4UUJB

Potassium channel kcsa-fab with tetrahexylammonium
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uujB01
1D5BA 2BVTA 4HGWB 2K7QA 4EIZC 2IFFL 3TWCH 4WFFD 4DKEL 4KJQC 2XRAH 4HJJL 4QTHA 2XTLA 4AQOA 2FECI 3V4PH 3UP1A 2WWMD 4MJ5A 4DGYH 3ULUD 5T1DL 4L4TE 3TFKC 1DEEA 2E5EA 4UIMA 1I1YB 2EH8H 3Q2CA 4X98B 1GOFA 5KANG 4Z78B 1YC8A 2WBKA 2R2EB 4MAUH 1T0PB 2IADB 1PZUB 3CVHH 2ZP0T 2OR9L 5DRXB 5ALBH 4YBQC 2UZIH 5BVJB 4LLMA 4PJFE 2NY2B 4JFED 3TPKA 4HS3B 3OKEB 3ZYJA 4HF5H 3BN9D 5AZEH 4G8GD 1X5FA 4MNGE 3OJDB 4JZNA 4PPTA 4FXKB 5ECJE 3KJ4C 2R9HD 3LEXA 5D7LD 1VFBB 4J3WA 4Y2DD 1FVCA 4DAGH 3MTRA 1HKLH 4TSAL 4G8IA 4HS8H 4XHJC 3SEPA 4APQA 3BXNB 4Z77B 3P4MA 4G9DB 4YAQB 1JZ5A 3V0WL 1QQDA 25C8L 1NEZA 4ODSL 3SQOH 2YWYA 5CJQH 5E5RB 1NCBL 32C2A 1V8HA 3S88H 4XNUH 4GMTL 5IF0B 5JIPA 4YHNB 4ZFZA 3SDDB 2EC9U 1MLCB 4E41D 1KJ2H 3T2NL 1MCLA 1KJ3L 3IDMB 3K8LA 3RGVD 3U30B 4BA8A 1MI5A 1FZMA 2X40A 4WUUA 5I1AA 4Y5XA 1H8NA 1XAUA 4MD4A 5EC1B 4RGOL 1QSEE 3WS3A 4Z7QE 4ORZC 1CXIA 1S9WB 3HE7B 4DGIH 1HHJA 4PJ7A 1T5WA 2BHZA 4JM2A 3EUUA 1MFEL 1UM4H 1BJ1J 1TCMA 1OGAE 4LNRA 4UI2A 1KYOJ 3WLWC 1ZLUH 1ZHLA 4UTBH 2VQ1B 1EEQA 3X3FL 2YRLA 5CSZA 3IB4A 2ZPKH 1D9KB 1JGVL 1YEKL 3G5YA 1CFBA 2ZSVB 3WKNA 4L8BA 1TTGA 5CBAB 5DJ2B 1AHWB 1UG9A 4UQ3A 3NGBB 4UB0H 4U1HB 2F54D 1S9YA 1U91A 2IBZX 4RFNC 2XG5A 3EYQD 2ARWA 3MPCA 3KG5A 1KELH 1PBYA 3MRGB 3DIFB 4HX1A 1X5XA 1NGQH 5D96B 2E9IA 4FQXB 1FNGB 1I8IB 5L8KB 4TNVF 1XR8B 5C3LD 5HVGB 1T7VA 4S1DD 3D18B 2CDGA 1U8KA 3KLAA 5IQ9A 3K1DA 5I16B 1NCUA 3RBSA 1OD7A 4YDLB 1ED3B 4M61A 4OCMC 4RZCA 4R2GC 4Y4HD 5CBEA 3QB7C 1A4JA 4P9MH 4H26A 4U1KB 3NIDF 5K9KA 1JGEA 5DQDL 1GGIL 1QPPA 3MV9A 4JFYB 3QNYB 3VRJB 4N90E 3ZTNH 2DLTA 5JIKA 4R7NB 5AAWA 1ZTXH 3UYRL 4QY8A 1SVCP 1P4BH 4ZO9A 1G7PB 3SKNB 1JHTB 1Y18A 4ZSOA 1FJ1A 2VDML 4WI4A 4WI8A 4XX1E 3ZO0A 3VWKD 3L3HA 1EZVY 3JTSB 4K9EH 2YPKA 5IVXE 2WINA 4PJCF 4FMKA 4LSVL 4AM0B 3O9WD 1V7NL 2GIYA 4BQ9A 1CGSL 3G6DL 4PLOB 5EZJA 3EOBB 3ULVL 1TCRB 4ALAH 3P77A 2AABH 4NSKB 3MNVA 3MYJB 2MFNA 2AV7B 2E7CA 1U58B 4CVWA 3VU2A 4CJ0A 3FN0L 3NFSH 1ORSB 4WY7H 3RGVB 4JM2C 3S96A 4M00A 1J11A 4KV5E 4QRQA 2DMBA 5JNYA 2J8UE 4PRPB 1EGJH 3V4UL 5CEZL 2DKMA 4PJ8A 4RBPH 1SMOA 3QULB 4N0FB 4W6WB 3EOAA 4M1GL 3CLEL 2XWTA 3QO1A 1T4KB 1YA5A 3ZTJG 5HHOA 4PJIF 1AXIB 1UADC 1V3JA 3HAEH 1ORQA 4HIEB 2PF6A 1O0VA 3S9DB 1NSNH 1BM3L 2IANA 1H5BC 1OAQH 3EAKA 4OD2A 1JK8A 3REWA 1J5OL 4OUUB 4UV7L 2DQCL 5D7JB 3ZDYF 1KPUB 4KMTH 2WUCH 1EO8L 5IW1A 3DMMA 4ZUTB 1XR9B 3MGOB 2W92A 1I8MB 1LE5B 4M9OA 4ZYKA 3CC5A 1JI1A 5E8NB 5JQHC 2P8LB 2UWEF 4Y4FC 1GGBH 3EJJX 4U6XA 3H9SD 3EYUL 5EBGA 4PJ9C 4K9EC 3VGAC 1A3LH 3HMXH 5D1XC 3MODL 3FJTA 3SE4A 4NCDA 4UTAH 3TIEB 3BD4A 2I26N 2VLME 3IDNA 3DLQR 2BOBB 1ODAA 5E1AA 3R0MA 2YK1H 5DMGC 1WAAE 3LHPL 1R5WA 4PJDE 3PWJB 2OZ4H 3BWAA 1RZ8B 3T65A 3WFDL 4JREC 4I18B 5HYQB 1YEGH 5TQ2L 3TZVB 3PGFH 3VXRB 4MNHA 3G6JF 2HFGH 4G6AD 4M1DH 1EFXA 2JELL 2NY3D 4TYUA 3VJ6A 3ARED 1Q9LA 4HKJA 4GLRI 4GJTB 2PO6D 1CVRA 4XP5L 2D7PA 1F11B 5F8QC 1YMMD 2CIIA 3ZE1F 3D6GA 5HHME 4WDIA 5IGXL 5JHDE 4URTB 1KCUH 4XNYL 1I9JL 1YQ2A 1C5BH 3S36H 1I1AD 2VZOA 2Z91B 2YUZA 1SVZA 3HRZA 3P73A 2VLRA 1XIWC 4AIXA 5SX5H 3O9WB 2HTLC 3NN8B 1HSAA 1MLBB 1U3HB 4NKIH 1U8HA 4G8EA 4IRZH 4O2EA 2BNUA 4TUKL 2ICES 2DD8H 2HVKA 1QBML 4P46B 4FZ8H 3TJHD 1G7MB 3C5JA 3T0VA 4WFEE 4Y5YC 3S34L 3QPQD 4XHJD 4MXQC 3O81A 4R3SB 2F74B 2H3NA 1QO3B 3DMMC 1MQKL 35C8L 1WITA 2ORBL 3GGWA 1CDHA 4U1LB 4PB9L 1NUDA 4PJIA 2IQAB 3C8HA 3NCFB 4JHZA 2V7HB 2I25N 2I60L 1KTKE 4ZO7A 5C0RH 1CD0A 5F7UA 5DWUL 5CD3A 2Y6SD 3MLTA 4JB9H 2JF1A 4Z95H 5BO1H 5SV4A 1CFNB 1JZ8A 3BUYB 3MRNA 4QHKJ 5EPMA 5DDHB 1DLHB 2QSCH 3QDHA 5FCUH 5HHNB 3H9SB 1WBYB 4HUXB 4E42A 2H32B 5DJDA 2X6MA 3UTTE 2BRRL 3W39B 1FYHB 5EWIH 5I1KH 2BSTB 1F6FB 4OLYH 4LSPL 3K2UL 2IALB 5EOTA 3WLWD 3V5KA 2X4OB 5I8EA 3IDUA 4PJGE 5TDOB 2IAMA 5J57B 5GS2H 1B0GB 2GKIA 3QNZA 3VGDA 2PN5A 2A73A 1YYMH 2C1OA 3Q1SL 2F5BL 2BOCB 2DQFA 4NO5B 2EKSA 3MV11 1G1YA 2MQ3A 4ZXBD 5FM5M 1VPOH 3UTQA 3T08A 3GBNL 1CU4H 4XXCA 3T4AA 1UVQA 2WIIB 5IMLA 2ARJQ 5IHLB 4DVBA 1II4E 4P2YA 2Y25A 4YHLL 2D7TH 3SKMB 1IGIH 4MJ2A 3SCMD 1ZAGA 4R2GD 4X6BB 1UWEH 4ZUVA 3FT3B 3QFJB 5ANMA 2ZUQC 3G08B 4V1DD 1U8JA 3O3EB 1K3ZA 1YEJL 1NANH 5GGSA 1LP9F 4D8PA 2JJSC 4PJ5E 4W6YB 4XZUA 3DSNA 4U1IB 1UCBL 3LPFA 3THML 5I1LA 4Q0XH 3KJ4B 4WW2C 3OAUH 5HYJD 5E2UL 4EI5C 1N64H 3KS0H 1TFHA 3HCVB 5FKPA 3QG6A 3MV8D 3FB7A 1UWGL 1UKTA 1NLDL 2P8MA 3MMEB 4Y4KA 3OHXB 4OF5A 1BWWA 3T1FB 1FYTD 3HUJF 4JFDE 1IZJA 2BSSB 1IC7H 2WBJC 1H0DA 3LQZB 1A6ZA 5KN5B 1WEJL 1MIMH 3TJEL 4PGBB 1MJ7L 5KSVB 5BMFL 2X4UA 1A9EB 2FO4B 1JF1B 5HYIA 5ISZD 1MCSA 1D5BB 5I1HH 1FRGL 1UT9A 2DTML 4NRYA 4Z0XA 4NNXB 1N8ZA 5CEYA 4ZOAA 4DWHA 4MMZC 4LVNC 2MSPA 4ONHA 4IIQC 1MPAH 4RMRA 3CVHB 3O8XC 4QTHB 5DT1H 4MJ5B 3T0AA 4JQIH 3GMOB 4LIQE 3QXUA 4OFYA 3SE3C 4LPYA 2R23A 3EYOA 3V6FA 2A6IB 1CD1B 4Z8FL 5IFJB 2EEAA 4GG6E 1A6AB 3IDJA 5KAQG 2C3WA 4RFNB 5D1XD 5I15L 3CX2A 3GSRB 5F7WC 3CVIH 3CH1B 3L3JB 2BK8A 2DQUH 5FGBA 3TBVA 2NNAA 4DW2L 5DMGD 4LPWA 2E9JA 3CZFA 1QPXA 3CSPA 4AEIL 3HLAB 4LCUB 3BVNA 5DD1L 3FOMA 1KJ2B 2BVEA 2XFXB 4R2GB 5FYKU 3ARRA 1NDGA 5C0AD 1TMCB 3H0TB 2XQYK 1QQDB 3MLSL 1KLFA 1LP9A 2P48B 1OCWH 4KKAC 4P3WA 4MNQD 3R4DA 3BESR 4GAGL 5KVDH 5ICXA 4YZFE 3DWTA 1OY3B 1MRFH 2C3VB 3WIFA 4MJ6A 2B8OT 3DOSA 4CUCA 4X8XA 1HHKB 1EMTH 5DD3L 5DURD 3AS3A 2PR4H 4FTVE 5D7IF 2VRAA 2VSCA 4WUUB 1TZIA 3CFDB 1GCFA 4H0IA 5FDWA 1T6VN 3QUMH 3TCLB 2DYPA 5DQ9A 4QXGH 3CDCA 3TBWA 3OG6B 4YHIA 4MGXA 4UDTB 5EOCL 3PGDB 4HZLB 4KKCC 4M48H 2FHFA 3VD5A 4PJ7B 3ULUF 4JM2B 5GS3A 4F3FB 1B0RA 2HTKD 2EEDA 5DMJB 3RTQD 5CLWA 3DARA 3JUZA 1ZT1A 2PYEE 1WBXA 3FQUA 3U7YH 2CLVB 4NQEB 1JHLH 3QT2A 4PRBB 5J06A 4XTRC 4ZQKB 4ERSL 5DJXA 15C8L 2QQLH 3SBWA 5H35B 5T3ZD 5SWZA 5MENA 3GEWB 3S5LG 4RFEA 2JK5B 5T3XE 1NCWH 4X7TB 2A9ML 1S9YB 1H5BB 3WV0A 1N6QH 4NHUA 1E4WH 1FDLH 4FQ2L 2Q7YA 3V6ZB 3PV6B 1HI6A 1C16A 1ZOXA 5GRVL 1DFBL 5KVFH 5IEHA 1C5CL 2PXYD 3DI3B 4PR5B 4ZFFB 3PXHA 1I7ZA 4UILL 1MHHB 3CLFL 1NFDF 1U8KB 1CGYA 1I3VA 4Y4FB 2AEIT 3P9LB 4XPFL 4PJ9B 1ZT4A 3LEYH 2JCCE 2JJTC 2HVJA 3U9PH 2NW2A 1A4JB 4NQXB 3VGAB 2BNRA 2VAAB 5D1XB 2E7HA 2MPAH 2P44B 4Q9QL 1W0YT 4E9LA 3WFBH 2HT4D 1FN4B 1AGFA 5E2WL 3QJHB 1A9BA 1SY6H 2HRPL 4QWWC 3FB8A 4JREB 5GIRA 3K8KA 2WINB 2CGRH 2VN4A 5CMAB 3P0GB 5A2LH 1LEKB 4KTDL 2P24A 2J1KA 3SKOB 5FECB 2M2DA 3WXWL 1BAFH 1J1PH 3OV6A 5EZJB 1A21A 2EDEA 3ARDD 5KAQF 4XPGH 5E8EA 3VFPB 3UJJL 3VG0L 4NPYB 3MNVB 5HHXH 5EBWA 3N50A 2VXQL 4L3EE 3X11B 4K3JL 4ODUB 2YZ1A 4JJ5A 3MRPA 1X6LA 4K7PX 3S96B 5EDXA 3HAEB 3GSWA 2W60A 3IDIB 4QRQB 2FJFA 2FLRT 3VFGL 1XIWB 5L8JB 4LIQL 4KTEL 3VGEA 5KG9A 4LNVA 5J6GA 5F1KC 3BEWB 5FYLD 4K7PH 4KJYB 4PGCA 5HI5C 3PWVB 4D0BB 3IFOB 2SEBA 3IJSA 3DX7A 1S3KL 1UH3A 3D3VE 1FFNA 4OGZA 1FE8H 3PWPE 1QLEL 2F53D 1SHMA 4HUVA 5H8DA 4K7FB 4FFYL 2DDQH 4OI7A 4Y5YB 3ZDZE 3W82A 5IW1B 4EKXA 1OQOA 4YHKL 3DMMB 4P5KB 4WI9A 3NABL 3CAFA 1DEDA 1T5XB 2EE9A 1CZ8H 4ZYKB 4NC1C 2BC4B 4M93C 4JFEA 4U6XB 4MLSA 5D2NA 2OTWA 7CGTA 3PE9A 4G9FD 5E5MA 5CJOL 3BQUD 4G8GA 1P1ZA 2WBJD 4HGKC 1I9RH 5MEQB 3CU7A 1J7VR 3KPMA 2ATKB 3TVMA 4LEOA 2G75B 5E1AB 1T1WA 1JPTL 4PTUA 4O4YH 5F7KC 1HILA 3HZYB 1NFDA 2W1NA 5F9WC 2OR9H 5TQ0L 1Z9MA 1QKZL 4GRWF 3RZWA 1VGKB 3MRFA 3BI9X 4ZOBA 5HD8C 1NMBL 2CDEA 4E41A 3VJ6B 4G5ZL 3JWDL 4HKJB 2A83B 3DX8A 4HUWB 3O8XD 5KVGL 3FQRB 5HY9A 2CIIB 1AY1L 1CK0H 4LCWA 4NDMB 1K8IB 5A2KH 1AIFB 3F5WA 1OHQA 1ZMYA 2FIRT 5KTEL 25C8H 5I1EL 5D72H 4PJCB 3TN0A 2VLRB 4U1MB 2HKFH 4N0CD 4I0PC 1RZJC 3IU4L 3RL2A 3DTXA 4HWBL 1RJLA 2VZ1A 3MACH 4R8WH 4F80A 6FABH 4X5WB 2NXYD 5T3XL 1BZ7B 4G3YH 4O2EB 4YK4C 1AD9A 4R90H 5DEGB 4X7EC 4CVUA 3LKRA 3OKLB 3L5WB 5I1GL 4QRTA 4S2SB 4XCNA 4XAWH 1WV7T 2YN3A 2HP4A 3TH2T 4YJZL 4CVXA 4OLZL 5AG9A 1PJ9A 3WDJA 1MREL 5DJCA 3ZKNC 2ZUQB 3B6SB 5GISL 2ICCA 1K6QH 3O45A 3CD4A 1FG9C 1NGWA 3GGWB 5IMKB 4MDIA 2VERN 2GITB 1D5MB 4YUEL 4GKOA 4PJIB 2XZCL 2ESVD 2BSED 1JYXA 1IC5L 1INQA 3S37H 3UJTL 3SGEI 5BS0A 5GS0C 5A1AA 5C7XH 3T0WA 2YA0A 4EDXB 4TOYL 3O2DH 5BV7H 4WW2B 2ED7A 1MUJA 4M9PA 4EI5B 1JGVH 3HR6A 4QCIA 5CD3B 5GSVB 5AYUL 3PP3K 1DSFL 4FMFA 4Y4HA 5D2LE 5GGSY 3X12B 2Y07L 2GJ6E 5AD0B 4NQDD 4OFIA 4QHUB 4I13B 5DUMH 5LBSL 3MRNB 4HV8A 3BKMH 5EPMB 4AT6A 5I30L 3O3AB 3UEZA 3E1F1 2UWEB 1HOCB 1IAII 4QRRE 1TIUA 3F7VA 1MFBH 4G9FB 1WFNA 1WF5A 4CL7A 3GMPA 1RU9H 1KIPB 2WBJB 4HC1A 4M7LL 5ADPH 2AJXH 5C70A 2L7UA 4X9GA 3FFDB 3OR7A 3VWKA 1MNUL 4MAYA 4HD9A 2AS5M 3QUKA 4WWKA 4ODHL 4OCSL 1J8KA 3C08H 2VLJD 3WD5L 5L2KE 3K0WA 4GAYB 3VFNA 3PQYA 1HHGA 3P3YA 1GGIH 1RD6A 3S5LA 1OPGL 2PW2B 3QNZB 2YD9A 3G6JB 5TE4H 3E8UH 2BCKB 5GGVY 7FABL 4LVNB 2Z0BA 2DWEA 3TNMA 4IIQB 4TVPH 1KTRL 5FYJU 3BRFA 3O8XB 1HH9B 2C4XA 1ZT7B 4WTWA 3TV3H 5IKCA 1NCTA 1OAYH 4EI6B 1YPZE 1ZANH 4QF1A 5IMLB 4LSVH 3RKDC 2MQCA 4M6ML 1B4JH 3TBTA 3WEXA 4AENA 2LTQC 3NCJL 5BV7C 4ZUVB 4IDJH 1BMGA 3ISWA 4HT1H 2X2YA 3RL1B 4HMDA 4JFHE 4GQ9H 4POYA 4D8PB 4ETQA 4U1JA 2YKLL 3RIFK 3J7HA 4MHHI 4UOW1 4MD0A 5K9QI 4UV4H 2EDJA 3B9EA 5HPMA 3V4UH 4BSVA 2J2ZA 3VE0A 1OF2A 3B8YA 1CICA 4BK4A 1EJOH 5ETUA 5FKPB 4NRXA 1WIOA 4HBCH 1OAXH 1T0NB 3F12A 3INUL 3QDJD 4LCCA 3FB7B 2FSEB 5GSRA 5E7BA 3DX9A 3OBAA 1B2WH 4XWOD 3TO2B 2BVOB 1Z5LB 2NW3B 2ICWB 1WZLA 2XZAH 1OSPL 3GJFH 4ISVA 5F71A 1KB5L 4O51B 2C5DC 4M02A 3W2DH 2JJWA 1PDKA 5K93A 4HHAA 4QOKE 4WHTA 4PLJC 1HE7A 2VKXA 4OF8A 4NKOA 4MWFA 5C07E 3AREA 4K94L 3MODH 5BJTB 3F58H 1SEBA 3PGCA 1Z3GH 1UA6L 3BKYL 3WFCL 5D1QD 1YMMA 5CILL 2EDWA 4RISL 4QXTA 3KPTA 3MLUH 3NCYS 1FIGL 4NP4L 2DWDA 3CCHA 3QCUH 1MFAL 5FGCE 2R0KL 1I7RA 1I1AA 3GSNA 3QI9D 4RFOL 3MRKB 5EZLB 5TE6L 5EN2A 4NN7C 1TITA 5C0DB 1S7SA 4FFWD 2I27N 3I3EA 3EFDH 2A77H 5DZLA 4G6MH 3GMMA 2XV6B 3V6FB 4GBXD 2ZKHL 2GJZA 1CFTA 2CRYA 1T7WA 3GSQB 2E9WA 1CWVA 1MY5A 2LABA 1J87A 5DQJA 4CBPA 5LAXA 2MKLC 1I9JH 2VXTH 1YUHA 2JB5H 3TBVB 4D9RD 4N5EC 2X44D 2OR8A 3T09A 1CICC 3FOMB 1A6TB 3U0WL 3BP4B 4UT6L 1NDGB 1RUQH 1TZGH 1BP3B 4TUKH 1ZHKB 2IGFL 3L95B 4I1NB 3P9WB 4IOIA 2C7UA 1AO7D 5B21A 1A4KB 1KCVH 3T4YB 1LE9A 1HKFA 3LSOB 3ZE2F 3QUMB 5FA3A 3AU1A 1N6UA 1EERB 3EGSB 2QKIB 1GIGH 3ZSTA 1QFHA 4XP9L 3T2QA 1IQWL 1UB5B 1IM9B 5F7YC 3LN5B 4P23A 4N9GA 4OM0L 2ORBH 3W9EA 2N7BA 4Y19B 3ZSSA 2H9GB 3QP3A 4PB9H 1NBQA 2NZIA 3QDJB 1NJ9B 1Z2KA 2PNDA 2Y36L 1TZIB 5IB4B 4UBDC 1KYOK 3P9MA 3VXUD 1TZHA 3V2AR 2DQTL 2WUBH 2B0SL 1RUAH 3BIBX 1DQML 4YO0A 3HUJB 3VXNB 1AC0A 1E4XH 3WHXB 2E8ZA 4JPIA 1YJDC 3HI5L 2Z4QA 1B0RB 4PJHA 2MHAA 3B5GA 4QRSA 1L6XA 4BUGA 4NJ9L 3QDGB 3FQUB 3ES6A 1D7FA 4N8VG 1JGUH 4R7DA 1YECH 1YMHA 3RVVC 5T1LD 4JG0L 1J18A 2Q76B 1CE6A 4U05A 4PJEE 1KCLA 1KIRA 4XNQA 5EZIH 3RJQB 4MX7A 4YE4H 1QSFE 3B2VH 1I7UA 1OSZA 3BYTA 3UAJC 4EQ2A 4JDVA 1YEHL 3MRRA 2P7TA 3G5ZB 3HC3L 3QEHB 4R4BB 1J8HD 1C16B 3SCMA 3RVTC 1T1ZB 3FQWB 2OR7A 1OTTD 4ETYA 1QVOA 4V1DA 5HSFA 3BP7A 4P2RD 4M93B 5E0QA 1HXYB 3U7WL 1AQDA 4HUNB 3OKKA 4HUUA 3U4AA 4YFLI 3WDIA 4JO1H 3MRCA 4BSJA 3IU3B 2Q1EA 3GSOB 4WGWB 4G42B 1VEPA 1REIA 1DBBL 5HYJA 4PY7B 4ZPTA 4KJPD 1ZHBA 3QIUC 3RWEA 3P4NB 1KPVA 2XKUA 3MV8A 1J86A 2D4DA 4N0UB 4HH8A 2AXJA 1GRWA 5F9WB 1CGWA 3NPSC 5I19H 5ITFA 1UWXK 43C9A 1TJHH 1EEZB 4EVNB 2AK4A 2VDPL 4EDWH 2VR9A 3MRQB 1JF6A 5I2IB 5CGYC 5IM7A 3GIZL 3H3BC 2D9QB 4PJBA 2HLFC 2XT1B 3QFDB 3BEVB 4QLRA 5ALCH 2XKNB 4KVNL 3FAXA 3T2PA 4JR9L 4OLVH 2AJUH 5ISZA 5D7IB 5JLZA 4KVCL 1F2XK 2BHUA 4I0PB 5ILTH 5BZWA 3BAEH 2BNQD 1G9NL 5IBTL 1H3UA 4IM8A 3VXUB 4YXHL 4PS4L 1Q72L 4RWYL 2OSLB 4YK4B 3IDGA 1ND0A 3DX7B 3GSUA 4OGXL 3NCEB 5DRNA 4TPRL 2EE6A 4DKAA 4LMQI 4WUKH 5BMFH 2QQNL 5CIPH 2EYTA 4PG9A 5GS1C 1L9MA 3HB3C 4JO4H 2CK0H 1OVZA 1ZEAL 1A5FH 4QNPF 4X6DE 1E6OL 4ZAKA 4X4YA 3KPLA 5ADOH 3GMLB 3TCXA 3AS2A 5MEOA 5C09E 2W9EL 1WBZA 5IMMA 3WIHL 2DJSA 1P1ZB 4HG4K 1CDCA 4OD1L 4XNMB 4KGJA 3HG1A 1JJUA 5GHWL 4LEOB 4X4ZA 2ENSA 3QH3A 4TVPD 3RIFF 5C0AA 4PLJD 4K3EL 5DFVC 4OZFG 3C8DA 4J8RA 4EEEA 4JRYB 1MHCA 5H37H 4MNQA 1S7QA 2YD8A 5FOBA 4S1QH 5EU6A 1KCKA 5C3TA 3BX7C 4M62H 4PJXF 1PQZA 2E6QA 4N1CA 2P43B 1R5VB 4P2QB 2X4TA 5I1IL 1N0LA 2V2XB 3DGCR 4AEIH 4HQQL 3RWGB 2KKQA 2LU7A 4PRIA 5B3JF 4N8PA 2CDFA 2QHRH 4L4TD 3MBXL 4U6VH 4EOWL 2AEPL 4NO0D 1LEGB 4MA8L 2UY6A 3RL2B 3CFIC 3DTXB 4GAGH 2XY2A 1RJLB 2X4NA 1F00I 5DEZA 2GUOA 3RTQA 1T04A 3P30L 1PKQE 1G7HB 1DR9A 3Q5YA 1KN4H 5DD3H 5F1NB 3T0XA 3LH2H 4QRTB 4LPXA 4H88L 4OSUL 5SWQA 2FGWH 2LTQB 5BV7B 1S5HA 5DJCB 5J9PA 2YUVA 3K80A 1LK3H 1IILE 3EYVB 3EZJB 3O45B 4OKVA 1NGWB 1S7UB 3DV4B 3JTTA 3BIKA 4GW4A 2VDNL 4BH8A 2NR6C 4ZAKC 1KPRB 4JM4L 2FZ3A 4NUGL 2PXYA 3FMGH 4ERSH 2ZCKH 5CZXC 4QCIB 3DUUB 1Q9WA 2CUIA 5C0CA 3GK8L 1MCEA 1YY9C 3FN3A 3UBXG 2DQGH 2FBOJ 3DV6A 3S35L 2J8HA 1T2JA 3SDAC 3RHWK 1QSED 4GFTB 1YEDB 3BPCB 3RZCA 3X3GH 3RWFA 4PV8A 3CDGA 3EO1B 4LP5A 1KBGH 4FQ2H 1Q9KA 4TQEL 2XN9A 4CDGC 3NCBB 4M7LT 4X4XA 4F37K 1J10A 3OR7B 2HT2D 2OL3H 3CLFH 5F7EH 2HT3C 4JFZH 4N8VA 1OGAD 3BP5B 5L6YL 3A67L 3HNSH 1TVBA 2C4FU 4KY1H 4P3CL 4KI5F 4NCC2 1F4HA 5HGAA 3BHBA 1FCGA 4M1CC 3ARDA 1P2CB 3PQYB 4GRWB 1MOEA 4LSUH 1CR9L 1NH6A 4PJXA 1I9IL 1EAJA 3BSZL 4WHYH 5IESH 3UAJD 1A6VH 3SDCA 2V6HA 2OQJA 2AJ3A 1KJVB 3GFUA 4NN7B 2EDYA 2XICA 3KHQA 3GMQB 1NAMH 1NMAH 3TBTB 2BDNH 2OTPA 3U46A 2V9QA 4QRUB 4AENB 1UXSB 4A6YA 5ENWA 1S5IL 1BOGB 2R0WH 3DROA 1HSBA 5C0JA 5LJYH 5GGVL 1M71A 2GSIA 3CGTA 1S7XA 2F53A 1R3IL 3LS5L 1YQVL 3QQ9D 4NQCA 2W07A 3TH3T 3D5OF 4F9PC 1W0VB 4LIQH 4N90D 5AUMA 4BSVB 2D2OA 1OF2B 4MNGB 1CICB 2ARJA 3OKYA 3QZWG 4NQTA 3GRWL 2DTSA 3VCLB 3LZFH 3QRGL 4NRXB 3VWJC 3DETC 3F12B 5C6TL 3RQ3A 3P0YL 1K85A 5L88L 3DX9B 3KLSA 3BQUA 1UB6A 1GL4B 2EXWC 2D03L 1DBKL 2V7NA 5C2UB 4H5SA 3CDFA 5I17B 3WFEL 3RZCC 4Z0BL 5HBBA 5CJXC 1YEEH 3HZKB 4CVZA 1JE6A 5EU5B 3P0VH 4ISVB 1T1YB 2DM2A 1MFDL 4XI5C 1KGCE 4XCYB 1N2RA 3KR3L 4I2XB 1IGYB 4HHAB 1QBLH 5I75C 5EULV 4U0RC 5HDLA 3KPSB 1I75A 4PJAF 2BX5A 4MWFB 1AXSA 1I9EA 1NKOA 5L8LB 5K9JL 1QR1A 4JKLA 1YN6B 4NZRL 4QXTB 1F3DJ 3OAZH 1U8PA 1RZ7H 2JLLA 3CCHB 5IVOA 1JPTH 1YN7A 5CD5C 5D6CA 4F33B 3SDCC 4I0CC 1IEAB 5MERA 3GSNB 2I9TA 1OGAB 5TQ0H 5EN2B 5ICYB 1IEBB 3UCRA 3MCKA 1ITCA 3VH8G 4BQ8A 5IVZA 3PJSB 3IFNL 3QQ3A 2XTJC 3TF7C 5JQ6L 4PTTB 5DC0A 3O6FC 3QHTC 3MR9A 1A7OL 1AY1H 2GJZB 1YY8A 1IAIL 5F89A 3BE1H 2IG2L 2VLKA 4R0LA 1E6JH 1W72H 3OXSA 3RX7A 4R96A 5HHVL 4FQLL 4J4PA 3AMLA 2VLMD 2W38A 5I1EH 1NCAL 2PW1B 2ZCHL 4XWGL 5ICZA 2OBGA 1IM3A 3NCCB 5E03A 5E24E 3IU4H 1OTUC 5F7DA 3PABB 1KENH 5SWSB 4OZFA 2RIKA 4HWBH 4LRIC 1F13A 3FQNB 1BQUA 5F1IA 1BJ1H 4XPTH 5BXFB 5EG6C 4KROD 3HC0A 1A47A 2H2SC 4KKBC 2V2WB 4PRPE 1INEH 4GT7A 5DTFB 3UROR 2C7UB 4OGAD 5I1GH 5JORB 3VXMA 4XPBH 3RAJH 3IFPA 1G9EA 4X9IA 1A7QL 2UYLA 1LILA 4XVUC 1V05A 1X6NA 5FA3B 2NX5B 1BFTA 3MLRL 1MJJB 3QIUB 4OLZH 5HHMD 2ZUTA 4HUMB 1I7TB 3Q6FA 1CDUA 1JPSL 4NQDA 4JRXB 2EIBA 5EO1A 5JHDD 1MFCH 3PDDA 5GISH 4D9LL 2ZNXA 3ARGC 3NPSB 4KDVA 1TXKA 2CIKA 4QYOA 5ABDE 5IVXB 1RJCA 3HN3A 1BD2A 2XZCH 4TULL 3M17B 4G80A 3P9MB 2R1XA 1OD9A 2B2XL 5CKAA 4OJFH 5I1DB 1DCLA 4I9WE 1ZLVK 4YO0B 5DEFA 5M95B 3OX8B 2ITCB 4H1LH 3IRZA 1RZKL 4OZ4A 1DSFH 3SGJA 1NDMA 3ZT7A 2VYRE 5LBSH 5DGQA 2FYYB 2MHAB 4X6EB 3JWOC 3LMJH 3L6FA 3PF2A 4WFED 3KAAA 1MHEA 3ES6B 1G6RL 2J8UB 3QIWD 4PRAB 4AG4L 4KI5C 4TRPL 1RZGB 4I4WA 2VE6A 4LPUA 1TENA 3MYZA 1NL0L 4MSWB 1UJ3C 3QO0B 4M7LH 2NR6D 3AXLA 1Q94A 4XNQB 1ADQL 1AI1L 4KC3B 2WQ8A 1JYNA 4X6CF 2XI9A 4FQPA 1LGVA 4XVSL 5E6IC 4H8WC 5LGJA 1VACB 4OCSH 4GH7B 3CJJA 1I7UB 3WD5H 3VXRE 2IBZY 1QOKA 5GS1B 1KSRA 3QG7L 2AERT 3EW3B 4MCZB 4X8JB 3UBXA 1ZKAA 5HTSA 4HIXL 3BP7B 4M6OL 3L7EA 5IOPB 5EU3A 1U95B 1RJZB 3MNWB 1AQDB 2AJYL 3OKKB 4U3CA 3QDAA 1CLYL 1FGVL 3TEUA 3X17A 5T1KB 12E8L 1I8KA 1JFQH 2R2BB 2DL2A 3NCJH 3QEGL 3DHJA 3Q3GB 3F7YA 4GKZA 5F9OL 1YNTB 1A0QH 4B7IA 5GZOC 4M1CD 1EO7A 5ITFB 3I3DA 4HK3N 4OCRH 1XGTA 4F57L 3BH9A 2X9WA 3QUZC 3CPLA 2H2PD 1ZLSL 1IE5A 4LSSL 4NQVB 5FO7B 4TUJA 1NCCL 3CFKA 3SJVE 5BW7A 3RHWF 3BPOC 3U4EB 5C71A 3TYGL 3WSQL 4DFIA 4JG1L 3QXAA 4JQXA 3VFWA 5EUOE 2ZG1A 4G7VL 1RQ5A 4YX2L 5F3BB 4PYHA 2F8XC 2R0LL 1B4RA 3MJ8A 2A6KA 4GMSH 3AVEA 5CIPB 4F37F 4OBRA 8FABB 3KPOB 5BZWB 2JIXD 5D1QA 4F2MB 4O2FA 4LFHD 1EHXA 5T1MA 3NH7H 2X4SB 4HJGA 5TDPB 4O58L 4RMQA 3VFTA 1KTDB 5INDB 4E0RB 1ND0B 3V8OA 4PJ5D 3O11A 3PHQB 3U0TB 1F5WA 1KJMB 3PDOA 1Q8MA 3STZB 4L1DA 4PY8J 2E9BA 3B9KC 2DL9A 4YFEA 2YD6A 4D3CH 4JFQB 4PGEA 2R56L 5DJ8B 1H9VA 3IFLL 4EUPG 4GBXA 5FUOH 4RISH 3DRQA 3FB5B 4Q9BA 4NP4H 3F8UB 2NLJB 1X5JA 4ZAKB 3I9GH 1CI5A 4X6CA 1MFAH 1AR1C 1F4WL 1X5IA 2FX7H 3R06A 3BZ4A 4JFDD 2CQVA 4WO4A 4MS8C 3MLYL 3RWJA 2J8OA 4JCLA 1RJYA 2EH7H 2ZOKA 4ZDHA 2NY5H 2HG5B 1T20A 1KT2A 4PRHA 3U1SL 1L7TL 2ZKHH 1XGPB 1ZA6A 3RUGF 3SDAB 1JHKH 4L8CB 1AO7A 4I48B 4NO3A 3QPXH 5GGRA 2C1PA 1KFAH 1AH1A 3U82B 5FOBB 3GSXB 1MRCH 3BDBA 3MV7B 2Q6WB 3QFJE 1IFHL 5HHPA 3UTTB 2UZYB 3L3KA 1QEWB 5B39B 5I8KL 5BW7C 1NANI 2ADJA 3NZ8B 1AD0B 5GGTA 5JW5A 2EDDA 4JQXC 3OAYK 4GRLA 3VH8A 2VL4A 1N0XL 5DI8A 1U8LA 1TVHA 3MJ7A 1DTUA 4ODTL 5EU4B 1OTSC 3MRDA 3O6FD 4HPYH 2A6DB 2P1YA 4LAQH 5DD6A 1CXFA 5JIHA 3OF6D 4PFEA 2X1XR 3FONA 1L4IA 1T04B 5ACLA 3OKDA 3UTSE 5ESVB 1W8NA 4JZJC 2Y36H 1Z0MA 1H3PL 5T1LA 4HWUA 4NT6A 2OXHA 5EBMA 3C5ZD 2B1AH 5HGHA 2Y72A 5JXEA 2PTTA 3WKMH 3HE6D 2H2SD 1DQMH 4KKBD 4Y1AB 2ICEB 3MGAA 4X99A 3QDMA 4QXUL 3AROA 1UKQA 1G9MH 3WNLA 4GW4B 1CBVL 1RFDH 1CFSA 2A9NL 4P49A 4G6FD 1J8HA 4OCWL 2ICWI 2NY0C 3N1FC 1BFVL 3OGCB 1MHPL 4WVRA 4L8DA 2YRPA 2WLZA 4P2RA 3CUPA 2NMSA 1EHNA 4JG0H 3VWJB 5F44A 1IQDB 4JCMA 4FTVD 3X14B 4JN2B 2OL3B 1KXVC 3CSYA 3DV6B 1RUKL 1A7NH 1K4DB 3V7AE 1JGLL 5C92A 4WI5A 3ULVF 3RZCB 3K81A 4PV8B 2ZUUA 1XEDA 2OJEB 2BFVH 2R2HB 4NYLA 5TPWL 1YEIL 1A2YA 3B9DA 2GT9A 5FM4A 3EDDA 1CDBA 3VA2C 4Q2ZA 5E56A 2VLLA 3EJYD 1BQLL 3C9NA 3U7WH 3IF1A 4XX1G 5I75B 3SKUD 2BVPB 4N8CL 4U0RB 2PYED 2AKRA 1TVBB 1BF2A 4P4KA 4ZS6C 4GRLC 4LDOB 1FGNH 5ITBH 3NTCL 1KIQA 1BLNA 3MLWH 4P2CG 4LGSB 1WCBB 3VFVB 3KPQA 1K8DA 2G5RA 5E6ID 4PJXB 3LV3B 5T3XD 1JN6A 1DBJL 4OCNC 1VSCA 2W91A 5JTWA 3SDCB 4KHXL 1QSVA 4JHAH 4LKXA 1M6OA 1G9MC 2ATPA 3IXAA 1JWMA 4R26H 2BNQA 3WXVL 3KYAA 1P7KA 3T3MF 3U46B 2XTJB 5LVEA 1G0YR 4ONGH 4EN3D 3O6FB 4HH9B 4JKWA 5JXEC 4FXGA 3DROB 4Q9RL 1HSBB 1MI5E 5GXBB 2HA1A 4HXBL 4HWZA 1NBVL 1M71B 2BHYA 3CNKA 4WUUE 3V5DB 1EO5A 1NUGA 3U2SB 1MCKA 3MRHA 4J1UB 2VH5L 3PXJA 1DUZB 3SQBA 5KJRH 5DJZB 4U7KA 1JNLL 1B3JA 4O2CA 2APVA 3I02B 5KW9H 5GZOD 4PJ7E 2ZOLA 2R69H 4PS4H 1QNZL 4X7SL 1MWAA 3IAGC 2WWKO 3HI6H 1BHGA 1XGUA 1JPGA 1RAMA 4OQTL 1UB6B 4NQEE 1FZOB 4GRMB 3S3JA 4DCQB 5JA9A 2QQNH 1L0XA 2HKHH 2J3SA 2FJGA 4X80L 4Y8DC 2NY6C 2YA2A 4FHBD 5JR1H 3UO1H 1LO3H 2VDKL 5KS9F 4GAFB 3MO1A 5K9OB 2WP3O 4L3ED 2ADIA 3HC4L 3ARGB 1R5IB 3LN4A 3C6LC 3LEVH 4IS6B 3IRPX 5EBLA 1T0MB 4NM4L 4RX4A 4YHOL 2W9EH 4P4KC 3BIAX 3MRBA 4JFPB 2QHLA 4RQQB 2F58L 4ONFL 1QFWL 4C56A 4JO2L 4LDEB 2IBGA 5IB5A 1EK3A 5GHWH 3N85L 5J1AA 3D3VD 3RVWD 4XGZB 3LKNB 1N7MH 4I0KA 4JQVA 5HVHC 3PWPD 4OLEA 1IGFH 3B9KD 3JUYA 5LG1A 1T03H 4K3EH 1I3RB 4ENED 2HAZA 5C0NC 4NO0A 3TBYB 1W72B 4V2BA 4EUPA 2EDRA 1BX2A 1S7TB 3UTOA 3TWCL 1CVSC 2CLZB 3MFGB 5DJ0A 1UJ3B 4ZSOE 2VXVL 3BOVA 3CFJB 4NGHH 5L2JB 3MXVH 1ZGLB 1LDPL 2AI0L 1AR1D 2DBLH 5I1IH 3MR9B 5LWYH 3V4PL 5E6IB 2H8PA 1YY8B 2DIBA 3MUHL 5DGRA 1LO5B 3AC0A 5JPNB 3VDCA 5A2IH 3NFPA 4AY0A 3CFBA 2EH8L 4RIRB 4JE4B 4XNXL 4PLKD 1IM3B 1K4CA 3CXDH 5I76A 4IMKA 4MAUL 3QJFA 3PL6C 5F7DB 3CVHL 1I3GH 3D9AH 2RGSA 4CAGA 1UCTA 2PYFB 5IR1A 1ES0A 4NZJA 1Q0YH 3P30H 1PGRB 5DSCB 5EUKB 4HF5L 5AZEL 2X7LA 1MCWM 1MH5A 4RMSA 4R4NC 4KUCF 2AAVA 2H26B 1DVFC 4BKLA 4DAGL 1IJ9A 1HKLL 4MZ3A 3EJZD 4HS8L 1JV5A 4K8RC 1TQCC 5D6DA 4BZ2H 4NC2B 2AEWA 1KN2H 1XGYH 1CG9A 2CRIA 4X9FA 5EO1B 2VSDA 4C4KO 1JPST 2OI9C 3D48R 1J88A 4H1LB 3SQOL 1QSEA 2CIKB 4JANB 3S88L 4XNUL 4X0KA 2HMIC 4MB4A 3QUZB 1LNUA 1R3HA 2LE9A 5CHNB 4HKZA 3QCTH 2P42B 1KJ2L 4NUGH 1M7IA 5FHAH 4K2UH 5CINH 5DEFB 5KS9A 3BPOB 4HKBB 2P5WA 3FOLB 2QL1A 4LHUG 2Z31D 3LKSA 4PP1C 3D69B 3UTZB 3KYKL 1J1XH 1MCIA 1MHEB 4WHCA 1F8TH 3IVKA 2NY7L 4PJAB 2GTZA 4HS6A 3VI3F 3QQ4B 4TQEH 3ROOB 1MJUH 4DGIL 3EZ8A 2Z8WC 1UM4L 3L3GA 3DYMA 4TVSa 2EDOA 1IC1A 2NY0D 1BZQK 1AE6H 1MF2H 3D3VB 2C3HA 3OZ9H 4UTBL 5HGBA 3A67H 3GMRA 4HCRH 4QT5A 3MREB 3B9KB 3NIDE 2ZPKL 1E27B 2DI7A 4CJ1A 2X1PA 4O00A 4Z7OF 1NFIB 1DDHA 2R1WA 4HIIA 4F58L 4UUJB 2YR3A 3UBXB 1VENA 2GJ6D 2K7PA 1U93B 4LFHG 4UB0L 5IFHL 4MVBD 3MOBH 3TBSB 4QRRD 1KELL 2P8PA 4PJCE 1Y0LA 2VLRE 4I77L 5SV3A 2Z35B 3LKOA 3FKUS 1KV3A 1A7BA 3NIGF 1C08A 4J3TA 1WWAX 2EXYC 1AGBA 1GOGA 5D6DC 2W0LA 3VFMB 2X70A 3GMNB 3QXDB 5FCSH 3BO8B 4BJLA 4UT9H 1PG7L 4GKZB 4P9ML 4U1NA 3QEQA 5HYSG 5I71C 3Q6GH 5L2KD 1RK1A 4FFZH 1EAPA 3B83A 5FB8A 4XMLH 5DK2A 2Y7QA 3CPLB 3UPAA 5DYOA 4Y5VC 4Y16A 5HPOA 4HFUH 3BZEA 1ZTXL 1ERNA 4TUJB 3DRTB 3WUWB 2XQBH 3U6RA 2VITA 4YFDB 4ZUSA 4K9EL 2F8VA 5IMOA 2Y9RT 4PJIE 1C5DB 1MJ8H 5GGRY 3VFWB 5EA0H 3EFFA 4H20H 1Z9SA 4K7PY 4JY5L 1JWUB 1V3LA 1FSKC 5ESAB 4ALAL 3ZDYE 2AABL 5BQ7A 4FQHA 3EO9H 3NFSL 1SYSA 4WY7L 1IAIM 4JFHD 1R3LB 4X4MA 4YDIL 2UWEE 3RY5A 4P3DA 3O11B 1D5XB 2DOCA 1EGJL 2JE8A 3FO9B 1RUPL 1EUTA 1BFOB 3BGMA 4JZJB 3WLBB 3EBAA 4WFGE 1YNKH 2ADFH 1HQ4A 2QQKL 2QBWA 3G6AB 1S7VA 3WL9A 1A1NA 4NZRH 2DJ4A 3FTGB 2D7OA 1OAQL 1WIPA 2R29H 4HW6A 4WV1A 1KLGA 4NRZA 2O93L 2FLBT 2W0KA 2NY0B 2WUCL 5E8DL 1FP5A 3EO0A 1ZWIB 3BZ4B 3G6JE 1F4AA 4ZTPL 3E6FA 3N1PC 3RL1A 4G43B 5DK3A 1C12A 3C6LD 1C1EH 1WAAA 5HI4C 1RJYB 1NFKA 1IAMA 3S3SA 3FQTB 3GM8A 1FCCA 4PJDA 3ZE1E 3PWUB 1GGBL 3OAYH 1WJ3A 2IF7A 1KT2B 4JVWA 3T8XB 4QOKD 2DQJH 2IEPA 1BJMA 1ZA6B 1A3LL 2EC9T 4U3XA 4HK0A 5C6WH 1TPXC 5FK9B 5C07D 3RDTD 4UTAL 2C1PB 4XBGA 4ZOEA 4UDUA 4XCEA 2QV2A 4LLQA 1FFOA 4QRRB 4HIJB 4FQLH 3ZKMC 1PX3A 1U8QA 1ZVSA 4HLZH 3HZMA 5T5NF 5F6HI 5JHDA 4PD4J 4HXAL 3ARFC 2OZ4L 5A16A 5F6IC 1YEGL 3PGFL 5HHQA 4GRLB 4PV9B 4M1DL 3QEUB 3N9GH 1JZ4A 3LQAH 1SQ2N 1S9XB 3LKPB 2Y5EA 1BREA 5DD6B 3RFZC 1A6PA 4FQJH 1KCUL 1JPSH 3FONB 3GB7A 1RULH 4ORGA 2HJFB 1S8DA 1C5BL 1XF2A 3S36L 1IVLA 1A1OA 1XCTB 3QIWA 3RWDB 4EXPX 4TULH 2DLIA 3ARBC 1P7QD 5FXCH 2E27H 4NKIL 5HGHB 1XGQA 4IRZL 5FF6A 1QG3A 2YPLA 5CEXA 3EIFA 1EA9C 2DD8L 4ELKA 2HRLA 3QDMB 3QUXA 4FZ8L 4DTGL 2OK0H 4R4ND 2E7LA 1LVEA 5KSUA 1ONQA 2X4RB 2IPTH 4AG4H 4AQ1B 4L8DB 2RAMA 2DM4A 3BUTA 2PCPB 1NL0H 4P48A 2VL5A 4LU5H 2NPLX 1F6LL 3BP6B 5GGUA 4L4JA 1WTGT 5LGHH 1EH9A 1FZKA 2P5EA 3JV4B 1ZGLP 2NY6B 3SDYH 3KPPA 4N9OB 1DN2A 1U2HA 4JB9L 2KZWA 4Z95L 3LQAC 5D1ZC 5BO1L 2GT9B 5F3HB 4WEBL 4LHUA 5IBUG 4HIXH 3C6LB 3NPZB 5BVPH 4Q2ZB 2QSCL 5JPMB 4LGPB 5FCUL 4RSVA 1BGXL 4N68A 5IHBA 5DRWA 1C7SA 1CLYH 1U41A 3CFEA 3GHEH 4OCYL 4P4KB 3RUGB 1AGCB 3TYFA 4KJWD 3D2UD 1FFPA 1FH5H 3FT4B 3S3PA 3K46A 1KIQB 1VDGA 4KKLC 4P0DA 3NZHH 5EWIL 5I1KL 12E8H 5H2BA 1A1MA 4OLYL 3L1OH 1EHAA 1G7JA 5HVHB 2MCPH 1MFNA 3IKCB 3QEGH 1QSFD 1HINL 4YLQT 2H1PL 2AQ3A 1LP9E 3ILPA 5F9OH 1XH3B 4YXKL 1HNGA 2ZJSH 2AJZA 4M7KL 1QBAA 2JIXA 2Q3ZA 1F42A 2G5BB 3HR5B 3QXWA 5FYJE 4F57H 4LLVA 1OW0A 1YYML 3FO1B 1DN0B 1CXEA 5D9SB 4MDJB 4M5ZH 1F3JB 1T6WA 1VPOL 3BZDA 4LLWB 2HWZH 2AXHA 3NOIA 4PJ5A 4Y19E 5FGRA 5HJ3B 4HWZB 4KDTC 2GW5A 1QRNA 3TO4C 2NTFB 4UOW0 4MD5B 3ARSA 4F9LA 2EXYD 4ODWA 2D7TL 3EYFA 2R0LH 2A74B 2VZVA 3VGGA 3VD9A 1UWEL 3HUJE 3PL6B 1E4KC 1ETZA 4FABH 1E4XI 4L4VA 1P7QB 1VFAB 1MWAB 4PRNB 4DZ8A 4XH2A 2AXFB 4O58H 5DD0H 3U48A 4LCYB 3WFZA 3BDXA 1XGUB 1JPGB 4OZHF 4F15C 3NA4A 3I75A 3QDGE 4JFXB 1ZLWK 4FQ1H 2YBRA 3HZVB 3MZGB 4GKSB 4PBXA 4ESKA 4X6FB 4Q0XL 3RVUC 4JFDA 3RWIB 3OXRB 3BMWA 1OM3H 1CDGA 1DVFB 2FJGB 3OAUL 4M03A 4NKDA 5DJYA 5HDBF 1N64L 1TQCB 5C9JB 5E2TH 1GJIA 2IQ9L 3K4DA 3MO1B 3JBG7 4HAGA 4XNZC 3RPKA 2OI9B 1FO0H 1JPFB 1IBGH 1ZSDA 5ACZA 3LN4B 1PYWB 4YDKH 1EHLL 3RWCA 2Y1VA 2Q8AH 5D7KE 3T0EA 1QFUH 5EBLB 1GVIA 1F4WH 3GM0A 2YSSB 1JZ3A 1S78D 1IC7L 2WSKA 5IBLC 4DKFH 4NC1E 1UXWA 3MLYH 1MIML 3VXQB 5IB5B 2CXGA 1KNOA 3FQXA 4MQXC 2H41A 1J0HA 2XACC 4LF3A 1I8LA 5KSAC 2BNRE 2D7MA 1FAIH 3PNWB 3E0GA 1MCHA 1KLUB 4PUBH 5I1HL 2FWOB 1KB9J 2EIZB 1IGJA 4YR6B 5C8JB 1YDPA 4TTDC 3BKJL 3MRJB 3O0RH 4OAWA 3MOAH 1IFHH 1TDQA 1F4YH 1ULVA 3L7FB 4GXUN 4RMWA 5DT1L 4BYHA 4DGVH 4QEGA 2H8PB 3RBGA 5IHUL 3QIBD 1F45A 5C09D 4JQIL 1QSFB 1NKRA 4U3HA 4OCXL 3MGTB 3NFPB 5HVFB 1DUYA 1RHHB 5HI4D 3C5ZA 5HYEA 3HE6A 5JOFB 4WRLA 1VESA 1JBJA 3KYOB 1T22A 1ES0B 1DE4B 2XA8L 1EVUA 3CVIL 2CKBH 5D7IE 1XGRA 3H9ZA 3K3QA 2VXUH 4FRWA 5C08B 1T7XA 1J0KA 3UXFA 5M7QA 2DQUL 1MH5B 3ZYZA 3I85A 4U6HA 2AGJL 4Z7VF 4OZGF 2GCYA 3ARFD 4BKLB 2DQEH 2FR4A 4IRJC 1FVEB 2XWBB 4FTVA 2KH2B 1SBSH 5I71B 4Z7UF 3ULUE 1BZ9A 5IEKA 4KRMB 1JRHH 1OCWL 2YMXL 3D39B 3G04A 4WI3A 1CBVH 4LLDB 5I1JH 4OZIF 2FO1A 2X89A 4Y5VB 1ACZA 5KVDL 3IXTA 43CAB 3I6KA 4DQOH 3VXSA 1MRFL 1I4FA 1EEYA 1MHPH 4IJ3C 5KS9B 3V0VB 2A6JB 1QHOA 2PR4L 5GRWA 3ILQD 5I66A 3H7BA 5D2NE 2P5WB 3PWNA 4JDTH 5FO8A 4Q97A 3ARBD 1AKJD 3U0PA 1NBYB 3QUML 2XZQH 1FSKB 3HS0A 4P5MA 5FYJL 3MA7B 2PUQT 4XMKH 4YDJA 4PB0H 3MUZ1 3WO3B 4HWBA 5DK0A 4M48L 2WANA 5F8RC 1UZ8A 3V5HB 2BSRA 1NFDE 5CGMA 3L3GB 4NM8L 3S8WA 3AAZB 4ZO8A 3D85A 4JRYE 3QBTB 3NCMA 1NC4D 2X9XA 4JZOA 1INDH 1JNHA 1YEFL 1CIUA 1GZQB 3FCTA 5HDOA 5FM5O 3NTCH 4P2QE 4HIIB 1HHIA 4XC1H 4EN3A 3ZYIA 4Z7WF 5IW6A 5J1TC 4F7CB 4LCWE 4P5TC 4C59B 4R97C 1NCWL 1Y6MR 1KXQE 2JCCA 1MCRA 5FHBH 1O5DT 2YUXA 4X5XA 1FG2B 2W65B 1N6QL 1NQBA 1E4WL 3GNMH 2MCG1 5C09B 5KVFL 3LKOB 1A14L 2H6PB 5GRJH 1JZ6A 4MA3A 1MAML 2D9CA 4JN1H 3MBEC 1AGBB 3MUJA 1I1CA 2NY2D 3U9PL 2VIRB 3ZZ1A 4U1NB 3QEQB 4F7EB 1VGEH 4HXBH 5I0DA 1U8OB 1TPXB 2MPAL 4JHWH 1EAPB 5INCA 4KKLD 1E0OB 3TGXA 1QA9A 4JGJA 2C26A 5JMRA 5DYOB 5DHVA 4RMUA 4Z7VA 2J88H 4L3EA 2D31A 3VXPB 1VERA 4HLJA 3RY4A 1SY6L 1K5NB 3ARFB 3G5VB 3Q48A 2GAZA 5F6IB 1QNZH 1W0WA 4XCCH 2FATH 5IMOB 2VISB 4PG2C 4U33A 4Z7UA 5BS0E 1AGDA 2VDOH 1BAFL 1J1PL 2CD0A 4QTIH 5AEAA 3SDDD 3AMKA 4XPGL 3WFHA 5I8CA 4OZIA 4Z76A 2IPUG 5HHXL 4PGDA 4DVRH 4WCYH 5CP3H 3PWPA 3FFCB 3OR6A 2FX8L 5FEBA 1OB1A 5JXAH 1PKQB 5C0EA 2FL5A 3F6IA 2HJLA 4YGAB 5F88B 4NM4H 2BVQB 3ARBB 3HE7D 5DZNA 3TNNB 4LLUB 2DM3A 5IB3A 4K7PL 4UU9A 4FFVD 4IHOA 3BGAA 4EXKA 1QFWH 1A1NB 3UDWA 4PBVC 5BRZA 3BKCH 3O4LA 3N85H 1FE8L 1A6WH 3HNVH 1SJEB 4MJIA 2BVYA 4IRSC 5JOEA 4NRZB 1RZJL 2DDQL 3PQYE 4GKNA 4GRWE 2G2RA 1AQKH 2JKXA 2LFGA 3EO0B 3RNKB 2XXMB 4C83A 5TFSH 3V4VH 2DB8A 1IGTB 3STLB 4M7JH 1C12B 1CZ8L 2EYRB 1KGCD 3RJDA 3JVGC 3LS4H 2X09A 2CR6A 5EORL 4Z7WA 2VXVH 4MQ7B 2W59A 1A3RL 3WBDA 4FG6C 1LDPH 2AI0H 1T2XA 1EJ6A 2BP3A 2XWJA 2J6EH 3T3PF 1D5ZB 1BVLB 4FQXD 1I9RL 2COQA 2IH3B 1FFOB 1IEHA 4J3XA 5DVKA 1KB5A 3QXTA 5D1ZB 4NKMA 4XNXH 1AFVH 3B3IB 4O4YL 4IMLA 3RWHA 5TDNA 5HVWA 3B2UC 3OTTA 3P4OA 4PP2A 5B38G 2BY3A 5IJKA 2Z8RA 4P2OC 3CZJA 1A3QA 3F7PC 1MRDH 2HJKA 3KDMB 4TTDD 5HHQB 3MRLA 1M7XA 2OJZH 3A6CH 3GUTA 3LAFA 2YEZA 1V7ML 5ESQA 1CK0L 4DZBA 4ZUWB 1HYRC 1VKXA 3ZE0F 3GB7B 4TNWK 4ORGB 2Z31A 5D72L 5DA0B 3FO2B 5F9JA 3WMSA 3QUYC 3IT8D 2HKFL 1NGXA 2RFXA 5J3HC 4J2XA 1XZ0A 3QWRD 3HA0A 1KOAA 3BH8A 4KMQA 3MACL 4R8WL 6FABL 2ADGB 3D25A 4BFIA 2NXZC 4G3YL 4LQFL 4RAVB 4R90L 1LWRA 3UDWC 5JO5A 4I2XE 4JY4B 4PRPD 3TO4B 1UQSB 3KPSE 2RR3A 4XAWL 3WJLA 2I5YH 5KSUB 1ONQB 2G9HA 4LGRB 4YHYC 1RUMH 1JGDB 2GK0A 3KYKH 3MLZH 4IBLT 5D7SL 2GJ6A 2NY7H 1K6QL 1KG0A 2DI8A 2JJVA 4N1HB 1RZFH 1T3FA 2Q86B 1NBZA 3VXTA 3DXAA 2AK1H 2VL5B 3U9UB 3OPZH 4F15B 5JDSB 3S37L 5D7JD 5C7XL 3O2DL 4XC3H 4QGYA 4M4PA 3LRSA 5BV7L 2BMKA 2P5EB 2F9BT 4M43H 2R4RL 1NGYA 4CADA 4HAFA 4I9WD 1OP5H 3WNOA 1JWSB 1XF5A 4XNZB 4F58H 1NCDH 1WVZA 5DUML 2ZG3A 3BKML 5L2KA 4JGMA 3O6MH 5FKAB 2X5PA 5IFHH 3MFFB 4YDVA 2QR0A 1I85A 4LOUC 1UACH 1CGUA 1MFBL 2V2TB 3TYFB 3H9HA 4I77H 5CGTA 1RU9L 1LEIA 1PG7W 1PG7X 2ZNWA 2APXA 5ADPL 2AJXL 4G8FB 5SWSE 4XBPA 1A1MB 3PIQA 1TVDA 2O61A 4ZFOB 3ROLA 3O3DB 3VD4A 3C08L 5C0IA 5KSAB 4APQC 4FN0A 3TZVD 3VXRD 1PG7H 1QLRB 2WQRA 5A2FA 3E6HB 2AJZB 4HC1L 2NX5E 3DURB 5TE4L 3E8UL 4LLVB 4NN5C 5CAYB 4MCYB 4C54A 2VDLL 4JRXE 3L3IA 4TVPL 2FH8A 4AL8H 4OFKA 5F70A 1T1XB 3TV3L 4XP4L 1OAYL 3CX5J 1HDMB 1QRNB 2GTWA 1ZANL 4BQCA 1CXHA 1G7QA 4BM7A 4Y5XC 5IJVA 4YHPA 1MIEL 2XOTA 1EBPA 1B4JL 1FIEA 2VABA 3MBED 4JY5H 4ODWB 5CKGA 1IAOA 4OKDA 3C60A 4Y89A 5DMKA 5B4MD 4YEFA 1U3HD 4QRPA 4WU7A 4OIIH 3DECA 1L7IH 5HI3C 4IDJL 5E8PA 8CGTA 3W0WB 1F3DH 1ETZB 3QISA 2L4OA 4ZMAT 4HT1L 4LLYB 1SYVB 3OB0K 4P46D 4GQ9L 3ALWA 1K3IA 2R2CA 1LO0L 1FO0B 3HPLB 4FZEL 5A40E 1FL5B 4YDIH 5E7FA 4YHMH 3DHMA 4HUKB 4UV4L 5A3IC 5HGDA 2YBRB 5CP7A 4BH7A 1RUPH 1R3KB 4QHMB 4NKDB 1EJOL 3JV6A 1S9VB 4IRJB 3SKJH 3SJVD 3AY4A 4HBCL 2XA3A 1OAXL 4DUVA 2QQKH 1U92B 2X9YA 3GSVA 4IOFC 4QOKA 4NWUH 1ZA3B 4JHBA 1B2WL 3ABZA 4TSBH 4XP1L 3NA9L 1HH6B 2I07A 2Z8SA 3RDTA 5BOZG 3KPNA 3HI1A 5LQBH 4ZUUA 4ZO6A 3VA6A 2XZAL 4YGVA 3DUSA 5E8DH 5FYKH 2MTPA 3MC0A 4ZTPH 4UQ2A 2MKWA 3TA3A 1V5JA 1XF4B 3C5SB 4IJ3B 3W2DL 3D0LA 4DN4H 5F1OB 3HNTH 1NC2A 4JPWH 3DGGA 5A2JH 5CWSB 4LF3B 1P84K 4RAUB 1JNNL 4YNYB 4GAJL 5E8OA 2Z92B 3MNZA 3F58L 4KFZC 3SPVB 2UUDK 5IIEB 1Z3GL 1ZV5A 4K55A 4NO2B 1FL3B 1ZS8A 3MLUL 5DHYA 2UY7A 4LPTA 5IWLA 2NTSP 4IRSD 3QCUL 4J23A 4RCAA 2VQTA 4CW1B 4YPGB 4HXAH 3LB6C 1JTPA 4JJHA 2AK4E 1RY7B 2CKBB 4HG4J 5C0BB 4P57A 1AP2A 4OFPA 3EFDL 4NZTH 1YJDL 3NFNB 2A77L 3I2CL 5FUCC 3ZE2E 1DZBA 4KJQD 4G6ML 4X9HA 3S36X 3FT2B 5E94A 4P5TB 2XNAB 3IGAB 4R97B 5T33L 4PREA 1VEMA 1FZJB 1CGTA 5GJSH 3GSNL 3TFKD 1T22B 4F7PB 2FEEI 1WUNT 3ALPA 4Y8AA 5J13C 4LKCA 3DVGA 3WIHA 2VXTL 1SBBA 1HZHL 2JB5L 4ZODA 4U6HB 4JFOB 3QFJD 2ERJC 2R8SH 2QJDA 3LN9A 4GW5A 1RK0B 3MBEB 4L9LA 4PJ8C 5B38A 1T83A 4YBQD 2IBBA 3VD7A 4A2MA 5K59F 1M4KA 4U2YA 3AY4C 4HULB 1IL1A 1RUQL 1TZGL 1WFUA 1BZ9B 1RSFA 3WJJA 5TGBA 4RAHA 3ME0A 4JY6A 4FQQB 1KCVL 3G04B 4DTGH 5F21B 3G5XB 4OZHB 4DUWA 3DO3A 3KYNB 2M26A 3IXTB 2NY4C 3O2WL 1GIGL 1PSKH 4LRNH 1J12A 3GJEA 1Z6JT 4P4RB 3TA3C 5IG7B 3SJVB 3UTSD 2B39A 1V3MA 3PWNB 1IZKA 1MVUA 5J3HD 5FO8B 2KQMA 2FIKA 5EUOB 1HHHA 3D2UA 5IQ7L 4P5MB 2WUBL 3KPRB 1CDIA 3HG1E 3SE4C 4PJEA 1RUAL 1BIIA 1U8NB 3I6GB 1E4XL 2FDBP 2UZXB 4ZG1A 3VFOA 4XRCB 3VI4F 3KXFA 3DBXA 2ZCLH 1DQJB 1Q9OA 4WEBH 1B88A 1EXUB 1QYGH 3D85B 3IS1X 5DR5H 2GYSA 1HK6A 1YNLH 3OL2A 5EU6E 1BGXH 1JGUL 4MHHG 5K9QG 1YECL 4JO3L 2WW8A 3LCYA 3MV7E 4OCYH 1JNHB 2VZ3A 4AIZB 1WT5A 4WENB 1H8OA 5JW3H 4TNWF 5EZIL 2HFEA 1CLOH 1F6AA 1QACA 4PRIE 4YE4L 1RZIA 3RVXC 3B2VL 4IRSB 3B8SA 4S1SH 1HINH 2H1PH 3D0VB 2AXGA 1UENA 2YC1A 3ULSB 3V9FA 4D0DA 4YXKH 1D6EB 4M7KH 4TUOB 5JW4R 1T7ZA 1S7RB 5JW4M 2B4CH 4JLRB 4QHLB 3RA7H 2IPKB 4QHKI 3MUGB 5DVMA 3QNXA 4JO1L 2WM0A 1WC7A 5BZDB 3WJJC 1UZ6F 3QA3A 1H3GA 3CSBA 1QA9B 1S7WA 3EDFA 3HMWL 5I6XC 2QLVB 3LPWA 4D9QE 4E5XA 3IETB 3SGDH 4JFFB 4Y1AE 4APQD 4OZGB 4LASL 4XPAH 2AJSH 1AGEB 4P2OB 4EZMA 5I19L 2BZDA 1LK2B 2GHWB 3OKMB 1FV1A 1CQYA 4POZC 1MCJA 1TJHL 1OAZL 5IT2H 3E3QC 2ZSWB 4Z7UB 4EDWL 4HGMA 5A43C 1T21B 3BD3A 1GH7A 2WZPD 1MCOH 5ERWA 4OZIB 4Z76B 3K2MC 3OJ2C 3QAZC 5C0CE 3L3DA 2P47B 1MI5D 2IQ9H 1J05B 4QNPE 5ALCL 3K8MA 4NQSB 4WUUD 4NNYB 3V52H 4OLVL 2AJUL 2O26U 3QUYB 3S7GA 4GW1A 3UTSB 2X10A 1EHLH 3MUY1 3VFSA 3NIFF 5EO9B 5ILTL 4L1HA 2BRQA 5C0GA 3BAEL 3BJ91 4AH2A 5C0FA 2BVUA 2XN9E 5FIEA 4IHOB 2NXZB 4JM2D 1ZE3C 2B4CC 4X6DA 5EO0B 2D7QA 1RIUH 2APWA 5BRZB 2Z93B 3B9VA 5DVNA 3KWWB 3QIBA 4GUPB 4WW1A 3H9YA 4MJIB 4WUKL 1MEXH 4NQED 4TSCH 2ITDA 4YHYB 1M05A 5E9DB 2IAMC 5FA4B 4JO4L 2GK2A 4ZTOH 1GZPA 2CK0L 3GRWA 4CNIA 4C83B 4GS7C 1A5FL 4PJXE 2VDQL 4NBYB 3BKJH 1PZ5A 3DX6A 3TPUA 3P40A 2APTA 4OLUH 4PD4K 5ADOL 4QHNA 4KZEH 4CGTA 3U79A 5B3JE 3GBMH 4LBEA 3OJMB 3V6BR 5IHUH 1XF3A 3OMZA 4HK3J 1U6AH 4XXCC 3AFLA 1IAKA 1DEEB 5DS8A 4Z5RA 1U8IA 4OCXH 4S0TD 3ZT6A 4UIMB 3GIVA 2XTJE 4Y4FD 3WCYA 4CKVX 1X5AA 3RWHB 4PJ9D 4RGNC 1JCKA 3O6LH 1VADA 1C7TA 4LLMB 2XA8H 4NQCE 3I84A 4S1QL 5E70A 4K3DH 3MRLB 4M62L 4JZNB 2AGJH 3LEXB 1KCSH 5DJ6A 4WU5A 5IHZA 1FVCB 5F96L 1OP3K 5DO2C 4G8IB 4APQB 2QHRL 1WZKA 3P4MB 4U6VL 5GZNC 1AKJA 2E8YA 5DJAA 1NEZB 1F90H 2YMXH 4Y4KC 1CF8L 2RFXB 32C2B 3NACL 5E95B 2OP4H 4NN5B 4XPHH 3BH8B 4ZFZB 3IJYA 2NY1C 4FOMA 4CRPA 3RY6A 1KN4L 4Q6IA 3LH2L 1MI5B 1XIWD 1FZMB 5SX4H 2WIMA 3WN5A 5I1AB 4Y5XB 4HGWA 1SEQH 2HTLD 4MD4B 5E4EC 2VOTA 3SE8H 4Y7MA 3DO7A 3WS3B 1UEMA 2FGWL 4KWUA 5FYJH 1JI2A 3R1GH 1LK3L 3UJIH 4LPCA 3QRFM 1HHJB 4J3SA 1T5WB 1VHPA 2GSGA 4NM8H 4POUB 1I1YA 4MXQD 4LNRB 3KLHC 1DQQA 4X98A 4Z78A 4KI5E 1ZHLB 3FMGL 3SDXF 3DMMD 2OLDA 2R2EA 5CSZB 2ZCKL 2IADA 1KC5H 3TT3H 2KUTA 3WNPA 2IMNA 1YEFH 2VWEC 5GJTH 3G5YB 3ESVF 4KRPC 5FGSA 4L8BB 2DQDH 2DQGL 4HS3A 3H7LA 3OKEA 2DLEA 4UQ3B 2VLKE 5KSBF 4MXWH 1U91B 2QR0B 4AMKL 3OJDA 3X3GL 2F19L 2EDQA 3MRIA 4FXKA 2A38A 2D4FA 2WWKT 1KBGL 1VFBA 4HX1B 1A14H 3BXNA 5FGBC 4G9DA 4KI1A 4XBPB 1N4XH 2OL3L 1MAMH 5IQ9B 2CDGB 3KLAB 5F7EL 4JFZL 4S10A 4M61B 4RZCB 5CBEB 1JTOA 2Y23A 5C0IB 3N1MC 3HNSL 3RNQA 4KY1L 4YHNA 1RMFH 4H26B 3SDDA 1BQHG 1G6RA 1EFXD 1MLCA 3VXME 5K9KB 1JGEB 3L5XH 4LSUL 3MV9B 2MNUA 4WTZG 1M7DA 4QY8B 5IESL 1ADQA 5D70H 1A6VL 1Y18B 4ZSOB 5EC1A 1FJ1B 4WHDA 1T7YA 4B7LA 3L3HB 3LIZH 1TETH 2YPKB 2EDNA 1BD2E 2VLRD 3VW3L 1NAML 3WN5C 1S9WA 4YHPB 1NMAL 3BDYL 4NFCA 4TN9A 2VABB 2EDKA 2BDNL 2D3VA 4OI9A 3P77B 2R0WL 2VDRH 4ONOA 4X5LA 4I5BA 2VQ1A 1NGPL 5J13B 2FX8H 1D9KA 5JNYB 2ZSVA 1N5YH 3MJ9A 5B3NA 4PJAE 2ERJB 5L0QC 5CBAA 1A02N 5DJ2A 4PJ8B 1AHWA 4LDLB 5D93C 3LZFL 3EOAB 3SBWC 3OKOA 2XWTB 3QO1B 1HQRA 5HHOB 3EDEA 3MRGA 4W6XB 3M1BA 4X7CC 3DIFA 3M07A 1ORQB 2AJVL 3L9RA 5KOMC 4FQXA 1FNGA 1I8IA 2IANB 3ETBF 4OD2B 1DANU 3KPNB 1JK8B 1XR8A 3HI1B 1ZLUK 1RZJH 1F4XL 1YEEL 3REWB 4EI5D 3D18A 5I16A 2NY4B 1RVFH 4DFHA 3SDXA 3P0VL 1ED3A 1KB9K 1WZMA 4J6RH 4RA3A 4YFLF 3TA3B 2FEDC 4U1KA 2YWZA 3W11C 3CC5B 3MV01 2YS4A 1FNHA 4H0HB 5EORH 3ULUH 1NC2B 1QBLL 1FFQA 5E5UB 2CSPA 1A3RH 5MP6H 4JFYA 3QNYA 2BJMH 5GS2D 4C4KT 3VRJA 5KSBA 4HWEH 4NOBA 4R7NA 4WFGD 1Q0XH 1G7PA 3SKNA 5EU7C 1K9TA 3IDNB 2R4SH 5D7LA 4Y2DA 5IB2A 2OMBA 1GOHA 3JTSA 3VGBA 2IC2A 1RZ7L 4AM0A 4UOJA 4UINH 4DN3H 3FO0H 1R5WB 5GS0H 3C8KA 2ED8A 2ILLA 3BWAB 3T65B 3EOBA 1TCRA 3LDBC 1UFUA 4NSKA 4OLWH 2AV7A 4MNHB 1U58A 1AP2B 1IGMH 3B43A 1EFXB 1ORSA 1Q9LB 2DAVA 3RGVA 5E94B 1V7MH 3KJ6H 5C86A 4PREB 3HHRB 4WDIB 2A0LC 3JWOL 3BE1L 3WIIH 4U4BA 1E6JL 1W72L 2YD2A 4N0FA 3P73B 3HRZB 1GC1H 3CSGA 1T4KA 5E00A 4NUJA 5F72S 4YXLH 4BFGA 1ZK9A 1KENL 4UIKH 5MHSE 4HIEA 1HSAB 4H8WL 4XPTL 4JAMA 4YEEA 4LQFH 1U8HB 4G8EB 2BNUB 2FB4L 1INEL 1KPUA 2HVKB 1I1RA 1UYWH 2WWMC 3UPRA 1XT5A 3ULUC 4ZUTA 3GI8L 4OFDA 4XPBL 3RAJL 1XR9A 3MGOA 4Z7NF 3C5JB 5I6XB 1U3YA 1I8MA 1LE5A 5DO2D 4OTXH 5E8NA 2P8LA 2H3NB 4RBPK 3S37X 5D7SH 2BXYA 1MFCL 2C4FT 5GZND 3HKFA 2RCSH 4NC0B 2F54A 4Y4KD 4U1GC 4KKAD 4X6CE 4CMMA 1LQSR 5DUPL 3S98A 2FIKB 5D2NC 2BOBA 3CIQA 5FV1L 1J1OH 1BBDH 2PKDA 1O7VA 2EO9A 3H42L 4OJFL 3QAZB 1BIIB 2R4RH 3PWJA 4Y2DC 3TVMC 3MLTB 4I18A 3TLRA 5HYQA 4PRHE 3KXFB 5KZCB 5FDYA 3VXRA 3K7UA 3LMJL 1G1CA 3P4LA 3WHE0 1F11A 4E42B 5KOVC 4KKCD 5DJDB 1GC1C 4R4FL 5AWNH 1MCQA 5JDJA 5EOTB 2Z91A 1Z0NA 3V5KB 5I8EB 4XTRD 3O9WA 4UNUA 2HN7A 2IAMB 2VXSH 1MLBA 1U3HA 3TN0C 4OFYD 4KUZH 4HC1H 5CUSH 1OL0A 3C2AH 2A73B 4P46A 4L3CA 1MAJA 2C1OB 3ZKSD 2VDLH 1RPQA 2DQFB 4D94A 2V5TA 5J11C 2EKSB 1G7MA 5LCVH 2CJUH 4Z9KB 3UTQB 1RIVL 4XP4H 3T4AB 4R3SA 1T2QH 1UVQB 1QO3A 4DVBB 4U31A 4GRWH 5SX5K 2FX9L 5BCAA 1JFQL 1MIEH 2B7DT 4U1LA 1U42A 2IQAA 4GQPH 4RGNB 5ANMB 3QDME 2A2QT 1U8JB 2V7HA 5DC9B 1BQHA 1A0QL 3GKZA 3VRIA 5GGSB 1X4YA 1FV1B 1LO0H 1WSST 4FZEH 4OCRL 2ZUXA 3EYQC 1OAUH 4XZUB 2Y06L 4WTZA 4KPHH 5FYJD 5MEPA 1BPVA 5I1LB 3N1QC 1CFNA 1IM9D 4QWWD 5DDHA 4W70A 1JZ2A 4Y19D 1G0DA 3EOTL 4Y4HC 4U0QB 3QG6B 3H9SA 1WBYA 2FEEL 4HUXA 5LXGH 2H32A 3C2SA 2P8MB 4XP1H 3NA9H 1CXKA 4GMSL 4Y4KB 2DJUA 2DYPD 3ARVA 3W39A 4PRDA 2BSTA 1BF8A 1WGOA 4PBWD 1CLZL 3TH4T 3AM8A 1FNAA 2IALA 5EOCJ 5EOQH 2NY1B 3NH7L 4G6KH 2XKSA 1H0DB 1IT9H 2JB6A 1A6ZB 4PJHF 2IH1A 3RPIA 3VWKC 4MAYC 3QDGD 4P9HH 4WWKC 1CL7H 2X4UB 3RUGE 5E4EB 3O9WC 4BZYA 3S97C 1JNNH 1Q1JL 1X7QA 4GAJH 3LRHA 1QRKA 2BOCA 4NO5A 4D3CL 5HI5D 4NRYB 4Z0XB 2CK2A 2PO6A 4XVTH 5FUOL 1N8ZB 5CEYB 5I8OH 3DX6B 2WIIA 4ONHB 3CXHK 3I9GL 4OQTA 5D7KD 3O2VH 3HAEG 3CFCH 2FX7L 3SKMA 4LCIH 3I3BA 2CR3A 3FT3A 1P4IH 3G08A 2QSQA 1I3UA 3O3EA 2EH7L 4KRPB 1YJDH 1R3JA 5JUEH 3I2CH 2NY5L 2R23B 3WO4C 3EYOB 3EKCA 2MWCA 4KDWA 5T33H 5GRXG 4ZPVA 3QHFH 1VADB 4X7FC 1JHKL 2BNRD 3IDJB 3GSNH 3QPXL 4WEMB 3JZ7A 1KFAL 1H3TA 5E99H 1MRCL 1JF5A 3HCVA 1FL6A 1HZHH 4K23H 3QWQB 2NNAB 4M8VA 3CZFB 1UH4A 1RIHL 4WU5B 3MMEA 3BVNB 1MCPL 1BVKA 1U2CA 3OHXA 3I6LE 4AZ8A 1HXMA 3T1FA 2AW2A 4LCCC 1UM6H 5HD8D 1A6UH 1CD9B 3JWNC 4K71C 1LP9B 4P9HC 2BSSA 1CGVA 4UNTA 4Y0GA 4HPYL 4LAQL 4PJBF 1DBMH 3UZEA 4PGBA 3O2WH 5ICXB 5FUZL 3RI5K 2FBJH 3WIFB 4MJ6B 2VUYA 1QD0A 1KXTB 4I0PD 4NNXA 3WN5B 3H3PH 3VD3A 1ZVHA 3W5NA 3ULVE 4J3VA 5FDWB 3JV0A 4HEME 3DO7B 4G6AC 2DYPB 2NY3C 2B1AL 5DQ9B 4ZNEA 3AREC 5IQ7H 3TBWB 4C56E 4N5UA 4YHIB 3WKML 3CVHA 2PO6C 1TTUA 4WFHE 3CMOH 1AR2A 1G9ML 3RX5A 3U7AA 2GSGB 1RFDL 1WWWX 4DK6A 3DYOA 3GMOA 5CEZE 1ZT1B 1DQQB 1I1AC 1WBXB 1NAKH 1CTNA 3ZKND 5L0QB 5KVMC 5F1SA 2A6IA 1CD1A 5DJXB 5EZOH 4JO3H 5IFJA 5D93B 2QSTA 4LQ1A 1A6AA 3GSRA 4ZXBA 5SWZB 5MENB 1L0QA 3CH1A 4L29A 3O3BA 4RFEB 3L3JA 5GS0D 1VFOA 1A7NL 3ZYOA 2DLGA 4L3AA 3TJHC 1CTOA 3MRIB 1WIUA 4NHUB 3HLAA 4LCUA 2Q7YB 3TVMD 2BFVL 1KJ2A 1HI6B 3QPQC 2XFXA 4OF6A 4CN1A 5IEHB 3T3ME 4CN4A 3H0TA 1I7ZB 2AEQH 1SM3L 4JRYD 4GO6B 3RNQB 1DBAL 1PD6A 1FBIH 1ZT4B 5C08E 1F58H 2HVJB 2NW2B 3CX5K 2GY5A 2BNRB 1FGNL 5ITBL 1G6RB 2OCFD 3MLWL 2FGZA 4KTYA 3HMWH 4P2QD 2C3VA 1HHKA 1AGFB 4LCWD 1M7DB 2Y6SC 4LASH 4P23C 1A9BB 3CFDA 3FB8B 3D39E 2Q8BH 1JRHI 1IKFH 3TCLA 4JHAL 4I3SH 5GIRB 3LDBB 3TN0D 2W0PA 1OAZH 4R26L 4UDTA 1FYTA 1RV6X 2P24B 3PGDA 4HZLA 2YN5A 5E8EB 1EX0A 4ONGL 3PHOA 4W81A 4F3FA 5KS9E 2NQCA 5EBWB 2P5WE 2CLVA 3QHZH 4NQEA 1TLKA 3RKDD 4I5BB 4PRBA 4JJ5B 3MRPB 4ZQKA 1KEGH 3GSWB 5FV2A 2W60B 3TM6A 2FJFB 5KJRL 5H35A 2KL6A 5KG9B 1EFQA 5KW9L 2JK5A 5JOPE 5J6GB 4X7TA 2R69L 1AJ7H 3OKOB 1H5BA 5BOPA 3A6BH 1HQRB 3HI6L 4PGCB 2P49B 4ZXBC 2SEBB 3IJSB 5C1MB 3V6ZA 5BS0D 1FFNB 3M1BB 3PV6A 3L9RB 3V6OA 4HUVB 4PR5A 3MOQA 2HKHL 4ZFFA 1MHHA 5JR1L 3UO1L 1LO3L 4Y4FA 3SDXB 3SCMC 3P9LA 1MWAL 5J1SC 4PJ9A 6CGTA 4NQXA 2VDQH 4LSRL 1L6ZA 4U1GB 1IGCH 2VAAA 5D1XA 3W81A 3TIDA 3LEVL 4JFEB 1B6UA 5D2NB 2OTWB 4NWTH 4HIHA 5E5MB 1FN4A 1D6VH 5KSBB 4G8GB 4K8RL 1NUNB 3QJHA 4BZ1H 1ZXQA 5D7LB 4Y2DB 5I1CH 4L5FL 5IB2B 3KPMB 3TVMB 4YWGH 4MAYD 4MJ4A 4WWKD 1T1WB 1OAKH 5JW4N 1N7ML 4PTUB 1FPTH 4KHTL 1HILB 5CMAA 3QEQE 1IGFL 2VNCA 1LEKA 3VMOA 1NFDB 3SKOA 5FECA 1T03L 1EGJA 3C8KB 3PQYD 5DMYA 3VFPA 4NPYA 5F97E 1UM5H 3MRFB 2Z9TA 4Q74A 4OQ1A 5T5FH 2CDEB 3X11A 3MCLH 4E41B 4ODUA 5HDQL 4NGHL 4RDQG 3DX8B 3MXVL 4XMPH 4B50A 4LSDA 5D71L 1TJIH 2DBLL 2VZUA 3HAEA 3UZVB 3F65A 5HY9B 5LWYL 1LO2H 3IDIA 5F96H 4LCWB 1XIWA 4H0GA 1MCFA 5F7FA 4NZDA 3WDHA 3F5WB 1A64A 2CRMA 1X4XA 1PX4A 5GRYA 3BEWA 3TN0B 4KJYA 1CF8H 3CXDL 3I50H 5E00B 4NUJB 3NACH 3PWVA 4D0BA 3IFOA 4O9HL 3DI2B 1I3GL 5FM8A 3KVQA 3D9AL 1D3CA 4X4ME 3FFCE 5J11B 4JAMB 4XB8A 2ZG2A 1Q0YL 4K7FA 1KCRH 4WW2F 1AD9B 4Y5YA 3HMXA 4XBEH 3LKRB 3UPRB 4N5ED 4P5KA 3V6OC 3ZL4H 4CU7A 4XCNB 1CICD 4HPOH 1T5XA 1X4ZA 3MLVH 3PP3H 4CVXB 2BC4A 4BK5A 3SE9H 4BZ2L 1KN2L 1XGYL 3FL7A 4R6UA 4P99A 3VI3E 1QFWI 4P59L 2OZ4A 1J9CT 2F54B 3CK0H 4MDIB 1CXLA 4CMMB 3Q5TA 5MEQA 3JSSA 4OB5L 1INQB 3O6KL 2HFTA 2ATKA 5BS0B 1GYAA 3QCTL 1GSMA 2G75A 4YQXH 2EDTA 5FHAL 4K2UL 5T3ZH 5CINL 3V95A 3CDYA 4Z7OE 3HZYA 2N56A 1MUJB 4QKXB 1RURH 1BWMA 1TJGH 4Y4HB 2B1HH 4EBQH 3FN9A 4B0MM 4HV8B 2J4WL 3KPSD 1VGKA 4UBDD 4AT6B 1GGCH 4NHCH 1J1XL 1DQLH 4M4RA 4AMKH 1F8TL 2A83A 2F19H 4HUWA 4OI8A 3F7VB 2MOVA 4XXDA 3FQRA 1GPOH 3NIGE 1HIMH 1PLGH 3GMPB 1P6AB 1MJUL 4NDMA 1K8IA 4LEXH 1T89A 1AIFA 3TT1H 3VWKB 4MAYB 3QUKB 4PJCA 4WWKB 1AE6L 1MF2L 4OD3H 3QCVH 4U1MA 2VAJA 3OZ9L 4LSTL 4HCRL 4UMGA 2X4PA 4AEHH 3RVVD 2HN7B 4J3UA 3VFNB 3MJGX 4X5WA 1HHGB 3RI5F 1BZ7A 5J7CC 4KQ3H 1HEZA 1OGTA 3S5LB 3MRMA 4M7ZC 5DEGA 1MVFA 4L3CB 2DWEB 4M5YH 3TNMB 3MOBL 3L5WA 3OKLA 3MA9H 4S2SA 2HTKC 3RTQC 5IKCB 3RVTD 4QF1B 3VW3H 3B6SA 3LRGA 4NNPL 3BDYH 3VFUA 5SWSD 5IMKA 3WEXB 2Q7NA 1FORH 5E2VH 2GITA 2JJSA 2YPLE 1D5MA 3WO4B 4UT9L 1WZ1H 4FQIH 3Q6GL 2UVEA 1BQHB 3BWUC 4KH2A 4EDXA 4FFZL 1JMXA 3VRIB 2LQRA 4ETQB 4U1JB 4WW2A 3KNBA 4RDQF 1NGPH 4XMLL 4MD0B 4EI5A 4MXVF 2NX5D 3U83A 5MEPB 3QIUD 4HFUL 5GSVA 5E6ZA 3X12A 3WS6A 5HPMB 4Y88A 5FYLH 1GGYA 5AD0A 4QHUA 1EVTC 2PXYC 3VE0B 2XQBL 4JRXD 4A6YH 4P23D 2V9RA 1NLBH 3O3AA 2OMNA 2UWEA 2EICA 1HOCA 5ETUB 3KHOA 1MJ8L 5EA0L 4LCCB 4H20L 5GSRB 4G9FA 4F7MA 4K71B 5CGYD 1KACB 2AJVH 2P5EE 1KIPA 2WBJA 5JHLH 4PRDB 2K3TA 2HLFD 2X42A 5J89A 1F4XH 3BMVA 2ZUVA 3FFDA 3EO9L 2HT4C 4NZUH 4OIBA 3HFMH 2OM5A 2JB6B 3SHSA 4GAYA 1T89C 2IH1B 3N1GC 3RPIB 5FFLA 1BQSA 1X9QA 5J12C 5DRZA 4WHTB 2O5ZH 2PW2A 3G6JA 1YNKL 2BCKA 2HH0H 1ZGLM 1X7QB 4NKOB 1FNSH 3IJHA 4UT7H 2NY3B 2ADFL 2O5YH 3AREB 2EE2A 3ARDC 4IIQA 3WE6A 1SEBB 3FB6A 3PGCB 2PO6B 3O8XA 4KZDH 1HH9A 1YMMB 1ZT7A 4EI6A 2DWDB 2R29L 5DXWA 1ACYL 2CRZA 3ARPA 1I7RB 1I1AB