5LBGA

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with faropenem-derived adduct at the active site cysteine-354
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
259
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 72
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lbgA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbgA01
4GSQA 4QTFA 5DU7A 4A1JA 4A1KA 3ZGPA 4HUCA 5LBGA 5D7HA 5E1IA 3TURA 3ZQDA 5DCCA 4QRBA 4QRAA 5E5LA 4A1IA 4HU2A 2MTZA 3VYPA 4JMNA 4Z7AA 2HKLA 5DZJA 3ZG4A 5E51A 4QR7A 4ZFQA 4K73A 4LPQA 5DC2A 3U1QA 4LZHA 3VYOA 5E1GA 3VYNA 4A52A 4GSUA 5DVPA 5DZPA 1ZATA 5DUJA 5K69A 4JMXA 4GSRA 3U1PA 3TX4A 3VAEA 5LB1A 1Y7MA 4XVOA
chains in the Genus database with same CATH superfamily
1LEGB 2W07A 3CIAA 4F9PA 1C16A 1QI5A 1VFUA 1TFHA 3KL0A 5DJAA 3TO2B 4WY7H 1O0VA 3F8UB 4N2OA 2DQMA 5DFAA 1CJYA 4ZTOH 2AFNA 4YDIL 2FJHA 1KUMA 3LQZB 1A6VL 5C07E 2HX8A 3DLQR 5I76A 5SWQB 1JYWA 3EH1A 2J6WA 4WFHE 3MV8B 2CQVA 3RIFK 3WN6A 1W6LA 1RY7B 2GJ6B 3S2CA 1BJ1H 1CB4A 4N9GB 1GJUA 2IBZX 2OL3L 3SE3A 3TZVB 1I75A 3F7RA 4X7FC 1QI4A 3AG4B 3QWOA 2G2RA 5AVZB 2X1XR 4CGTA 1WITA 3OJDA 2JJSA 5EFIB 4UF7C 5MI0C 2WLIB 3M17B 2QHLA 2VXQH 2PXYC 3N42B 4G8GE 4HZ1A 3D85D 1J9RA 2VLKB 2X4PA 5T8IA 1PSKH 1JYXA 2BXYA 4KPHL 2R0ZL 2B4CH 2XWJB 4B5EA 2Z93A 4JL2A 5L2KE 5AW5B 3NABH 1BLNA 4E5XA 4I4WB 1WEJH 4MS6A 4CSSA 1ZSDB 3JWOC 1T7YA 1A3QA 2Z31A 4JANA 5HD8D 3BZEA 1IE5A 1NTDA 3FK3A 3Q2WA 4NQQA 4D3CH 3TS8A 2VZOA 4YFLF 5EU5A 2RTTA 1GC1C 1IKOP 4J8QA 2GBUA 4LIQH 1EO7A 3LKSB 1TQCC 4FZ8L 3V5DB 4YSQA 5AOMA 5I1EH 3ULVL 1ACZA 4M1DL 1BF2A 2ZIDA 4XBMA 1LXMA 1EZVX 3MJWA 3MLYL 3SKNB 4PW9A 2V17H 4IOSD 4OZHB 1IBYA 3TVMB 5AKVA 3NZHH 3NH7H 3N91A 1MFUA 4PB9H 1QA9B 4MMZC 2JKWA 2MOGA 4GQRA 4HX1B 4PRHA 5DZLA 2MNJB 2W8CA 4J6RH 5D6DC 5B39B 2WZPA 4GEIA 1HJBC 4QD2E 3GMOA 2XWRA 4N86A 4XXCA 5CMAA 4XHJD 2VDML 4I88A 4N2DA 2W0PA 2ZTBA 4KH9A 1L9SA 4EAEA 4FFVC 4RIRA 5DS8A 4N8VG 4KROB 5FO2A 1QBMH 5IV2A 2C9UA 2OJEA 5D7EA 2E8ZA 4XNMB 3FUIA 5DFVD 4HW6A 1G6RA 2CR3A 1XCWA 1UA6L 3H9SD 3LEYH 5CN1A 3ZHKA 4LDCA 3T3MF 1GAFH 1M9SA 4IYKA 4MKTA 4U7KA 1MZYA 1KELH 4KXZH 3VFTA 6FABH 4KK5C 5E4EC 2MMXA 1SLUA 2ZOWA 4N0FA 1OPGL 2X6MA 4KU1A 4PJ5D 4Z7WE 4Z0BH 2NYKA 4XB7A 1ES0A 4D9QE 1CLYL 4R7VA 1ZHLB 3DBSA 5L0QB 3STLA 3BFWA 2WSPA 3DJTA 3VG0L 4MJ6A 3VFSB 4PJ9A 1RKRA 4E41B 5C0BB 1YEGL 1LM8V 3P77B 3MV9E 3NTCH 3VH8A 4FA8A 3KZ8A 5FO8A 4PRPD 1XSJA 2FIRT 4Y16D 2JKNA 3F7PC 4XBEH 4ZPVA 1U21A 1BIIA 1ZDQA 2F18A 1CFSA 3UTSE 1ZTXH 3EDFA 4HAKA 1NGZA 2C1PB 2CJUL 5HGAB 1HSBA 1RZQA 2HYMA 3TBVA 1VIWA 3V0JA 1LILA 3F3HA 3LDBC 2QEJA 5F44A 1N3NA 2DJSA 4X50A 2KPWA 3HNVH 1I9IL 4FG2A 3LSOB 4TQEH 4NLHA 3QDME 1DUZB 1IM3B 1U8MB 5C09E 3WFBH 2AI0L 3T8VA 3UEZA 1AR1C 3BE1H 2G3XA 5AOZA 4H26B 4LQFL 1A1OB 3WS6A 4GW1A 3PHQB 4X7TA 1ZRUA 2CKBH 2E6PA 1E4KA 2VUKA 4JDVA 4WFGE 5AKTA 1WIPA 2CO6B 2GAZA 4RQQA 3DRTB 1SBBA 4X98B 4ALAL 4EDWH 3DOSB 1S7UA 1NBVL 3W9DA 4OCMC 1XH2A 2DJMA 4Y4FC 2APSA 4P23A 3MR9A 2WBKA 2Z8SA 4X7SH 1YHPA 4IEFB 3HUJF 4GKNB 3L9RA 1DSFH 4YHLH 2J71A 2VMJA 1D2PA 4YEEA 2BW5A 1AVAA 2ZUVA 2FTAA 1KYOK 3LTVA 3GUTA 4XNUH 1W72A 1XB6A 5GGVH 5HDWA 3BO8A 3UJJH 5IQ7L 3CHOA 4P2QD 4KJPC 1EQWA 1NSNL 1H15A 4IKKA 3TT1H 1YJDC 2ZXDA 3S3CB 3KDMA 1CO1A 2R69A 1LP9B 4YAQA 4AOFA 2Q3AA 5KTEH 1JVOA 4HEPG 8FABB 1KJMB 4FQJL 1X5HA 3GO1L 1CFMA 1CL7L 2BY0A 2ITEA 5HYSB 3CFCL 3WJLC 4L9DA 4M7LL 4KKNA 2CG9X 4A7GA 5IP4A 3FHQA 4NWUH 3OF6D 3GSOB 3ERXA 2O72A 4K4KA 3RNKB 2A2QT 3CDGB 3MV9B 1YDPA 4JFDA 3EBIA 4WFHD 3O6FD 2EUXA 4H8WC 2EDOA 2XQ0A 4TKWA 3MGTB 3ZKMD 3AM8A 1Z2KA 3GZQA 3MTXA 2FRGP 2OW7A 5CP3A 4AG4L 4OZGB 5K9OA 4OF8A 1I1AB 3C5ZB 4LGSB 5JUEH 2AJSH 2Y72A 1I8KB 2EO7A 3DKHA 3EFFB 4FFZA 1J8HE 1HQRA 3DHMA 1AGBB 3WFZA 2KZBA 2R2BB 4J3OF 5L2KD 3QUYB 4LASL 3BEWA 3CFKA 2NXYB 3HRZC 3SDAA 3FULA 2NXZC 5C09B 3P2DA 5TDPB 4S0HA 3ULSB 1JF6A 4Z95H 3ULVC 5CJBA 2DBLH 3CZUB 1U42A 2BNQE 3RWFB 4F33B 2XWTA 1R75A 3JBG7 4PWEA 3QXDA 5DVMA 3DXAE 4NIYE 2CZNA 4P5SA 1CG9B 2AK1L 3OGCA 3ARFB 1NKRA 5D2NC 1ERNA 2ZCZA 4WFFE 5CM1A 5BO0D 1KPVB 1KXQE 4EDXB 3UTZB 1Q9KA 2YD1A 4YLCA 4UTAL 3OMAB 1Z9NA 3MJ7A 1T5KA 4J6IA 4KQ3H 4PJGF 5TQ2H 1MJ7L 4O2EB 1MI5E 3EYVA 3GRWA 5DFTA 3RGVD 5JW4M 1NCUA 2J88L 3BKJH 3LY6A 2LGNA 3PXJA 4JRXB 1DDHB 4AENA 1A4JA 5JHLH 1LEGA 4P9ML 2IIJA 5I1IH 3IFLH 1F1DA 3TO2A 4KTDL 5T5FH 1A7NH 3G5VB 4K3DH 4QXVA 4BEIA 1GHFH 1FGNL 1LGVA 4CC1A 3ZOAA 1MHCB 1F0LA 5M94B 4A39A 3HUJE 3W39B 1VAHA 4PP1D 2E76C 5SWQA 4XOEA 4ZSOE 3MV8A 2GJ6A 3TGXA 1U8IB 3QXWA 4N9GA 4UMSA 1AKJD 2P52A 1UOWA 4G11A 4UILH 3TZVA 4L8DB 4RGMC 4E5XG 4XN7A 2OYLA 4AITA 3M45A 4HT1L 1BZ7B 3CTTA 4G80B 4LDEB 3BOVA 3MREB 4JFSA 2AABL 5EFIA 3RWCB 2WLIA 3M17A 3QNYB 5J11C 2X9ZA 3GXUB 4WO0A 2VLKA 2J20A 3R4DA 1YYML 1EHLL 3S96B 1U8CB 2IH8A 2IWGA 2VDOH 3GGWB 1KACB 3HZYB 2XWJA 4ODWB 4D9QD 5JYMA 4M6ML 4WFEE 4NGHL 3UGXA 4I4WA 4OLEA 1ZSDA 2D0HA 1TJHL 4WTXA 1J05B 1OAUH 1Q4NX 1IAII 4B6ZA 3QFGA 3TP4A 1KYDA 3BCFA 3OLIA 1AY1L 2JJVA 4WHDA 2CUHA 4RFOH 2YMTA 3SZKC 5KJRL 3SJVB 4N6RB 3QRGL 4NNPH 4XGZB 3WBDA 1R34A 2Y23A 4I1PA 1LD9B 2ZCHL 4M7JL 2BNQB 4LPUA 3LKSA 3V5DA 4HF5H 3DX7B 3TBWB 3DXAB 5E4OA 1HX0A 5F7EL 2K45A 1A7RH 5FYJU 4XAKE 4WWKC 3WKMH 3T4YB 1RU9H 3SKNA 4JO4H 4OZHA 4OZIE 3V4VH 2VQUA 3TVMA 3ZR5A 5DDHB 1AG0A 4QXUL 3RY5A 2F7PA 4QGYA 2DM4A 1A47A 1QA9A 4KK8C 4HX1A 4HBQA 5HI5D 5TQ0H 3QDMD 5CP7B 2P5ED 4K2UL 4ZTOL 1MVFA 3GEFA 2ATKB 4P5KB 2CPUA 2R0WH 3U30B 1GXEA 3QIUB 4ALAC 5B39A 2AJYH 1N5YH 1SXAA 2BHZA 4JAMB 6PCYA 4CADB 1QRNB 4FNQA 1UWXK 3LVTA 4LVOB 3RTQC 1KPUB 1Q72L 5L4IA 1FFRA 4Z3HA 4QHNB 4MZIA 4AQAB 5HVHC 4MJIB 4XNMA 4KFMA 4Z7QE 2NZIA 3F7VB 4JDZB 3IMBA 1JNHB 4NSKB 5EOCH 1XTMA 2ZP0T 4CVWA 5FS5A 3IDUA 3A6CH 5CBAB 5T1LB 1RL1A 2B4CL 3UAJA 1UUNA 4KVNL 5DHMC 1WVZA 3NABL 1SHMA 4XP5H 4B9ZA 2CLRB 2DMGA 3K0WA 2F54E 4OCWH 4AUUA 1TQWA 3MDJA 4MAUH 4YSOA 1ZHLA 2YSSB 2GUOB 3O81A 3I74A 5LDSA 4GRLB 3BIBX 5A2KH 2CU9A 2CE6A 2AJ3B 3VFSA 4D3CL 4ZT1A 3REWB 4E41A 5C0BA 1V3MA 3P77A 5IHZB 3CX2A 4LIQL 3QEGH 5GS1B 4KZEH 4JQIA 2XZAH 1WGVA 5I1EL 1V3JA 2V17L 2NTFB 4H8QA 1HAUA 3UBFA 2E9IA 1NEZB 5E2WH 3NH7L 2DICA 4KRLB 4PB9L 4YZFE 3X1EA 2X0WA 1U8LB 2C1PA 5HGAA 2WVUA 2P5WE 2PTUA 1KDJA 4Z7AA 3LSOA 4WKZB 3VW3H 3N0AA 4OQTA 1FRGH 3L81A 1DUZA 4LBAA 3P4OB 1IM3A 1U8MA 1XDTT 1OCRB 4KZ0A 1MZZA 2BVEA 3V10A 1TPXC 4M62H 1QBML 1LVEA 1SJHB 4H26A 4J2QA 3EBAA 1A1OA 4PS7A 1DBKH 4X9IA 3CCHB 4MFHA 3EJSA 3TFKC 4CUCA 3PHQA 4GSRA 3V0DA 5JDJA 3VAEA 4GG6E 3V0WH 1E65A 4F5CE 2UVFA 1D5XA 3LEYL 2CO6A 3D6GA 4AVJA 3DRTA 1EA9C 5C1MB 3UBXI 4X98A 1NGWB 3K8MA 4Z6AT 3NJXA 1KELL 6FABL 3TXAA 4UAHA 3DOSA 5L88H 2MKWA 3Q9QA 2VDLH 4NKMB 3WIIH 2J5LB 4J39A 4Z0BL 4Y1AE 2WW8A 3E3QC 5FKPB 4YBLC 4WFFD 4IEFA 4XX1G 4GKNA 5GRZA 1Q94B 1XZ0B 4KAQH 4FG4A 1NPJA 4JHZA 2K4WA 3BH9B 3QORC 4H0GA 1M6UA 1TETH 3D39E 4UIMB 7FABH 5JPNC 4K5PA 2CBMA 4CN6A 2FSDA 5F9OH 5A6LA 3QB7C 4HMDA 3EYOB 3NTCL 3S6CA 2MFNA 4XBPB 1C12B 3NJLA 4ODTH 4Z7WA 4IHOB 4G82A 1LP9A 1KN4H 1PKOA 4Y9FA 3EYFB 4IKJA 4XBEL 4BUHA 1DVYA 1HIMH 8FABA 1CD8A 1KJMA 2WLZA 3BVWA 1BX2B 3IGFA 1IAOB 1TQBC 3MOQA 4KKRA 4RCAA 3T0VA 5HYSA 3MXVL 4S1SH 5DGQA 3VXQB 3GSOA 3RNKA 2YSTA 1L3NA 3CDGA 3MV9A 5T1KB 3OKDB 4FYRA 1T80A 4BSWA 3HNVL 1HJCA 4UAOB 4TQEL 3P69A 5EO0B 1JNNH 3VE0B 3FQ1A 3MGTA 2TSBA 3BIAX 1U2HA 4JFEE 5IM7B 3PJSB 4EXPX 2BP3A 1H6UA 5FPIA 3WFBL 2WQ8A 4OZGA 1XSOA 1ZLWK 5FOJA 1I1AA 1DJGA 3BE1L 2EEBA 3C5ZA 4CVUA 3DVFA 1RZFH 4YOKA 3UTTD 2CKBL 1U4EA 1I8KA 1BYOA 3EFFA 5KVFH 2IXQB 4UQAA 5IUSA 1USZA 1AGBA 3ZRCC 5JIHA 2R2BA 1JGVH 4HXBH 4XN4A 1CLCA 2ICCA 3QUYA 1B9ZA 2C4XA 2X88A 3EJQA 3MRNB 1TJMA 2Z3FA 4G9FB 5KBMA 3L4WA 4EDWL 5C09A 5TDPA 5JORB 1F4YH 3ULSA 5G4OA 3BAXA 4B9IA 1U8HB 3ILQD 3RWFA 5AOLA 4F33A 5E6ZA 1DSFL 3C60C 4GG6B 5I6XC 1CG9A 3A4DA 4IJTA 4PJHB 4YHLL 4EOWH 3DURB 3GPSA 1UADC 3ARFA 1KPVA 3X1BA 4EDXA 4XNUL 3UTZA 4CC4A 5GGVL 4LL4A 2CRMA 4YSEA 1E9QB 3BKMH 3UJJL 2JI2A 3LIZA 2WHVA 3M46A 2ZCLH 3TT1L 3S36L 4O2EA 4XAKD 1RJLB 4W9CC 4UANA 3RURA 4J3OD 1MCNA 3Q5TA 1S7XB 5KTEL 3LMJH 2Q3ZA 4JRXA 4OFYA 1DDHA 2YRBA 3H6JA 2N3JA 1KJ2B 3GSVB 5I6MA 1BYPA 3QEUB 4Z77B 1ZTMA 3G5VA 2V7NB 2WZAA 3CZJA 4LPWA 1MHCA 2R2EB 1FVDB 1PZDA 2C9VA 4M6OH 4YSRA 3U9PH 3RIAK 1MNNA 5GGTH 3GK8H 5E6ID 3M1OA 2LVCA 2YPLB 1K8DB 4NJ9H 4XMKH 1U8IA 5JUEL 1P84K 3WXVH 1H9DA 2YXMA 1CVRA 4L8DA 2AJSL 2XFGB 1BZ7A 2XT1B 2YD8A 4G80A 3MREA 1IE4A 4N2LA 4XN1A 4ZZFA 3FDWA 3RWCA 5E2TH 2XPYA 3QNYA 3LCYA 3LZLA 3DMMC 4RZKA 5F6IB 4JFEB 1JYVA 3W9EB 1BV8A 5HPMB 3S96A 1U8CA 2G3NA 1X44A 3GGWA 4Z95L 3HZYA 2WJ5A 3BSZH 5EUKB 1ETZB 1V10A 1A4BA 1O7VA 2OPCA 1FI8C 4U0RB 3WY3A 3KCWA 4H0IA 4F3FB 1UXLA 2JQZA 1J05A 4FMKA 3SPJA 1MJ8H 3ABKB 4H2AA 2WN2A 3MRBB 1I7UB 2LAGB 3PGFH 4NHCH 2PCXA 1H6FA 2JWYA 5JW5B 1UZGA 5TQ2L 2EYRB 3SJVA 2AXJA 4KQ3L 4N6RA 5CZRA 3OX8B 4HUMB 2WLMA 4IKLA 4XGZA 1SDAB 1LD9A 4D9LL 2BNQA 1AZUA 2MCG1 1X5MA 1KTCA 3DX7A 3BKJL 3TO4D 3TBWA 3DXAA 4BRVA 5I1KH 5JHLL 3ZVVA 3SHSA 3T4YA 1MFCH 2GCYB 2P5WD 1DQQB 5I1IL 5I1AB 3IFLL 1ZMYA 1KXQA 5DDHA 2FR4B 4X6BB 2YO3A 3QI9B 4WGKA 1A7NL 3QJZA 3OB0K 4K3DL 1GHFL 5IHUL 1QBLL 4BIKA 1FYTB 3BPOB 5CP7A 3U6RB 3FSAA 4S0SD 2ATKA 3MBEB 4P5KA 4ONGH 2HTKC 3QIUA 4A1IA 2MCMA 1RZ7H 5FGCB 1A3RH 2AQTA 3Q1SH 4FNRA 1QD0A 4WNJA 1B4RA 2AXFB 1U6AH 1BMGA 4CADA 1QRNA 2WMPB 1VSCA 2K3HA 1KPUA 2NQDA 4QLWA 1T5XB 5F7NC 3EF4A 5FGRA 4QHNA 3LNDA 1BHGA 4AQAA 1BPLB 4MJIA 2E7LA 4OCRH 2NY3C 2RQ8A 4OJCA 3F7VA 4JDZA 4HPYH 1JNHA 4NSKA 1HWWA 3MRHB 1JL8A 2DI9A 1ET7A 4XNZC 5CBAA 5IBLD 1VENA 2X89D 3D33A 2VDOL 3K7UA 4Y1AD 5ICUA 5T1LA 4D9RD 1HN1A 1ZLVK 2MNUA 3QXAB 1OALA 4KRNA 3KLQA 2CLRA 3L3DB 3FKUS 3D39D 3W1ZA 2PP9A 1GS8A 2GUOA 2YSSA 1N4XH 4M7KH 4GRLA 5B21A 1H6EA 4MWFB 3B6SB 3HBZA 2AJ3A 2FVNA 4Y1TA 3REWA 3RYMA 5JOPE 4ZXBD 3KWWB 4KDVA 3OL2A 5IHZA 3THMH 3MFGB 3DTDA 4L8CB 5GS1A 4HF5L 4YHMH 4HWBL 2QVIA 3FZUD 5DSCB 1RV6X 4H0LC 4P46C 2AKRB 1JXGA 1A7RL 3CIQA 4HEMA 3WKML 3WDJA 3ZGHA 3ZTJG 4JO4L 2NTFA 4BV1A 1KTRL 3V4VL 1NEZA 1KCSL 2VYRE 1U8LA 2ZWNA 5TQ0L 1SQ2N 3S7GA 3RKDD 3VTTA 2JCWA 3MV7E 4AMKH 4Y89A 2HTLD 2R0WL 4MNQD 1BMZA 2AJYL 4DPCX 3V79C 2JI3A 4WKZA 4FABH 3MA7B 1HL9A 5CJ8A 3SGEI 1OM3L 1JXFA 3P4OA 2J3SA 1Z32X 1NDTA 1FP5A 1XR8B 3ILDA 1OE1A 2WWMC 1SJHA 3BLKA 3WMQA 3BI9X 4XOBA 2GK0B 2VE6B 3CCHA 2DM7A 2VLJB 3I84A 4G8IA 3MUJA 1PIGA 4N2KA 2AC0A 4RMBA 5EOCL 3LZQA 4I13B 4AGQA 5IHLB 3A6CL 3D7PA 35C8H 2WKOF 1X9QA 4MDIB 2E3VA 1SUJA 2WLYA 3N1QC 1IIKA 4NKMA 1SXBA 4XP5L 3C12A 3BPLC 1N12A 4DFHA 4OCWL 4I3GA 1P9MC 1NC2B 4MAUL 5FKPA 3UDWC 1ICTA 3ASNB 1Q94A 3AWEA 3NFSH 1XZ0A 2Z7UA 4PLNC 3HS0B 3BH9A 2E5EA 2ATAA 3CDYA 4UIMA 1U0QA 2YD3A 4HK3N 4HVBA 3FUMA 3PDDA 3KWUA 2Q7AA 3EH2A 3B9KC 3EYOA 4ONOA 1V3KA 3QEGL 5J1AB 4KZEL 1ACYH 2XZAL 1PD6A 1C12A 4XBPA 3MLUH 4IHOA 1FFQA 2H1LM 3ZKND 2VXUL 4F93B 5LVEA 4NKIH 4Y5VB 5C0NC 3EYFA 3TYFB 3ZT7A 4IJ3B 2NY2C 1VERA 1O9WA 1BX2A 2XPGB 1OIOA 5E2WL 1IAOA 2N1KA 3X2QB 2XCMC 3MVSA 4X6DB 3GDBA 4BXSV 4Z76B 1EV2E 5A2AA 5T1KA 1JVKA 1UXMA 3OKDA 4F8NA 5BOZG 3CLEH 2Y4SA 4PJDF 1XCQB 2RMNA 5HYJD 1XMEB 3MC0A 3PV6B 3VW3L 5EO0A 3U2SB 1FRGL 1X3DA 4LFHD 3VE0A 2PETA 5IM7A 2IBGA 1XD1A 1KBWA 4LMQE 3EYUH 2BNRB 1M7DB 2D3NA 4M62L 4NP4L 3TBTB 2E7DA 4H20H 3L54A 1DBKL 4BWUA 2VITB 3KPNB 3QO0B 4DEPB 4R9HA 1NQBA 4TUKH 3V0WL 1CL7I 1BFOB 5CHNB 5JXAH 4AIXA 1A7OL 1YEEL 1H8SA 1HI6B 3HN5A 3SO3B 2BK8A 12E8H 1PLGH 1UT1A 3QJFB 5SWSB 5SWZE 4GAGH 3MRNA 4G9FA 3W0WD 4GUQA 3RU8H 5L8KB 3WNNA 2VDLL 5JORA 3EHBB 3WIIL 3BCDA 1S7VB 1ZANH 4IRJB 3NJMA 4B7LA 3F05A 4MJ4A 1U8HA 1AC0A 1BQUA 2PPCA 3AFLA 3JWDH 5AAPA 1INDH 2PCPB 4UINH 4KAQL 4GG6A 3H2QA 3KLLA 4PJHA 4FULA 4DH2A 1GYCA 3DURA 1TETL 7FABL 2P8MB 3NYKA 4WK4B 4X7DC 3MRPB 1Z6JT 2A74B 1E9QA 3PREA 5JHDB 1IGMH 2EXWC 2V9TA 4LPYA 3LZOA 4PYHA 1IL1B 4JGUA 5FAAA 4ODTL 3RILA 3V0IA 4CBZA 1RJLA 2AXGB 4ZW7A 5AB2A 2EE2A 1S7XA 2DQJH 5G5DB 1XGRB 4J7RA 3II2A 3MTRA 4XPTH 2BVUA 1KLFB 1NGQH 3QIBC 1KJ2A 2WLKA 3GSVA 4HPHA 3AXHA 4S1SL 1AH1A 3QEUA 1AXIB 4Z77A 1LJMA 3TONA 2NPLX 3ECQA 3VUAA 3ZQXA 2V7NA 4U05A 2R2EA 1FVDA 2H0PA 1D7BA 5KSBF 1JNNL 5CEXB 2ITFA 1IUZA 2GK2A 3SYCA 3TOPA 3QUZB 4TSCL 2YPLA 1PY9A 1K8DA 4XVJH 3VD7A 3VACA 2R2CA 2WUBL 5A2BA 1RZFL 1JF5A 2HT4D 4JHVA 1J18A 1NH6A 3QQ3B 5KVFL 1ITCA 4U1NB 4IOIB 5B3JE 1JGVL 3SDXE 4HXBL 1B6DA 3UMNA 4LVHC 1O5DT 1RI8A 4JFEA 4NN7B 5E6UB 3W9EA 5BCAA 3QZBA 5HPMA 1IEHA 2B20A 4GBXC 1F4YL 4MCYA 3D4GA 4ZFFB 4XTRC 3KD4A 3NIGF 3RKPA 5EUKA 4XVTL 3TA3D 1J0YA 4FOMA 4F3FA 4JHUA 3PP3H 1RMFL 4EOWL 2H2PC 2HT2C 4F7MB 2CR0A 3MRBA 1I7UA 1DEDA 4L23A 3IAQA 3BKML 5JW5A 4UIKH 2EYRA 3H3PH 2AV7B 2ZCLL 3OX8A 3UZEC 3DGCR 2GG1A 5DJ6B 3ARGD 1F8TH 5DC4B 4QTFA 3LMJL 3T09A 5LHDA 3BISA 3LQAC 2NY1D 5I71B 2FBOJ 3FT1A 1U2YA 2GCYA 3JTTB 3MV7D 4NDMB 5I1AA 2GB2A 3V5KB 2FR4A 4ZFQA 4X6BA 3QI9A 3RY4A 4U1KB 4NHUB 4W9FC 2K4AA 4Y4KC 1FYTA 2D7MA 5MEPB 3U6RA 3W57A 4M6OL 1UOLA 3MBEA 3U9PL 1Z7JA 4NNYB 2FHFA 5GGTL 3VFWB 3GK8L 5GPRA 1WWBX 3CSGA 4G43B 2AXFA 3LN4B 4NJ9L 4XMKL 5I82A 3WIFB 2WMPA 3S37H 2XXMB 4BGLA 3TPUB 4WWNA 3RX5A 3WXVL 1WIOA 1TJIL 1T5XA 3PGDB 4PGJA 5FW6A 3QUXB 5SX4H 3HA0A 5E2TL 1FV1B 1OP4A 3MRHA 3N0PB 3SDCB 3T6WA 2VMDA 5BV7H 5ALCH 4Q6YA 5IB2B 5FKAB 3BSZL 1C5BL 1N0LB 4K55A 3QXAA 4X6CF 1JZ7A 4NO0D 5BZWB 3MRCB 5GS2D 2C9RA 4MA7H 3W5NA 4M1CD 4LSRH 4KWUA 3IBEA 5GISH 1R6VA 3L3DA 5HJBA 1YZZA 2FNWA 5D1XE 3FTWA 1PZAA 1LO4L 2E74C 2CRZA 1OARH 2YD7A 5DUPH 1MJ8L 4OLWH 2OM5A 5ITFB 3UC2A 2VZVA 3PGFL 4NHCL 3VRIB 4FYQA 1NEZG 5I28A 1BQKA 3N44B 2VW7A 4MWFA 3CVIH 5J12B 3B6SA 4M5TA 2A0LC 4WLCA 1OGAE 4IMLB 4KRPB 4OFKA 3ZDZF 1N67A 3KWWA 2X6VA 2XUWA 3ABMB 4X8CA 4L8CA 1VESA 3GS0A 1NCCL 3VD0A 5DSCA 1IV8A 5I1KL 2AKRA 1M3IA 5CCGE 1WV7T 4PJ8B 1MFCL 1FE8H 1KTLB 3EJZC 5F7HA 3G9AB 1F90L 3LB6D 3IPBA 3FCUB 1YEJL 4LOEA 4RZCB 2ALAA 4K23H 4QHUB 1IRAY 2VN5A 4K5MA 3KL5A 3SBRA 2ZONA 1C8QA 4ONGL 4U1MB 1UTDA 1RZ7L 2J8OA 4NC0B 3Q1SL 4O2CB 1U6AL 3MA7A 2GW5A 4OCNC 4ZMXA 1JCKA 1C9SA 1EDYA 4OBSA 5GRXG 1XIWC 4A52A 4XN5A 1UHVA 1XR8A 3L9BA 4H5SB 4LB8A 5I1DB 4IBWA 3SGKC 1NCGA 2GK0A 2VE6A 3G5XB 3M1CA 2VLJA 4OCRL 4W70A 5E94B 2PNDA 3CSTA 1J0IA 3MUY1 4JY4B 1GGYA 4HPYL 4F2MB 1KCLA 1KCVL 5ICYB 4GUCA 2IANE 2Z1KA 2FK9A 1SOKA 2VB5A 3II1A 4MDIA 3B2UD 2BW4A 3VMOA 1X5IA 2ETWA 3WLBB 5DC9B 3SN6N 4QDGA 5D1ZC 4KH2A 5FO7B 1DVFC 2ALWA 3MXWH 1NC2A 1P6FA 4EQ3A 2WLJA 1K5WA 4D0CB 1XGUB 2YUZA 1F3RB 1JV5B 3D2TA 1N4XL 4FXLA 4M7KL 2K9UA 3HS0A 2EEAA 4XI5D 4XE5B 1FPTH 1EIBA 4BQ9A 2MPAH 2IFGA 2ICEA 3NACH 3CLFH 1SXSA 3HNSH 2RCSH 3BQVA 3THML 5J1AA 4DERA 1SVBA 4POUB 4YHML 1FO0L 1MF2H 3DTXB 3HI6H 3OLEA 1E6OH 2A9CA 5D1XB 5IMKB 4Y5VA 3CVDA 1MCIA 1WAPA 4J3OH 4KDTA 4KXZI 3LH2H 3TYFA 5E70A 3ZO9A 3RVWC 1OAYH 3WLWD 4M5YH 2XPGA 3EJTA 3VGAC 4ELME 1PAZA 5EU7C 4Z76A 5B38G 4NRXB 3T6ZA 4AMKL 1RZGB 2X44D 4XNAA 3NSDA 4P2CG 1RK1B 3D08A 1XCQA 2DYSB 3PV6A 3P9MB 3QO1B 1A5FH 3U2SA 4CSPA 1YEIL 5D7LD 4FABL 5DZNA 3T1FB 2UUDH 4UQDA 3D30A 2BNRA 1WP6A 1M7DA 3IDYB 3TBTA 3DJZA 3ZDZE 3VFRB 4FHBD 4BKLB 2YGVA 2VITA 3KPNA 3GBMH 3QO0A 1UJ3B 2EADA 4JB9H 1BFOA 1XH0A 5CHNA 5EBLB 4ZMWA 5F9WB 5IEKB 1HI6A 2BHFA 1J88A 35C8L 4MA3B 3KPOB 1FFOB 3QJFA 5SWSA 3IPEA 1WZMA 4DPRA 3WO3B 1MWAB 1S7VA 3QWRA 4IRJA 4NPJA 4ZUVB 2QVTA 3V4LA 5EV7A 2OMWB 4QYOB 5CR8A 4NN6B 2DJ4A 4R8WH 2D2OA 5D96C 3SDDC 1J0JA 2PCPA 32C2B 5C70A 1NUNB 3U6XA 2P8MA 4NKDB 4KK6C 4DP1X 3MRPA 1ANUA 3PXHA 2VNCA 2QSQA 2DLIA 3TLRA 5JHDA 3SBWA 3Q3GB 1GW6A 43CAB 1MDTA 1ACYL 1IL1A 4L3CB 4OGXH 1A4AA 2X2JA 2AXGA 3KGTA 4NKIL 3AT8A 4XHJC 3UP6A 5G5DA 1LQSR 1XGRA 5HHPB 2ZICA 1KLFA 2XOTA 1U91B 5C0AB 3NCXA 4WF7A 5I2IB 1O6VA 1VDGA 3KM2A 2VXVL 4F9LC 2W95A 3CLEL 3S34H 1UKSA 4X0KB 1KLGB 2VERA 4M6NH 3E6HB 3HEIB 4KKBD 2VR9A 5CEXA 3HLAB 1VEOA 3GMPB 1CLZH 1MCHA 4P23D 5DD5L 1CDJA 3QUZA 3L5HA 4ACPA 5IVZB 3EYUL 4Y1SA 3GIVB 4H20L 5KW9H 2CHZA 2IQAB 2APFA 1OANA 3OHXB 4I0PC 2A9BA 2EH7H 4JRYB 4TUKL 3FQ2A 4FFTA 5HVWA 3RVUD 3QQ3A 5JXAL 4U1NA 4IOIA 2CALA 1UT2A 2CXGA 2Q8BH 3SSGA 12E8L 1XAKA 1PLGL 5JIQA 4GAGL 5I75C 2ZWLT 2E9GA 3RU8L 4ETYA 1Q38A 1FH2A 5HYFA 1ZANL 1W80A 3BZFB 3GMRB 2NSQA 4ZFFA 3FAWA 4NZFA 1EEZB 4UM9B 3JWDL 3AXLB 5F0JB 3IAGC 2Q3XA 3WTUA 4NOBA 1AE6H 1P5UC 4UINL 3CD4A 4XAWH 4B9KC 1B0IA 1OGAD 3G6JF 3RX7A 4FJ6A 5F8RC 2ZX8A 2H6PA 4F7MA 4DW2H 2YN5A 4JFDD 3C6SB 5EH1A 4Q9RH 3A67H 5JQHC 5DLLA 3K72B 3EBHA 1IGML 5KJ7E 2QGBA 3K2KA 2AV7A 3L1GA 5E4IA 3WO4C 3NCCB 3M6DA 5DJ6A 2D0GA 2AXHA 2DQJL 2FDBP 5GZNA 4XPTL 2ORBH 2Z65C 1NGQL 4F80A 3H4FA 3JTTA 4NDMA 5FYLE 3WIHH 5I17B 1VFOA 3V5KA 1DLFH 2P45B 2QJDA 4I1RA 2VXSH 3S3DB 5BNXD 3BQUD 1AQDB 4U1KA 4NHUA 4AL8H 3K80A 5A2JH 1P1ZB 4P57B 4S1QH 1NCNA 3HLKA 5MEPA 2Z1PA 4B97A 3ES6B 1GKOA 1XWVA 4NNYA 3VFWA 3VMPA 1E2WA 1E43A 2DKUA 1I8AA 1E4XH 1HZHH 1I7ZB 1RZKH 2VDQH 2KHAA 3LH8A 4G43A 4N5UA 3ENEA 1IFHL 4XVJL 3V6OC 3T0EB 3WIFA 3EKCA 3TPUA 2BXZA 2B59B 3NCBB 3PGDA 3DJ9A 4H13C 5KVMC 2IAND 2W38A 4HOZA 1UASA 1SN5A 3QUXA 3M1BB 1CTOA 3EFOB 1TIUA 1OZUA 1FV1A 4N87A 3DHPA 4TL4A 3SDCA 1H3UA 2JCCF 2E7MA 4M5SA 2VDRB 5EZPA 5IB2A 5J9PB 5FKAA 1N0LA 3PY9A 4NRYB 5BZWA 3MRCA 3NJNA 1OCZB 2JXMB 1KB9K 4CN1A 3W5MA 1BXUA 4BWWA 5ITFA 4P5TB 3VRIA 2ICWJ 4FFWD 1MQKH 4UIKL 4IMLA 2NT0A 3H3PL 1AYOA 5IROC 3KEDA 3O6FC 2E7HA 3MOAH 4ZPTB 1CDBA 1OT1A 1M2VB 1F8TL 3MV8D 1S8DB 3ZKMC 2GJ6D 2GJRA 4PUBH 4QI3A 5F6HJ 3TZVD 3U4KA 4YSCA 4PJ8A 5IQNA 1X9UA 1KTLA 4UT6A 2NR6D 5DVKA 4FL4C 3GTNA 5E0FA 4NQEE 2IDSA 5FK9B 2C1OB 5D1QB 4RZCA 4XR8C 5GGUB 1WE5A 3RAJL 4IDJL 3BXNB 4QHUA 5C7XH 2PWDA 2K6YA 4U1MA 2NNFA 4K8RD 1PKQE 3G6JE 4O2CA 3L95B 4NT6B 3S37L 5GRYA 1JTPA 5A6IA 4A2GA 1T2XA 4H0HB 3TA4D 4H5SA 4IK6A 5I1DA 2H45A 2LTQC 2MTZA 4ES9A 2DTSA 4ZOBA 3RI5K 3OXRB 1W2KT 3G5XA 5E94A 2X38A 4M3KB 3OR6B 1NCOA 3KXFB 3ARED 4JY4A 5ERWB 4F2MA 2VQ4A 2ZWYA 3A4AA 3DYOA 5ICYA 4PRBB 5I73C 1TCRB 4JZJC 4PJ6A 3C09B 3H2PA 5ALCL 2SEBB 3WN5C 5JMOC 2WQSA 1M56B 2YOAA 2VLRB 1EJOL 2ADJB 5HHXH 3WLBA 2AZAA 4MA7L 4LSRL 3RIFF 1AHWC 5GISL 1MCBA 5FO7A 3ASWA 2VN7A 1BOGB 3C6LD 2V7HB 1OARL 5DUPL 2RBLA 1XGUA 4OLWL 4D0CA 4OBRA 1JV5A 3QNXB 4ZUSB 3CVIL 5ID0B 1SRDA 4GI8A 1SXNA 4PRNB 3EJCA 1E27B 4AEFA 4P99A 4XC1L 2ILLA 4PP1C 4N28A 3DIVA 3DTXA 1MCRA 2NQ3A 2VDPB 3KBHE 3UTTE 5D1XA 5IMKA 4B41A 2PO6D 3GXIA 3VI3F 5BXFA 2X1WL 1I8LC 4OLUL 2CSPA 4QHLB 1LWHA 3V0GA 2G2PA 4MA1B 1JBJA 2JCCE 2F7OA 1JI2A 4DP2X 5HVFB 4R0LB 3IKCB 4TN9A 4K23L 1R0AH 4NRXA 3FJTA 2V9QA 3MUUA 4M43H 1RZGA 2YOCA 1DQJB 2XDHA 5FLUA 3C2AH 4AUJA 1CDYA 1RK1A 2JELH 3PWLB 3KR3L 2HPTA 4Y19E 1CPUA 2BERA 3P9MA 3QO1A 5IKCB 2H3NB 5BS0B 5CN2A 1QSEB 4FYTA 5DK0B 3LD8C 3T1FA 1VEMA 2AK4B 3JWDC 1FIGH 1W9XA 2YEZB 1H8OA 3VFRA 4A1JA 2C7FA 4MB4A 1AZZC 4POZD 3O8XD 1UJ3A 1I3UA 4E41D 2EKSB 2QKSA 5EBLA 5C0BD 1F4AA 1HHKB 3V4PH 5IEKA 4MA3A 1KDIA 3KPSB 2Y7QB 3KPOA 4QTIH 4PGZA 4KK9C 2X0VA 1JTTA 2QGEA 3E0GA 2VN3A 1SNRA 1MWAA 4ZUVA 3MXWL 4GAYB 2OMWA 4QYOA 3VD5A 2BDNH 4A6YB 3VQ1C 1MCPH 4Z23A 4HLZH 3G5ZB 5A40E 5IBUG 4Z7OF 4XNDA 1FPTL 1W0YT 4NKDA 1NFIB 2MPAL 4OKDA 4OJFH 5DJXB 2YQ3A 3PFQA 2EDFA 3NACL 3CLFL 3HNSL 2RCSL 3DX1A 3P3TA 43CAA 5K5YA 5FDWB 1MF2L 1MREL 4L3CA 1E6OL 4PJIB 1OSPL 3GJFB 4PJBF 4FC3E 1WAAF 3LH2L 4F7PB 5I19H 4JPKH 4MAYB 1E8WA 1OAYL 4HS8H 5H37H 5HHPA 1E5YA 4M5YL 3LRHA 3MN8A 3WJMB 1WUZA 1U91A 4HJEA 1WBXB 3STBA 5C0AA 2D7NA 2N7SA 3CPLB 2EDYA 3LRLA 1B2YA 5I2IA 4O4YH 1NFDB 2E86A 4ZO9A 1FORH 4QUOA 3GQFA 5IWLC 5DTFB 4X0KA 1KLGA 3FSZA 4IDLA 3E6HA 3HLAA 1FN4B 3UFIA 3GMPA 5IFHH 3P3UA 4JGNA 3ZQWA 1JZ4A 2YC1B 1MCFA 3OD3A 4N22A 2BIMA 1NBQA 5IVZA 4R2GD 3GIVA 2XI9A 3UYPB 5I1CH 3H3BC 2A4ZA 1ETJA 5D1ZI 2IQAA 4MXQD 1R3LB 3OHXA 2BJMH 3GBML 5F9DC 4JB9L 4WI3A 3U4EB 2XTJC 3AQZA 4R7LA 4G6KH 1FZJA 3B5HA 4HG4K 3KPLB 3N1FC 4HCRH 2DMBA 4MS8D 3VVWA 3NDZE 3HB3C 2IJ0C 2K6ZA 1MVUB 2R29A 4ZQKB 1IZKA 5E7FA 1DQMH 2XWCA 3GMRA 3BZFA 5ISZE 4LU5H 1INQB 3C8HA 4M02A 3TC9A 3K71A 4TLSA 4DP7X 1EEZA 4UM9A 3AXLA 3D69B 3PRZA 1DTUA 2IDQA 4R8WL 3W56A 2Q9OA 5GS2H 4MCNA 4MDRA 4L1LA 1DJZA 1PIFA 2WV3A 3COOA 1LHZA 3C6SA 3K72A 1LO5B 2HP4A 5CD5C 4OT1H 4LHJB 4OGXL 5D7JD 1JPFB 4QRPE 2LQRA 4MMYB 3QJVB 3S48A 1UWGH 3D8MA 3CXHK 2MNWA 3L7FB 2BCKA 3EYSH 5I17A 3ZL2A 4MDJB 1AQDA 4U6VH 3S34L 1P1ZA 3QUGA 4P57A 3BUIA 1MAJA 1XGZA 1E3FA 3QUYD 4H1LH 2X2HA 4M6NL 2KPNA 3ES6A 3FXIC 1WD9A 4Q9CA 1CLZL 3FU5A 5GS3A 4Z7OE 4HJ0D 2OYPA 2YD4A 3T0EA 5KW9L 2FQFA 2EILB 3VX1A 4KOBA 1ZLUK 2AJVL 2B59A 5EEWA 3UYRH 1Q0YH 1VGEH 3ARFD 2EH7L 1BAFL 1ZIAA 1I1YB 5D72L 3M1BA 3CXDH 4PJBE 2E4FA 3EFOA 1WAAE 3ARWA 4WW2F 1ESOA 3JZ7A 4UYQA 3MRIB 3LNEA 2WYZA 2OMBA 4YFDB 5J9PA 4UTCA 4NRYA 5EU6D 4JRXD 3O3EB 1JGDB 3MNZB 3AWFA 4E9WA 1AE6L 2JXMA 1AOZA 4KY2A 4XAWL 3R1GH 3WI9A 3GTTA 2I85A 4LT7A 1G9HA 3Q8BA 1CFNB 3DI2B 2AEOA 4P5TA 3ULUE 4Q9RL 3A67L 4XVUD 3WEMA 5FA4B 1MNUH 2QDVA 4ZPTA 1F4XH 3CZNA 2NX5E 3WL9B 3B9AA 1CIUA 1M2VA 1S8DA 1EJ8A 2A6JB 3OHMB 1ORQB 4QLRA 1OAQH 1X6LA 3F7YB 3EADA 2ORBL 3NQIA 3WIHL 4XMTA 1PVHA 1DLFL 3MQIA 2BWIA 2VXSL 4MD5B 5FK9A 4AM0Q 4AL8L 4M93C 1XGQB 2C1OA 3HS9A 5D1QA 3KS0J 4PB0H 5IIEB 3ARUA 5GGUA 1L5GB 1BDYA 2VZUA 4S1QL 1RIHH 3BXNA 5A43C 5ANME 5J1SC 3WFEH 2OS7A 4PJXB 4I3RH 3BPCB 2VDQL 1E4XL 1HZHL 1RZKL 2C3WA 4M7ZC 4XBGB 5CF3A 3L95A 2O6CA 3K8KA 4NT6A 3UXFA 3EOAB 1TENA 2HFEB 2X2UA 2ZXBA 5DHDA 5AW6B 4IMKA 3ABLB 3OXRA 4BE5A 5JXEA 2YEQA 2C4FU 3H7LA 3OR6A 2QQNH 3KXFA 4E9QA 5ERWA 1U95B 3SJVD 1N26A 1YEFH 5C6PB 4NQTA 4PRBA 3GM8A 1TCRA 4FJYA 5TK4A 4GRWF 2C3GA 3JWNH 3QDGE 4YO0A 2SEBA 3SCMD 1GTFA 3AADB 4URTB 2X10A 2GJPA 2VLRA 2ADJA 1BXAA 2A9DA 4DFIA 2GITB 2QPSA 2YAMA 3QQNA 4NBXB 3QJXA 2W0FB 4L4VD 5HHNB 2V5MA 1T66D 1BOGA 4WV1B 1ZATA 2V7HA 4NJAH 4V1DD 2WWOA 2HWZH 1HHGB 4UT9A 2A1WH 4XO3A 5D7IB 4YXKH 3QNXA 4ZUSA 5ID0A 1MQKL 4JQXA 3DV6B 4PRIB 4PRNA 1OW0A 2JIXD 4K7PH 1E27A 1MG3C 4ANWA 2X4SB 2OYKA 1VZHA 4NCDA 2DIBA 4XP4H 2OKMA 3DHUA 3T8MA 2V0AA 1S78D 5D93B 2X09A 4G59C 1IEBB 4PMEA 5E6IC 1MIMH 3L4ZA 8PAZA 4PUBL 2OMVB 3WNKA 3KH3A 4Y4HB 3ESUF 3IRZA 3BGMB 3SO5A 4QHLA 3L4TA 1MW1A 2L3BA 2BO0A 2HAZA 5D55A 5C08B 4R0LA 1PZ5B 3IKCA 3F5WB 4R4NC 3HTLX 2VABB 1WUNT 2NX5B 3U1SH 5C7XL 1DQJA 2PP7A 1IGCH 4UMGA 4MAZA 5LB1A 3PWLA 2X6UA 1UB5B 3S9DB 1XXDC 3BWZA 5IKCA 1KB5B 2H3NA 5BS0A 3PFUA 3PNWB 5DK0A 2KMWA 2IAAC 1TEYA 3MJ8B 2AK4A 5JPMC 1XAUA 3OPUA 2CO1A 4W9LC 2CCLA 2O6FA 2BVPB 2YEZA 3ECWA 1SYVB 4BFFA 4F8QA 3S2AA 3UEQA 2O5XH 4GRLD 4MMXB 3EUDA 2AQRA 4QAWA 3VI4E 4ABQA 3QZMA 5ANMB 1V27A 4PSPA 3QAQA 2EKSA 2XWZA 3N40F 1HHKA 3NCMA 1IGIH 4CJ0A 1ZXQA 3SOBH 3KPSA 2Y7QA 1DCEA 3TASA 4WHCA 2F7QA 4GXVL 4NEHB 3SKJH 3VD2A 2R69H 4S1DD 1UZ6F 4GAYA 4NAQA 4OIAA 1U8NB 4KI5E 3A21A 4MVBD 3S3BB 4A6YA 3CFJB 3UBGA 4ZRGA 3OKKB 3G5ZA 1CF8H 4OD2B 2AP2A 4RNRB 1NFIA 3HMXH 1IGYB 5DJXA 5E95B 2B9BA 2JQAA 4QRPD 4JO5A 1IT9L 5K69A 2CCVA 4QRTB 1DLHB 2E9BA 4LSTH 5JOFB 4KZCA 5FDWA 4IS6B 1JCVA 4HLEA 2PWEA 4PJIA 1OF2B 3GJFA 3QIWD 3RWHB 1QFUH 4ABWA 4FCHA 4F7PA 2V2XB 4MAYA 2QADC 1RZJL 1E42A 3WJMA 4B50A 1FZMB 3Q1EA 5F0LB 3MYJB 2BOLA 1WBXA 1TNMA 4D8OA 3CPLA 3WE1A 4JE4B 1R0AL 1E0OB 4KGLA 1NFDA 4PI0A 5KSUB 1J48A 3C2AL 2JELL 2YPVH 5DTFA 4J12A 3PHAA 4EJ1C 4UQ2B 4PJEF 2FLRT 2FQDA 4X5RA 1FN4A 5F7MC 2YC1A 3AMLA 5J6SA 4X6DF 1MELA 1FIGL 2ZOLB 2AXWA 5DEJA 3NPSC 3UYPA 2EDNA 1HSAB 4KKCD 4JRLA 1NOFA 2WBJB 2Z7YA 4R5TA 1R3LA 3DRQA 4QGTA 3U4EA 4N2HA 5K9JH 2Y5QA 3V4PL 2BIHA 3MLTB 4QTIL 3KPLA 4FERA 2VDKB 2K0RA 4ZXBC 4BQ6A 3LAFA 4ILDA 4N3UA 4P4RB 3Q2VA 3K81A 1MVUA 4ZQKA 4F7CB 1INQA 1ZHKB 2OTWB 3O3DB 1JE6A 2WQXA 4KUCF 3D69A 3ZZ1A 1EX0A 1OZTG 1MCPL 2DY2A 5IZ7A 1G9NH 4JCMA 5HHOE 5EDXA 2HX9A 2IC2A 5I6KA 5AG8A 5TFSH 4AL8C 1YC8A 2E59A 3BN3B 4K07A 4OJFL 2XZZA 4AZ8B 1T89C 5GSRB 3FQYA 1LO5A 3EGSB 3QFJE 3TVMD 5ESAB 2QVKA 3VWJB 4L5FE 2X6AA 3PJNA 2NY6B 1FLRH 4FXTA 4MMYA 3AITA 1N7MH 5I19L 4DUXA 1KTBA 4HS8L 1GZHC 3FOLB 3L7FA 4NFCA 3DJRA 1P4BH 5LGKA 3OAUH 4A2FA 4DP8X 4ODXB 2WINB 4F91B 1QQDB 5EDSA 1DDTA 2V5SA 4MDJA 1NCIA 3BP6B 1FORL 1CS6A 1UXWB 3ULVF 3O2VH 3KGUA 4ZO7A 5E9DE 4G9FD 3FO1B 1MFBL 3CHQA 4JG9A 3T2LA 5B1AB 2VWEC 1TTGA 3GKZA 1WTGT 4FQQB 5IFHL 4K8RH 4FN0A 3QQ9D 1BQHB 4F15B 1CGYA 2ZOKB 4L05A 1BFVH 5B8CB 5CEZE 5DYOB 5I1CL 1JHLH 2QFPA 2BJML 1U8QB 3BVUA 4G6KL 4MMZB 2BIPA 1I1YA 1NWPA 3CX5K 4G3YH 3V6BR 4EUPH 4XVOA 2XYBA 1SN2A 4NQDB 4BDVB 1OLZA 2ADIB 3PWPE 3MRIA 3VXME 2F68X 1DQML 4XMXA 5LQBH 3ZKNC 1UKQA 1QFWM 1AG6A 1QSZA 4N2GA 1JGDA 3MNZA 4PGCB 4AEHH 4YFLI 4AX3A 5DVNA 1CFNA 4LP4A 2RQEA 1B4JH 3UGUA 2WB1A 3PL6B 4X9BA 3OGOE 5FA4A 4EBQH 2Y22A 4G7SB 1SYSB 5BO1H 1C08B 2XN0A 4A2DA 4Z18A 4OT1L 4JO2H 4U49A 1OK8A 2Q20A 3QCVH 3WL9A 5TH2B 2YPLD 4FLRA 2DMKA 3VXUB 2A6JA 4APQB 5EIQA 1ORQA 3CK0H 3L5IA 3F7YA 1S9VB 3C6EA 2IDUA 4WO4C 3EYSL 4EPSA 2VN4A 2ADFL 4MD5A 2UUDK 4U6VL 1XGQA 4LRIC 3QJHB 4JN2B 5IIEA 1SGKA 4PV9B 1FFNA 1L5GA 4ZS7H 2FLBT 3ZMEA 2HKFH 4YHOH 1HNYA 2YARA 1YN6B 4PJXA 5DUBB 3BPCA 4XBGA 1OB1B 1YPZB 3P4NB 4PCTA 1OO2A 2YAQA 3EOAA 1DE4B 1EFXB 2HFEA 4UV4H 3QDJE 5F1OB 4QNPF 5E2UH 3AZUA 2FL5B 4UQCA 1VGEL 5C2UB 3KYAA 4OFVA 4J3VA 4D0DB 4N6QA 3CXDL 5DQ9B 1HAWA 2PXYD 4JHAH 4FG0A 1U95A 5IQ9B 5IJDC 4S2SB 1RLBA 4L29B 2Z35B 1JXDA 2HA1A 4LOFA 2FO1A 3NG5A 3RIAF 4OV6F 3DJSA 4U1LA 4DP5X 4JHWH 1AS8A 1GOHA 2GITA 1SOXA 3L2MA 2W0FA 5HHNA 4IGBB 3HZ3A 3ULVE 4N1HB 1RZJC 4WV1A 4AH2B 2C8NA 2F6AA 1TTUA 1ED3A 3GSNH 2EXYD 3QI9D 3DGGB 1HHGA 4Q14A 4PU2A 5D7IA 3OR7B 1FYTD 1GRWA 1MNUL 3VXMB 2WXFA 2C9PA 3DV6A 4PRIA 5D2NE 5I8OH 1JWMB 5SX4I 3OKYA 2RHEA 1F4XL 1P7QD 2MQCA 3HAEG 4R96B 2X4SA 4UDUB 3FU8A 3SB3A 4YK4C 1I9JH 1UD8A 2J8UB 1IEBA 2OMVA 3PQYB 5FYLH 4Y4HA 4DGVH 1OGTB 1B4TA 3BGMA 4XO9A 5KSAC 5FF6B 1FSKB 5HHVH 3ZN6A 3HFMH 2BY3A 2HT4C 1UENA 3FQTB 3LXUX 4I8DA 3EJYD 4UWQB 3NOIA 1PZ5A 4PB0L 1CTNA 2KLTA 3F5WA 1XQ4A 1RIHL 2VABA 1XCTA 2NX5A 2BIIA 3WFEL 4LHQB 2OR7A 4XC3H 3TIDB 2YLKA 4I3RL 4TPRH 1J5OH 4NUJB 1E50A 3ZMRA 2Z92B 1KCWA 1KB5A 1P69B 2QPDB 1F11A 3PNWA 4FFVD 3GBNH 5F2FA 3RIKA 3MJ8A 4ZAKB 1DQLH 3QUKB 2BFVH 4RLDA 2B5IC 3DX3A 4AMWA 3TA3C 1R3IH 2BVPA 4YSSA 5IHWA 4GUOA 1SYVA 2EDDA 3HCVB 4MMXA 3POHA 2QQNL 5ANMA 3BAJA 2QPEB 4NI6A 1YEFL 4LBEB 4C4KT 2IAMB 4CC0A 1RURH 3OQ3B 4OU3A 4KK5D 4PV8B 4N8UA 3FYIB 1WISA 3GBDA 3SBQA 4FNUA 4PM1A 5HHOD 2BS9A 3R7RA 3CLWA 1UCTA 4JGMA 2JJUA 1U8NA 2WNWA 3EDEA 4ZDHB 4NJAL 2HWZL 3OKKA 3IWUA 2A1WL 3DROB 4YXKL 3QFJD 4OD2A 5TE7L 3REVB 4C58B 5EEUA 2VLME 2ZOTA 2BHUA 4RNRA 5I24A 5MHSE 3HAEH 3QT2A 4K7PL 2CJ3A 4N2MA 1JZ3A 1KGIA 1ZS8B 4QRTA 1DLHA 2OW6A 4XP4L 3VCLB 4IS6A 4OJDH 2RD0A 1MIML 1OF2A 3DO4A 5CGTA 3RWHA 4GQZA 5FEBA 2V2XA 2B1AH 4U2YA 4YDLC 2Q7YB 1NAMH 2FGWH 2J73A 2VLJD 1FZMA 3MYJA 5E9DD 3KYNB 1M42A 3MHZA 4Z7UE 3C5XA 2X42A 1U3HB 1HXMB 2VDNB 3U1SL 5DU7A 1WC7B 2ZZUT 2ZNWA 1IGCL 3FAXA 5EZJB 5AW0B 5KSUA 4ZW8A 3RVVD 4D2NA 5AFAA 1T0PB 4A7QA 1NMCB 4NN5C 4NX0A 4UQ2A 4XOAA 5DQJB 4DO6A 4EN3B 2VDMB 4R3SB 4RETB 1A3LH 1KF9B 3V8OA 1CGVA 5ITBH 3F7LA 3PHSA 4M1CC 4F9PC 1WO2A 3HI5H 1HSAA 4Q7DA 1IZJA 5IK3B 2WBJA 3FRUB 2J1XA 2O5XL 3LNFA 1KULA 5CINH 4L0PB 4OZFH 3DUHA 3PWPD 2XIDA 1D6VH 1IGIL 1W72L 3SOBL 3ZDYB 3MLTA 4M3JA 2XXGA 3LIZH 4P4RA 4OI8A 1SY6A 4LVNC 2R69L 4F7CA 1QZNA 4OAWB 4L1DA 4FZEL 1ZHKA 2OTWA 3O3DA 5C6WH 3SE3C 1TG8A 4RX4A 5IESH 3VI4A 5I6PA 2JJTA 5JW4Q 1AZVA 4U1JB 1CF8L 2KUTA 4CMMB 3AGWA 4RDQF 2JJSC 3LB6C 2QLVB 2MCAA 1NCDH 1AO7B 3HMXL 2A9AA 5LGYA 4B9PA 3BRDA 1OOAA 4KJPD 4WJG3 2LFEA 3IE4A 5E9NA 5GSRA 4BZ2A 3GZKA 1AAJA 3EGSA 5DVLA 2GTQA 1L6PA 4I2XE 4LSTL 5ESAA 3VWJA 4ADGA 2WANA 1QSFB 1GYWA 1Y07A 1S9WB 1Y0LB 1QFUL 2BNRD 5CLYA 3ZQDA 5KS9F 4GY4A 5H4ZA 3FOLA 2A6IB 1T21B 1URZA 3Q6GH 3W38A 4LP8A 1D5RA 2Z31C 4FFZL 4ODXA 2WINA 1QQDA 4LZHA 1HE8A 4AT6B 5AVUB 3BP6A 1UXWA 2FT7A 3FSWA 3HG3A 4ZOAA 2YPVL 4NO3B 3NJVA 4Q6IB 4ABVA 3P0GB 3FHEA 3NEXA 1FUNA 3FO1A 3O4LE 2ZX5A 3EW3B 1L9QA 3B2UC 4FQQA 3QWRD 4BCYA 1QVOB 2DIAA 4TVPL 3JT2A 1L9OA 1LEIB 2XSKA 5AWNH 1BQHA 2EUWA 2ZOKA 4HETA 1CQYA 2B08A 5DYOA 1OCWH 2YRZA 3QK0A 4X8GA 1P1VA 4L4JA 3CBRA 4AK1A 1U8QA 2L7JA 2BSBA 5K9JL 4MMZA 2VIRB 4XI5C 5IJCC 4WEEA 4NQDA 4BDVA 1K72A 2ADIA 1BJMA 3RJQB 4FHJA 2NXZD 2XYCA 5D71H 3VDBA 2AS5M 4LLWB 3ABGA 4XXCC 2JK5B 3IGAB 4NC1C 4NKOB 5KUMA 4HC1H 2OZ4H 4PGCA 5EN3A 5L7XH 1VFBB 3CNKA 1B0GB 1EH9A 1TQUA 3WLWC 1T04B 5HBBA 5F1KC 4K0OA 2P80A 4FHKA 5TFSL 5FGBA 1U58B 3NGBB 3TV3H 3PL6A 5CWSB 5L4FA 4CMHB 5CJXA 1SYSA 4LZKA 4YE4H 4FTVB 1FC2D 2AQNA 2QL1A 3BMWA 5EA0H 5F7YC 1DN2A 1FLRL 15C8H 3QUZD 5TH2A 3P4MB 3VXUA 1N7ML 4APQA 1GIGH 3VNZA 1S9VA 2H0FA 2D31B 1P4BL 2ESVE 1XL6A 1A3ZA 1FCCA 3M7OA 5I18H 3OAUL 5KANI 2BVOB 1O7SA 4PJ9C 3QJHA 4JN2A 3O2VL 4PV9A 3IMVA 4JZOB 3B83A 4NZRH 4HLJA 5K33A 1UD3A 1YN6A 5DUBA 2FBRA 5F7DB 4K8RL 3GSXB 2I9TB 1WGOA 1OB1A 1YPZA 3P4NA 5F8QC 3E2HB 1DE4A 4KKZA 2LLNA 3PAZA 1JHLL 2FL5A 4DKEL 1S9YB 3KVPA 4PGDB 5EZOH 2D7QA 4GSQA 4G5AA 1SJXA 4G3YL 4PW4A 4D0DA 1F1GA 1HYRC 5DQ9A 3U0WH 2OCFD 5B7FA 2NY4C 2BVQB 4JY6B 5IQ9A 3I6LE 4S2SA 5KS9E 4L29A 1IBDA 2MPVA 4U1SB 4X99B 3RPBA 3SYAA 3UCRA 1CR9H 2FH6A 2M2DA 2Z35A 2YD0A 4ZNCD 4NQSB 3TU6A 5LQBL 5ICZB 1N6VA 2HVJB 2OMXB 1JP5A 1RSYA 1RK0B 2HLEB 3V9EA 1E4XI 5I26A 4IGBA 2QVMA 3RX8A 1AXSB 2XV2A 4DOHE 4AH2A 3WS6C 3L9EA 4PWIA 3L4VA 2R7EB 3O45B 1E4KC 3DGGA 4P9HC 5CD3B 1B4JL 3OR7A 4BK5C 5E5RB 4BUQA 3VXMA 4EBQL 3W11C 1JWMA 1TDQA 4F2EA 1VA9A 4JO2L 4RWYH 1G9MC 4R96A 3QCVL 1UG9A 2YAOA 4UDUA 3KG5A 4FTDA 2CDEB 4KKBC 5H94B 3OKNB 4EI0A 3SIKA 2J8UA 3QYMA 4P23C 4JBSA 4WWKD 3N43B 5FDYA 2IO5A 1DVTA 2ZF8A 3BP5B 3PQYA 4BJLA 1OGTA 5KYUB 3F84A 1GY1A 5FF6A 3KNBB 3OM3B 3KJ4B 4KK8D 4I3SH 3FQTA 4QHPA 3RVUC 4F7EB 3GLEA 4ZS7L 4DGIH 4J27A 2EUVA 1F3JB 2HKFL 3GINA 4YHOL 2YUXA 1W91A 3TIDA 4P49A 4NUJA 4GP8B 2Z92A 3F6IA 3P0YL 2KLSA 3RTQD 2C3XA 3AG3B 4ZAKA 3QUKA 1JF1B 4Y9CA 5E2UL 5HSFA 4XWGL 4MKMA 4HZLB 4U1GC 3P54A 2R56H 4Y2LA 2DW5A 3HCVA 2ICES 5A1AA 4JHAL 2R83A 3FUKA 5IFAH 4LBEA 2IAMA 1A22B 3IS0X 4KXAA 2X3AA 2IV9A 4OFIA 1K3ZA 1JDAA 2EINB 4PV8A 4NKQB 1BVNP 3AM8C 3KDPB 2BSEA 3OB8A 4LIQE 4P2AA 3DGDA 1F4HA 1DBJH 1VFAB 4LPCA 2AMUA 5TE4H 1SM3H 1OY3B 2DQIH 3NCFB 4MCZB 2X7LB 2DQCH 2P4AB 4ZDHA 4L3EB 3SQRA 1E4WH 4M1GH 3WNJA 1Q8MA 3GSNL 3IDNB 2WQWA 5JLZB 2EVJA 2ED6A 3DROA 3ZE2B 5T5NF 3WENA 3REVA 4AMXA 4DGYH 5DD0H 4E9XA 5C6TH 5I8OL 2EKJA 2KZKA 2OFQA 3DARA 2W0KA 2I69A 3TEYA 1ZS8A 3SDAC 1HL4A 1I9JL 4QRRE 3VCLA 1QW9A 2JKLA 1BVKB 4MHHI 4ZFGL 2HH0H 2WXNA 5IW3A 1IAIH 1X5AA 4DGVL 3ARRA 4R90H 1MH5B 3MJGX 5HHVL 4DK6A 2Q7YA 3HFML 3G6AB 4K3JL 3JYBA 3KYNA 3QG7H 5J13B 3O4LD 1U3HA 1HXMA 3BAWA 2ZUQB 1L7IH 1WC7A 3RVTD 1TZ8A 5EZJA 5F9JB 4TPRL 3S8GB 1J5OL 1F02I 3L4UA 1YG9A 2APTA 4GFXA 2DEXX 5FIEA 2WNGA 3L5JA 5DQJA 5HJGA 4EN3A 3GBNL 4R3SA 3BLBA 1DQLL 1IAMA 2BFVL 3HG1E 4AQZA 1GOFA 1YMHB 3MACL 3BVNB 3U6XS 1MCWM 4RGNB 4AYDC 3TFKD 5IK3A 1T1WB 3FRUA 1EAQA 1L0QA 2VC2B 1FC1A 4F57H 2F74B 5AUMB 1RURL 1BBJB 4PY7B 5HPOA 3QEQB 5J0BA 1FZOB 3D3VE 3T1WA 2PWFA 4ODBD 4YX2H 5EEZA 1BF8A 4OAWA 4HBCH 5MP6H 4XMUA 5F21B 2L7EA 4X7EC 4W9JC 3TZVC 1CQKA 2KDGA 2G4EA 3I3EA 1EHNA 4PJ7F 2QELA 3QORD 1ZJBA 5ICXB 4U1JA 4CMMA 5E8EB 5LGHH 4KV5F 1WJ3A 5IB1B 3F65A 4J8RB 4RMWA 1AO7A 3FUFA 4PVBA 1UD4A 5GHWH 3UBXG 1M6OB 1DVXA 1YRKA 1VRSA 2EYSB 3ARBB 5LN4A 2XN9E 2YS4A 1QSFA 4UOW0 2HRLA 1S9WA 4I18B 4FLSA 1Y0LA 5ACLA 1RH8A 3WTYA 2B1AL 5CFAA 3N41F 4EF3A 1FIEA 1G7HB 4X8JB 3SODB 1LK3L 1NAML 2A6IA 2FGWL 1T21A 3M7FB 1BQHG 4BFGA 2NY7L 1QYGH 5AW7B 5FUCE 3ZY7A 4EZKA 3FYEB 5A16B 5DZ9A 4AT6A 5K93A 2B3IA 4NO3A 4Q6IA 1ZV2A 3OMNB 4F24A 5E08H 1BWMA 1REIA 1A3LL 2CHDA 3OZKA 3ZE0B 1QVOA 1NFAA 2VUYA 1LEIA 2EE6A 4H8VA 3TEXA 3APNA 1NFDF 1QX1A 4XMZA 5IMMB 3KMDA 3HI5L 4HSCX 3TVMC 4O02H 3I6LD 4NLAA 4NWTH 5DS2A 3FW6A 2QZQA 1D6VL 2VIRA 4J3BA 4WK0B 1OP9A 2ZG3A 5HGDB 3GJEB 3LIZL 3GYRA 3B56A 4YDKL 3MV11 4A2MA 2LU3A 3CDCA 4LLWA 2JK5A 3IGAA 3K46A 2YUWA 4NKOA 5DD1H 2NNRA 4KROC 5IESL 3FFDB 1VFBA 4BA0A 1B0GA 2GI0A 5C0AD 2PR9A 4KC3B 3AUWB 3WS3B 2GC7C 4YSTA 5KZCB 4N90E 1XSKA 1OOWA 1ZV5A 4JNXA 2Q2EB 5DMIH 3VWKB 1NBYB 1U58A 2L04A 3MKKA 5D6CB 5GS0D 5CWSA 3MNVB 3FTGB 1Q9LB 1GC1H 3HC4H 4FTVA 3QWQB 3EH3B 3UAJC 3QYNA 1K8IB 3EO9H 2V3FA 3P4MA 3PGCB 1XHHA 3VVVA 1H8NA 3SOTA 4GRWH 4YBQD 4QHKJ 2D31A 3Q6GL 5DUMH 1T7VA 1U2CA 4FXGB 4JRYD 3M8OH 5L0QC 4S10A 3UG3A 2VKWA 2BVOA 1NGYB 3ATEA 4QJ5B 4XO4A 4X2UA 2A4EA 4XZ4A 4WRLA 4JZOA 5FHBH 1T7WA 5GZOA 5F7WC 5F7DA 3GSXA 1A4KB 4Z78B 2I9TA 2VL4A 3LNIA 4KV5E 5AWNL 4YHIB 4UNTA 3HN8A 2FWUA 5E1HB 1CICB 1OCWL 2LVEA 2NDGA 1S9YA 3IMUA 3KPPB 4PGDA 4ENED 3G7TA 1TMQA 1KSRA 4F58H 5KYNA 1N18A 2YRPA 4L48A 1D7CA 4JY6A 2BVQA 1FL5B 5F7LB 3WXWH 4X99A 4NRZB 1X4XA 3PP4H 4BFNA 3WNLA 4NQSA 1JIBA 1EEYB 2ENJA 5ICZA 4Z7VF 2UX6A 2HVJA 2OMXA 4HC1L 1GYUA 5D5ME 5TDNB 2OZ4L 1RK0A 4AKPA 1QEWB 5L7XL 4KNSA 3OVUB 5FGSA 3T08A 1VZIA 4Z7IA 3ME0B 1AXSA 2HJKB 2BP5M 4X5LA 4ZZKA 5FB8A 2R7EA 3O45A 2QPFA 5HHMD 5CD3A 5I74B 2JH2A 4UTAA 4FQLH 3ZIYA 1RQ5A 1UC6A 1ADQH 4ODVL 4L5FH 4YE4L 2FHBA 2F15A 5EA0L 1QPXA 2IH9A 2CDEA 4IBZA 1LMKA 5H94A 3OKNA 1GIGL 4QMEA 1MCCA 4P4KB 2VJ0A 3BP5A 4EIUA 4OFDA 5I18L 5KYUA 3KNBA 4U3CA 2JI1A 3FBQA 4UM8B 3IPFA 3EAKA 5B7MA 1RPQA 4JLRB 1UWXH 1XGYH 3GS7A 3WKQA 3D48R 4F7EA 4NZRL 5EEXA 3FFCE 2HTKD 1F3JA 1KY6A 3HC2A 5D7SH 5ESQB 2ARJB 4A37A 4MS8C 1F5WA 4LEBA 5L6YH 4E68A 1MFVA 2X53A 1JF1A 4HZLA 2XXCB 4OB5L 3FN0H 3NIDB 1O5PA 1BG9A 2NY3D 1U93B 1RP9A 3CFMA 4FQXB 4IBSA 2DMHA 2XACC 2YAEA 2I9LB 3U0WL 3L9YA 3D3VD 3OBAA 1QLEB 5C0JB 4HIXH 4YPJA 5I15H 1ZA3B 1HH9B 4G70B 1K5NB 1CR9L 1DBMH 2VCOA 2QVFB 4HDIB 1G7JB 1ZT4B 3DOHA 1VFAA 1KBGH 4L0YA 4JPWH 2X28A 5AZUA 1I1AC 3C5ZC 3FONB 4MCZA 4O2FB 2X7LA 3WEOA 4L3EA 1B4LA 2FEDC 3IDNA 4YVNA 4TRPH 1W16A 3ZGPA 4Q52A 4PTTB 2SODB 4WENB 2OZNA 1IVTA 4UNIA 3QUYC 4DN4H 4JFFD 2WXKA 5D5MB 1YJDH 2ODIA 2I32A 3ZYJA 1BVKA 3ZLQC 4DESA 4ZMPA 1ASPA 1ZE3H 4WI0B 2OL3H 4LARH 4HJ0C 5D7IF 3C9NB 4ABUA 2YKKA 1MH5A 1IC7H 2AV1B 4U2ZA 4TNVK 4HOXA 2W9LA 3G6AA 4R26H 4XWOC 3ARFC 4K3EH 1Z9MA 1S9XB 5JW4N 4LCWD 2OSYA 4X9YA 4OKVB 2XIIA 4DGIL 4CC4C 3ESOA 1F6LL 2JKSA 3FU0A 4UQEA 4H8WH 1EZLA 3HHMA 4AYFB 1RZIB 2YXFA 3VDCA 2CO4A 2YN3A 5DJ8B 1ORSB 1G1OA 1NA8A 5AVQB 2CNZA 3A6BL 2WWMD 5I8EB 2DEYX 1YMHA 1QPPA 1WFNA 3BVNA 3VFPB 1YNKL 1VKXB 2R56L 3BEVB 1T1WA 2EE3A 4BSJA 3FFCB 2F74A 2VXQA 5IFAL 4MYPA 5HGGS 5AUMA 1HXYB 4XVUC 3NZ8B 1S5IL 3RA7H 1BBJA 4IBLT 4PY7A 1ZPLA 3WDIA 3VXNB 3QEQA 2YZ1A 4DZBA 2VDOB 2WCSA 5BQ7B 1FZOA 2EVGA 2R1XB 2V8LA 1WTLA 2OSLB 3ULVH 4L8SB 3WKPA 1DBJL 2H41A 4G7VH 5TE4L 1SM3L 3GSQB 4Y9GA 2DQCL 2RJMA 1CXHA 1E4WL 3O9WB 4M1GL 3VA2C 4NM4H 5FFLA 4JR9H 5ICXA 4GINA 3RI5F 3NP3A 4W9DC 1UH3A 3HRPA 5DD0L 2J6EH 5E8EA 5IB1A 4DGYL 5C6TL 4J8RA 5JHMA 3S98A 1DYZA 3ELQA 5JIPA 4YSPA 5L8LB 1M6OA 2BWQA 1XT5A 5BRQA 1HEZB 2EYSA 1QSED 3ARBA 1L6ZA 5M7QA 2R2HB 3EDKA 2AK4D 1ULVA 4GG8A 2HH0L 2E46A 2E7CA 3ZDXB 3H6AA 3VYPA 4R90L 3QEHB 1G7HA 4X8JA 4XB3A 5CILL 5GJSH 3V4VB 4DKDC 2F1AA 3FU3A 3E6FB 3QG7L 3DOIA 4R7XA 1GS7A 2YA0A 5MEND 2Y1YA 3IETB 2AITA 1L7IL 5A16A 5I0XA 2R4RH 3LPOA 2XWXA 4WUUE 2CK0H 4Z9KB 1CD1B 4WI5A 4J5VA 5DJCB 3V9FA 2DH2A 1UWEH 1D9KB 1NCJA 1DEEB 3HC0B 1D5ZB 1UH4A 2E47A 5IMMA 4ERSH 2A4CA 1CT8B 1N6QH 1TTCA 2HFTA 1SLWA 3T0DA 2IALB 3S4SB 3Q8CA 3ZRFC 2YJLA 4NCC2 1DQTA 1AD0B 1SUHA 1F00I 4NCC1 2L0DA 4MCMA 4AV0A 1YEGH 3B2PA 2FWOB 5HGDA 2EECA 3U30C 3GJEA 3QIUC 5KBNC 3X17A 4P0DA 1Z0MA 2VOTA 4YX2L 4GAAA 3I6GB 2WPGA 4R84A 5MP6L 1U8JB 3LN9A 4O9HH 4UQIM 2FHCA 4LVOC 4MAYD 3IVKB 4PY8J 4EXKA 4IRSB 2DWYA 3FFDA 3GMQB 2PLTA 1XFPA 1XGPB 3P3YA 1FNEB 1QNZL 3WS3A 2E7LC 3RDTB 5LGHL 3WTWA 2E27H 2P26A 4N25A 3VWKA 1NBYA 4UCFA 4YZWA 2EXWD 5D6CA 2OAAA 5HDLA 1JERA 3FTGA 1SVCP 1Q9LA 3LZRA 1F1AA 5CMAB 1K8IA 4IKNA 3PGCA 2V5RA 3KVQA 4TULH 2CBQA 4EI5B 6TAAA 2Q86B 2AI0H 3ZO0A 3QIBD 3M88A 4U31A 3AT0A 4ZMNA 2P28B 4FXGA 1QYGL 5T33H 4KNUA 1ZJAA 5AVRB 1GJIA 4GRLC 4GLRH 1E8XA 5FUOH 5KVFE 5EU7E 1IKNA 4PREB 1ZA6B 2EDMA 3BKYH 5GS1C 4J4PD 1A4KA 4Z78A 4P46A 4PGBA 1JXJA 5C2BH 4YHIA 3ML8A 3ORJA 4DKFL 1FFTB 1CICA 3NZUA 4HHAB 4WHYH 4O02L 1X5ZA 3KPPA 4NWTL 1BEXA 4BZYA 4NYLB 4WUUB 1P7KB 4IBYA 3KPTA 5JA8B 1FL5A 1KXVA 1O9VA 3VA6A 2XIBA 5MEQB 4NRZA 4R97B 4PJFB 2VDLB 4XTRD 5CJOH 2M83A 2JKIS 5DD1L 1EEYA 3SEPA 3U48A 2H3KA 3O0RH 4GKOA 5TDNA 3ZL4L 3HE7B 1QEWA 4FX5A 5BRZE 3C8DA 5BQDA 2HT2D 2H2PD 3ME0A 2HJKA 1DJYA 4UT6H 3KWVA 5F7KC 2R59A 3BSGA 5DMIL 1MFMA 5ANHA 2IGTA 2YHGA 1BFTA 2EDHA 2VM3A 2VRKA 4JFHD 2EICA 1GC1L 3HC4L 3EZ8A 2HLFC 1OGPA 3L5XL 4WEMB 4P2RB 3OB0H 2J5LC 1HCYA 3WGVB 4P4KA 3WMPA 2WSKA 3J2PA 3OKLA 1MW2A 5F70A 2H7WA 4UI2A 1GYVA 4KKCC 4UM8A 1LO0H 3KLSA 3SDYL 5HY9B 1J8KA 3ZPDA 4JLRA 4PLOB 1WZLA 5FHBL 3IAPA 3K6DA 1L9MA 1IFGA 1T83A 5ESQA 2ARJA 2NY5C 2KQNA 1WICA 3CXFA 3H9SE 1KXHA 3JVGA 4HFUH 1NLBH 3DVNB 1IX2A 2IFFL 1ONQB 4LSSH 5J6GB 1TQTA 4BZ1H 3S88H 3V9CA 1B3JA 3IFOB 4O58H 4PS4H 4XO8A 1M7IB 2GSIB 1JZ6A 2OSXA 2COQA 4PJ5E 1U93A 4FQXA 1ZLVH 1HHIB 1VPOH 1NEPA 3BUBA 2I9LA 4F58L 4CA4A 2NY0B 2ZJSH 5C0JA 3BO8B 1S46A 3D85B 3QZLA 4PQXA 3WXWL 1ZA3A 1HH9A 1H15B 1K5NA 4UAOC 2Z8RA 4AC4A 4LNRB 3PP4L 2DM2A 2Y7OA 4HZAA 4P2OB 4HV8B 1JPGB 5EUOE 5LAXB 3VTAA 3D0VB 4OY9A 3VDAA 1EPFA 3KBFA 4HDIA 5AW1B 1G7JA 2YBGA 1ZT4A 3NMEA 4ANVA 4LGPB 3GNMH 3FONA 3VD1A 4O2FA 4PRPE 1MUJB 1MY7A 4JKWA 4G8AC 2IGFH 1V54B 4QO1B 2FATH 4PTTA 4FQLL 1QATA 4LHUD 3FUHA 1ADQL 1JXKA 1YLBB 2J4WL 4J1UB 1E4JA 2F53B 4L5FL 1W15A 4GXFA 4P59H 3VGDA 3P0VH 4JGJA 1OD7A 1T7XA 3RUGF 5EU4B 3B9EA 4LLQB 5D5MA 1T6WA 5LXGH 4HEPA 1I82A 4GEJA 2OTPA 1KYOJ 3QR0A 4PJCB 4WI0A 5JHLA 4HA1A 1R3KB 3EJZD 3GXDA 3QQ9C 3C9NA 2GSGB 4JG1H 4X4YB 2AV1A 3GLDA 3JUZA 4K73A 5T5FA 2AEQL 1AKPA 1S9XA 2EYTB 4OFQA 4OKVA 3T4AB 4MB5A 5D7SL 1GL4B 5HHQB 4MBRA 4ATWA 2JKXA 4DVBB 4AYFA 1RZIA 2O6EA 3O2DH 5L6YL 5DJ8A 4JL1A 1ORSA 5L4MA 2I5YH 2HRHA 4NGHH 3NVQA 5I8EA 4BHUI 1OAKH 1CF1A 3LRGA 4N3TA 3WNMA 4AC2A 4DETA 3FN0L 1TJHH 3VFPA 4AGNA 1VKXA 3BEVA 1Y7VA 4YXLH 3SQOH 3FFCA 5DLMH 3TEWA 3PWJB 3ISRA 3TPKA 2UWEE 2KKQA 1KGUA 3BN9C 1HXYA 4HIXL 5I15L 3NZ8A 4QRSB 1AACA 3KLHD 4WSKA 5BQ7A 3VXNA 1DBML 1RZ8B 1GSKA 4QRQB 4XT1C 2AQQA 3T0AA 2XPZA 2R1XA 2OSLA 1PLCA 3MRQB 4P2QE 4L8SA 3AG2B 5B1BB 3ZE1F 1KBGL 4JPWL 4PJ5B 4X4ZA 3FO9B 4WVRA 3O9WA 2CPCA 2IBBA 2WOYA 4QXUH 4PJAB 5C08D 4TRPL 2BFGA 3CH1B 5DURB 1IC4H 4EMZA 4DQAA 5JR1H 4K2UH 4X4MA 4DN4L 4V33A 5F6IC 1MCQA 4ES8A 5GS0H 1WFIA 3ARQA 2J25A 1HEZA 1YJDL 3RJOA 3WFDH 4WJKB 2R2HA 3RVWD 4JCLA 2D7TL 4LARL 4AIZB 4Y16B 3BRFA 1Q72H 4U0RC 1W8EA 1IC7L 4G1EB 3QEHA 5LBSH 2HFGL 2LU7A 3V4VA 2WQVA 4R26L 2YD6A 3L3IB 1P6AB 4K3EL 3E6FA 1JUFB 2DQUH 3I2CH 1FNLA 1G7IB 1MCOH 2X9WA 3IETA 4Y5XB 4UTBH 3SKOB 3SQBB 3IN0A 3NIFB 4H8WL 1IBHA 1Q1PA 1JGUH 1CD1A 5DJCA 2R29H 2VJ8A 3B7UX 4KVNH 1D9KA 4PBWD 2XKUA 1RPUA 1DEEA 3U82B 3HC0A 1D5ZA 2K7QA 2EDEA 4LCUB 5E8NB 1CT8A 1LL1A 1IQDB 2IALA 3RUGE 2ZG2A 3O4OB 3S4SA 1CI3M 2JNZA 2EXYC 3QI9C 4WI6A 5JIIA 3TH2T 1AD0A 2EZ0D 3GXNA 1TCMA 1U3YA 3G3LA 9PCYA 5JIDA 3BPOC 3RA7L 2FWOA 3HZMB 1KEMH 3MBEC 5D7KE 1CI5A 5AW9B 1NBCA 5BRZD 3I6GA 2YQGA 2YMXH 5FM4A 4RBPK 1OTSD 4G7VL 1U8JA 3FTXA 1A9EB 2O5YH 2XZQH 3SDDD 3IVKA 2PCYA 4IRSA 3GMQA 1I85A 4NM4L 1BJ8A 6CGTA 4JR9L 1XGPA 4GW4B 3DDGA 1FNEA 3NSCA 3L3GB 4KK6D 4LDOB 3T5WA 1WCBB 3RDTA 5CCJA 2J6EL 1HWHB 2Y69B 3A5VA 3EJYC 4Y7MA 4NENB 5ACZB 1CUOA 1L9NA 1BQLH 3SZ6A 4L4TB 1Z9SB 4W6YB 1T22B 3V5HB 5CGYC 1SMAA 5DO2D 4WEBL 4AGLA 1U8PB 1JPST 4CDGC 4N0UE 5AYQA 3ZJAA 4EI5A 1ETA1 4F37K 3AC0A 3ZHNA 2Q86A 2DL9A 5GJSL 1KYFA 3MRJB 5FV2A 4ADJA 2AVFA 4XCCH 1F2XK 1NLDH 4K5NA 5DHVH 5T3XE 5EWIH 3IDIB 1U3ZA 4G6JH 5C07B 2R4RL 2Y6TE 1T20B 2NRDA 3NJIA 2DMCA 4YDZA 4CN4A 3ZE1E 5ILTH 1UD5A 3O2WH 4LVEA 2CK0L 4NIKB 2NTSP 1KXTB 1OEZW 4PREA 1ZA6A 2XWBB 4HWEH 4HXAL 2VDRH 1UWEL 1ND0B 2XVGA 5DMGD 3TBBA 1PD0A 1QI3A 4RX4D 4ERSL 1N6QL 1BQSA 4I0PD 4HHAA 2FWLB 1PFOA 4MLSA 2C9XA 5DC2A 3BUYB 1SFDA 4U3XA 2DOCA 4G8GB 5B22A 3ZHFA 2V6HA 1F41A 4JUSA 4NYLA 3O6MH 1KIUB 2ICWB 4WUUA 1MFDH 4NQCE 1OT4A 1KY7A 1P7KA 4F8LA 3KYMB 5L2KB 5MEQA 3CFQA 4PJFA 2JKTM 4MQ7B 4O9HL 1GGCL 2UZIH 4DGUA 3DSFH 1Z9LA 3HE7A 1BD2D 2EXSA 1TU2B 4U6TA 3V7AE 3QUMB 2IWFA 4LQ1A 4RWHA 3MXVH 5K9KB 2HMIC 2E27L 4PEEA 1HK6A 4DP6X 2FT8A 2O6PA 3PS6A 4JKPH 3RVVC 1HZKA 5CIPB 4IU2B 2WK2A 3F12B 2MRYA 2P5EE 1Q0EA 4P2RA 4TULL 4P5RA 3RGVB 3ZZSA 3KH4A 5AD0B 4C56E 5F0PB 3GSUB 5DJZB 1DQVA 4N1EA 5T33L 1A7BA 1NGPH 3HS0C 1U33A 5HY9A 5DWUH 2D3VA 1UGNA 5FUOL 1D5XB 4K3HA 4UOW1 2D03H 4DSYA 3TTSA 5KOVC 3OWRA 2MQGA 3BKYL 1SF5A 5LG6A 1OLLA 5EOTB 3AQDA 4RMVA 4PWJA 1Z1WA 1JHTB 3BYYA 2B8OT 3DVNA 4Y5VC 1ONQA 4KDTC 5C2BL 5J6GA 1MSPA 4B96A 1NCTA 4IJ3C 2Z0UA 3FCTB 2XU9A 3IFOA 4F1ZA 2YGPA 1QR4A 4HUUB 1M7IA 2GSIA 5AZ2H 4HJIA 1HHIA 4UT9H 2YRLA 3PL6D 5E5MB 1G7QB 1R17A 2IPUG 1X5GA 4AEIH 1ECYA 2XTJE 3ATBA 1PJ9A 4OCSL 3D85A 2C5DC 2EVIA 2VAJA 4Z7WB 4LNRA 3TCLB 1OWRM 4P2OA 5CJOL 5LAXA 4HV8A 1JPGA 5I9QB 1UOKA 3S36H 3VXUD 3D0VA 3GUFA 4KFZC 3QQDB 2VDPH 1ZE3C 3O0RL 1S7QB 2HRGA 1QKZH 3T3ME 1BVOA 3HS8A 1MUJA 4UT6L 5LCVH 3QQXA 4DEPC 4PY8I 3ZW3A 5C0IB 4QO1A 3SO3C 2QSTA 3UJTH 4J1UA 4BFOA 4BSWB 4YMPA 5DJYB 5IROD 2F53A 1NBZB 3FF7A 1JFHA 5EU4A 4LLQA 2RR3A 2ZP8A 3EHBC 3DX2A 3GHBH 2LU4A 3KHOA 1EFXD 4IRJC 3DNKA 3UTSB 1ZVSB 1TYJA 4PJCA 4AQ1B 1R3KA 2GSGA 3KHQA 4X4YA 5BW7C 3GIZH 1CN4A 1LO0L 4Q8BA 1HKFA 3E80A 2EYTA 4Q56A