3GBML

Crystal structure of fab cr6261 in complex with a h5n1 influenza virus hemagglutinin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
208
Chain Sequence
b'VLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEANYYCATWDRTAYVVFGGGTKLTQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Antibody recognition of a highly conserved influenza virus epitope.
pubmed doi rcsb
source organism Influenza a virus (a/viet nam/1203/2004(h5n1))
molecule tags Viral protein / immune system
total genus 36
structure length 208
sequence length 217
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gbmL01
3HE6A 4RAHA 1TJGL 4RWHA 5DC9B 1B4RA 1V3MA 4GMSH 4X99B 3OZ9L 5F9AC 2IPKA 3BH8A 3UTTD 3CVHL 2MKWA 4M7KL 1W72B 2X4OA 5ESAB 1OQOA 1UCTA 1WIUA 2F19L 1UZ6E 5CCKL 3L9RB 4I48B 5BVPL 5C3TA 1LDSA 3FMGL 4PJDA 1F4XH 4PD4J 8FABA 1CF8H 2MFNA 3MBED 1JPTL 2O5ZH 5ALCH 1Q0YL 2VLLB 5DK0B 3OJDA 5DGQA 3G5ZB 1I9IL 3RIAK 1MREL 2JIXD 1QEWB 5GGSB 2FHBA 3NCCB 4ORZC 2RGSA 3B9KC 4Y4HC 3D69A 2OMBA 4HHAA 1FC2D 2VDOH 5CP7B 1W0WA 3QIBB 2IFGA 4OF7A 1IEBB 5J4MA 4ODBD 5DRWB 3GMMB 3VMOA 3QIUD 5GJTH 1H0DB 1NBYA 4NKQB 4QWWD 4F15C 5JW5A 3KNBA 1ES0A 4KJWC 2HFFB 2F53B 3P0YH 1DQLL 4OLWL 1ITBB 1F58L 5I8OL 2X4UB 3HZYB 3MOQA 5F8RC 1J1PH 4KAQL 2IANA 4GG6F 4JFEA 3TH2T 3HI5H 1KFAL 4O51A 1RD6A 4PJAB 1BBDL 5C08B 43C9B 4PJ8A 4H8WH 3RVXC 5DS8B 1ZTXH 4WI4A 1BEYL 1SY6A 3X11B 5SWZB 5IJVA 3L3HB 5FYKE 2P1YA 3L3OA 4F7MA 4ZFFB 4AT6B 2YD7A 3E2HB 4Z5RB 4JRYE 1UACH 5HJ3B 5I74C 4G7YL 3I6GB 1EEQA 2Z91B 1KTKE 2EIEA 4MXWL 2EDXA 4D0CA 5ICYA 2EYSB 1AGDA 2R2HB 1VGEH 3RWHB 1LEIB 1F90H 5ILTL 4GKZA 4FXGB 5HYJA 4QHUA 5LBSH 1MIML 5DTFA 5GISL 4LEOA 4U05A 1Y18A 1FG9C 3BW9B 1WICA 2BCKB 2BVQA 2QQKH 5TDOA 4GQPH 1INEH 1J10A 2HTLD 4BZ1H 3QUYC 2P4AB 5GRVL 4XWOC 2BXYA 3EOYG 2I07A 3AAZA 1AXSA 4LPCA 3B9DA 3I6LE 5F1IA 5DDHA 1TETL 1ADQA 5B38B 3ARFB 3C6SB 4MHHG 1JNNL 2B0SH 2BDNH 3NH7H 2RHEA 4F7EA 5FDYA 2D31B 1R24B 3TPUA 1NMAL 1Q9WA 4Z78A 2J5LB 2O61B 4CN1A 1AGBB 3O2DA 1UB5A 4WEMB 1SY6H 4GKNB 3IDUA 1E4XH 2AI0H 2DQTH 1NUGA 3D0LB 2CR3A 4PJBE 3KLHD 3QQNA 1R5WA 2DQDH 4PLKD 2VLKE 4JPWH 3AROA 1HHHA 2OR7A 2XZCL 1TLKA 4JHWL 3QNXB 1BM3L 2YUXA 1MRCL 3MLSL 4LU5L 2KUTA 3DIFB 3ULVD 1OTUD 2VXUL 4QHMB 4QY8A 2Y5TB 1DJSA 5GGVY 4ENEC 3DHJA 1Z6JT 5IGXL 2VMFA 1GGTA 1VFAB 4FQ2H 1QO3A 4N8CL 1FO0L 5IFJB 4FMKA 3K4AA 4LARH 1T2QL 4WTWA 3QZWB 4NKIL 1ZANH 3CK0L 3WFHB 4P5TD 3O9WA 1I8MB 1WEJH 3KGRA 1PVHA 2HP4A 3BGAA 4X99A 5FUOL 4JFQB 2KZ1B 1HNGA 1ADQH 3N06B 1E4JA 5F7KC 1GJIA 1W72A 3MV7D 5ESAA 1QG3A 1ODAA 3SCMB 1KEMH 3L9RA 4N9OB 1OAKH 4PJDF 2VXVL 5J6GB 4PYGA 1KCSL 4JR9H 4OTXH 1QKZH 4XP1H 3DSFL 3U4AA 3BQUD 3O2DH 1CDCA 2P24B 2QSTA 3L5IA 2VLLA 4K3HA 1H5BB 4DGVL 3CSYB 3G5ZA 2QADB 1NEZB 5AZ2L 1BFVL 4X98A 3V5DB 1QEWA 5GGSA 3BXNB 1UM6H 3AMLA 1HIMH 5CP7A 1NQBA 1XCQB 4B41A 3GNML 3P0VH 3LEXB 3BI9X 1IGCL 4LCIL 2D03L 1IEBA 1UH3A 5DRWA 1KCRH 1LO2H 2GKIA 2HJKB 3GMMA 5HYQB 4X9BA 4BELD 4Z7QE 2OCFD 3KVQA 3O11B 2BSSB 2HFFA 2F53A 1GPOH 3KJ6H 2X1WL 4NN6B 4K3GA 2OJEB 5D70L 5IHUH 4HMCA 3TT1L 1UZ6F 3HRZB 3HZYA 3VGHA 4GBXC 3CFEA 4LSRL 2DQJL 3EZJB 3D0VB 4MJIA 3VGDA 4PJAA 2HLFC 43C9A 1I7ZB 3RHWF 2FCBA 3M1BB 3OMZA 1HE7A 5EO9A 3X11A 4ACPA 5SWZA 3G9VA 1NC2B 4I18B 4PJXE 4NUJB 1W72H 1QFHA 3MPCA 4YFDB 4PRHB 2B1AL 4Z5RA 1WFTA 4A6YL 1FGNH 3I6GA 2Z91A 5DD6A 4H0GA 1KB9J 1VHPA 3MX0A 2FATL 4L5FL 4TUKL 2EYSA 3MLYL 5L0QB 4RNRA 4JRXB 1WFNA 2R2HA 3RWHA 1LEIA 4M93B 3FZUC 3D9AL 1YMMD 2GFBB 2G60H 3WDIA 3RVWC 2APTA 2IEPA 2QEJA 3QXAB 3NA4A 3V5KB 2BCKA 4JGUA 1F4HA 1PSKH 1W0VB 2Y1VA 3H9SE 5J13B 5KTEH 3QUZC 4N1CA 3LS5L 3ZTNL 1IARB 1RK1B 2EICA 3UO1L 4FQLH 4NQEB 5I1HH 5KSAB 2EXWD 2QQLH 5B38A 1WTLA 3C6SA 3G9AB 1U91A 1BFOA 2UWEE 4W6XB 1CLYL 3LMJL 2D31A 1R24A 4YHKL 3LD8B 4M62L 4NN7B 3V6FB 1GOHA 4XVTL 2AV1B 3SEPA 2O61A 5D1QD 1M7XA 2DMBA 4O2CB 1AGBA 1LO4H 3DBXB 1VCAA 2E9BA 2YD8A 2AEPL 1MY7A 4LLMB 5BRZE 1RUPL 3ZTJH 3D0LA 2CKBB 3HMWH 3TF7C 3Q0HA 1XGTB 4AEHL 2AXGB 4WV1B 1BZ9A 1T21B 2GK2A 3BT2H 4G5ZL 4HDIA 5DRZB 4S1RL 2BC4B 1ND0A 1MCBA 3JVGA 5D8JH 1V7ML 3ZLQC 3DIFA 5IM7B 3TYGL 1HQRB 1KN2L 4OZGB 3HMXA 1TPXC 4LCWA 3DGCR 4PJHB 2Y5TA 2NZ9D 3BIAX 2VDMH 4KJPD 4LLVB 1VFAA 3G5XB 5IFJA 4QRUB 4YO0B 3BN9C 1J1XL 3HAEB 3QZWA 4QEGA 3GK8H 5D7SH 2UZIH 2P47B 3WFHA 1OGTB 1ZLVH 4BFGA 4DUVA 1RFDH 4JFQA 5EU4B 4LSUL 5EO0B 5C09D 5KOVC 4AEIL 1P69B 3S34H 1Q9LA 5FM5O 2NR6C 3DXAB 2EO9A 3SCMA 2ARJB 3W5NA 3LEVH 4NPYB 5I1AB 3GMLB 4UV7L 2EIDA 5EA0L 3Q5TA 3B2VL 4NQCE 1J05B 3BMVA 5F44A 3F7QA 1KENL 1RJZA 1K85A 1H5BA 3EFDL 1MCOL 3EHBC 4UDUB 3CSYA 3FT3A 4O4YH 2JB5H 5KVGH 1NEZA 4J4PC 2DL2A 2PXYC 4M6NH 4L9DA 3AREB 1DUZB 3V6OA 3EO1A 2E8YA 2NXYB 2YD9A 4WTZA 3O4LE 3NVQA 1XCQA 1CGTA 2OBGA 2LU3A 3BPNB 4PG2A 4NNPL 4P57B 3LEXA 4Z7WE 2BNQE 2HJKA 5HYQA 4TTGA 1FNSL 5CEYB 2EDHA 3BPCB 2J88H 2BSSA 2WW8A 3HMXH 3TWCH 3UJTH 5C0FB 4P46B 2OJEA 3RHWK 5D96B 1TVDA 1R5IB 4JDVB 1I7UA 1T1YB 2E6JA 1OL0A 2NNAA 4OFIA 1VKXB 2BVOB 1I3GL 2F54D 3D0VA 5EU5B 3VD5A 1VPOL 3PP3H 4ORGA 3TGXA 4PREA 2ADJB 2D7OA 1B0GB 5FUCC 1I7ZA 3QXUA 3M1BA 3RPIA 3SGKA 1S9XB 5IVXA 2YRLA 4I18A 2Y36H 4AMKH 1KPUB 1RZJC 2WQ8A 2YBRB 5EC2B 3SN6N 1UJ3C 1FBIH 3QUMB 4PRHA 3OPZL 1KN4H 3C6LC 4U1KB 4K94H 4ELKB 1RSFA 4NP4L 3EYSL 5DWUL 3QCTL 4BM7A 3E8UH 3H8NA 3JZ7A 4F33B 5EOTB 1N3NA 5ICXB 4JRXA 1KIRB 4PRPB 4IMKA 1FPTH 1OLLA 4KK6C 4JQIL 5F1SA 2DWEB 1EMTH 3U7WL 5I19H 3QDJB 2BJMH 4BSWB 2V17H 3QXAA 2XZZA 1PQZA 1U3HB 3NCFB 1JTTA 4JFXB 1MCDA 2A9NH 3D5OF 4UBDD 2OYPA 3ARTA 4I0KA 1P9MC 1Y6KR 4CJ0A 2CKNA 4R9HA 1ITCA 3FQUB 2IWGA 1U92B 2KH2B 4H0HB 1NSNH 5LCVL 3X12A 1RK1A 3EOTH 3V5HB 4WFFE 2VH5H 4NQEA 3P2TA 5DO2C 1T1XB 4EI5B 3RAJL 3RNQA 1KLFA 5ITBL 3SE3C 3NCMA 4GH7B 4PP2B 1GGBL 2FDBP 5KSUB 4XZUB 1OWWA 3OG4B 3V6FA 3MRRB 3D6GA 2AV1A 4NZJA 4KV5E 3DX7B 1HOCB 2R9HD 3CIQA 5T3ZH 3TM6A 4ETQA 3DBXA 5CEZH 1T7VA 3ARDC 4MX7B 1KJ2L 4RMUA 2A74B 3AY4A 4LLMA 4ZSOE 3X3GH 2CKBA 4M1CD 2FR4B 3W11C 4NQDB 4XPBL 5IMMB 4WV1A 5DK2B 2NY5L 5DRZA 2BC4A 3FO1B 3T77B 1BHGA 2D0FA 5BQ7B 4QLRA 3MRQB 5IM7A 4MA7H 5KAQF 1HQRA 2PO6D 1S7RB 4ONOA 3BE1L 1JI2A 4Y8DC 4PJHA 1ZT1B 1RULL 1P2CA 2YZ8A 1NAKL 4LLVA 2YMXL 3G5XA 4EBQH 5B8CC 3MSPA 2UWEF 2C4FT 1UWEL 1SVCP 1CD1A 3H42L 4YO0A 3HAEA 4OGYL 2CLRB 4I8DA 1KYOK 3A6BH 3L1OH 5KJRL 3HE6D 3FRPG 3IJSB 4Y4FB 3IXTB 1MHCB 4F9PC 1JZ2A 2A83A 2GJ6A 3DXAA 3TCXA 4JFDD 1XIWC 2ARJA 2XTJE 3MNWB 3N50A 5I1AA 4NPYA 5D5MB 4MZ2A 3CSBA 1J05A 3QPXL 5BMFL 5MI0C 1UH2A 1GOFA 4GXVL 5F7HA 4MHHI 3SE4C 4UDUA 4K71C 2ZNWA 1WWCA 5DURD 4NQXB 4NT6A 3SKJL 3T0DA 1G9EA 5TF1L 4PGBB 5T1LD 2CKBH 1DUZA 1QLRA 3ZL4H 3WJLA 4ODTL 5SX4H 1CFTA 4M6AA 5D6DA 1HKLH 1QLEH 4P57A 5JXEC 3BWAB 4MJ2A 2YD2A 3VXSE 3ZT6A 3B43A 4NOFA 4OM0L 1JJUA 1QRNB 4OFDA 2VSCA 2DM7A 4IEFB 1YEIH 3BPCA 3G5VB 3TH3T 4LVEA 5C0FA 4P46A 3IFNL 4JZJC 3BRFA 5F7MC 1P53A 3MACH 2D7TL 1R5IA 4JDVA 2WWKT 4M48L 1T1YA 1VKXA 2KPNA 1KC5L 2BVOA 3MOAL 5C0BB 2IAND 5EU5A 4YWGL 3HAEH 4E0RB 2JJSC 4JG0H 4JFED 4XI5D 5CZXC 2FB4H 4NKOB 3C5ZC 1B0GA 5IVXF 4PJ8D 3PGFH 3EOAB 5DMGC 1A4KA 1G1CA 1KPUA 2XKSA 2A77L 2YBRA 4MDJB 4PV9B 5EC2A 3QUMA 2Z8SA 3F62A 4U1KA 4ELKA 3SKMA 3O6ML 4NRYB 3MLTB 3FO0H 5FCUL 3QEGL 4OZHB 4CL7A 4Z7WF 4NO3A 3VXSA 4F33A 4FZEL 5EOTA 5ICXA 4G8IA 1KIRA 2ORBH 4PRPA 3ZO0A 1OQXA 1A6TB 3SE9L 5LWYH 4ZS7L 2EKJA 2QL1A 3QEHB 2DWEA 5HYJD 1HEZA 3QDJA 2PUQT 4L9LA 4BSWA 4GRMB 4YHNA 1U3HA 4JFXA 4UT7L 1OSPH 2K7QA 5IG7A 1HZHL 5IWLA 2CR6A 2OLDA 4OD3H 2DM2A 3FQUA 1WQVT 2JKXA 3VXTB 4O5LL 1UYWH 3V5HA 1T1XA 4RGNB 3WLWD 4EI5A 2JJUA 4HMDA 3QO1B 5JW4R 5D7LB 5MHSD 3UROR 1EDQA 1UKTA 4PP2A 3S37X 3QSKB 2VYRE 4FQIH 3I02A 5KSUA 4XZUA 1L0YA 1UWXK 2AJVL 3DX7A 1HOCA 1FZMA 3ULUH 4CADB 4DGIL 1T03H 4WCYL 3T8XB 5DJZA 2R23B 4XNZB 5EZIL 4MX7A 4P3DB 1QBLL 1J0JA 2A74A 3MQIA 2DLFH 1FGVL 3ARYA 1NUDA 4Q6IB 3RDTB 1NFIB 2NXZB 1A02N 2FR4A 2CK2A 3QUMH 2P8MB 5IMMA 2EEDA 4G9FB 5DK2A 2VLMD 1A6PA 1C5DB 1XMWA 3F6LA 4RX4A 3PWNB 3FO1A 3T77A 4G8GD 3R1GH 2APXA 3VFOB 1UM5L 3VDCA 3MRQA 2W9EH 2NW3B 3RBSA 2XV6B 1N6UA 1X5LA 4PJHF 5CJOL 1HYRC 1S7RA 2R56H 1FNLA 2RFXA 1ZT1A 3ZDYE 1AO7D 5MEPB 2AVGA 2ZOLB 5AUMB 3KYKL 2BY1A 1UXSB 4AENB 4OD1L 4KKBD 4XPGL 5DT1L 4XNXL 2CLRA 5DEZA 2MTPA 5B3JE 2YPKA 1AD9B 1BAFL 2DI7A 4U3CA 4Y4FA 3WNMA 3IXTA 5AYUL 1MHCA 2FEDD 1ERNA 1INDH 1QVOB 1TQCC 3N85H 4JKMA 3VI4F 4MDIB 3QCUL 4M7JL 3C09B 4I3RH 2BFVL 3MNWA 4GAJL 4K8RH 4K9EH 4QOKB 5E56A 3R8QA 3MLRL 1OT2A 2BHUA 2HJFA 3MRLB 3D39E 2RR3A 3S36X 3MXWH 2ZJSH 1O0VA 2H1PL 1MAJA 5AWNL 3CLEL 5FECB 4NQXA 4P2OC 4HG4J 4QTHA 1F02I 4XTRD 3TJHC 4OQTL 1R3LB 4FFVC 4L1HA 5IEHB 1BD2B 1CK0L 3VFMB 2IH3B 1BFSA 3R4DA 3ES6B 3PWPE 4UV4H 1MJ7L 1MNUL 2VKXA 3QIBD 5D93C 4OJFH 3BWAA 4XP9H 1T5XA 5EO1A 5DVLA 4HIEB 5LG1A 3QB7C 1MCPL 1A0QH 1QRNA 3C60B 4P2QB 4H20H 5AZEL 3ZE2E 2WNGA 3G5VA 4Q74A 3BAEL 5E2VH 5CEXB 5K9OA 1I9RL 2F53D 1A14L 1SYSB 2YKLH 4X7EC 4NWUL 3VFUB 2FJGB 2IBZY 4JCLA 2E7MA 5C0BA 4JHAH 7CGTA 3VXNA 4WIQA 1OWRM 2EH8H 4NKOA 1EO7A 3VA6A 1S7QB 3X13A 1BQHB 5C08D 5E95B 2JELL 2ENYA 4DQOH 4Y1AE 2VOTA 3EOAA 1DE4B 1B0RB 5SWZD 2GY7B 1X5JA 4LVOB 5DHYB 2WUBL 4MDJA 4PV9A 4QHKJ 5KVDH 1G9NC 4K7PL 1J9CT 2EDQA 1CLOH 3NCYP 1HSBB 1OT1A 3FFDA 1CDIA 1UCBH 2BVYA 3PWPA 4LVNB 1CU4H 4EEEA 4POZC 1NL0H 2MPAL 5TQ2H 2R4SL 4YC2C 4EQ3A 1A6TA 4F57L 4G7VL 2EDRA 5IV2B 12E8H 3THML 4GRMA 4P5MB 3U30C 2VC2H 35C8H 4UTAL 4IRSC 4R97B 2IG2H 3RVVD 3K7UA 4P3WA 5CZVH 1HHJB 2ED7A 2HTKD 1XGQB 2AJXL 3ARGA 1EEYA 4NFBA 2H6PB 2K9UA 5F89B 5DJ0B 3LAFA 3K2MC 5D7LA 3ARFD 5DJCB 4YXLL 4PPTA 5DRNA 1A64A 4YJZL 1RIVH 4WFED 2LAAA 1JGUL 3MNZA 3CMGA 2R15A 1S8DB 4KQ3H 4CADA 3T8XA 1JP5A 2R23A 4M7LH 4Q9CA 2ZUYA 3NA9L 2DM4A 2EO1A 2ZUSA 5C0IB 5DMIH 3RDTA 2ZCKL 3VGBA 1NFIA 2DBLH 4AH2B 1UEMA 4Y5XB 3QDGB 2X40A 5ADOL 4G9FA 1FORL 1MQ8A 3PXHA 4Y2DC 5IB5B 1NLBL 1Z2KA 3N1GC 3PWNA 5F6IC 4UU9B 4M43H 4CNIB 5I1CL 2IBZX 5DC4B 2OS7A 2NW3A 4YAQB 4PBWD 5CUSL 3U9UB 5E24E 3DVNB 2V5SA 5MEPA 2ZOLA 5AUMA 4XRCB 4RIRB 1QHPA 3QNZB 4O58H 3BKYH 1UXSA 3T0BA 5JIIA 3DRTB 2JJTA 1WT5C 4KMTL 1RZFH 3T0EE 3JWOH 5IESH 3PQYE 1AD9A 1FVCB 1OTTC 3T04D 3X14B 1KNOA 5D2NE 3U4BH 1EFXB 3MNVB 3OAZH 1DVFC 1RURH 5DUPL 1QVOA 5I71C 2ICCA 1CD0A 4FABL 3SCMD 4HUUB 2R2BA 5ABDE 2P44B 4MDIA 4OLZL 4QOKA 2VLJA 5HHNB 4F7CB 1EBPA 2PTTB 1NGXB 2R1YB 5CWSB 1PY4A 1MFCH 5D1XC 2ICWJ 4OF3A 3EKCA 3IDXH 1EEZB 2OK0L 2JJWA 4CBPA 1QTYT 1A1MB 1BWWA 3WS6A 3DTXA 2QADD 1GH7A 2QSCH 4YHOH 4P4RA 1R3LA 3ZDYF 5IEHA 5EUKA 5GRJH 3VFMA 1T66C 5C0CA 5EOQH 2IH3A 1IGIH 3ES6A 2DI8A 5FK9A 1XF3B 3DMMB 2FBJH 1F3DH 3D87B 4IIQA 4DCQB 5KS9E 3BRDA 4HJGB 3RY6C 2AGJL 3C60A 5BZWB 4P2QA 4HFUH 1S7WB 4XNYL 2X09A 2YPLE 4WO4C 4OGZA 5CEXA 1EO5A 5GZOD 1A7RH 4Z7UE 1AY1L 3BZ4B 4P23C 1SYSA 1LEKB 4OIAA 4Q9RH 3GUTB 3WO4B 3SO3C 3VFUA 2FJGA 2V5MA 1EHXA 5HGDB 4N5UA 4Y4KA 2YSSA 4OBSA 5IOPA 1S7QA 1BQHA 4XC3H 5T3ZD 5CEZD 1B0RA 1C5CH 1NC2D 4I3GA 5DHYA 1IT9L 3S8WA 4L8BB 3TA3A 4UAOC 1ZHNB 1IEAA 3E6FB 4PRHD 1HSBA 1V7NH 3QXVA 4GO6B 5J11C 3OSKA 3HR5B 2AJYL 2BOCA 4OLYH 4AL8L 4D9RE 5JR1H 4HJJH 5HDQH 5IB1B 4JRXD 4UI2A 4PJGB 4IOFD 2HLAB 3IAQA 5GSVA 4ODVL 1FZOB 4XNMA 4R0LC 4U49A 4XXCC 3GI9L 4HZLB 4DFIA 3QRGH 1F00I 5IV2A 3MRHB 4P5MA 1MWAB 4MQ7A 2H3NB 5C8JB 3D18A 4QXUL 3LQAL 1K3IA 3PP4H 3DX6B 1NCCH 3WDJA 4TOYH 5I6XB 2WP3O 4NQED 4U6VL 5F89A 1M7DB 5KSAD 3TP4A 1XF2B 1FRGH 1BX2B 3BPOC 2VZOA 5GRYA 1EHNA 1H3PH 4OD2B 7FABH 4XPFH 1CTNA 4F8QA 3WNPA 4ZDHB 1S8DA 5HHME 2X4QB 1H8NA 4YNYB 5IFHL 5I17B 1XGYL 1FE8H 4PP1D 4YIQB 5C0IA 5MENE 5F7UA 4Y5XA 5FIEA 3QDGA 2EE3A 3S5LG 1HH6B 5FUZL 5HI3D 5IB5A 1MJUL 3K2UL 4U0RB 5E5MB 4FTVE 3MV8E 4KJQD 2Z93B 1X3DA 2J12B 2Y6SC 4JN1L 3BP7B 4CNIA 4ZAKB 4ODWB 3VWJC 1CDJA 2LVCA 4I5BB 4CGTA 1FYTE 1XF1A 1N4XL 4YAQA 4OCYH 5ACMA 3U9UA 5C07A 3DVNA 1CI5A 4GW5B 1QSEE 2VZ1A 1RIHH 5D2LE 5L7XL 2JTDA 4XRCA 4I0PB 1RHHB 2C1OB 3GSNB 3DRTA 2X7LB 1E4WL 3MV9B 3T2OA 4WW2B 1S5HB 5HTSA 3B9EA 4EUPB 5E94B 3OKLB 5TQ0H 1A22B 2DD8H 1IFHH 3BPLB 3X14A 2BVUA 2VN4A 3MNVA 3JTTB 1NCWL 4O9HL 1YJDH 1M6OB 3QO0A 2MNUA 2VQTA 1YY8A 3MGOA 3DXAD 4N90E 5E6IA 3HG1E 2B5IC 3KJ4C 4HUUA 4F7CA 4X80H 5J89A 2PTTA 1NGXA 2EEAA 2CRYA 5FXCH 1CDBA 5JQHC 3IXAB 3MV8A 1BQLL 3DX8B 4YE4H 3L95B 4YDJB 5DVKA 1EEZA 5JQ6L 4PGCB 4UB0L 2DS4A 1R3KA 1A1MA 3MTRA 2DLEA 1KJMA 4N0UB 1JYVA 4X4ME 1VEMA 3QULB 1NFDA 3ARED 4JFYB 5C0GA 1NCNA 2NXYD 4Z77B 3NTCH 3SDYH 1NDGB 4PGEB 1XF3A 3DMMA 3O6KH 3MLVH 4C4KT 5EIQA 4KZEL 4NCC2 3K3QA 4HJGA 3RJQB 5BZWA 4QHKI 4H1LG 1S7WA 5CD5D 3RA7L 1YEFH 2N1KA 2QV2A 4XVUC 4MCYA 4P46D 2QBWA 3BZ4A 5JIHA 2FX9H 1JMXA 1QSVA 1LEKA 4BK4A 3GUTA 1FL6B 5HGDA 5C0AE 4DOHB 1ZHKB 3FOLA 2L4OA 3VJ6B 2IAMA 1IL1B 4MNQB 4XVJH 3ULUD 1NGZB 2HH0L 5FO8B 4FFZL 1NLDL 1MFNA 3GMNA 2D9CA 3B5HA 1CBVH 1QFUL 5CSBA 4KTDL 4PJXB 5F9WB 2H2SD 1KLUB 3CXHK 3E6HA 4OGXL 5GGRY 4L8BA 4JY6B 4HT1L 3E6FA 3O0RH 2XRAH 3CVIH 3T09A 3NABH 1NGWA 2JCCB 3BDYL 3HR5A 4NJAH 2B1HL 4CVXA 5KS9F 1QFWH 4MSWB 5IB1A 4FXKB 4PRPD 2HLAA 4BQ8A 2X10A 4HZLA 4Z7UF 3T1FA 1KTDA 3QDJD 3MRHA 1IQDB 1MWAA 5D7JC 1U3HD 1SQ2N 1A3LH 2H3NA 4G6AC 5C8JA 4U6XB 2XTLA 4X7SH 2X4RB 3DX6A 1NJ9A 1K8DB 4MXVF 5TE7L 5GGTL 3NACL 1OP5K 4EI5D 1ZHBA 3MRNB 2O5YH 5JLZB 3NN8B 2Y4SA 3WS3B 2BVEA 3GSWA 4C56B 4LIQL 1TIUA 1FZJA 1YEJL 3EJYC 4K8RD 3KPLB 4OD2A 5L2JB 3WHXA 2X70B 4ZDHA 3TYFB 3SGEI 1VACB 4S1QL 2X4QA 1JF6A 1EUTA 3VRLF 4YNYA 2XOTA 1T1WB 3BD4A 5I17A 4WUUB 5DD1H 3BJ91 5JDSB 3KXFB 1I1AC 3B9KB 4XPHH 4Y4HB 4NQDD 3CDYA 1HH6A 4KDVA 3NFPB 3QFDA 2Z93A 2FO1A 4PJ9C 4N0CC 5DEGB 5KSBE 2HG5B 3BP7A 4N5EC 2RCSH 2UYLA 3H9ZA 4ZAKA 4ODWA 4OLVL 4PBXA 4RFOH 4I5BA 3TV3L 2DF3A 4NZTH 4LOUC 4Z0BL 2WWMC 3DUSB 4GW5A 1LE9B 4RRPA 1T6WA 3BUTA 1RHHA 3OXSB 2C1OA 1MWAH 3GSNA 2X7LA 1R3HA 3MV9A 4WW2A 1FH5H 4BK5A 1S5HA 2DRUA 5EBGA 4EUPA 2FX8H 3OKLA 4DKFH 3LB6C 1U8MB 2MQCA 4GKOA 2R69L 1YYMH 4LPVA 4L29B 1NMBL 5AEAA 3JTTA 2ITDB 4Y4FD 1M6OA 2QSVA 1YZZA 5K33A 4XP6H 3TH4T 1ZS8B 3FAXA 4NZUL 2ZG2A 4XAWL 4D9LH 1NGQH 5M7QA 5IW6B 1AE6H 5E70A 5I74B 3QUKB 1EO8L 3IXAA 1EEUA 3UTPE 3VFVB 2ATPA 4PGCA 2IFFL 5KVEL 3O8XC 1KEGH 4N0UA 3L5HA 3NAAH 3P4MB 5FAAA 4UINH 2IADA 1NFDF 2AXHA 5D2LF 3QULA 2E7LA 1WJ3A 3NCJL 3O4LB 1T0NB 4XMPH 1NDGA 5FHAH 3AS1A 4JANB 2IH1B 2WINB 3QUYB 2HT2D 4HWNA 1IM9B 3VRJA 3TN0C 1QRND 3DYMA 1N8ZB 4MNGB 5CLWA 2FLRT 3WEXB 1FLRL 3MGTB 1U8QB 1RIUH 1N5YL 4S1DC 3GSNH 1MAML 4HAGA 4GT7A 2MCPL 5C0BD 2IQ9L 4L4TB 4QRRE 4GAFB 3VJ6A 4EUPH 1IL1A 4MNQA 1NGZA 3P9LB 2ZUWA 4UT9H 5FO8A 3ZKMC 1BJMA 1ZGLB 4IDLA 1C1EH 3U9PL 4IRZL 1KLUA 4OLXL 2HMID 2D7QA 4JY6A 5F7DB 1KBGL 1BLNB 2KKQA 4DUXA 1MFBH 4L8DB 2ED8A 4M5YH 5E8DL 5BW7C 2JCCA 4V1DB 5DI8B 4D3CL 3LH2L 4MSWA 4ZO8A 5TFSL 2P45B 4FXKA 1I9JL 2NY4C 5B4MD 4ERSH 3IU4L 3GMOB 3LEYH 3DV4B 4ZPTB 1WBZB 4HWBL 1IQDA 1F4YL 3N1QC 4HGMA 1NH6A 2W59A 4YBLC 1OAQH 1T80A 2ZG3A 4U6XA 4KKAD 4QRRA 4FQJL 1CT8B 5K9KB 1KB5L 3ECBA 1K8DA 3I85A 5SV3A 2DM3A 4RGND 4QO1A 4ZD3H 3MRNA 5A2JH 1FL5B 2X4SA 4PB0H 5D7LD 5JLZA 4U1LA 4EOWL 3WS3A 1CL7L 1I8KA 4W4NA 3VFPA 3VMNA 3VXUE 4C56A 5I1KL 1SEQL 3MLZL 3KPLA 4WHYG 5L2JA 4R96B 1LDPL 3M8OL 4AYFA 3NIFE 1VACA 4X4YB 3S35L 1KPVB 4X7TB 4YQXL 4HS6B 1YNTB 1CL7I 3I9GL 4HXAH 4ZSOB 3T08A 1P84J 4FP8H 4UTBL 3ESUF 5JDSA 1JF1B 3KXFA 5T1MB 2VR4A 3RDTD 3B9KA 2NXZD 4Y4HA 1VERA 1A3RL 4G9FD 5F70A 3NFPA 1MI5B 3VXMB 1ZGLP 4WY7H 3RWCB 3ZDXE 1FAIH 1WWAX 5DEGA 5ANME 5FGCE 1E0OB 2H8PB 4OZIB 2F9BT 3BGFC 4G80A 1U8OB 1TVBB 3CFBA 2CDFB 1IAIM 4AG4L 5SX5H 3DOSA 4AEEA 3KPRB 3OXSA 4LLYA 4V2BA 4WW2F 4NWTH 4GBXB 2W07A 4I77L 4K3DL 4TRPH 2R8SL 3FCTB 2LTQC 3GSOB 1U8MA 4L29A 1KJVB 2ITDA 1J8HE 4DWHA 1ETZB 3UTZB 1P6AB 3IETB 3ILPB 1ZS8A 2XTJB 3I84A 5EU7E 4QOKD 5IW6A 4ONGL 3V0VA 1X5GA 1JPST 3EOBA 5IVZB 1B2WH 2W0LA 3QUKA 3MRIA 2A6IB 5KSBF 3G6JE 5DJ6A 3W0WB 4JKPH 4Z7NE 3VFVA 4KGJA 3O2WH 2A0LD 4ZTOL 3GJFK 1ORQB 3P4MA 5HI4C 1IZKA 5JOFB 3T65A 4H26B 3V0WH 1T0NA 3MJ9A 1CLZL 4DVRL 3RY5A 1NGYB 4JANA 2IH1A 4P2RB 4PGDB 1G7IB 5DD3H 3QUYA 3C08H 4HUMB 3K0WA 4P9MH 1QR4A 2QQNH 3C60D 1N8ZA 4P2QD 4KI5C 3WEXA 4XWGL 1U8QA 4ZS6D 4NO2B 4OZFA 3F65A 4XCYB 3F7VA 1WCQA 4L4TA 1MHPH 3QIWA 4Q0XH 1ZLUH 2VDPH 1M71A 1YEGL 3C8KA 5EDXA 3SBWC 3P9LA 5E2JA 3V52L 1ZGLA 1R5VB 5HXMA 4QXTB 1CZ8L 15C8L 3Q48A 1DBAH 4HCRL 4GRWE 2FIRT 1BLNA 1U8LB 4L8DA 2W60B 4XT1C 1KCUH 1QBMH 4KUCD 3H6JA 4ZTPL 1A9EB 4OSUL 5I8EB 5DI8A 1WZMA 4JQXC 5E7BA 4WJ5B 3Q3GB 1GAFH 1U8IB 2Q76B 5HGBB 2AJSH 4ZPTA 1WBZA 2IBBA 3MJ9H 1SYVA 2EE9A 4X4ZA 4G42B 3TCLB 5EUOB 4HUNB 2XKNB 4HLZG 4HS8H 1CT8A 5K9KA 4JG1L 3MA9L 4YLQT 4XP5L 2HRPL 4LK4A 1O7VA 2F58H 1UFUA 3HUJE 4R2GC 3JWDC 2VUYA 1E6JL 1OM3L 1ZT7A 3QFJE 1YEHH 2X4NB 2ADGB 4F8TA 4R6UA 2WIMA 3PG2A 4FQXB 4RFEB 5IBTH 4R96A 2W65B 4H5SB 3ARXA 4L4VB 2W91A 4X7TA 2EIZA 4HS6A 1YNTA 2J4WL 3ARZA 5D1ZC 4I1NB 5HHVL 2QLVB 1HH9A 2PXYB 4H25B 1YQVH 1CGSL 3JV6B 5I0DA 3QDGD 1RZKC 1CGXA 1MI5A 2GQHA 3VXMA 4P48A 3VWKC 3RWCA 4AJ0A 3PNWB 5CGMA 3SPVB 1A7NH 2VABA 1S7TB 2H8PA 4QXWA 4OZIA 5F1NA 4PJEB 2XT1B 1MFAL 3GIVB 2WV3A 5LXGH 1U8OA 2R29L 4OCNC 5I75C 3BEWB 4OIIH 2CDFA 1IILE 3EYFA 4ZUSB 4C55A 3KPRA 1QYGL 1GGIL 1JWUB 3JV5A 1BREA 2Q1EA 3FHAA 3EO0B 4GBXA 3MLXH 4MXQD 4AQ1B 1X5IA 3BN3B 5EOCH 2J8UB 3I2CH 4KTEH 3GSOA 4OM1H 2Y7QB 2D3VA 1JFQL 1KJVA 1I8LC 4K2UL 4NJ9L 5HD8C 1EFXD 4JVPA 4YFLF 4LLQB 2V9QA 4U1GC 1ETZA 3UTZA 2WLYA 3IETA 5TDPB 4GG8B 1CICC 4YEFA 3S37L 3C6LB 2Y23A 2FBOJ 3VRIB 3OJMB 4EI6B 3C2AH 3D39B 4DAGL 2NY6C 2NCMA 4R7DA 4WFHD 2A6IA 3ARSA 4UDTB 3W0WA 3BVNA 1KELH 3GIZL 2VISB 3RL1B 3MRBB 2MJWA 2BVTA 3EJJX 4NC1C 3UJIL 5JOFA 2FLBT 4H26A 3KPSA 1T3FB 2D7NA 2Y06L 1KULA 3S7GA 3GHBL 4O2EA 4NN6C 1NGYA 3DMMD 5FF6B 4PGDA 3QUZA 1G7IA 4M03A 1DQLH 1HILB 2BY2A 4UT6H 2VWEE 3QRFM 3D85B 4LIQE 1RK0B 2FL5B 1G9MC 5K9JL 3UAJC 2AK4A 3O3DB 1BBDH 4NO2A 4JM2F 3NCBB 3O6FA 4XCYA 1IBGH 3MOBH 2Z8VC 3ZDZF 2NX5B 2CIKA 1P4IL 3PV7A 4YPJA 1PKQB 3D1MC 4JREC 5JZ7C 3ARDB 4QXTA 3J7HA 4U1IB 5IB4A 1AR2A 2PR4H 4POUB 4MXWH 1BGXH 4A2LA 4M93C 3IFPB 1DEEA 2DQCL 3QWOA 1U8LA 1YPZB 2W60A 2VZ3A 1JNHA 4KHTL 5ILTH 1A9EA 2AKRB 3IDJB 2A9ML 5I8EA 3CLFH 1FFOB 4I3SH 3OR7B 5F9DC 5TDNB 4WJ5A 4B5EA 5CJ5A 5HHPB 3Q3GA 1BF2A 1U2CA 1U8IA 3O45B 3LS4L 3QISA 3H0TB 4HEPG 3EO9H 1A7PL 4NKDB 5B8CB 2XN9B 3E1F1 3EYQC 2XA8H 4G42A 4FG6C 5E2UH 4HKJB 2XKNA 2C4FU 1TETH 3I3DA 1XGUB 5A2KH 1FLTX 5JXAH 2VDRL 3LD8C 4HWZB 2V2WB 2FD6H 1QRKA 1RU9L 4KDTC 5EPMA 4KK8D 1CGUA 2E9WA 2GK0B 3P40A 4OT1L 2H2PC 4X6DB 2X4NA 2ADGA 5DJAB 4GRWF 4RFNC 4MD0B 4RFEA 4HQQL 2W9DL 5I30L 2W65A 3HB3D 2JLLA 2QHLA 5E1AA 5MI0B 4L4VA 2APVA 5A2FA 4NRXB 3BHBB 4FNLL 4K71B 4ZOBA 5J56B 4J4PA 3JV6A 1X5XA 1YEEH 1P4BL 4HWEL 2NYYC 5F9OL 3U79A 3D2UA 3BKCH 2F5AL 3QG7L 4G6ML 3AS3A 3QQ9C 3PNWA 2VXUH 3SPVA 1S7TA 4LCYB 1HXYB 4PJEA 4ZAKD 1JNJA 3GIVA 1EGJL 3EZ8A 4KI5E 3F7YB 4Z8FL 1MAKA 1TZGL 3BEWA 5CILL 2CO6B 4JZJB 3LPFA 5I76A 4ZUSA 1PX4A 4I0PD 1OVZA 3CK0H 3KYMA 4NGHH 5CINH 3EO0A 4I4WB 3L5XH 4WI7A 3MV9D 3VFTB 1LNUA 3GKWL 4KK5C 4NUGL 4L4JA 5BO1L 1GOGA 2J8UA 1FNHA 3C5ZB 3CU7A 5C2BL 2Y7QA 3WFEL 4B53A 1B4JL 4CUCA 3CMOL 1UXWA 1YEDA 4LLQA 5DYOB 2JF1A 5T3XH 1UJ3A 4GG8A 1DBJL 2X9WA 5GGVH 3UDWA 4DGVH 2HT4C 4LFHD 3VRIA 4EI6A 3ARPA 3CXDL 2LABA 3RZCC 1DEDA 1LE5B 4UDTA 2J6EH 3GI8L 1HYSC 4LASH 3AC0A 3FFCE 3RL1A 3MRBA 5K9QG 3GNMH 2C3WA 2XFXB 4LF3B 2D03H 3VD7A 4ZO6A 4HJ0C 3D3VE 3RPKA 3FRUB 3KWWA 2NQCA 4K3JL 4PJIE 4WEBL 5HVFB 2OTUA 5HYSB 4HC1A 5FF6A 1CVRA 3WXVH 2P5WB 5FV1L 1HILA 3DVGA 3D85A 4JO1H 3BX7C 1A7OH 2FL5A 4NCDA 2DQJH 1U3JA 2W0FB 3LSOB 4YXHL 1A6UH 4JKKA 3SE3A 5GS3A 4PV8A 3BOVA 1L7IL 1TCRA 2H2SC 3LCYA 2HWZL 2NX5A 5D72H 2W9LA 3HFMH 4MNQD 1PKQA 3ARDA 2VAJA 4U1IA 4JDTL 1N26A 4PLOB 2YXMA 4ELMB 1RZJH 4NNXB 3HS0B 4PLJD 4AIZB 3I75B 3DETC 3N9GH 3MLYH 1UVQB 4PJCB 1IGJB 5GS0L 1YPZA 4HIJB 1R6VA 3OKYA 5C2UB 3IDJA 2OI9C 5CKAA 4K55A 1A1OB 2AABH 1FFOA 4OQ1A 2APWA 3OR7A 1UWGL 4PUBL 2C3VB 3NZ8B 3HC4H 3EDKA 4AEFA 3TZVA 1UADC 5HHPA 1JPFB 3B83A 1NAML 3H0TA 3VG0H 4Q6YA 3EYVA 4NKDA 4XNQB 5B8CA 5EWIH 2XN9A 6FABH 3T0WA 3EW3B 3I50H 2HT3C 3UO1H 3JSSA 3A6OA 4HKJA 4AY0A 5F3BB 4HC1H 3HC3H 4IHOA 1XGUA 3G6DL 2V2WA 2F15A 3LKOB 5E4IA 4NNYB 1AXTH 4F9PA 43CAB 2GK0A 4HUKB 1GGCL 2AV7B 1TQCB 1IC7H 1Q0XL 4X6DA 4NBYB 1XIWA 5DJAA 4C56D 1G7PB 3PHOB 4MD0A 1DCLA 4I2XE 4Y2OA 1WAAE 2G2RA 4O2FB 3SDCA 3VXRB 1I1FB 5HHMB 1EPFA 3ZTJG 4NRXA 2W92A 1PJ9A 3BHBA 4TUJB 3SE4A 5HGAA 1RJLB 4AEHH 4P2OB 4JM4L 3AMKA 5GRZA 2NY7H 4WUUD 3KXFD 3OV6A 3WNNA 2XZQH 3IVKA 3B9KD 4Y4HD 1G6RL 1MFDH 3TYGH 1BVLB 5JXEA 3RU8L 3BKML 2FNBA 4LQFH 3FKUS 5L88L 1TJIL 1FYTB 4GAYB 3S97C 4YH6A 4G8FB 4YDIL 3F7YA 4KJWD 3GRWL 1T1ZB 3DO7B 1BP3B 3QWRA 4XVSH 4LRNL 4JZJA 3O3EB 3RGVC 2B4CL 4AQOA 3S88H 1JYNA 1G0DA 4I4WA 3W9DB 3C9NA 2DB8A 1BF8A 3QEQA 2JJSA 2I60L 4OF8A 4JPIA 4ONFH 4AEIH 3C5ZA 2KQNA 4G3YH 1NFKA 5B38G 1FZKB 3RVXD 2ITCB 2ZCHL 3U7AA 3VXPA 4UV7H 2V5RA 2XZAL 4JPVH 3B2VH 5I73C 5FYLH 1YY9C 3OJ2C 5DVOA 1F6AA 1MCOH 5T5FL 1OAUL 4X9FA 4NZRL 4P3CL 1LE5A 1HSAA 3EYOA 4PLNC 3IRPX 4PRIE 8CGTA 4YDKH 4NNPH 3T3MF 2XFXA 3V7MA 5DD0H 3MRDB 3O4LD 3WIFB 2BHZA 3FRUA 1DFBH 4XAKD 1FNSH 3QH3A 3U30B 3SE8H 3TC9A 3OR6B 5HYSA 4X7FC 4IRSB 3MUHL 5KAQG 5CP3H 2P5WA 3QUYD 1J5OH 3L3GA 4G43B 4U7SA 2FECI 1IM9D 4XWOD 3MODL 1SJEB 4J1UB 3KYNB 1B90A 2W0FA 2XWJB 3LSOA 4EVNB 2WQRA 5C0EB 1VPOH 3UTTE 2XWTB 4WWKC 3QZWG 4G6KL 4N1HB 3U83A 4BFBD 2DQHH 1E6OH 3OX8B 3BDBA 3ZT5A 4XH2B 4L4TD 1K9TA 1SMOA 4UMGA 5K59E 4JGMA 1A2YB 1I7TB 1WISA 5GS0C 2RB8A 4ELMA 5CBEB 4NNXA 3HS0A 1F4XL 3QCTH 4AIZA 1CF8L 1DZBA 2PW1B 1FQ9C 1N0XL 2O5ZL 5ALCL 4PJCA 4IOSD 4Y2DB 3F5WA 4X6EB 2CIIB 3CSGA 5A3IC 1Q94A 2XWBB 5F6IB 1NEZG 1G0XA 1A1OA 2XXMB 3KR3L 4V1DD 5J8OA 3GMRB 3CGTA 4P2YA 2VDOL 4WTZG 1JPFA 1O7SA 2X1XR 3EFFA 2P5EE 3P30H 4YGVB 4BZYA 4ENED 3LQZB 5GJTL 5FGBC 5F3BA 3KYOB 3L7EA 3RAJH 3P0YL 2ZUTA 1GGBH 3LKOA 4UNTA 4WFFD 4NNYA 1J1PL 3MBEA 43CAA 1DVFB 1CCZA 1L6XA 2AV7A 2GJZB 3HI5L 5I71B 1SM3H 4MJ4A 2DQGL 1C7TA 3CDFA 2JJVA 3MCKA 2WBJC 1G1YA 1G7PA 3PHOA 4H8WL 3MLPA 1ZTXL 5C6TH 5BZDA 1HCFX 3U0PA 5D1XB 1I1FA 3V6ZB 3QA3B 3PWUB 4I9WD 4TUJA 4WUKL 5EORH 1RJLA 5F7EH 4P2OA 4HGWA 2K1MA 1UACL 1RUQH 4PGZA 4FQ1H 3BIKB 4PRBB 5DUBB 5CGYC 5BOZG 2OXHA 1BVLA 1MI5D 1VGEL 4MB5A 3VXMD 1F90L 4BA8A 5LBSL 2W1NA 4M8QA 4U6YB 1NAKH 4GAYA 5DJXB 3UTQB 1QSFB 1UWEH 4G8FA 4WO4B 3DO7A 1T1ZA 1DLFH 4KKLC 2QQKL 3S3JA 1XGPB 3O3EA 3MJ6A 4OGYH 4P23B 1INEL 3FB8A 4BZ1L 4Z7VB 3KPRD 1D5MB 4UNVA 3W9DA 1IKNC 4GBXD 5KJRH 2I9TB 4NDMA 4CAGA 4WWID 3C5JB 3TIEB 1WAAF 1N6QH 1NKOA 1OLZA 1OW0C 2Z9TA 1C12B 2HLFD 2B0SL 2BDNL 1FZKA 1CFQB 1EERB 2Y9RT 3PIQB 2CPCA 3GSUB 4UAOB 3CZFB 1T20B 5EZLB 2R1WB 4C58B 5B39B 4BZ2H 1E4KC 2XTJD 1SY6L 3CFJB 5J11B 3SKJH 3F7RA 1JUFB 2AI0L 2DQTL 5TF1H 5HHQB 3W0WD 3DJ9A 3HNTH 2ZWLT 2DAVA 1FG2A 3FZUD 3HZMB 1KTLB 4R0LB 1MOEA 5GHWH 4MGXA 3RVWD 3WE6B 3CD4A 3WIFA 1S5IH 1HI6B 3MUJA 3CCHA 3OR6A 3W9EB 4P2RD 4IRSA 3QUZD 2AW2A 4AIXA 1F3RB 1KSRA 5JNYB 1PYWB 3IJHB 1IGTB 1MCFA 4CRPA 1HHKA 5CHNA 5HGHB 1QSZA 3KYNA 2EDYA 4EVNA 3FQWA 1PFCA 4K3EH 4YWGH 5C0EA 3HAEG 2AK4D 1RZGB 4XCFH 1ZANL 4KRMB 2XG5A 3MV7E 3X3FL 3OX8A 2FWOA 3ZHDA 5BVJA 5BV7C 5JW3L 1WEJL 4J7RA 5I8KH 4Z6AT 5KN5A 4OV6F 1ADQL 1A2YA 1EJ6A 4Y7MA 2PW2B 1I7TA 4R26H 3VFGH 4ELMF 5K93A 5CBEA 4KFZC 4OTXL 1AI1H 1QKZL 2RBLA 3VFNA 1G9NH 2EDFA 3DVIA 1D6EB 1RJCA 3O2DL 4X6CE 1ZLWH 4Y2DA 4X6EA 1R0AH 2CIIA 1IGFH 2XWBA 3SE9H 4J3WA 3Q6GH 4PRDB 1UM6L 2YPVH 3VWJB 3GMRA 1HHGA 3MZTA 1CDUA 2AK1H 3VMPA 1HZHH 5C0RL 1KCRL 1LO2L 3LQZA 1DQTA 2AJUL 2R0LH 1PX3A 1T7ZA 1WT5A 1CG9B 1CTOA 3BN9D 5KW9H 4F9LC 3KYOA 5K9QI 3KJ6L 1GPOL 3MCLH 5K59F 1T5WB 5IHUL 1ZLSH 2WLZA 4MWFB 4HUXB 1M05B 2EH7H 3BH9B 1MCQA 3O6LL 1DVFA 5F8QC 3BQUA 1OGAB 1YYLH 4JZNB 1OF2A 2VR9A 2NR6D 5T3XD 2B5IB 3KJ4B 5C9KA 5BOPA 5AAMA 3WN5A 4FQXD 5DQDH 1TNMA 1JPGB 5MEQA 3S36H 2HRLA 2P8LB 1WZKA 3UEZA 1JMZA 4L4VD 3QA3A 3V6ZA 3PWUA 4QT5A 1W72L 3ARWA 2ZKHH 4RDQF 2G5BB 2HKHH 2E3VA 2I26N 3ZE1F 3EHBD 4P2CG 3FN3A 5E00B 4J4PD 2PXYD 1FGNL 2A6DA 3BZFB 2VO5A 1YMME 2BZDA 3BIKA 4KHXL 5DUBA 4NBXB 3TFKC 4S2SB 3VG9C 2DKSA 3GSVA 3MGAA 5FGCB 5ANMB 2ZG1A 3ZE0E 2G60L 4M1DH 3RY6A 3CH8A 5DJXA 5SWSB 3UTQA 1QSFA 4OD1H 3K4ZA 4ZFZA 4WO4A 3A6CL 2C26A 1NCBH 4Z9KB 2ADIB 1PSKL 5DT1H 1XGPA 4D9QD 5KTEL 4Z7VA 3TIDB 1F6FB 1OHQA 4XBPB 1D5MA 4DW2H 2I9TA 5I16B 1WZ1H 5H94B 3C5JA 4PTTB 5HYEA 5AYUH 4FQLL 4MMXC 5I1HL 3GFUA 5ALBH 2QQLL 1C12A 1YUHA 5CSZA 1CFQA 4X4XA 4LHUB 2BFVH 3NPZB 3LN4B 3MLRH 1L9NA 3JUZA 2V5YA 1PD6A 1YC7A 5EZLA 2R1WA 5B39A 3OKKB 4NHCL 1NPUA 2A6KA 3DYPA 5HSFA 1LO4L 3C6LD 3CFJA 3QCVH 3D39D 2N7AA 1JUFA 1CFNB 4ZODA 4OQTH 1U0QA 4PRAB 1PLGH 1EV2E 1MJ7H 3BT2L 4R0LA 1IGMH 4KK6D 4XXCA 3SGDI 1LHZA 4YHZH 1L0XA 3LKSA 2P48B 1U8NB 4PJFE 5C70A 4GLRH 1MCPH 5DA4A 1C08B 5D7JB 1Z3GL 2J2ZA 3RFZC 3W9EA 1DUYA 4HBCH 32C2B 1I9RH 5BS0B 1A14H 3WIIH 2PN5A 3IJHA 4W70A 3D85D 1IGTA 4GW1B 5HGHA 2GTWB 5DO2D 5JHDB 3GK8L 1KIPA 4OLUH 5C09E 5D7SL 1P5VA 5E8OB 2UZIL 3GHEH 2JELH 2ADFH 2CRIA 1QOKA 4UQ3A 3ZYZA 1RFDL 3VFRB 5C9JB 2NX5D 1XT5A 4LSQH 3S34L 3DURA 2PW2A 5DJ2A 3ARDD 3WLBB 1CXHA 2NPLX 3LEVL 4LNRB 2UZXB 3IDNA 1QD0A 5DQ9B 3ULVF 4HIXH 1DQJB 1I1AB 5DUML 1D6EA 3W11D 1LWRA 3UPRB 4PJFA 3EGSB 5E9DA 1M1SA 4O4YL 4P4KC 2JB5L 4PJ9B 4YPGB 5KVGL 4D0DB 3ELAT 1C16B 4M6NL 1H15A 2VXQH 4PRDA 4JO2H 5IBUG 1FHGA 4P9HL 4DGYH 3VWJA 2VQ1B 3THMH 1ZHLB 2K3TA 4Q9QH 3G04A 4KK9C 3C5SB 4ZNEA 2XN9D 1P5UA 1CG9A 4OCMC 2X41A 3UZVB 2J88L 3HMXL 3TWCL 3UJTL 2F54E 2YA1A 1BOGB 1EFQA 3KPOB 1T5WA 1AQKL 4YXLH 4ZUTA 3MUZ1 1QQDB 4MWFA 3HUJB 3BH9A 4NM4H 1JGUH 1YN6A 1OGAA 4MQSB 5FYLD 4JZNA 1XIWD 1I7RB 2B20A 2X4PB 4XBEL 5E6YA 1QFPA 1GSMA 1KB9K 1JPGA 1YNKH 3MA7B 4AMKL 2P8LA 5D71L 5F96L 5AG9A 2VERN 3GRWA 1LP9B 1UKSA 4GKSA 2G5BA 1FBIL 1U8KA 3O8XB 1FORH 1KN4L 1X7QA 2AQ3A 5INCB 3NCYS 1NLBH 3BWUC 4K94L 5E00A 4ZXBC 1VFBA 1H8SA 2LE9A 1QACA 3E8UL 3O2VH 1AJ7H 4S2SA 4S11A 5I1GH 3QUXC 1EZVX 1FPTL 4DZ8B 1MF2L 5JXED 5CUSH 1EMTL 4M7ZC 2BJML 3TN0B 5SWSA 2V17L 4ESKA 4B50A 3FJTA 3PHQB 3V4UH 3IDYB 2A9NL 2ERJC 2ADIA 4KMLB 3QWRD 4QF1B 2EKSB 2LU7A 4XBGB 3TIDA 1U6AH 3LN5B 1GRWA 2OSLB 4XBPA 1NSNL 1ACZA 4HUWB 3RKPA 3QEQD 3EOTL 3G6AB 4PTTA 5CZXD 3C5ZD 1JRHI 4MD5B 2YC1B 3FQRB 2YD5A 4LHUA 3LN4A 1X5AA 2EDBA 5FOBB 3V95A 4TSCH 3KPMB 1KLGB 3B5GA 3UX9B 5A1AA 1SVZA 5CEZL 2NY3B 3T4AB 5IMLB 3UC0H 1CFNA 1YQ2A 3X3GL 3WIHH 3LKPB 5SWQB 3LV3B 4PRAA 5CD3B 2NY4B 3DPBA 4HXBH 4PB9L 3Q5YA 2F8VA 3ALWA 5ICZA 4HSQA 1U8NA 5GGRB 4XPAH 1C08A 5D7JA 2EZ0C 4WNQB 5TPWH 1BVKB 4U1JB 4YUEL 4MA7L 4XNYH 1DSFH 4YBLB 4YDVB 3HC0A 5IKCB 32C2A 3C87A 1WBYB 2P5WD 5BS0A 3LN9A 1KUMA 5ID1B 2UUDK 5JDJA 4GW1A 5DMYA 2ZCLL 4HX1B 3RWEB 4HF5H 1JHKH 3IDIA 5JHDA 2QJDA 4U1MB 2DQEL 2E8ZA 1U8PB 3A6BL 3L1OL 1AR1C 4QRPB 5ESVB 2KQMA 4F58L 4RMWA 3EDDA 3U46B 4MA8H 3B9VA 2QR0B 3VFRA 4E5XB 5C9JA 2HFEB 1IT9H 1N64H 4PJDE 4AZ8A 4XHJC 3WLBA 2NW2B 5GXBB 4LNRA 3LY6A 2JE8A 5DQ9A 5ID0B 4W6YB 1DQJA 4AL8H 1I1AA 4PJFF 2IGFL 3CXHJ 4P9HC 4IJ3C 4IBLT 3O4OC 4ODVH 4PJ9A 4YPGA 3SDDC 4D0DA 2EECA 5AAWA 2CKBL 3JVGC 3L3IB 4MLIA 1JK8B 2VQ1A 3BGFB 3ZL4L 4LSTL 2C4XA 4OB5H 1ZHLA 1HKLL 1QLEL 2HFGH 4M3JA 1H3TA 4GAGH 4GFTB 1D9KC 1H3VA 1MIEL 1LGVA 4QXUH 3C5SA 3MJ7B 4QXGH 3WD5H 2A2QT 1UEYA 4JFDA 2IANE 3PJSA 2GITB 5E08H 1BOGA 4JFEE 2LTQB 2Q8AH 1T83C 4LSVH 5EC1A 3MACL 4RISH 1EHLL 4FQQA 4MJ6B 1QQDA 1ED3B 3KLSA 1P4LA 4TSAL 3B2UC 2FB4L 4TVPH 1BQHG 3PGFL 1I7RA 2X4PA 1F4WL 4J3SA 3RL2B 5T1LA 1F11B 4RWYL 3DI2B 5F7LB 3VXRD 2CRZA 5EU3B 1XGRA 5CS7A 5HHMD 3JUYA 1LP9A 3DRQB 3GDBA 3O8XA 1TDQA 1MHHB 1NUNB 25C8H 1CXIA 4P2OD 1ZVSB 4M9PA 4X8JB 4ZYKB 5IIEB 3TJHD 3FO0L 4FFVD 4OFYA 4EN3C 3B9AA 5HYJE 4NSKB 3WXWH 4ONHB 1N4XH 1BMGA 2ORBL 3FTGB 3H2WA 5LWYL 4ZUUB 4NBZB 2YUVA 3TN0A 1FYTD 3QQ3B 1IAMA 3PHQA 3CDCA 1OSPL 5FO7B 1PZUB 2EKSA 4OFKA 3HPLB 1I85C 4JO3H 4XNUH 4XBGA 4OD3L 3LN5A 4M6MH 2OSLA 2OMNA 1JZ7A 5MHSE 4ODUB 4HUWA 1UYWL 3G6AA 1MFEH 2VL4A 4O9HH 4MD5A 1SJHB 2YC1A 3FQRA 4R90H 4X9IA 3HPJB 2G5RA 4G6FB 2O5XH 1J11A 2VNCA 2LVEA 1U8HA 4FQIL 1JWMA 1NCUA 5FOBA 5IFAH 1NMCC 1MCWM 4N8PA 3ULUL 3QAZB 1ZMYA 1T03L 3HHRB 5H37H 5IMLA 4H88H 3T4AA 2VLME 3P77A 1AGCB 5BW7A 1AC0A 2C9AA 2DLFL 3LKPA 4JFZH 4POZD 3LV3A 5SWQA 3FFCB 4NZDA 3QUML 4F37F 5CD3A 4DFHA 4Y19B 3VD3A 3DV6B 1UM4H 4BH8B 3R1GL 4JLRB 5I1JL 5GRUH 5GGRA 1AO7E 1KB5B 3NFSL 4WNQA 1BVKA 4U1JA 4PJIB 1GHFL 4YDVA 2R56L 3OHXB 2DLGA 4IRSD 5IKCA 1UH4A 3H7BB 2XA3A 4QRSB 4HX1A 4TQEL 3RWEA 5T33H 2PCPB 4R2GB 1PEZA 4U1MA 1S9YA 1T2XA 5IW1B 4LP4A 1U8PA 5ESVA 4P59H 3U46A 1MJJB 2OQJA 3DX9B 4KTDH 2QR0A 2ID5A 4OGXH 4XPTH 2HFEA 4E5XA 3QJHB 4HT1H 2BK8A 3N85L 3LRSB 4KGLA 4PJ7A 2I25N 1MLBB 3UPCA 2ZSVB 4X7CC 5IJKC 1ZA3B 4G8GA 5D7IB 5D1ZB 4I3RL 4K8RL 4K9EL 5IP4A 1A1NB 3NCEB 3DARA 3AY4C 5B22A 5ID0A 2AJZB 3BDYH 2BOBA 2ICWA 4HIHA 4ZFOB 4OGAC 2Q3ZA 1A7QL 3PABB 3ZSTA 3MXWL 2ZJSL 1AO7A 2G9HB 4Y2DD 5IT2L 3VWKB 4MQTB 3BO8B 3ALPA 3I3BA 4JJHA 3KG5A 3L3IA 1JK8A 5I1EH 4RBPH 3RWIA 5EZOL 1CFSB 5H2BB 2A73B 5I75B 4OJFL 3TO2B 3W81A 4WW1B 2F53E 1IQWH 3MJ7A 1A0QL 4H20L 3D25B 3PGDB 4WU5B 3S9DB 2E9JA 4I48A 2Q86B 3J8F7 4MJIE 3GBLA 1OTTD 4PJAE 3VGAC 3RI5F 4MJ6A 5C08E 1RUAH 3UBXB 1YEJH 3SOBL 2F8XC 4JHAL 3WMSA 1DVFD 3JV0A 4KRPC 4U1GB 5SWZE 2EH8L 5DGRA 4WGWB 5DK0A 1CICB 1ZKAA 4ISVB 4DQOL 4I2XB 3RL2A 1F11A 4N8VB 2E27H 5D1XD 2NY6B 1LP9F 2OJZH 2P7TB 4BUGA 5KVDL 3QIBA 4KROC 4MQXC 3S5LB 1CLOL 2XI9A 1MHHA 3PGCB 1QP1A 1ZVSA 4X8JA 4ZYKA 1H0DA 2A1WH 5IIEA 2FZ3B 3L3KB 1D5IH 1CU4L 4GQ9H 4U2YA 5IVNA 4ONHA 1T66D 3WJLC 1MY5A 1LO3H 2VL5B 4IRJC 5I1IH 3FTGA 2X4UA 3QT2A 4ZUUA 2CUMA 3RVUC 4GUPB 3IDMB 12E8L 1WUNT 1QSFD 3NZHL 4WO4D 2BNRB 2VC2L 5FO7A 5C08A 5JMOC 35C8L 4LSDA 4P23D 5DS8A 3DECA 5CZVL 4QRQB 2CMRL 4J6RH 3L3HA 1DLHB 3EYUH 4U3HA 5TE4H 4ZFFA 1PZ5B 4WFEE 4AT6A 1OARH 2XTJC 3SBWA 2X6MA 3V4PH 1SJHA 4NZUH 5HJ3A 4HW6A 4JREB 5CJXC 3HPJA 2V9RA 1BIIB 1RIVL 4KZDH 1I8IB 2ESVB 2MQ0A 1T04B 3DGGB 4F3FB 3GSRB 1EO8H 2DDQH 5DK3A 4X0KB 4KQ3L 4F37K 1ZVYA 5DJ8B 4FXGA 5HHOB 2YHGA 2VAAB 4EXKA 4M7LL 5J0BA 5KZCB 4OI9A 3P73B 5EFIB 3BW9A 3RWFB 4L3EB 5ISZB 2DWDB 4JQXA 2DBLL 2GSGB 1QZ1A 3EBAA 4Y19A 3DV6A 5L8LB 2O93L 3F7PC 5ETUB 1HQ4B 5FM8A 4ZQKB 4PY8I 2YWYA 3UMTA 2DLHA 4JLRA 4LCWE 1FYHB 2A6JB 3EIFA 4M43L 4MA3B 4L9LC 3MBXH 2QKIB 3ARFA 3H7BA 2WBKA 1N5YH 1TTGA 4HEME 4RRPG 4O58L 3BKYL 3S4SB 1T22B 2MCPH 2E5EA 1RZFL 2PCPA 1Q72H 5JO5B 1ZGLM 3JWOL 3ARBC 5IW1A 4GKNA 4NO0B 1A6ZB 4EUPG 1Y6NR 2AEQH 5C7XH 4RFNB 3RWDB 4DN3H 1MJJA 3DX9A 3GBML 3U4BL 3BIBX 4PJ7F 3U4EB 1RURL 5HY9B 1P7HL 2PYEB 3LRSA 2ZSVA 4FFYH 4HG4K 1ZA3A 3QNXA 5D7IA 5D1ZA 5EH1A 1FFRA 4LFHG 1A1NA 5JIPA 4E9LA 1MFCL 2AJZA 4D3CH 5KSVB 1DANT 4ZFOA 4DVBB 1OP3H 5IEKB 1TNNA 3IDXL 4QHMA 3V6OE 4JFFB 5C6PB 5E9DD 3VWKA 2DJ4A 2Y6SD 2QSCL 3H7LA 4YHOL 3OAYH 3SDAC 3VWJD 5GRJL 4F7TB 5EOQL 2Z4QB 1F4YH 1IGIL 5FHBH 1CFSA 4RGOH 5H2BA 4CVUA 2P5EB 3TO2A 2FBJL 5L8KB 4FQJH 4HUVB 1I8MA 1RJYB 3RI5K 1KB5H 1K6QH 4KQ4H 3QXDB 4DTGL 4HFUL 3D25A 1TXKA 1A7RL 2Q86A 5BCAA 1K4CB 4FQXC 4EOWH 5J6GA 1CL7H 3U82B 2FGZA 3BP4B 1I8LA 3UBXA 2H32B 1CXKA 4WTXA 5IVXE 5CEZE 1LDPH 3JWDH 2P24A 1OGAD 4YQXH 1CICA 4MB3A 4XC3L 5JIKA 4ISVA 4M4RA 3V5DA 3MLWH 3BXNA 4N8VA 5D7KE 4PRHE 1C5CL 3MLUL 3RZCB 1B6DA 2P7TA 4X7DC 4K7FB 4K23H 3T2PA 3PXJA 4UOW0 3PGCA 1J1OH 4JRXE 1JE6A 2VN7A 2FZ3A 4Q7DA 1I1RA 2DKMA 3SY0B 3MREB 4OLYL 3O11A 5JR1L 1RZKH 4HJJL 4KTYA 2DQUH 5DR5L 4XGZB 3DROB 4NC2B 3REVB 5DLMH 3WJJA 3HRZA 4X9GA 3IS0X 4W81A 3QRGL 4GUPA 3IDMA 4LKXB 2IPTH 3LRHA 4PJAF 5SWSD 1EIBA 2BNRA 4XVUD 4NQEE 3LHPH 2R8SH 3T0AA 3S3SA 1NC2A 5TGBB 1IKFH 3PP4L 1DLHA 3MUY1 4NHUB 1NCCL 1EVUA 4NUJA 2IQAB 5E5RB 4TOYL 1PZ5A 1I3UA 4UIKL 3O3BB 4U6HB 1U42A 4YHLH 4PJ5B 4LHUD 4CDGC 2ZUXA 1BIIA 1FV1B 2AXFB 7FABL 1I8IA 2ESVA 4XPFL 1T04A 4F3FA 3RUGB 3GSRA 5MP6H 2K7PA 1JGVH 1EK3A 2GFBA 5HHOA 2VAAA 2DMKA 3UTSB 3EJZC 2OI9B 3MCG1 3RWFA 4L3EA 5ISZA 3V5KA 1GYAA 1TITA 1W0VA 1BWMA 1NCDH 1CLZH 3P11L 1HQ4A 5ETUA 4LGSB 1D6VH 3T0XA 4FQPA 4ZQKA 2RAMA 1CXEA 4PJHE 2A6JA 4WRLA 4MA3A 5D7JD 5KSAA 1ZXQA 3QJFB 2QKIA 4G6AD 3V79C 4JPKH 3BEVB 5BS0D 1RIHL 3GO1H 1OOAA 3S4SA 5CBAB 1T22A 3ARGC 4KDTA 4XHQA 1G9MH 4L8CB 4O2CA 5JHDD 3IKCB 1NDMB 5JO5A 1LD9B 4NO0A 1A6ZA 4TVPD 5TQ0L 2GJ6E 2DD8L 3GB7B 3ZYJA 1S9WB 3DXAE 3RWDA 3EJYD 3VI4E 1CQYA 2WM0A 1YJDL 3U4EA 1XGTA 3ALXA 2AXGA 4LCCC 5HY9A 1T21A 2FIKB 2PYEA 4HCRH 1RZ7L 4XCEB 5DHXB 4X80L 3CC5B 4ZFGL 3RVTC 4OSUH 5KSVA 1I1AD 4OZGA 4JY5L 4DVBA 1BBJB 1J0ZA 2VR5A 2OR9H 4J8RB 4JFFA 2EYRB 2V7NB 4N0YH 4PJ9D 4N0CD 4KU1A 4N5ED 2NY2C 2J1KA 4PS4H 4QRUA 1YMHB 3PDGA 3P4NB 2Z4QA 3EDEA 5AYQA 3NTCL 4LOUD 3SDYL 2WWMD 4YBQC 1OGTA 4R3SB 3O6KL 3RGVB 3MLVL 3MJGX 1RJYA 3OB0H 5EU4A 2ZP0T 5EO0A 3QXDA 3VGEA 3U48A 2CH8A 3T2QA 3OB8A 1OM3H 1K4CA 2FX9L 3LB6D 3GMLA 4QRTB 3BP4A 4OZFG 3ULUE 2VDKH 4OUUB 2H32A 1JGDB 1CXLA 1A5FH 1YN7B 4MVBC 5I73B 2NY0C 4J23A 4GW4B 2X44D 1U3ZA 2BXZA 4GRLC 1CD9B 4EDWL 1MJ8H 2DJSA 3LKRB 1CBVL 5CJ8A 3AREA 5HHVH 3RZCA 2YWZA 2VKWA 4I0CC 5DHVB 5I0ZA 3WBDA 3O8XD 3O0RL 2CDGB 4YR6B 3CVIL 1DBKL 4PRPE 3NABL 3SY0A 3SDXB 1MEXH 5CEYA 2LAGB 3MREA 4OFYD 3BESR 2AQ2A 4ALAH 3QDJE 1QFWL 1P7QB 3REVA 4IIQC 1OB1B 3MRMB 1QYGH 1AIFB 4LKXA 3TN0D 1N59B 3T0EC 5JPNB 1AXIB 5DSCB 3LPWA 2ADJA 4Y16C 5ADPH 3LOWA 4WWKB 1CIDA 5D2NC 1S9XA 4WDIB 4S1DD 5TGBA 2RQ8A 4NHUA 1EJOH 3WCYA 4B0MM 4Y4KC 4LGRB 3LIZH 4U6HA 3ZKMD 4PJ5A 2H32H 4MA1C 2AXFA 3KAAA 2ZOKB 3RUGA 2VLRB 4DAGH 3TO4C 4BFEA 1NANH 3K4DA 3STLB 2WWKO 2HN7B 2VDNH 1ZLVK 2Z8WC 4NQDE 2NY3D 1RUKH 4FQCH 3UTSA 3OKMB 5DD1L 2QHRH 1IC5H 4HIIB 1CGWA 4RMTA 4E41B 4IM8A 4XPHL 2Y06H 4CMMB 2NY4D 1IC4L 1Z9MA 1ULVA 2ZSWB 1U92A 2GCYB 2RCSL 5I1DB 3AFLA 4RFOL 3QJFA 5E8EB 1H8OA 2PKDA 4OF5A 3MRRA 3L3DB 5CBAA 1A6VH 1MWAL 4L8CA 1KOAA 3IFOB 4LCUB 3TT3L 2Z92B 4D94A 4LMQE 3U0TB 3AM8C 3IKCA 1NDMA 3RJDA 4DKFL 1BOYA 2NY5C 3MFFB 2WBJB 1S9VB 3UYOD 1S9WA 4QRPD 1YYML 3WKMH 2Y07H 5AG8A 4NQDA 4LKCB 2FIKA 1G6RB 4N0FB 4D9LL 5LVEA 1NGQL 2QSQA 1AE6L 1NCAH 3FQTB 5BQ7A 2UVEA 3C8HA 4MAUH 4OZGF 2FGWH 3PP3K 5E2WH 1ORSB 1ZWIB 1BBJA 4J8RA 1L7TH 2QTEA 2EYRA 1KEGL 3NAAL 2D0HA 4UINL 1A7PH 3F6IA 1YMHA 1GVIA 4YEEA 2Y72A 3CSPA 4XMPL 3P4NA 1PG7H 1JN6B 1QRNE 4M61B 5FHAL 1LVEA 4R3SA 2F8OA 3RGVA 3IJSA 2VDRH 1AFVH 5J7CC 1LO5B 3AUVA 1RU9H 1VGKB 1PGRB 1MUJB 2IJ0C 4YK4C 1JGEB 5C0BE 3TBVB 3OGCB 1FSKC 2HKFL 4GG6B 1EX0A 1RIUL 4O00A 1NBZB 5D5MA 4QRTA 1FVEB 3GSNL 4OUUA 4KUZH 4Z95L 1JGDA 4IDJH 4CU6A 1YECH 2Q6WB 5I30H 5BJTB 5DQJB 4TPRH 4UT9L 2I27N 5E6IC 3LKRA 4PGBA 1C1EL 1Q8MA 4ODXB 5J1TC 3VGFA 2P49B 4X5LA 5DHVA 5EU6B 2EC9T 5F9OH 4K7PY 5FOJA 4HWEH 5BXFB 2CDGA 4YR6A 5HI4D 4G6MH 1MFBL 1TZHB 3DLQR 4M5YL 5DZNA 3SDXA 1H3GA 2ARWA 5IHBA 5J57B 4LPYA 2KL6A 1UT9A 1Y0LB 4ERSL 4Z8FH 3LEYL 1J7VR 1V3KA 3MRFB 3MRMA 1PAMA 4NN5C 1AIFA 3HLAB 4E0RA 1N59A 5JPNA 3SJVB 4RAUB 4ZUWB 3ULUF 4MS8C 1JIBA 5DSCA 4KI5D 5EBMB 3GKWH 2V5TA 1N5AB 1A8JH 4DKAA 2F5BL 4WWKA 3U0WH 3MR9B 3MYZA 2BSRB 2N56A 2O26U 2EXYC 2WMPA 3L5JA 5D7LE 4Z18A 3QDMB 5BV7B 2B7DT 4WHTB 2DQFB 1YC8A 3W2DH 2HAZA 4U0QB 4XC1H 4OFPA 4ZD3L 1VB9A 4PB0L 1GC1L 2IAMC 4NRYA 3MLTA 5DJDB 5FDWB 1FVDB 4G6FD 4DN4L 4OZHA 2VLRA 4FOMA 5FYJH 5T5NF 2P43B 3U36B 5CGTA 3STLA 4OIBA 5L2KB 2GTZB 4YX2L 3QEHA 1PBYA 4JAMB 4Z76B 3MMEB 1SMAA 4G9FE 3QI9C 1LO0L 3OKMA 4HXAL 1X4YA 4G9DB 4FP8L 1OP9A 5DHVH 4S1SH 4LAQH 1BPVA 1G7MB 3FFCD 4E41A 4HV8B 4CMMA 5IB3B 4OF0A 2P42B 4Y19D 4WEBH 3RKDC 4WY7L 1FAIL 3VXTA 3QDAA 2GCYA 4U6TA 1JCKA 5HI5C 1AQDB 4GSDH 3IB4A 3ZYIA 3QO1A 5FGBA 3TJEH 1A47A 1DBBL 2HA1A 5F97E 1Z9SA 2FX7H 3ZHLA 5L6YH 2DICA 4FZ8H 1TJHH 3L3DA 4NWTL 3IFLH 4LCUA 5LAXB 1WK0A 4LHQB 4R2GD 2FH6A 4TRPL 4P3DA 2X4OB 2WBJA 1S9VA 5TJWK 1IC1A 4DJMA 4Q6IA 4QOKE 2VLJE 1DP0A 2P8MA 1CWVA 4PJDB 3OKEB 2C3GA 8FABB 1C5DA 1L4IA 2BRRH 3RTQC 4N0FA 2FHFA 3MRPB 2H45A 5D1ZD 3VFOA 5GS0H 4HPYH 4LAJH 5L9DL 2EDJA 1B2WL 2PNDA 4LBEB 1QA9B 4JKPL 4WVRA 1ORSA 1ZWIA 4R4FH 4X6FB 3VG9B 3PL6C 3O2WL 5FKAB 1A7BA 1W0WB 5F1KC 5C0CE 5A2IH 3VWKD 4AENA 1PG7W 3QP3A 2DBJA 2X4TB 5I9QC 1JN6A 4OCWH 4M61A 5JW5B 4P2QE 3KNBB 3C08L 4P9ML 1IKNA 1LO5A 1VGKA 1MUJA 4OCRH 5CAYB 2DLTA 1JGEA 3OGCA 1OW0A 5D5MF 4GG6A 4O51B 1NBZA 1FVEA 3MRLA 5HD8D 2YA2A 1DR9A 2YEZB 4NFDA 1MHPL 3IGAB 2Q6WA 2VDPL 3WSQL 2V2TB 2F74B 5E0QA 5FECA 3L5WB 5DQJA 1CICD 3VCLB 1E4KA 1AGFB 1F8TH 5ELIA 5EIIB 3GZKA 4JM4H 1BD2A 3RX8A 3E3QE 2X1QA 2NY6D 4R8WH 3ZKXC 1S3KH 4D0CB 1G6RH 2Z31C 1DBAL 4WHCA 4HIEA 1AGDB 3SDXF 1WSST 1A4JB 1KCUL 1TJIH 4NFCA 2B39A 2R0ZH 3T4YB 3K1KC 3AU1B 4YFLI 2MOVA 1Y18B 1SBSH 4OI7A 1Y0LA 3NIDE 1GAFL 3Q5OA 5TE6L 1B88A 2BVQB 1PY9A 3MRFA 2AJSL 3HLAA 4ZUWA 3MJ9L 5EBMA 2BNRD 5IROC 5LGKA 2ENSA 4HLZH 4MXVE 3UAJD 2PTUA 4XMLH 3MR9A 3HE7C 5C0NC 2BSRA 1DE4A 1X5ZA 1GC1C 3QDMA 1DTUA 4F7EB 4WHTA 2OL3B 3TPUB 2XZAH 3UJJL 1M7IB 1Q9WB 1G0YR 4JRYB 3PDOB 5KVFH 1MRDH 1Z5LB 4OZHF 1YEHL 3G5YB 5DJDA 5JZ7D 4ZMAT 1P84K 5IBTL 2ESVD 3VRLE 3U36A 4L3CB 5L2KA 1T4KB 2GTZA 3AXLB 3PUCA 4JAMA 5HHOD 1ZK9A 3QDGE 4P4KB 5KZCD 2VJXA 4G9DA 4OCXL 1YQVL 2R0WH 3HKFA 4L3ED 4N1EA 5ISZD 3VW3L 1G7MA 2YD1A 4HV8A 5IB3A 3WV0A 3ILQC 4LSSL 4HH9B 1HHJA 2D7PA 1XGQA 4QGYA 5C07E 2H6PA 1A7NL 1A6AB 1AQDA 5DJ0A 3EYQD 5GGUB 1FDLL 4FG6D 5DJCA 4F9LA 2HYMA 2ICEB 1DQDH 4OIIL 2X89A 3MLXL 3O9WB 5LAXA 5EOCL 2H2PD 3I2CL 4KTEL 4NO0D 4O02L 4OM1L 1QHOA 2YK1H 3WFDH 5BV7H 4PJBB 3P9MB 2OZ4A 1A6WH 4AH2A 2VLKB 3BSZH 1MQKH 3OKEA 1FIGH 1UC6A 2PYED 4WFHE 3WFCH 1N0XH 4CU8A 3MRPA 4UU9A 5JTWA 4ZXBB 4APQC 3IKKA 3C2AL 4LBEA 4X98B 3KR3H 1QA9A 1KELL 1CQKA 2GUOB 1HINH 2NYYD 4X6FA 1NFDE 3QUXB 4JFFD 5FKAA 4EKXA 3QQ9D 4RIRA 3QNZA 4A2MA 4PYHA 4M7ZB 3MYJB 2X4TA 4DKEH 2R0KH 4BJLA 3QBTB 2ERJB 2P5ED 1FVCA 5HYSG 1EFXA 4UT6L 3T3PF 2GYSA 3CFEB 4KK5D 4B7IA 4MJIB 5HHNA 1JWSB 2DQGH 2R1YA 5CWSA 4NQUA 1IBGL 3MOBL 5EO9B 3OKNB 2YEZA 1IAIH 3IGAA 2V2TA 2F74A 5GGQH 4KVNH 3L5WA 3VCLA 4WUKH 1AGFA 4M1GH 2OZ4H 2HT4D 5EIIA 1RUMH 3RZCD 3SQBA 1J87A 3VD4A 1R3IH 2PR4L 1HYSD 5DD6B 1BGXL 1IJ9A 1OAZH 4JDZB 4RNRB 3TBTB 1OAYL 4DCQA 1A4JA 3NIGE 4PJGE 1AGEB 4HJ0D 3DSNA 1OSZB 3CLFL 4I3SL 4ZUVB 3T4YA 1V5JA 4X5XB 3AU1A 2IF7A 1VEOA 3A67H 5DFVC 4AIOA 3EO9L 2GHWB 3MFGB 1OAXH 2G75B 5IQ7H 3NOIA 2XA8L 5E2UL 4AM0B 4WI5A 1NCTA 2VXSL 2IALB 5JXAL 2M2DA 1U91B 1BFOB 3R0NA 2FD6L 3O3UN 1ZHNA 4JM2C 2OL3A 1S7VB 2YD4A 3K81A 5F7WC 3QIWC 4C4KO 1M7IA 5GJSH 5EU7C 4JRYA 2ZPKH 4KUCF 3MC0A 3PDOA 1Z5LA 3G5YA 1NGPH 4PJ5D 1DQMH 4OF6A 5CIPB 4PJGA 2CXGA 4L3CA 1FZOA 2NY1C 1T4KA 3DETD 1BFTA 4JHZA 4IJ3B 3AXLA 5J3HC 1AP2B 3O4OB 1BZ9B 4P4KA 4RDQG 1A3QA 3SDDB 3NIDF 4HDIB 3UTSD 3LQAC 3OAZK 3V4VH 1OPGL 1ND0B 1RI8A 2VDQH 2OR8A 3L3JB 3S98A 1YEEL 3H9SB 5INDB 3BKCL 3OXRB 3BKJH 4HH9A 1D9KB 1MCCA 4LCWB 4DEPB 1A6AA 1M7DA 4JQVA 3VXQB 4XCCH 1XF2A 5GGUA 2HT3D 1BX2A 2UWEB 2ICEA 3MV9E 1QBAA 4LRIC 3S3PA 5CLTA 4OKVB 4MNHB 3PWLB 4NGHL 5CINL 3X3FH 4Y89A 5J06A 3L5XL 5E2TH 2LQRA 5JW3H 4Y0GA 3GBNL 1Q9LB 5FYKH 3FN0H 5BRZB 4WFGD 4BQCA 4LLUB 5I15H 4PJBA 3P9MA 4YIQA 1WGOA 2OL3H 5A43C 3GMPB 2VLKA 3WKNA 5F72S 1OD9A 5T3XL 5E5MA 2CUIA 3H3BC 4NRZB 5GGVL 1RJZB 4LPUA 3KS0J 4ZXBA 3FT3B 4N0UE 3OQ3B 1AD0B 1D5BB 4OCSL 4EN3B 4HK3J 2J6EL 2GUOA 4LASL 3EO1B 4LEXH 3TVMC 3QUXA 2D0GA 2YR3A 3P4OB 4I0PA 4YDLC 1NC4B 5C0RH 5J1SC 1HXMB 2AAVA 3MYJA 2AJUH 1JNLL 2R1XB 1FNAA 5E94A 1U93B 3RGVD 3WXVL 1XR9B 2XQBH 4JFHD 4XX1G 2GJJA 2L7JA 4JO1L 2ED9A 1I7UB 2NNAB 3NMEA 1A7OL 1U8JB 3O6LH 4DOHE 1A6UL 4ORGB 3M07A 3MZGB 1JWSA 4PREB 3KPNB 1BJ1J 4MNQE 4NQCB 1ZV5A 2VDLL 3K8MA 3RPIB 3OKNA 3BMWA 4QYOB 5IVXB 3DX8A 3L95A 4YDJA 4XMKH 3HI6H 3TNMB 3UYRH 5FYJD 1YY9D 1NMCB 5D72L 3HFML 5F71A 1JHLL 1GIGH 5DD5H 1KJ3H 3UYPA 1BECA 1VADB 2YRZA 4GMTH 1RZIB 4JFYA 3M45A 1RZJL 4YHYC 4Z77A 1AKJB 4KHXH 4PGEA 2JCCE 2VSDA 4OKDA 4XB8A 3N9GL 1N3NB 2BNQB 4JDZA 3TBTA 4Z7WB 3BYTA 1TENA 1YEKH 1JPSH 1N2RB 4CDHA 3PF2A 1DBMH 1AGEA 2R2EB 5EIVA 2RIKA 2AABL 1OSZA 5D9SB 1UG9A 3IDYC 4TSBH 4ZUVA 4X5XA 3HC4L 1P7QD 4ZO9A 3MXVH 1PQZB 3A6CH 2MMXA 1JGLL 3VG0L 1FL6A 3ARVA 4UZGA 1ZHKA 2G75A 2DQIH 1EHAA 4M00A 5EWIL 5KBNC 3X12B 6FABL 1MH5B 3I50L 4HC1L 4AM0A 3HC3L 4WWKD 5HDLA 5C0JB 2IALA 3L7FB 3RNQB 4PJXA 5I18H 4RMQA 3K8KA 3O6FC 4C56E 1JZ3A 5E4EC 1AXTL 1S7VA 4YXKH 3V9FA 1RVFH 3QHZH 1IC7L 2NTSP 2NY3C 3HZVB 4NHCH 4ETQB 4YHMH 5GS0D 2R4RH 1Q1JL 2P8PB 3SGDH 4RSVA 3NIGF 4PJGF 2VLRD 4JGJA 5JOPE 5CIPA 4WUUE 3LKQB 1DL7H 4TTDC 5DF0A 2GAZB 2LU4A 3KXFE 4M3KB 1AP2A 5A3ID 3SDDA 1WTGT 1K8IB 2NY7L 1SEBB 1M4KA 4HPOH 3L3JA 2XZQL 3GJEB 3H9SA 3DUUB 4E41D 1Z3GH 3OKDB 3CVHB 5INDA 1JBJA 3OXRA 1MFDL 1LK3L 4U7KA 4UOW1 2VWEC 1D9KA 1NBVH 2X4RA 2DYPB 3SQOH 5B3NA 4M5ZH 3QQ4B 4LQFL 1P2CB 1S7SB 5FB8B 4KPHH 3VXQA 2BY0A 3FQXB 3HNVH 2NTFB 1II4E 3LZFH 2UWEA 3NN8A 1CD1B 3U1SH 2HFTA 4XVSL 4OKVA 4MNHA 1T83A 4JO4L 3VGAB 3PWLA 2X70A 3S88L 1GZPB 3TYFA 3GM8A 2D4DA 3MV01 4KRPB 4KKCC 4ONFL 4ZO7A 4M6OL 2A83B 5JUEH 1GXEA 2GJ6B 4G3YL 2DL9A 3WUZA 4PJBF 5BRZA 1T1WA 2WBJD 4LLUA 4WUUA 1S7XB 1UA6L 3VFSB 3GMPA 3RY4A 3R0MA 1P7KB 3WUWB 4JPVL 4C59B 5FYLL 3FO2B 4KROB 5DUMH 5B39G 4NRZA 1QBBA 3VH8B 4NM8H 2HG5A 1S9KC 3TBYB 4NT6B 1MCKA 2J8OA 1AD0A 3WFZA 1D5BA 1LILA 4FMFA 2COQA 4KRLB 4EN3A 5CIPH 5CGYD 4PBVC 1QLRB 3DUSA 4P9HH 4TVSa 1UWXH 5T1DH 1CFTB 1LE9A 4YDKL 3P4OA 4IRJB 4XAKE 1NC4A 1HXMA 5DD0L 3HCVB 2R1XA 1DFBL 1WFUA 3SE8L 1CFVL 3HA0A 1HWGB 4KKLD 1U93A 4MNGE 1I85A 1WCBB 1XR9A 1J5OL 1AQKH 5CJQH 1OTSC 4KC3B 3KHOA 3N0PB 2VXTH 1U8JA 4OFVA 4EIZC 3PHSA 1CR9H 4JB9L 4L4TE 1J0IA 3S35X 5DXWA 4U1HB 1J18A 1RPQA 3KPNA 2OP4H 3ZDZE 4NQCA 5F9JB 2DQHL 1E6OL 1MCHA 4XBEH 4QYOA 1A4KB 4QTIH