3GBML

Crystal structure of fab cr6261 in complex with a h5n1 influenza virus hemagglutinin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
208
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRTAYVVFGGGTKLTQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein / immune system
molecule keywords Hemagglutinin
publication title Antibody recognition of a highly conserved influenza virus epitope.
pubmed doi rcsb
source organism Influenza a virus (a/viet nam/1203/2004(h5n1))
total genus 36
structure length 208
sequence length 217
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbmL01
4TOYH 1EJ6A 4KK6D 4QHKI 4R97B 3MLWH 5D9SB 3L3KA 4I4WA 1QFPA 3OAZK 4PJ5B 3VFNB 5FCUL 3MLRL 5C08B 4HQQH 1V7NL 2JK5A 2Q8AL 4FABH 1KJMA 3VD3A 3MBEC 3MR9A 3O9WB 3FO2A 4APQA 4HS8H 1U8IB 3KLAA 3BGFC 2IJ0C 4EUPA 1OGAB 2EDXA 1T89C 3A6OA 3I50H 4HHAA 5DO2C 2I07A 4KQ3H 1MAKA 2GJ6B 1VA9A 5CUSH 3OF6D 4PRDB 2H6PB 2X4RA 3QCTH 4NQEE 1JFQH 4Q9QL 1MCPL 4EIGB 4NQDE 3P2TA 1UADC 2WIIA 3MV8A 4JFDA 2FRGP 2IC2A 3EYUL 5T1MA 4RMQA 4DTGH 2ADGB 1P6FA 4RGNB 4ZAKA 2QHRL 4UAOC 1N6QH 4Y4KD 4WFHE 5DMKB 1J1PH 2FJHA 1EMTL 4PJXF 4WHYG 5D2NA 2YPLA 1NKOA 3SDXB 3HB3C 3QXWA 3E1F1 3QDJA 4ODTL 1PYWA 1U3HD 3ARBB 4WI8A 4D0CB 1DSFH 5EO1A 1R5IA 5GGTA 5DJ0B 2C1PA 4K3GA 3RWFA 3FO9A 4XP9L 4DZBA 5F71A 2UWEB 4X7TA 1CG9B 1A64A 4P3DA 3FQXB 4GRWH 1RJLA 4PJ8D 3TA3D 5A2LH 1DP0A 2ESVE 2YZ1A 2F8VA 3LH2L 1ZA6A 2A6JA 4PV9A 4AEHL 4PGEA 2VNCA 3IFLL 1EVTC 3RY6A 5KSUB 5L8LB 2FHCA 4NOFA 4G9FA 4PRPB 2AJYH 4PY8I 1EVUA 4ZUWB 3CXHK 3VW3L 1EZVX 2VDOL 2NY3D 5H2BA 1GPOL 5KSAD 2BFVL 1MCOL 1J10A 1F3JB 1FYTA 4Z7QF 2QKIA 5E5MA 5GRXG 2X7LB 1VENA 2DBLH 3SBWA 3UDWC 5A2FA 2HJLB 1A3QA 1H3XA 2WBJA 5E8DH 5C09B 5C0BB 3O45A 1CXEA 2A9MH 4EXPX 1KPUB 4GQ9H 1QFUH 4JGMA 4N0CD 3LHPH 4FQIH 2EDRA 5DRXA 1UJ3C 1ZSDA 3DVIA 3QPQC 1CZ8L 4DOHB 2IQ9H 1HH9B 3S8WA 1ZEAH 3DX8B 4MHHI 3F12A 1D6EB 5F89B 2OXHA 4PRHA 4Y19D 2VH5H 3MLZH 2O5ZL 4LCYB 2FATH 4AY0A 1F3DH 4OGXH 4TSBL 5JOFA 1YUHB 2F74A 2WP3O 4M6ML 3UPRB 5CP7A 1AGBA 5KVGH 2OJEB 3JUYA 1XIWD 1MFEL 5IEKA 3R1GL 2GTZB 4XPFH 1BBDH 3L9RA 2B4CH 4IRZL 5I6XC 5HD8D 1RPQA 3CNKA 1YECH 4KKLD 3WD5H 1U58B 2M2DA 3RVXD 1NFIB 1A1NA 1KCUH 3BP4B 1QPPA 3AC0A 3X11B 3ARFC 1GAFH 2FLRT 3C6LB 1H15B 1VFMA 5GZNC 3PABB 5HI5D 4GQPH 3LN4B 3LKNB 4CADA 3SJVD 1BOYA 4JCLA 5FECB 1IM9D 3NVQA 5FGBA 4N1HB 4QXUH 1CFNB 4BFIA 4G6AD 1SJXA 2VLJE 2HRPH 2EDQA 5DC9B 4PREB 4A2MA 4HT1H 2R8SL 1FNEB 4PYHA 4U7MA 4RDQG 3UTTA 1R3LB 5I66A 2DICA 4URTB 1SJVA 1AGCA 2HYMA 3MLSL 4YGVA 2ZCKH 5BMFL 1SHMA 3T77A 3DGGA 4P4KD 3BZ4A 4MA7L 2MNUA 2PR4L 5DEFB 1ERNA 4YHLL 1YPZB 3TZVC 1U92B 1Z3GL 1E4WL 5I74C 3OR6B 4NWTL 4PV8B 5F9AC 5CGYD 1FVEA 4YX2L 3ULVC 1F90H 5I30H 3K7UA 4BFBD 4U6XB 1I7ZB 1UVQA 5D7JD 1OP9A 3GSUB 4LLUB 3QA3B 5IW1B 4OCXH 2HH0H 1MAJA 1FCCA 5FOBA 4BSJA 1XGPB 2AK4D 4FG6D 3UTQA 2XTJC 5GRVL 1X7QB 3FJTA 4UT9H 4PJGB 4LMQE 4PBWD 4Q6YA 2R4SL 5CWSA 1UCTA 4UILL 5DA0B 3VWJD 3O2DA 4KK8D 4KRMB 3LCYA 5D6DC 1G6RB 3HZVB 3HUJB 3FB6B 3DURA 3K4DA 1U8NA 2UY6A 2NX5D 4ZD3L 2F8XC 2CIIA 2C3VA 1I1YA 4LCCC 2QSCH 3FN9A 1UG9A 3BQUD 2AW2A 3FFCA 2QTEA 4ODHL 5E7BA 3S98A 2ZPKH 3TO2B 1HH6B 5SWZE 2OJZL 1AHWB 5DSCA 5I1CH 3KYOB 3Q5OA 4WWKC 5DJDB 1UB5A 2B5IB 1ONQA 4S1QL 1ZA3B 1RHHB 1OTTC 4CVZA 3JVGC 3FO1B 3QEHA 4P4RA 2F54E 2WINA 1QVOA 4QT5B 4NWUH 5D6CA 4EBQH 1FVDB 4Y5VB 3MV7B 3TVMC 1CU4L 3QRGL 3MRGB 2VABA 4XX1G 5D1QD 1R3KB 4Z9KB 4RAUB 1ZWIB 3WUZA 3RL2A 1TCRA 4HS3B 4XNMB 5K9KA 3MCKB 2YD8A 4NQEA 3MRCB 4D8PA 2DIAA 3O41A 4NQDA 4QKXB 4P2CG 2C7UA 3IDUA 3PGDB 3IXAB 4M00A 3JV4B 2XWTA 4E42B 5K93A 2KUTA 1OM3H 4O02H 2BXYA 3E0GA 1A9EA 1MH5A 5EIIB 2XWBA 1PW3A 4NN7C 2BNUA 4WTXA 2QQLL 1TVBB 3SJVE 1ZLVH 1PG7W 4GUPA 3D1MC 1WUNT 4JEGB 1J1PL 3EO0A 4M6OH 2PXYA 5ELIA 3TBTA 1HQRB 5I1DB 5F9JA 2RCSL 5L7XL 4HXAH 2HVKA 2BDNH 3P40A 3TJEL 1B0GB 5J56B 5T1KD 5T5NF 3G08B 3QCVL 2UY7A 4XP4H 4LLDB 3MRHA 2OYPA 1FFPB 4EJ1C 8CGTA 1EHLL 4YE4L 5CLWA 3U36B 5DJXB 1JPST 2HT2C 5DHVB 4XZUB 3MRLB 4B50A 4PJXB 5F3HA 5DMYA 5DRNA 1QKZH 4NFBA 1TETH 3CMGA 5AG8A 3FT4A 3L5XL 5I15L 3OG6B 3NH7L 1FFNA 1TLKA 1DBJH 1X5HA 3P73B 5GSVA 1YMHB 4RFEA 1RUQL 1C08B 2F5AL 4LBEB 4NCC1 1MRCH 5T1DH 1TDQA 1H3TA 2COQA 4Y4FB 4M9PA 5FAAA 3DV6A 1G7PB 1OB1A 4IS6B 3SDYH 5D4QA 3QWRD 5TH2B 3BE1L 1ZAGA 5ICYB 3KJ4B 1YQ2A 1CR9H 2QV2A 5LQBH 4OFIA 1DJSA 4ELKB 3D69A 4F3FB 1U42A 5A2JH 1TJGL 4H25B 4S2SA 1G7QB 3BN3B 4HPOL 4AIZB 3UC0H 3FB5B 1JGDA 3U4BL 1NBVH 4U3CA 2R4RH 4GRWE 2A9ML 2KH2B 5E5UB 5EWIH 4XAWL 3P4OA 2VLRD 1JZ8A 2VR5A 5EUKA 3PHQA 3PP4H 5FYJL 1ZV5A 3QDMD 2FR4B 5CIPA 5CSZA 2VH5L 5DD6B 4PGDA 3BAEL 2ENSA 1T1WA 3VA6A 3HLAA 5C2UB 5MI0B 1VCAA 5E2VH 1X4YA 3M45A 1I3UA 3T0XA 4EI5C 1JF5A 4XNQA 5ABDE 1OAUH 1QP1A 3OKNA 2AV1A 2B4CL 4BH7B 2QADD 2NR6C 2G9HA 2YK1H 5IIEB 3BIAX 2PKDA 1RZIA 3RTQB 3TV3L 4DGYH 1CD8A 1CGXA 1CL7H 2D31B 4HK3N 1CE6B 1KCUL 3B6SA 5FM5O 4Z7NF 1GAFL 5HPMA 1FL5B 3JWDH 1JBJA 1JGVH 2CRYA 1ND0B 4OLVH 5E9DE 4I2XE 1A9BB 1MIEH 3CC5A 1VFAA 3OF6A 3C8KB 5JPNB 4M03A 4KJWC 4P0DA 4QXUL 5IBUB 3HNSH 2X4SB 4OLWH 2A6DB 4M1DH 3BKYH 1AXSB 4HT1L 6CGTA 4GH7B 5BOZG 4MSWB 4OCRH 5ICZB 1HWGB 2CKBB 1F11B 5DD0H 1YDPA 1HHJA 1ZTXH 3LQZB 1JJUA 1NBZA 3BKCH 4RCAA 4D0DB 4Z7OE 2DQHH 4B7LA 4FTVE 3CD4A 1UACH 4PD4J 1LD9A 3RHWF 1EZVY 3ARED 3HE7B 1T1ZA 1KLUB 3MLYL 3GGWB 4LAJH 2XI9A 1OP5H 4PJ8A 3TA3A 4ERSL 2GK0B 1NCCH 1NBYA 3PDOB 4OT1H 4WENB 1NAMH 2FEDC 1JI2A 3TC9A 3O2WL 1UCBL 3W81A 2R0WH 3L5HA 5D1XB 1H5BA 1FHGA 3BJLA 1NGXA 1JNHA 3F7YA 3TN0C 4ZS7H 4LP5A 3U0TB 3BP7A 2RHEA 4LSSH 4UDUA 5F1SA 4LEXH 1GOFA 5HYJD 3B2VL 4NN5C 1IAIH 2BC4A 3AM8A 3QIUA 3K46A 3VA2C 1G1YA 5I71B 4K23H 1UXSB 5E70A 5J9PB 4KHXL 4XTRD 3VFVB 1CE1H 4Z5RA 5SWZA 5IK3A 1CIDA 3BZDA 1ZANH 3N50A 4YXLL 3HE6A 3MX0A 3OR7A 3BI9X 3D2UB 3T1FB 1CCZA 4PJ7F 2R29H 2QSCL 5DURD 1RK0B 2PCPA 2PYEB 4MJ5A 3FT3A 3O11A 1FC1A 4PR5B 2JELL 3PWLA 3BP5A 2F54A 1PLGL 4L5FL 4KROB 4XNXL 1EGJH 2GSGA 4G8FA 5IV2B 5I1CL 1UWEL 4QHUB 4DKFH 4O2EA 1YEIL 4LOUC 3STZA 5E00A 3C9NB 5BVJB 1RZ7H 3FAXA 1UM5L 5EOTA 3DX9A 5IF0B 2E7LA 1XIWA 4Y5XC 4WEBL 4MNGB 3FKUS 4FNLH 1F4YH 2IMMA 2Z31B 5DJ6B 2VDNH 4NO0D 5ESQB 1BEYL 5JDJA 5ITBL 3PJSA 2D0HA 3QR2A 1GGCL 3QIBD 1YY8B 2C3WA 5I1GL 1LILA 1FN4B 5JXED 1K5NA 3G5ZA 1EH9A 3SJVA 1IM9A 4OGAD 4PJHB 5I1LA 1QACA 5C7XH 3QIWB 5GGSA 3MOAL 1MJJA 4FQXD 3V6ZB 3MRQA 3NCYP 4LSTH 4DKEH 1U8QA 5KAQG 1JPTL 4X4ME 2DLEA 1C5BL 4D9LL 4X80H 5DI8A 4NKOA 3WIHH 3MOBH 2DM4A 3BGMA 2YD5A 3QUYD 4IIQC 5CINL 1X6NA 1EEUA 3TFKC 1D3CA 4JFYB 5JHDB 4P4KA 4LLWA 4PRID 3REWB 5EOCH 5BV7C 1E4XI 3QJHB 2IADA 5HHNB 1BECA 4OM0L 5IKCB 4P2OB 4ZQKB 1H9VA 4BQ8A 1A6TA 3BDBA 4LCUB 3VXPB 3AAZA 1Q9KB 3OB0K 1MFAL 1R6VA 1TTGA 4GLRI 5DD3H 2D7PA 1NUDA 1VDGA 1LO3H 4MZ3A 5FF6B 1GL4B 3GKWH 3N1QC 5LXGH 1KCVH 3DRQA 1F58L 1EEYA 1JWUA 1PZ5B 1B88A 2JCCE 1MRCL 1MFBH 4F37K 1TPXC 1FL6B 2HN7B 2AK4A 1S7QB 2YMXL 3ZO0A 4U2ZA 4OD1H 1NC2D 3F7VB 4Q6IB 1L7IH 3BPOC 4H88L 2A74A 3VWJA 4IRSA 3KPTA 5E8EA 5IQ9B 4HAGA 5IR1B 1P7KB 2NY6D 1YEEH 2EEDA 3VMNA 4U1GB 3VG0L 2NX5A 1K3IA 2BSTB 2OK0H 2P8MB 4IDJL 1LMKA 5FYLD 4HIXL 3T4AA 1HXMA 2ERJB 5HY9B 1OAQH 1DUZB 1RZKL 4WV1A 1Q72H 3B9AA 3BQUA 4JVPA 2OLDA 5C08D 3VXSB 4YLQT 3STBA 4XCFL 3GRWA 3RWCB 4YEFA 2YN3A 3EYVB 2BHZA 2VXUL 3HI5H 3D39B 3O9WD 3KPSB 4F9PA 4WO4C 4MJIE 4F7CB 3PWPB 5JZ7D 4XWOD 3PP4L 2V9RA 2VE6B 3DX7A 4XPGL 4C59B 3O8XC 3OKYA 1J8HE 5DRZA 4R97C 3LN9A 3CUPA 5I1JL 4R7DA 3M1BA 2YWZA 1TXKA 2XN9B 1AXTL 1MCIA 1M7IB 2MWCA 2Y5TB 3L6FA 2XKSA 3HAEG 1OAUL 4OZHE 3ULUD 3LRGA 3MUHL 4OQ1A 2ZG3A 1SYVA 3V52L 1GZPB 3V5KA 5D1QA 2Y7QA 2ZG2A 4HZLB 2O5YH 2R23A 4CN4A 4JHWH 3BOVA 3GI8H 4ODWB 3RWHB 3LPGA 3I84A 2ZOKB 1VPOH 3V0WL 1AC0A 1JGVL 5KSVA 1PG7L 1MIEL 5TDNA 1FBIH 1KENL 2V17H 3N1FC 4NO5A 2GUOA 1NLBL 3V5DB 2E9IA 2FHBA 3UTSB 2AJXL 4ZUTA 3HG1D 1T80A 1TVHB 4J6RL 2Z92B 3QI9B 1WCQA 5FM8A 3D3VB 1MCFA 4JHAL 3BKYL 4X6DE 3V9FA 1G7IA 2I9TA 4JM2A 3FCTA 2IPKB 4I5BB 3LEXA 4FTVA 3ARBC 1Q94A 3H9YA 3S3PA 4L8SA 1I1FB 5KVFL 4JDTH 4E41B 3B9EA 5SWQB 1WC7B 1OD7A 3C5ZA 1NCTA 2IBBA 4JZJA 4XGZA 3T3PF 4GMSH 4OD2B 2YC1A 1KB5H 1NSNH 3QEGH 1NEZB 5DJ2A 4P9HC 1UA6L 4P5TD 4JVWA 2I60L 4J3OC 3RL1A 4CKVX 1DUYA 2I27N 4LSPL 1S9WB 5FA3A 2ICWA 2G60L 5FM5M 4PRIE 2X5PA 2NY5C 4OT1L 3LQMA 1BIIB 1JWMB 4DJMA 1RV6X 4TPRH 2AQ3A 2OL3B 1DL7L 3WIFB 5C1MB 4KKCD 5LKNA 2PN5A 4KJPD 2R0LH 4I3RH 4LEXL 1Q0XH 5C0AB 4DUXA 5DJ8A 5AAWA 4FXGA 1Z9OA 4ZUSB 3M8OL 2ITDB 4KXZH 5EULV 4KPHL 1A7BA 4R26L 3VGFA 4OFDA 3GHBH 1CE1L 2ZOLB 3BDYH 4NZDA 3ZKXB 1IAKB 2YD1A 3O6FC 4YHPA 2EE6A 3BIBX 3ILQD 4MCYA 1S9YB 4M1GH 4JQIH 3X12A 3KPOB 4XVJH 3CPLA 4X5WA 4MWFB 1S7VB 1I9RL 3OHXB 2V9QA 1QA9B 3H42L 3QDMA 5I19L 1IGMH 1FIGH 4TSAL 5ALBL 4XI5C 4PJ7B 1LQSR 5KTEL 2P7TB 3QXDB 3VXTB 4NQVA 4KDVA 3LB6D 5CD5C 1HKLH 4WI4A 4NO3B 5FGRA 3HC4L 5M95B 4ZSOE 2NW3B 1DQMH 3MJ9L 5T33L 4JANB 5DK3A 2ARWA 2UUDH 4Q0XH 1ZHKB 1F4YL 4GG8A 1WFUA 4L3AA 1N59B 5IHLB 3C6LC 4PP1D 3TBSB 3IU3B 1FO0L 1A2YA 1F97A 1IILE 4I48A 4NJ9H 4LSUH 1RIHL 4EN3B 3GMMB 3D85B 4L29A 2HRLA 5E6YA 5F9DC 2P5ED 2KZ1B 2EIEA 3T2OA 2VDRL 3HZYB 4X4MA 2DI9A 1TNNA 1QFWI 2EEBA 1VHPA 2QSVA 3O6ML 4ZXBB 2DOCA 1TIUA 4ZPVA 4KH2A 3OKOB 4L3EE 4Z0XA 4X98A 5C7XL 2R2EB 2AQ2A 4UT6L 5LBSH 5KVEH 4QRRD 1EHXA 1LEKA 1SMOA 1KPRB 4NQSB 5DUPH 4ODUA 3EFFA 3VFGL 4X80L 2ZCHH 5IMOB 2Y36L 2V2XA 1LO0H 4HCRH 1CFTB 3HG1E 5DR5L 2CMRL 1AY1H 3L3GA 3QP3A 4LP4A 1LP9A 4HK3J 4R3SB 1D5XA 2CLZA 4ENEC 4XHQA 5F9OH 1FQ9C 5H37H 3SKMB 4L8BB 4NRXB 3VGHA 4MS8D 3PL6B 1WT5A 4FQQB 4O2CB 5TDPA 4D94A 2CH8A 4FA8A 5HDQL 1HXYA 3AREA 1PKQA 1QSEE 3IETA 4HFWA 4MLIA 5MEPA 3QRFM 4GSDL 3PP3H 1SYSA 1DN0A 1ES0B 3CK0L 3VWKB 2JCCA 3L3OB 1K2DB 3FOLA 4TTDC 4OUUA 3CLFH 1AJ7L 3TO4B 1T20A 4JAMB 4H0HB 3D18A 4KI5C 5MP6L 4ZOAA 1KCVL 3RWIA 1UM4H 5JIIA 3BUTA 3DUSA 4X7DC 2FB4H 5CEZL 2D4DA 3TYGL 4QXGL 2ORBL 2GY7B 4HKZA 3AB0B 2DYPB 3DBXA 2YZ8A 5EZJA 5EZLB 4OD1L 5BOPA 5EU6D 4CN1A 3ARZA 4LDLB 2HKHL 4LPWA 4Z76A 4XXCA 3V7MA 5DMGD 2X4OB 2Y1VA 3GO1H 5DVLA 1HSBB 5CGMA 4XBPA 1NMAL 1AIFB 4MJIA 1GGTA 1AHWC 1OAQL 1F8TL 1K6QH 3I75A 5B38A 4IDLA 3G5YA 5C9JA 7CGTA 2VZVA 3VXMB 2B5IC 4HXBL 1CLCA 5C0FA 3QG6B 4M7KL 2ADJA 1FIEA 3I3DA 4MB3A 1D5BA 5D2LB 4PIRF 1J0YA 4OZHA 4IRJD 3WDHA 1U8PB 4B41A 5JW4R 1LO2L 3AUVA 4Y5VC 2V5RA 1YC8A 4XH2B 5E2UH 3B5HA 2J4WL 2OQJB 4WUKH 3ALPA 1QLFB 5CEXA 4N9GB 3QNZB 1OT1A 4JPWH 1TJIL 4V1DD 43CAA 4M7LT 2AXFA 3P9LB 3IDGB 4NO0A 1YNTA 3TIDA 2G2RB 1W8OA 4JN1L 2GJZB 4TNWF 3EDKA 5IQ7H 1INEL 1BVZA 3QIBA 5DTFA 3RWDA 5CMAB 4X7SH 4HUUA 2GHWB 1NMCB 1YC7A 3MBED 3DUUB 3B9KD 4GBXB 1FBIL 5I9QB 5FDWA 4X6DA 4ZTOH 3NIFE 1T1YA 2Q6WB 2FGZA 1T1XB 2PETA 3WKMH 3J8F7 4BZ1H 2I9LA 4JFEE 4MQSB 4PP2B 1OT2A 4M3KB 2CDEB 4O2FA 3LN5A 3RQ3A 3IKCB 3SKNA 1YYMH 4S10A 3GUTA 3JV5A 1TCMA 3ARDC 2VXVL 4M48H 1FDLH 1XZ0B 1E0OB 3LRHA 1IKFH 4LRIC 1DBAH 3MRMB 2ITCA 4Y2DD 1T21B 4HK0B 3HCVB 2DM2A 1I8KA 1ZMYA 3QUYA 4LSQH 4CDHA 3MNZB 3P4NB 3ULVH 1K8DA 3UZEA 3T4YA 5TQ2L 2VR9A 4PRIA 4MB4A 2RFXB 4FQCH 3MMEA 1MI5E 4OQTH 3WJLA 1ZLUK 1NCNA 4HPYH 3RGVD 1CDIA 2GITB 1F4AA 1NDGA 3HI1B 3P0YL 4NQCD 3U46A 1RD6A 1OTSD 4LF3A 3VGGA 4F7PB 2R9HC 4I1NB 2IAMD 1P7QB 3NFSH 4HDIA 2O93L 2Q7YA 4Z8FL 1AC6A 3OAUH 3IRZA 5E2WL 2A83B 2C9AA 5HHMD 4ZDHB 4PB0H 1H8OA 4Y5YA 1X5AA 3KJ4C 4J4PD 4P23D 5ALCH 1JHKL 1Q0XL 1U95A 2P24B 2GYSA 3ARGB 4TUOA 4CVWA 5H37G 1MQKL 1NC2A 4YWGL 1BPVA 1KB9J 1P4LA 5E7FA 1E27A 1I4FB 4M43L 1BOGB 1KNOB 3WUWG 5C3LD 3GHBL 3AFLA 3HI6H 3ILPB 4NOBA 3AY4A 1ORQB 5AYUH 3LKSB 3RZCB 1QSFD 4P2QB 1FZKA 1NBQA 5DJAB 1DEEB 4AT6B 4J8RB 2HKFL 1OP3K 4J3UA 4EI6B 5J13B 1WZLA 4Y8DC 5MI0C 3GJEB 3DVGB 1KXVC 4S0TD 1LO4H 3QPQD 4ZSOA 4CJ1A 5K33A 2J1KA 4TYUA 3MRPA 3SKUD 4I0KA 3DROB 1JWSA 4NCDA 5LWYL 1D5MB 5CJQH 5KOVC 1WICA 2H26A 5BO1H 1XGRB 3WV0A 3ZE2E 3RTQC 3S37H 1OLZA 3FT2B 3KYMB 1FNGB 4M3JA 2HG5B 2HJKA 4P5KB 4I13B 5HI4C 1T2QH 1UYWH 3SGJC 4LLMA 1S9XB 3BJ91 1EGJA 1VFBB 1RJZA 4C54A 1QFHA 1N5AB 5D1ZB 4H20L 3WXWH 4ZUUA 3AU1B 1XF1A 1G7HA 3WO3B 2VLLB 5GS3A 2HFEB 5E6ID 1GYAA 1WCBB 4L3EA 2KDGA 1T7YA 3H9SB 5KSBE 1ZGLM 3RY5A 1NGZB 2EXYD 4LHUG 5K9OB 1IC4L 4RMRA 2XPGB 3HG1A 5EU3B 2X4NB 2X4UA 5TE4H 2YRZA 5LBSL 1QQDB 2D03H 1R3HB 5EBLB 5FO8B 4DN4H 3CFKA 5J12B 3IFNL 1SEQL 2ZCHL 1BVKB 1PGRB 1UWXH 3SKJL 1WAAE 4GRLC 1BZ9A 2BY2A 4WTZG 4AMKH 3B2UC 1AY1L 1QSEA 2F19L 4RSVA 4DZ8B 2LU4A 2VL5A 1T0NB 2R1XB 5C0CB 4FQ2H 4GAYA 1MCDA 3IDYB 2W0KA 2EEAA 3HE7C 3KJ6L 5TF1L 1R5VA 5E0QA 4G6KL 4KDTC 4NT6A 5EH1A 3LEYH 1XGYH 4O51A 1GJIA 4P5TA 4KMTL 1P2CA 4N0RA 4WVRA 5D1XC 4MAYD 2P46B 3BWAA 2DMCA 4UB0H 5FUOH 1X5XA 5DLML 4HIJB 3QHFH 4RMWA 3WIHA 3SO3B 1VACA 2YXMA 1I3VA 5DDHA 1FV1B 3L7EB 2YEZB 1CF8H 1UM4L 4WGWB 2X44D 1MVUB 4X5LA 4ZOCA 3RUGB 1RUAH 4CL7A 3TBWA 1U0QA 1IM3B 4H8WL 4X4XA 5GSRA 5T3XL 4RBPH 3HNTH 1HIMH 2VQUA 4YXHH 1AGDB 5TE7L 1UXWB 4J7RA 3L3IA 4WY7H 1QBMH 3CCHA 4PGCA 1CGSL 2N4IA 4OCYL 3GSNL 5HHME 4HBCH 4U1HB 4GG6E 4XP1L 3UJTL 4JRXE 4X4YB 5EOQH 4QXTB 5C2BH 4JO4L 3BRDA 1JZ7A 4PTTA 3IFOA 5HYQA 3GJFB 3HZMA 4KROC 1K6QL 3IDXH 1RHFA 5SX5H 1ZLWH 1TZGL 3BHBA 1EPFA 2GCYA 1K85A 1G9NH 1KG0A 3PWJA 3T0DA 4GJTB 4UOJA 3GDBA 3WS3B 1P7HL 5BZWB 1IGIL 3N85H 4LSDA 3NIGE 3SDAB 4ISVA 4HJGA 3TNMA 4LMQI 4CN6A 1W72L 2F53B 4WWKD 4NNYB 3OGCB 3MODL 4Z7VE 5E2UL 2Z31C 1QEWB 3U0PB 1NANH 3C60D 4JDZB 4PJCE 1JHTB 4PB9H 3GMRA 4QY8A 4XPHH 3B5TA 3T0BA 4JPWL 1A14H 1M4KA 3LAFA 3TBYB 4K7FB 4NO2A 3NFNB 2BSED 3PWUA 2PTTA 1IQDA 3MNVB 5CZXD 5A3ID 5IQ7L 2C1OA 4WW2A 5IMMA 3ZSTA 3NA9H 4JFEA 4ZTPL 3BZFA 2E7BA 2R2CA 2P5EA 3UP1A 1WBZB 3QIWC 1JL8A 4MQ7A 3U0WH 2K9UA 4M4PA 1B0RB 3MCLH 1B6UA 1CBVH 1ITCA 1UH3A 5DZLA 1LO5A 1YN6A 4NKIL 1UFUA 1KF9B 1U8LB 1DQDH 2DQDL 1T7WA 3QDGE 1J8KA 4K8RC 1J05A 1EO7A 3MRIB 4M5YL 3WLWC 1IKFL 4FQJL 5B8CA 4LVEA 2EZ0C 3KPLB 5C0RH 4U6HB 3NIDE 4AH2B 3DYPA 1IEHA 3LKOB 3BEWA 4JPVL 4HWZB 2IH3A 3EOAB 4P2OC 1G9MC 4PJ9B 5BS0B 3ULVL 4GW1B 5BQ7A 4OJFH 5E03A 3OX8A 1I75A 1WBXA 1ZVSB 2OTUA 2X70A 1GGIL 3JV6B 3CDCA 4KUCD 5D93B 3FMGH 2VLMD 4ONHB 3QFJE 4NFCA 4HKJB 3GSOA 3IJHB 4UTBH 3WO4B 4ZYKB 3VI3F 3UYPA 2IG2H 1FGVL 1EFXA 1D5IH 4L4VB 5EU5A 4QEGA 3RVWC 3TWCH 1MWAL 2D2OA 25C8H 5I76A 4I9WD 1LE5B 4G7VH 3SDCB 1R5WB 4GRMB 1KB5A 3F6LA 5I75C 1MJ8L 4Q9RL 1A7QH 2CSPA 1KIQA 1YEJH 4M61B 3MSPA 1KXTB 3ZKQD 4U1GC 2XIDA 5GS2D 2Y25A 3ULVE 2PF6A 4HKBB 3FQUA 1QOKA 1G7MB 3MA9L 5I1AB 2ERJC 5C0JB 3T8XB 2D7NA 3G5XB 1W0VA 2VN4A 2W0FA 3PNWB 4X0KB 3HI6L 4ZFFB 4YXKL 1L7TL 3O2VH 5AYUL 1T3FB 5C6TL 3QEQB 3SCMA 4I0CC 1ZXQA 4QO1A 1BZ7B 5J1AB 2NZ9D 2EIZB 4N0UB 4ZUVB 3ULSB 4FP8H 3T3MF 3H3BC 4QRPB 3CFCH 3GMPA 2AGJL 5IESL 3V6OC 5E2TL 3GRWL 2BRRL 1VKXA 2R0KL 5EIVA 4AIOA 2H32B 1TITA 4HUVB 4IRJA 5BRZB 3MTRA 1NCDH 1NUFA 3FB7B 4J3VA 1MEXL 3EOBB 3LPFA 4LSVL 3KYNB 1ORSA 3RKDD 4I0PB 1YZZA 1AKJB 4CAGA 4GKNB 5GS0H 2E27H 3O3UN 5KSBA 3QJFB 1SJEA 2NY1B 3FTGA 4NRYB 1CT8A 3QUZB 2HMID 4E5XA 3LKRB 4KVCL 1S5HB 2FX8L 4WFFD 2DQJL 3V4VL 1FE8L 2VKWA 2DLFH 3ARQA 2MOVA 3MBEA 3B9KA 5KZCB 4QOKD 2ZUQB 3QI9C 1T89A 2HJFA 4GMTH 4ZFOL 1WAAA 5FOJA 2EXWC 4HGMA 4X6BA 1KTDA 1J0IA 5D7IB 5CD3B 1I7RA 1T6WA 3MGTA 3WFBH 1Q1JL 3EO9L 1T04B 3IDIA 3P30H 5BV7H 4XCNA 1BLNA 4G6FB 1QBAA 3OZ9L 5EZOH 4JO2L 2D7TL 3CDYA 4AMKL 1JYVA 2GQHA 4HC1H 5F6HI 3RVUD 2GTWB 1EIBA 4R2GC 3W39A 4NNPL 2NY2D 1KN2H 2XQBL 4BSVB 1NC4B 5DYOB 4TN9A 1A1MB 4QXWA 2FO1A 5HI3C 5GIRA 3GIZL 3PWNB 1J1XH 4P59H 3RGVA 4JRWA 5T1LB 4ZS6C 4GKSB 5CJ5A 3S96A 2F5BH 3KNBA 3IJSB 4HCRA 3TJHC 1RIUH 3QQNA 3I6KB 2AJUH 3U7YL 1NQBA 4FQ1H 4LDEB 3CFDA 3SY0B 4YAQB 4DK6A 3ARUA 1U91B 3MLXL 4TTGA 3K2MC 2FEEI 1A7OH 3QNYA 1YYLL 4J4PA 5GHWH 4JRXA 1CTNA 3VFRA 2MPAL 3QXTA 3CZFB 4I4WB 3WUWA 1U41A 1M71B 3ZDXE 1A7RH 4WY7L 1R3IL 5A2KH 4KK5D 2G5RA 3ZTNH 2JK5B 3OJMB 3S35X 3ZKXC 2CD0A 1R3JA 4ETYA 1IGTA 1Q0YH 1KJMB 4WFEE 3MR9B 4APQB 3FO2B 1C7SA 5DEZA 3KLAB 2AI0H 5EU7C 2F58H 1OF2B 3G5VA 4EUPB 4HV8B 5C2BL 1KELL 2ED8A 1FLRL 4HHAB 5T3ZH 3FQTA 3UDWA 4EKXA 2EYRA 5EFIA 1QSFA 4UINL 3CSBA 1U8HB 4LGPB 2X4RB 5I1KH 2J88H 3L5JA 4D3CL 2DJSA 4C4KO 4NKDB 4ZOEA 5AAMA 4Z7VA 2WIIB 3MV8B 4KK9C 1YEFH 2ICWI 1UJ3A 3ZT6A 3WKNA 4PJCA 3JTSB 1I1AD 3QH3A 1DLFL 3Q3GA 4ZAKB 4KFZC 5BZDA 1GIGL 1DQLH 2FJHB 2Q1EA 4ZXBD 3MRBA 3GM0A 3TH4T 2YPLB 4GAGH 2FJGA 4JB9H 4M7LL 2VAAA 3QDJB 4PB9L 3U4EA 5DRWA 1TZHA 3ZYJA 1WSST 4YDVA 5EO1B 1HZHH 4XPHL 5AZEL 4X6FB 1R5IB 2DQEL 2C1PB 3EOTL 3FONA 3RWFB 3ZMRA 1AE6H 1A14L 5ISZB 4U1IA 1T4KB 4P3DB 3WHE0 3JBG7 3GMOA 3O6LH 2WM0A 5E6IA 3TT3L 5IB3A 1RJLB 3O3AA 4PG9A 2O26U 4C56E 4IMLB 1H8NA 4JY5L 3NA9L 4X5XA 1KCRL 4QNPF 4HX1A 4LASH 1MHHA 5C70A 5BXFA 3LIZH 4YHOH 3ARFA 4KJYA 2VISA 1ZA6B 3VGDA 1B3JA 1BAFH 2RIKA 5GS0D 3QUKA 4XC3H 4Z6AT 4X9FA 2OM5A 3VWKD 3MRFA 4P5MA 5HGBB 1JGEA 3OTTA 5I1EL 1ACYH 4WTZA 5H2BB 4Z7UE 3CJJA 3UYRL 1SY6H 3KPPA 4WHTA 3IJYB 3CX5J 4P9HH 5D8JH 4BZ2H 2VXQL 1A1OA 1X9QA 3D0VA 2QKIB 1J0KA 4NM8L 1OCWL 2DM7A 2W60A 1VSCA 2NY7H 3Q1SL 2AABL 3PL6C 1A5FL 3CLEH 3VFUA 3QFJA 4O5LL 3I02B 2WBJB 2NY5H 1C5CH 5AYQA 1YNLL 2DYPD 3M17A 3O45B 4WDIA 1AQKH 3MLTA 2N56A 2VDMH 2YD9A 4OJFL 4XCYA 4OGYH 2J8HA 2VLKB 5DRXB 2WUCH 3ES6A 4U1KB 3TO4C 5ADPH 4G8EA 2APWA 4JQVA 2A6IB 4X6CE 4MAYA 3VFTA 3UAJD 3F12B 3WE6A 2F15A 3UJJL 4PRHB 1DQJA 1CXLA 5JIPA 1AFVH 3W0WE 5CILH 3CU1A 3WNMA 5J11B 4JKLA 4E0RA 1PVHA 3AB0C 3QEUB 4XP6L 4C58B 3CFBB 4G7VL 5CP7B 1AGBB 4NJAH 1CTOA 1WISA 4KU1A 5EBMA 4WJ5A 3G04A 4OLYL 2X42A 4OQTA 4RZCA 4NUGL 3L9RB 2V7HA 1U36A 1BJ8A 1T66C 3DSFH 5F3BA 4QWWD 3DHMA 1LEIB 1CICD 1A1NB 1PY9A 4ALAL 3HZKB 4U1JA 3CDGA 1DVFC 3BPLC 3RWJB 3OAYK 4YDLB 1I9IL 5I2IA 4R8WH 5D6DA 4PJDE 5FV1L 1A8JH 4CADB 3QXAA 3CZJA 3GEWB 3RVTD 4RWYH 5A40E 4JG0H 1KJ3H 1Z0NA 5JA8B 4LCCA 4YFLI 1NCWH 3HPLA 3HR5A 4WI7A 1B9ZA 4DQOL 5I73B 2J8UF 3JWNC 2R1WA 1M6OA 3WNKA 5IFJA 5GJSL 5CP3H 4DW2H 3H3PL 4GS7C 4PLKD 3UTTB 2BSRA 1NMBH 4WWKA 2FSEA 1FL3A 1E6OL 2MHAA 5EO0A 4X9GA 4DN3H 5TF0A 3JVGA 5GRJL 3BZ4B 3MC0A 3VFPB 4HULB 1OVZA 2NLJA 5EC1A 3FN0H 4G6ML 2IH1B 1NMCC 4UU9A 1NDMA 3ARSA 5I9QC 1JPFB 2O5XH 3HMXL 3S34L 1FVEB 2X41A 3RJDA 5CCKL 8FABA 2CIKA 4OCWH 2DJ4A 3FQNA 1P9MC 5HYSA 3ECBA 4FRWA 4G42A 1UVQB 5I8OL 5JQ6H 2WK2A 1DQQA 2IFFL 1A3RL 3X13B 1A7NL 1QR1A 4S1SL 2BY0A 3SDDD 3PDDA 4CU8A 3UTQB 4DCQB 2ZSWA 3P30L 5CWSB 3UBXB 2WUBH 2YD6A 2VKXA 4HS6B 3QCUH 5JQHC 1HCFX 3O0RL 4KZEL 4NQXA 1HHHB 2CIIB 5FK9A 5HDOA 2DQCH 4PJEE 4G80A 1X5FA 4J3WA 5SV4A 1LE9A 3BMWA 3I9GL 4MB5A 3GNMH 1IL1A 3QUXC 1WEJH 5ICXA 1J1XL 3TYFA 4DVBB 4P59L 5DSCB 1KJ2L 1JZ4A 5A2IH 1DBKH 4OTXL 2GIYA 2VDKH 3MRRB 1G6RH 1UB5B 3O4OB 4DUWA 1ONQB 1CQKA 2VUOA 1RIUL 4UBDC 4OZFB 1MLCA 2DQUH 3FFDA 1KGCD 3RAJL 4OD3H 4CVZB 2R56L 3L95A 4P4RB 3ARGC 2WINB 3GB7B 4LU5L 4GAJH 5FB8B 1QVOB 1QBBA 3HS0A 2R69L 4G6JL 1B6DA 1S78C 3MLVL 5D6CB 4LRNH 4OIAA 3W82A 1K9TA 3SGKA 1WIPA 3BSZL 1F4XL 1P4BH 4MQXD 3WMSA 2YKLL 1CL7I 4PJFE 3VXUE 5GRZA 4S1DD 3VFOA 1TCRB 3RPIB 3CXDL 4P2RD 1Q0YL 4TUJA 3RZCC 4NQEB 3S36X 2BVTA 5HHOE 3O41B 4L8DA 4RMUA 3MJ6A 2UZYB 1BIHA 1RFDH 2C7UB 3N1GC 4GOSA 4Y1AE 2XWTB 4OIIH 4Y4HD 3BPCA 4JGUA 5T3ZL 3UTZB 3WN5C 5F7NC 1YNKH 1ADQL 2YPVL 2AEPH 3O6FD 2HA1A 2J88L 4B0MM 4KTDH 1A9EB 1QO3B 1MH5B 1RZJC 1EAPB 2BNUB 3DTXA 4WNQA 1YEFL 5LGJA 1EBPA 3D87B 5DD1H 3H9SD 3G6JE 4RQQA 4TQEH 1DLHA 4PRNB 3UTPE 1AD0A 1DQLL 2VDPH 2Z0BA 2H2PD 3OXSB 1SQ2N 2X4PA 3BIKA 4U0RB 5F9JB 1OPGL 5D1ZC 1KC5L 3KHOA 4C56A 4JCMA 1UZ8A 3MRHB 1EX0A 3QQ9D 2QQKL 5F97E 4LHQB 5T3ZE 4MMZC 3ZHDA 4IMKC 1Y0LA 2ZCLL 5F3HB 1I1RA 4N5UA 5DRNB 4X99A 3VGAC 1NLDH 4PJ5E 2G5BA 3FT4B 5EPMA 3BESR 5JUEH 3GK8H 1MHCA 4Z7UA 5D7LD 1FFNB 3ARTA 1K8IA 2MKLC 4W4OA 2OR9H 1IAII 2GJ6E 1X6LA 4I3SH 1CYGA 3DV6B 3WCYA 5DHVH 2RQ8A 1IGYA 2AJ3B 1TJHL 4HFUL 1SM3H 1A3LL 1A6UL 3IDYC 4LLYA 4P9HL 2QEJA 4XVUC 5D8JL 4BZ2L 4XWGL 2R2BA 4DGIL 1RZ8A 4PJAE 4LLVB 3D69B 4GXVH 2J5LB 4S2SB 3HMWH 5L88L 1U6AL 3DSNA 1JGDB 1WGOA 3K2UH 5ESAA 3MACL 3NTCL 3UTOA 3W0WA 5IFAH 5J89A 3EFDH 4XT1C 1S7RA 4XMPL 2W07A 3SO3C 4HF5H 3CAFA 3VH8A 5EUKB 3PHQB 4OCSH 4X7FC 4NHCH 1MFCL 2A1WH 2XY2A 3RNQA 5CSZB 2EC8A 4I8DA 3VD4A 4HEPG 4PGDB 1AFVL 3FAWA 5CILL 1GRWA 1T1WB 3HLAB 3PE9A 3NZHH 5DEGA 3O3DB 5L2KD 4YBLB 3MROA 4CDGC 3WNOA 5ANMA 4XNQB 2NZIA 3CH1A 3OKNB 2NY4D 1BFVH 5B3JF 4RGOH 2AV1B 4K55A 2APVA 1MCBA 2G9HB 3QQ4A 4XXDA 1KGCE 2IF7A 4PJDA 4LQ1A 1RZIB 5IBTH 4RNRA 3VJ6A 5IMKA 1N64L 3X17A 2F53D 3H9ZA 3DSFL 3EBAA 3VFMB 4YZFE 4BFGA 5HPMB 5EG6C 5DUML 4Y2OA 2A2QT 4WU5A 5KOMC 3RX5A 5DT1H 1JHLH 2HFFB 1GOHA 2P48B 3CC5B 1VFAB 4JFFE 4KV5F 4P2RE 1CD1A 3SDAC 2J6EH 3WSQH 2DB8A 4L9LB 5C0BE 2WWMC 3EOYG 4B53A 4UMGA 1F6FB 4PGBA 1I1AA 5HDLA 4DOHE 4UV4L 4Y4KB 1YQVH 1NMBL 1MCCA 4ETQA 2LTQB 3X3FH 1HHJB 1NBZB 1DE4A 5IB4A 1C7TA 2EYTA 3IAPA 5GGQL 4YPJA 2J8UB 4HUXA 1MCRA 5TFSL 1XF3A 2Q87A 1VFUA 3FN0L 3VXRD 3VFSA 5E8PB 1LD9B 4Y5XA 4MAUH 4DEPB 4PLOB 2YRLA 2XZAL 4NCC2 1C1EL 1T1ZB 5GZOC 1RJCA 2O5XL 4MD5B 4PJ8B 3TA3B 2CKBH 1NBYB 4KC3B 4NNXA 4XCEA 1MF2H 4JRYD 4ZPTA 3WHXA 1D6VH 2AP2A 1H5BB 3DXAD 1JNHB 4K3JH 1N2RA 2UZIH 5JQ6L 1WWBX 1MJ7H 1RUPH 2EO1A 2XZZA 3BP7B 3DO3A 4X9HA 1EV2E 4UDUB 3TESA 4RIRB 3GSNB 2PTVA 5D7LE 1WLHA 4PJEA 4LNVA 5KSAB 2BC4B 2WUBL 4PLJD 3QIUB 4PJ9C 1J88A 1N8ZA 4HGWA 1CN4A 2Q86B 3W2DL 3ARDD 5JHLL 5SWZB 2XWJA 4Z5RB 3CXHJ 5IK3B 4TRPH 2AK1L 4PY7B 5D93C 3SOBL 3C5SB 4CVXA 4UT7H 3LY6A 2PCPB 4IIQA 2IPTH 1Q9OB 2AEQL 3FT3B 3O11B 4HJJL 2XZQH 3IXTA 3PWLB 2CK0L 1MCEA 1CD0A 3OKDA 3U30B 3PWVA 32C2A 1KEMH 3NACH 3P0VH 3G9AB 4AQOA 1NCAL 3SDCC 2IQAB 4O2EB 3STZB 5E00B 1GC1C 1NL0L 4POZC 4PJFA 4CJ0A 4UDTA 1J5OL 4KZDL 3VXUA 1JRHL 4HC1A 4FOMA 5E8OB 5EOTB 3DX9B 1KTRL 4QTIH 4LHJB 4CUCA 5DZOA 1XIWB 1OLLA 3CSPA 4MVBC 4WI9A 1JF1A 4YPGB 1RVFL 1FZJB 3WJJC 4PGJA 1EEQA 1CICA 3OKMA 4RRPA 4F33A 3QWQB 1QLRA 4QHNA 4PJGE 1HI6A 1VGKA 3QWOA 5EO9B 4GW4A 2QBWA 1RFDL 4UQ2B 5JTWA 4MNQD 1YMMD 2H2SD 1AKJD 3G5ZB 4X8XA 4MQTB 4XPBL 3SJVB 5C86A 2XA8L 3B83A 3G6JA 1MRDL 1IM9B 4OV5A 2AEPL 4NN6B 2IALA 1LP9F 5I1LB 3BKJL 2MQCA 4OM1L 5DFVC 5GGSB 1DFBH 1MJJB 2VWEC 3BD4A 1HHGA 3MRQB 4FFZL 1AH1A 2E8YA 3W9DA 4KHTH 2NTFA 4WO4A 4JREB 2DQTH 5DI8B 2B2XH 4MD4A 4NKOB 5HGAA 1G7LA 3BGMB 3RWEA 2XKNA 1FORL 2EKSA 4A6YL 3LRSB 2NY1C 4P4KB 3GBML 4M9OA 4LLWB 3QUZC 3PGCB 4PJ5A 5DQDH 3NCBB 2W0LA 2IADB 4PBVC 2MCPL 2P43B 3PHOA 3SQBA 2W9DH 3MV7E 1JMXA 3AAZB 3CVHA 4N5ED 2ZUQC 2JIXA 1MWAB 4K8RH 1Y18A 1J1OH 1T2JA 5EN2B 2GJ6A 5FYJU 3TLRA 5EUOF 4Y7MA 5CS7A 5D7JB 4XNUH 3DRQB 1EEYB 1JWUB 1GXEA 5IFHH 4K7PH 3IU4H 2OR9L 3RIAK 1IGCL 4FQHA 4PJAA 4YFEA 1SBSH 1G9MH 4KXZI 2AK4B 4OSUL 2NNAA 4JZNA 2CR6A 3MV9D 4I3SL 4RX4D 2ADGA 5IBUG 2VB5A 3GSWB 2A74B 2XRAH 5DMKA 4IRSB 5FHBH 3VWJB 5E8EB 5B22A 4PD4K 4GW5A 1AR1C 1BD2D 3DO7B 1DBMH 3HHRB 2NX5B 3MRDB 4D0CA 3HMWL 4GRLD 3N9GL 1HXMB 3T4AB 1MFDH 4WV1B 5DJ0A 4YHKL 3BQUB 1AD9A 3EO1A 2ZKHL 1CG9A 4BH8B 3FQXA 1O5DT 4KKBD 4KRLB 3D9AH 4HF5L 1SY6A 4HSQA 2QL1A 1F42A 1MNUH 3DX7B 7FABL 1JE6A 2E3VA 3DETD 2DTMH 5DRZB 2X1QA 1JYNA 1IC7L 3CUPB 4PJXE 2Y6SC 4R7DB 1JV5B 5KSUA 5GGVY 1X3DA 1A47A 4JFDD 4MA3B 4WHCA 4RGOL 3RA7L 1SYVB 4APQC 2DDQH 3IS0X 5BW7C 5MEQA 1X5ZA 3WEXA 5D1QB 1IQWH 2Y7QB 3CSYA 4HMEA 4LCWD 3U1SL 1MOEA 2GT9B 4JFFA 5E8NA 2BVOA 2YPLD 4P2RA 4G8GD 2ICEA 5HHPB 3WIIL 4LVHB 5I18H 5KSVB 5C0BA 1KPUA 5TDNB 4Y4HA 3HNVH 4UV7L 4XAKD 5CGTA 2GUOB 4TVPD 3O6FA 1HH9A 5F1IA 4ZUTB 4YDIH 1U2CA 3MXVL 4MNQE 2HWZH 3GMNA 3C08L 1G7IB 3LEXB 3K8LA 2FNBA 2QR0B 4Z7QE 4X8JA 1S9VA 3KPRD 3X3FL 4XNYL 3KS0J 3KPNA 2GTZA 4LSRL 3E6FB 4G9FD 2CJUH 3C5ZB 4H1LH 2XQYG 4JZJB 4MDIB 4XGZB 2CLRA 2YC1B 5DMIL 2FX7L 5DJ2B 2N7AA 1V7ML 2VDLL 1FYTD 1S7TA 1U58A 3O3EA 5CP3A 3RL1B 1DUYB 4WEUD 2YUXA 5FA3B 2ICWB 1L6XA 1T7ZA 2CKBL 3PABA 5E08H 4G5ZL 3EYQC 5KJRL 5FHAL 5D7LA 1I3GH 4KTEH 2UZIL 2FIKA 4JFHD 2A77H 3WXVH 1J0JA 3MRJB 3KLHD 1INDL 1HYSC 4R4ND 5DJ8B 2W9LA 4PREA 4FXGB 3V95A 4MA8L 1GGUA 1FNEA 4YIQB 5EA0L 5L9DH 2WBJC 4TVSa 3VDAA 4YDKH 3WLWD 4F57L 2OL3H 4M7JL 5I1HH 1VESA 1QSVA 1KPVA 2EZ0D 5AWNL 1HOCB 2NW2A 3R0MA 5DEFA 4YHPB 4LGRB 4UT7L 5FCUH 3MLRH 3NCYS 4P49A 1NGYB 4O58H 3RIFK 1K4DA 1V7NH 3X12B 1JTPA 3I85A 3OR6A 5AD0A 1KEML 3QO1A 1VERA 3ULUF 5J11C 2VLRB 4KDWA 5LG1A 2DLTA 3QDMB 3GSQA 1PX4A 3E2HB 4P9MH 1QRND 4YR6A 1HKFA 3T2QA 4NQVB 3ZTJG 2P42B 3SDXF 1L9MA 2ZNXA 4B5EA 5HVGB 2NY0D 5F7MC 3MREA 1MCPH 5T5NG 1XGPA 5HXMA 2ILLA 3EYUH 4IOFD 4ELME 2QADB 4NGHH 4GG8B 3QUML 1CFBA 2QHRH 2UWEF 3KPMA 3TEUA 3UPAA 1JMZA 2IEPA 4FMKA 1G6RA 5HYEA 3FB6A 2FO4A 4L29B 2P8PA 1DR9A 4G7YL 2LV4A 2J8OA 1A6WH 4LCWE 3ABZA 5CZKA 5I73C 4DKAA 4JDVA 4NM4H 4K3DL 3CH8A 5J1TC 1LK2A 3AXLA 2OBGA 4ZPVB 1QYGL 3MJ8A 1WWCA 1MIML 1DFBL 3KYOA 1P4IH 3LQAL 2PYEE 1LEKB 5IVXE 4OLEA 4KHTL 1RHHA 4ODUB 4AEIL 4XAKE 2DQTL 1JUFA 4YDJA 2B2XL 4TVPE 4AEHH 3IFLH 3INUL 5C07D 4FHBD 2D9CA 1LP9B 1D5XB 2CLZB 4Y5VA 3TBVA 4U1SA 3VW3H 2VDOH 5D7KD 5IG7B 1R3KA 2VITB 4FFVC 4RAUA 1MCOH 3VXRA 3KG5A 5HYIA 1C5DA 4HS3A 1JVKA 2BOBA 3AREB 4HFWB 1PKQB 4XNMA 3MRCA 5I1IL 4OBSA 4HLZH 1SYSB 1DN0B 4MNGE 1G1CA 4MX7B 3MYZA 3EDEA 5TQ0H 3FOLB 4OUUB 1TQCB 3JV4A 1T20B 3FFCD 4DGVL 3D18B 3EDJA 3P3YA 2D4FA 4TSCL 3T09A 1CZ8H 3DUSB 4GAFB 1OQXA 1XF5A 2DIJA 4W6XB 5IFHL 3FHAA 4LK4A 4W6WB 4KRPD 2JF1A 2V7NA 1TVBA 3HTLX 1XGQB 1D9KC 1OD9A 4H1LG 4HKZB 3L5WA 3DBXB 5EZJB 5DQ9A 5HYJB 3BH8A 3QXVA 4JFQA 2OX5A 2WWKT 4JG1L 5HHXL 2BY1A 5CSBA 3TCXA 5EUOB 1QBLL 2ATPA 4Z76B 4NUJB 4L3CB 3ARDA 3V8OA 1ITBB 3MFFA 1HNFA 3NA4A 1MFEH 4LRIA 4AL8H 3DMMD 4XBPB 1B0GA 1KCKA 2NXYD 4IRZH 5DURB 3ZHKA 3I75B 3IF1A 5B38B 4HWEL 4MMXC 1PFCA 5HJ3A 4YHYB 5C9JB 3G5YB 4R2GD 3O4OC 3U36A 5C0FB 4ODVL 3ZKMD 5DHVA 4XZUA 2ADJB 3MRLA 5K9JL 3CGTA 3D9AL 1NEZG 1D5BB 4NQDD 5JW5A 5F7YC 3ZDYF 2DQGL 3OJ2C 2P45B 3HFML 4LIQL 3D0LA 1BVLB 4PRAA 4WFHD 1YMHA 2RGSA 4WW2F 1KYOJ 4XVTL 3FZUD 1KLGB 1G7PA 4IS6A 1ZT7A 4N68A 3QHTC 1QRNE 3UEZA 5ICYA 35C8L 3QXUA 4IHOA 5L6YL 2R8SH 2Z93A 4NO0B 1YNTB 3TIDB 1IZKA 4M1CC 2PXYD 5KVDL 4J1UA 4PRBA 1G7QA 3QIBB 4JHBA 5BMFH 5J6HA 3RWDB 4HUUB 3FB5A 4MA7H 3R8QA 3ESUF 2PR4H 3EKCA 3V4PL 4MNQA 5B4MD 2ESVD 1JNLL 4YHLH 5FDWB 1EXUA 1T1YB 1NKRA 1E4WH 3GSXB 1JZ2A 4NWTH 3AS3A 2I9LB 1BJ1H 5FO7A 5ECJE 3LN5B 4FQXB 4NDMA 4OCMC 1GZQB 3SKNB 4YX2H 3GUTB 4U0RC 2DKUA 4M6NL 1NJ9A 2APBA 1QNZH 2ITCB 5DWUL 3D39E 5EBGA 3KPSE 5C0DA 3PWPE 4WI2A 4YNYA 4NZTL 3QUYB 4HJ0D 1J0ZA 2I26N 3RFZC 3VDCA 1EUUA 3A6BL 4BH7A 3T4YB 4PRIB 5IIEA 3ROLA 2J6EA 2X4QA 5EORL 5CBAB 2BP3A 3BN9D 1KJ2B 1MHPL 3MMEB 4PTUA 6FABL 2XN9E 5C07E 2D31A 4YBQC 3RI5K 3T2PA 4NC1C 3SGJA 2YUWA 4ZD3H 1NDGB 1TMCB 3BZEA 3LDBB 1VB9A 2B7DT 4LF3B 4U31A 3U2SA 1I1CA 3GBLA 4ODHH 4HDIB 1OW0C 4MCZB 2OJZH 1V3KA 2X4SA 1U95B 4TUOB 3DHJA 4RX4A 1NC2B 4S1QH 3IYLW 1AXSA 2J5LC 1P4LB 1E27B 1T5XB 4MSWA 5L9DL 4YO0B 4J23A 3LQZA 2NY6B 4YDKL 2OL3L 4HLZG 3DJ9A 1OGTA 1OSZA 3D3VE 4Z7NE 5I1HL 4LQFH 3X3GL 4LARH 1LDPL 1FRGL 4GRLA 4F2MB 1CU4H 3MA7A 5IBLC 3QRGH 4M5ZL 1FZKB 4BSWA 1JZ6A 1CIUA 15C8L 4O58L 3NZ8A 3HE7A 1FSKC 2AJVL 3TP4A 5C8JA 4KDTA 1KLUA 2B0SL 5DS8A 3BXNA 2HFTA 2DMKA 4ZSOB 2XICA 4XHJC 4YBLC 2EDBA 3MRPB 2VLJD 4AK1A 4Z95L 5D1XA 1JWSB 4Y16D 3VMOA 4P9ML 4ELMA 1NANI 4KK6C 4HMCA 2YSSA 1KLFA 2BZDA 4JVUA 3GI9L 2LABA 3OKKA 2KPNA 1LWRA 2HT3D 5JDSB 2QQLH 2HJKB 4P46C 5GGUA 3KYKL 4F7MA 4NGHL 4LLMB 1RJZB 4LCWA 4LNRA 1ZHLA 4ZUUB 1UXSA 3RNKA 3SE3C 5J9PA 1G7HB 1BQHB 1KIPA 3VFVA 4F9LC 1RZJH 5C0AE 1D5ZA 4G8GA 4MJ2A 1ACZA 2RCSH 3BO8A 5L7XH 3WL9A 1GOGA 1MCNA 3TJEH 4BKLB 4XNZB 4BM7A 1A6WL 3QCVH 5IVXA 4L9LC 4N8VA 4PR5A 2WSKA 4S11A 4NM4L 4LAQH 1EHLH 2FL5A 4YE4H 3MRNB 5F7FA 1Q8MA 4WWID 1I8IA 1IEBB 3BW9B 4OKVB 4Y4KC 3HG1B 4AJ0A 2VSDA 1OARL 3B8SA 4KY1L 4QHUA 1UQSB 5LVEA 1P4IL 5EU7E 3C9NA 3L5XH 5I15H 3CFKB 3NH7H 1U3HC 2FBJH 5DXWA 1JF6A 4TUKL 1BZ9B 1XEDA 3KPRA 1RUQH 2F5AH 1QSEB 2IPUK 4DEPC 2VL5B 4GAYB 4MNGA 4PJ7E 4NT6B 1T5WA 5DJ6A 3BE1H 4O51B 4PJ8C 3TA3C 3QIUD 2X10A 2XKUA 4P5TB 1UJTA 4HWBA 2VZ3A 4OFPA 5SWZD 5IEHB 3BWAB 1YY8A 1TJGH 3T0ED 3HE6D 4HPOH 4DVRL 4H8WC 3R06B 5TQ0L 3U4BH 4N9OB 5M7QA 1JNNL 3FRUA 1VACB 3NPZB 4H26A 2JB6B 4XAWH 2NY3C 2F54D 5KSAC 2WP3T 3TBWB 4ONFL 3AM8C 4Z18A 3RDTD 5FYJH 4X4XB 5GSRB 2HVJA 3EJZD 1REIA 3BAEH 2N7BA 4NP4L 1G0DA 3L3IB 2VZTA 3BWUC 3WFCL 2Y06H 4PGCB 5EZIH 3MQIA 3MUZ1 1FYHB 5ADOH 2W9EL 1BF2A 4N0CC 4B7IA 1WK0A 4HH9B 4AL8L 4JFYA 5ACZA 3BD5A 5HHQA 3U30C 1KJVA 1TNMA 2X1WL 3HZMB 2CGRL 2UVFA 4IOIA 4PS4L 5HHNA 2EDOA 5DF0A 3TV3H 3BHBB 4ZQKA 1JP5A 2DN7A 1YY9D 2C4FT 1XR8A 4LCUA 3PWJB 1Q9KA 1FAIH 3ZHLA 2UYLA 2E7LC 2EH8L 2EYSA 1XIWC 4HJGB 1QRNA 3LKQB 1FZOB 5E1AB 1N3NB 3GJFH 4Z78A 2EDDA 2HTKD 5HD8C 1FL6A 2HN7A 2L4OA 4KKLC 1JN6A 3GMRB 3BYTA 3JTTA 4QY8B 3S88L 3DYOA 3ZYOA 3V0AC 3F7VA 5F6IB 5C6PB 2CRIA 1FGNL 5DMJB 1A7PL 1I9JL 3RVVD 4NO2B 5HI5C 3NIDF 4AEEA 5IW6A 3ARPA 3PWUB 4UI2A 5F7UA 1AI1L 5IJKA 2QQQA 4WW2B 4Q2ZB 4LPXA 1EA9C 4NN6C 3SE9L 3UZVB 4JFEB 3BZFB 3I2CL 2P5EB 2J7LA 4MQ7B 4OCNC 3RWCA 5AZ2L 2DQFA 3TNNA 1ZOXA 3KPSA 3F7PC 4JREC 3MLYH 4YUEL 4ERSH 1R24A 3ROOA 4QRRB 1J05B 4WCYH 3O2WH 1UCBH 2HT4D 1QNZL 3FRPG 5B8CB 1QFOA 4P4KC 1HHKA 3W9EA 2XN9A 5C07A 1M7IA 5GGSY 3BEWB 3DIFA 1FZMA 3OV6A 1JCKA 2DL2A 1EJOH 3EIFA 4W68A 5BQ7B 2JJTC 3B2VH 4U1LB 3CX2A 3MV11 1IE5A 2W0PA 3OX8B 4HZLA 4JO1L 5CGYC 4IRSD 3MZGB 1WBXB 4JY6A 2OTUB 5J3HD 2X70B 2Z91B 3RWHA 4KHXH 5EBWA 2ZOKA 2VMFA 3K1DA 5D7JC 1RUML 4YH6A 4YXLH 1EFXB 4W6YB 1UZ6F 4R4BA 5LCVL 5I76B 2JELH 4U3HA 4H1LA 1D7FA 4MXQD 1PLGH 4L5FH 3BPNB 3S4SA 3T0EE 4XNXH 5MERB 4MZ2A 3B3IB 3VWJC 4YQXL 4KK8C 4GO6B 4R4FL 1KIQB 1UWEH 3QI9A 3D3VA 1S7SB 1YEIH 3WFHA 5DK0B 5EU6B 4I5BA 3FQUB 2XFXA 1UM5H 2NYYD 4LKCB 4UTAH 2R2HA 2BHUA 4WV1C 3C09C 4OKDA 4PJBE 3BQUC 4KJQD 5SWQA 3K8KA 1WC7A 1CLZL 5KVMC 4XVUD 3DMMA 4LQFL 4WEBH 4LARL 1WZMA 1AP2A 4JPKH 5E9DD 3QULB 5LAXA 4XVSL 1NEZA 4YFDB 4PJHF 5FYJD 1VADB 1BEYH 5ITBH 1CFSA 2H1PL 4QRUB 5SWSE 3MGOA 1S9WA 1GGCH 3H6JA 1V3LA 2JJSC 2XYCA 5I1GH 2R1YA 1VKXB 3GIVA 1BIIA 1JWMA 2J2ZA 1IJ9A 1F4HA 3MBXL 4QHMA 2R0ZL 4C57C 4IRJB 3WIFA 3GSVA 2KQNA 4A6YB 1A6AA 2XNAB 2Z8WC 2ADFL 5D1QC 2VL4A 3N0PB 4J2XA 3MOAH 4ORGA 5JW4N 1VEPA 3IDMB 1CWVA 3T3PE 5JR1L 1C12A 1U8MA 4ZUSA 1JPTH 4OCLC 4UQ3B 4LVHC 1C5BH 4V1DB 4JM2D 4D9LH 2OZ4L 3VRLF 3NN8A 1JGUL 4FTVD 4EIZC 4MGXA 1MAML 2OS7A 5DA4A 1G84A 1Y6NR 1SJEB 3FTGB 2APTA 1KSRA 2XA3A 4E5XB 2ZOLA 1RZJL 5CINH 3P4MB 3C5ZD 1H3VA 2OMBA 2ADIA 3MBEB 2ESVA 3B9KB 4QYOB 3BGFB 2DD8H 4OM0H 4LAQL 4CVUA 4MWFA 1NUNB 3IAQA 1WJ3A 3M07A 1KTDB 1I7RB 1MFAH 3MGTB 3VDBA 2EECA 4P2QE 1IGJA 3IDIB 4PJ7A 4FZEL 2M26A 4XCNB 5BVPH 2WWMD 4KUCF 2ATKA 4Y2DB 2FBJL 4JJ5A 3EJYD 1F58H 1HHIA 1M05A 5JNYB 1U93B 3SHSA 4CBPA 1XGUA 2NW3A 1RIVL 4HIEB 2P44B 2DQIL 2YMXH 1MSPA 5KS9F 2LE9A 4YBHA 3ZDXF 2X40A 3TBSA 3IU3A 4H88H 1DQTA 2CDFA 5LGHL 2CRMA 4BZYA 3KXFD 1XGTA 1CD9B 5GIRB 3GMMA 3D85A 3RGVB 3VG0H 2ZZUT 1OSPL 4NQCB 4IDJH 4HIXH 5CJXA 1RZKH 5F1KC 2P1YA 5INCA 5GZOD 5IWLA 2IAMB 1PD6A 3S35L 3CFDB 4XCFH 3DV4A 4ZFGL 4IJ3B 5HHMB 2VXUH 3OKOA 3CDFA 2ID5A 3E6HA 3FB8A 4P23B 4QTHB 3VFRB 1N7ML 2Y9RT 1BQLL 4NQSA 4XPGH 4OZGF 1LHZA 5GRYA 1P6AB 2Y06L 5ESVB 3H7BB 5EZIL 1CFTA 5I1JH 1LK3H 5C0EB 5ADOL 1AXTH 4R3SA 3OKEA 4ODXB 4QRSA 2YUVA 4L8BA 3H9HA 3PL6A 4FQQA 4FS0A 2EYRB 3V0VB 3V52H 1QSFB 3WNPA 1YJDL 5DFWH 2Q8BH 4U6YA 3E2HC 1HK6A 4XX1E 5C0CE 5TPWL 3V0WH 1FAIL 4XPTL 5DK2A 1PG7H 4LFHG 5FKAB 2VLJA 4M8QA 1BFTA 3QH3B 1J9CT 4Y16A 5BZDB 5FYJE 1KENH 1RAMA 5JIKA 1CXIA 2ZUUA 2QQNL 3MRBB 5CHNA 1NLBH 5E94A 2AJXH 5HDBF 3CMOL 3FQRA 2DMBA 2VAAB 1IAMA 4J6RH 3U4EB 5DRWB 1TZHB 4JHAH 2PO6D 1JTTA 3FONB 3VXOB 1F00I 3BH9A 4U1IB 5CBEA 5GXBB 4Y0GA 1FG9C 2YBRB 1UM6L 2X4OA 2B1HL 4KAQL 5KVFH 3L5IA 5I6XB 4DWHA 5E6IB 1GVIA 3O3AB 1AIFA 5FXCH 3T65A 5IGXH 5B21A 4P3CL 1FAKT 1M7DA 2PYFA 1MHHB 3LSOA 5BXFB 1EO5A 1DVFA 3SGEH 1J12A 1INQB 1MHEA 3TIEA 5ID1A 1UA6H 5IVZA 2WBKA 3NABL 5DD5L 2VXSL 2I60H 2BNRD 3T2NH 4LSPH 3W11D 2X9YA 2G60H 4P5MB 2BOCA 4WCYL 2ED7A 5JPMB 3KPPB 5F70A 3TPUA 1S5IL 1DL7H 1YEDA 1OWRM 2HTLD 1A1OB 5EDXA 4ORZC 3D0VB 4XH2A 5F21B 2A0LD 1WT5C 3VFUB 3E3QC 1X5KA 2ED9A 3IGAA 3AREC 4N9GA 3M17B 1EJOL 3MLTB 3F6IA 2JE8A 4XCYB 1NUGA 1GH7A 1RI8A 3M8OH 3P9LA 2YR3A 1K4CA 4KPHH 4R26H 5I8KL 1TQCC 3ARXA 1FNSH 2GJZA 4G8EB 3UX9B 4F58L 4MAYB 1CDHA 3HAEH 3T0EA 3WE6B 1T22B 2FIRT 4MJID 4PJDF 5I74B 2MJWA 1KFAL 3FO0H 5D7SL 3EDFA 3KXFE 3WLBA 1AGFA 2Z4QB 3IAGC 4E0RB 1J8HD 4KKNA 5FFLA 1XCQA 4NC0B 1RK1B 4WJ5B 3ORJA 3QUMB 4PJBA 1I9RH 5ITFB 5TE6H 5JORB 4RZCB 1IAOA 1OAXL 5E5RB 3RDTA 2V7HB 4GFTB 3H42H 4XXCC 5I19H 4TSAH 1XZ0A 5ALBH 1XH3A 3MRMA 5KTEH 4HK0A 1H3UA 5F3BB 4UTAL 4U1JB 4YHYC 3HC4H 5SWSA 3P4NA 3O3BA 3MJ9H 5T33H 1V8HA 1AO7D 2OI9B 2X89D 3BMVA 1FFRA 1GC1L 5HGHA 4YHMH 1PY4A 2RFXA 4JPKL 1ZS8B 1CLOH 4TNVK 1FO0H 4P57A 1RIHH 1S3KL 1E4XL 4R0LA 5I16B 3T0AA 3HPLB 3HR5B 4F7TA 5JW4M 3ET9F 2ZNWA 2R1WB 3QUXA 4F7EA 1IZJA 1RUKH 4L1DA 2A9NH 1BM3L 2NXZD 2VDRH 4XBGB 5F44A 1KEGH 3I3EA 3OL2A 3KGRA 2O61A 2BSRB 4WWKB 3O6MH 2FSEB 3Q0HA 1FL3B 4KI1A 5T5FL 4L4VE 3C60B 4UT6H 4JO3H 2NLJB 1CFVL 5EC1B 2DLIA 4BYHA 1I4FA 1EO8L 3VFGH 2Y36H 3C5JA 5JXEC 4UU9B 1N0XL 5DR5H 2CMRH 4RMTA 3EZ8A 1HINH 5C0IB 1NGWA 8FABB 2CIKB 1ORQA 3FQNB 2DM3A 5HYSB 3LKSA 4P2QA 1Z5LB 1DEEA 3R4DA 4G42B 3HR6A 2DD8L 4G3YL 1MCJA 4FQXC 5HDQH 1MREL 1DQQB 4PYGA 4GSDH 2Q20A 3DVGA 3WN5A 1QR1B 1BFOA 4UOW1 4M6AA 3CK0H 3QEQE 3ZL4L 1AJ7H 1MVFA 3QUYC 4UNTA 2CO7B 3OAZH 4KUZL 4N0UE 5BVPL 1PQZA 2C26A 2EE2A 3B9VA 4QRPE 4K94L 5MP6H 4JLRB 3LS5H 2BNRE 1XGRA 1ZGLA 3O81A 2X6MA 5CEZH 2D9QB 2H41A 4NQXB 4QXGH 3TYGH 3THML 5FK9B 2ORBH 4EOWL 4JFXB 2BVQB 4G80B 1B2WL 3QO0B 5BRZE 1S9XA 2VWEE 3LDBC 1IL1B 3ESVF 2HKHH 3MUGA 5ICXB 2HFEA 4OIBA 3HC0A 1P1ZB 5D2LF 3A6CL 5ERWA 5ID0B 2MMXA 3D6GA 4QHLA 3PXJA 1NMAH 2CO6B 3CFEA 4NZUL 1CQYA 1F8TH 2YXFA 3HA0A 3FFDB 1C8PA 5KS9B 1NGZA 3L95B 1WIUA 3QYCA 4HXBH 2E9BA 2BMKA 2NCMA 3S36L 3IFPB 3CFJA 4M7KH 3SPVB 4OZIE 1QQDA 4Q74A 1NFDF 4JFPB 5FDYA 2JKXA 1I85A 4LDOB 5JO5A 5GGVL 1QG3A 4K9EL 3C2AL 1LO2H 3Q6FB 5TDOA 3N1PC 1L4IA 4OZFH 4TUJB 1LK3L 2BCKA 2J4WH 4YHZL 4DZ8A 3NFPA 1RU9L 5C0CA 1F2QA 5F9WB 3SQOH 4XMKH 5IROA 3TT1L 1ZLVK 3B8YA 3O9WC 4ZODA 1T0MB 1S7XA 1TJIH 5E9DA 1NH6A 2BJMH 4I2XA 5JZ7C 4XWOC 2N1KA 4OZGB 3D25A 5FYKL 2AVGA 4JN1H 2Q8BL 2W92A 5C71A 2BSSB 3LEVL 4XB8A 4MNHB 1INEH 4WNQB 5LGJB 1AO7E 4L3ED 4HIJA 4JQXA 2W38A 2I24N 4WHDA 4RQQB 4U3XA 1DLHB 3L7EA 3ULUC 1I8MB 4OZ4A 4M4RA 3ZKSD 2X4PB 3BIKB 4RGNC 4EDXA 1IC5L 4JR9H 1F4WL 2BERA 3KLDA 2VDQL 3PG2A 4KKAD 3U7WL 1RZFL 3MJ7A 2VXVH 3O6KH 4ACPA 3PIQB 4XNZC 4U1HA 2VRAA 3MFGB 4PJAF 1Y0LB 2KKQA 3LV3B 1QSED 3U79A 4X99B 5IGXL 2G5BB 4FZ8L 3GJFA 5TQ2H 4FFYL 4N0FB 5EPMB 2OSLB 3U83A 3U6RA 4QOKB 2ARJA 4AG4H 1IKNC 5GGTL 1K8IB 5DJZA 1DBBH 3Q6GL 3RKPA 3DARA 3WS3A 3T2NL 2EC9U 5F1NA 3P0YH 3P4LA 1QUNA 1S7WA 1IGYB 3SDAA 2SEBA 1SEBA 4LLAA 4Z8FH 4N0YL 4NNYA 2ENYA 2LVCA 2R2BB 5E2WH 4ONGL 1FCGA 1H3GA 1RZ8B 3U0PA 5HVWA 5CJ8A 3TF7C 1NGQH 4F8QA 3NCCB 3NAAL 1JHKH 4P5TC 5ESAB 3OJVC 4N90D 1MQKH 2NY2B 3S5LG 2K7QA 4YWGH 1CDCA 1LNUB 3AROA 4K7FA 4M43H 4I18A 1S7RB 3KXFA 4YZFF 1FNSL 4CRPA 3QDJE 1M7XA 4FFVD 3EYSL 2EDHA 3VH8B 1RJYB 2D7OA 4KKCC 1WBZA 5ISZE 3FO0L 4RGMB 1B0RA 1E28A 4NYLA 3QZWB 2HKFH 1Z9MA 3DVNB 5DJYA 4HIIB 5ANMB 5GISH 3KDMB 1QFWL 5TE6L 3CH1B 1MUJA 3CU7A 3MNWA 3MRIA 4XXDB 4PJDB 3BT2H 5LWYH 1KTLA 3VJ6B 4RNRB 5IMKB 1D9KD 3B5GA 1U8OA 4AH2A 3UBXG 3C8HA 3ILQC 5CZVL 5C0NC 3KVQA 4WU5B 1ZT4B 4AM0A 2XACC 4YHML 3QDHA 1CLOL 1ZVSA 1X5YA 4H20H 3JV6A 1CD1B 3KPQA 3IJHA 1XCTA 4PUBL 1W0WB 3LB6C 4JFED 1RUKL 4L4VA 2A9NL 2VLKE 1WITA 4PGBB 1I1AB 1KEGL 4M62L 4NRZA 4GKOA 1LE5A 1WFTA 3SDCA 4K3EL 5F6IC 4ETQB 1IC4H 4GRMA 2BVUA 4OZFG 4Q9CA 1XT5A 1DE4B 4PRHE 4PP1C 1OP5K 5IB4B 1S7UB 2FGWL 1V05A 4JO3L 1OHQA 2PW2A 4HUXB 4FN0A 1XF3B 2G75A 2PO6A 5FKPA 4WW2C 3VFSB 3BGAA 3IFNH 1SEQH 5IB2A 5C0JA 2DWEA 3SKJH 1MI5D 1XR9B 3G5XA 3FL7A 4G9DA 3PNWA 4X0KA 2F19H 1HINL 1E4JA 1UENA 1T83C 3VI3E 5TF1H 2H45A 3KJ6H 1T3FA 3LKPA 4G6KH 4NNXB 3GM8A 3QEQA 4ZPTB 1JPSL 3WHXB 5C9KA 4PPTA 3OJDB 2FYYA 2EIZA 4WFGE 2Z9TA 1N2RB 1OAKL 2H8PB 2JJVA 4N0UA 3RUGF 1G6VK 4KMTH 4OAWA 3S3SA 3BISA 3JXAA 2BNRA 3IRPX 4OLZL 4JGJA 4ZO8A 5DLMH 2E5EA 4R6UA 1EFXD 1ZT1A 2X9XA 1N5YH 4PJEB 3NGBB 4PBXA 5BRZA 1KACB 1N8ZB 4HGWB 4XC1L 1ETZA 1JGLL 2IMNA 3LS5L 4HMDA 5F7HA 4MS8C 2XWJB 1OWWA 4H8WH 4WUUD 5T3XH 5HGDA 5TE7H 3UTTE 3WNLA 4IIQB 4O9HL 2GSIA 4OLUL 3QJFA 1CGSH 4FXKA 4OCYH 3GSNH 5C0GA 3PWVB 3QUZA 4XP1H 32C2B 3T3ME 3UJTH 2GFBB 3O2DL 3S37X 4JO4H 4N90E 1WBYA 4OZIA 1URLA 1PSKL 3BPNC 3KS0H 3SCMD 4KTYA 1O0VA 3RIAF 4UDTB 1TZGH 3VXUB 5DJCA 1J8HA 1GHFL 4OBRA 2F8OA 3QFDB 4MD0B 4RWHA 4QHKJ 5MEND 1IGIH 1T04A 5CEZE 4NPYA 3G6DL 5DMGC 2VIRB 1JF1B 5SV3A 4KVNL 5FA4B 1W72H 4PG2A 5AG9A 3DX6B 3MCG1 3MODH 1CICB 4BFEA 1QLRB 2GTWA 3MUJA 4JKPL 4QHNB 3SQOL 1HI6B 4XMKL 1VGKB 4GW4B 1AO7A 2X89A 1NFDB 2BJML 1A1MA 3QAZB 1WFOA 2IALB 5BJTA 2HLAA 5T1LA 5IB1B 4IRJC 4HH8A 1HHGB 5I8EA 1ZK9A 3IJSA 4ZTPH 1PEWA 5IM7B 3W9DB 3I6KA 2NTFB 3CVIL 3OXRA 4Z0BL 4MD4B 3E8UL 2Z8RA 2X4TA 1SVCP 3RY4A 2J3SA 5HGAB 4NKIH 1U91A 5DO2D 4EVNA 3DNKA 1AGEB 3RWEB 2EKSB 4N1EA 2DQDH 4JR9L 5F7EL 3CZFA 2W59A 1NCBL 1M71A 5DHYA 4M5YH 1ZVYA 1I7TA 3O6KL 4QRTA 3HC3H 5E99H 1IFHL 4FQJH 4UIKL 1MCHA 3PHOB 1U8JB 1UC6A 4P46D 3VXQA 4U6VH 3B9KC 3G9VA 5BW7A 1OF2A 3CVHB 4HV8A 1EERB 1MPAL 4JPVH 2JIXB 1Y18B 2AJSL 5IT2H 4X6EA 3HB3D 1U8HA 2E6PA 2VXTL 2IFGA 2FJFA 1GCFA 1GGIH 4AG4L 4NKDA 1DBBL 3R0NA 3I6LE 1QTYT 4FQHB 4PJAB 4LCIL 4Y2DC 4PY8J 3SDDB 3SO5A 2NNAB 4JZNB 3JTSA 1FGVH 5IB5A 2BRQA 1MWAH 3UJIL 2MQ3A 4Y4FC 1FFOA 2AJZA 3BVNA 4M02A 2P8LA 4GW5B 1A6VL 1JPGB 1MJ8H 4JRXD 4Q9RH 1NGQL 4PJIF 1I9EA 4C83A 4X6FA 4L8CA 5ACLA 3RGVC 2BX5A 4NZRL 1AD9B 2LFGA 3EO1B 5ISZA 3L3DB 3S7GA 1T4KA 2Q3ZA 3JWOL 3MA9H 3QNXA 1OTSC 1H3PL 4OI8A 1NAMA 2IAMC 1OAZL 5B3NA 4IMLA 1PX3A 4WUUE 4S1RL 1ULVA 4YC2B 4OB5H 4IJ3C 4YXKH 3L3JA 1L7TH 5C6TH 4OI9A 3EYOA 2V2WA 4J4PC 1UKSA 4OFVA 4P23C 1CDUA 4H5SB 2ZG1A 4JM4L 5T3XD 1N4XH 5D72L 1EEZA 5GISL 1QR4A 2AGJH 5IESH 2WIMA 5E2TH 3GRWH 5HGBA 2BRRH 2R0KH 4NC1E 5MEQB 2VZSA 3FOMA 3BT2L 3WEXB 3IJYA 3PXHA 3CSYB 3MXWL 3HAEA 3WS6A 1H0DA 4JFFB 1MCSA 1IEAB 2C5DC 2LU3A 2BVOB 2V5TA 5E8NB 1MEXH 4P2RB 2ICEB 4L4TD 5CEYA 2EDEA 4LSVH 5MENE 3I02A 1WZKA 3RIFF 4OLXH 4MXWL 4QNPE 5MHSD 1KN4L 3TH3T 1F6LL 4Y4HB 2VLKA 1T2XA 3KWWA 4U1KA 4OFYA 3O6FB 3L7FA 5D7IF 5F1IB 2A6IA 3EDDA 4KVCH 1KULA 3Q5YA 4U0QB 2FX8H 4D0BA 3TGXA 2DQJH 4RFNB 3V4VH 4LHUD 3H0TA 1FE8H 3VI4F 4JZOA 4EEEA 3QDGD 3GMNB 1VEMA 4LLQA 2BVPA 2I5YL 1EHNA 3ARFD 1RULL 4X7EC 3QEUA 2AXJA 3MJ9A 3ZDZE 5GZND 3CFBA 5CFHA 1B90A 4X8JB 1S9VB 4WTWA 2X05A 1FFQA 3KPNB 3OKLA 1FO0A 4ESKA 2YD2A 1Q1JH 3EO9H 1R0AH 4U7KA 3FQWA 2CLRB 3X14A 5E6IC 4R90L 5AEAA 4AZ8A 1J87A 1S7TB 3OZ9H 2Y07L 4JO2H 1LEIA 3C2SA 1UGNA 5DVNA 2D7TH 3O3EB 3HZKA 4Z77A 2H9GA 3QFJD 4GKZB 2FH8A 3RWJA 2EXYC 3K81A 2V5MA 4NNPH 1N6VA 1A4KA 2XQBH 4HG4K 5D7LB 1Q9LA 5DC0A 4CNIA 2ZJSL 2FIKB 4PLNC 3GIZH 5D71H 3T08A 3JV0A 1ZGLP 1MJUH 1PZUB 3TZVD 3QG7L 1N5YL 3U7YH 2BHYA 3N06B 5IOPB 1CDGA 4QF1A 5A1AA 3ULVD 1X44A 4XP5H 2W65A 3MLXH 4O4YL 3S5LA 1Z6JT 1YYLH 2B1AL 5GRUL 1KPVB 4O00A 3VFPA 2FDBP 2VQTA 3TCLA 1BGXL 5I71C 2NW2B 2MPAH 2UVEA 4ELMF 4JQVC 4MAYC 3ARWA 3F58L 1R3IH 2IH1A 3P11L 1K4DB 1BJ1J 2XTJD 5AD0B 1JPFA 3CFIC 3QO1B 1DDHA 2J8UE 2OP4L 1KELH 2UUDK 3NCJL 3L1OL 1FLRH 1HILA 3GSQB 4ZO7A 1E6JL 4MDJA 4NHUA 5CJOL 3QSKB 4UINH 3WFEL 4YR6B 1B4RA 5I8CA 2E6QA 1IBGL 4HGKC 4D3CH 5IUSA 1A22B 3MOQA 5L2KB 3X13A 3GZKA 1B4JL 2YA0A 3MREB 2Q76A 3UMTA 4PGZA 1KBGH 5IVXF 2NY4B 4DCQA 4UIMB 5GGRA 3HRZB 4P3WA 3GSRB 1UEYA 3UBXA 1DLFH 3SE8L 2DWDA 3KPMB 1GIGH 5T3XE 4HS6A 1D9KA 2OI9C 1CGUA 3WFDL 3ZE1F 2FO4B 2F9BT 2VSCA 2GI7A 1OTTD 1DTUA 1HHHA 4M7LH 2P8PB 3OB0H 3LQAC 1XF2A 3F62A 5I17A 5AZEH 2OTPA 3V4UL 2DQEH 3EOTH 5K59F 4JDVB 5J6GA 1LK2B 4DVBA 3AXLB 3TVMD 4L4TE 1WV7T 3TT3H 1JK8B 5F88A 3IB4A 3MJ8B 3V6FB 1G0YR 3MRRA 3V6BR 4JY5H 5MHSE 5E56A 1KCRH 5IVNA 5EC2A 1I8LC 4OZFA 5EU4B 3C60C 2ZSVA 3MLUL 5JW3L 1JUFB 4YDJB 3GB7A 5FB8A 1F6AA 3SKOA 3PP3K 3KR3H 3C6SA 3DLQR 4XB7A 4TOYL 4HUWA 4Y19E 3TM6A 3TBVB 3MLWL 2P49B 2FH6A 1KUMA 4U1SB 3OGOE 3B4NA 3PV6B 5I1EH 3P9MA 5DVMA 5CZXC 3UYRH 5A3IC 5F7DA 5E99L 4NFDA 3HC3L 3VXRB 1ZHBB 4HQQL 4BJLA 3RPIA 3QQ3A 1C5DB 2VXQH 5GS1B 5IHBA 5HSFA 2BOBB 4NM8H 1MI5A 1OCWH 4FABL 3Q1SH 4U6VL 1XF4A 2AABH 4HS8L 1A5FH 1CDYA 3G6AB 4NKMA 4O5LH 2MKWA 3I50L 1YNLH 4KQ3L 4JRYB 4Q9BA 3UTZA 5CUSL 5IT2L 3DXAB 3QCTL 2YWYA 1JFQL 5DQJB 1QO3A 1XF5B 1EAPA 5L0QB 2V7NB 2D0GA 4WU7A 3UJJH 2OR7A 3EJJX 3L5WB 4DTGL 5DQ9B 3GMLA 3BH8B 2HT2D 4P99A 1N6QL 4JFQB 4PRNA 1E4KC 1PAMA 3HN3A 4XP6H 3OXSA 2ATPB 1WIOA 2Z35A 3ARDB 4Q6IC 4JJHA 4WFED 3MFFB 2FHFA 4OLYH 3I6GB 4NUGH 1DSFL 4WUUA 2IAND 3RI5F 3IF1B 2VZOA 5TJWK 5HJ3B 1DANT 3F5WA 2Q3AA 2AV7A 4ALAH 5A16B 3PQYD 1FG2A 1FJ1A 3UCRA 1I9IH 2PW1A 5JW5B 4OB5L 4JN2A 4PJIB 1QPXA 2EDFA 3SGKC 1KV3A 2XTJE 3D0LB 4PRAB 1N4XL 1FVCA 4U2YA 2BK8A 4DQOH 1MCKA 2AJYL 2D0FA 5MENA 1OW0A 4R96A 4RAHA 1ZT7B 5GJSH 5IHZA 2AJ3A 1BWMA 3REVA 1CGVA 3H3PH 4IHOB 5F9WC 1UB6A 2Z93B 5KN5A 3BX7C 4U1NB 2DBLL 3B9DA 4J1UB 4PRBB 3NCFB 2BVEA 4LLVA 1E6OH 2AK4E 3AS0A 5J6HB 2NZ9C 1K3ZA 5E8DL 4LGSB 5GRJH 4OLXL 3BEVA 4C56D 2EE9A 4XPAH 4MNQB 1YMMB 4EI5D 4GQ9L 1TZIA 1QFUL 3EYFB 3LHPL 1EXUB 4FQIL 4G6MH 3W5NA 5M94B 1XFPA 2C4FU 2IQ9L 2NX5E 2EDNA 2NR6D 1ZEAL 3EHBC 5DHXB 1KT2A 3HMXH 3S34H 5FO7B 5CCKH 4NDMB 3MLZL 1FNFA 2EICA 4CW1A 5JLZA 2FATL 1NJ9B 4OGXL 5ENWA 3RWGB 1CLYH 2KL6A 5I8OH 3RKDC 3O3DA 1G9NC 5C0DB 4YNYB 2DAVA 1ED3A 2IFFH 1A3RH 5H94A 5KVGL 3KAAA 1A7NH