4UUJB

Potassium channel kcsa-fab with tetrahexylammonium
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujB01
2ADJA 4DK3A 3IDYB 3TNNA 3NH7H 4TUKH 5CGTA 3GJFA 5E2UL 1T0PB 3VXRE 4U3XA 4ZUWA 5ISZE 1K8IA 4LGSB 4F7TA 2Q8AH 5HD8C 4YZFF 4PG9B 5CMAB 2A0LC 1IGFH 2FEEI 5MI0B 5HDQL 4NQEA 5EO1A 3GI9L 1RIUH 4C59B 1B0GB 4XMLL 1I7RA 1YN6B 1F8TL 1HCVA 2BHYA 1MHEA 1U92B 3UTPE 1CD1A 1S7VA 3AU1A 4PR5B 3X14A 4OLXL 2F15A 1GH7A 4LLQB 5D1ZB 2C7UA 4PJGB 1FL5B 3R1GL 3TYGL 1W0VA 2YR3A 3SGJA 4Q2ZB 5TFSH 1D5BA 4EUPH 2GI7A 2DQUH 3QIWA 2CJUL 3EUUA 3K2UL 4RMQA 4P5TC 3HZMB 4TVSa 4POUB 1F6LL 1UB6B 2ZPKH 4M6AA 2MMXA 2QQLL 1ZAGA 2J88L 5CILL 1A5FL 1K3IA 3GUTB 2OZ4A 3QQ4A 3DX7A 4J1UB 3OHXA 4OAWB 4F7CB 1WICA 5DA4A 2GQHA 4K8RD 3VU2A 1PSKH 1A6TA 5C08A 2FJHB 2BVTA 1KCVH 4LKCB 5EFIA 1C7SA 3NFSH 3EGSB 2ZUXA 1WUNT 4Y19A 5E0QA 4MJIB 5KSUA 4JGMA 2Z8VC 4C56D 2PYEE 4WHTA 3VXMD 5I73B 1G9EA 4ODHL 3G9AB 4NKDB 1QA9A 1OP9A 5MENA 5DJYA 2Q87A 2E9BA 4X6DB 1H3UA 3QWOB 1IAIM 3BAEL 3C9NB 4RAUB 2KL6A 5JHDE 5D7LE 1QSFA 4WEUD 2ZSWA 4F33A 5L6YH 5JUEH 4XNUH 2X4NA 1X4XA 3AS2A 3MV8B 2H45A 4MNHB 1NCAH 3RWFB 4HX1B 1IMHC 1OVZA 1T1XB 1XF3B 3IKCA 3WD5H 5HSFA 1YDPB 2BP3A 1YEHH 1K8DB 2N1KA 1A6WL 3VWJC 5JZ7D 1ONQA 2X6MA 5J6HB 2NY6D 3GSXB 1SYSA 1MJ7H 4HZAA 1J5OH 1MCHA 3M17B 4PPTA 1WISA 4KRPC 1AKJB 2V2WB 5GISL 1DSFL 4GT7A 1NLDL 3BVNA 4D8PB 5GS2D 4N5ED 3D85B 3TPKA 2WV3A 2IFFL 2XZAH 3ARGB 5IMOB 3VWJA 3HG1E 5DYOA 1MCPL 1M71B 1I3GL 1UXSA 5D71L 3ARDC 3GSQA 4GXVL 1H3GA 3L3KB 2AJZB 3GSNL 2YD4A 3LB6C 3CXHJ 5HHXH 4JREC 2H9GA 3DURA 4S1SH 4PJEB 4WNQB 2G5BB 3U6RA 3A6BL 1I1YA 3LCYA 1MJUL 4DQOL 3FQRB 1VPOH 1JPFA 3MGTB 4P9HC 4PJ8B 1QFOA 4P9ML 2YRPA 3LN4B 5HHNB 3NPSC 2I24N 3G5ZA 4Y16B 1A02N 5GQBA 2J8OA 4HZLA 1FC2D 5CAYB 4MB3A 2FGWL 3H7LA 4M5ZH 3BD5A 5KTEL 4TULH 3FFCE 5I8KH 1LE9B 2VAJA 5EU7C 4X6CE 1I8MA 3EO9H 1ZHKA 3HRPA 1MJ8H 3QHFH 1FZJA 1ZHBB 1G7HB 5D2NB 2BX5A 5E4IA 5KVFH 5DQDH 1ZLUH 2W91A 3LQZB 3JV0A 4OCXL 5HVGB 4R4BA 1DEDA 1MCJA 4ZUSB 4ODSH 7FABL 4PRHB 5DUMH 2CGRH 2LAAA 3LEXA 2WP3O 1BP3B 3OB8A 2PW2B 1XGUB 5AWNH 3MRLA 1C08A 5L8KB 4NT6A 5T1MB 2IH3A 5DD1H 1Q38A 5DI8B 5DO2C 3EJZC 1OPGH 3ZL4L 5J12B 1JPTL 3QCTH 3ZKMC 4F58H 1A7BA 3VE0B 3U9PL 3GSRB 4U33A 1CF8L 5GPRA 2VXVL 3BGFB 5C0JA 2EIZA 1E28B 3SE9H 2I9LA 4OLWL 4NYLB 4AEHH 3PQYD 4M8VA 1C12B 3E3QC 3KPRD 4EKXA 5JW4M 4L1DA 2BVOA 5CBAA 2BOCB 5AZ2L 4JDVA 3DSNA 4LHUA 5IHLB 3ZYOA 4PGBB 3QPQD 5FO7B 2NPLX 4RRPG 3KLDA 5BVPL 1S9YA 1Q0YL 4IRSC 1AXTL 1CFTA 5CJBA 1AGBB 3CK0L 4HK0B 2VISB 4IM8A 3O3BB 3QXAA 2W92A 4G7YL 2AJ3B 5I71B 1FZMB 2O5ZH 4QRTA 3QJHA 2BVEA 4WGWB 1AD0B 3L5XL 1YN7A 4IRSA 4P49A 3PP4L 4AJ0A 5I8EA 5IB5B 5FGRA 1ETZA 1HILB 3NFNB 2GJ6B 2CRZA 1JV5A 3S96A 1RMFH 2VLRD 5F3HA 1VKXA 1MIML 2PCPA 1PGRB 5K33A 1LEKA 5C7XL 1AXSA 3EDKA 1HDMB 1A1MB 3VW3H 5H37H 2X4QA 4OZFA 4HKXA 4HPYH 5DZNA 1FIGL 4LLVA 1KELL 1KGCE 3SQOH 3SJVD 1X3DA 5T3ZH 4YO0B 5ACZA 3QXDA 4N0UB 1DLHB 3V5HA 3M8OL 2A73A 4AG4L 4HDIB 4K3JL 1LO4L 4LNVA 5TPWL 3F7QA 3FQTB 4YEEA 4XB8A 1FVDA 4MJID 3N1QC 2VH5H 5IQ9A 1CICD 4P59L 5I1AA 1TPXB 3RZCD 1XGPB 3MYJB 4KJPC 1KCUL 2WAHA 5J57B 5F88B 5MEQA 1YPZE 3FO9B 3OGOE 5D7KD 2L7JA 1X5XA 4EI5A 1VENA 3ALPA 1KB5H 1T5WA 3T4AA 3QUZC 4C56E 4UT6L 2YA1A 3OAZK 5LVEA 1MIEL 2ZNWA 3MV8D 4XPHL 4OV5A 4NRYB 3K4ZA 3O2WH 2WLYA 5EZLB 5F7WC 2DQCH 5CKGA 1OCWL 3WE6A 1E4XH 4KJYB 5LGHL 5BS0A 5D72H 4NO0A 3Q5TA 2AXGA 2EC9U 3GSOA 2A6JB 3DGGB 3OMZA 3O2VL 3QUZA 5DURB 2BFVH 3RI5F 3GBML 4HC1H 1AE6H 1AKJD 2J5LC 2BXZA 1KJ2H 1FO0B 3WFEL 1J10A 5BQ7B 4HS6B 5I74C 3WXVL 3T8XB 3D85D 3LKQA 4D3CH 4RCAA 1U95A 2P7TB 3AY4C 1HH9B 3VGDA 3INUL 2FZ3A 2IFGA 1CCZA 4X0KB 2CDGB 4PJ8D 2C1OB 4UQ2A 4OSUH 3QO1A 1HINH 5EO0A 1MFDL 3HC3L 3AY4A 5GSRB 5GS0D 5IR1A 4L3EA 2D7QA 5L88L 3BH8A 3BPNB 1AGDA 4QRUB 4OQTH 5BZWA 1JWUA 1HHJA 1RZIA 2FJGB 4PJ7B 2Z31C 1EV2E 5FYJD 3IJYB 4UTAL 2RIKA 1QNZL 3IDMB 1B0WA 1Q9LB 4F57H 4K9EH 3VXSE 4PBVC 3U36A 3OSKA 1A2YB 1UM4H 2A1WH 3PV6B 2E6JA 5D7JB 1CGWA 2XFXA 4JJHA 3ZE2E 5JIIA 5L2JB 3FONB 4UTBL 4H88L 3LZFL 3MJ9H 1TDQA 4UNUA 5IMKA 4F7EA 2FB4H 2ICWJ 1MWAB 2AVGA 4ZSOB 3IDIB 4RIRA 1AHWB 1ES0A 3A6CL 1EBPA 4NNPL 3L3JB 3UJJH 3P3YA 5J6GB 4ELKA 3RPIB 2LVEA 3NZHL 3FT3B 4PRPE 5DRZA 1Z9MA 2DICA 3ZE1E 3WV0A 3RWJB 1LO5A 2WQ8A 3RWHB 2VDKL 1WBXA 5IB2B 1D5IL 4EDWL 4HCRA 1QFPA 1W8NA 3QUYC 4RAHA 3P4LA 1YEIH 3QEQD 4YHLH 1MVUA 4PJDA 2BHZA 1AGFB 4PRIB 1OAXL 1KIQA 2VNCA 3HTLX 4NHUB 3GMLB 1OGAD 4R7DA 5JNYB 2R4RH 3DX9A 1JI2A 5B39G 3B8SA 4PTUB 4Y2DA 4PRNB 4MD5A 3GSUB 4MLIA 2IQAB 1WFNA 2J6EA 3IDGA 3VMPA 4NQDD 5E99L 4EOWL 2NTFB 5SX5K 1XF5B 3MV01 2H26A 4J4PD 2YEZB 2YN5A 3M45A 1YNTA 4UAOB 2FHFA 1CFQB 1S78C 5K9OA 2CR3A 1DN2A 4XVUC 1CQKA 1D5XB 4BSWA 1J1OH 1U8HB 1I1AB 2EE9A 3DTXA 5ADOL 1DQLH 2CD0A 4KKBC 5L8LB 1PX3A 4KKAD 2JCCE 3ZE0E 5MERA 4PJ5A 4KKCD 2BY2A 1NGXB 2ENSA 2GJ6D 3O8XB 2J8UE 3NIFE 1OM3L 3TCLB 4CMHB 4MDIB 2NY0C 4L29A 4HGWA 4P48A 3IS0X 1FL6B 4X9FA 1VEPA 2YXFA 1UM6H 4I4WA 3OXRA 4KQ3L 3L3HB 2VLRE 4XNXL 3MCKA 3KJ6H 1I75A 2Z91A 2UY6A 2BY3A 2OS7A 2MCPL 5JR1H 3B3IA 2XN9E 4EN3C 3PDOA 5D1XB 4Z9KB 1QFWL 3ARZA 3F7RA 3QEHB 2ZUWA 3E6FA 2BK8A 5JORA 3SJVE 3TNNB 4LRNH 1F3JA 1F11B 1PDKA 4R4ND 2X4UA 2YD1A 4D9LH 5AYUL 4ZUWB 2NXZB 3D48R 4DFIA 2IPTH 3RAJL 4Y5VC 1T89C 4EN3A 3RGVA 4JJ5B 1U36A 1UM5H 4OZGF 1HCFX 2X40A 3KLHC 3O6FC 3O4LB 4CADA 4XPTL 2XRAL 4KZDH 1UJ3C 3WS3A 2WIIA 4Z77A 2A83B 5IHBA 1NL0L 5CEZH 4ODBD 5D7KE 3DWTA 1HIMH 1S7VB 2VJXA 3AU1B 3RL1A 2XT1B 2F19H 3X14B 2PF6A 4Y5VA 1T89A 5DFTA 5ALCH 2C7UB 4GG6A 2LTQC 2PXYC 5DURD 5B3NA 3O6FA 4P5KB 1D5BB 3BT2H 5E5UB 5T1KD 1UJ3A 1EFXB 4KV5E 3RVTD 3WO3B 5F89A 4ZOAA 5E9DD 3GHBH 3IGAA 1NFKA 3V6OC 1G1CA 4R7NA 3LKNA 1IFHH 4R8WL 3DHJA 2PXYA 5FYKE 3V6FB 1FJ1A 4IJ3C 4GRWH 2DJSA 5TDOA 4P5TB 1U42A 4QKXB 4FP8H 4P4RA 3RUGE 3WFBH 1ZA6A 3V6OA 2P49B 4Y19B 3BE1H 5I1HH 1EERB 3ARBD 1J0KA 3G04A 4PJAA 4WHTB 1Z0NA 3QIUA 5FCUL 3VMNA 3IF1A 1HWHB 5DMJB 4Z7UE 3ULVL 4MNQE 3AFLA 3TPUB 5MENB 4U1LA 1P2CA 3F65A 1FGNH 2NZ9C 4B7LA 3O3AB 4M43H 2VDNH 3MOAH 4YFLF 1QSFB 4TSAL 5BMFH 4N0CC 2ZSWB 4F33B 4XBGA 3CDFA 5F9OL 2H3NA 1AGEA 3LIZH 1E4WH 1CGUA 2O93L 4K94H 3IKCB 5DEGB 1J18A 4F8QA 4G5ZH 4LCUA 1MFCH 1JRHH 3E8UL 4UV7L 3WKMH 2A77H 1QFWM 5ESAA 5D7JD 5IK3B 4LAQH 4KDTA 1ONQB 2PR4L 2XKNB 1U8QA 5IT2H 2GAZB 3CMOL 3HKFA 3RY5A 3TP4A 1FH5L 2P5WA 2CKBH 3BVNB 2LQRA 5DFWH 3IXAA 1TLKA 4WRLA 4XNYH 2DYPD 2JK5B 4AH2B 3VWJB 5DYOB 5F7DB 1RHFA 1UXSB 1VFAA 5ICXB 1TMCB 2ADFL 1DE4A 4QXGH 2XZQL 1ACZA 4KRPB 5FK9B 3DURB 3C2AH 2B4CH 3BN3B 4EEEA 2VZTA 4TVPL 1JPFB 4FG6C 5LXGH 3KPLB 3HI5H 3I6GB 2QEJA 2J4WH 1RUPH 3C60A 5CZVH 3QCUH 4HZLB 4QHNB 4NPYA 3ARDB 1GGCL 1MOEA 1QRNE 2VR4A 2AJSL 4M4RA 3MLPA 1QUNA 5IVOA 5DTFA 1HOCB 4JREB 4HLZG 2OK0H 4JHAH 3MA9L 3I75A 1ZHKB 1YQ2A 1OGAE 4K7PX 4DAGH 3IU3A 4HT1L 5KS9E 1BFOB 4XVTL 4NC2B 3NPSB 5EU5A 3HS0A 4BK5A 1OTUD 3AB0C 5ABDE 3JSSA 1Y6MR 1GC1L 3PGFH 4X4XA 4KGLA 3DSFL 1MFEL 1A4JA 1NCDH 1T03L 1NFDE 1RI8A 3LEXB 3O8XD 1RU9H 3MRLB 1AIFA 2HFEA 4J3VA 3IDUA 2IH3B 3CD4A 4JDZB 4EXKA 5IHUL 3T65B 5D70L 2HLFD 4G6AC 3TBWB 3VD5A 4XP9H 4L3CA 1IM9A 4AIZA 1RUQL 5KSVA 5IJVA 2MQ0A 3QEGL 3B9VA 3TH3T 1ITCA 1C5CL 4U1MB 3V4VL 3N1GC 5GRUL 2EIZB 3N9GL 5D1XD 1A6VH 1VADA 4NGHH 3MODL 3MZGB 1IC5L 4X98A 5T5FL 4G3YH 5FYLD 1FLRL 2ZCLL 5E6IB 1H3PL 2XWTA 5KAQF 4LHUB 3MRHA 4GMTH 3MLSH 1INQB 1G6RB 3V0WH 1JGUH 3ULUD 1FDLL 5FAAA 2NXZD 1CFTB 4MS8D 1UADC 1WBYA 5FM5M 2R29L 2ARJA 4WTZG 2VSDA 4HD9A 5FECA 4NN7B 1NFIA 2DQGH 3O4LD 4X80H 4YFDB 4XCFH 4WFGD 1NC2B 2EH7H 5DJ6A 3QJHB 4R2GD 5HGHB 3P4OB 1YMMA 3BDXA 4MVBD 4X7TA 4ZTOL 2OLDA 1YN7B 3UCRA 2CKNA 4P2CG 3PG2A 4LIQH 5DEZA 5I8EB 2BRQA 4HXAL 3MLRL 1TCMA 2A0LD 2UYLA 1EJOL 3SDDB 3S96B 3LSOB 1MHHB 5JA9A 1VKXB 1EFXD 2R2BA 2B1HH 2PCPB 2R56H 3FOLA 3OR7A 1AXSB 5C70A 2VLKB 4M62L 3TT3L 3QH3A 2X4QB 4OZFB 5KOMC 4A2MA 4HKXB 4OF8A 4MQSB 4IRJC 2COQA 5TE7L 4YDKL 2EDTA 5GGVY 4MJ6A 3IXTA 4IDJH 5I8OL 1Q0XL 4LAJH 1RZJL 5E9DE 3V5HB 4P5TD 5DFVC 4YHIB 1BOYA 5E8PA 4QLRA 5GZOC 2UZIL 1FVDB 4MMXC 4Z5RB 1S9XA 1NJ9B 5IQ9B 1F3DH 1RZ8A 2WBJC 2D7MA 3S36L 2X4PA 4JRXE 1XF2A 3BD3A 5K9KA 4A6YH 3I84A 3RVXC 3ESVF 5F7HA 3P9MA 5HYIA 2WANA 3T4AB 4M1CC 2A38A 3HNTL 1FAKT 4JDTH 4OV5B 4PJHE 1YEGH 1KN2L 4HUVA 3CFCH 2WBJA 3WFZA 3O0RH 5F7MC 3CVHL 4NQCA 1ZV5A 4NO0B 1OAUH 4G9FD 3OZ9H 2AXGB 3QUZB 2E7HA 2VXSL 1JZ2A 2VL5A 2FH6A 2ILLA 3QB7C 1OWWA 1DUYB 5F1KC 4JAMA 3G6AA 4LEXH 1ZHNA 1KCRL 3MJ7A 4JFEA 4H0HB 1DEEA 4LSTL 3X3FL 4E41B 5E8NB 3EYVA 1AQKH 2V7HA 3BUYA 2HVKA 5T1DH 1DDHA 3RPKA 5FF6B 5E8EA 2ZCKL 5I66B 3HA0A 1ZT1B 1SVZA 5A40E 5CLTA 5IVXA 4XMKL 2F53A 4WFFD 3WMSA 3GM8A 4PJ9C 4KRPD 2HH0L 4R3SA 2CUHA 3I6LD 4QCIA 4LVOC 4UQ2B 1FNGA 3T0EA 3QO1B 2R2CA 5EO0B 5I1JH 4OBSA 5DVKA 35C8H 2APXA 1P4LA 3ARDD 5SWSE 5IR1B 4L3EB 2R2HB 1AGDB 4PJ9A 4HS3A 1HHJB 4I9WD 1RZIB 2MQ3A 2R0WH 4X9HA 5JW4R 4GSDH 1ZT7A 3P77A 1IZKA 1FFRA 5AZEH 2F5BL 3KR3H 4JFXB 4N8CL 2GK0B 3QPXL 4NCDA 4OGAD 2H32H 4KVCH 2IPKA 4P2QB 4ETQA 2DOCA 4MAUL 3UP1A 4ENED 1MCEA 2CLZA 3B2UC 2Z31B 4YE4H 2VDPH 4YXKL 3GBNL 4KMTL 2VXTL 5DK2B 3PE9A 2R0LH 1ES0B 1DQTA 2H6PA 3MUJA 4DW2H 4OIBA 1F4WL 2FD6L 4ZQKA 3BQUD 4ELKB 2J12B 3UEZA 1L7IL 3G6DL 5DRZB 2VXQH 1RUAH 1U8IB 1Z9SA 2ZP0T 3ARYA 3BKCH 4XPFH 4Y5XC 1ZGLA 5DDHA 4H20L 3PHQB 1UZ6F 2LV4A 2R1YA 4PJDB 5DO2D 4OLVH 1S7SA 5D5MA 5E6ID 1UCBL 3EJZD 3ZKNC 3GK8L 5F1NB 2A6DB 2DLIA 4I0PB 2X42A 4R7DB 1CDUA 3DX9B 4QT5A 5EBMA 1MCOH 4ZUUB 3ZKMD 4Z8FH 4XZUA 4M6NH 2WW8A 4MD5B 5DZOA 4Y5XA 4QRRA 5J11B 3IDGB 1N26A 1U91B 3QUYB 5FYLE 2X89A 2H26B 1NC2D 1RD6A 1YNTB 4JKLA 3UZQA 2BNUA 1G9MH 4PLKC 5HI4C 2MKWA 1OAYL 4F8TA 5BV7H 1JZ8A 3NMEA 2X44D 4WFGE 4PJ5B 4QTIL 4ELME 3SDDD 2FWOA 4YXLH 2WNGA 1OB1B 3LKRA 4Z95H 5I1CH 1A6UH 4K7PH 2VLKD 2UVFA 1U8OA 3PNWA 4WDIA 5GJSH 1W72H 1KENL 2Q8BL 1DANU 2HFFA 3OXRB 1P4IH 2PTTB 4JM4L 5E08H 4NZTH 1MH5A 4N90D 5IFAL 2Z91B 2QR0A 4ZFGL 3C6SB 4MXVE 3B3IB 1B0RA 4N0YH 5E5MB 1HK6A 2VITB 2AW2A 2NY0B 2V2XA 1D6EA 3D0VA 1D6VH 3KLAA 3PDOB 3TZVD 3DVFA 2OZ4L 4OJFL 5C09D 5TH2A 5K9JL 3IDXH 1UZ8A 3ZTJH 2BZDA 1JPST 1SEQH 4K3DH 1A6AA 2X4UB 1LE5A 5CP7B 4G6JH 3TA3C 1BD2E 3BP6A 5A2LH 1GVIA 4LCIL 1CG9A 2F8XC 4EQ2A 4XC1L 4EN3B 2AXFB 3ABZA 4DUXA 3PUCA 4NRXB 3WS3B 4C4KO 4F7PA 4Z77B 3GEWB 5ANME 5ACLA 4PJXE 3DV4A 2ZG3A 4KJPD 1P6FA 4X4YB 3RDTC 4WUKH 2APBA 4Y5VB 4JRYE 4AMKH 3GKWL 3MNVA 3O6FB 1IKFH 1SY6H 4M48L 1I7ZA 1KN4L 2BNRD 1SYVB 3EDDA 2HG5B 4YC2C 3IGAB 4E41D 4G9FE 3V6ZA 3LKNB 3RDTA 2Y06L 3UO1L 1OLZA 4NZUL 3IU4H 4KHTH 5D7SH 2PXYB 1GGTA 1FNEB 1N7ML 1PEWA 2X9YA 3ZYZA 5CJOL 3I3DA 1A7RL 3V52H 5IV2A 1I9JH 4TN9A 5TDOB 4P4RB 4TPRL 5IROC 1ULVA 1V7MH 1ZA6B 2GJJA 3FRUA 2AJUH 4JPWH 5HI5D 3TN0B 3BRGC 2JJUA 3G04B 3P4MA 2I60H 4PJAB 1UCTA 5SWZD 4N8VB 1NGZA 4YUEH 4YWGL 4IJ3B 1J0JA 2BOBA 1JNNH 2OR7A 4DKDC 3U82B 4Y4FC 4PJDF 3C08H 3IYLW 4IRZH 4M7LH 3TYFA 1AGEB 1RY7B 3S34H 3SBWC 5JOFA 3GDBA 1KB5A 4JB9L 4ZD3H 3DO7A 4ZO6A 3B9KD 4Y2OA 4GQ9H 1VSCA 3T0AA 4G42A 1CVRA 4I9WE 5ESAB 3W39A 5ADPL 4P2QD 1NLBH 5MHSE 1KEMH 1EHAA 3RBSA 4IS6B 2Z31D 4FTVE 4P9HL 2JB6A 3TBSA 1IZJA 3SBWA 5ICZA 1QKZL 1TJGH 3KYKL 3IXAB 2JELH 4LK4A 2FBJH 4HC1A 3CCHA 3P0VH 1EEYA 4M7JL 2Y4SA 5FHBL 5F3BA 2QSQA 2HTKC 1VFAB 1FFPA 4YBLC 1S5IH 1DE4B 1HH6A 1D9KD 1PG7W 1DVFD 4MA3B 4EQ3A 1IM3A 2ZSVA 4HKZA 4NHCH 1A1OA 1G0DA 1J8HE 4KTDL 4I0PD 1U8PB 1AI1H 2W9DL 3UTSD 2ESVD 3QCVH 5DHVH 3TIDA 4LLMB 1AXIB 1V3JA 3A67L 1QHOA 3QUYD 4P3DA 2BVQA 3BJ91 3GIZH 4K9EC 3WIFA 1T7XA 4LDLB 4CN1A 2QSCH 4FXGA 1NBQA 3IU3B 5IW1A 5T1LA 2Q3AA 4WEMB 5TF1L 3W2DH 4UOW0 4OQTA 4DZBB 2WLZA 4TOYL 3RNQB 2YPVH 2CDFA 4K7PY 1KFAH 4Q9RH 5DJAA 3QUMA 4HEPG 2AS5M 3RFZC 3LV3B 3BO8B 3MQIA 3T4YB 4IHOA 5D2LA 2HYMA 3WO4C 1VHPA 1GIGH 3AB0B 3RU8L 3O6ML 4XVUD 5T33H 3VD7A 3MXVL 3K1DA 4KXZH 1V3MA 5BOPA 2X05A 1IAOA 1IM9B 2GSIA 1EVTC 4AIZB 5SWQA 4DN3H 5KSVB 5IJVB 4GG6F 4OT1H 3CX5J 5HYJA 3NAAH 4RGMC 1FZKA 2NY0D 1G7MB 1OTTC 4X6FA 4YHNB 2IANA 5FGSA 4PY7B 2VTFA 3H0TA 3HI6L 4XAWH 5H8DA 4X98B 3HNVL 1NEZA 1PAMA 2P5EA 4N90E 2VDQL 2JF1A 3MNWA 1VCAA 3B2VL 4JPIA 3SO3C 2XWTB 3MJGX 4RISL 4KVNH 3MRHB 2YZ1A 3QSKB 1N0XL 5DJZA 3L95A 3S4SB 3QI9D 4OI7A 4M6MH 4FQ2L 5CINH 1E6OH 3BUTA 4UILH 3JVGA 5GGVL 3QHZH 2AQ2A 2OJEA 3OAZH 5IB1A 1QSEB 4G8GA 3TFKD 3MRDA 1MCWM 3C5JB 3RKPA 2V5TA 4PJAF 2QHRL 1JVKA 2AV1A 1S7UA 4X7TB 1A7OL 2E7LC 4LQFL 1T2XA 3DRQA 4LLYB 1CLZL 3QDME 5J1AB 3V7MA 1F4YL 1T83A 2NX5A 5DZLA 4ZDHB 2AP2A 1RZKL 2YPKA 5D1QC 4JO4H 4PGEA 3K1KC 4UT9L 2BY0A 4JFDA 3FOLB 3TH2T 3WEXA 2E7LA 4TSCH 4YHYC 3OKDA 3HE6C 4KHXL 3QH3B 3UYPA 1ZKAA 4KU1A 5ELIA 1YEFH 3CC5A 4MSWB 4U1HA 5FB8A 4MJ6B 4Z7WB 5D1QA 2AQ3A 1CXIA 3TBVB 4J3XA 4JN1H 3VFPA 2EDXA 3HE6A 5FOJA 3CSPA 3TN0D 1MPAL 5AAMA 1AD9B 4IRJB 5LCVL 1RZ8B 2X4PB 4GAYA 5F97E 4CVXB 1O7SA 3IFLL 2XA8L 4K2UH 1PY9A 5IOPA 2P48B 1DBAL 3SGDI 4GKNB 1EAPA 3ELAT 4HWZA 3SKJH 3QJFA 4FFWC 1NSNL 1DQQB 1EO5A 2EDDA 1ROWA 3W9DB 2R0KL 3JTSA 5SWZE 5LJYH 2XTJD 1HSBB 1T5XB 4HIIA 1QR4A 4PJCA 4BQCA 3P11H 3U2SB 1MHCA 3S97C 2ICEB 1JK8B 1QR1A 4HV8A 1IAII 1ZVYA 3TT1L 2SEBA 2MWCA 4K8RH 4S1RL 1BGXH 3UAJD 1WZ1L 4WU5B 1KC5L 1JF5A 2RFXB 4YJZL 4I77L 3ILPA 4X6EA 1ZHNB 4MMZC 5CEXB 5HDLA 1W8OA 1L6ZA 3EYVB 4OCYH 1NBYA 4HH9A 4U6YA 5KVDH 1NMBL 2V7HB 4EUPB 3S88H 1FQ9C 3WFCL 3BUYB 4P2RD 2HVKB 1TZHA 5E8EB 5HHOD 3FL7A 1Y0LA 1UGNA 3PWNA 3QWRD 1DR9A 4XPAH 3MUHL 1INDL 4ALAL 4DUWA 4W70A 5IBUB 5D8JL 4GRLC 1CZ8H 5GZNC 1BWWA 3LQMA 4HQQL 4LCWE 4R3SB 5TE4L 1H8OA 5C0NC 1I8IA 4PLJC 4OZIE 3ZTNH 5EORH 4EXPX 5IESH 3L3OA 3OKKA 1EHXA 1ORQA 3G5XA 3GMPA 4KK8C 4UT7L 1EO8L 5I30H 4JM2B 3OKLB 3MFGB 4PJ9B 4GRLA 3UJIL 2D0FA 4K94C 1UYWL 5SX5H 2C3GA 3NCBB 4RDQF 1ZT7B 2W9EL 2VZ1A 4LVOB 1MRDH 2EDLA 2VZ3A 3P77B 1XR9A 2ESVE 4KY1H 4WI5A 5D4QA 5FUZH 3GMRA 1AO7D 3BZFA 5LGJA 2WBKA 1SBSL 2HJLA 1UFUA 2PETA 5JHLH 2IPKB 4L4VA 4ETQB 4HW6A 4KZEL 3O6LL 4QXUH 4S11A 1IC4L 4CKVX 3U7WL 3MLVH 3BN9D 2VR5A 1DBBH 4PB0L 3SDAC 1RFDH 4GMSH 4H8WH 2H6PB 4KTYA 5HYEA 2YRLA 1CGXA 1AR1C 4YHMH 5EOCJ 4OLUL 2B4CC 3PJSB 2VOTA 3C8KA 1S7QA 3DGCR 2KZ1B 3DUUA 3LN5A 2BNQE 5DDHB 1MY7A 3SDAA 1I1FB 4G6AD 2R1YB 4DK6A 4OGYH 2CLRA 3ARXA 5J06A 3C6LA 4G7VL 1P84J 3X13A 4XP6H 3QBTB 2IJ0C 3ULVD 4OM0L 1C8PA 5FUOH 4QRRB 5A2FA 1QSED 3TWCH 2R39A 4ODXA 2CR6A 1QO3B 5HJ3A 3KPTA 1OOAA 1R3JB 1BJ1H 3G5VA 2DQTL 2XTLA 4XRCA 3ESUF 3R4DA 5EU3A 2R15A 4KKLD 3DXAB 4NUJA 4R90H 5CKAA 4XNQA 1PLGH 4F9LC 3BGMA 1M05A 1ZE3C 4FQQB 3PNWB 1U8OB 5C0IA 3OKMA 4J7RA 3HI1A 1QFUH 1YMHA 3W81A 4JN2A 4HPOL 4BZ1H 3LS5H 2QR0B 4R0LC 1RIVH 5C0AD 4RWYH 3UTQA 3KLAB 1D6EB 3ARED 1KJ3H 1NCCL 4M3KB 4M1DL 1KIRA 1RUKH 4TVPD 4NFCA 1WIOA 1CTNA 1UZ8B 3U7YH 1BJMA 4WEBL 5IF0A 4IRJD 5I1KH 5DD0H 1A6AB 2VABA 1LE5B 2OL3A 3REVA 3TJHC 2R1XA 5IVXF 4R0LA 1CG9B 2YBRA 2R8SH 4DTGL 3PWVA 1UVQB 4ORGA 3D69A 4XGZB 1EDQA 2D7TH 5GZOD 3MJ8A 2RQ8A 5GIRB 3OB0K 3C87A 1KJMA 3GSWA 3NCYP 3DYPA 5I9QB 4F7PB 3DV4B 5A16A 2X2YA 4N8VG 3TA3B 1MNUL 3F7VB 3PL6C 1FCGA 3H9SB 4O02L 2EYRA 2D4FA 4M1CD 2RHEA 4TUJB 3MNVB 4Y0GA 2XTJE 2V9TA 2VLJA 2X4OB 4OCWL 2O61A 1X5YA 1I7ZB 1W0WA 2BERA 4PJFA 3EZ8A 1FPTH 1LEIB 3G6JB 4HGKC 5I6XC 4PV8A 3V6ZB 3PL6A 1WC7B 1YNKH 4UDUA 5ALBL 1SM3L 3RDTB 4O58L 1U9KA 1I9EA 2DIAA 4WHYH 4M93B 4XT1C 4J12A 1TCRA 2DM2A 5J4MA 4ZUTA 3I3BA 5IV2B 3MOBH 3VDAA 3EDEA 2UWEA 2W0LA 2Z8RA 1JN6A 2YA0A 1MCLA 1ADQH 4YC2B 4EVNB 3BP7A 4P2RE 5HHOE 1HKLL 3PDGA 3BSZL 3ULSA 4G80A 5F96H 2Q7YA 4Z7VA 3AXLA 1E4KA 1NGZB 3O2DL 3MMEB 3U30C 4HS8H 2BOBB 3WIHA 2NY3C 2GTWA 2V5SA 4JM2D 1GZPA 5JA8B 1TNMA 3D1MC 1G9NH 1CN4A 2N4IA 4JFFD 5ITFA 4A6YA 4OZHF 3CLEH 5D5MF 3TYFB 1U3HC 2IBBA 5FYKH 2HVJA 1QBBA 5I15L 1KB5B 2I27N 4U6XA 3BXNB 3DO7B 3VDCA 3W39B 5LBSL 1QFHA 4BM7A 1V7NH 1WTLA 3GJEA 4JG1L 1BBDL 4Y4FB 1NGPH 3TBSB 3LH2L 3RVWD 1AO7E 4WV1C 2X4TA 4JVPA 1EGJH 1P6AB 3TC9A 1YYLH 1BFVL 3GFUA 4LU5H 4OIIH 4S1QL 5K93A 3JWNC 2ZG2A 4JO3H 4O9HH 4ZUVB 2R69L 5GS0H 1NAKL 1KJ2B 3B2UD 2F54A 5CHNA 2XWJA 4OF3A 1Z5LA 4GOSA 2Z9TA 2QSTA 1HH6B 3OAUL 5E8DL 3KNBA 2ZSVB 1MAML 4FQIH 4L8BA 1WF5A 3MV9A 5ITBL 4BQ6A 3U0PA 1JYNA 1LD9B 4M6OH 3W0WA 3PABA 4JR9L 4BUHA 4WHCA 4HWBH 3KXFD 5L7XL 3QUKA 4LLDB 1GJIA 3KPSD 4FFVC 1S8DA 5C6TL 4ZTPH 5DUBA 1MI5D 1QLFA 4CU8A 5IEHA 5L2KA 1UG9A 3S4SG 2I25N 1WAAA 4RMWA 3CFJB 3LMJL 3VFTB 4KH2A 4ZODA 4YX2L 3DXAD 4F3FA 3MJ6A 2H32A 3BDYL 4ODWB 1HI6B 4HLZH 4KK6D 5E95B 5L9DL 4PLKD 5HI4D 5ECJE 1T0NB 1U2CA 2DWDA 3T1FB 3BP4A 4PJIE 1IAOB 2GSIB 4PJBB 2DLFL 5JQHC 4XVSH 4W4OC 5KSBB 3UTTA 4GXUM 2IMNA 3MOQA 4JKPL 3NABL 1K2DB 3WLWC 3WUWB 2DMBA 4UV4H 1CTOA 2IANB 2YD2A 5CCKH 4LOUC 3H0TB 4MJ2A 4X4ME 1NEZB 2D9QB 3MNWB 4JPIB 2DI7A 4MB5A 4X4ZA 1ED3A 3DI3B 2CIKB 2VDMH 3L95B 3S5LB 1JPGA 1T4KB 2ATKA 5C0AE 3QFJD 4RGMB 1KV3A 1SEBB 3ET9F 4FQPA 4TVPE 1WFOA 1G9MC 3VXUD 1FE8L 5BV7C 3KPOA 3GHEH 1OQOA 3EKCA 5EU6D 3TIEA 3VXOB 2GT9A 3IAPA 3SO3B 1DN0A 2AV1B 4AEIH 1S7UB 3IJSA 4RQQB 2W9LA 3TA3D 3IJHA 2OTUA 4XPBL 2NX5B 4CN4A 1WITA 3H9SD 2D7PA 2VDLH 1IGML 1M7IA 4GLRH 5MEPA 2CMRL 3LY6A 2WM0A 4PLNC 4P23C 5I2IB 2CLVB 3WEXB 1WLHA 4C57C 3OKDB 4NP4H 3WSQH 6FABL 4P0DA 2IG2H 1RJZB 3CC5B 4CW1A 1M7XA 3OTTA 1MRCH 3PHSA 2E7CA 5FB8B 5D1QB 3U4BH 1W72A 2HT2D 2EYTB 3O81A 4JQXC 1UEMA 2ADGA 4P23A 2ED7A 4P57B 1XCTB 5IBTL 4YHYB 3HE6B 5I18H 3F6IA 4EUPG 2C1PB 4ZXBD 3EYFA 4RX4D 1IEHA 5HGGS 2W0PA 4HFWA 2BVYA 4GAYB 1FAIH 3VG0H 2ITCB 3IDNB 1TVHB 1FL3A 4BFIA 4BQBA 4JQXA 4V2CB 1EAPB 1RIHL 1J8KA 3QJFB 5BXFB 1YC8A 3RI5K 4M5YH 2YC1A 3Q6GL 4FQXC 1RUMH 1LO0L 1FRGH 1RZFL 2Y6SD 4L4TA 3F8UB 4HIIB 1BFSA 1X5FA 5EOTA 1MHCB 1OY3B 4OKVB 3DV6B 2AJVH 3HR5B 2FX8L 2O5XH 4HV8B 4JFFE 3ZKQD 2R23A 3CXDL 1JL8A 2R9HD 4Y4FD 4OBRA 1JI1A 3WFDH 4OIAA 3ILPB 4PFEA 5GGTH 1BAFH 3BIAX 5HHPA 3ZKXC 2EEAA 4X7EC 1ZVSA 3JWDL 1NBYB 4PREA 3PWUB 4NO3A 3MX0A 1TZHB 4WFEE 3I02A 4AM0B 3R06A 3FAWA 2L0DA 3FTGB 1FN4A 2YKLH 4HUUA 4CL7A 5D2LF 4JFZL 4BYHA 3HUJE 8FABB 3T3MF 1I8IB 4QXTA 4GRWB 3ARQA 3ROOA 1ZGLP 5DLML 3UPRA 3QA3A 1G1YA 5DRNA 1ORQB 1A6ZB 5CS7A 2NY2C 3G5XB 4GAJL 3GMPB 1NANH 1JTOA 2ZCHH 4D0CA 3P9LB 4J3WA 2BVPA 4FQLL 3PGCA 3NIGF 4GS7C 3O3DA 5GRJL 1TJIH 4Y1AD 2EDJA 1NCNA 1XR9B 2XQYG 1MFBL 1NBZB 3KXFE 4NM4H 3ARUA 3GMRB 3BZFB 5LGJB 2HJLB 3H3BC 3SQBA 1P4BL 2HRLA 4OZGE 3BX7C 3KPSE 4ODTH 4YNYA 3WN5B 4NN5C 3TBTA 1P7HL 4N9OB 4G8IB 1JGLH 5I1GL 1MI5E 2UUDK 2P42B 3N06B 3IVKA 4PUBH 1EJ6A 2EE2A 4TNVF 3EO1A 3B4NA 3HMWL 3QUXC 4Y4KB 4OI8A 1GCFA 1DJSA 3L5IA 2X1PA 1NC4A 3QDJB 2WBWB 8CGTA 2CKBB 2RCSH 3TV3H 1S7QB 3ISWA 3P40A 4NUGL 5DQJA 5F7EH 5B21A 2EE3A 4XI5D 3DYMA 3LN5B 2X7LA 3MR9B 2VQ1A 4JO2H 5C3LD 1U8MB 5LQBH 3QUXA 3SDAB 1MCIA 1YJDH 4HMDA 4Q0XH 1OAKH 4BSVA 3LHPH 4UOJA 3EW3B 1KCSH 4P4KA 5I8CB 1YY8A 4NWTL 1RAMA 2ORBL 1OTTD 4Z7QE 2NW2B 3MLZH 5E94A 2AJYL 2Q3ZA 1S7WA 1HXMA 3G08A 4FNLH 5DHVA 2GCYA 5T5NG 1YECH 3QFJE 4XB7A 2AGJH 5BRZE 4W81A 1P7QD 2EDOA 1E27B 5DJ2B 5DRXA 3MLWH 5CFHA 3VXUE 2PYFA 5EU4B 1YEJH 2O26U 1TENA 4NKIH 4XTRC 3VD9A 5EU3B 5EU6E 4GRMA 2K1MA 3D39B 5JXED 1IT9L 4NUJB 4XNQB 3SKMA 4J6RH 1S9KC 3FZUC 5DGRA 4PB9H 3LKOB 1M05B 2IWGA 1U8NA 4PJCF 5FYLH 2FDBP 4H5SB 3V4PL 4MNGE 3FFDA 1S9WA 4MA8L 1YMHB 2BCKA 3JV6A 1LHZA 4CNIA 4IOSD 4NZRL 4UIMB 5M95B 5IKCA 4DKFH 3UTQB 2V17H 4QWWC 3I9GH 3WL9B 1ERNA 1GOHA 3EJYC 1KIRB 2WP3T 5I0DA 1IGTA 2F74B 3BKML 5J9PA 4KPHH 2OXGA 3IETA 1WSST 4M7KH 3BMWA 2OM5A 5H37G 4R0LB 3DROB 4DKAA 5DHXB 3PIQA 3PWVB 3WNOA 1DQJB 3D69B 4ORGB 2HT3D 3OF6A 3MNZA 3KPPA 3FQNA 3MJ8B 4OF7A 4KDWA 1RZ7H 2NXYD 3DBXB 4CVUA 4OTXL 4KJWD 5EC1A 2ERJC 5A16B 3HZKB 4XP4L 1GGBH 4WU7A 4GW1A 4NOBA 1XF4B 2EYRB 2YRZA 4KI5D 3MV11 2BDNL 5E24E 1W0WB 5EDXA 4NSKA 4RRPA 1P7KA 4R9HA 3AMKA 4PV8B 2HKFL 4G8FB 4UDUB 1FFOA 1T20A 2BY1A 4HIHB 3PDDA 4NQEE 3DRTA 4JKMA 1MCWW 1EXUA 5JW3H 1J05A 4U0QB 4JFYA 4FOMA 4LPWA 3V0VA 1TVBB 1ZWIA 2FO4A 2ZOLA 1AJ7L 5DR5H 5I6XB 4KUZL 4N1HB 5F6IC 1Z3GH 1KPUA 4G80B 3BKYH 5IB4B 1VA9A 5DMIH 3T1WA 5CUSH 3WHXB 2Q7YB 1LP9F 1I9IH 5JXAL 2MNUA 4CU6A 3O11A 3HAEH 1JZ7A 5CBEA 1GZPB 4WUUD 4NFBA 2LVCA 5C0ND 1X9QA 3GSVB 1OW0A 4G6KL 3VA6A 1MRFL 4PLJD 5ITFB 4A6YB 3O45A 4RMVA 2B2XH 1CGSL 2HVJB 3H7BA 1MREH 4K8RC 5C0RL 2HWZH 5C08E 1CBVH 4KK8D 3U30B 1J0YA 1OQXA 3QRFM 1LEGA 2NY3B 3N0PB 3GJEB 1CFBA 4Y1AE 3NPZB 5IMMA 2NQCA 3MZTA 1U3HB 3SE8H 4BZ2L 5IWLC 2X4TB 4FQCL 3GNMH 4GW4A 4Y4KD 4K23H 1GPOL 4RMSA 1QHPA 1QSFE 5E2UH 3QDJD 3Q2CA 4MD4B 3QUML 3S3PA 4F15B 3X12B 2FH8A 4C56A 1Z5LB 3VXMA 1CE1L 2F5AL 5LKNA 4WV1B 1CXFA 1LMKA 5DRWA 2HAZA 5HDQH 3GI9H 1N8ZA 4BUGA 3C8HA 1VERA 4NC0B 4XMLH 3U0PB 4CU7A 4LDOB 2IADB 5JZ7C 3GJFK 1L0QA 1AR1D 4GKSA 4OF5A 1F8TH 2NY6C 4WW2A 5CJQL 3EOBA 3VH8G 4OLXH 1XIWD 2CQVA 3WUWG 4HK3N 3QUKB 3R1GH 4H1LH 3TYGH 1S8DB 2CJUH 3K2UH 1V3LA 2G60L 5EZOL 5F8RC 4HG4K 2QQLH 2J88H 5CILH 5KZCB 1A5FH 5L2KB 4NKQB 1MCSA 3S5LG 5CWSA 2P1YA 5HYFA 4KUCD 3GGWA 3FT4B 4HUMB 4ZNEA 1NGYA 3REWA 3FO1A 5HGAA 3D39D 2NCMA 4H8WC 5AG9A 1WIUA 4P46B 4I18C 3G5YB 2H32B 1KULA 1BX2A 1HHIA 3GO1L 1JWSA 5C0BB 1JF1B 1R5VB 1N6QL 4U4BA 2Y07L 5F1SA 3IRPX 5DVOA 3FCTB 3BP4B 2FL5A 3U48A 4ODHH 5EBGA 3C8DA 4Q9CA 3ZDZF 2D31A 4BFBD 1KTLA 3BAEH 4I18A 4PJFF 4OF0A 1Z6JT 4XCYA 4JVUA 1UEYA 1DQDL 1Q9KA 3O6KL 4XHJD 1AFVL 3DVIA 1JNLL 1ODAA 2Z35A 3VFMA 1REIA 1KB9J 1JPGB 4AZ8A 1EK3A 1WCBB 1A6WH 1QBAA 4U6VL 2NLJB 2AKRA 2UWEF 1F58L 1YNLL 3VWKC 5ID1A 1CFSB 2WINA 4L8SC 3LOWA 4H25A 5CP3H 3VFVB 3KPOB 3MRRA 5D7IB 3BIKA 5GISH 3VRLF 4TRPL 2OBGA 4Z7VF 1DSFH 1W2KT 1NLDH 5C0CD 2AEPL 4QO1A 2OTUB 4OFIA 2IFFH 1PYWB 4MCYB 3VFOA 1SJHA 1MCPH 1I3GH 2X1XR 5EUKA 2VE6A 5D71H 5HY9B 4PYGA 4L8SA 5BV7B 4GXVH 3ARFD 3GSNH 2OP4L 3IDYC 5B39A 3QPQC 2PO6D 5EULV 1LO2L 3A6BH 4DQOH 1MJUH 1Q94A 4P9MH 5CZXD 2YD5A 2PTVA 4F7MA 4PLOB 5KSAD 5C07B 5I76B 3PQYA 2FGWH 3KPRA 3UROR 3CSYA 4UOW1 2VN4A 2AK4B 1ZXQA 4G43B 4WI8A 1W72B 3VDBA 1LDSA 4HIJA 5KTEH 3QNZA 2ADGB 4P23B 2IALA 5LG1A 1IQDB 2N7AA 2I5YL 2QJDA 2EDKA 1EPFA 1X44A 4APQD 4XP1L 4PG9A 3WFHA 5CMAA 3HMXL 1JHLL 4HFWB 5IEKA 1BVLA 4OCXH 3OAYK 5JIHA 1MCQA 3ZDYF 1B0GA 3OXSA 2I9TA 7FABH 3L3GB 1L0YA 2J8UA 3QG7L 2K7PA 1YN6A 2LAGB 1UZ6E 1BMGA 3MRKA 1U92A 1H3VA 1RJCA 4O2EA 1BZQK 4KQ4L 4CN6A 4LLQA 4PJGA 1E4XI 3SO5A 4XP5L 1H5BC 3ZZ1A 4Q2ZA 1CIUA 3ECBA 5EOTB 4U1GB 2VLRA 3CZJA 1RULL 3GI8L 3ZL4H 3ROLB 1T7ZA 1UB6A 3L9RB 1JPTH 2NY3D 2RBLA 2IAMC 3U9PH 3A0OA 1CF8H 5GHWL 2VXVH 4FQXB 1HQ4B 2CUMA 4F7CA 1CICC 5JPMA 1U3HD 4XXDA 4OLWH 3RZCC 1H5BA 3SJVA 3SDXF 2VLLA 1WAAF 4X83A 5AZ2H 5ISZB 3O9WD 3EGSA 2XPGB 3I02B 3R06B 5ERWB 5BVPH 4LSQL 1Q0YH 4MJIA 1AXTH 1FN4B 1CR9L 4IMKA 1CICA 5B8CC 3CK0H 3MXWL 3RZCA 5BS0E 3ZKXB 2OYPA 4U3CA 5H35B 4G7YH 4X6DA 3QWOA 4OD2A 1HZHL 2FYYA 3O4OC 3Q3GB 4LNRA 3C9NA 1UA6L 4RAUA 4D0BB 4QXTB 3SCMB 3ROOB 3L5XH 3VD4A 3V0AC 3QA3B 5DRNB 1ADQA 3ARSA 1G9NC 4L8DB 4X5XB 2DTML 1J0IA 2EDBA 3MV8A 3PP4H 1IEAA 2XY2A 4MNHA 4QY8A 1BQHA 1JFQL 3BEVA 4EBQL 2YPLD 4D0CB 2BVPB 1MLCA 1QSZA 3O3DB 1MIMH 5HHVL 2PTUA 4OLEA 1I3RA 5C7XH 3QG6B 2NY2B 4Z6AT 3M17A 3MV7D 2CDEB 1FIGH 2CK2A 1AKJA 2V2WA 4ONFL 1KELH 2YD3A 3VGFA 5BOZG 3TBTB 3D85A 4GS7B 4P46D 5IMOA 3IVKB 3M8OH 15C8L 4AG4H 4K3JH 3RTQB 1LO4H 5TPWH 5C0BD 2PYEB 3EO1B 3L6FB 5T3XL 4S2SB 5GS0C 1OAQL 3L3KA 3EOTL 1A14L 4P59H 4YQXL 1NC4B 1R3LB 1I7TA 4PJEA 2G5BA 1KCUH 4NN5B 1NCWL 5JHDB 3FQRA 2FX7L 4OCNC 4PJ8A 5D7LB 4LRIC 3HFML 4U1NB 5AD0A 3KHQA 3QDAA 1BQLL 4UT6H 2X7LB 2VQ1B 3QUXB 3CMGA 1MIEH 3ZSSA 4XPHH 1I85C 2M2DA 3NN8B 5ILTL 4OLYL 3EAKA 1OCWH 1NKRA 3H6JA 5LGHH 3MSPA 5BO1L 1G7HA 3U1SL 3K4DA 3WLWD 3O2VH 4OQ1A 1R5WB 5TDPA 4ZUSA 5E94B 3GBMH 3G08B 3OB0H 5DHVB 4ZMAT 1I85A 2ZJSL 4ZNCD 4MWFB 3B43A 4LL9A 4ZFFB 3OKOA 2OL3L 2B0SL 3HG1B 3WFEH 1XGUA 5DRXB 3WXVH 1ZLVK 5T1MA 2V5RA 4PYHA 3MFFB 3BZ4A 2DMCA 4PJDE 1ZS8A 5DI8A 2IQ9L 1JHTB 3WNKA 1G7PB 2GTZA 5C0CE 4FZEL 3INUH 3QFDB 2IPUG 3EZJB 1KNOA 4HKJA 4XPGL 3GSRA 4LKXB 3RX5A 1I8LA 1E28A 3QYCA 3GZKA 4AY0A 1MFDH 4NYLA 3HC3H 3AMLA 3QEQA 4QNPF 3JV6B 3LKSA 5C07D 4J4PC 2V5MA 2GJZB 2AK4D 1MY5A 5L88H 4X6CB 1H3WM 4YBHA 4XHQA 1OGAA 4PGBA 3H9YA 1CL7L 5FO7A 2A9ML 1T04A 3D0LA 1AGBA 2EYSA 4PG2C 4UTAH 2AK1L 1QNZH 4M61A 4HK0A 4KKAC 3LS4L 5B38B 4NQDA 4KKCC 3QP3A 3O3BA 5J9PB 3IETB 2AJ3A 4J4PA 2BMKB 3HE7D 1FZMA 2ID5A 4NO2B 4EDXB 3V5DB 4N68A 1NMAL 4N8PA 2NY5L 4PS4L 4LP5A 4UTBH 4H88H 5FGCE 3MNZB 1H15A 3LZFH 4FQJL 4S0SD 3FQNB 3KS0H 5IB5A 4PG2A 1NCBL 4JO1L 1KOAA 2GJ6A 1QQDA 1KLUA 5EC1B 3A6CH 2P8PA 1I3UA 4NNPH 5E7FA 3RY6C 3HHRB 4WU7B 3WIHL 3AROA 4OLZL 4Z18A 4O00A 3NZHH 3Q1SL 4MQTB 3IFNL 1A1MA 2NY4D 1FFNB 3S3SA 2FEEL 1T7YA 4FQXD 2VDKH 5F21B 1NCTA 4OD3L 1D5IH 4EDWH 4OCSL 3ZHKA 5JW5A 4R4NC 4YO0A 4N0UA 1DLHA 1OAXH 1I4FA 3RY6A 3VXRD 43CAB 2JJTC 5ISZD 4WTZA 3T77A 3H3PL 3DRTB 3L7EB 2YZ8A 3FQTA 3QULA 5DD5L 5F8QC 1J05B 3DIFA 4JFYB 1U8JA 3WHE1 3HNSL 3V0VB 1ZWIB 3NCEB 2FO4B 1LO3L 4KDVA 5E99H 3MYJA 4EOWH 1BM3L 4MGXA 5F88A 3ZT5A 4GG6E 4I2XE 2JJTA 1QACA 3UTPD 2E9IA 1WVZA 3SCMD 1T66D 5F9DC 2X09A 3NA4A 2AQ1A 3RVTC 3GIVB 5ADOH 2WUBL 4AIOA 5CBEB 4D9QE 4KJYA 1OM3H 3SGEH 5F6IB 4XXCC 3O45B 5C8JA 1JRHI 3SY0B 2Z93A 3DUSA 2NY2D 4X7SL 1I9RL 1KG0B 4JLRA 4LPUA 2DL2A 1BZ7A 5T1KA 2YPLE 4O2CA 4KQ3H 4LSRL 1LEGB 3V6OE 5E9DA 1FO0A 1MEXL 4XNXH 3I6KB 2H2PC 1LDPL 4NN6C 4HS6A 5IMMB 4PJAE 3CU1A 2MCPH 3ARBC 1I8KB 4RGOL 4P3WA 2DLHA 4FXLA 1NBVL 1Q8MA 4L1HA 4RGND 1ORSB 1QFWH 2D4DA 2WIMA 2XNAB 3MV7E 3OQ3B 2PYED 3RTQD 1N5YL 4M1GL 5GGTA 3MCLL 4TNWF 1HE7A 5AYUH 5DMGD 5JHDD 4X0KA 2CDGA 3PP3K 5D7LD 3ARBA 4C56B 4UBDD 3RAJH 1RVFL 3RX7A 4F80A 1GOGA 4PJHA 1ZOXA 2O5YL 4XPTH 1F6FB 2XRAH 2P4AB 5IVZB 3RHWF 1ZLSL 1NL0H 2FJGA 4ETYA 4JGJA 1KLGA 2P5WE 3IDMA 1YC7A 3UJTL 1N2RA 1AHWC 4L8CA 1A2YA 3PV6A 3MLYL 5D7JA 2K3TA 1PVHA 5D6CB 2NY6B 5L2JA 3TO2B 3HG1D 2VDRL 2DL9A 3F7YB 1BQUA 3F58L 4IOFC 4R8WH 3GGWB 4NFDA 3IDIA 3REWB 1MJJB 3FO1B 3JTTB 1AHWA 1V5JA 2DYPA 1JGVL 3RPIA 1HHIB 4KRNA 3P73A 5CSGA 1KSRA 1F6AB 3RWJA 4MA1C 3QZWA 4Y88A 2C4FT 5IB2A 2FL5B 1CXKA 3MRQB 5FCUH 5JPNA 1R0AL 3ULVH 2D31B 3FFCD 4QHMB 1YJDC 2D03L 4NHUA 1F3DJ 3U4EA 3FZUD 2G2RB 3GMLA 3MACL 4HMCA 5JNYA 4TSAH 3OPZL 4PRNA 5A3IC 3MUZ1 1CYGA 5F9OH 2IQAA 3VXSB 2F58L 1S3KL 2W60A 4QHLB 2NTFA 3VFMB 1XF5A 2BC4B 3E8UH 3OBAA 4UV7H 2GITA 2XZCL 3TLRA 3SGKC 3P4NA 3EYUL 3SE4C 2AKRB 5DJ0A 3LRHA 4I3SL 3BPOC 4PV9B 5ID1B 1D5XA 2AAVA 2PR4H 4H25B 5IFHL 3S37X 2OI9C 1I7UB 3MRRB 3CMOH 2MHAB 4KROD 1FH5H 1XGYL 3O8XA 4GO6B 1QVOA 4PRPB 3RA7L 3TCLA 4MDIA 1BVKB 2QQKL 3SE4A 3VFOB 1KTDA 3ZTJG 1F42A 2BRRL 3VWKB 1PD6A 4L8SB 2ADFH 5EO9A 4RFOL 2XZQH 1IARB 3PXHA 3L3HA 2IH1A 4KRLB 2L4OA 3H42L 4HFUL 3ULUC 2NXZC 4OUUA 4TVPH 4MXQD 1CLCA 1YY9C 3VCLA 5D1XA 4BH7B 4F7MB 5EG6C 4LSSL 4U1IB 1GGCH 1YMME 3CSYB 4NBXB 3VGEA 5MEOA 2AJSH 4R2GC 3B6SA 4HIJB 4MVBC 1F11A 1MFAL 4U1JB 3QNZB 3SE3A 3MA9H 2IALB 4X99B 3BKJL 3PWPD 2R2EB 4HT1H 4JJ5A 4XVTH 3WFHB 2P8MA 3FT2B 5IEKB 3O4LA 1BVLB 2R4SL 2JCCB 4ONGL 1GC1H 3OXSB 2I9TB 3IKKA 2J8UB 3DSFH 1MFEH 2A83A 3MRKB 3BPCB 2JIXB 2E5EA 1EIBA 1G7IA 4HULB 1T03H 2GEEA 4O2EB 5HHME 3ME0A 1H9VA 1AP2A 4HLJA 4C83A 5IHUH 5C0DA 5D70H 5FIEA 3OGCA 4ACPA 4P5KA 3ECBB 1F97A 3QEUB 3CPLA 4WW2F 2VLRB 1ZANL 1EFXA 1KGCD 4CAGA 1RUQH 3QEGH 4NCC2 1C5CH 4C58B 5E2VL 4R4FL 3V4VH 2UUDH 2YD7A 5HGBB 5JPMB 2CO6B 5GRUH 3N9GH 3JZ7A 4XXDB 4JRWA 5DJ8B 5JLZB 2X41A 1H5BB 3CFDB 3MODH 3SJVB 3V6FA 1IC5H 1YYML 5T5FH 2VLLB 1FLRH 5KW9L 2ZCLH 4P5TA 4PRDA 1H3PH 3SEPA 4C4KT 4DCQB 2IAMB 4RGNE 1FDLH 4MJ5A 5GS1C 1UWEL 1CICB 3KYOB 2R29H 4ZFOB 4NQCE 1U41A 3RZCB 4O51B 3TPUA 4KTEL 2HT4C 3RWDB 3UDWC 2QADB 4O5LL 4X7FC 4OD2B 1GHFL 2FYYB 3O3AA 4LNRB 1XZ0A 1CXEA 4EJ1C 4V1DD 2ITDA 4LVHC 4ZTOH 4E5XB 5ICYA 4M8QA 5GS1A 1OL0A 4JFEE 1IEAB 3GMMB 4HXAH 1UXWB 5B8CB 4RMTA 3MLRH 5I17A 4QY8B 1BQHB 3BEVB 2QQQA 3BHBB 1EJOH 5DEGA 1MLCB 3UDWA 1IC1A 2NY1C 3O4OB 4G9FA 5I1DA 5IK3A 1I3RB 5IVXE 4G8EB 1PJ9A 2XKNA 2G9HA 4M62H 2F53E 2GAZA 3TT3H 1NAML 2OCFD 5TE7H 4YDKH 3LEVL 5JOEA 3CGTA 3LRGA 3RUGB 3T0EE 4Z7OF 2JK5A 1Q0XH 2HTLD 1RZJH 5I8OH 4AH2A 3TVMD 3MBXL 3ZKSD 1B88A 5F7DA 1FVCB 2CXGA 1X7QB 5ICXA 1U8KA 3HB3C 2UZIH 4Z7UB 4M7LT 4MNQB 1D5ZB 5FK9A 4GFTB 2AABL 1I7TB 3S36H 1G7LA 3AM8C 3KPLA 1HHHA 3I6GA 5AD0B 4X8XA 5C9JB 4R6UA 4QHNA 1GRWA 2XG5A 4AT6A 4OGAC 3ARDA 1ND0A 3HNTH 1J9CT 2YA2A 3UPCA 4J8RA 3VXSD 1KN2H 1HOCA 3I2CL 3WXWL 4ENEC 3U0WL 3CVHH 3R0MA 1IE5A 4NQXA 1GGIL 1IEBA 1HHGB 4WWID 1BFOA 5E6YA 4NO5A 3EOAB 2VXSH 5TQ0L 2MPAL 1S7RB 5TDPB 2BHUA 1N0LA 2AI0L 1WBZA 3BQUC 1KCRH 5DK3A 2Y72A 5B38G 4LSTH 3X3FH 4H1LA 3EFFA 3OKOB 1JCKA 4PRPD 5BJTB 1IGJB 1ITBB 3SDYL 2J8UF 4OB5L 3BZ4B 2ADIB 4JDZA 2ZCKH 3T65A 1ZS8B 1GGYA 4FZ8L 4OZHE 3VWKD 5D5ME 3TBWA 1UACL 4GG8B 5E6IC 3JUYA 4XMKH 2GTZB 3BQUA 4O2FB 4PJGF 2HH0H 3OKYA 1F4AA 1KNOB 4HKJB 4U1MA 5ESQA 3JWOL 4YR6A 1QTYT 1OF2A 4HJ0C 2UZYB 1NKOA 3QEQB 3LKSB 4NN7C 1WZMA 5CD3A 5E6IA 5LAXB 1OGAB 1INQA 5KS9B 1G6RA 4HF5L 3VFWA 1T04B 3D0LB 2EYSB 5E00B 4UQ3B 3NIDF 4M61B 1UKQA 5EWIL 1FORL 2F5BH 4N8CH 4NQDB 3QPXH 3SDDC 2DS4A 1NC2A 3X3GL 3V8CA 1NFDB 1AC0A 5HGHA 3P4OA 3PWPE 2JIXD 4MAUH 1BOGA 3PGDA 4X6DF 1H15B 1TQCC 1AY1L 1FCCA 4YXKH 1YEKL 3GBNH 1F00I 4KMTH 2VXTH 5E1AA 1QQDB 1KLUB 3SDDA 4LMQE 1ZTXL 1MHHA 3LSOA 2P8PB 3B5GA 1F4WH 2FD6H 4W68A 4R26L 2C4FU 3TZVC 2XN9D 2VLKA 1L7IH 3G6DH 1BLNB 5C2BL 5FO8A 3SOBL 1GZQA 1IGCL 4RA0C 1B2WL 5JW5B 1IBGL 4H20H 3AS0A 3TESA 4OZ4A 1I4FB 3PWLA 1UCBH 3GK8H 3T77B 4YHIA 5IVNA 3TZVA 3QULB 1XH3B 2IAMD 5C09A 2EDFA 3DIFB 1U8JB 2ZNXA 4Z5RA 1NJ9A 4K7FA 2EH8L 3CH8A 2W59A 1GAFL 2QADD 2E7MA 3IFPB 5EZIL 3GJFH 4FMKA 4PJEF 4DWHA 1OAYH 5F9WC 3DECA 2RJMA 2RAMA 3MGOA 4E42A 4QTIH 1P9MC 4V1DE 2YD8A 1U6AL 1C1EL 5BVJB 5C8JB 2Z93B 5MP6L 3DUSB 5GGRB 1PQZB 2BNRA 4JLRB 1DUYA 5T1KB 1BZ7B 1KENH 3N85L 2EKJA 2Q8BH 2YWZA 4O2CB 1JBJA 5FYKD 4JM4H 1LILA 4IOIB 3IS1X 5E9DB 3VGGA 4E41A 4Z76B 5E8NA 5HI5C 1P9MA 5IFAH 4L9LB 1UH2A 4ZFGH 5FF6A 5I66A 3AGVA 4CJ1A 1ZT1A 1NMCC 3TO4C 2OZ4H 4OJFH 2GY7B 4U7SA 1TJHL 4JRXB 1J0HA 1IC7L 4MNQD 4NOFA 5K9JH 1QD0A 1EFQA 2GY5A 1XGTA 4NN6B 1DLFL 3ARBB 4LCIH 2LABA 1FP5A 4XC1H 4FS0A 5SWZA 1C7TA 3B9KC 4PJHB 1WV7T 3QRGL 4QGYA 4HAGA 4CMMA 1L6XA 3FO0L 4P3CL 3MGAA 2R2HA 2VWEE 5F72S 3VFNA 1TTUA 5JDSB 4OCRL 3T0XA 3K3QA 4LFHD 4JPKL 2FRGP 1KLGB 2ZZUT 1BBJB 4JFXA 3GKWH 2GK0A 1J88A 1N2RB 3B9KA 4Q74A 3S3JA 4M48H 4L8CB 1KN4H 2DM4A 4P2QA 1JUFB 3UMTA 1A9EB 5HI3D 2Z31A 4NWUL 2OR9L 3CLFL 2Y06H 3UO1H 3WJJC 4NZUH 2VR9A 1XAUA 1D9KC 5ENWA 1DVFC 4MAYD 5DK2A 3E0GA 3AS1A 4TSBL 3ZT6A 4NQSB 5IFJB 1N7MH 3LAFA 4P2OC 2DYPB 5CJOH 4IIQC 1A7RH 2ZWLT 2FIKA 1TETL 4OZIA 4I0PC 4TPRH 3P73B 1A3RL 3UC0L 4KXZI 1U8IA 3QZWB 1K4CB 4OM1L 1IL1B 4WTWA 1A7NL 4WW1A 3WJJA 5J11C 5JPNB 1D9KA 2WQRA 1DVFA 1QRND 3T0WA 3PHQA 3U0TA 1UC6A 4Q9QL 4YWGH 4XCEB 5F1NA 3U4EB 2A6DA 4I0PA 4ZUUA 2HRPL 3UTSA 2ESVA 4MA1B 1FNAA 5IM7B 2KKQA 4U0RC 4MZ3A 1KBGL 3SN6N 2W60B 4QTHB 1U91A 3QUYA 4JB9H 4ZYKB 4LLUA 3M1BA 3OAYH 1ZEAL 5D2LE 2GITB 4AQOA 4DFHA 2QLVB 4B0MM 5ADPH 3ILQD 3P4NB 2VZVA 4HKBB 5DJ0B 3T3ME 4YLQT 1T1YB 1E6JL 1U93B 4P9HH 5FDWA 3MLTB 5HYJE 5ESVB 3MLUL 1QKZH 3KYKH 4M03A 1QVOB 1OB1A 2WUCL 4HIXL 3W11D 1MCCA 4M7JH 4U1KB 1L7TL 1HKFA 3E6HA 3NIGE 5FHBH 1N3NA 1KTDB 3BPOB 2OJZL 2GW5A 2P5EE 2P47B 5TGBB 2BVUA 5EO9B 2OI9B 5JO5B 2PTTA 4NBZB 4NIKB 2IH1B 3H3KA 3QI9C 5TQ2L 2APVA 5T3XD 3C6SA 4BSJA 4OUUB 5E5MA 3VCLB 2VITA 4KTDH 4G8GE 2Q86B 4B7IA 5D9SA 2W9DH 3TFKC 5DVMA 4QRSB 5MEOB 4WCYL 3A67H 3B6SB 3QI9A 1T0MB 5CP7A 5HYSB 2AEWA 4QXWA 4WI4A 1YEDA 5C0FA 5TF1H 2H2SC 1I3VA 2AXFA 4DN4L 4WTXA 4JFHE 1G7QA 2P8MB 1A21A 5DA0B 4TOYH 2EDRA 2AERT 3KPQA 1OD9A 2NNAB 2C9AA 4NRXA 4JFDE 3Q6FA 4R2GB 4ELMB 2OR8A 4D0DA 1CD0A 1G7IB 3MBED 4JKKA 4WHYG 1F45A 4Z7NE 5J1TC 4K07A 4X4YA 1AP2B 4F9PC 4X6BB 3DMMD 4C83B 3R8QA 5C0DB 3OGCB 4PJ7F 3RU8H 3O6MH 3MXVH 3CPLB 3RWIB 1SYVA 3OJ2C 1JE6A 2HG5A 1DUZA 1BQHG 2A2QT 2FECL 1EX0A 3TN0C 1A3QA 2DDQL 4F9PA 3BP5A 5E8OB 1R5IB 2KQMA 1FNEA 3HI6H 1DQML 1NDMA 3HNVH 4JRXD 5F7UA 2VDQH 3B2VH 4PRDB 4RISH 2E8YA 1N0XH 2GIYA 2PN5A 5GGSA 5JQ6L 4FQ2H 2H2PD 4MJ5B 5GGVH 2XTJC 3TN0A 32C2B 4EI6B 3FAXA 4PJCE 1UH3A 3FRPG 2X1OA 4N8VA 1OD7A 5ANMB 1CFVL 4PJXB 2W65A 2EDWA 1XZ0B 1CU4L 2QHRH 5CEZE 1V05A 3UAJC 2D9CA 1A7OH 2ITDB 2JB5L 2YD6A 4LQFH 4JRYB 3V6BR 5ICYB 5E2TL 1CLZH 4M8QB 5EIQA 5GS1B 1F4YH 2VIRB 1PX4A 5I17B 1RZKH 1BJ1J 5FA4A 4UT9H 5DWUL 2DLGA 2MQCA 3HAEB 4G9FB 5KVEL 5I1DB 1XCQA 2V2TA 2AXJA 4IS6A 4X5LA 5FYJL 4LVHB 2G9HB 3FO2B 4LFHG 4KHXH 5EUOA 1ZLVH 4EIGB 5GGUB 2F9BT 1AQDB 3FKUS 4XWOD 1RZGA 2FGZA 4P2RA 2NY1B 5HHOA 3V5KB 1ZLWK 3QWRA 2EC8A 1U8KB 1FHGA 4WWKD 2K9UA 1MPAH 2D3VA 4IOFD 5LCVH 5SWSD 4MA3A 1KYOK 5C0GA 4CGTA 1G7LB 3IFLH 2XA8H 1DBAH 1HHHB 4FFYL 4DUVA 1U8PA 1NSNH 4AT6B 3BOVA 5C1MB 2R0KH 4LSPL 3RWCA 1ND0B 4L4VE 1U58B 4LLMA 5HVWA 4J8RB 4MB4A 3HCVA 4FQHB 2FX9L 2VL4A 2E3VA 1KIUA 4NQXB 4U05A 5FDYA 1IEBB 4OGXL 3TT1H 4FTVB 3BN9C 4DZBA 4S1RH 5IUSA 2DM3A 4NO5B 1WZ1H 4JY5L 1KC5H 3RNQA 1AO7A 1VESA 3ULUF 4I77H 5A3ID 4WO4D 1WBZB 5HVHC 1LP9E 2JLLA 3DX8B 4H1LB 3EFFB 4PD4K 1X5ZA 3LV3A 3BO8A 2A9NL 1NMBH 3T4YA 3WFCH 2AEQL 2G5RA 4L5FL 4MA7L 1VFBA 1OP5K 3MRJA 4ALAH 1INDH 3NTCL 3OJMB 2HJFB 5D8JH 3BQUB 4HQQH 5TE4H 3CDGB 1CDJA 4G6FB 3ULVC 1J8HB 1UWGL 4YBQD 5ESQB 4YR6B 1QPPA 1OF2B 1ZK9A 4NNXA 3VFGL 1G7MA 1PZUB 3ORJA 4YHNA 3L5WB 5I1IL 3QQ3A 4PY7A 3SDCB 4GXUN 4MQXD 1SBBA 5CD3B 3QDGD 3RWGA 1FGVL 4UT7H 5HYQB 1EO8H 4WIQA 3LPGA 5T3XE 4OCMC 3UJIH 3S4SA 4GJTB 1UYWH 5JTWA 2J2ZA 1OSZB 4PBXA 3VFWB 2W9EH 5DUPL 1S5HB 5HXMA 3VXTB 1YY9D 2FJFA 4LSUL 4KKLC 1QSEA 5BW7C 3C5JA 1SBSH 2Y7QB 4U2YA 3VRJA 4KZEH 1BOGB 4LLYA 4WHDA 3PGDB 3O6LH 5J1AA 3C5ZD 1IC4H 3EHBD 4ZDHA 3U7WH 5FXCH 1LK2A 4NM8L 4PJIA 2DTSA 4EIZC 4PB0H 1EAJA 5FKAA 5E1AB 2ED9A 1MQKL 5C6WH 3KDMA 2A6KB 1FYTD 5BW7A 4B53A 3KVQA 3AREC 4OLUH 2YHGA 5FO8B 1TQCB 1UWXK 2Q1EA 4OFPA 4P2YA 5C0EB 1GZQB 3VGAB 4MSWA 4JZNA 3FB7B 4Z7WA 4OZ4B 3NFPA 5EPMB 3PWLB 2DIJA 5C0AA 1BD2D 3LPFA 3TBVA 3GSNB 4G7VH 3AREA 3TZVB 1FO0L 3MRFA 5EBWB 3PP3H 3LEYL 5C09B 3STZB 3BWUC 4OM0H 1AD9A 1RHHB 3FQUA 1KF9B 1KIPA 4IRJA 4AENB 4PRBA 5M7QA 1XGRA 3LQAL 4DGYL 4CVXA 4G6ML 4K7FB 1HWGB 3MLXL 5INDB 1GC1C 3GRWA 3ZDZE 4GKNA 2VLJE 4F37F 1DQQA 1RPQA 3W9DA 4LCYA 1AGCA 4PJFE 4JRYD 1H0DA 2NYYD 4LIQE 2DQTH 2W38A 1HSBA 1T5XA 4HJGB 3BWAA 4MQ7B 3MGOB 4E42B 2VN7A 3GMNA 2X4SB 3U2SA 1K4DB 2HT4D 2ICEA 1JK8A 1QRKA 4XX1E 2MJWA 1YZZA 4WU5A 2RFXA 3C5SB 1QLRA 2UWEE 4M9OA 2BNRB 5F9WB 3DVGB 4CDHA 5CEXA 2OTWA 1FG2A 4HPOH 3CAFA 4PP2B 3VA2C 3MUY1 2YMXL 3VRLE 4EUPA 2NY1D 4XMPL 4QOKD 1T3FB 2CUIA 4Z7VE 4FMFA 4LEOA 1NCCH 2LE9A 4M1DH 1G6VK 4JM2C 4WEBH 1MWAL 3GB7B 3WYRA 4YHKL 1XGTB 3NA9L 4TYUA 2VC2L 4DTGH 2FLRT 5SWZB 1NMCB 4LLWB 3TO4B 1RQ5A 3HB3D 3D5OF 1MF2L 3QZWG 4CMMB 4J3UA 3BISA 4JM2A 3OKLA 3VFNB 2CH8A 2ICWB 1YQVL 4FABL 5FHAL 1MNUH 4JFFA 1I1RA 3DETD 5MHSD 1F90L 1CE6A 4I0CC 3RVWC 4FTVD 2H41A 4O02H 2EKSA 4JCMA 3B9KB 1M4KA 4OCWH 1MAKA 3SKOB 4ZPVB 5HPMB 4DGVL 3RIAF 2F54E 3ZDYE 4FFZL 3VJ6B 1XGQA 2J7LA 1NCUA 1RZJC 5ALBH 1SM3H 2DQEL 3ZYIA 4O58H 2E27L 5ENWB 3EYQC 1NDGA 3MV9E 5HBBA 4LCWB 3W0WE 3U7AA 2EDNA 3HUJA 4CVZA 5FO9A 2FIKB 4WGVB 4HJJL 4OZIB 1O7VA 3PJSA 4F2MB 1A3LL 4G6FD 1J8HD 1HKLH 3WUZA 2R0ZL 4JPVL 1PBYA 3BSZH 4WW1B 5HTSA 2E6PA 4IEFB 1FNSL 1D9KB 3S37L 1DVFB 3SDCD 1I1FA 3O2DH 5DS8A 3U0TB 1JGDB 4P2OB 4IIQB 4UDTB 4YHOL 1A7QL 1J11A 1JPSL 3EIFA 3MRBB 3SDXE 1A7PL 1WAAE 3VI3F 3UTSB 2ESVB 1JWMB 4OV6F 1BWMA 3KXFA 3NVQA 4K3EL 4HJ0D 1EHNA 2GKIA 3QDGE 2VMFA 5I15H 3KPSA 4LLUB 3M1BB 2DQHL 1QO3A 1GYAA 2AXHA 5SV4A 5LBSH 4KK6C 1FFQA 5FKPA 3MRMA 3KPMA 3MRNA 1MI5A 1S7TB 4JG1H 1BBDH 4M7ZC 1R3JA 4NJAL 5HYSG 3ULUL 4DKEL 5IW1B 1RJLA 5FDWB 1QYGL 4U0RB 3UTTE 3LH2H 3N1MC 1HYSC 3BH9A 4BKLA 3S9DB 3DXAA 4Y4HD 4HXBL 1BFVH 4S1QH 4GLRI 3TF7C 2CSPA 3E6HB 1N3NB 2CK0L 4FQQA 2R69H 1NAKH 1UENA 1SMOA 2QQNL 2BNQB 5GGQL 3RQ3A 2GFBB 3OAUH 5E8DH 1FYTE 3VMOA 4MCZB 2VZOA 1MQ8A 4HBCL 4YXHL 1MAMH 3U83A 1L9MA 5ITBH 2BSED 4ZS6D 2M8XA 1U0QA 4I5BB 5E2WL 4TTGA 4JR9H 4HGMA 4S1DD 5E03A 2VRAA 4D9RE 4YHZL 1DBKL 5D9SB 4I8DA 5I9QC 5L7XH 3QI9B 2X5PA 3HN3A 5C6TH 4ZFZB 4WY7L 3QFJA 2Y5TA 1YEDB 5C0FB 1UVQA 2MFNA 12E8L 4U31A 3QDMD 4XGZA 1G7QB 3VXUA 5H2BA 4RNRB 4NBYB 4I3GA 3KPQB 3NCJL 5EU6A 5GIRA 5FYJU 3Q6FB 3LMJH 4UNVA 3BMVA 3FMGL 4AL8L 4D0DB 4W6WB 3TA3A 4YX2H 4H26B 1MCBA 3F7VA 4JY4B 4XBEL 3BDYH 3BW9A 3H9SA 2DB8A 1DBML 3FQWA 4M93C 4TUJA 5L9DH 3ZO0A 1NPUA 2X4OA 3QIBD 5F70A 2HT2C 5KVGL 2DLFH 1LEIA 1JZ4A 1F5WA 1CK0L 3G6JA 1DUZB 1PKQE 3LDBB 1BHGA 1WC7A 2JJVA 4JKPH 3NABH 3TNMB 2YWYA 4ZXBC 1T2QL 3HAEG 1LK3L 4OFYD 3BP5B 1NGQL 1FVEB 1NDMB 5GRVL 4EVNA 1IAIL 5GGSB 4QOKE 5INCA 4L4TE 2EC9T 2EECA 1WQVT 2Y6SC 4HHAA 2FNBA 2OX5A 1TTFA 4ZXBA 4RX4A 4OZIF 2MKLC 1CD8A 5AYQA 3TO4D 1FE8H 3MMEA 2W65B 4QNPE 3HZVB 2YUVA 5IROA 2R9HC 1NANI 5DD6A 5EH1A 1WWBX 3IAQA 5D93C 3FB5B 4XPBH 2XTJB 1NH6A 1IGMH 4AIXA 2HP4A 3BXNA 3MREB 5IB3B 4U1SA 5FA4B 2CMRH 1D7FA 3UTOA 1Y18B 1KCKA 1XCQB 3W5MA 2V2TB 2YS4A 4X8JB 4Y4FA 2V9QA 3SGJC 2IGFL 1QLEL 5EUOB 3B83A 1Q72L 6FABH 3QIWC 4GBXD 3T2NL 3PHOA 1Y6KR 5F9JB 5SX4H 3RJDA 2YK1L 4DOHE 3L3IB 1RZGB 4JANB 4LCWD 4P2RB 3VI4F 2NZIA 5HHOB 4ZUVA 3D25B 1KJ2A 4H1LG 2QTEA 5IBTH 1OAZL 2DBLL 1K6QL 4NDMB 25C8L 1U3ZA 3WLBA 3V4UL 5C0GB 4Y8DC 4P2OD 3RNKB 1LD9A 1CFNA 3OJDA 1RIHH 1TZIB 2KPNA 4QYOA 3RWCB 3Q6GH 4LSVL 4YGAB 1LO0H 1RZFH 1TTGA 2NW3A 1DBJL 2ED8A 3CXHK 4LLDA 3HCVB 2XQBL 2VAAA 1IQWL 4E0RB 3VXPA 1FV1A 4Y1AA 2FX8H 3WBDA 1FIEA 1G6RL 3CXDH 5FM4A 4EZMA 1AO7B 3DNKA 1FBIL 3CFJA 2H1PL 2JKXA 3VFTA 43C9A 2FSEB 3BRDA 5CEYA 3JWDH 4ODWA 1HI6A 3WNNA 4XI5C 4JEGB 1MHPL 4YPGA 4Q58C 1VFBB 3MRJB 3KLSA 1QZ1A 5E4EC 1T0NA 4LDEB 3T1FA 2BNQD 3MJ9A 4PJBA 3UBXB 2Z0BA 5HVHB 3RVVD 2V5YA 1CDGA 5KSBA 1F2QA 1G7JA 4JFZH 5F9AC 3VH8A 2QBWA 4KWUA 1K2DA 3WUWA 2EZ0C 1FC1A 4NNXB 5DLMH 1IAKA 2YUZA 3QHTC 3QQ3B 1X5LA 4GAJH 3CX2A 3RWGB 2LFGA 1CLYL 4XWGL 3WNMA 2CIKA 3S5LA 1T4KA 3G9VA 4FQLH 5EOQL 3T2OA 3D3VD 5GRJH 2JE8A 5BZDA 1MFBH 1SEBA 2FJFB 4G9DA 2D2OA 4U7KA 5JXEC 3D2UB 4W4NA 2GSGB 5EA0L 3VXOA 1P4BH 3VRJB 1ZMYA 1ZSDA 5EOCL 2BJML 4RQQA 1P7QA 1PW3A 5DC4B 4MXWL 5I1GH 4ODUA 1QBLL 1OARL 2H2SD 4OD1L 1LK2B 3SKNB 4PJIB 3EFDL 3ZLQC 4ZG1A 1WEJL 5FKAB 3HMWH 3BDBA 3TJEL 5JXEA 3KDMB 4OKDA 4QRPD 2Z8SA 3H9HB 1R3KB 1DFBL 5I2IA 2ATPB 3S7GA 2CLVA 1MCKA 3K74B 1N59B 1LQSR 5E1HB 5A2KH 4NUGH 1RJZA 4W6XB 5C92A 3HC4L 5GJTL 4JZNB 1C5BL 5EUOF 3NFPB 5KG9B 2XA3A 5C0AB 2EYTA 4WFHE 3K8KA 3TBYA 4TUOA 3AREB 4GAGL 2HT3C 4P57A 1XCTA 3MRFB 4LPXA 3FB8A 4NWTH 1IGIL 2NY7L 1H3TA 2PUQT 4LF3B 2NXYC 4YHPB 2C1PA 2ORBH 5DQ9A 3FQUB 1KIPB 1KEGL 4PRBB 4B50A 1XGRB 5EN2B 3FN0L 4KJWC 3T0BA 1J1XL 4JQIL 2ITCA 3IDNA 2AJYH 4LPVA 1TVHA 2V9RA 2FATL 3P30L 4KI5C 4X9BA 1PG7L 2XWBA 4ZPTB 5BXFA 2X70A 1AGCB 2E9WA 3DI2B 4LCYB 1H0DB 1BEYL 3BWAB 4FQ1L 4PGZA 1QBML 1IILE 1O0VA 3GMNB 3RL2A 2X9WA 4OKVA 3DV6A 1IT9H 3HR5A 1IJ9A 4X9IA 4L9DA 3EYOA 1QLRB 1DL7L 3V4PH 1WT5C 4TNWK 3OKNA 4MA8H 1JYWA 5CGYD 2OTWB 4Z0BL 1FG2B 4NZRH 3PWUA 1ACYL 1JHKL 3LKPA 4JZJC 5KJRL 4UINL 5D1ZD 4LEOB 1PKOA 4AM0A 1OHQA 3FTGA 5AUMB 1O5DT 4AQ1B 1FSKC 3S98A 1WT5A 3KWWB 3RHWK 3RWEA 3BKMH 4OI9A 3RGHA 4DGIL 1CLOL 1F4XL 2H8PB 8FABA 5EC2A 2DMKA 1MSPA 4JZJA 1A6ZA 3F5WB 5HGDB 3AUVA 4R96B 3OJVC 1T22A 4HCRL 4EI5C 4OTXH 4Y5YC 3WN5C 1RZKC 4WUUA 3P9LA 1HNGA 5I75B 4XP4H 4JFFB 1CE6B 3THML 1NBZA 4K3GA 2EKSB 4N9GA 4QF1A 2BDNH 3KJ4C 1RJYB 4Y4KC 3ARPA 2EEBA 3ULVF 2DQIL 1Q9OA 4YZFE 1YEEL 2HN7A 1WZLA 2W0FA 3QNXB 4ERSL 2J6EL 4TQEL 4Y5YA 3WN5A 1B90A 2EXYC 1XGQB 3VXME 4G8IA 2HKFH 2RGSA 4I3RL 1H8SA 4K55A 1UH4A 1NDGB 4HWEL 4Y4KA 4JFOB 4ZS7L 5DJXA 3HUJB 3S35L 4CVZB 5FO9B 3QDJA 4PJIF 1AJ7H 2CKBA 4JHWL 1MLBA 4KUZH 4NKOB 2XKSA 3C2SA 1XIWC 3WIIL 3MR9A 1RV6X 4NJ9L 2OQJB 5JXAH 1U8MA 5GXBB 4KAQL 5DS8B 1JIBA 1EEZB 1RK0B 3ARGD 4ZO9A 2XKUA 4LARL 3VGBA 5I8CA 4Z7WF 2VO5A 4G6KH 2XACC 3KXFB 1MRFH 4ZNEE 1XIWA 3FB6A 1CGSH 2VZSA 3UZEA 5C0RH 4OZGB 3RKDD 3KPSB 2NW2A 4RSVA 3D2UD 5IGXL 2Y36L 1EVUA 1A47A 1MAJA 4YK4B 1CWVA 3MRMB 5FKPB 5FV1L 3WHE0 3D3VE 3KPMB 3MRNB 3S6CA 1MI5B 4Y16D 3OKEB 2DQDL 3D87B 2ZKHL 5DJ2A 1E27A 3KPNA 5AG8A 2VDOL 3CVHB 3I50L 4ZAKB 4M4PA 1RJLB 1R3HB 5EU4A 4JQVC 4BZ2H 4NCC1 1ZA3B 3BH9B 4BKLB 2KBGA 3D39A 4FQCH 1N64L 4UU9B 1GPOH 1HQRB 4KJQD 3LKOA 3NACL 4JY6B 4M7ZB 3QUMH 4XHJC 4H5SA 4N1CA 1CE1H 4JQVA 2F5AH 4PRHD 4QRPE 1VGEL 2P24A 1EHLL 4UIMA 4LBEA 1D5MA 4F9LA 5E7BA 4Z7OE 1S9VB 4PY8J 3WL9A 1KT2A 1IAMA 5CJQH 4ODVL 2V7NA 5FCSH 1J1PL 2F74A 4P5MB 4JG0L 5EIIA 5DMYA 4Y2DC 3RIFF 3DROA 3QFJB 1X5JA 1TZGL 2Y5TB 2G60H 5BRZB 2M26A 5EZOH 1DQJA 1GOFA 3VXUB 5H2BB 1BZ9B 5EU6B 2HFGL 3ARFC 2NR6D 3DBXA 4A2LA 1BIIB 3Q0HA 2PO6C 4OUOA 5FA3B 5C0CA 4HK3J 3HZKA 3AAZB 1WCQA 1T80A 4XNMB 5CSBA 5CZXC 3BW9B 3PQYE 4JM2F 1XF4A 3FQWB 3GO1H 3KPRE 5FEBA 5KSAC 3DARA 4MNGB 4Z0XA 1N6QH 4KK5C 2Y07H 1C5DA 3ARFA 1MCFA 2A6IA 2PO6A 1Q1JL 2VXUL 1BF8A 4G8FA 3L5HA 4PIRF 4NQUA 3W9EB 4APQC 4HIHA 3Q5OA 2QKIB 1ZLWH 5KSAA 2JJWA 1M6OB 1EMTL 3QXUA 1DQDH 3O6KH 3BPLC 3E2HC 1AFVH 1TVBA 2DN7A 1OGTA 1JNLH 2DRUA 5I16A 3KYMA 3VD3A 5I1EL 4I0KA 1R24A 5INCB 2WSKA 2B1AL 4PJGE 4DVRL 5JW4Q