5LBGA

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with faropenem-derived adduct at the active site cysteine-354
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
259
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
total genus 72
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lbgA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbgA01
3U1QA 4A52A 3U1PA 4A1JA 3ZG4A 5DC2A 3TURA 4GSUA 4GSQA 4K73A 5D7HA 5E1GA 3VYPA 3ZQDA 3VYOA 5DUJA 3VYNA 5DZPA 4A1KA 5LBGA 4JMXA 4A1IA 1Y7MA 4HUCA 5DVPA 4ZFQA 2HKLA 5DCCA 4QR7A 2MTZA 5K69A 5DU7A 4Z7AA 4QRBA 4GSRA 4JMNA 3ZGPA 1ZATA 4XVOA 5E1IA 3VAEA 4QRAA 5LB1A 4LZHA 5DZJA 4LPQA 5E51A 4HU2A 5E5LA 4QTFA 3TX4A
chains in the Genus database with same CATH superfamily
1KFGA 5EOCH 1BAFL 2VDKH 2XZAL 1CF8L 1BOGB 1MWOA 2AEPL 4UQIM 2YMOA 2NXZB 2KQNA 4F7TA 2XTJE 4IEFA 3NJXA 1CFTA 1TEGA 3QNFA 1FL6A 3QEGH 3L7EA 4MA7H 3FU3A 4U0QB 4BH7A 4C55A 2ODIA 2WLIB 4IYKA 4JRXA 1YQVL 2G4EA 3EYUL 5FOBA 1GOGA 3RX8A 3CMOL 3VXQB 5DT1L 3D2UB 3DX3A 1G5GA 4X7FC 3S88L 1XGQA 4UANA 1HSBB 2R69L 4I3SH 4PWEA 3MAWA 1A7NH 5E9AA 3ZTJH 2Q8BH 3D9AH 5EZJB 2E9BA 3OKDA 4UDTB 4P5TA 4YIQA 3NCYP 4ZD3H 4OM0H 3D3VD 3MRPA 4A7UA 3ZR6A 5D7JA 2PO6A 3ES6A 5EU6A 1QLRB 2WN3A 3MLXL 4K9EL 2GJJA 4I3RH 5F6IB 1ID5I 3D0LB 4QNPE 3VD4A 3RZCB 3ZE2F 5C0ND 4OUUA 1M7DB 5J6GB 2ARJQ 5LNGA 3OAYH 1KCSH 2WBWB 2ZCHL 2FIKB 3MLZL 3ZE1F 5G5DA 1E2ZA 1J1OL 5DWUL 3ZE0E 3MR9A 2A4EA 3BVDB 2WBJD 2NUPA 1I3GH 2Y4SA 2V7NB 3DTUB 3KXFA 4P9HH 3SIKA 4P3DB 1QVOA 2NY6D 4TUOA 5KVMC 4PGEB 4MS8C 2F7IA 3KWWB 2XJKA 5E6IA 4PHXA 5CN1A 3WNLA 3BIKA 2B5IC 4N2BA 1AHWC 3UL4A 2NXZC 4JL2A 4NRYB 1FGVL 4CBPA 3BAJA 4AI7A 4J8RB 4YGVA 4PLJD 2CK0L 4PP2B 4Q2ZA 5TF1L 3ZE2B 1TTCA 3DK0A 5AWNH 1FN4B 4HJGB 3QIUB 5I76A 3I6LD 2WWMD 1IBYA 1EFXA 1QI5A 1Y1UA 1LVEA 3U48A 2APBA 3LH2H 3UYPB 4LPWA 3SOBH 2WWNA 3CU1A 2AK1L 2VITB 5CJQH 2XZQL 1MFVA 4AG4L 5TK2A 1DQQB 4BCXA 4YS4A 1KXTB 1VGKB 4GG6F 1EHXA 3A6CL 1DN2A 4DZ8A 4QRFA 3O6LL 1NICA 1JN6B 1IKFH 4PJAA 4L8DA 3U9UB 4FI7A 4QT5B 2H0EA 1RULH 3AWEA 3GJEA 2CHWA 4P5MB 3UX9B 4UT6A 2VO8A 5D1ZD 8PAZA 4CU6A 1RZFL 3M17A 3SO3B 1B0GA 1NGXB 2JK5B 3CSFA 2IANB 4JM2A 2YEQA 3VWKC 4FJYA 3MCKB 2MOGA 4Z77B 2R4RL 1UWXH 3GBEA 3TVMD 1MREL 3GRGA 1ASQA 3HNVH 5ALBH 3QISA 4LCYA 1E2VA 3SCMB 4PJBB 3CMOH 4AVHA 4X80H 4X7TA 3L5HA 4U3CA 4U33A 4OF0A 1B0RA 3H6JA 3LRKA 4IBYA 5JTWA 3NIDE 2WKLA 4BXVA 2O5NA 1SM3H 2C9VA 5D72L 3KBFA 4Q9RH 1ET5A 5DD1L 1JZ5A 35C8H 4OF6A 4OCRL 4ABUA 1F4YL 1FVEB 2J12B 4FYQA 2WB7A 4DPBX 2OI9C 4NWUL 4XAKE 4GAYB 4YHOH 4JZOA 2A6KB 4Y9EA 3P9LB 4NIKB 3LPGA 3DBSA 3DV6A 1G9NC 1X5LA 1G0YR 3IRZA 4PJDA 1CD9B 1QBAA 2LHAA 5T3XH 2DH3A 3MV7E 1BZDA 1K8DB 3VGGA 1BQLH 3SCMD 1LHZA 4Z0XA 1UENA 2OSXA 1WZLA 1BEYH 3R1GL 1HINH 3SKMB 3GI8H 4L8BB 2DQJL 5IBLD 5KSAB 3AG2B 1R46A 2E8ZA 4NS0A 1O7DE 2CSPA 1AHWA 1VERA 2QL1A 2WIIB 1UCBL 1IIKA 1EHAA 4UQ3B 1HKLL 2XN9D 3QZLA 3RPBA 4WAFA 5DJ8B 4IU3B 3O9WD 4U6YB 5GZNC 2FZ3B 1A65A 4GUPA 4HZAA 1ZLSH 1KJVB 3FULA 5FO8B 3A6BL 3FAWA 3Q2WA 4PR5B 4APQC 4HWUA 1C5DB 5FIEA 4D9LL 3QIBB 5FUZH 4P2QB 4E41D 5EG6C 1MF2L 1RUKL 2R8SL 2AXFA 4UIKL 4X4YB 1NCCH 4J28A 1T3FB 1BJ1J 3NPZB 3WJLC 3MMEA 1XH3B 4L5FL 3OKLB 4LSQL 1ZT1A 3C5SB 3RQ3A 2VTFA 3FYEB 3LQAC 4L29B 4PVBA 2FO4B 2X4RB 3O2DH 4P04A 5JNYA 1TLMA 2K8QA 3T0VA 2ADGB 2YKLH 4GSUA 2VXTH 5IR1B 3IU3A 1ZLUH 3N9GL 2EABA 3NH7H 4WJ5A 1UVQB 3T4YB 1DQIA 1QLEL 4JFDB 2H7WA 4E9VA 3CFCL 4Z3HA 4G7YL 1EXUB 2P45B 3X12A 1UOLA 4TM9A 1MFEL 1XF4A 5EU6D 1XIWD 4O2FA 3ZQXA 1OP3K 4RNRA 1S9VB 4NKMB 4JRXD 4NQED 1OP9A 3TBTA 1I4FB 2H47C 2NZ1A 4ZUSB 1MCPL 2BSSB 3GPEA 3TBYA 5ABZA 5FM4A 3HPLA 2N7SA 2EKSB 1QSFD 4L3CA 1BCIA 5SWZB 1I8MB 1DFBL 2LABA 3JT2A 1Y6NR 3KXFD 3QIWC 4A6YL 4MJ4A 3SDDA 4BRVA 2NNAA 4R84A 5F9JB 1XWVA 3BDXA 3WIHA 2CBPA 4FLRA 4NNXB 2XVGA 1IKNC 3TBTB 2F8OA 3DJZA 3A3YB 3IMVA 4P99A 5JO5A 5B21A 2YOAA 4PB0H 4IHOB 4M6MH 5JR1L 1AZUA 3UG4A 4AJVA 1J1XL 1HQ4B 2DLFH 2OMTB 2ZONA 4J27A 5MP6L 1G7IA 1A14H 2WWMC 3RWGA 5IMMA 1JWMA 5AB0A 1YY8A 5DJCB 2C7UB 3QDGA 4AZ8A 1TTBA 1MCLA 1U8QB 2DMHA 3QUMH 2ISDA 3HS0B 3KBEA 2DM3A 5IR1A 3CN1A 5BOJA 1T5KA 3ESOA 4YHLH 2NXZD 4IBUA 1TG8A 5A7EA 3QZPA 2YZ1A 3DURA 4BZ1L 4L18A 3OKLA 3SBWA 4KZEH 3GJFA 1XDTT 2VZVA 3WFBL 1JDAA 1CD0A 1NAKH 5G4OA 2NDGA 2Y7QB 3QO0B 1KT2A 1AR1C 4QRPB 4PEEA 3GXPA 1W72H 3Q5TA 3FZUD 5GGVH 1ZAGA 5DJXB 3PF2A 4FLQA 4PJFF 3FQRA 5FUZL 1XMEB 1MPAL 1PD6A 4QEGA 3MOAH 3FQ1A 5CZVH 4ZFZB 1WAAE 4G7QB 4IU3A 4U6YA 1QSZA 1YNKL 4ZUVB 2MMXA 2UWEB 2QSTA 1LE5B 2QVFB 4V33A 1WAAA 3L4CA 1WUZA 3UTSB 2VXTL 2XQBL 1TF4A 3AFLA 4RGNC 3U0WH 2A9NL 3NIFB 3QEUA 4GSDL 5E8OB 5LBSA 4Z5RA 3GD1C 5DHVA 3BUQA 1ZTMA 1KN4H 3G6AB 3BUYB 4IS6A 4PU2A 3VSUA 3W3BA 3WS3A 2Y1ZA 5M94B 3F6IA 4JFEE 4WEEA 3HFML 1YUKB 1V10A 2ZXDA 4P23D 4W9LC 2CKNA 2ICEC 2V2WA 4H1LH 2H0JA 1RURH 3C6LC 5IB1A 1IVTA 1NBCA 2BP0A 1BXXA 1BSIA 1E9PB 1MH5B 4XN1A 3V5DA 3CHQA 3T8XA 1RCYA 3FONB 3HN3A 1CTOA 5IVXA 2J57A 4ELMA 1FNHA 1TPXC 3HRZB 2NUTB 1KNOA 4QCIA 5T3ZD 1N68A 1KLUB 4HGKC 4CVZA 4DGIH 2F8VA 4AY0A 2PW1A 1VEOA 2GYSA 1I1AD 3DHMA 2XWBB 4W9HC 2MH4A 2QEJA 1JPFA 2BC4B 4FABL 3WOVA 3U0PB 5A2LH 3MRCA 4DEWA 1IEBB 3GSWA 2W59A 4M3HA 5E8OA 4Z5RB 4WI9A 5DURD 1TDQA 4AYMC 4UT7L 1Q9OA 1IZJA 4ZTOL 4QRRD 4AJYV 3MC0A 4ZPVA 2ICWI 3ARBD 4AEEA 1WBZA 2OZ4A 2F19H 4IRSB 2H1PL 3L4ZA 3V4LA 5T33H 3VXTA 4X6EB 1OAXH 5DZNA 1XGTB 3WFBH 1NEZB 3KJ4C 2EVHA 4XP5H 5GZOA 2PPAA 3VJ6A 4OLVL 4MTMA 4A1IA 4GQQA 2ICES 4RBPK 3UEZA 3TBVB 2B08A 1IBDA 1EXGA 3B2UD 5ELIA 2LTQB 3NGBC 1FN4A 4HJGA 1JV5A 3EG9B 4AQ1B 1PW3A 4ZNEE 1FFOA 2NW3A 1WGVA 2D7TL 3KPRA 2F53E 4MQ7B 4MDJA 1G9MH 3V55A 4PCKA 4HF5L 1A14L 2HB0A 2J2ZA 3D85D 4FMKA 3EAKA 1YEFL 5ITBL 3MNMA 1P9MA 5J1TC 1DDHA 2F58H 3ILQC 3LXCA 4XP9H 2D3LA 1AANA 3DHPA 4HWNA 1W72B 3DJRA 4MYWB 3TL5A 3KMDA 2WTOA 5C0BA 5FGBC 1OF0A 3R4RA 3C8KA 2DQHL 1QSFA 1HAUA 1OAYL 2D3JA 1QVOB 3D69A 2FJSA 4M8RA 2NW2A 4GRMB 3NTCL 1D5BA 2ADJA 1UB6B 2P47B 4V1DE 5G5DB 3ZUCA 1R4XA 1XB6A 1I1CA 1EAPB 1L5GB 1M7DA 5J6GA 3BWAA 3JBG7 1XGUB 2J8UE 3IJEA 4KJWC 3WSQH 3EDDA 3V8CA 1N6QL 5A43C 1ZGLM 2A74A 3LQAL 3FMGL 1KIRB 3IT8D 3I6KB 1CDUA 2DQCL 4TOYL 4P4RA 2OL3A 3DYMA 4DVBB 4PY8I 1BV8A 4HH8A 1JFHA 1S8DB 1AE6L 1F3JA 3X1GA 4YHLL 4YNYB 2Y1AA 2KT6A 1W6LA 1CICB 5LQBL 4RDBA 5C07D 4DP7X 3N55A 5AVUB 3HI1A 3WTTA 5I1JH 4HFUH 2VW6A 5ISZA 3VD7A 2RQEA 1JPEA 1UYWH 4X9YA 3MXVL 3AABA 3ZKNC 3KPRE 1U3JA 4MB4A 3DO7A 5MI0C 1NEZG 1KGCD 2K8MA 5JIIA 1MEXH 3SKNB 3HNTH 4G11A 4PSPA 1WG3A 3OKMB 4LP8A 5EN2A 3P4MA 3STLB 4C58B 3QPQD 1HQRB 4AYBA 1BW8A 5TDNB 1UXWA 3EJRA 3WNIA 3X3GL 3WTXA 2FR4A 2VDKB 4I0PC 1PZ3A 5LJYH 4U7SA 1OB1B 5DHYB 3QWOA 2CIIA 1NMAL 3UBHA 5F93C 15C8H 5ACLA 2XG5B 2Q86B 3D87B 4MMXB 5CZXC 3IN2A 3P4NA 4UTAH 1JRHH 3GMRB 4XC1H 3ARFB 3DOSA 3KBPA 2XSKA 4G1MB 3L1FA 3C5JA 2WK2A 5CN2A 1E9QB 4M8UA 1G1CA 1CGSL 2VXQH 1T7WA 3DRQA 3S9DB 5KS9A 1QKZL 2YLHA 4I3RL 1YECH 3C6LD 3U6XS 3MACH 4CKQA 2H0PA 4WNSA 2IH3B 3TYFB 1DQDL 1OALA 1W6WA 4FJZA 4PRPA 5C08D 3Q7JA 2E6QA 2ZXEB 5FHBH 5E7FA 4HAKA 4L8SB 5CBAA 2XV0A 4PGCA 5I6XC 1UM5H 5C97A 3M45A 4KMLB 4HFUL 3RL2B 3GO1H 5D1QE 4ZQKA 3SKUD 1H6UA 4YHYC 3H8NA 4ODUB 1ETB1 1U58B 5E6SB 5AAWC 1FSKC 3N1FC 5DLLA 2WJ5A 5D7HA 3BP6A 5HJGA 3FPYA 1FFRA 4BRJA 3RGVC 1HYSD 4LSUL 4U1NB 3WLWC 4B50A 2HRGA 2Q3AA 4HV8B 4K9JA 3FHAA 4AMWA 4Z7OF 2CH8A 4GG6A 5CGTA 1CZ8L 2VL4A 4KJPD 5FM8A 2NW2B 4M9PA 4EN3C 2VISB 3NIDF 4OKDA 1PZ5A 3DPBB 3OGCA 5HHME 1IC0A 4F20A 1KXHA 4FFWC 4YFLF 5AWNL 5GQBA 1PSKL 2DMCA 3AWGA 4N6RB 4X7TB 2CZNA 3M07A 2P5WB 2L04A 1FZKB 3KJ6L 1PQZB 1UGKA 1V27A 2DQFB 2DWDA 2RHEA 3EOAA 3QRFM 2WANA 2CM5A 3O8XB 3VXUD 4CMHC 2FWSA 3VGBA 2DM4A 2IBZY 4YK4C 3WGUB 2CO1A 5ALCH 1WFUA 1SFHA 4D8OA 3LXAA 2FBJH 4JFXB 5IM7B 1D5MB 1LWRA 4I48B 4ZPTB 5I8EA 4F15B 4QHKJ 3B3BA 3UAFA 1A6WH 4LLUA 1QSEE 3CIQA 4GW4B 3H4HA 3PXHA 3CFTA 5FHBL 2Z8VC 4DZ8B 4FGMA 4FQXA 2YD4A 4JREC 4H0LC 4O58H 4JDVB 4M8VA 5JW5A 1RZGB 4Y1AD 4FXTA 5BVPL 2VITA 1T20A 4AENA 2NZ9D 4Y2OB 4KTDL 3EBIA 3O8XC 1J87A 2R7EA 2ZYSA 3K71B 5AD0B 5IMKA 4TNGA 1AQKH 1Z9OA 3GNMH 3GMNB 3UJTH 3WKPA 5ITFB 3ZKSD 3B9KA 3SBRA 4WJG3 5E23A 4AL8H 3FQWA 4AITA 2ALAA 1KNOB 4QCIB 1MCWW 2P52A 4EN3B 1WZAA 4WNQB 1CR9L 3BN9D 1KB5L 2AV7A 3FUKA 3THMH 2Q9OA 2VDQL 2DMBA 1DSFH 2YO3A 4L1SA 1KWGA 2CK2A 1ACYL 2I85A 1J8SA 2JTYA 2VN4A 2VR5A 3UTZB 3H85A 4KUCD 4NYLA 4UTBH 2H26A 1WIUA 3UBXI 2XICA 3BSHA 2ZOLA 3N50A 3O3AB 1RK0B 4PRHA 1A2YA 3GXIA 2AZAA 1UA3A 1G5AA 1IILE 4NFBA 3JTSB 1ACCA 3L3KB 3VFTB 2OTPA 1YMMB 3ARGC 5IB5A 1T0NA 2N3JA 1DLFL 3RVWC 4JRFA 4H25B 3AY4C 4P2RB 2B39A 4RWYL 5DMIH 1J0IA 9CGTA 4DH2A 5LXVA 3NPSB 3P9WB 3HZYB 4UT6H 1KXVA 3EYUH 3KCWA 4FXKA 1EBPA 2ARJA 3EFOA 4NX0A 1MKFA 3PE9A 4ZUVA 4Q14A 4OVUA 4XOEA 1XL6A 3B2VL 3AVEA 5C09E 3BKCL 5TGBB 5BV7B 2FNBA 4NQXA 3OLIA 4J3XA 1WPCA 2BJMH 1HIML 5I17A 1RHHB 2CO6B 5LVEA 5FKPA 3GRWH 3RTQB 1OGAB 4I0CC 1E4KC 4HGWB 3IEAA 4ORZC 5B7EA 1BHGA 1PJ9A 1KYFA 4MNHA 3LKSB 3PHQB 2XOTA 4HSAC 5F3HB 2CKBA 4M1GH 2QQNL 1AYOA 4MJ5B 3QORA 2CGZA 3O45A 4Y8DC 3NUKA 2BHUA 2GT9B 5HHQB 4PS3A 2C7UA 2YQ2A 1FL5B 5I1AB 4F7EA 5IB5B 4HIPA 4OJCA 4WFFD 4MNQE 3DTXB 5E9NA 3VXMD 1NBZA 3L3OA 3REWA 5DR5H 1S7XA 5EF0A 3HI5L 2GIXA 3KPSA 5GGTH 2FGZA 3WN5A 3CZLA 3UTZA 2J6EL 2EH7L 1SPDA 2XA8H 4IJ3C 1BAFH 3MRHB 3QHTC 2ATKA 2DLFL 2GCYA 2TRHA 3ETSA 4K8RH 4I3GA 4PGBB 4X5WB 3VXSB 5L4FA 2M83A 3BP5A 4TULH 1GZPB 5DGQA 4YVUA 5I15L 1JF1B 4NKDB 2NY1D 2ESVD 4K07A 4XOAA 1F4WH 1O5PA 3BMWA 3ISWA 5DRNA 4ZNCD 5J8OA 3FSZA 1U95A 1Q9WA 3AAZB 3C09C 3BP5B 3MBWB 2LLLA 4NKMA 4OI8A 4G59C 4NQUA 2XWZA 3OAWA 5ID0B 5K1JA 5JPMA 3EJCA 5K69A 3RUGB 2O5ZL 5I75C 2C1PA 3V4VA 5D71H 5KJ4A 4IGBA 2EDEA 3D2UD 4F37F 2A73A 2NY5H 3MRIB 5FYLE 4E68A 2GJ6D 4PRPE 5IQMA 1MY5A 4XO4A 3B3IA 3PWPE 3ZZ1A 4U3SA 4IGBB 1F1AA 1T21B 5I0DA 2C1OA 2CU9A 3I3BA 1A8JH 2H32A 3V0VA 1BYNA 5D1XB 3HG1B 3ZHKA 4K3GA 2Q10A 3D06A 4WDIB 1MFMA 2HVJB 3VFMA 1M56B 3FFCB 4KOBA 4F7EB 2Q8AL 5T1MA 3TT1H 5FS5A 1LO0L 7TAAA 3GHEL 4XCYB 3MMEB 4FQXD 1VPOH 1SLWA 4FEIA 4JR9L 5D6DC 3MTRA 4M3KB 4OCYH 4HUCA 3FUNA 4KO5A 4P2AA 3MV7B 3TN0B 2OSLA 2PXYD 4JFOA 1RK1B 4G80A 5BV7H 4HOWA 1FYTB 3B9KD 5BO1L 5AB1A 3O8XA 2X40A 3IMBA 3ATDA 3BYTA 1O0VA 4W9FC 4C4UA 4FHBD 2H1PH 4HIHB 4R3SA 4Y19B 2K78A 2X6UA 4MMYA 2HN7B 5IHUL 2C5DC 5AW1B 4FRWA 3RGBA 2F1EA 1PIFA 4QHUB 1MJUL 1CI3M 5I17B 1KB5A 1SXSA 1GYWA 5FWQA 1MLBB 1KLFB 1YG9A 2E9JA 3V9EA 4ZMYA 3VYNA 3PUUA 5C08E 2ZAIA 3TT3L 5AVWB 1I1FB 5KAQF 1FO0A 1MLCB 1QOKA 1CE6B 1WUNT 3L54A 3I3DA 1U3HB 2Z7YA 2ZXAA 3MKGA 2H6OA 4JZJA 5I1LA 4YHML 1P2CA 2W65A 5T5NF 4K5OA 4J3OG 1UGNA 4GSXA 3CE1A 5D6CB 4OF5A 1HEZA 5D7SH 1PLGL 2F58L 1FVCA 3INOA 5B1KA 2A77L 4K3EL 4B5ZA 3RWHB 4YAQA 4DETA 3IVKB 2LLGA 4G1EB 1SFDA 3D48R 4XX1E 5I82A 2CJUL 2D0FA 2BY3A 5J13B 2YUWA 2BCMA 4IRJA 4HZLA 1W15A 5E6ID 4O00A 4AQEB 1NAML 4FABH 4YZWA 5IJVA 2VERN 5DMJB 3FQUA 4P4KB 3UTSE 1TJGL 3WI9A 3NFPA 2GJZA 3GHEH 2RD0A 1IEAB 4QHMB 1HJCA 1AG0A 3QEHA 1NFAA 3G7TA 2D73A 1E9OB 3IMWA 4G8FB 4JFFA 3O4LD 5DD6B 5BRZE 4N22A 3MDJA 5E94A 4PJ7A 2J88H 4V1DD 4WTWA 1KGWA 3GI8L 3S35X 3L4VA 2B4CH 3ML8A 1OOAA 4FZ8H 4ZFFB 4XNBA 5ITFA 2VE6A 2QR0B 2C9XA 2EDNA 3NZHL 5D5ME 3WMQA 1D2PA 1PPIA 3FO1A 5F7DA 2CBTA 1X4ZA 2OP4L 3PWLA 4MAYC 1YNTB 4NPYB 3OHMB 2X9WA 3N91A 3TT1L 3ZSSA 2UUDH 2CDGA 3B9AA 1R3KA 4M93B 5I5IA 3VFGH 5HI5D 1AQDA 3FK3A 1P4BH 4NQDE 1S7SA 1J9TA 4P06A 1MEXL 5I15H 4G43B 5FUCE 1HOCA 3CVHB 1DEEB 4FQXB 2B1AL 1K4CA 1R3LA 1PD1A 2DWSA 5L2KA 2XKNA 3U4EB 2WHVA 4KK8D 4XMXA 5ENWA 1BFOB 1WICA 4KKAD 2F9BT 2PW2A 3QQXA 3DPDA 4KK5C 4WO4A 5BZXA 5ES4B 2R2BA 2WJ7A 4JFXA 4JANA 1IGFL 1FV1A 5GRVL 2IADA 1KIUA 5C7XH 1JVKA 2VAJA 3ULUE 4U05A 1DZBA 5IHUH 3RRQA 4DP8X 1EVTC 3FTXA 2OXGB 1JK8B 4M6OL 1A6ZB 5AZEH 1JV2B 3LQAH 3N0PB 4GIOA 4ZOBA 2MNJB 3WUWG 1BX2B 2NY1C 4AQOA 4PJIB 5E1AA 2APVA 2IV8A 4X6DF 5TTRA 4Y2OA 3C5ZC 5J0BA 3IF1A 1LK2B 3CFNA 3H9SE 3LKRB 4S2SA 5G55A 3VYOA 4YHPB 5I1IL 1NBYA 5F9OH 3OXSB 1FAKT 2UY6A 2DH2A 1H5BA 3L3JA 2OK0H 2XZZA 3VACA 3Q8CA 3BGMA 5D8JL 1Z5LB 1KC5L 3KPOA 4ONFH 1R5WB 1MG3C 1I3RB 4FQJL 3AREB 4DF9A 1TJHH 2MIZA 1A47A 2WKGA 2W9EH 2ED9A 3AU1A 4YIQB 2W5PA 4IIZA 4R90L 4J3OC 4XVUC 2FHBA 3ML9A 4WV1A 1IBZA 2VXSL 4EUPB 3GEWB 3EYVB 1F5WA 4AUJA 5I28A 3T65A 1G7JB 1X7SA 4QXUL 4ZUTB 4PJGF 4K7PY 1BVKB 1G9EA 3TBSB 4FQCH 4LDLB 4V1DB 1G0XA 2BSRA 3LRSB 1CLOH 5H37G 4R97C 2E3VA 3LKOB 4WHTB 4BFEA 2IH3A 1JGVH 3BMVA 3UTQA 2HRLA 1ZTXE 1IM9B 2LE9A 3MLWL 2FO8A 2AKRB 3BH8B 1NCTA 1TEFA 3CZFA 1JFQH 3P2TA 4L0PB 1GGCL 1BBJA 1ECYA 2DZEA 32C2B 4YDVB 1X9RA 5T3ZL 1WAAF 3J07A 3PGDB 1F02I 3K81A 3ZZLA 4GG8A 1IKOP 2HX9A 2DMKA 4K2UL 1TJGH 4HDIB 3VI3B 1N18A 1PZCA 4N25A 1LQBC 1AI1L 1S5IL 1ED3A 3OZKA 3QC6X 4K23H 4PVLA 1JPFB 1DBAL 3EUUA 2BY1A 4GMTH 1FH2A 5KJRL 3OKMA 4LFHD 1AZCA 5C2BH 4X8JB 3V0AC 3P3TA 2ZCHH 5IJKA 3CFEA 4FFYA 1E2WA 4ZT1A 3ME0A 1M3IA 4NUQA 2ZNXA 1A4AA 3HHRB 4MCZA 1URIA 4G6AC 4K4KA 3DRQB 4MA1B 4ZQTA 4PJGB 3V0WL 2AABH 3CTTA 3QHFH 3CFEB 3IJYB 4L4JA 2MCG1 1CGSH 3B2XA 3N85L 1K4CB 3J7HA 3KLQA 4WK0B 2R0WL 4WGKA 3HPJA 5FUOL 4ZD3L 5F1SA 4IBZA 4NQSA 2GK0A 4GY4A 2WZ0A 3MRJB 1QI3A 4TNWF 1UADC 1CL7L 3BKMH 3MNDA 1KOAA 1VDGA 5EZOH 1KUMA 1SXBA 4JFPB 5KSUA 3SYQA 1MIML 2OMYA 3H9HA 4S1QL 4RSYA 4N5UA 2N1TE 5MEPA 5J57B 2AK4D 4B95C 4WFGE 2EDDA 4U1LA 1GKEA 5HPOA 4LCCB 2JKNA 4WLCA 3SCMC 3N06B 3O2VL 1UKSA 3MYJA 5K9OA 3MJ9A 1TKWB 4MB1A 4HFWB 4L1LA 3WFDL 5SWSD 4JM4H 4I9WD 4ZMOA 1MNUL 5ANMB 5C7ZA 2P9RA 1QFHA 3CFDB 1QSFB 5E51A 4FG6D 4WI0A 5IW3A 4L37B 3HI1B 1IV8A 3MBXH 2WVUA 3UFIA 2EYRB 1NFDF 2OR7A 1JGVL 5D7JC 5DFVC 1TXKA 1UHVA 1RJYA 4JFSA 2DMGA 4MDJB 4YR6A 1R5IA 4WVRA 1N10A 1UD6A 1AD9A 3LH9A 2FX7L 3S4SA 3I6KA 5EF3A 3MRLB 3N40P 2QJDA 2O6CA 1MHHB 2M2DA 4XPBH 2ETWA 1Q0XL 1ZHLA 3VG9B 1G4RA 1FVCB 1YEGH 1AGEB 3MBED 3WE1A 1ZSDA 2GEEA 1XEUA 4JKPL 1FNSH 5L9DH 1E3ZA 1EHKB 2EXWD 5H35A 4P2RD 1ND0A 4XCFL 5B8CC 5IMMB 3B9KC 5TE7H 2CK0H 2XHNA 3R19A 4ZFOL 1P4UA 5L8LB 3L08A 3CVCA 4HUWA 5F9OL 1MZYA 3STZB 5B3NA 3UJIH 3GPSA 1RIUH 1GC1C 3QQ4A 2QT6A 1HEHC 1U3ZA 3QUZB 1U30A 3WD5L 4BQCA 4EF3A 5CF3A 1FUNA 2J3SA 2IWEA 4JM2F 4H40A 3ZGIA 3HNVL 3ZT5A 2NTFA 4R7XA 3TWCH 3BXNB 1H0DB 2CHNA 5J06A 5HYJE 4KFMA 5EO1A 3QRLA 2D0HA 5IK3A 5J56B 4P46D 4JQXC 1TUPA 4JDEA 5KVFE 4XMTA 5C0AD 5KSVB 3KDPB 4DTGH 1F90L 4H20H 2PPEA 3FSVA 1N8ZB 1UZ8A 1V3LA 2K6ZA 2F8IA 3RUGE 2X4SB 1I8LA 4L3AA 5C0GA 1EGJL 5L88H 3BCFA 3UGXA 1RVFH 5IBUB 5E24E 3VXME 2X4QA 2HFTA 3DVNA 3EDKA 4QRBA 1U8HB 4ZMVA 1ZS8B 1WCQA 2C1OB 1MVUA 3CFMA 3QUYC 5ETUA 2VLKE 2ADFH 3HC2A 1ZT4A 3SQOH 4PLKD 2Q7YB 2A73B 3QE5A 3MJ7B 4HH9B 4HXBH 3WJJC 4OGXH 2QDWA 4LVOC 1YNTF 4EI5C 1NMBL 4HCFA 4HS3A 3HCVB 4H8UA 2F1BA 4U6XA 3D0VA 4PJ8A 5GIRA 1UD8A 3O2VH 3ZDXF 4HCRH 2IIJA 2CGYA 2PWDA 3MA9L 1JHKH 3VU2A 3VDCA 2ZX7A 3O6FB 5GZOC 2WUCH 3RWDA 4I18B 3OLDA 4XZUA 3E9UA 1GZPA 5K1VA 4NUGL 4LVHC 1JZIA 5LGJA 1P4LB 2ATAA 1TQUA 4AV5A 3VQMA 2HRPL 5IJCC 3QIWA 3PS6A 2FB4L 2IV9A 1CTMA 1T2QH 5ABAA 5IFJA 1Q9KB 4Y4FD 3TZVD 4DNLA 3OZ9H 2W9DH 3UYRH 3WNMA 5FWRA 4JFZL 1D7CA 2P44B 4LEBA 2AGJL 2AJYL 5JHAA 1OAYH 1R3HB 1HHJA 3A0OA 3QZWG 4OLUL 4JLRA 3A21A 4FQIH 4K94C 1RIHH 3O45B 5EEXA 3KCPA 2E7MA 3CFKB 4YZFE 4JFED 3FHEA 3IJ8A 5K9JL 5DQJB 3O3BA 4HU2A 3MBXL 3QIUD 2FGWH 2ZP9A 1YY8B 4AGOA 1DJGA 5HJBA 2GUOA 3G5ZB 4MAUL 4O02A 1WE5A 3UBGA 4AYDC 3GTTA 1AGFA 2CRYA 1INDL 4ZBJA 3UADA 5DQDH 4BA0A 2YGNA 3QQ3B 4Y1SA 2G2PA 3ZTDC 3CU7A 1CYWA 4UF7C 1PLBA 4R7LA 2PO6C 2ZKMX 2KKQA 1KT2B 1NC4B 1A7OL 4M48H 4NO0B 2V2TA 4M29A 4LSVH 4HK0B 1ACXA 2G2RB 5KVFL 2JJTC 3ZDXE 4LGSB 4LPTA 4YEFA 2V37A 1NOLA 2BSSA 1M6OB 1YJDL 2EACA 5DVKA 1E4JA 3C75A 1ZVNA 1BMWA 1M2VA 4OCYL 1YEEH 2GAZA 1I1AC 1KGUA 3GJEB 1ZIBA 4PS8A 1FZJB 3A24A 4UV7L 4XXWC 2DQDH 4LCCC 4O2FB 2ICEB 3D39E 3L3KA 3II2A 1I8IA 3VFTA 3VD2A 2ITCB 4UT9L 5E00B 2HTKC 5DYOB 4MX7A 2VLJD 1FVDA 1S5HB 2HX8A 3B3IB 3IDMB 1H3PL 4TVPE 3DUUA 3RWCA 4YSRA 1LYQA 2YD1A 3L5JA 1VB9A 4E9YA 2H26B 4HJJL 5I71C 2L7JA 4NNXA 3GIVA 4UTAL 2F53B 3QFDA 3D51A 4IKJA 4U1SB 1YC7A 4JDEB 4WWKB 1E5YA 2VDPB 1ZT1B 3LPFA 4NUGH 3ULUH 1RU9H 2BSBA 4KTYA 1EZUA 5HTSA 3WE6B 1MHEA 2AV7B 4L05A 1BEXA 2WINB 4HPOL 3F6JA 5JXEA 5ADPH 3APMA 2J4WL 5BZZA 1FO0H 2R0LH 3CXFA 4XMKL 3EYSL 2W0FA 3F5WA 5D96C 1C5DA 2EVGA 1TYJA 3X13A 3BC9A 2VUOA 1B0IA 4N2MA 4BJLA 2X4OA 3LRLA 4IKIA 2CGRL 4KI1A 3GMLB 2P5EE 4X5PA 3QS2A 5HYEA 1UH2A 5CM1A 4F5CE 3V4VH 3SYCA 1T1ZA 3IDNB 3US1A 2WC7A 2WUBH 1AMXA 3U0TA 2R0KH 4JDVA 1WT5C 2GG1A 2Y07H 4TTDC 4YK4B 3HE6B 5DRZB 3SGDH 4APQB 5JNYB 4HUVA 4WTZG 2DQEH 2DPKA 3MO1A 5C0EB 4F9PC 3C5SA 1QLRA 5EFIA 3BFQG 3MCLH 5B8CA 3NABL 3BDYH 3E6FA 3VGFA 2XWRA 4QJ5B 5EDXA 5FKAA 2BRRH 4QTFA 3W0WD 4JQVC 3AGWA 2D3VA 1BZ7A 1SY6H 1XH1A 5DA0B 4PYHA 5CEXA 2QADD 1A7OH 1HSBA 4U6TA 4UCFA 3ZX1A 5A2CA 3MLRH 4GUPB 2Z8SA 5HBBA 4KKQA 2P5WA 2JJTA 4ODXA 3RWEB 2F68X 3OR6A 1PFOA 2NQ3A 4KRPC 5HYFA 2XTJB 4NM8H 4PPTA 2VDML 3GFUA 1AO7B 1IVLA 2PP7A 1RLWA 3O11A 4K7PX 4L23A 1SUHA 1WFMA 3KS0J 3FO0L 4BH7B 5DTFB 4KAQL 4YE4L 5GS1A 1J1XH 1YEJL 3KPPB 3A22A 4YSDA 3VXOB 2DIBA 2J44A 2OTWB 2MNUA 4W4OC 5DUPL 5KUMA 3QCUL 3MUUA 2OLDA 3HZKB 5FOJA 3H42L 2HT3C 2BOLA 1MW0A 5H94A 1K8DA 4GMTL 3BW9B 5I75B 1IGFH 3JZYA 4CC4A 4XPTL 5DC4B 3P9LA 4MD4B 1T83C 4FXGC 4XP5L 1RK7A 4EQ3A 3P11H 2V3DA 1MFDL 2BP5M 3L3HB 4U49A 4B6ZA 5FB8B 2GTZB 1DQQA 4MQXD 3SJVE 1OPGL 3H9YA 1NCOA 2V5YA 3ME0B 2IAMA 2PPFA 4RIRA 4U6HA 5HYJA 2X4UB 5IBTL 3CQFA 4NI3A 4RRPG 1PLAA 3PJSB 4ZX5A 1Q1JH 4XE0A 5L2JA 3VWJB 1A9VA 1DSFL 2BOBA 4BXSV 4B9CA 5I1IH 2LLNA 5DJYA 4OR1A 4ZX6A 1S9YA 3FQXA 3T2NH 3FSOA 5FYKL 5E6IB 2DWYA 1LJMA 4Q0XL 3A4FA 2VDNL 3HG1D 3QQDA 4GG8B 3T77A 2ZAHA 1D5ZA 4F3FA 4MLIA 1NM9A 2WMPB 5KJ7E 1IKFL 3RX7A 1LK3H 4ACTA 4HKBB 4S1DD 1T89C 2APXA 4LE8A 4ZO9A 3MFFB 3BH8A 5FUOH 5I24A 5BS0B 2NTSP 2GHWB 3P2DA 4W9EC 2R2EA 3CN2A 3NJVA 1F11B 3VFUB 5D5MB 3B1UA 4ZYKA 3U2SA 1PY9A 3UTSD 1F11A 2FO1A 4RFNB 2OCCB 4IMLB 3O6FD 3A5VA 2CXKA 4JRLA 2VLLA 2J8UA 3OXRB 1DVFA 2E46A 1DVYA 4WFFE 3EYVA 2CIKA 4XAKD 2BMKB 3QK0A 3PWUB 4N86A 2X05A 3I9AA 5F8QC 3W37A 2Y1VA 1QQDB 2K0RA 3LNHA 2V8LA 3P3YA 4JHAL 2HMIC 4M1CC 2MNWA 2FQGA 5DU7A 3BGMB 2GBTA 1G0DA 4GS7B 4HKJB 3VMNA 2DWEB 4DP4X 1XGUA 4KK8C 3J27A 9PCYA 5I0VA 4OT1H 1A64A 5DSCA 2OJEA 3VWKB 4KKAC 3FF7A 1NGYA 1LE9A 1UB6A 1EO5A 2IWFA 3PNWB 1E27A 1IL1B 1IAIM 2FJGA 4P23B 4BGLA 2GBAA 3JUZA 1GMIA 5I1HL 5C0AB 2BWQA 3WLBB 4KKPA 3FSWA 1CF1A 5FO9B 4XNYL 5ICZB 2A9MH 2OKMA 1TNMA 3ZQWA 1UM6L 3ZQ9A 5HY9B 3CJJA 3NH7L 4LNRA 4DZBA 5C0CA 4FS0A 1FNEA 3JTTA 3BH9A 5L4JA 5F7EL 1JG9A 1FWXA 3ALXA 2FLRT 2B1HH 4UQAA 5EIIB 4MJHA 4HLEA 3CGTA 5KBNC 4Z8FL 4HIJB 2FK9A 2VLLB 3WTWA 2Q8AH 1EJOH 1ZIAA 3CSTA 4PJDF 3EG9A 1AG6A 3LOWA 5D1XC 4AQ1A 3ULUD 5TDOB 1AGDA 2QV4A 1FIGL 3JWNH 4JFQA 4TUUA 4NRZA 4OZHB 4X50A 4ZUWB 4UOZA 5HP5A 1AKPA 4X4ME 3DYOA 1U8JB 1QSEB 4R5TA 3HN8A 1S7SB 3MFFA 1EJFA 1U8NB 4QRSA 4L2LA 3VFPA 2P8LB 2FATH 3T4AB 2OP4H 4S1RH 3BUPA 2CUMA 2VXQL 5JORB 2F6AA 4NC0B 3UTTD 5I18H 2XT1B 2GC4C 5E1IA 3RPIA 5H37A 4EZLA 1SJXA 5GGRB 2VM9A 4DFHA 1GOFA 1HE8A 4IGBC 1KPVB 4Y5YC 4X6DB 3S5YA 4LHUA 4XPGH 1MW3A 5DJYB 5BV7C 5AVQB 3FRUA 1QUNA 3GHBL 3SY0B 5D96B 1JDCA 2VQ4A 1T4WA 2FX9L 1DANU 1MI5A 1VADA 3E6FB 4HEME 4KRMB 5DI8B 4ZS6C 3QUYD 3RU8H 4ZMQA 1QUPA 1N4XL 4G2AA 1CFVH 3PGCA 2ERJC 2BNRB 2V3FA 3P54A 3NFPB 4HBQA 4M3JA 3HG0A 5EO0A 2FWLB 1QFUL 5IMOA 3V0JA 4RAUB 3VFOB 2PETA 2XYCA 3S36L 5J13C 2DI7A 5HI4D 5FFLA 1CE1H 5AYTA 1SHSA 5CCJA 4PSRA 3RHWF 4WY7H 4JJHA 5IGXL 1MCOL 1JHKL 3ILQD 4LDOB 3WL9A 1YN7A 5AKVA 5LBGA 5E6ZA 2A4CA 4HPHA 4ICXA 1JPGA 2EZ0D 4Y1AB 1PYWA 3D08A 5FR3A 2XNAB 1XTMA 4B3VA 2C9AA 4IOFC 4PRBB 5TQ2L 2P28B 5IF0A 1T2QL 2WCSA 5F71A 3UMTA 2C9SA 4YBQD 1GHFH 3NSCA 3KR3H 3SGEH 5HVGB 4RZCB 5EPMA 1MRDL 1QWNA 1LO3H 2Z0BA 3SYAA 3QP3A 1IBFA 5CP3H 1HH6A 2DQGH 2IQAA 4PJHB 3BPOC 3RIAF 4CU7A 1HWGB 4D9QE 2R2HA 4GFTB 5F7UA 4H13C 3NCWA 3L95A 3UABA 4AOFA 5L2KD 4H7VA 4QTIH 4X9GA 4O58L 1DSWA 2LU3A 4PAZA 2HT4D 3IDJB 2BNQE 1NEPA 3KPRB 3MRBA 1S7TA 5SWSB 4XXDA 1NMBH 2YJLA 1MSPA 3WHE1 3PP3K 2WKOF 1KEML 1EEYA 5LBSH 2PWHA 3CVDA 3FF8A 5D93C 1W0WB 2XTJC 4HD5A 3GSQA 3IDGA 3EZ8A 1MHPH 1NFKA 4FFVC 3CWGA 4QUOA 2KLSA 4QXTB 1DBJL 2NSQA 1QSVA 2XZAH 4JHUA 4LGRB 2FH8A 2Y22A 4B7LA 1OF2B 3C5ZA 2VL5A 4ZODA 4P5TC 4WSGA 2XV3A 3UYOD 4QOKA 1QHPA 4HEMA 3OB0H 1CT8B 3LPWA 1AD0B 3CFBA 3VWKD 3VXSE 4PTTB 2DL9A 5IOKA 3K6NA 4FXLA 4FQ1L 2CBOA 4JFFE 2QSCL 1I8KB 4JPIB 2HMID 4HISA 3PV6A 3QB7C 4U1GC 3QUGA 4OLUH 1A7RH 5DMGC 5EBMA 4FDWA 1BWWA 2QVKA 3CSBA 3RGVB 3BAEL 3DI2B 5KBPA 3BEVB 4NENB 1ZDSA 3PHAA 5TE4L 2A0LC 3SE6A 1E8ZA 2WLJA 2HLAB 2YKKA 3APFA 5A2KH 2YSTA 2HXAA 3F7PC 4WHDA 4BE6A 3APDA 4JPQA 5C3LD 5KBLA 1IE4A 1QSFE 2VDRB 5H4YA 2VIRB 5AOKA 5JHDD 4FF9A 5F7AA 2HT2D 4FTVA 3QUMA 4U2ZA 3F2LA 4EIZC 2IC2A 4O02H 3OB0K 4JKNA 4L5FE 2ADGA 3K4DA 4N5EC 3GSOB 3QZWA 3WKQA 1M6UA 1ONQA 3HI6H 4GW5B 2K1MA 3RWDB 2OYKA 4JPWH 4FFYL 4YUEL 1QA9B 5CR8A 4D3CH 5HI3D 5EEZA 5CSZA 2YARA 4TSBH 2A83B 5EF1A 4XE5B 1FF5A 2XKSA 4PJIE 1RZFH 4Z3JA 5CSZB 3GZPA 4NZFA 1HILB 1ZGLB 3DC0A 1CBVL 2ZOKB 4XP4L 2W60B 2YXVA 3PPEA 3ELAT 3O6ML 3Q2CA 3QIBA 1AI1H 2Y23A 4QOKB 4WIQA 3SODB 4G9FB 3B2VH 2E9GA 4JO8A 1KJVA 3QJXA 1RZJL 3QVAA 4O02B 4P5KB 3QUXD 1T03H 5DJ8A 1I1AB 3KLSA 3NCYS 3W2DL 5E8PB 5J6SA 2LGNA 1DHKA 2NY0C 5LBSL 3BZ4B 1K8IA 1QW8A 2FL5A 3I9IA 2J8HA 5AW7B 2QADC 4IRJC 1DFXA 3U30C 1B2WH 1YEHH 1QG3A 4NB7A 4OQ1A 2XXGA 4LL9A 5AFAA 2VMDA 3FC8A 3PHOA 4LAQH 4JG0L 2Z31A 4IRZH 1HCYA 1S7TB 3N1PC 4MMZC 3ZMEA 4KC3B 1W9XA 3AT0A 1CL7I 1VCBC 4TOYH 4JPKL 1NOFA 3QORD 4IMKA 1TMQA 1UXSB 2Z4QA 3HBQA 4IBWA 3F65A 2CUAA 3UPAA 4C56E 3FBKA 3PXLA 3STZA 1YC8A 3GYRA 1TLKA 4S1SL 1FNGA 5EEWA 1GHFL 1JGIA 4ZS7H 4MMXC 2BM3A 2O6DA 3UZEC 3VFNA 4EXPX 1M05A 3CDZA 4ODHH 5DZOA 2VLRB 4HIXL 3WNOA 3D3VB 2VLJB 3L2MA 4RFNC 3V0EA 1YEKL 2Q7AA 1UXMA 1EZVX 5INDA 4JM4L 3V0GA 1QFWI 2AJXH 5F89B 3PV6B 3BKJH 5EIVA 4EZMA 4JW3A 2EICA 1CDBA 5C6WH 1Q9LA 5SWZA 3MCKA 3O4OC 2G2NA 3CNKA 1YEDA 3NCEB 1YEIH 1CT8A 3H9SA 3HNSL 1DQVA 5DK0A 2WYIA 4JZNB 5FX3A 4KKBD 2BVPA 4PRAB 3DX8A 1YN7B 3D3VE 3K1DA 4KKLC 3PYCA 3TJEH 1MVUB 2FEJA 2XQYG 4UZGA 4U1JA 3CAFA 4LP4A 4F7PB 4NHUA 4M43H 2EP6A 2MCPL 4RGNB 4UI2A 4G5AA 4DW2H 5CU5A 5BZDB 4ZUUA 3VI4A 3CD4A 5C0DB 2VSKB 2MHAA 2V0AA 4WEUD 2HFFB 1QLEH 1BMGA 3P1VA 4K71B 3ZXAC 4FFVD 4JG1L 5IMOB 4YC2C 5F7BA 3SBQA 4XNUH 5DD0H 3VG0H 2CMRH 2HKAA 4QJ4B 5KYXA 3ARED 2DTSA 4GPVA 2NXYB 2F5AL 3KXFE 1ID2A 1KJ2L 3ARPA 4J8RA 1H6TA 3C08H 4FTVD 2W94A 5MEOB 2QGDA 1H9DA 1XGPA 3WNJA 1TOXA 1L7IH 3O6KH 4JQIH 4DKTA 1AXSB 2EDBA 2VXUH 3EFFA 4JE4B 2YMTA 3V4UL 2BIIA 3G6DL 4B5EA 3WL9B 2PYEE 5DFTA 5DJ6B 5J3HD 3AG1B 3GXFA 1RJZA 2R0ZH 1A1OB 3VXPB 4ZW6A 3WS6A 3KPNB 3DO4A 4Q8BA 1TKWA 3TIDB 4OU3A 1FSKB 1B0WA 1OP4A 5FLUA 4Q4IA 2VDKL 3AT8A 2AQ1A 3DSFL 3ECQA 2B16A 1B3IA 1MZZA 4R5XA 1XGZA 5B1AB 3T3MF 2IDUA 3BISA 5D7KE 1W0YT 1HN1A 1YUHA 1AGDB 2H4EA 3RTLA 2YA2A 3EUDA 5IW6A 4JY4B 43CAA 5JZ7C 3DV6B 3SKOB 1FZMA 2VH5H 1DUZB 4KHXH 2ZCLL 4WWOA 3IWVA 1FGNL 3L1OL 1JCVA 4QKXB 2Y36H 1BD2D 2KZ1B 3UBXA 4XB7A 1IJ9A 1OAZH 1FNEB 4OBSA 5JOEA 4EXKA 4KNSA 4ADJA 3EHBB 4F58H 4HYTB 5CILL 4XN7A 3QRGL 2J8UF 3S34H 1NJ9B 3GI9L 3LAFA 1L6ZA 4JM0A 3QNZB 2I9LB 2RA1A 3Q1SH 2X3BA 3KHQA 3VFPB 2WN2A 4ZXBA 5DXWA 1CFNA 2VUYA 1JGEB 3SY0A 1QSEA 4XC3H 4P8QA 5D1XD 5C07E 3UTQB 3PV7A 3HN5A 3ULUC 2Q6WB 1H15A 2OMYB 1AS8A 2V7HB 4NFDA 3REVB 2ZUXA 1W8EA 5J9PB 3NT0A 4NCC2 2EQDA 1ZV9A 3GHBH 1FFTB 3OKOA 3ECBA 3MRFB 1D6VL 3LIZH 1PU0A 1G7JA 5IQ9A 3VSTA 4DJMA 1MVFA 2FJFB 3LHPH 3RBGA 3NAAH 3RWIA 3MQIA 1JFQL 1SN5A 1HL8A 2XVLA 5PAZA 1QFUH 2VQ1A 4ZMNA 5CEZL 3GTVA 4IK6A 4XB8A 1LP9B 3WMPA 3ZTEA 2CR3A 4KXBA 2XN9E 3OG4B 3O0LA 4L1DA 4NRZB 4OZHA 3WKML 1OHQA 4PP1C 1AY1H 3GXMA 3GDCA 4L0ZA 2VW4A 4FULA 2ITFA 3RVVD 4DKFH 4Y4HD 4ZTOH 4XP9L 4M7LH 3IF1B 4LLYB 1ED3B 4A7QA 4XVTH 5HVHB 3NA4A 3LRHA 4PM1A 1X9UA 5AB2A 4M62H 1PKQE 3NJJA 4J2QA 3VI3A 2WXHA 1IO4C 3MODH 5DJ2B 4ECNA 5F97E 3JV6B 1UFGA 4ISVB 3ZKND 5DMKB 5AB9A 4JDZA 3EGXA 2VN7A 3PNWA 2BXZA 4PD4K 1DVFB 4LLYA 4JG9A 1AIZA 3OXSA 3W1ZA 4WY7L 3LS4L 3S37H 1BQHA 1NDGB 4IHBA 5DSCB 3MREB 1FH5H 4QAWA 1IM9A 5GS2D 2XU9A 4FYSA 4CDHA 2Z31C 3LVEA 1N6VA 2ZUUA 3MLWH 1RJLA 1OAZL 1DZ0A 2P49B 2P5PA 2VDLB 1HOCB 1UD2A 3OVUB 4DIXA 1FFOB 2NW3B 2OXGA 2X2JA 1J86A 4HKBA 2B2XL 2DOCA 5GJSH 1HNGA 3RI5K 1IT9L 3LN4B 3O9WB 3DUHA 3RLSA 3FT4B 3T3MB 4XNQA 4CC0A 2VLRE 3BW9A 3NEEA 4Z7WB 2VE6B 5HDRA 5JIMA 3AREA 1DBMH 2VMEA 4R7NB 4M61A 2FIRT 1KIPA 3L3JB 4PD4J 5CJBA 1FHGA 4RFOH 1IARB 1THCA 2CLVB 3IGKA 5C92A 2A2QT 4P05A 4QHLA 3VU1A 5LWYH 5DD6A 4JVUA 5ISZD 2X4UA 4RISL 2V5MA 5CXPA 2ZKHL 3HS0C 5DZVA 2MRYA 2HG5A 4K15A 1UOKA 2WYZA 4GKZB 1NM4A 4DGIL 3LDBC 2I25N 2Y7NA 1VENA 3ABLB 4G6JL 4YHNA 3RKDC 1MN4A 5KVGH 3UZVA 4H8WC 1KG0B 1G1YA 1ICTA 3V4PB 4EI5D 5HXMA 4LVHB 4ODVL 4G1EA 2R2BB 1WAPA 4KAQH 4PRNA 4WKZB 4RGOH 3IGFA 2WBKA 3CLWA 3BT2H 2VH5L 5ENWB 3D85A 1L9NA 3P0GB 3PGFH 3KW7A 4R97B 3U6RA 2EIZA 3DMMA 1KULA 1TSHA 2DW5A 7CGTA 2OX5A 3NMEA 2A9AA 3TH4T 1NFDA 1WHOA 4XPAH 3CVHA 2E59A 3G9VA 4TQ8A 3BFWA 1OGTB 5GS1B 3DROA 1BVNP 1KXVC 4F33B 3NEOA 1W0VA 2WWOA 3IDNA 5HGAA 5CLYA 3VH8A 3LDBB 4QGYA 1OP5H 4ILDA 1IU1A 3SE9L 1UACH 2ICWB 3G6AA 1GSMA 3VI3F 1KENH 4NM8L 2WKOA 4MMYB 5BW7A 2CCWA 2H32H 1KCUH 1B3JA 2R1WB 1QBMH 2QGCA 4ZFFA 2WOBA 5F6IC 1K3IA 5H94B 1D5XB 3L3DA 1UWGL 3QUZD 4PUBL 5SX4I 2ROYA 1AXSA 2AANA 3ZOAA 4YFLI 1U3HA 3BH4A 1BM3L 1YQ2A 3C9NA 1IGTA 2KPNA 4OZGB 3ASOB 1T80A 4XO3A 3NSDA 2C3VA 3LMJH 3BQVA 3UTTB 5CIPA 3EH4B 4JFUA 4FNTA 2ADFL 5HJDA 3SQOL 3CCHB 3ZO9A 4RX4A 3GMOA 5DHEA 2J55A 5DJDB 5IW1B 3VFWA 2NY2D 3VXUB 3S8FB 4AEHL 3HR5A 5I1CH 2W1NA 2O5ZH 5BO1H 5IJVB 3ARFD 4PJ9C 1P7HL 2WD0A 1MCSA 1GH7A 1U8OA 4LSUH 4NKOB 4WK4B 4CSSA 1I7TB 4ZMLA 5I8OH 2XVKA 3N9GH 2YIHA 1NAMB 3QFJB 5BJTA 1P5VB 2YSSA 2ZWYA 5DJAA 4OFQA 3NP4A 4ZS6D 5AAPA 3FT0A 4X6FB 1U8QA 1P1ZB 5I74C 1RIVL 4Y4HB 1XT5A 1ZJBA 2IFGA 2FYYB 5T1MB 3M6DA 2ZCZA 5JW3L 2E6PA 4NT6A 2IDFA 3C6SA 3E1F1 3ILDA 1J05B 5A2BA 1O75A 1CU4L 2IQ9H 2IOOA 1MFNA 1NL0L 3UO8B 3MRRB 3H2PA 1QHQA 4PJ5B 3HMWH 4A6YB 4U3HA 2Q20A 1ZHBA 3GHPA 4OLWL 3VRIB 2L7QA 4PJFB 2WO4A 1XF5A 2NDFA 2JLPA 1I8LC 2EKSA 1I8MA 2YC1A 3ZRCC 4NRXA 3K6OA 3HE7C 3UTOA 2XBTA 2VO5A 3X1BA 4JK0D 2C7FA 1ZKAA 1JZ7A 1W8NA 2FX7H 1KCWA 3ZT6A 2CKBB 2Z4TA 4KTDH 3T71A 4I77H 2YSSB 4MNHB 4ETQB 3GIVB 1EMTL 3HG1A 1FFPA 4OJDH 4H8HA 3G04B 4ODWA 4OTXL 4ES8A 5I30H 4NJAL 1CGXA 2RGSA 4M48L 5JLZB 5IFJB 6PCYA 1VKXA 1DANT 3IBEA 2EDJA 3AM8C 3G5VA 4UM9D 1UTDA 1I1AA 4PB0L 4XXWA 5FDYA 1RPUA 2I26N 1FL5A 4O2EB 1FZJA 2MPAH 4JQXA 3VFGL 1RUAH 1JDDA 1Q9WB 2IWGA 3AAZA 4O4YL 3F7VA 4OCSH 1XZWA 3S3BB 4WI7A 4Y2NA 3WHXB 4HOMA 2H1LM 4UV7H 4PRIE 1DJXA 2DEXX 2ZOKA 3O6FA 4DOHB 4PREB 3ZL4L 4EO5A 4NKDA 4G8IA 2O93L 1CYXA 1YYLH 3GZQA 4C54A 1EK3A 2P80D 1BVNT 2R1WA 2A83A 1P6AB 1U2YA 3BP4A 4QIRA 3SE9H 4CDGC 5DHVH 3VWJD 5FKPB 4Q58C 5KSBF 3GSOA 5F72S 3TBWA 5B1BB 1CFSB 3KLAA 1AHWB 2VLME 4B60A 1JXKA 3MV9D 3O3AA 2F1AA 5ANME 3G04A 4YDMA 5L88L 2NY4D 3T3ME 1Q9KA 4L8BA 3VDBA 5EUOA 3HBPA 2PR4L 4OIIH 4HGMA 5AVRB 3S3PA 2OZ4L 4MJ5A 4NGHL 4HHWA 4LVOB 4D8PA 1GY2A 2DQMA 5CCHE 1MCBA 1N64H 4HS8L 3HB3C 2BVYA 2C9QA 2YC1B 4NNPL 3KYAA 2A9NH 4MBOA 5JW4M 1A2YB 2OULB 4G6KH 1HJBC 1L0PA 1NIAA 2OW6A 3TIEA 1FYTE 4HG4K 1LGVA 1VEPA 2D7NA 2DYSB 5E5MB 4U6XB 3BXNA 4PJ7E 3K71A 4JFEA 3ZKMD 3LKNB 5KOMC 2DV6A 2XIDA 1DVQA 4MAUH 1ROWA 3CX5K 4BKLA 1T20B 3GXNA 3T6QC 2P7TB 4AZUA 3MJ8A 3NN8B 4XXCA 1MI5D 2HRPH 3MLZH 3SEPA 1FFNB 2E74C 1NWOA 1N26A 4Z3TA 3OAUL 2X4QB 2YWZA 4UTBL 3L81A 4A52A 1SLXA 2JI2A 3IPEA 1N70A 2Y69B 1XH0A 3ARQA 1IFHL 1Q38A 2ENJA 3VA6A 5EO9A 2WV3A 2Y36L 1PX8A 1R5VB 2P48B 5LAXB 2BWDA 1Z6JT 3QDJA 3A67L 1E4WL 3MUHL 4ZXBC 1MHHA 4ADIA 3G6JE 1JN6A 2WLHA 3DKHA 4HVBA 3BVXA 4PRHB 4JN2A 1U8OB 4WCYL 5DZ9A 4LEEA 2GTWA 1AD9B 4JY6B 4H4NA 3AB0C 1T04B 2DM2A 3H54A 1FZKA 1KSRA 2EIKB 1OM9A 5JOFB 1N0XL 3GSVB 3TVMA 4IJTA 3RUGF 3FPXA 4KDTC 1E3FA 4NZTH 4CSPA 1RFDH 3L95B 1U36A 4E5XB 3NEXA 4Z7VE 4QY8A 1JNHA 1NL0H 3QWNA 3TN0C 2NX5B 5L8KB 5IM7A 3RDTB 2J25A 3BEWB 3NRQA 4X80L 5F7NC 5FM5M 1T7YA 4G6KL 3RWFB 4EI6B 3AACA 4JN1L 4R7VA 4OZIB 3ETTA 2ADYA 1W2KT 3AWFA 1XV8A 2ZSVB 3F7LA 1F3DH 3UMNA 1ZSDB 4N8VG 1XGRB 1WFOA 2C9RA 1N6QH 5IMKB 5CEZD 4XNXL 1E5BA 2F54B 2QBWA 2R7EB 3G08B 3ILPA 4WF7A 5GRVK 4V2CB 3VNYA 1P7BA 1DE4B 1O9ZA 4ZQKB 3WKNA 1VZIA 2E75C 1T5WB 3ASWA 1YY9D 2DLEA 4XPHL 3ARBA 3I84A 1XXDC 1R5IB 1IC7L 3GK8H 4HUWB 1KMGA 3DPBA 1TZHB 4XMPL 4A2MA 5HHOA 3S48A 4G9FE 1ZLDA 2MCAA 5MENE 2ED8A 2V5TA 1A3QA 4GG6B 5LCVL 2Q2EB 1ZATA 1ZSHA 3GMMB 4DN4L 3OMIB 4KKNA 2YKLL 1CIUA 3DO3A 4UQBA 3BP6B 3PCYA 5KYYA 4XH2B 4IGBD 1I53A 2JKJA 5C86A 2Y1YA 5L9DL 1BECA 1NLDL 4F2MB 4L0YA 2CO7B 3B83A 3DOSB 3MOQA 4PMEA 5JXAH 3UEQA 3SO5A 4G8EA 2R4SL 5A2IH 2X1XR 4KKLD 3SDAA 2CHDA 3PIQA 4R0LB 1JHTB 3UJIL 2WLMA 3OJMB 2BFGA 3Q06A 2I32A 4BWWA 3FU0A 4JGMA 3GO1L 3FNKA 1A9EA 3GBMH 1CFTB 3NQKA 3S98A 3A6OA 5EMYA 5FFGA 3CC5A 3OAUH 1QR4A 4Y7OC 1J5HA 1EO8H 2NT1A 1UWYA 4B9YA 3NZ8A 1S7WB 1AGCB 2BZ7A 2XN2A 1FLRH 1QYGL 4B9PA 1ZWIA 4GBXC 1SJVA 4YDVA 3UBXG 5LN8A 3ZE1B 1Q0XH 1BVLB 1JVOA 1KPRB 5LGYA 2LV4A 2HVKA 5DS8B 2OMWB 5EU3A 3U9PH 2IH8A 1GSKA 1P7QA 2D4DA 1ADWA 1O6SB 1HXMB 1U8JA 3BPCA 3OTTA 2CIIB 4DQOH 3HIZA 3GK8L 4QXWA 5AG8A 4JFQB 4ZUWA 4HOXA 4ODVH 1DQLL 4XRCB 4GQ9H 2ZOUA 3VW3L 4K9EC 1HOEA 1M71B 1PKOA 1S8DA 1UXWB 4AMKL 5T1KD 4ELME 2ROXA 1HSAB 2NY4B 4PLOB 3QJOA 5ACMA 2FJHA 3AXLA 1PL3A 1O6SA 1FC1A 4FFZH 2ZKHH 1AHMA 2ZUVA 5IHLB 3MREA 4PRIB 1WFIA 4PLKC 1L5GA 3SPHA 5F7LB 3GMPB 1J8KA 3K0WA 1I7ZA 4XNYH 3NCCB 2FJGB 4G1MA 1XCQB 4PJDE 3MUY1 3SJVA 1MJUH 3KPNA 5CD5C 4ZMXA 2PYEB 4LKXA 43C9B 1JUFB 4YNYA 5CJOL 1V5JA 1Y1DA 1K72A 4NAQA 4DVBA 1E6OL 4MWFA 3ZYZA 2WZPD 1WZ1L 3ATEA 3HB3D 2YRLA 1NMCB 4DGVH 2R1YA 3I6GB 4LLWB 4X9IA 1U33A 2NYKA 4F8OA 2WZ5A 5D4IA 2WQWA 1JV2A 5IG7A 4DP2X 5I0WA 4NKIL 1K5NB 4Y5VA 1O9VA 2IOIA 1KC5H 1SNRA 3LIZA 3FCBA 1E4KA 4XNUL 5DD0L 3VG0L 1BJ8A 1EVUA 3QFGA 5H2BA 3ASNB 4B9GA 4F8LA 5CP3A 1Z9SA 3VI4F 1K6QH 1PCSA 1KDJA 5D7EA 1UACL 1IFRA 1F8TH 1GIGL 2GKIA 4AM0Q 4P9MH 4DTGL 5E4OA 3GMMA 1R5WA 3QIBD 3U4EA 4TVSa 5HGHB 3LKOA 5HHXL 1A6WL 3EGSB 4NN6B 1WEJL 4KJQC 2N0MA 3F85A 4BZYA 4H88H 4ONGH 5I8KH 4HC1H 4JY6A 1AQDB 4HP5A 5ECJE 4Y2DA 4Y4KA 1SGKA 4J39A 1KBPA 4NKQB 4Z7UE 1G4MA 3HC0A 4PJIA 5TFSL 5IEHA 3REVA 2QPEB 2UX7A 1WA0X 4NQCD 4W9KC 3DWTA 1J0HA 4FQHB 5D1XE 3BWAB 4KPHL 3EXJA 3MA7A 1FLTX 2HX7A 2FECI 2YLKA 4JG5A 1U3YA 5GRWA 3H9SD 5C6TH 4LSVL 1NCBH 4X4ZA 4GSDH 4IRSA 5CJOH 1MCNA 3LZLA 4X42A 3NJHA 4UB0H 3HRZA 4YDJA 3MGAA 3UC0H 3D69B 1P4BL 3LN5A 3ROOA 4WO4B 3AITA 3LKRA 4K7FA 5C0BB 3ZYOA 2ESVA 4MQSB 3OKNB 4FA7B 1D9KA 2XWXA 3DVIA 4G8FA 4JFHE 1CLOL 4L3FA 4PV8B 4TQHA 4NBZB 1C08B 4UQEA 5I1EH 2AAAA 3BPLC 3CVHH 3WFZA 1XIWB 3SKOA 3MLPA 2B4CL 2D0GA 2H8PA 3T2OA 1NCAH 4AXWB 5GRZA 2ZX6A 4BKTC 1AR1B 3RE0A 1OTTC 2WXNA 4K94H 3GXDA 4N26A 4KXZH 3IS0X 5DC2A 3IDXL 3ZBMA 3CHSA 1QEWA 4UOQA 1R5VA 2Q5BA 1BVLA 1KPRA 1XGTA 4PWKA 4F9PA 1KCUL 3LNFA 4UNUA 1NGZB 4CMMA 1TZIB 3DX9B 3S8WA 2WBJC 4EBQL 1MCFA 4ZPVB 3DDGA 3FUHA 2BHFA 3WIFB 1U8MB 3II3A 1JS4A 3EJTA 4GRLA 4ZMWA 3ULVC 4H8PA 1OP5K 4ZW3A 5CD3B 3LHPL 3TA3D 1L7TH 1OZUA 2KL6A 2VZSA 1LTXA 3BUYA 4IS6B 5FA3B 5KVEH 3BKYH 3GRWA 2F2HA 4G6FB 2CJSA 4UQDA 5FUCC 4Z7NF 4XWGH 5EUKA 1SEQH 1CD1B 1T66C 4ZZKA 4BWTA 1XZ0A 2WPGA 2O72A 2I9TA 1VCAA 4MVBC 4V2BA 4LRNH 1QRNA 1UURA 3FTGB 4DO6A 3PWJA 3IJSA 5J11C 1RH8A 4N2CA 3SDCB 3IGUA 3NK3A 4F2EA 2ENQA 5FYJH 3OAZH 4OGZA 3FU7B 4XCYA 3GB7A 5SV3A 1R0AL 3FONA 4R83A 1C5BH 2JKRM 2QQLL 2YD8A 4U7KA 3MO1B 5C0EA 3HG5A 1CE6A 2LAAA 4ONFL 2IBGA 4UAHA 4UT9H 2NCEA 1P9MC 2OA9A 5IESH 2AMGA 5EORL 3FN0L 4Z3EA 2DL2A 2FJUB 4W68A 2VQUA 3P02A 4KK9D 4F91B 3WMSA 3QXWA 3SDDB 2OMZA 2ZXCA 1HEZB 4ADGA 4Q74A 3B9EA 4JZJC 4R8WH 5D70L 4G6ML 3VXNA 5K1NA 4OD3H 4DPAX 1FO0B 3EXLA 1I4FA 4ZUSA 4OIAA 5TQ0H 3Q48A 1RIUL 4Y5YA 1JNHB 3CUPA 4KY1L 3WD5H 4GIAA 1FNGB 3ZW3A 1AXIB 4N0FA 1YPZB 5EOCJ 1VIWA 4W6WB 4M7ZB 4ZFGH 4KKCD 1OSEA 1H8LA 1P7KA 5CGYD 1DVUA 3OX8B 4FCAA 1GZQB 3O2DA 5E1HB 3L4UA 3W11C 3PJNA 1QNIA 4LNVA 5E99L 4AUUA 3HRPA 3GJFB 1TJMA 3OC5A 1FNAA 1OKEA 2ZG3A 3MRMA 4HLJA 1CDCA 1QD0A 3FQNB 3PNRB 4RESB 1J88A 3C6LA 5C71A 1I8IB 2YN5A 3GWJA 3JQOB 3MLVH 4Y9BA 2A1WL 3MGTA 2HTKD 1BFTA 3UGUA 4Q6IB 4DPRA 3LQMA 1WO2A 1CXFA 2EDRA 1T3FA 5BVJB 4QWWC 3X2QB 1G9NH 3C6LB 2YR3A 1PSKH 1VAHA 2X6BA 4V11A 1BLNB 4FFWD 4M62L 2VMFA 4XOCA 1EQWA 3CX2A 3CHPA 1EZVY 3DX1A 1P6WA 2CLRA 3VSVA 4G9FA 2IQAB 2DD8L 2V33A 4W6YB 4F92B 3VXUA 2RJMA 1N2RA 1YZZA 3ET9F 3IPBA 5EA0H 1QO3A 3CFCH 3D7PA 2LTQC 3NGBB 5EULV 5JZ7D 4A7VA 2Z91B 3HZMB 1DL7L 1H3VA 1SXNA 1QA9A 1X5ZA 2YXWA 4O5LH 3VUAA 1I82A 4IU2B 5HPMB 4PRDB 2WXPA 1ONQB 4WO4C 5FECB 1WT5A 4JFVA 4AVJA 2AJZB 4MSWB 2OMZB 4S0HA 3L4XA 1INQA 2ODHA 1CGYA 5IJDC 3KVPA 1YMMA 4I2XE 1CGTA 1TQCC 1SQ2N 4K7PL 4L1BA 3WN5B 2VIRA 3SBPA 2NNXA 3NA9L 4JFDA 5IROA 3N42F 4RZKA 4DERA 1Z1WA 1W0VB 1CFQB 4UZUA 2BNRE 4FXGB 4RFEA 3P11L 3N5AA 1N59B 3HR5B 5CN3A 4GKSA 3MV8A 1LMKA 4NN7C 3ZMRA 1CR9H 4OJYA 3VA2C 5F8RC 4Z0BH 1ODUA 4PJBA 2FGWL 4JREB 3QORB 4LPYA 3TEZA 1J12A 1ROCA 1IKNA 3QDMD 2HCZX 2XFGB 1ZE3H 4PJHF 3QIUC 4TLSA 3TJEL 1J8HD 25C8L 4WNQA 1Z5HA 1HWHB 4B41A 5IROD 2P4AB 4P2QA 4OD2B 1KG0A 4I9XA 2JE8A 3QH3A 4RX4D 4EVNB 3PXJA 2BSTB 4KRPB 4H25A 5EORH 3DECA 1BM7A 1UA6L 3TFKC 3BWZA 4X0KB 5B3JF 5AW9B 3GDBA 2AJXL 1OAQL 2GC7C 3T0EA 3EOTL 3MJ7A 5F1NA 4JRYE 3THML 4RA3A 2EO1A 1NBQA 4KDWA 2NZIA 4QHLB 1FFPB 1BAGA 4UZSA 4ZMPA 1HS6A 2BDNL 4FXKB 1N5YL 2EIZB 1T6VN 3DMMB 1Y07A 3HZYA 4W81A 2OMVB 4JO5A 3TTSA 1JGLH 3V6FA 3FH5A 2WBJA 1ACZA 4N2DA 2XTJD 1NGQL 3EO0A 4LVEA 5ECGA 3QUKB 4JN1H 2RQ8A 3Q9PA 2GI0A 3QDHA 4K0OA 1OCWL 4WFED 2A6KA 3D12B 4XCNB 1PG7X 4PJ9A 1TVBB 3KYOA 4BH8B 1CDYA 3BHBB 5C0CB 5AG9A 4FG4A 1NANH 4MJ2A 4JKLA 4XNXH 1FPTL 1U3HD 3UP1A 3SGKA 3ILEA 1HESA 2QZ5A 3UYPA 2EE3A 5D2LB 4KROB 5SWSE 5IJBC 4MA3B 3IAGC 2DM7A 4GXVH 3KEHA 3NSJA 2ESVB 4XMLL 5DEFB 3VGAB 5F1IA 1QLFB 4JPKH 3RDJA 3ULVL 1PZ5B 3QJHB 4Q9CA 3EYSH 4HKZB 1XR8B 5TDPA 1PBYA 3FTUA 2FVNA 2IFFH 2IANA 4AKPA 3AU0A 5DA4A 4NHCL 2XRAL 3ISYA 3BP7B 4KX8A 4YN3A 1NLBL 3ZPDA 5IVNA 3KH3A 4MCMA 4YQXH 4FQHA 4NO2B 5EC1B 3PWUA 1MVYA 4GAFB 1N5AB 1NC4D 4GP5B 3MR9B 1I7TA 1NCWL 3D1MC 3BESR 3F12B 3GSNH 4NEHB 4YDKL 3WG7B 3D33A 3HBGA 3LIUA 2IF7A 1OD9A 3P0VL 4Y9GA 4KVCL 1TU2B 4ORGB 5E08L 4BSWB 1U92B 3TO4B 2CE6A 5I5RA 1UCTA 4J3WA 3GBDA 3ULAB 1OE1A 5D7JB 2PXYB 2ZP8A 3H6AA 3QEQB 4DESA 3P4OB 1PKQA 4DT2A 2P1YA 5GS0C 1P6FA 4MHHI 3QUXB 4Y9CA 1Z9SB 1A0QH 5BZWB 3I6LE 5B7MA 2HJKB 3EGXB 5BRZA 5AKRA 3FO9B 3ARFA 1MFCL 1I3VA 1FRGH 2VUKA 3BN9C 4PRHD 1UA6H 2SODB 4PJ5D 3E8VA 3K91A 3S97C 2XN0A 4LSTL 1NBVL 2X1PA 4OZ4A 3EO9H 3T3PF 4DFIA 3LKQA 4MJ6A 5SX5H 1NCIA 1AIFB 1CXLA 5KSBA 2R1YB 3ULVH 2DEYX 2K4AA 2CLZB 1REIA 4ZO8A 4PGCB 3U6XA 3ARFC 2RCSL 2G9HA 2DJMA 1L0QA 5GHWL 1LL1A 2WCGA 2I9LA 2JKWA 1KIQB 1OGPA 1PZSA 3NRPA 4Y5XB 4IKLA 4HHGA 4HQQL 3U1PA 3S5LG 1QWUA 5IHWA 1INQB 4RH4A 5D71L 2AABL 2B5IB 3FUFA 5I66B 3DGGA 5J6HA 4E9RA 4X7DC 5ISZB 4MA1C 2KERA 3EYFB 1JYXA 1E43A 1XF1A 3D25A 4KVNL 2RR3A 5L2KE 4TRPH 5B1JC 5CAYB 1T4KB 1DUZA 5K9QG 3IS1X 2NY2B 1UASA 2OCJA 4TNFA 5J6HB 2MPAL 5IGXH 3QQ9D 4YXLH 2NSMA 2VC2L 3HZVB 5AW8B 3T6ZA 1SOKA 1YA5A 5DC9B 3VG9C 2OMUB 3VFRB 1HXMA 3H53A 1NA8A 4DUXA 1NQBA 2WZ6A 1JGEA 2B59B 2IFFL 4Q9RL 4FTDA 3HUJB 2AK4E 3HAEG 2FEDD 2K4WA 1N12A 1Q72L 2XWEA 4ZXBB 1BLNA 4A55A 4AQ8C 4FLOA 1VFAA 1UJ3A 4OFPA 1U21A 3LKQB 3D30A 2BVOB 2VXQA 1X5JA 3CC5B 4ANUA 1LEGB 1SYVA 5DMGD 5MERA 1GY1A 1XCXA 3WAKA 4MKMA 4YSPA 3NZSA 4JO2L 4K5PA 1HHKB 4DP1X 3O9WA 2MKLC 2FUQA 1CICA 1S3KH 2FR4B 3F62A 1F3JB 1DYZA 4FZEH 3MCLL 5J12C 2MFNA 4BINA 2W81C 3CVHL 5IW6B 4IMLA 4DEPC 4QMEA 1THAA 5GZNA 3MVSA 4JFFD 2QSCH 5LUMA 2O5XL 2IH1B 5B4MC 1U92A 2QKIC 3TBVA 2V4LA 4ZTPH 1HL5A 2F15A 1TU2A 1TTFA 4ORGA 2EKJA 4GAAA 4PV1C 3RY6C 5HHNA 3KD4A 3V52H 1F90H 4H20L 4HOZA 2NPLX 3G5WA 4OV5B 1UZ6F 4F9LA 4A66A 2IMNA 2NY2C 3QWRD 2PUQT 1T0MA 3MJGX 5DMKA 1SDYA 5HD8C 1V8HA 3EIFA 4TS6A 4IMKC 5DJ2A 3AS3A 2ADIB 1T1XA 5C08A 3WV0A 3ZSTA 5C8JB 2BVQA 5JIHA 1BJ1H 1NCNA 2B15A 5DK0B 4RMRA 2KLTA 5E5UB 4PGZA 1EX0A 1WA2X 1YEDB 3TF4A 4X8XA 4KGJA 5BUPA 2JQZA 2GJRA 2KYIA 4N9GB 3WFCL 1JPSH 4F57L 1XF2A 1EDQA 1EUTA 2ZUTA 5C09B 2BCKA 5K39B 5C7XL 3PDDA 1N0LA 3I2CH 2AEQL 3HAEB 3RA7H 3QO1A 4ODBD 2YS4A 4IBTA 4TNVK 3IXTB 5BRQA 1DN0B 3U7YH 3GTNA 1YECL 1CZ8H 3WXWL 2PTTB 5I5JA 5BO0D 3T8XB 1EGJH 4RGOL 2J2ZB 4UILH 1JZHA 1Y6KR 4O9HH 4W9CC 4RMTA 1KELL 4Z95H 1Z9PA 2VT0A 2XUWA 4TUKL 3EO0B 1XZ0B 2I9TB 3T0XA 4KQ4L 2X2UA 3S96B 3IMUA 3TBCA 3D9AL 3FB5A 1JL8A 2I60H 1C7SA 2IMMA 2Q6WA 5CHNA 4TQIA 1OHZA 2BC4A 3ARYA 4FP8L 3D39B 3LEXB 3VXOA 2O1AA 3LN9A 4HCGA 2QR0A 2QQKL 4QXGH 1O7SA 5IUCA 5INDB 1KLUA 1KTJA 2Y6SC 1UWFA 3TYGH 3E0GA 5FGRA 2JKXA 3DIDA 2BWIA 2NUTA 3L16A 4P59L 4MMZB 1NGZA 1X5YA 1NGWA 1QZ1A 5HHOD 5IVXB 1OCZB 5JIDA 4FXKC 3KPLA 3Q2NA 4N2LA 3RX9A 4C56D 5CEXB 3GSWB 3QH3B 3CN3A 4JGUA 5DJXA 4XNZB 4OD2A 1EJ6A 5E03A 4PG2A 3QXDA 4CGUB 4WI3A 4PRID 4RBPH 3QNYB 4KKBC 1JHLH 3VI3E 5HGBA 4GSQA 2BIHA 2YFOA 1N4XH 4XN5A 3HR6A 3K6SB 3K2UH 2YMXH 3G6JB 4L9LA 3NZHH 5HGBB 4RRPM 2FHCA 1I7RB 4LSPH 3WJMB 3IBOA 3QXDB 4I0KA 1JPST 2UY7A 5IESL 1RP9A 2AGJH 1A8ZA 2YAQA 2KZWA 2K6YA 4UM8A 5E8DH 5JDSA 5SX5K 4PHZA 1CYGA 1A6UL 4KROC 2RAMA 2PO6D 4Z7OE 5BPPA 3ZO0A 2VZ1A 1SYSB 3CV5A 4C4BA 2HP4A 3EFDL 5FC9A 1JSYA 3ZE0F 1NTDA 2A6JB 4BD4A 1A3RH 5E2VH 2BP0B 4QNPF 3CN0A 2V2WB 1U3HC 3ZE2E 5E1GA 1BIIA 2VC2B 4U7MA 3E3QE 3MRNB 1J9RA 5L4MA 4N8UA 3F7YA 4BZ1H 3DDFA 2GY7B 4QHUA 4H0HB 4YO0B 4LT7A 5FHAL 3ROLB 1X5MA 3T09A 3GSRA 2MKWA 3ARXA 5LCVA 1CLYL 1MQKH 2A9ML 4N85A 2NQDA 4HIHA 2B4CC 1W8OA 4R3SB 5CZXD 1S4IA 3MN8A 2UZXB 3GEFA 3RDTD 3CC1A 1RLBA 2BIPA 1Q1PA 5JQHC 3O4LB 1F42A 3W82A 4O9HL 3WFHB 1KTBA 2E7CA 2F53A 4KQ3L 1J0YA 4AIOA 1QABA 3QIWD 4PS4L 2OM5A 3CHRA 2CUIA 3JWNC 2FEDC 3IXTA 4OFDA 4RNRB 1A6AB 1C1EL 3QUMB 3HAEA 4AMXA 4MLSA 2XX1A 5B4MD 5DR5L 4TV3A 3LH2L 5C09A 5D7LB 2X3AA 2YPVH 3H3BC 3F05A 3LNDA 4X5RA 5AOZA 2GPZA 3QS3A 5DZAA 1IGMH 3DMMC 2DD8H 2WNKA 2H2PC 3WFCH 4F57H 1JZDC 3KL0A 1KEMH 1NIBA 1GGYA 1T1YA 4TVPH 4BK8A 3DURB 5F88A 5KSVA 3PP4L 4ODTL 3IJ9A 1NUNB 1AC0A 2AQRA 1JI2A 1UWEL 1Z0MA 3GBNL 4G71B 3VYPA 2AI0L 4HK0A 3V5HA 2RFXB 3LRGA 4LARH 1EFXD 2EINB 4NZ8A 1PZAA 3ZDZF 4EKJA 1ZVSA 3U9PL 1T0MB 5KYWA 4FERA 4YSCA 4RAHA 3RWGB 3C09B 5T1KA 4Q6IC 1E4XI 1EIBA 2EXTA 4NQVB 3VFNB 2AK4B 2WM0A 1G7PA 1DQJA 3T04D 1FFQA 3ZDXB 1P0SE 4UOJA 4MD0B 2AK4A 3HG3A 5JW3H 1KCSL 4QLWA 2QFPA 1RZKC 4R2GC 1KBGH 4TUJA 2OI9B 3MXVH 3U9WA 3TH3T 5CJXA 3VXNB 3SD2A 3WTYA 1D3CA 1MWAH 2FEEL 5IT2L 5KVGE 1EEZB 1T22A 3P3RA 4B97A 1H3XA 1I8UA 4D7BA 4PS4H 4M7KH 4QD2E 4FHKA 2YEVB 3D50A 1T1YB 1VRSA 1EPFA 2EH8H 3MRLA 3QCVH 2GT9A 5A40E 2NY6B 4KTEH 1X5KA 1WEJH 5AKTA 2WIMA 4L5FH 3K6SA 5DJAB 2AQTA 3P77A 2K70A 2GEQA 4UOW0 3WEAA 2N4IA 3UAJD 1ZWIB 4DK5A 4OQTH 4NIYE 4QF1B 3SDXF 1OARL 2GVYA 1XIWC 1SM3L 1UVQA 1ADQA 2NY5C 3HUJA 4HA1A 5TE6H 5I0XA 5JHBA 5AZUA 4PBDA 3ATFA 3HI5H 2JIXD 2OFQA 3B56A 3WXVH 1KGYE 1PG7H 2LQRA 2ZE0A 3MBEA 1F3DJ 2FO4A 2X4RA 3SPJA 4X6BA 2DI9A 4NQCE 2XY1A 4N2AA 5DVOA 5I9QC 3QI9D 2CO6A 2COQA 3CVBA 3U2JA 5IW1A 4WHYG 1OW0A 4KZCA 2D7PA 5K9OB 4UB0L 4NQXB 2X2HA 3MXWH 3ESNA 4ANXA 4W1TA 3CSGA 3TPUB 3V0DA 2IH9A 4AEIL 5HDQL 3FRPA 1IM9D 1AY1L 4PR5A 5GGRA 2PCYA 3T2NL 3IKCA 4MAZA 4P5MA 1BIIB 4CNIB 4Z7IA 1BQKA 4P57A 3MRJA 3FN0H 2KUTA 4G8GD 3CSYB 1ZS8A 1KCVL 2C3HA 3MRQA 3MZGB 2J5WA 4DKEH 4KRLB 4M03A 1CQYA 3RPKA 1JYNA 3WO4C 3RWJB 3C60C 1D7BA 4E41A 4F33A 3SGDI 3WENA 4RAUA 3VFOA 1UT1A 1F4YH 5I1GH 3SHSA 3N40F 5C6TL 2CG9X 2F5BL 3PGCB 7FABH 1NFDB 1N0LB 3ARBC 3LS4H 5D4HA 2EEXA 3EKCA 1EFXB 2UY7B 2YD7A 3UTTE 1A5FH 2PXYC 4F93B 4AGQA 1NUFA 3G3LA 4NQEA 4Q6KA 2YBGA 5EO1B 1MJJB 1ZD6A 1I9JH 1F6LL 4YGVB 5DQ9A 1XIWA 5FHAH 1IC7H 1BQLL 5L8JB 2JV6A 3I75B 1ODAA 5BZWA 3R8QA 2XX0A 3M17B 4G6FD 4GP8B 4GAYA 3RTQD 4IKKA 3BZFB 2I07B 4ODHL 5CNHA 4FYTA 3V95A 1ETA1 2KPWA 3LD8B 5KOVC 2VRQA 3VB8A 2NUPB 3KXFB 1MDAA 1DBJH 5JOFA 4AENB 3BGAA 3GUTB 4NP4L 3K2IA 3O4OB 3HNSH 4G7RB 2X4NA 4PWHA 2BHZA 3L9BA 4U1MA 2H3NA 4XN2A 3S35L 1YMME 3JVGC 4M7LT 3D0LA 2CDEB 3UDWC 3ULVF 1QTSA 5BXFA 4LLUB 3TVMC 1IJNA 1KJ3H 2HFEB 1VEMA 3QDJB 3QUML 4FNQA 4TF4A 5I8EB 4P23C 1NGPL 4JCLA 4QT5A 1YEHL 2W38A 3IETB 3BZEA 2PWEA 2KC0A 1X5IA 1FFNA 1G43A 3S3SA 3EBGA 5BOZG 3TONA 1QLFA 2D3NA 5FO9A 5HHOE 4CJ1A 5ICZA 3CPUA 1ANUA 1MFUA 4PG9B 1HH6B 5I6OA 3NPSC 2V7NA 3QJTB 4HLZH 1LNUA 4HFWA 1E5CA 2WLLB 4JFEB 3IN0A 3RX5A 1PJWA 3LZRA 4LCCA 1E4XL 2CKBL 4IEFB 3ZTNH 4RFOL 4ZS7L 3T0DA 1L7IL 3O6KL 4JQIL 2CQVA 3JWDL 2GJPA 4QO1B 5FYLD 2GITB 5DRWB 1KTDB 1X4XA 3P73B 4HV8A 1U4EA 4I4WB 1URZA 3KNBA 4X4KA 2WVSA 5AVTB 4IDLA 4DOHE 2E27L 4Y1AE 3PP3H 4K71C 3OKDB 4ZG1A 4OM1H 5DHDA 3VSQA 5C0BE 43C9A 5EZJA 1PS3A 2R4SH 4LAQL 4IOSA 3R0MA 3BCDA 5EUOB 1XVSA 3IJYA 5BOPA 3ULUL 4GT0A 1VACB 4PJGA 2DKSA 3GMPA 1TTUA 3ZKQD 1QFOA 2QGBA 5I66A 1SN0A 2G3ZA 2AXJA 4ZOCA 3ZDZE 2DF3A 1NZRA 2YXMA 1RD6A 3E6HA 2B1AH 3TWYA 5TF1H 3AS0A 2IH1A 1KIQA 3QJQB 4LL4A 4X8JA 4WFHE 4E9XA 3BYYA 4NSKA 2G9HB 1ZHNA 5IB4A 1W80A 3K6IA 4EVNA 2R0ZL