ZKXB 4MNGA 2DLIA 5MEPB 1EEYA 1N64L 1BGXL 1PJ9A 3MYJA 3HCVB 1AD0B 2B1HL 3JV4B 3UDWA 2HFGH 1SBSH 3VFSB 3WNLA 1XCQA 3TA3A 1DQTA 3IDYC 3T0EA 3O6FB 5IB2A 4LLVB 4QXWA 5L88H 3IAPA 3OAZH 3OR6A 2PF6A 5EB9A 3RWJA 4U1LB 3L5HA 1V7MH 4OQTA 5IMLB 3SCMA 3MV8B 3MRQA 4Q97A 2FZ3A 4Q0XH 1AXSB 5MEPA 3OXRB 4OZ4B 2G75B 3S97C 2EDDA 4LPXA 4M7KH 1ACYH 2V7NB 4XNMA 1IAIM 4AYFA 2NY6B 4WW2C 1Z3GL 1QFHA 2ITDA 3HUJF 5ACLA 3REVB 3DTXA 2IAMD 2VDRL 1FL6A 3V6OC 1PQZA 1AFVL 4WY7L 5HGBA 2V2TA 4U2YA 2Q76A 3HUJE 5IF0A 5KVEL 1FNEB 5F7EL 4NP4H 5BCAA 5SWSE 5GSVA 4ETQB 4YO0B 2NY6D 3KHQA 1A2YB 2X89D 4U31A 3TCLA 3E6FA 4NRZA 3LKRB 5HXMA 3EFDH 4KC3B 3R8QA 4G6AD 4APQD 4L4TE 5BVJB 4P2QD 2Y6SC 5E8OB 1U95B 2RCSH 4P57B 3BHBB 2A6JA 3N06B 1YEDA 3QIBB 2HN7B 3RA7L 5KAQF 1XCTB 5JOEA 4U1MA 3V5DB 3HZVB 4KV5E 4PJXE 5EZOH 5E2VH 3QXUA 1AJ7L 4YO0A 2XZAH 2DQEH 3D2UD 4QOKB 4OZFH 3BQUD 3LSOA 5EU3A 5E8PB 1E4WH 2AJUL 1T1ZB 3T77A 4X7DC 3HNTL 3MJ6A 1M71B 3CK0H 1HE7A 4F57L 1MAMH 4N0FB 4G8IA 5F89A 5I15H 4PB0H 1P6FA 2PW2A 3UJJH 3DROB 1CG9A 4WUUE 2E6PA 3LN9A 4MJIA 3VD3A 3VWKA 3WIHL 4ERSL 5T3XH 4ZAKA 1R3LB 3U0TB 3O4LB 1MCSA 3QBTB 1IEAA 1DANU 1ZMYA 4XXDA 2F74B 3GBML 1XGTA 4N5ED 2D7QA 2O5ZH 1XGYH 4FXKA 3ZHDA 1IKNA 2V17H 1BIIB 5EULV 3I50L 4JPWL 3L3DA 2A6KB 5LQBL 4KDWA 3WNPA 3JWDL 2YC1B 4HT1L 3MNWB 3FRPG 2DQIH 4WU7A 4U1NB 4QRRD 1G7JB 1JRHH 4MGXA 5BV7L 3U30C 2QSTA 3VXTA 2XTJD 1QLEH 3LRGA 1JWSB 1RUMH 5GS0D 1IGMH 1LO4H 1U92B 1U9KA 4KJYA 1U58A 1FGVL 2L0DA 1HI6B 3ZSTA 2AKRB 4ZUWA 1J8HB 5TQ2L 1NGXA 2EXYC 5ACZA 3CSYB 1RJZA 1E6JL 1MEXH 5AD0B 5CEXB 3G5YA 3VXSA 1J8HD 4PG2A 3BH9B 5CUSL 3HA0A 3GIVA 3H9SA 4U6XA 4JEGB 2PTTB 1MIEH 4EZMA 2W9LA 3RHWK 3IT8D 2OMBA 4IRZL 2WWMC 3QNXB 5GRVL 2NY4D 1FO0B 3O6ML 3RP1A 2AV1A 4XPBH 5B38A 4XCFL 4X4MA 3DX9A 3QIWA 3HMXH 2Z8VC 5DD6A 1UEMA 3KPSE 2X05A 1I7ZB 4I5BA 5BS0D 1FGNH 1WAAA 2VXQH 3CC5B 3H9ZA 4Y16B 2ED9A 5DZNA 2HP4A 1INDH 5HVGB 5I1KH 4JG1H 2WNGA 4ZUVA 5BV7H 3GBLA 4L1DA 5C9JA 1MJ7H 3CX5K 1JZ7A 5K59E 5JR1H 1FFRA 1LP9E 2EIDA 4QRUA 4EN3A 4D9LH 3RIAK 3G6AB 3U4AA 4PTUB 2G9HA 5KG9A 2I9TA 4L4TB 4YLQT 4PJ5B 1I7ZA 4I5BB 1AKJA 5EOTA 4G9FA 4UAOB 3LKOA 4W70A 1Q0XH 3U30B 4TUJB 2GUOA 5SWSB 4H1LB 3MV8D 3KYNA 4LEXH 1EMTL 2GSIB 5SWZD 3U9PH 3AAZA 3VGGA 4AM0B 3HI5H 3ROOA 3RIFF 3SDYL 5EIIA 4BA8A 3LQZB 5CINH 3BKYL 3HTLX 1OAKH 5C0RL 3M8OL 5HHXL 3NAAL 2X4NB 4BQ8A 3CJJA 5ILTL 3MLSH 2ITDB 1EJOL 2P8MB 4XPBL 4HIHB 2OXHA 4GO6B 4JFPB 1M05A 1WIPA 4O58H 1MEXL 3ARED 5I66B 3QFJE 4L8BA 1Q1JL 4I0CC 3UTQB 1VB9A 5GJSL 5J6HA 4HKZB 3SDAD 5C86A 1Q9LA 1BZQK 4MJ4A 4LAJH 4ZG1A 4NQED 3X14B 5DYOB 3SEPA 1MFNA 4TQEL 4HG4J 2XIDA 3IFNL 5ICZA 4KQ4L 4QKXB 1LK3H 5E4EB 4XCFH 2YRZA 2WK2A 4K8RH 5F1OB 1J18A 5D6DA 4GRMA 3E2HC