4UUJB

Potassium channel kcsa-fab with tetrahexylammonium
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujB01
3OKYA 1J18A 3VXOB 4JFPB 4DGVH 4Y5VC 4I48A 1A1NB 1MI5D 3GO1H 5D6CA 1FAIL 1F6FB 3JUZA 4YFDB 5E2WH 4F7PA 3LH2L 2PYFB 4LLQB 5ENWA 2AXFB 3VWKB 3KPNB 1ZXQA 4LHUD 4MX7A 4POZD 1JNJA 3AS0A 1IEAA 4F58H 4I1NB 3U30C 1X5GA 5CJQL 4NCDA 2Y06H 3UEZA 4JO3L 1TNNA 2FECI 3E6FB 3MRPA 1JGLH 5DLML 5CLWA 5C0GA 3GSVB 1CLYH 1U8MB 4ZUWB 3UJIL 3O4LE 4G8GE 4M1DH 1HNFA 3F6LA 1WBYB 4OGXH 4WUUA 2E8ZA 4MMXC 4X6BA 1CYGA 3GSWB 1NDGA 1T0NB 5IMMB 5CINH 4KXZH 5B21A 3HNTH 2D7MA 1HOCB 3SKMA 3O2DA 1NDMB 5MEOA 4KMTH 3QHZL 4PP1D 2OL3L 3FQRA 4HWBA 1F4YL 4Y5XC 2ZSVA 1MCJA 1YMMD 1D5IL 1JMXA 2QQNL 4P2RD 4Z18A 4HIXL 4D3CL 1QBAA 1FLRL 1K5NB 5I1LA 3SDAD 3VFGL 5FGBA 4LSRH 2ZCHH 1GGYA 3KPMB 2G5BA 3JV0A 4XH2B 3VH8A 1JZ5A 5D7IB 5JXEC 4ZPVB 5E2UH 4Z7WB 3MUZ1 2G75B 2V7HA 4RIRB 1ERNA 4PTTA 3HI5L 3J8F7 3I75A 3KHQA 2JLLA 3HC4L 1H5BB 3RWIA 1FL6B 5DMGC 4PRNB 4X5LA 4JG1L 2NW2B 3FMGH 4JJ5A 1NCCL 8CGTA 5FM4A 3BIAX 4QCIB 4F7EB 4I0CC 3S98A 4UOJA 4NN6B 1Q1JL 2FX8L 5TPWL 2AJSL 1D9KB 3G6AB 2JJUA 3P77A 4FQCL 5HYSG 1A3LL 3VE0B 2F58H 3LAFA 5HHOE 3KWWB 3L1OH 5E9DB 4HUNB 3KAAA 2R0WL 5KS9F 1T66C 4YAQA 3MLYL 3QI9A 1AI1H 1XIWD 2PW1A 1BFTA 1CFTB 1CG9B 3QCTH 4RMUA 4N68A 4LLWA 3SBWA 5C3TA 1S9YB 5DMIH 4LLUA 3CMOL 4M5YL 1H15B 1IZKA 3TN0C 1JHTB 4M7KL 3VFRA 3UZQA 1XGQB 5DJCA 4PJCF 1TITA 3E8UL 1OSZA 4TNVF 1UC6A 5E6IB 1WLHA 5T5FL 3D69B 4X80H 3QYCA 4O00A 2ZUUA 2CKBH 4XGZB 3RTQA 5SWZA 4YFEA 1MF2H 3GMOB 2WQ8A 1MFDL 2YXMA 3OKKA 1CT8A 4YDKL 3RNKA 4NRYA 2QSQA 3WSQH 1JP5A 3NCJL 4MJ5B 1AKJA 3PV7A 1YY8B 4MXWL 3RUGF 2R8SH 3OKDA 1SEBA 3T65A 4ZFFA 3EYQD 1ZLSH 3O4LB 2R0ZH 5E7BA 5BJTA 4LOUC 2YPKB 4CN1A 3ROLB 2ORBL 3D0LB 3W0WD 2R1WB 5FGRA 3EFFA 3NZ8A 1HXMA 1SYVB 3P4OB 3U7AA 5F6IB 1KB5A 4WJ5B 4Y1AB 2FZ3A 1U36A 2VDKL 4P2YA 1IGMH 2YWYA 5SWQA 1MCSA 1VSCA 2Z92B 5F7YC 3K0WA 3ZE0E 4P5KB 3JWDL 1I1AA 1UYWH 4NKOA 4XWGL 3SE8H 1WZ1L 5E6YA 5EULV 5TDPB 2DBJA 1HYRC 1S3KH 1OB1A 2EYRA 4IHOA 3ULVL 2FR4A 2I9LB 3L3GA 4M43H 5TDNA 4YQXL 5IMOB 1UFUA 4MCZA 5JPMA 3O3DA 1H3UA 2ZUYA 5DHXB 2YD1A 4TVPD 2ATPA 3IJYB 3OJVC 4U3CA 4NO2B 1WTLA 4AMKL 3NIGE 1F42A 5FO8A 3MRBB 5JW5B 1EUUA 2VR5A 3NABL 4G9FA 3ABZA 4CBPA 1DVFB 1U3HC 2LTQC 2VDLH 1KBGH 3CXDL 5LGKA 4OD3L 1MCOL 4UOW0 1NBZB 5EUOB 2JJSA 2UY7A 3IJHA 3HNVH 5HHOB 1MCRA 2XFXA 3HCVB 3HUJA 4F33B 3WKMH 2BNQA 3O6MH 1FRGH 5F9JA 1Y6MR 1FZJB 3G5ZA 3RIFK 3VFUB 4OZFA 4YUEH 3PDOA 4XRCA 32C2B 1WK0A 4U6YA 2FO4B 2Y7QB 3ZL4H 5DD1L 4K7FA 4UZGA 1OGAD 4WFHE 3MLSH 1A21A 2Z31D 2AKRB 4HGWB 1MLBA 4G6FD 3P4NA 1RU9L 5GJTH 3GHBH 5C1MB 1A6UL 4NOFA 4YE4H 5I6XB 3GRWL 5HGDA 4PLNC 2X4OA 3NPSC 5EBGA 3L3JA 3EHBD 4IOFD 4KPHH 1QSEB 2FRGP 5J13B 1IC5H 1P6FA 1TJGL 4OCRL 3RL2A 2HLFD 4GXVL 2GK0B 2LU3A 5CCKH 1FIEA 2YD2A 1H3WM 2BJMH 1TZIB 4M8VA 5F1NA 1Q9LB 3BIKA 2ZSWB 2CGRH 4PBVC 3MLZH 3QDMB 3CLFL 4OLZL 4BUHA 3LIZH 4NNYB 3BPNB 2DAVA 1V7ML 4Y16A 1ACYH 4XB8A 4KQ4H 4XZUA 2YPVL 1VFMA 4OZ4A 1HILA 5H2BA 4P4KA 2VDOL 2BSSB 2IQAA 5IB1A 3ZTNH 5J1SC 1HKFA 4K23L 4LK4A 4PR5A 3MJ6A 1OM3L 4Z77B 5B22A 3KPRA 2HRPL 1H3PH 4X83A 4MS8D 4YC2B 1EEZB 1C12A 5EA0H 2EDBA 3IRPX 5EZIL 4RMSA 1PSKL 7CGTA 4I48B 5GS1C 3T0XA 5D6CB 5DUBA 2OP4H 3BW9A 5K9JH 4F7PB 2IBZX 3GIZL 5I74C 4WV1A 4KI1A 1A4JA 5ENWB 4MX7B 5IR1A 2OM5A 3LD8C 1A3RL 2YUZA 3SDXF 1IEAB 3DSFH 3ZHKA 1GGIH 1KCLA 2WWMC 1GGCH 3QAZB 4HJGA 4NC1C 2DI7A 4OF0A 4OV6F 1XEDA 3MRPB 4BQ8A 4KKBD 1INEL 5IJKA 3D18A 5C0GB 1KGCD 4JPVL 1K2DA 3MOBH 5AEAA 2H6PA 1XAUA 2MCPL 3O2DL 1RIVH 4ZG1A 1CGUA 2NY3B 4JHAL 4WUUB 4BFGA 1B4JL 4X6BB 2ZPKL 1NDGB 5KSVA 4X7CC 2QSVA 3DO7A 3SKMB 5L2JA 4JFHE 5MEOB 3EZ8A 3TM6A 4GRWH 3FQRB 3CPLA 3SJVA 5C0DA 1T03H 2ZSVB 3WUWG 3NPZB 2XKNA 1XF2A 4I13B 1MCIA 1QLRA 4NZRH 5I1LB 3KJ6L 3GMLA 1HSAA 5I66A 2UWEF 3C2AH 5HYQA 2EKJA 3A6BL 2G5BB 2B8OT 1AD9A 4KJQC 3VH8B 1A6TA 3RZCD 1D6VH 1F6AA 3AAZA 3ZKXC 3LY6A 2V7HB 1E4WH 4MZ2A 2Z8VC 4KJWD 4PTTB 3I75B 2N56A 3IU4H 3RWIB 3RY5A 1IC7L 1JZ8A 1GSMA 4JJ5B 3RVVD 2H2PC 2HLAA 1P4IL 4P59L 4LHUA 4MYWB 3GBNL 5FGCB 2NR6C 1A3QA 5ALBL 1UM6L 4M6AA 2XXMB 1MJ8L 2OLDA 1FL3A 1NGZA 2O5XL 3B9AA 4JB9H 4HXBL 3C08H 1M71A 3P77B 3KR3H 2CMRL 2PNDA 4HS3A 3UZEA 5I1KH 4XPTH 4FABH 2Z8WC 5E5RB 3UTZA 3VXPA 5BCAA 4Z78A 2BCKA 2CJUH 2QHRL 3HUJE 4Q0XL 3UROR 1QA9A 2VE6A 3RGVC 2JKXA 4YAQB 5C09D 3QI9B 1EK3A 4UBDC 43C9A 2PW1B 3OX8A 3MOAL 4LHJB 2XN9E 2WW8A 1AXTL 5TDOA 1YDPA 4LLWB 1KJ2H 4LLUB 2AK1H 5J6GA 4KJYA 4MDJA 5JQ6H 4OF6A 2IH3A 4HULB 1P69B 3G5VA 1YMMA 3GSNA 4Y88A 3VFRB 1PYWA 5DJCB 2CR3A 1RULL 2DQGH 3DETC 1OSZB 4KTEH 1KT2A 4R4FL 4WI7A 1TPXB 2WBKA 3RTQB 5SWZB 2BERA 3BN9D 4ODVH 1I9RH 2IFFL 4PJDF 3OKKB 1CT8B 3RNKB 4NRYB 5I1CH 1AKJB 2E8YA 4XMKH 3OKDB 1SEBB 2EYSA 2HVJA 3IGAA 3T65B 4ZFFB 5BJTB 5IBTH 1H8NA 5EBMA 3EFFB 3NZ8B 1HXMB 1BFSA 1J9CT 3EOTH 1NFDF 3U36A 1LP9A 2Q87A 1KB5B 3MACH 3MX0A 3K81A 3GKZA 3LN9A 2BXZA 2FZ3B 4UI2A 4EUPH 3ALWA 1SVCP 1IGJA 2GJ6D 4YHPA 5JW4N 4P3WA 5SWQB 4RGMB 4XX1E 5TE4L 3VWJA 4YXLL 1IEBA 4GW5A 5DRZA 1EAPA 4MCYA 1LO0H 1CD1A 4BKLA 1I1AB 4J3VA 2Z8RA 4NKOB 5D2NC 5C9KA 4OT1H 2ITDA 5I8CA 1JGDA 5GGSY 3SDCC 4M1CC 4PRPE 1TQBB 3PWVA 4IHOB 1OB1B 2EYRB 2VC2L 4U31A 4MSWA 3WS3A 3C60D 2FR4B 3L3GB 5TDNB 5IB5A 3JVGA 3GUTA 4MCZB 5FKPA 5AZ2H 5JPMB 2IBGA 3O3DB 1JZ3A 4KROB 4XVSL 2F19L 1EVUA 2A9ML 2ATPB 4RAHA 5FO8B 2ZZUT 3RY6C 4LIQH 1ZLVK 1T5WA 4ONGL 4G9FB 2BX5A 4F15C 1XT5A 1MJ7H 5FB8A 3UPAA 4MDIA 3WFZA 1K9TA 2NZ9C 1W72L 3MJ9H 3K4ZA 3DXAD 2HT3C 3IJHB 1CXKA 4YHZL 4LCWD 1U92A 3QUMH 2XFXB 3HUJB 5I8KH 1GH7A 2AXJA 2BNQB 3GEWB 5F9JB 2BK8A 4DW2L 3G5ZB 4OZFB 1D5BA 4UUJA 3PDOB 4XRCB 4U6YB 1OSPL 4UT7H 5D2LE 2BY0A 2ZUTA 4K7FB 1Z0NA 1HZHH 3ES6A 4ZOAA 2ZUQB 4FP8L 1AO7E 3P4LA 4K71C 4MHHI 3KS0J 1MLBB 4JR9L 3P4NB 5B8CC 1GHFL 3LCYA 4OFDA 4JKPL 5IVXF 5HGDB 2CLRA 3VFMA 1KENL 2GAZA 4J23A 3QFDA 3DNKA 4M7LT 2X4OB 5C0RH 1MHPH 3D85D 3L3JB 1MI5E 1CBVL 3T2NH 1I8IA 3QIUC 3RL2B 5IHUH 5JXED 2BXYA 4MNGE 4JFXA 3DRQA 1R3JA 5FAAA 5F1NB 3BIKB 15C8H 4KXZI 4M1GH 3H6JA 4OF5A 4BJLA 1LQSR 4Y16B 5LVEA 1SJVA 1NCWL 3SCMC 5A2KH 5J3HD 4XZUB 4OZ4B 1EGJH 5FUOL 3O41A 4GBXA 2A6DA 1HILB 5D1QC 5H2BB 3WNKA 4P4KB 1NANH 3QO0A 4WI8A 3THML 2DLIA 2IQAB 3T0DA 1F8TH 3Q5YA 4CRPA 4B50A 3K1DA 5IB1B 1JF6A 4HZAA 4BQCA 1IGCL 4AQOA 1YEFH 4HPYH 4KZDL 5DQDH 4PR5B 5MP6L 4EJ1C 3N1MC 3KPRB 4WEBL 5EFIA 1R5VA 3BYYA 3ARFC 5DD0H 3P9MA 1T66D 2J4WH 4L3CA 4P2RE 3WIIL 1C12B 3BX7C 5CJOH 3VMPA 5SX4H 1H8SA 5HYSA 5DMJB 1OP3H 1T20B 4Z7QF 2VTFA 2DJSA 4WGVB 3QXUA 5DUBB 1OGAA 3BW9B 5D7LD 3JV4A 2Z31A 2YOCA 4WV1B 1A4JB 3TN0D 4LQ1A 3ZHDA 5IR1B 1SY6H 1EIBA 4HJGB 4PRIA 2IF7A 3SGEH 1A0QL 4QHKI 2EDYA 4ZO7A 3D18B 4YHOL 5CWSA 5DRWA 1GXEA 1K2DB 1J1PL 5I1IH 4FQ2L 2FSEA 2H6PB 4KKLD 1WTGT 3WFEL 4WGWB 1LMKA 1GAFL 1GRWA 4HH9A 4R90L 1I9JL 4W6WB 5EOQL 3S97C 4Z7OF 5KSVB 5D7JC 1JYVA 4F8QA 1BD2D 3DO7B 5ID1A 1HINH 4HUWA 5L2JB 3OAYH 3HE6D 2WLZA 3CPLB 3SJVB 5DA4A 5C0DB 2XKNB 4KAQH 1Y0LA 1GC1L 4YX2H 1XF2B 4KI5F 3PGFH 2XY2A 2FHFA 1JFQL 1JWMA 1QLRB 4I77H 4L4VE 1R5IA 3GMLB 1HSAB 1X5IA 3DROA 3TBSA 5DMKA 4XXDA 5I66B 2J5LB 3O6KL 3ARSA 5HYQB 5ID0A 3VGBA 1AD9B 1MQKH 1A6TB 3P0VL 1LE9A 1F6AB 1QRKA 3AAZB 3RWCA 3DYOA 3NMEA 4HWZA 1TMCB 5F1IA 5F7EL 3MV8D 2HLAB 1YNTA 4LHUB 3U2SA 4A6YH 1Q0XL 4IRSD 4L8SC 3DVFA 4PJGF 2RQ8A 5FHAL 4OD1H 4P99A 1NGZB 1PY9A 2HH0H 1CXFA 2DQCH 1M71B 3EJJX 2OTUA 1FO0L 4JFZH 3S7GA 4OIAA 1IQDA 1RJZA 4HS3B 3UTZB 1CLZL 1YN7A 3VXPB 3MBXL 4P5TC 4Z78B 5HI5C 2BCKB 3W0WE 1U3HD 1IEHA 3PL6C 1S7RA 4ZO9A 2MQCA 2VE6B 43C9B 4CMMA 1CICA 2XOTA 3OX8B 5DFWH 1J0HA 4NBYB 1J0IA 4M5ZH 1T21A 3M8OL 4GS7B 4P3CH 5TDOB 1YDPB 1E4XH 3WFCL 1IFHL 1T0MA 2R29L 5TFSL 4UQ2A 5GZNC 4KJYB 1MCKA 5J6GB 5K59E 4MDJB 2DL9A 2IH3B 3AS3A 3G5VB 1YMMB 3GSNB 1PYWB 1J05A 5FA3A 1RZFH 2EDLA 5GSRA 2H1PH 3DLQR 1F45A 4OGAD 4EI5C 2AGJL 4QEGA 1T2QL 1WIUA 1KT2B 3RJDA 1U8NA 1J88A 1FL5A 1YQ2A 3RWHA 3VFOA 3RZCA 1NJ9A 4CN6A 5EZOH 1UCBH 5TE6L 4L3EA 1RZKC 2ICWA 2EYSB 2HVJB 3IGAB 4GOSA 5D70H 1S5IL 3FOMA 4X7SH 3TJHC 2CIKA 3TEUA 4PGCA 3MXVH 5EBMB 4NZUL 3MYZA 4LF3A 2XA8H 5ABDE 5I15H 1BMGA 3U36B 1LP9B 3MJ7A 1EO8L 4HHAA 1IGJB 3NA9H 4YHPB 3TT1L 2V5MA 1MREH 1LO4H 2B20A 1IEBB 1VADA 4GW5B 4LSTH 5DRZB 4F57H 1EAPB 4MCYB 3BI9X 1CD1B 5BRZE 4BKLB 2WAHA 5DSCA 5C09A 2ITDB 1JTPA 5I8CB 1JGDB 4ZOBA 3VXNA 2VH5H 2O5ZH 3PWVB 3UTSD 1OTTC 3MR9A 5T5NG 4MSWB 3WS3B 4M4PA 4M9OA 1ZAGA 5IB5B 3BISA 5C70A 3GUTB 2RBLA 2X1PA 5FKPB 4HBCH 1WUNT 5IEKA 1X5HA 4Z76A 2EIEA 3VG9B 1J0KA 2VZOA 2CKBA 2PTTA 2WWMD 1T5WB 4RGNC 4LMQI 1NCBL 2XA3A 3INUH 4FQLH 5FB8B 4M7JL 1DQLL 4MDIB 3F65A 3U79A 1QYGL 2DYPA 2CDFA 1QP1A 5E5UB 4Q9RH 2VOTA 3IFPA 1WCQA 3Q5OA 4KTDL 4JQVC 1U92B 4LSVL 1D6EA 4CVXA 1SVZA 4HFWA 1WQVT 3MUJA 1D5BB 3CVIH 4UUJB 1KYOK 1NCAL 3ALXA 4NUGH 3EYFA 3QDGD 1F02I 3WXWH 2NTSP 3GB7A 2GJ6A 3FO9A 2A1WH 3ES6B 4FQXD 3TGXA 1FFPA 3CSYA 3DHMA 1MCCA 3WKNA 4W68A 3CC5A 5D96C 5CEZH 2FO1A 2CLRB 3VFMB 2GAZB 3QFDB 2X4QA 3D48R 3TO2A 3KPQA 2MWCA 3O0RL 4WW2A 2DM7A 3WUWA 2DKSA 1I8IB 5KVFL 2AJVL 2D9QB 4M62L 1JWSA 4JFXB 3DRQB 1DUZA 1R3JB 4YGVA 1WEJL 4UINL 2Q8BL 3R8QA 4Y5VA 1C8PA 2JTDA 4BH7A 2PTVA 4RFOH 5DA0B 4NN5B 4JEGB 4Q6IC 5D7KE 5TF1L 4MWFA 3TH3T 2XKSA 3W81A 2XV6B 1L7IL 2H2PD 2IC2A 3GSOA 1KGCE 3EYVA 2VDPL 3TBWA 4LCIL 1EFXD 4YXHL 2FH6A 1CU4H 3O41B 4GBXB 2A6DB 3QO0B 4NQCD 1Q72L 3V5HA 1OWWA 1G9ML 1RVFH 2KBGA 2R0KL 3PQYE 5D8JL 3PABA 3LS5H 1LEIA 1XF5A 4N5EC 5KSBF 3LDBB 3DXAA 5EFIB 1R5VB 3RPKA 3P9MB 3B9KD 3ARZA 4L3CB 4UBDD 1HWGB 1S9VA 1BGXL 5I16A 4JM2F 3BRDA 1QFUL 5HYSB 1T2XA 3W11C 4ENEC 1X4ZA 1OGAB 1YPZE 1ZTXL 1RHFA 3JV4B 2Z31B 1DSFH 4G6FB 4YBQC 5I30H 5ITFA 4XT1C 3SO5A 5F3BA 5J0BA 3VD3A 2DI8A 3DETD 2E7BA 4PRIB 3D85A 4N0FA 4JKKA 4KKAD 1IVLA 3CXHK 4P2OC 3HZKA 4AT6A 1MH5A 5CWSB 5DRWB 3AGVA 5JXEA 2FSEB 1MRFH 3QP3A 4QHLA 2D7TH 2AABH 3TCLA 4O58L 3NIDE 4MD0A 4HH9B 4H25A 1R3IH 5ADOH 3TYFA 1AD0A 3VJ6A 5IESH 1RZKH 4KVCH 3NH7L 1CDCA 3GGWA 1WZMA 1OAKL 3DTXA 4HUWB 2DQJH 3L3OA 5ID1B 1X3DA 1GIGL 2MJWA 3HMXL 4PRHA 4MGXA 5C0FA 2VMFA 1Y0LB 5KW9L 1YEEH 1JWMB 3T0EC 4LSSH 3I2CL 5C09E 2APXA 1R5IB 3VXRD 3DROB 3O2VH 3TBSB 4DGVL 5DMKB 3O3EA 3QQ3A 4XXDB 4ZUUA 3OL2A 4MA8H 5L8JB 3S5LG 5ID0B 3GO1L 1C7TA 4PLOB 5E2WL 1WISA 5F7LB 2NX5D 4ODSH 3RWCB 4F58L 2RHEA 3SDCD 4M1CD 4HWZB 2Y06L 4OCWL 5A40E 5F1IB 2CD0A 3GDBA 1NUGA 2DTSA 2V6HA 5D7LA 1WAAE 3TN0A 1OPGH 1YNTB 1TENA 1CLYL 3U2SB 5JOEA 3RVUC 4M1DL 4DGYH 2C3XA 4I3GA 4OGXL 2HG5A 3RU8H 3N1GC 4DKFH 1BJ1H 4PGJA 3GZKA 5CINL 2OTUB 2VXSH 4X0KA 3WNLA 4BK5A 1WFOA 1IQDB 1RJZB 3IAPA 4NZDA 1YN7B 4KMTL 4PY8I 2NY0C 1T5XA 1S7RB 2EDDA 4U3HA 1F4WH 5DO2C 5LBSH 4J3SA 2G9HA 3A67H 4GG6A 4XP1H 4CMMB 1CICB 1BD2A 1L4IA 4LPVA 2HT3D 1T21B 1HEZA 5HD8C 2B4CC 3QSKB 4Y89A 1T0MB 4LSRL 2ZCHL 4UQ2B 3TF7C 3N0PB 5GS0D 3GMPA 4R3SA 5DQJA 1UADC 1PG7W 1J05B 4RGOH 4JKLA 5FA3B 3VG0H 3AMLA 5E2UL 1EJ6A 4IJ3C 5GSRB 3U4AA 1BFOA 3PGDA 2A73A 4Y7MA 4JHBA 1ZKAA 4K3EH 1PKQA 2Y36L 1U8NB 5DXWA 5J11C 2D4DA 3FMGL 4MQXD 5AAWA 3ULVE 1FL5B 3RWHB 3VFOB 3RZCB 1NJ9B 1HI6A 2DQTH 1PBYA 2P5WE 1FNGA 3MGTA 5DMYA 3EBAA 4L3EB 3KLDA 2ICWB 3O6FC 5BZWA 4PJXA 3MV8A 3FOMB 2CIKB 3BWAA 3QJFA 4PGCB 2DM3A 5EC2A 1T2JA 3RWJA 4LF3B 2F58L 3WFBH 3QUZD 4PJ7A 4OGZA 3L1OL 4JRXD 3MJ7B 5T33H 4HMDA 2ENYA 1F4XH 4HHAB 1AI1L 4G80A 1QSFE 3DXAE 3QCTL 1FNAA 3WLWD 1DJSA 1VADB 4YXKH 4LCWE 5DMIL 3SOBH 1N4XH 1U3HA 3U0PA 5DSCB 5C09B 4AIZA 1WT5C 1ND0A 3EO9H 2PETA 3VXNB 1KJ2A 4IM8A 3MR9B 1GOGA 2O26U 5C0IA 2H9GA 5F72S 1N5YH 4X80L 1U3ZA 4YHYB 3QBTB 4HIHA 2HYMA 2NYYC 2CKBL 4ZODA 1MF2L 4Z7UE 5IEKB 5D1ZD 3KYKH 1JPFA 3WSQL 2QADC 3GSXA 4JGJA 3N9GH 2R8SL 2CKBB 4GKZA 1NANI 2PTTB 3SGJC 2R0ZL 3K46A 2B0SH 1MFAH 1IGIH 4HFUH 2DYPB 2CDFB 1JF5A 4UAOC 4P9HC 4F8TA 5BV7B 4CVWA 1B4RA 2D03H 4AL8H 3LRGA 1D6EB 5D7JD 4HUUA 2MSPA 2FATH 4HFWB 5SX4I 4CVXB 5IV2A 2YK1H 3HG1A 3C9NA 3EYFB 4K9EC 1UYWL 3GB7B 4JQIH 2GJ6B 2JJTA 3FO9B 3SE8L 2DQHH 1FFPB 3CSYB 1YYMH 5FUCC 5GGUA 4RBPK 3ARBC 1S3KL 3CC5B 4AH2A 3SKUD 4N0CD 1RMFH 1S9XA 5GRYA 1NUDA 1S7WA 4UB0H 3SGEI 4U0RB 4M43L 1UXWA 4OTXH 2X4QB 4YBLB 3QT2A 4OLYH 2IH1A 3TO2B 3KPQB 2ENSA 4WW2B 1PG7X 3WUWB 3TZVC 2Q3ZA 3UTSA 1UH4A 1V3KA 5LCVH 1JWSB 4B41A 4DK6A 3PP3H 1DUZB 4LDEB 4XCNA 4YGVB 1QO3A 5KANG 1SJEA 3RVTC 4Y5VB 4BH7B 1BZ7A 1DFBH 5HHMD 4MWFB 2JCCA 2VDLL 1KBGL 5L9DL 4KI5C 3GSOB 1A8JH 1FFOA 3EYVB 1P5UA 5C6TL 1E4KC 3U30B 3TBWB 5CBAA 3HNVL 1OOAA 4YZFE 2C9AA 4E5XA 2YD6A 2FEEI 3WKML 3O6ML 4QXGH 1FRGL 4GG6E 2E6PA 4QHUA 4S1RH 1G6VK 4JFEE 3STBA 3PABB 3MBEC 3T3PE 3MJ9A 4I0PC 1LEIB 1XF5B 4WNQA 5HI5D 4YEEA 3DXAB 3Q2CA 3ZL4L 3QUMA 3WO4C 5GJTL 3GHBL 1VB9A 2CK2A 1S9VB 5HXMA 5I16B 4X6DE 3WNMA 1DN0A 4YE4L 1VDGA 1TZHA 3QDGA 4IEFB 3ZYOA 3GSQA 2B4CH 2FB4H 5GZND 4FQXA 1W0VA 3H9HA 1K4CA 4XNQA 1IC5L 5ITFB 5DC0A 5F3BB 3F7RA 2BJML 3ULUC 3D2UD 3SKOA 3D85B 4N0FB 4L8BA 4HUMB 4EI5D 1FC1A 4PJFF 4U6VH 2CGRL 4NWUH 3VFTA 2N7BA 3LIZL 1BIIA 3HZKB 4AT6B 1MH5B 1PEZA 1ACYL 4KQ4L 4M7LH 4DK3A 3V6ZA 4O9HH 4QHLB 4HS6A 3TCLB 3PUCA 4MD0B 4H25B 1X5AA 3TYFB 1AD0B 3VJ6B 3DOSA 4LPUA 5DZOA 3K74B 3GGWB 3DTXB 1IC1A 1OLLA 1QLFA 1TJIH 3L3OB 3TJHD 3ZTNL 4ELMA 4PRHB 4ETQA 5C0FB 1KJMA 4L4TE 1EFXA 3V0AC 1H3PL 4XP4H 2XPGA 2HAZA 4P2QD 1A9BA 1YNLH 2VLRD 1TIUA 3O3EB 3QQ3B 4ZUUB 1DTUA 4RMWA 1IBGH 3I3BA 4DN4H 1N5AA 5GRXG 5I18H 5DGRA 2OP4L 2Z4QA 5K9JL 1YA5A 3RGVA 4XNZC 4N9GA 3DV4A 1YEDA 2GFBA 3DSFL 2APVA 5CD5C 1GGIL 1OTTD 4OCXH 3TA3C 1GGCL 5C0EA 4L1HA 4MA7H 5D7LB 5FCSH 3X3GH 5TQ0H 3TN0B 2FHCA 3AXLA 5JZ7C 3CFKA 5F7HA 1SY6A 3MOBL 1LILA 5ACMA 1RIVL 4BSWA 1CCZA 3QULA 1R24A 2HG5B 4AEHH 4WO4C 2R69H 4X0KB 3OJMB 2R56H 3Q48A 4RGND 2VWEC 4RISH 3P0YH 1T5XB 4YDIH 5HY9A 1KTLA 1NCDL 2YZ1A 3MRDB 5IWLC 3MFFA 1T03L 5D6DC 3FT4A 2G9HB 3T0VA 4GG6B 2SEBA 2UUDK 1BD2B 4P9HH 4NZRL 1HEZB 4DWHA 3CFEA 4DVBA 3RWGA 4E0RA 1GPOH 3PXHA 5DRNA 4P2CG 4OZHA 2FH8A 1TTFA 3GMPB 3MRMA 4R3SB 5DQJB 1R3LA 2VLLA 1LEGA 4NKIH 1FNHA 5FOJA 4K9EH 1D6VL 2EDEA 4OAWA 3VXRA 1E4WL 1BFOB 4WHTA 3PGDB 2A73B 1KXVC 3UTSE 1PKQB 4CW1A 1ITCA 3IU4L 5GGQH 4JHZA 3UYOD 1DL7H 1C1EH 5D2NA 1G9EA 2NX5A 3ARDD 3A6CH 1HI6B 2HJKA 1R6VA 3SDCA 3K2UH 1FNGB 2DS4A 2JCCE 4PY7A 3MGTB 3GJFH 5BZWB 4JB9L 4PJAA 1RHHA 3C08L 3MV8B 4PJXB 2ED9A 3BWAB 3QJFB 4OB5H 4A6YA 5BOZG 3ARYA 3KR3L 5EC2B 1AFVH 5I1KL 4XPTL 3RWJB 4FABL 1N3NA 4PJ7B 1A6AA 1OP5H 2CJUL 1E6OH 5D7SH 2IMNA 3KPOA 1ZOXA 4NNXA 3H42H 1CIDA 4B7IA 4G8FA 3DPBA 4G80B 3GIVA 5GIRA 4ZTPH 3RY6A 5T3ZE 4JANA 2Y07H 3FB5A 4MQSB 2X5PA 1U3HB 2AK1L 3H9YA 2LTQB 3U0PB 3V6OC 5JQ6L 4AIZB 2H2SC 1ND0B 3S35X 5IT2L 3QDGE 1UJ3A 5L7XL 1KJ2B 1QSZA 4PJ9C 4OF7A 1KB9K 4KTEL 5C0IB 4H5SA 2H9GB 4Y19D 4KVNH 3W39A 4MB4A 3AY4C 3IS0X 4HIHB 1KELH 4WI9A 1JCKA 3BD4A 4X5XA 3W11D 4FN0A 4ODVL 1I9RL 4ENED 3MV9D 4KHXH 1MFCL 4FMFA 2W9EL 1AE6H 3ZDZE 4WFFD 4KWUA 1JPFB 5SX5H 4MJ6A 1A6VH 5B8CA 3SPVA 3GSXB 5I1CL 4GKZB 1F3RB 2QEJA 5IBTL 4LP4A 3ULUH 1LHZA 5E6IC 2GHWB 4R96A 1YMHA 5KVDH 3EOTL 5I0DA 3QIUA 3MACL 1I1YA 5D2LF 2HT4D 4HJJH 4M00A 3KXFD 4QXUH 2NY4C 3V0WH 4RA0C 2YKLH 4RFNC 2VQ1A 1VPOH 4MLIA 3O8XD 4LBEA 4HUUB 2QTEA 4NQCE 5IV2B 3QUZA 4JRXA 1LO0L 3DUUA 1G7QA 3HG1B 5KVEH 3C9NB 5E4IA 3MRIA 4OT1L 3V7MA 4N1EA 3OKEA 5FK9A 4HUVA 1OAQH 1BREA 1IGFH 5D1QA 5GGUB 2JF1A 3TIEA 2PW2A 4AH2B 1I85A 1A14H 5ACZA 3D39D 3T0ED 1RZJC 1S7WB 2H3NA 1UXWB 4I8DA 2IH1B 5AZ2L 2VIRA 2VXUH 1LO5A 2VERN 4NGHH 4PJHE 1FNLA 5CMAA 1MHEA 4LU5H 4J12A 3ARFA 3UTSB 1YYLH 4OF3A 5DFVD 3JWOC 1X5XA 4XCNB 1QO3B 4NKQB 1SJEB 1XF4A 1BZ7B 4LIQL 12E8H 3MRNA 3S5LA 4OLUH 2JCCB 1MJ7L 1ODAA 3P2TA 2W0PA 5ILTH 5D1ZA 3OB8A 5I74B 2CDEA 1FFOB 5C8JA 3LD8B 2KZ1B 2VO5A 3MJ9L 3MQIA 5CBAB 5L8LB 1EAJA 3P9WB 3ZT7A 4E5XB 3QUML 4ALAH 5I8KL 5IVZA 4DKAA 1Q38A 4QHUB 5DEFA 3RBSA 1N59A 3EDJA 5T3XD 1UG9A 2AVGA 5KS9A 5LQBH 1BM3H 4WNQB 3BSZH 4UT7L 3HR5A 1DVFC 4EBQH 3NFNA 3IETA 1HZHL 3QCVH 1DBBH 4OZHE 2EEDA 5D7JA 3CH1A 4JY6A 2DIAA 3RPIA 1DN0B 4IMKC 1AQKH 3FCTA 1TZHB 3QDGB 2F54D 1I8KA 5BW7C 4NBXB 3GSQB 1MHPL 1OTUD 3D25A 5C0RL 4PJCA 3CAFA 4FQXB 1W0VB 3H9HB 1K4CB 4YLQT 2PTUA 2HFTA 4XNQB 1NGPH 2CXKA 4J2XA 2NX5E 1T80A 2UY6A 3SKOB 1NLBH 4L8BB 3BKYH 2ATKA 2ILLA 3BQUC 15C8L 3VFTB 4M1GL 5A1AA 1BIIB 5I6XC 2I5YH 4KRPC 4PJAE 1FVEB 3GMMA 4OKDA 3V6ZB 3RUGA 4GRMA 4I3RH 6FABH 1P53A 5EBLA 4HS6B 3ZKXB 3VGFA 1CVSC 1KCUH 5EUKA 4W4OC 4OGYH 1EGJL 3GFUA 3UX9B 5J13C 2YRZA 1F8TL 4XP5H 1QLFB 3MLPA 4ELMB 1YEFL 4HPYL 5C2BL 4ETQB 5DQDL 1KJMB 4LQFH 1EFXB 4L8SA 4LPCA 1N0XH 3IB4A 4LP5A 2G60H 4QNPF 5DD0L 4ZFGH 2XPGB 1KN4H 2J4WL 3BD5A 4ZMAT 4OQTH 1A9BB 1UEMA 2XQBH 5IROC 3ARTA 4LEXH 1B2WH 3BPOC 5CJOL 5KJRH 3FFCD 5DJ8A 1N5AB 3PL6A 1DBKH 2Z4QB 3G08A 3RGVB 4N9GB 3DV4B 3QUKA 1YEDB 2GFBB 4Z9KB 8FABA 1SY6L 3UTQA 1Q8MA 3KPSD 2IFGA 1BFVH 5C0EB 3L7FA 1ZK9A 4IBLT 1JV5A 1U2HA 5T1LA 5FYKH 4D0BB 2NYYD 3AXLB 3CFKB 1CD0A 5I1IL 2Y9RT 4K3HA 4BSWB 3QULB 1R24B 3B5TA 1G7JA 2X6MA 4EI5A 1ZHBA 2QADD 3U82B 1HINL 5E2VH 5EB9A 3C2SA 4X6CE 5HY9B 1M6OA 1KTLB 4H0IA 4ZS6C 3MFFB 1F2XK 3FT4B 4JRXE 3NAAH 4KAQL 2ZCLH 4YX2L 2SEBB 5IW3A 3PGFL 4I77L 1N64L 3R0MA 1UCTA 1GOFA 4ODBD 2FEEL 4MAYC 3CFEB 4DVBB 3RWGB 3OGOE 4E0RB 5DRNB 4OZHB 1AY1H 2C3WA 3WFHA 3MRMB 1MQKL 1R3LB 4YJZL 2VLLB 1LEGB 4P2QA 5EWIH 4OAWB 3VXRB 1XGPA 4Y5YA 4WHTB 5MEPA 1K6QH 5DD3H 4CJ1A 4WTXA 4CW1B 3DURA 2VLKD 2YPLA 4CKVX 4Z5RA 3CDFA 2JB5H 5D2NB 2EECA 2NX5B 4LPXA 3MCG1 4I3SH 4PUBH 4A6YL 2HJKB 2IEPA 3SDCB 1HHKA 2OK0H 1QBMH 4O5LH 4UOW1 3TZVD 4PY7B 4QRUA 1LNUA 2HH0L 2DQCL 4PJAB 1FCCA 1RHHB 3JWOH 4R9HA 4A6YB 4JFZL 1BQUA 2YUXA 3LKPA 5CSGA 4WUKL 4PTUA 3BP5A 1N3NB 1A6AB 3OZ9H 3B9VA 3KPOB 2B39A 4NNXB 2VYRE 4KI5D 4G8FB 1PX4A 2P8LA 3GIVB 5GIRB 1YC7A 4JANB 4M5ZL 4P3CL 3FB5B 3BJLA 1BOGA 1E4XL 4F15B 1OP3K 1CFBA 2W60A 2DKMA 4I0PD 3QNZA 3T2QA 4XC3L 5D71H 1LGVA 1MLCA 1UJ3B 1RZFL 2ED7A 1ETZA 4JQVA 5HPOA 2H1PL 4H5SB 3W39B 4JPKH 3H8NA 4JJHA 4Z6AT 3BEVA 5DFTA 3AU1A 4X5XB 3SDXA 5ANME 2F8XC 5CFHA 3R8BB 5EZOL 4QO1A 4MJ6B 3KYOA 4J6RH 4D0DA 5B8CB 1U91A 3SPVB 3MRKA 5D70L 3MLRH 4X7SL 3ARDA 2VZVA 2WWKO 3JV6A 3MXVL 4DFIA 4R96B 4LSPL 3V8CA 1YMHB 2XA8L 1JE6A 2HWZH 5I15L 3QIUB 1TPXC 1QRNA 4AIXA 4DGIH 1I1YB 4XP6H 2EIBA 3NA9L 3CXHJ 3VRJA 5IG7A 2VQ1B 3VGEA 1MREL 1LO4L 5DJXA 3NFSH 3OB0H 4ZNEA 4LBEB 2A9NH 1OTSD 3QUZB 2P44B 5E6ZA 4JRXB 4KTYA 4F57L 2L7JA 3DUUB 1G7QB 5IUSA 1R3KA 3MRIB 5D93C 5ERWA 3KLAA 3VCLA 3OKEB 5FK9B 2PXYC 4HUVB 3TIEB 2VH5L 3ARRA 2O5ZL 4NP4H 2PW2B 2UWEA 5ACZB 5ISZE 2KQMA 2F9BT 4LAQH 4N0YH 1RZGA 1BQLH 5FM8A 2H3NB 4LCUA 4PGEB 5IB3A 4RGMC 5DJ6A 1MRCH 1AR1C 2VIRB 4MNQD 4OFKA 1LO5B 3VXTA 4HBCL 5CMAB 3QXAA 1MHEB 2DMBA 2X89A 3ARFB 3VRLF 2Z9TA 2FLBT 4Y19A 4ZUSA 2V7NA 3CUPA 1SEQH 1HN1A 1TDQA 1XF4B 4GAFB 3TA3D 1TCRA 3MRNB 3S5LB 4V1DD 3L3DA 3INUL 4PJIE 4FQLL 2WMPA 2UZXB 3UDWC 1I3RA 3UBXI 5D1ZB 2CDEB 5I71C 1BAFH 3U6RA 5F97E 5C8JB 3I02A 4K2UH 4Q9RL 1S5HA 5FIEA 4NQUA 5C0AD 1I9EA 3HZMA 5DVKA 4ZUTA 1T3FA 1A6WH 1OLZA 3I9GH 5IVZB 2P5ED 1V05A 3H7BA 5DEFB 4P2OA 1N59B 3BH9A 3CVIL 2O5YH 5KS9B 3QQ9C 4NUGL 5JO5A 3WXWL 1YPZF 3HR5B 3KXFA 3NFNB 2A1WL 3IETB 5D7JB 3O8XA 1TNMA 3CH1B 1DQMH 4JY6B 3ZKMC 2HTLC 5CEZL 5FDWA 2XNAA 5ESVA 3RPIB 1Y6KR 4YDLC 4AM0A 3FCTB 5I19H 1I8KB 2E9IA 3V8OA 4L9LC 1CXIA 2VLRE 3D25B 1LWRA 4UDTA 4PJCB 3B9DA 2ZUXA 3H3KA 5C07D 1XF1A 5AG8A 5I76A 3D39A 3T0EA 3UPCA 3NIDF 4PB0H 4ZXBD 4HWBH 1BX2A 2ATKB 4RFOL 4PJDA 3EGSA 3C09C 1WCBA 1TLKA 4AQ1B 4KZEH 4NC2B 3DGCR 3GMMB 1AGFA 5D1XD 5GHWH 4EEEA 3RUGB 4GRMB 1WBZA 4XC1H 5EBLB 4P48A 2B7DT 4K3JH 1CU4L 5HHMB 4P46D 3BGAA 1NFDA 1RVFL 3D0VA 3VXMD 5L2KD 1VESA 1YY9D 3CU7A 3LS5L 2VAJA 5E8PA 1HIMH 4L8SB 1KXQE 1TJHL 3NOIA 4GW1A 3N1QC 3UPRA 5DR5H 5HGAA 2EDNA 4H1LH 1VEMA 4P4KC 5DJ8B 2A6JA 5I1EH 1NBYA 3BP7A 3PL6B 4W4NA 3MRGA 1WAAF 4G6MH 3G08B 1DSFL 2H2SD 2A6IA 1HDMA 1RZ8A 3QUKB 4NWTH 3QZWA 2P47B 4PJ5D 8FABB 3UTQB 4NN7C 4HK0A 2DQEH 4S2SA 3ZKNC 3L7FB 3Q6GH 5F9AC 5FYKD 1JV5B 5T1LB 3TJEH 2Z0BA 3TBTA 3S96A 3VGHA 2J8UF 1MRFL 2D7TL 2AABL 1LEKA 3D2UB 1G7JB 4EI5B 1ZHBB 2EDOA 1GGTA 3T1FA 1R3IL 5ADOL 4NHUA 2RR3A 1RZKL 1MRDH 2ZUWA 4KVCL 5IESL 4MJ4A 2DQJL 1JIBA 4R2GD 2VXTH 3PP4H 1M6OB 5JA8B 5LKNA 1WWBX 2FX9H 4JDZA 3IKKA 2GTWA 1J8HE 3O6FA 2CK0H 1JGUH 4LSSL 2APFA 1ORSA 4JM2D 1DN2A 2NY4D 1YEHH 3KPPA 1ZLWK 4MA8L 3WBDA 3S35H 1J86A 1FG2A 1UM5H 3WFHB 3ULVF 4G8GD 4P2QB 4UV7H 4ODSL 5IVXA 3VFSA 4PRBA 1XGPB 4Y5YB 4KDWA 3X13A 5GSVA 3ARWA 3FFCA 5MEPB 4MA3A 1U6AL 1KB5H 3DURB 1UZ8A 3B4NA 2YPLB 2QSCH 1FNSH 4Z5RB 3DX7A 3DX6A 2EZ0C 4JO4H 1OPGL 1EDQA 1WT5A 1KIUA 5IK3A 1ZEAH 2DDQH 5CLTA 3RX5A 1I9IH 2J5LC 4DGYL 1HHKB 3FZUC 1CXHA 3FQTA 5C08E 3MV9E 1B0GA 1JGEA 1MAML 4NO5A 1FG9C 1AHWC 4QRUB 2Y25A 4WFFE 1LNUB 1WF5A 3RU8L 4FZEH 1H8OA 4DKFL 4U1SA 2VXSL 5IKCA 3FJTA 1KCVH 3QUYD 3LKPB 4PTUB 3BP5B 1EEUA 5ALCH 5AZEH 4KKCD 2HKFH 1X5KA 3M17A 5LBSL 5E8NA 3A67L 4POZC 4FNLH 4XP1L 2P8LB 4QHKJ 3SGJA 3W9EB 4RGNB 3KXFE 3OAUH 1BOGB 4XHQA 2FIRT 1UB6A 2X40A 3DMMD 3Q5TA 5CJBA 2W60B 3ARGC 4Y4FD 1BZ9A 1U8IA 3QNZB 2X9XA 1MLCB 4RGOL 4Z7UF 1ETZB 1MIMH 1HWHB 5DEGA 4K3EL 2PKDA 3BEVB 3RFZC 4OIIH 5I1HH 4NDMA 1U2CA 3AU1B 4GS7C 2B5IC 1MFNA 3SDXB 1HHJA 3F7QA 4PJDE 2DQTL 4Z8FH 4NQED 2F5AH 3KYOB 4D0DB 5D96B 1U91B 1H3XA 1XCTA 2W0FA 3MRKB 2VLKA 3RNQA 4WU5A 1F3JA 1GYAA 2FJHA 4PBWD 3SDAC 2H32H 3ARDB 3L5HA 3JV6B 5C0NC 3BQUD 3WFBL 1VFOA 3TZVA 3NFPA 1JPTH 3DJ9A 3ISWA 5MEQA 4KRPD 2HFFA 1QRNB 5EN2A 2BOBA 5T33L 4IRJC 2HA1A 5F7NC 1F4XL 1EJOH 5K9QG 4ZO8A 5IG7B 3VRJB 1S7UA 4H1LG 4LLVA 5DJXB 5EU3A 3GM0A 3HAEH 4YXKL 3L5XH 3IFNH 3SOBL 1N4XL 1FORH 5HGGS 1R3KB 1MCBA 5T3XE 5ERWB 4AK1A 3KLAB 3VCLB 2X4RA 3TNNA 3EO9L 3TO4D 4ZAKD 3VA2C 1HHGA 2UWEB 3EYSL 4BFIA 2YN5A 3Q6FA 5CKGA 1N5YL 4XPFL 1RZGB 4LCUB 4C59B 3MBEA 5DJ6B 1W2KT 4I0PA 4YPJA 4Y4KC 2F54E 3VXTB 2DTMH 4U6HA 4FZ8H 3FN9A 3QXAB 2Z93A 2JK5A 4P0DA 3KYKL 3PDGA 4G8EA 4M61A 3WEXA 4KUZL 4ZUSB 4Y19B 1JK8A 2V7NB 3CUPB 3MPCA 2Z91A 1XIWC 3N9GL 4FQHA 3TBYB 3GK8L 4YZFF 5IJVA 1QNZH 1TCRB 2B0SL 3EYOA 1MFAL 3L3DB 1IGIL 4Y2DD 3DIFA 4HFUL 2EDKA 1I3RB 2CQVA 4PJGA 4JQXC 3EZJB 3JVGC 3T3PF 3U6RB 4UILH 3I02B 2OCFD 1S5HB 3Q3GA 4RZCA 2V5TA 4YK4B 3HZMB 3V4UH 1SYSA 4ZUTB 4XMPH 1T3FB 2D03L 4CN4A 1HHHA 4AL8L 4ZOCA 4MJ2A 3H7BB 3QEUA 2OXHA 5EO0A 4X6DF 2FATL 4P2OB 2YK1L 3BH9B 3EDKA 2X05A 3OG4B 5JO5B 1EUTA 4LMQE 1U42A 4KUCF 4JQIL 5EIQA 3KXFB 3WE6A 2DQHL 3Q1SH 4ZS6D 1YYML 3O8XB 4PJ8D 3QWRD 5FDWB 2XNAB 5ESVB 4XNUH 4JHWL 1RMFL 5HYFA 4AM0B 1MIEH 4UB0L 1KEGH 4GRLD 4MAYD 5EOTA 4UDTB 2VXQH 4ETYA 1M05A 5I76B 1ZHLA 5LCVL 3D39B 3T0EB 2P8MA 4YEFA 2FYYA 2A6KA 2A38A 1S9WA 4X4XA 1BX2B 4MNQA 3KPSE 3EGSB 2MFNA 3CCHA 4JG0H 4PJDB 2RAMA 1WCBB 4LDOB 1FNEB 4WFED 1AGFB 5E8OA 2C26A 4P9MH 1WBZB 2OQJA 2AEPL 3D6GA 5CSZA 3TA3A 4W6XB 4V1DA 5E7FA 3ZDYE 1NFDB 4QXGL 3D0VB 4S1RL 2ZWLT 1NAKH 5DK2A 1TZGH 2D7NA 4BFEA 5E8PB 3GMQA 5C0AA 4QRSA 4ODXB 4KRLB 5IEHA 4WO4A 2P5EA 3LV3A 4I18C 5T1DH 1UWGH 4GW1B 1A1MA 3UPRB 3MZGB 4IRZH 5FA4A 4OCLC 1NFKA 5HGAB 2VZ3A 1UWXH 4HC1H 5GXBB 2A6JB 4RCAA 1NBYB 2NY0B 3BP7B 2B4CL 4Z7QE 2FB4L 3MRGB 5IWLA 3QHTC 5D6DA 2A6IB 1HDMB 1RZ8B 4ODWA 3QZWB 4ZFOA 4HK0B 3MOQA 1JNNH 4S2SB 3O3BA 1V3MA 4U1HA 5CHNA 2BVTA 4JFYA 5ESQA 4S11A 4U6VL 4NWUL 1TETH 4FXLA 3TBTB 5C07A 1N7MH 1KB9J 3S96B 1ZHKA 4M7LL 4JFDD 2IQ9H 4O9HL 1Z2KA 1LEKB 1OARH 1V7NH 5E5MA 3D3VD 2YD7A 2Z31C 1CGVA 4U05A 3T1FB 2VDQH 3HAEG 4GMSH 2NCMA 4OFIA 5TQ2H 3GSNH 4HKJA 3HHRB 3REVA 5J11B 3S4SG 2OZ4H 2Y1VA 4LKXA 5GISH 1I1RA 5D1XA 1TJIL 5IVNA 3QCUH 5IGXH 2UVEA 5GGTA 3AS1A 3C5ZD 2AK4D 4IOFC 1MOEA 1G0XA 4JDZB 2GTWB 3O6FB 4P46A 1OP9A 2VLJD 3BDYH 2KPNA 3EDDA 1ORSB 3DRTA 3VXMA 5L2KA 2XIDA 2C4FU 1YNLL 3KPPB 1HCVA 3B6SA 3ZKQD 1IBGL 2CUIA 4DN4L 3C8DA 1FG2B 2XQYG 5I18L 1KN2H 1WVZA 2ESVE 4ZUVA 4NC0B 4HIEA 3HI6L 3KLSA 3CVHH 4UU9A 1JZ6A 2X10A 5IVXB 3VFSB 4PRBB 4XX1G 2PXYD 2YUWA 2BMKA 2VR4A 3X13B 5GSVB 1NGYA 3FFCB 3U7YH 1U3JA 2EDTA 4OCXL 4DQOH 4MA3B 4X98B 3V6OA 3DX7B 5F88A 5FV1L 3DX6B 4MA7L 3X3GL 5TQ0L 4JFHD 3BDBA 3RA7H 1E28A 3B83A 3QEQD 2WP3O 5IK3B 4KY1H 4PJ5A 4PB9H 3RBGA 3FQTB 4PJ9A 1B0GB 1JGEB 2DM2A 3LKSA 4NO5B 2D2OA 2HRLA 3ORJA 4XVUD 4QF1A 4AEHL 2R69L 4U1SB 3AY4A 1ZV5A 2CO6B 1ULVA 5IKCB 2YD9A 2R56L 1P7KA 4RISL 1TQCC 2X41A 3P0YL 4WENB 4YDIL 1F90H 3M17B 4HF5H 2QADB 5E8NB 1HE7A 3HNSH 3LMJH 5I1JH 4P9HL 2E9BA 3FN0H 1X4YA 2CRMA 3JTTA 2E7CA 1S7QA 1UB6B 1GPOL 4KKBC 3FO0L 1CLOH 4XMLH 1BZ9B 1U8IB 4UAOB 4LFHG 4NKIL 4JM2A 4K9EL 2JJVA 3ZDZF 4FFZH 1GGBH 3IT8D 5E4EB 3VI3F 5IIEA 4WI4A 4OFVA 5L6YH 5DEGB 4JGUA 2DQFA 3ZKMD 5EZJA 2LAGB 2HTLD 4G7VH 5GGQL 3C87A 1KACB 4NDMB 4G8GA 1DL7L 4XVJL 1C1EL 5JORA 2IPUG 1HHJB 2DLGA 3A6CL 4MNQE 5LG1A 4WTWA 3VDAA 4DUVA 1KLGA 3K2UL 3D5OF 2DLHA 4KQ3H 1HH9A 1XCTB 2W0FB 4LCYA 2VLKB 1F58H 2NY2C 2R2CA 3ILQC 3RNQB 4WU5B 1F3JB 2M2DA 3QQNA 2FJHB 2D0FA 3FQWA 4OB5L 4I4WA 3AFLA 1AFVL 3TZVB 1E6OL 3NFPB 5D7SL 5I17A 5MEQB 5EN2B 2HFFB 2BOBB 3H42L 2PYED 3J7HA 4UT6H 1Q9WA 1B0RA 1OCWH 2F8VA 4ZTPL 1S7UB 5DHVH 4LLVB 2Y07L 5C0AE 4C56E 4KJWC 5EU3B 4PD4K 1MCFA 2OXGA 4FQPA 3R1GH 4XP9H 2ITCA 5F6HI 4PJHF 4D9RD 2X4RB 3TNNB 2GTZA 2WUCH 3MNZA 5J06A 1HHGB 4BFIB 5HI3D 3Q6FB 3DMMA 2ZJSH 4PY8J 3MBEB 4Y4FA 5EU5A 4I0PB 3R4DA 3CFJA 2E3VA 4U6HB 1TVHA 2E6JA 4OCSH 2Z93B 3OR6A 4KHXL 2JK5B 4P4RA 3WO4B 1AE6L 4G8EB 4M61B 3WEXB 3ZZ1A 2DQIH 1T7XA 4LLYA 3UJJH 4TQEH 1JK8B 1A6VL 2Z91B 3H7LA 4PV8A 5EC1A 5I1GH 4FQHB 4IMKA 5IJVB 1KIQA 5I75C 3ZKND 5BW7A 3EYOB 3ULUL 3BUYA 1NBVH 3DIFB 5IFHH 3H3PH 4PJGB 5KVDL 4NQEA 2BC4A 4KJPD 3S3JA 1MSPA 4HJJL 2VABA 3HB3D 3Q3GB 1QKZH 4RZCB 5DJZA 1WWAX 4QXUL 1SYSB 3OWEA 3OAZK 5HVGB 3V0WL 3GSUA 2YKLL 4FHBD 4X8XA 1HHHB 1X5ZA 3BQUA 1NKOA 1VPOL 3QEUB 5EO0B 2VRAA 4MB3A 5KVEL 1OAXH 4WU7A 4K7PH 3BN9C 2PO6C 4UNVA 1VGKA 3SE9H 1KUMA 3WE6B 1C7SA 1OAQL 4JZJA 3I50H 1DLFL 1JJUA 4XPGH 3CX2A 1A14L 2APBA 5A2IH 4UT9H 5EOTB 1V5JA 4LGRB 3TO4A 4LARH 2GCYA 4NGHL 4KRNA 5F3HA 4LU5L 1M05B 3HMWL 3DX8A 1ZHLB 3ZE1F 5J57B 1MUJA 1YYLL 2XTJE 1WITA 2P8MB 4PS4H 2FYYB 2A6KB 1S9WB 3BRFA 4X4XB 2IJ0C 4P49A 3GJFK 1AQDA 3RY4A 4MNQB 12E8L 3CCHB 4OLUL 4X5WA 1UM4H 2BNRE 2EDHA 5ILTL 4XNZB 4U0RC 1EH9A 5E8OB 1S7VA 2X4NA 1OP5K 2VLMD 2OQJB 4KRMB 1AO7D 4OUOA 3FZUD 1YJDC 3TH2T 5CSZB 3TA3B 4DAGH 4V1DB 3CIQA 3B2UD 2XZCH 4Y2DA 3P4MA 3C60C 4ALAL 4Y4HD 3BKJH 1KCKA 3IFLH 1NBQA 1IGYA 1A7RH 4NO0D 5DK2B 3ULVC 2K3TA 3KJ4C 5LQBL 4MQ7A 3BSZL 3GMQB 5C0AB 4QRSB 5KSBE 4EBQL 3QCVL 5IEHB 1DBBL 4TPRH 4WO4B 2P5EB 3LV3B 4TUOA 2J88H 1A1MB 1Q94A 4QGTA 5FA4B 4ZFOL 1AQKL 1NMAH 3RL1A 4N5UA 3QDJD 5GPRA 1DQTA 1CDIA 4PG9A 1KPRA 4YHLH 3RDTD 3OKMA 4TSBH 5C0BD 3F6IA 4D8PA 3ARGD 1HQ4A 4D94A 4ODWB 3QWRA 4GW4A 1T6VN 4ZFOB 1NGPL 3T09A 4GRLA 5SWSD 3O3BB 4MAYA 1L9NA 4U1HB 5CHNB 1NLBL 4JFYB 5ESQB 4KK9D 4C4KO 4NKDA 1YEJH 3BE1H 5C07B 2I5YL 1ZHKB 3BDXA 4H0GA 1DEEA 4X6CF 1MNUH 4I3RL 6FABL 1KCUL 4YH6A 3FB7A 4OGYL 5E5MB 2FBJH 1KPVA 4HWNA 4HKJB 4UV4H 5IVOA 1ORQA 1X5FA 3REVB 2YRLA 4LKXB 1D5IH 2BSTA 2VKXA 4XP5L 5D1XB 2DF3A 4UNTA 3C8KA 3SKNA 3JZ7A 2Q3AA 5C0ND 1YNKH 3HE7D 3EOAA 3IDXH 4LQFL 4RRPG 4WEUD 1N0XL 2G60L 4YHMH 2AAVA 4IRJD 4WHCA 1NMBH 4P46B 4PLJC 1KN4L 4ZFGL 5JHDD 2J8OA 2XKUA 3DRTB 3VXMB 4OQTL 3L3IA 5L2KB 2XQBL 4LEXL 5KJRL 4UNUA 3B6SB 2QR0A 3CFDA 4J8RA 1DBKL 4LASH 2XG5A 4ZUVB 3MA9H 4HIEB 3ESVF 1U8PA 4UU9B 5J3HC 3G5YA 2BMKB 4H1LA 5HGHA 5HTSA 1NGYB 3V5KA 1NSNH 2ZUVA 4M02A 1BFVL 5F88B 1ZT7A 3ELAT 5FYKL 3O3UN 1E28B 4Q9BA 4MD4A 4PJ5B 1KIRA 4Y4KD 5JUEH 2I24N 3ZYZA 2MOVA 4W70A 4U1KA 4PJ9B 3LKSB 1FGNH 4QF1B 1QLEL 4NQEE 4L4VD 4HGMA 4TUKH 2XICA 5FM5M 3RZWA 1IM3A 4K3DH 1CL7H 4JFDA 1P7KB 5E2VL 2I26N 5HVHC 4OCYH 3LQAC 3NAAL 3WLBA 3BZEA 4M7KH 1RUQH 1FFQA 3JTTB 1S7QB 1D5ZA 2GJJA 3C5ZA 5J1AA 2AK4A 4NQDE 1AY1L 2WQRA 5F9OH 4BZYA 3KYMA 5HYJE 4QWWC 4KKLC 3CH8A 4NQSA 3T3ME 4JM2B 3WHE1 4JZNA 2QL1A 5EWIL 2NY4B 1ZA6A 1H3TA 1CDJA 4RFNB 5IIEB 4B5EA 3D9AH 3WJJC 1K6QL 2DQFB 4GAYA 4JRYE 5DD3L 5EZJB 3V2AR 4LLMA 3RKDD 4LDLB 4G8GB 5BV7H 2AEQH 2X1WL 2JB5L 3M1BA 5FYLE 5JORB 3HE6C 4U1IA 2BSED 4I3SL 3BEWB 4PUBL 2WV3A 2EE6A 2PXYA 5FYJU 1KLGB 3RGHA 2OK0L 1QBML 5J7CC 1RUMH 4O5LL 3SE4C 1NPUA 1HH9B 2Q7NA 4LCYB 4ZFZA 1XGUA 2XYCA 2NXYC 3JWOL 2B1AH 2PR4H 3FQWB 5AUMA 4BZ1H 1I8MA 4X6EA 4I4WB 3QEQA 3WL9A 2ZG3A 2OTWA 3DBXA 3N1PC 5JIPA 1GZPA 1A02N 5I17B 3OZ9L 3UYRH 2WBJD 3STZA 1Q9WB 2J6EL 3ZSSA 1OGTA 1B0RB 4WVRA 4LLDA 1EVTC 3VXSE 3U0WH 1YJDH 4AG4H 5HHQA 3UDWA 3IYLW 4ZQKA 5BQ7A 2ITCB 1ZS8A 1MHCA 4L9DA 3ULVH 1RIUH 5J12C 2FCBA 5D71L 2VQTA 2GTZB 3MNZB 4IRSC 5JW4M 1OF2A 3O4OB 1T7WA 2X70A 3DMMB 4NHCH 2XZAL 4JPKL 4HAGA 4U2ZA 1PG7L 4Y4FB 4G9DA 5EU5B 2P43B 3CFJB 4PJIF 3T1WA 1TVHB 4EZMA 1HKLH 3OR6B 4NZJA 4P4RB 3ZSTA 4N90E 4QHMA 4LLYB 4J6RL 4PV8B 5EC1B 4C55A 2OBGA 2ZCKH 3MJ8A 4HDIA 1KIQB 4URTB 1JN6A 3MLRL 4L9LA 3RI5F 3V5DA 4CNIA 3BUYB 1AXSA 2AQ3A 2D7PA 2BHUA 5BRZD 2KDGA 2HWZL 2LABA 4R97C 5DF0A 3X3FH 4NQEB 2BC4B 1QEWA 4DGIL 4WFEE 1QSVA 4XP6L 3ZO0A 2VABB 1RJYA 4BYHA 5DJZB 1RIHH 2H32A 2XN9A 3GSUB 1P84J 3WS6C 4OGAC 1IL1A 3BQUB 3NFSL 2NNAA 2A9NL 4GQ9H 1NGQH 4LRIC 4Z7VE 4KRPB 4UQ3A 2PYEA 4WU7B 3VI4F 5E1AA 1VGKB 4EXKA 2CSPA 2Z35A 4NFDA 1FV1A 4JZJB 4NP4L 43CAA 3HAEA 3TFKD 3QRGL 3S4SA 1FVCA 1YEKH 2E7HA 4HV8A 4LAQL 4N0YL 4U7MA 2CDGA 5BS0E 1BQLL 4DUXA 1PDKA 5EO1A 4OCRH 1MRCL 3FQNA 3TO4B 3RVXC 2GCYB 4NIKB 4RMTA 1JBJA 1BP3B 5F3HB 1J12A 2DIBA 4JY4A 3DX8B 1MUJB 3L9RA 1SEQL 2JJTC 4HLJA 4CDGC 4OLEA 3BPOB 1AQDB 1EO5A 2P7TA 1A7OH 4PJBE 1VA9A 4X5WB 2BVPA 4MXQC 3KYNA 4KU1A 1BAFL 1S7VB 2X4NB 5JXAH 4K2UL 5DTFA 3VGGA 4JFDE 4U1LA 5IFAH 2FEDC 3DVGA 3MSPA 2N4IA 3S36H 1A6WL 3D3VE 4Y2DB 3P4MB 3I9GL 1IGYB 2X4PA 5DT1H 4JDVA 5DVLA 2BVQA 1CD8A 2O5YL 2MCG1 4MQ7B 3VWKD 4S1QH 1T20A 1VKXA 4NJAH 3IVKA 4PRPA 4AEFA 3DUSA 1XF3A 2AK4E 3LQAH 1DQML 4TUOB 1P7QD 1Q94B 2DJUA 4R4BA 2VLJE 5HHVH 3RL1B 4DOHE 2HFEA 5I19L 5D7KD 4PG9B 1KPRB 3MRJA 3DSNA 3OKMB 5M95B 4D8PB 1HQ4B 1DCLA 1IILE 1IT9H 4GW4B 5F9DC 3O6LH 2J7LA 4GRLB 4J1UA 4PB0L 3B5HA 4MAYB 4S0TD 4HWBL 3L5WA 5HI4D 4PJFE 4NKDB 5EBWA 3W5NA 3PQYD 4WWID 4KZEL 4LGPB 1J8KA 1EZVX 1CE1H 5GHWL 3FAXA 1DEEB 1SM3H 3QEQE 3BGMA 4XC1L 4PLKC 3FB7B 4FQXC 3MNWA 4K3JL 1FZKA 1KPVB 4U49A 2B1HH 1BHGA 1ORQB 2NY2D 3ILQD 1X4XA 4MJIE 3MCLH 1FDLH 1OAZH 2BSTB 3S37X 4E42A 1TVBA 2BRRL 3C6LC 5D2LA 3C8KB 3IAQA 4HEME 3SKNB 5C71A 1WJ3A 4JCLA 4JCMA 1AO7A 3EOAB 1HIML 4RDQF 5EU4A 5E70A 3FRPG 1AHWA 1VGEH 1QFWH 4NZTL 3L3IB 4NO0A 1KPUA 3LZFH 4HUKB 5DR5L 3MLTA 1EXUA 1OL0A 4JN1H 2QR0B 1MI5A 2R2EA 5I1EL 2DLFH 3CFDB 3OBAA 4J8RB 4GLRH 5INDA 2AXGA 2EH7H 4MNGA 1U8PB 3G5YB 4NWTL 4JZOA 1P4IH 5GGVH 4H1LB 5HGHB 2V2XA 4HC1A 3QDJA 4Y0GA 3V5KB 2DQEL 3Q6GL 2HT2D 5F21B 5AYUH 4NM8H 1ZT7B 4G3YH 3TJEL 3ARGA 1ZLVH 4MD4B 1KIRB 3MMEA 4U1KB 5SWSA 4NNPH 3KYAA 2I07A 3B9KC 5KBNC 5CJXA 4K55A 4QT5A 1MRDL 4X7EC 5HYIA 1PQZA 1IM3B 4FFWD 2AJUH 4JFDB 4OZGF 2VXVH 2VXTL 3PP4L 2FBOJ 1HYSD 4QKXB 3D3VB 1VERA 1SQ2N 3QG7H 3WLBB 2FX9L 4P2RA 1BJ1J 1SBBA 2OZ4A 2PYEE 3SKJH 2CK0L 1JGUL 2E9WA 4P57A 3BZEB 3SDAA 1YEHL 9CGTA 4N0UA 1D5ZB 3HE7A 3C5ZB 4KKAC 2ICES 3GI8H 1BBDH 4YO0A 2AK4B 3IDGA 4WW2F 5TE7H 4JVWA 5J1AB 3S35L 4OZIF 1UM5L 3KYMB 4IRJA 2E27H 1J1OH 5JHDA 4NQSB 2PO6D 4UTBL 4JZNB 4MLSA 4UV7L 2R1YA 1ZA6B 4D9RE 3H9SE 4GAYB 2Q1EA 1K3IA 4AENA 1KB5L 4LLMB 2W9LA 1BQHG 2QSCL 1FNSL 1UENA 1MFBH 4JO4L 3CVHA 3M1BB 3UTPD 5D93B 4U1IB 1Z9LA 3U7WH 1JGVH 1ZEAL 2DDQL 2PXYB 4QOKD 5F89A 2C5DC 3QEHA 2FD6H 4EI6A 5IQ7H 4D0CA 4FZEL 1XGUB 4ZFZB 2C4XA 4GJTB 4JFQB 5IBUG 2BZDA 1B3JA 5AUMB 1I8MB 4X6EB 2O61A 3QEQB 1KCVL 4HMCA 3WL9B 4Y4KA 3WDJA 2K7PA 3JUYA 2OTWB 3DBXB 4FQ1H 2COQA 4XCCH 1EFQA 5AZEL 1GZPB 2HKFL 2P24A 4YXLH 3UXFA 3STZB 3CZFA 4L4VA 1OGTB 1XIWA 4FNLL 4WY7H 4EQ3A 1TTGA 4JM4H 4LLDB 3OAUL 3SEPA 2ICCA 5HHQB 1SMOA 5GRUH 1J0JA 4NJ9H 4ZQKB 5I71B 4JQXA 5BQ7B 1KC5H 1ZS8B 3ULVD 1MHCB 1MCPH 2VDNH 1REIA 4OJFH 2P5WD 3EOBA 4JO2H 2CUHA 1MIML 3IKCA 4X9BA 1OF2B 2ZNWA 2EICA 2X70B 4F37F 4FRWA 1FQ9C 2DQDH 3PWLA 3OG6B 3K1KC 4OIIL 4G9DB 4GAJH 5I1HL 1M7DA 4QHMB 4RFEA 4Z8FL 1IM9D 2F5AL 3MLXH 4FG6D 1DANU 4K8RC 4YDLB 1UJ3C 1QSFD 3MJ8B 4HDIB 5T3ZH 1P4BH 4CADA 4ZTOH 1JN6B 4OM1H 4L9LB 2J12B 3V5DB 1NLDH 4R4ND 4CNIB 1T22A 3LQZA 3W0WA 1AXSB 2K7QA 1JPST 3MLWH 5DVOA 5GS0C 1JPTL 4XNMA 1QEWB 5I73C 1RJYB 1EJOL 2H32B 2JELL 2VLME 2XN9B 1QPPA 3W9DA 1IL1B 3V4VH 2GITA 2NNAB 3C09B 3AM8C 5CP7A 3L5XL 3IFNL 2KH2B 2WBJA 3VD5A 4UQ3B 4HWEH 1FORL 2PYEB 4BUGA 4MQXC 2XWTA 5E1AB 3H3BC 2Z35B 4PV9A 1ZGLM 5DHVA 3OV6A 3BZ4A 1FV1B 4EXPX 4W6YB 3CK0H 43CAB 3HAEB 5E94A 3EFDH 1KCSH 3QDMD 2WIMA 4PLJD 3S4SB 1FVCB 4HV8B 2CDGB 4WI3A 4XAKD 4EOWH 5EO1B 5ACLA 3BESR 3FQNB 2CRZA 3QDJE 1ACZA 3KG5A 2DTML 1RQ5A 4RRPA 4FZ8L 5EZLA 3QUZC 1VCAA 3S3PA 4JY4B 1CGXA 4XAWL 5C0BE 4I18A 5JOFA 3L9RB 5FYJE 2C1PA 2P7TB 1VENA 5SWSE 3WLWC 1QNZL 1X44A 1I85C 3FB6A 3ZDYF 2BVPB 3KYNB 4UILL 5DTFB 4C83A 3I85A 2A2QT 1CQKA 4Q2ZA 4U1LB 3T2OA 4NN7B 5IOPA 2BRQA 3DVGB 2FJFA 3V4UL 4XMPL 4GRWF 1WSST 4WEBH 3AS2A 5BRZA 2X4PB 4JDVB 4R7NA 2BVQB 3CDCA 4QHNA 4HG4K 3WIIH 4KFZC 2OYPA 2ICWI 1VKXB 1CDHA 3IVKB 4PRPB 4N0UE 2VJXA 3DUSB 1YECH 3R0NA 5D1ZC 1XF3B 1J5OH 3Q1SL 1QHOA 3BZDA 1I3VA 3QFJE 3T77A 3MUY1 1CGTA 3P30H 4R4BB 4XNUL 5JHDE 1CK0H 1MIEL 2HFEB 3LQMA 1KEGL 3MRJB 2VXQL 3ZKSD 1S9KC 3LKRA 1UJTA 3NN8A 5CGYC 3MRLA 1U93A 1ZHNA 2XZQH 3IFOA 4QWWD 3BRGC 2M1KA 4J1UB 3DX9A 3L5WB 1HCFX 4JG0L 4OLWH 1CL7I 1I9JH 4JFED 5EBWB 1P2CA 3OR7A 4GUPA 4QY8A 4XBEH 1EX0A 3MNVA 2V2TA 1JUFA 4P9ML 3BGMB 1U8QA 1FAKT 5CP3A 3VRIA 3MNWB 1FZKB 2LVEA 2AEWA 4N0CC 4XXCC 2NXYD 5C9JA 3WNNA 4TOYH 1G7LA 4E42B 5D9SA 1IAIH 1NGWA 1NAKL 1TVBB 2P48B 5D2LB 1EEYA 4KUCD 1BOYA 1TZGL 5H37H 1AO7B 2R4RH 5EU4B 1U8OA 4LVHC 5CZKA 5KOVC 4XVTH 1AHWB 4JAMA 4QNPE 5T1DL 1UWGL 3ETBF 4NO0B 4IRZL 1KPUB 3MLTB 1EXUB 5KZCD 5EOCL 1MI5B 2G2RA 2R2EB 1VACA 3HC3H 2X1XR 5DJ2A 3FAWA 3UCRA 4J4PC 5INDB 1F3DH 2AXGB 4MNGB 2VDRH 1IGTA 5J8OA 1P7QA 1JTOA 4PD4J 4JZOB 2ADJA 2V2XB 3QDJB 1JNNL 3CMGA 3LRHA 2GY7B 3RHWK 4QRPD 2RGSA 1TETL 3NACH 3ARGB 4WW1A 1N7ML 5E08H 4BZ2H 4L4TD 2IQ9L 3MMEB 1CZ8H 2BFVH 5SWSB 1JHLH 1OARL 1V7NL 2I07B 4M48L 1SBSL 2VDQL 4GMSL 1EA9C 1L0XA 4X4ZA 5TQ2L 3GI9H 3GSNL 4QT5B 3PQYA 4FXKA 1PQZB 2OZ4L 4K8RH 5GISL 3S34H 1H0DA 2B5IB 1JZ2A 3HS0A 4DTGH 4WI5A 1FNFA 3NCYS 3QCUL 5FUZH 4YNYA 5IGXL 1B6UA 1EBPA 2IBBA 4IOSD 2OL3A 4QRRE 1S8DA 4P2RB 3TV3H 5GS0H 1F5WA 3WDHA 3BDYL 5CJ8A 5LXGH 2YUVA 1FBIH 4P57B 3SDAB 5DVNA 4N0UB 4G7YH 1YPZA 3HE7B 4O02H 5CIPH 4YO0B 3IDGB 5A2FA 1FZMA 4L4JA 3VD4A 1KN2L 2AGJH 1AP2A 1F11A 4IRJB 5JHDB 1KXTB 3BIBX 4M93B 3CVHL 5FXCH 2R1YB 3PWUA 2DRUA 3U7YL 4DQOL 4AENB 5GZOC 1MWAH 3DO3A 3CVHB 3RA7L 3VGDA 4KY1L 4PB9L 3RVXD 1I3UA 5F89B 4OI7A 2BP3A 2J1KA 3UJTL 1DP0A 3QEHB 5F71A 4EI6B 2OX5A 4LSQH 5DURD 4D0CB 3BGFC 4HT1H 3IRZA 4OBSA 3OF6D 4Y5YC 4OIBA 2O61B 1YQVH 3QISA 4Y4KB 3VFPA 3TT1H 5BXFA 1MHHA 4MXQD 2P24B 4KGJA 1F90L 4HF5L 1VHPA 3CZFB 4L4VB 4M9PA 1XIWB 3HNSL 4R0LA 3LMJL 5I1JL 2FEDD 1BF2A 4DCQA 3FN0L 2VISA 3LS4H 4HZLA 1MPAH 1LD9A 1RURH 3BAEH 3TP4A 1ZLUK 3OJDA 2MTPA 1CLOL 4XMLL 2J8HA 3EOBB 1F4HA 2WWKT 3IKCB 3MRRA 1GGBL 4FFZL 3RAJH 3QRFM 4RA3A 5KN5A 4G9FD 5L6YL 1J11A 1WAAA 2JB6A 4G7VL 2DLEA 3R06B 3PWLB 4PRAA 4RWYH 3QUXC 2PO6A 3IAGC 4JFFE 3TNMA 1M7DB 4RFEB 4I5BA 1OT1A 3ME0A 4M03A 4O51A 4KQ3L 2BNQD 1BJMA 4JKMA 2X1OA 1F58L 5T3ZD 3OJ2C 4CADB 3MROA 2J8UA 1T22B 3BKCH 3LQZB 3W0WB 3LRSA 5H37G 4L8CA 4QOKA 1MCQA 4XNMB 3TC9A 4R7DA 2AERT 2YEZA 3VMNA 4UT6L 3SDDC 4HQQH 2J3SA 3C5SA 3HA0A 4OCNC 4PLKD 3W9DB 3QWOA 1A6ZA 1E0OB 5A2LH 2GITB 1OWRM 1UZ6F 5DHYA 2AP2A 5CP7B 4G6AD 1IARB 2WBJB 4LVNC 3R1GL 4XP9L 2XWTB 3C6LD 3ARDC 4EN3D 2D3VA 1UB5A 4PV9B 5DHVB 3QXWA 3BZ4B 2PUQT 2WUCL 1G7MA 3KLHC 2FIKA 3PG2A 3JV5A 4TVPL 5E94B 2VITA 3C60A 3QQ4A 2ZJSL 4FQIH 4Y16D 5J9PA 4YGAB 1P7HL 2P5WA 5EZLB 5JQHC 2EXWD 4OCSL 3ARQA 2DQUL 3FRPA 5GGSA 4U33A 3QIWD 4I18B 2DQIL 3HZVA 3QNYA 3UJJL 5JOFB 4TQEL 3VRLE 3TPUA 3PHSA 2C1PB 5CBEA 2VDPH 3FB6B 2Y72A 5DRXA 2HTKD 2GYSA 1NBVL 5IFHL 3KPRD 3H3PL 1IM9A 1Q72H 4RMQA 4C83B 4UTAH 2R15A 4JREC 4Q2ZB 5IOPB 1QSFA 1QKZL 1T04A 2FJFB 3IDYB 3KNBA 1QFWI 1NQBA 4LCWA 1IRAY 3S37H 2DD8H 5BRZB 2LE9A 4O2CA 1TVDA 5CKAA 4R7NB 3G04A 4QHNB 5DJDA 2GJZA 1OAXL 4GLRI 4K7PL 5D7IE 5GS2D 3HC0A 4MAUH 4Z7WE 3SE9L 1WV7T 4F3FA 1D7FA 3I50L 3DI2B 1ZTXH 1SJHA 4XPGL 3T77B 4D9QD 4JVUA 3TVMC 5EPMA 2XY1A 3D1MC 3LSOA 4YK4C 1QOKA 4UT9L 5K93A 2WANA 4Z7UA 3LKRB 3NN8B 4QYOA 3MRLB 1U93B 4X99A 1ZHNB 5C0JA 3IFOB 1CFVH 5TH2A 1UVQA 2HT4C 4XWOD 4PS4L 2DOCA 3DX9B 3HLAA 2D7OA 2DBLH 1URLA 3O8XC 4KDVA 2MHAA 3IDMA 3S3SA 5EIIA 1UM4L 1P2CB 3OR7B 4GUPB 4QY8B 1LE5A 1SJXA 3MNVB 1E27A 2V2TB 1JUFB 4U3XA 1U8QB 2Y6SC 3VRIB 4U1JA 1RUPH 2FJGA 3VFWA 5FEBA 4DAGL 2LU7A 1P4LA 2XZCL 1BQHA 3BKJL 4XCFH 5C9JB 3IFLL 1G7LB 4MA1C 1M1SA 5D9SB 1A7RL 1NGWB 2VR9A 4FS0A 1EEYB 2EYTA 1NEZG 1EHLH 4U6XA 5CD3A 3WCYA 1U8OB 5FKAA 1KG0A 5IMLA 4TPRL 4JAMB 5DFVC 5JNYA 4NKMA 1JHKH 2J88L 4CL7A 4D9LH 1NMAL 4PRDA 3RRQA 4J3TA 1SHMA 2G2RB 1TQCB 1VACB 5L88H 1MCHA 3Q0HA 5DJ2B 4YHLL 4OCWH 4TSBL 1JGLL 3DUHA 1ED3A 1X6LA 2DN7A 2YXFA 1IGTB 2IPKA 3QR2A 1BEYH 4FFVD 1P7QB 4XNXH 3F58H 4LL9A 2ADJB 2ZNXA 3LEYH 4M8QA 3FT3A 2C3VA 1KTRL 3AUVA 4NRXA 4XTRC 1YEJL 3BE1L 4WW1B 3HNTL 3K2MC 4HKXA 3FHAA 4X9FA 3UTPE 1QG3A 2J8UE 4Y1AE 1MNUL 2VZSA 4QOKE 3MRDA 3WJJA 2FBJL 4F9LA 2QQLH 4JFEA 4EQ2A 4K8RD 3PQYB 4UV4L 4FXKB 1H0DB 3HS0B 2AV1A 3HE6A 1OTUC 4YNYB 4BELD 1YNKL 1DBJH 3IDXL 5IMKA 1G0DA 4KK8D 2OL3B 3SE4A 4A2MA 3OPZH 1S8DB 4Q6YA 2FLRT 4YHML 1KTKE 4X6DA 3T3MF 1NMBL 2NY2B 3E0GA 2H41A 1K85A 25C8H 1JVKA 3S88H 4RBPH 1YPZB 1FZMB 2R9HD 3FO1A 2CH8A 5D5MF 3QNXA 1AP2B 1NMCC 1F11B 4LASL 5CSBA 2XTLA 2Y36H 3MA9L 1ZVYA 1Y18A 3PWUB 2C3GA 3M07A 1NSNL 1F97A 3RI5K 4HBQA 3V9FA 1T1XA 2EXYD 3QXDA 3TLRA 1BVKA 1WGOA 1G7HA 5JUEL 4PYHA 2EDXA 3F7YA 4IRSA 5EUOE 1FGNL 4J3UA 3VWJD 5FDYA 1AC0A 4QRPA 2BOCA 2ADFH 4TUKL 1P9MC 1H3VA 3U1SH 4K3DL 4JLRA 1CL7L 3MGOA 4L4TA 3VFPB 3H2WA 2NPLX 5BXFB 4PFEA 1MHHB 1EBAA 5DZLA 4OCYL 1JZ4A 1B9ZA 4LSUH 4R0LB 4TSCH 3NCCB 1TCMA 2GK2A 5I75B 3LEVH 1OQOA 4DCQB 3HRZA 2VISB 1RUQL 4HZLB 2VDMH 2XRAH 5I2IA 3B8SA 4ONHA 1LD9B 3MUGA 1Q9KA 4GMTH 1A7QH 3OJDB 4FTVD 1QSEE 5F9OL 2I60H 2L7UA 3BMVA 4NQVA 1FIGH 3MRRB 3WS6A 5KN5B 3D9AL 3BD3A 4XHJC 2JB6B 4LRIA 3QDME 1QZ1A 2C4FT 3LN4A 3W2DH 4PRAB 1FYTD 3VGAC 5EDXA 1ZLSL 4XAKE 5BV7L 2AEQL 2PO6B 1A2YA 2IGFH 1QFHA 3OKLA 4DKEH 3TNMB 4EIZC 1LDSA 4I5BB 4KC3B 5CGYD 1RUML 4OKVA 2DM4A 4O51B 1PVHA 3RVWC 4R8WH 2EIZA 2B1AL 1IGML 2PR4L 3MROB 2M26A 4BZ1L 2J8UB 4PGZA 5E4EC 4L8CB 3LRSB 4QOKB 2EE2A 4Z7VF 1X5YA 5FCUH 3UYRL 2AXHA 4R7DB 2YEZB 1RZ7H 4QTIH 1A7PH 1MQ8A 3C5SB 3G6JF 3OF6A 1WICA 3QWOB 1A6ZB 3MRCA 4MHHG 2A0LC 3DVIA 3U0WL 1YJDL 4AG4L 2P45B 5DHYB 3FT2A 1XCQA 3M45A 2BSRA 3KGRA 5E2TH 5L8KB 1RIUL 1UB5B 2NW3A 4MB5A 1G7MB 2FIKB 2F5BH 5MHSE 1U8HA 1JPGA 1A64A 2VITB 3C60B 5IQ9A 3SO3B 4TTGA 4NHCL 3QQ4B 1FGVH 2APWA 3EO1A 5J9PB 4PJBF 3KJ4B 2P5WB 1W0WA 1I7UA 3P0GB 3AREC 1HKLL 4GBXD 4J4PD 2WUBH 5GGSB 4WUUE 4OV5A 3HZVB 3QNYB 5E00A 3MLUH 3TPUB 4PJEF 5L9DH 4DVRH 2ZCKL 3MRQA 5CBEB 3CX5K 4U7KA 5C6TH 5DRXB 3E6HA 1IAII 1IM9B 2OR8A 3X3FL 3VFVA 4FMKA 5MERA 1T83C 4YUEL 5T3XH 4MNHA 5FFLA 4K7PY 1W72A 4IIQA 1QSFB 1U0QA 1RIHL 1T04B 3KNBB 4LCWB 3MLSL 5ISZD 4ZNCD 4BFBD 4G6KH 2UUDH 4GQ9L 4O2CB 4EKXA 3QEGH 4BQBA 1NGQL 3G04B 1YUHA 5DJDB 2GJZB 2MQ0A 2W9DH 3MXWH 3HC0B 1BF8A 2PN5A 4F3FB 2E7MA 1JPSH 3KPLA 4KPHL 4PRID 5EORH 4LHQB 1SJHB 5EPMB 1YEKL 2VZUA 3LSOB 5CCKL 2L4OA 3C6LA 1RFDH 3PNWA 4EN3A 1QR4A 4Z7UB 3B2VH 1DR9A 3MLZL 1W8NA 4QYOB 3QIBC 5FGCE 4GT7A 4X99B 4OCMC 1FVEA 5C0JB 3QPQD 2R2BA 5TH2B 1UVQB 3ZT6A 5KVMC 2CKNA 4S1DD 1AJ7H 1A7OL 3HLAB 5MEND 5F6HJ 1OTSC 2MHAB 3IDMB 5EIIB 4O4YH 2E9JA 4RDQG 1E4XI 2VSDA 4QRPE 3TBVA 5GZOD 3QIWA 1LE5B 3HN3A 1E27B 5JXAL 1G6RH 5JOPD 4FXGA 2OI9C 4U1JB 2FJGB 5IFAL 3VFWB 3SE3C 5CZXC 1CF8H 1U8JA 4NQCA 2E7LC 4HIIA 3S36L 1P4LB 4M6NH 3O11A 1BQHB 3SQOH 3BN3B 5DT1L 5EA0L 5C2UB 4R26H 2QLVB 1A6PA 2EYTB 3ALPA 5GRZA 4U6XB 4S1QL 5CD3B 3UZVB 4NJAL 1K8IA 1EHNA 1YC8A 5FKAB 4LPTA 1KG0B 4UIMA 5IMLB 1AIFA 1BJ8A 1J0YA 1WWCA 1CD9B 3B9KA 5JNYB 3LQAL 2D4FA 4NKMB 5IBUB 2EIDA 4B7LA 3BKMH 1LVEA 5GJSH 5HHVL 4JY5H 4PRDB 4PJHA 5SWZE 4G6JH 1BWMA 5HVHB 1X6NA 4KMLB 4TN9A 3ROOA 2NQCA 1ED3B 2WSKA 4D0BA 2AJ3A 2IPKB 1IT9L 5KG9A 1MCWM 4F7TA 3O6LL 4PREA 3U46A 4LCCC 4M8QB 4U2YA 4PGDA 3FT3B 5I8OH 3MLVH 3SDYH 2C3VB 2KZWA 1FC2D 2V5SA 4NRXB 4PP2A 2VUYA 2WM0A 4EDXA 1QTYT 3AMKA 3QUXD 4HKXB 1DBMH 5DUMH 3WXVH 1CE1L 3P73A 1Z3GH 1CICD 2W92A 5CS7A 2K1MA 1SM3L 1OD7A 3A6OA 4HPOH 3FO2A 3KVQA 4JPIA 1UH3A 4Z7NE 5I1AA 5E0QA 4CVZA 2B1HL 4JFEB 1NCDH 2YA2A 3NIFF 3GHEH 35C8H 1I1CA 3MCLL 1FDLL 3V6FA 1OAZL 5GRJH 4Q9CA 2AV1B 3HE6B 2OS7A 1OAYH 2BVUA 5JTWA 2R4SH 2OR9H 5IMKB 3C2AL 2R0LH 3G9VA 1RJCA 1VGEL 4X4YA 4X6DB 2NXYB 3SDDD 1IMHC 4F37K 4KV5F 1QFWL 3UAJD 3WDIA 2WP3T 2RCSH 4ZXBC 1TXKA 3LZFL 5CILH 2CPCA 4OM0H 3RWDA 3PWPD 4JN1L 4WDIA 3OTTA 3EW3B 3FO1B 1J0ZA 2DLFL 3QNXB 2HMIC 1U8KA 3BJ91 1ZMYA 1R5WA 1C16A 4L3ED 5D1XC