5LBGA

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with faropenem-derived adduct at the active site cysteine-354
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
259
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 72
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lbgA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbgA01
5K69A 4HUCA 1ZATA 4ZFQA 4A1JA 3U1QA 3VYNA 5LBGA 5DVPA 5DU7A 3VYOA 3TX4A 3U1PA 4QRAA 3VAEA 3ZQDA 5DZJA 5E5LA 5DUJA 5E51A 4QTFA 4HU2A 5E1IA 5DCCA 5LB1A 2MTZA 4A1IA 4A1KA 4JMXA 4QRBA 3ZGPA 3TURA 5DZPA 4JMNA 4XVOA 5D7HA 4Z7AA 4LZHA 4GSUA 4GSRA 3VYPA 3ZG4A 5E1GA 4A52A 4LPQA 4QR7A 1Y7MA 2HKLA 5DC2A 4GSQA 4K73A
chains in the Genus database with same CATH superfamily
1KELH 3HFMH 4I0CC 3MCYA 1OVZA 4RGOH 3WFEL 2Q3XA 5EN3A 4I2XE 4ZUWB 2EIJB 5C0CA 2DQJL 1JK9B 4C83A 4PV1C 2WNGA 2ZYIA 4ONGH 4PFEA 3V4PA 4L4TA 3BGFC 4WEBL 4ZOAA 5DZLA 2FX8L 3SCMB 3WUWG 4CL7A 1SJEA 1BIHA 4P3CL 3H2QA 3O3BB 3EFDL 3P0YL 2I27N 1BHGA 3ATEA 3PNWB 4PJDE 3KL5A 5E8DH 2Z7WA 4AV4A 1AHWC 1CXLA 2Y7SA 1QBLL 4KK9C 1K8DB 4IOIA 4N0CC 2JELL 2LT9A 2E75C 1BOGA 2B08A 4IRZH 4WNSA 3T0BA 2UY7A 4K15A 2B4CL 1F42A 3O2WH 1PTZA 2VAJA 3MGTA 5AW1B 2EYRB 2GB2A 5E5LA 4ORGB 4KQ3H 4AKQA 1JPFA 4G70B 2K0RA 2HT3D 2YBRB 1ZVYA 1S5HA 2WNWA 3NIFB 1OLZA 1T1XA 3PJSA 3L9RB 3GSNH 2Z3FA 2EO9A 4LCIH 1IBBA 1Z7JA 1MCFA 3C5ZD 1WSST 2OMUB 3G5YA 3LH8A 5D71H 4PRPE 3FFCB 1HS6A 1E3FA 1VADA 1JE6A 4G7YH 3LSOB 4WUKH 4B9CA 4CADB 3O6MH 1UASA 3MLZH 4QIRA 2AV7B 4JRLA 3U4BH 1WRFA 4BM7A 3JV6A 3LKQA 4NCDA 4AENB 2EO7A 3DX7A 1BMWA 2YKKA 1KT2B 3DVNA 3OKNB 1GS8A 3DBXB 3HN3A 4AQOA 5KSAC 4BSVA 1F4XL 3ZYZA 1K9TA 1H19A 2RGSA 3K6SB 1H3XA 3MLRH 5CNHA 2Z34A 4RLDA 3VSUA 3GXMA 4FXGA 3BQVA 1EIBA 4M1GL 1D6EB 1B88A 5T5NF 3IETA 4WO4A 1T6WA 4OY9A 3WHXA 4PYHA 4XMLH 4RQQA 3OKOB 4P57A 5DK2A 3OAYH 1RZPA 1GGTA 5I8KH 4B95C 4OCNC 3LMJL 3H8NA 4QRSB 3IPBA 1ETZA 1MG2C 4I0PC 1ROWA 4PJBE 5DD6A 5HHOE 5DRZA 2IG2H 1SYSA 1KB5L 1OGTB 3UTZB 1YAZA 4XC3L 5T5FA 1J8SA 5D1ZA 1V10A 2FGZA 3HAEH 2ICES 3I50L 4P2OC 3WNNA 2QSCH 3ZW3A 1SFDA 1RZQA 4RIRB 4NO0A 3CZUB 3O11B 5AB1A 1ASOA 1X5XA 2V8LA 4MB3A 1OAQL 3JZYA 3ZUCA 4DGIH 5JOFA 3BEVB 2W92A 4X6BA 1E4WL 3DC0A 1AH1A 1GXEA 5IJCC 5F1SA 3EYFB 3HRPA 1UGNA 2ZP9A 4D9QD 3DVFA 2GIMA 1INEL 1VACA 1H5BB 4NNYA 1MXGA 2XQYG 4UAHA 3K72B 3KYNB 3LX9A 4Q9BA 4A7QA 5DQJA 2WINA 2NMSA 3D07A 2HJFB 3NA9L 5K1NA 3CHSA 1EXGA 1N5YL 5EUKB 1GZPA 5F7EL 5I9QB 2FEEL 2IDTA 2C1OB 2Q0ZX 5F7DB 5ICXB 4QRAA 3TH2T 3CBRA 4WUUB 4KY1L 1J5DA 1U8KB 2NZIA 1VGKA 1DVFD 1NBVH 3B2MA 5LHDA 3BUTA 3TH4T 5J6GA 4ETQA 2UYLA 2HMIC 4AC2A 3VXSD 4OZGE 2ICEC 4QRTA 1W8OA 3MDJA 4RMSA 4B0MB 5IFJA 3VD4A 5AWNL 2X9YA 3GHPA 1WEJH 4IBZA 4KHTL 1XHHA 5JQIB 4U1HB 3ZRCC 2UZXA 3B3IA 5FPIA 4N2IA 3WMPA 2K8QA 2QSQA 1BZQK 4WHCA 3NJXA 5IG7B 1M7XA 3AFLA 2GC7C 4JRXB 1QRNB 2X1PA 2X6MA 4WTZG 3O2DH 2IQAB 4MD5A 2EQDA 4JEGB 3EF7A 3GD1C 2DBLL 1L9PA 2YO3A 3C5ZA 3BH8B 4PQXA 1QZNA 3WEBA 4Y8DC 3EUUA 1IE4A 4X83A 3TN0D 3IGFA 3TXAA 1P2CB 3DX8A 3GXPA 2X05A 2VJXA 4NIYE 1WS7A 2IWFA 5HGBB 3KCPB 4UZSA 1YUHB 2Y0SA 4EDWH 4ZD3L 3OMIB 4JFPA 4GQQA 4U1LA 4YFLI 2E7HA 4ZX3A 4HXBH 3BPOB 1AR1C 3NJIA 2NYYD 3PIQB 1H3GA 3MRJB 4EIZC 3QAQA 1ZA3A 5DK0A 3TO4D 3UERA 1OAYH 1YEHH 2IGFL 4RDBA 3C2AL 1P9MC 3BP4A 3SGKA 3TEWA 2HJKA 5F7WC 1N0XH 3ROOB 4IGBA 1YEIL 5F89A 1S9VA 5PAZA 2QR0B 4BXVA 1TU2B 4NO3A 3JWNE 3WY2A 1XF3B 2CA3A 4ODXB 4NQSA 5EEXA 1UCBL 3IE4A 2QLYA 4L8SC 2BVEA 1AR2A 4LK4A 3TBTA 1J0KA 4KKLD 1A6AB 2KERA 4Y4FD 6FABL 3WN5B 2ZKHL 3F6IA 1AO7B 3GI9H 4DNLA 3FNKA 2CRZA 2LLLA 3W2DL 3MNZA 25C8L 3QUYA 3NGBB 5F9OH 3DRTA 1SYVB 4GQPH 3D2TA 2A9NH 3ES6B 5HYIA 4XHQA 4ELME 2EH8H 4FS0A 3P9WB 3BZEA 2FE0A 3MRIA 4KVNL 3G04B 4FTVD 2YIHA 5C0NC 3AS1A 2X1OA 3DROB 4OLWH 2WVVA 4PIBA 2OMYB 3RGHA 4ZMQA 4YHZH 7PCYA 1AJ7H 4BCZA 4BKLA 1FNEB 4HLZH 3WLWC 2XJKA 1CDHA 3WG7B 3WFCH 4ONFH 3MACL 2E6PA 2MTPA 3IJ7A 3QFDA 1BBJA 2X6CA 3S97C 3SE4A 5I76B 4TVSa 5FF6A 1EERB 1CZ8L 2EDMA 1HHKB 2R1WB 5FOBA 4HOWA 1F90L 1MCCA 2FYYB 1YA5A 2P80D 2DOCA 5B38G 2H1LM 4C56D 4DGWC 1E3ZA 1XD1A 3ARYA 4YDVA 4L3EE 3WJLC 5FCUL 3VFSA 1BV8A 3NCMA 3ETBJ 1I7RB 2W9DH 3MAWA 2YC1A 4L37B 2OSYA 3X14B 3HZMB 1RLBA 2C3VA 4G6AD 4JO2H 2BVYA 2WLYA 1JNLH 1Z3GH 1OW0A 4YFLF 1Q0EA 3LIZL 1DVFA 5F7BA 3TP4A 3ZE1E 4Y5XA 3WE6B 3TWCL 5FYKE 1QSFE 3VXSA 4AT6A 3QQ9D 5HVWA 5KSUB 1T04B 1IEAB 5E6UB 3OPZL 5KJ4A 1CWVA 4N87A 4NN6C 3S5ZA 4XPGL 1BEYH 2BJMH 5DHEA 1AS7A 1QATA 4XVSL 2C9UA 2YAQA 1IZKA 3L3HB 3GZPA 1C7TA 2LAGB 4E2OA 1N26A 4LSVL 4LOUC 5DFTA 3CD4A 4FQJH 4B9YA 4XBEL 2XA8L 2GSMB 2KI6A 2RAMA 2FVNA 3BIKA 1PSKL 1QAWA 2A6DA 2FT8A 2JCCA 2NW3B 3HMXL 4GAGH 5DJ6B 5FM5M 3X3FL 3TN0A 4GI6A 1UB6B 4KHXH 3PWJA 1DBMH 3SN6N 4YEEA 2FX9L 3T0EE 1TTBA 1X5ZA 4FXTA 4YXKH 3ARQA 1A6WL 1U8JB 4NN5C 4XCEB 1P84J 4DEPC 1YPZB 4IOFC 3L1EA 4BQCA 5EBWA 3GB7A 3PHQA 1CL7I 3CFTA 4V2BA 1WGOA 5DA4A 5TH2B 4A2LA 4N28A 3TO4A 2NZ9C 4A1KA 3E3QE 2LR4A 3W5MA 1DFBH 3OR7B 4OIAA 1ULVA 3H7BB 1XBDA 1HEZB 3FO0H 2VMFA 3NFNB 2G9KA 3BWUC 3MJ6A 3V6ZB 3FUDA 1R0AL 2HKHL 3LEYL 3ULAB 4HWZA 4OIIH 3K81A 3DOIA 2E7CA 4Y4FA 3F05A 1SLXA 1MI5D 1YEGL 3UAJA 1JVKA 3R8QA 3D08A 4E9RA 4F7KA 1G7IA 5IVXF 2OYLA 5IVXB 1BYPA 2AXJA 2LFGA 2VR6A 1CCZA 4FQQA 3HC3H 1QWUA 3MREA 4D94A 2VLRE 1ZLEA 3ZSSA 2XA3A 3PWLB 1EH9A 2O61B 2FHCA 5FGBA 3QUXD 1TDQA 4FTVA 2VLME 2ZJSH 4JM2C 2XZZA 4QR7A 3GMLA 5ADOH 2B77A 2EDOA 3I85A 4R7NB 4PWFA 4D9RE 2V2TA 3KPMA 1T7WA 2R0LL 3VYOA 4YGVA 2X4PB 4R2GD 1GS7A 4ONHB 2Z31B 3CNKA 5CU9A 1H9DA 1IGTB 1V7MH 3Q1SH 2P80A 1A21A 4C56A 1CFNB 4YR6B 4IBWA 4GRMA 3I3BA 4BZ1A 4I18A 1HHHA 1BX2B 3NJGA 3IGLA 2CNZA 5AOKA 2P49B 5AALA 3GSOA 2P8PA 3FYIB 4U1GB 3X2QB 5SWSE 2L0DA 4LIQH 4FNTA 1ILSA 2GT9B 2WO3B 2CBMA 3L9YA 4MKMA 2DS4A 1RZKC 4LASL 3MC0A 2DQCH 3W37A 2FWOA 4N4YB 3BAEH 1WAPA 1BXUA 1NCNA 5G4NA 2KZWA 4NSKB 4MCYB 2HFFB 3HNVH 1D7FA 2QEJA 1RJCA 3HEIB 3ARDD 2VQTA 4GIAA 5BPPA 5KG9A 1UYWH 3ML8A 1A2YA 2B5IB 4H8WL 5IBTL 5JR1H 5D7JD 1QACA 4UT7L 2AK1L 4EIBA 4HV8A 1WC7A 3LKSB 5KYXA 3B2XA 1TVHA 4GKZA 2B7DT 2Q2EB 4S2SA 3HFML 3UADA 3VFTB 1U2CA 3EJQA 3MBXL 3ULVC 1FG2A 3QPQC 3JTBA 1KFAL 3T0XA 2E9WA 2X4SB 1IQDB 1F3DH 4AG4L 2VW4A 1ZA6A 1D5IL 4XNDA 3DOHA 2WOYA 5C0DB 1M05B 4F20A 4WHYG 4XHJD 3FONB 2XQ0A 1BPLB 2F5BH 2WXHA 3QJTB 4F24A 3QZBA 1E9QB 3DOSA 4YHMH 1MFDH 5FKAA 5ACLA 1KNOB 4UQ2B 3TA4D 1INQB 5CINL 4TL4A 4MCNA 4WFED 5EH1A 2YEQA 5J5EA 4OLXH 4P2RE 4JY6A 2Y3AA 2ZONA 5LBSH 1UOVA 2MCPH 5JUEH 2VDOH 1AZNA 3EJTA 4JVWA 5J57B 5H2BA 3RKDD 3FQNA 5KEZA 3T6WA 2EACA 2FQEA 4HC1A 5D4QA 5HHQB 1MI5A 4AV0A 2MEJB 3JV4B 2F19H 1MCPH 1T2XA 4GMSL 1XR8B 4P5TC 2MCG1 4OLYH 2DQTH 3T4AA 3E8VA 1ECYA 1C5CL 1IBYA 5JW4M 2X4UB 2DMBA 1NCOA 1YY9D 2Y5TA 4WV1A 4D0BB 3EJYD 1H0DB 1ZHBB 1IBHA 2HVJB 3RFRA 1X5HA 3QUXA 3GRWA 3HKZA 3MXWH 3WXWH 4N0UB 3VXOA 1C12A 3BHBB 35C8L 3BP5A 2CNYA 1LILA 3TBSA 1EJOH 1WFMA 4M93C 1ZHLA 1USQA 1EAJA 4UU9B 4Y5YA 1ZK5A 3OLEA 5JXED 3GBML 2P8LA 3RIFK 4J3OG 5DLLA 2XUWA 4I48B 4LZHA 3HI5H 1JG9A 2VB5A 4FP8L 4JFEE 3BW9B 2J1WA 5BXFB 4PJAA 2BNQD 1X5AA 1HZHL 1HE8A 3FUIA 4PWIA 3RNQB 5IWLA 3HN5A 1BECA 2PCYA 1IC5H 5E1HB 1F8TH 1RIVL 4PJHA 4JPIB 3UZEC 2HJLA 2XOTA 2ZCZA 4PJXF 4PJXB 1RHHA 4TNFA 4MCZA 3ME0A 4AKPA 4Y9EA 1HXMB 3DURA 3KW7A 3QT2A 2W5PA 1CMOA 4FJZA 3JT2A 2BO0A 3ARDA 3QORC 5E1GA 1KN2L 1XEUA 1E5ZA 4WWNA 2CLVA 1LYQA 1K4DA 4UTBL 1BFTA 3UJTL 5D7JA 2X70B 1Z9OA 4L1DA 1L7TL 2D7OA 3D09A 5I74B 1CTMA 4I1PA 1H15A 1M7IA 2D03L 2FT6A 2HG0A 3HBQA 4W4OA 3QEUA 4OJYA 4P5MA 2WVSA 1AE6H 3BVWA 3FTSA 5D1XC 1Y6MR 3VXPA 2R29H 2WJ5A 1JHKL 2C9RA 3MLTB 4R26H 4X7CC 4X6DA 4R4ND 3TLRA 3UIZA 4AK2A 3S88H 2LTQB 4XO3A 2DLTA 2I26N 4IIQA 1DVZA 5FIEA 1WA2X 4J8RB 2A6KB 3VFVB 3MNDA 3IU4L 4LRIA 3EG9B 4KKPA 5F44A 3SGDH 4QXTA 3V0IA 1Z0MA 1CIUA 4TNEA 5KBMA 3MA9L 3LZOA 4XNQA 3BC9A 3WE1A 3GZKA 1I82A 3HCVB 4YVNA 4ANXA 2XKSA 1VFAB 3ESOA 1A9BB 2D3VA 3KGSA 4BQ9A 5C86A 3MFFA 4RSVA 2B39A 4GSRA 3DUSB 2YWYA 1N8ZB 1AGFA 2PO6C 3DX6B 3SDDB 1DQJB 1OLLA 2BVUA 4XOAA 3BPLC 3MRBB 1E9PB 4D0DB 5EWIH 4B9JA 1NEZA 4M5TA 3FTXA 4N5ED 5BUPA 2V7HB 3HE6C 3JWOL 2KPWA 4IRJA 3RVUC 5J6HA 2CXKA 3C6SB 4ZQKB 4FLOA 3V6OE 4BZ2H 4A2HA 4WQOA 2VR4A 1EUUA 4MD0A 4HA1A 4GOSA 3SBQA 5J11B 2NQDA 1FVEA 5JXEA 3QH3B 4ENZA 1UXMA 3L9EA 1QLEB 3UZVB 4X9IA 1L7IH 1N0XL 2BNQA 3FHEA 1HSAB 3DVGB 1FZJA 1VERA 3Q44A 1N7ML 3MRDB 2PW1A 4YZWA 3NFSH 1GGIL 3AGVA 4P99A 2HLAB 5GGTL 5DRXB 2VDKH 2ZYSA 5HYSB 1M9WA 3ULUD 3D0LA 4ZUWA 3U7YL 1ESOA 3WD5H 1CICB 3V0WL 1DQMH 4PJ5B 4R84A 3MUY1 1RK1B 2DWSA 1BD2D 2J2ZB 2J8UE 4WWKD 3SCMA 2QPFA 4I4WB 9CGTA 2VMDA 3KJ4C 4IHBA 3MXVL 3O3BA 3CC5B 4K94L 3RVXD 4PSPA 5C0CE 4HALA 1K8DA 3SDYH 1D5BB 5IP4A 1D7DA 5DSCB 1SOKA 4XT1C 5L9DL 4K3JH 3LQMA 5EBLB 2UXFA 5DRNA 1ADQA 2CLZB 3BKMH 4L4TE 2BDNL 1RP9A 3OC5A 4HP5A 4M5YH 4R0LB 5TDNB 1S7QA 5DMIL 3PFUA 4OLUH 1HH9B 1TO4A 1PIGA 4KJYB 1SPDA 5C6TH 1S78D 2IF7A 5I17B 2EYRA 2Z8SA 2Z9TA 3PABA 4JPWH 4W4NA 5F8RC 1OO2A 1O6SB 5AG8A 2Y7OA 5LVEA 4JQVA 2TRYA 3CZJA 2YBRA 4XOBA 1UT2A 2YUWA 1A1MB 5I6KA 1HHIA 1IC4L 2WN2A 2VXTL 3EYVA 2UV3A 3GMOB 3L9RA 3BVUA 1PKQB 1HC1A 5LG1A 4AQ1B 4AIXA 3K5RA 1RZFH 5IREA 4CGTA 4WWPA 2E7LA 3I9GL 3BKCH 2YN3A 1DO6A 1ONQB 3MYZA 3FFCA 2C1PB 4JKPH 2F1BA 1R3IH 3LSOA 4CU8A 3EZ8A 3ETBF 4ZTOH 3O4OC 4AENA 4I5BB 4LCUB 1L3NA 3IRCA 3CX5J 4X8JB 1FCGA 1KT2A 3OKNA 3B7RL 2VR8A 1XIWB 5FM4A 3DBXA 3I74A 4WI7A 2BWDA 4ZTEA 1BVOA 3K6SA 3B7SA 4LPTA 4UINL 4W6XB 3CZEA 3WENA 5BV7H 4GPVA 5HDWA 3BZ4B 3T77B 2PCPB 1IIKA 4X7DC 2W60B 3GBLA 3WJJC 3WIHH 4W9CC 4AGLA 2ZUQB 1SXNA 1LM8V 4FX5A 4JO1L 3JWDL 3OKOA 3GKWL 4HBCH 5BZXA 3QDMD 1JNJA 3DV6B 3B2PA 3O81A 3HS8A 1AAJA 1UH4A 4S1QL 3K6DA 4NC2B 4ORZC 4QRSA 1DBML 3M86A 2FECI 2DWEA 3BQUC 3BJLA 1CFQB 1AO7D 1XL6A 2FEJA 4ZMLA 4EUPB 5I16A 1GTFA 4FN0A 2A77L 3UTZA 1OGTA 1HWWA 2Z93B 1A0QL 5C0BB 4U6XB 3LPPA 1IVTA 2EUVA 1A7QL 4X4XB 1OTSC 3K6OA 1YEDB 3NIGE 5CJ5A 2DPKA 4RIRA 5T3XE 3O11A 2Y7NA 4E9YA 4UQBA 2MPVA 12E8H 1DP0A 2V3EA 3CDYA 4QWWC 1WBYB 2CU9A 2CALA 3ZHLA 2WZ0A 4F5CA 5CEZD 4UQCA 3O4LD 3D0AA 1ZPLA 3EYFA 1NSNL 2NTFB 4J39A 5ICUA 5JOPD 1PZUB 2P1YA 4WHYH 15C8H 3K72A 4A63A 3KYNA 1PY9A 4A39A 2VXSL 3BSZL 3U2JA 3R06B 2HJFA 1BD2A 1TCRA 3IDJB 4XI5C 3STZA 3B3BA 1O9WA 1T7VA 3MV01 1DZ0A 1BBDL 2HLEB 4CVUA 2AC0A 2W1NA 5EUKA 1HQRB 3DXAB 4AL8L 4JKNA 1S2EA 2ZP0T 4CVXB 2NR6A 2C1OA 4RGND 5F7DA 4LVNB 1MHCB 5JA9A 1KLFB 3TNMB 4S1SL 3EKCA 1U8KA 1IX2A 4U0RC 5C0AD 2JI2A 2D4FA 4B96A 2PWHA 4BFKA 3FSVA 4J3XA 4MQTB 4IBSA 1HEHC 4HCIA 5JHLA 4HWBH 1JCVA 1QTYT 2MHAB 4PHZA 1CTOA 1U8NA 4NQDB 2PCFB 5EZLB 5IZ7A 4XRCB 3S2CA 4FERA 3PJNA 4GI9A 4XAWH 4B50A 3EGXB 2DI8A 2IQAA 4XX1E 1KC5H 4M7KL 4MWFB 5IQ7H 1SUJA 1JZ8A 2V8MA 2CMRH 3CFBA 3LZRA 1GOHA 2R69H 3NABH 5F96H 4YDMA 4GEJA 4BFEA 2A83B 3EYSH 2DY2A 1P2CA 2PP7A 3A5VA 2ZXWB 4P06A 2IDQA 5HGBA 3TA3C 2F7RA 5J8OA 4CKVX 4NQQA 3I6SA 3ZTJG 3BKJH 4J3OH 2BCKB 1BQUA 3P4MA 2MQ3A 3WGVB 1KJ2H 2OAAA 1IL1B 2XU9A 3MRJA 2PTVA 1O7SA 5JR1L 4KC3B 3RU8H 5K9KB 1JGVL 3ROOA 2QR0A 1P1ZB 2OSLB 1RPKA 1TU2A 4AUUA 3KJ6H 4ODXA 3CDFA 3TCTA 4Z0BH 4ZAKC 4L5FE 2QMKA 3TEZA 4O02B 5F3HB 3QVAA 2X42A 4JR9H 5T1DH 4LDCA 1BXVA 3SEPA 5IW1B 1A6AA 4YSCA 3BEWB 3G6JE 1S9KC 2GHWB 1NPJA 4KZEL 1RQ5A 1TTRA 1AO7A 2Q3AA 3ATBA 3CV5A 5EULV 1SYVA 2ZUWA 5E03A 1YMHB 4JO4L 2KS0A 4FQPA 4NAQA 1PFCA 3HR5B 5KBKA 5BZDA 4JN1H 5IFHH 3TIEB 3G04A 3UXFA 1NCAL 1A3QA 1RP8A 1RL1A 2GYSA 3DROA 3QIUC 2FJGA 2OMYA 2YUZA 1XSKA 1TJHL 2O5YL 3VX1A 3DMMD 4M6NL 1FNEA 4Q2ZB 1OK0A 5I6MA 3QUML 4ZXBB 1FGNL 1TXKA 3N85H 1E42A 2X0UA 1UFUA 4AEHH 1EPFA 2IANB 4WIQA 5I76A 1KGIA 2WBJB 2Z31D 1CI5A 1UUNA 3V5DA 1HHKA 2R1WA 4LRNL 2FYYA 2XWXA 2Z35A 3PDOB 2BW4A 1W8NA 1W72B 5EUOF 5EUOB 4R97C 3SPJA 3ZX1A 3ZL2A 1SHXA 5MI0C 3C09B 3FU9A 2W59A 4JFXA 4PP1D 1TQBC 4G7VH 4GYBA 4U1JB 4XAKE 1I7RA 2QVKA 1CJYA 2WW8A 4U31A 2WCGA 3X14A 3LNFA 2WLZA 2O6CA 4MVBD 3DHMA 5EU3B 1RUMH 3WXWL 3IT8D 4EI5B 4S1DC 1H3PH 1AQDB 5GGVH 1EJOL 5C0AA 4NFBA 4X9GA 4PG9B 1MPAL 4JKMA 5KSUA 5GZOA 5D7EA 4MS8C 4D3CL 1MNUH 3Q8AA 3ARXA 1EHKB 2V7NB 3QC5X 3WFHB 3V2AR 4KKCC 3MCKB 4ZSOB 3L3HA 1MRDL 1ASPA 3CSGA 4OV5A 3E0GA 4HJJL 3IGKA 3VXSE 2OQJB 1GSKA 3VXQA 1T2QH 4N0FB 3FU5A 1MRFH 3B43A 3CTTA 1JGUL 3IFNH 2NW3A 1XSIA 1P7QB 1SM3L 1ZJBA 2XLLA 4TVPL 5CFAA 1A14L 4YX2H 4KXZI 5INDB 1UB6A 1U93B 3PPEA 1IILE 3NSYA 5LCVL 5FFLA 1DQDH 5F0LB 2UWEF 1B2WH 1ZV9A 2UWEB 4XCEA 3S37L 1U8JA 3GBNH 3WEXB 4DN3L 1YPZA 4FQ2H 4ATTA 3KWWB 1E40A 3LRKA 2JCCE 4AE0A 3UYRH 2NY0C 3UYPB 5CZVH 5TH2A 2WXJA 4WKZA 4XTRD 1OHQA 2JNZA 2DF3A 1B3JA 5FUOH 5CCHE 3ZKXC 4F37K 5KAQG 1JHLH 2X6AA 3OR7A 4ZUVB 5AAMA 4JZJC 1AD0B 3H7BA 3PV7A 5SX5K 5CLXA 1AOHA 5EOCJ 3P4OB 4P9HC 4TMPA 5MP6H 1CBVL 1HEZA 3GMNB 1IGFL 4GAYB 5AL0A 1YDPB 3V0AC 4YC2B 1RIHH 2AQRA 4IKIA 2QSVA 2BSEA 5C6PB 2CHWA 3FJTA 4GKLA 1IBFA 1WPCA 4GXVL 2XY2A 1NCJA 1I8IB 2Q8BH 1S9YB 2IC2A 1FFNB 5GJTL 4YHLL 1JZ3A 2FBOJ 1PL3A 3NSCA 2K4AA 3NAAL 1T89C 2AEQL 5IVXA 4G43B 4H25B 5BRZB 1MAMH 3PWLA 2AXFB 2ZCLH 4MGXA 2O61A 1INDH 5TDPB 1OWWA 4Q9QL 4PD4J 1QBBA 1NAMH 1ZLWK 2AEPH 4CSSA 43CAB 4D2NA 5DHMC 3PHAA 4JHAL 4MDIA 2F54B 1XDTT 2GHZA 4NT6B 5I23A 2Z31A 4FTVE 3SYPA 1Q9OA 5TE6L 1CFNA 1ERNA 4BFFA 1IT9H 4YDJB 1RD6A 3QNZB 3H85A 4HPOH 2HN7B 1YNKH 1QFWH 1T20B 1B3IA 3MKKA 1JYXA 1MF2L 3ECQA 2EIMB 4Z7OE 1F00I 3FQXB 3NTCL 2ITDB 4IKKA 5DQDH 3PWVB 4ZO6A 2I9TB 1BVKB 1U4FA 3RHWK 4C56E 4ABWA 3D34A 3ESPA 4JUTA 4BFJA 3QAZB 2FIKA 4NSKA 4P23C 4MCYA 2GABA 4QAWA 1BFVL 2HFFA 1Z1WA 1X4ZA 5I5MA 3DTXB 2BHUA 5TE7H 1QX1A 2GJZB 4HMEA 1WWBX 3FSWA 1OD7A 4KKBC 4KV5E 1DVQA 4TVUA 5A7BA 3O45B 1E27B 3LEVL 4P4KB 3T4YB 3U36B 3IWVA 4K8RC 1GRWA 1WWWX 4LKCB 4X5PA 3LKSA 2C9QA 3QGVA 4HU2A 1OQXA 3AM8C 3VFTA 4DW2L 4YHYB 3S4SG 1NKOA 3MVSA 2KLRA 2X4SA 1IQDA 3EH2A 1JMZA 2OMXB 4JGNA 3TS8A 5D7IF 2B0SH 5D7IB 1M05A 1BQRA 3WLBB 5I8OL 5AAWA 3I75B 4BHUI 4A6YH 2AABH 1I8KB 5D7KD 5CBAB 1E9QA 5ALCL 4B41A 3SE3C 1JHTB 4FQCH 4PJGF 1ZTXH 4PJGB 3CBJB 4PV9B 1KNOA 4QO1B 2LU7A 4UQ2A 3RVTC 4G1MA 1KTJA 3GSNB 1IGJA 4TYUA 2IMNA 2JIXB 1LO4H 2R7EB 1HU8A 3HMWL 3MSPA 4LBEB 3VWJC 1YN6B 1KCSH 4BFNA 1I7UB 4JPWL 4ZMVA 2YD0A 1NFIB 2GBVA 1RHFA 1ZDQA 3PL6C 1DBBH 4YFEA 3EOBA 5HHQA 1T4KB 3GBEA 3RWCB 5A43C 1ZLDA 2GVYA 2H6OA 1F2QA 1A02N 1YEFH 1XR8A 3OD3A 2VERN 2P24A 1HZKA 5SV3A 4Q56A 1TJIH 1YMMB 5I8EB 1NCDH 1CLZL 3V0VB 4N68A 5TQ2L 2X4UA 1BQ5A 4OGXL 4N9OB 3KLKA 1H0DA 1ZHBA 5BNXD 1MI5E 1U58B 2HVJA 1ZAGA 3KAAA 5CGYC 2R0WH 2VXQA 4N0UA 4OFKA 3DUUB 5DJXB 5LAXB 1JZHA 1LMKA 4NOBA 4BFRA 2Y24A 3NCYP 1GHFH 4NNXB 2R2BB 4A55A 2IQ9H 2E5EA 3DARA 2PPDA 4UU9A 4X4YB 2O4EA 4AIZB 2A1WH 4JFUA 3PXHA 2IV9A 1IGIH 4JPSA 3S8FB 3FB8B 4FFWD 1JD9A 1H9VA 4YHNA 3BW9A 3B2VL 1NL0L 5DVLA 2Z7YA 3VD7A 3HAEB 4BWUA 1KWKA 1K4CB 2E27H 3QEGL 4JPIA 5I6XC 4OT1L 1XGRA 2HLFD 1G4MA 4PJ6A 4PJAE 2NY7L 4X9FA 1FVDB 3EDDA 1M1XB 4PJXA 2BSSB 2KQMA 3L7EB 4IBYA 4NOFA 5KVGE 3WIIH 5I1HH 1BAGA 2KUTA 4OLEA 2JCWA 1HINL 3FHAA 4G6KH 1UXSB 3U0WL 3KBFA 1T66C 4PJHE 4H26B 4AKOA 3F84A 2EIZB 2CBQA 3MTRA 4ZNEA 4CW1B 1Z9SB 4N90D 1TIUA 2Y5QA 5DQ9B 3B1TA 3RWGB 1C9SA 2X9ZA 4U6YB 5CIPH 1AI1L 4XH2A 4JQIH 1U9KA 2AQQA 5HI4D 1OP5K 1Q9KB 1F5WA 1A65A 1QFUH 1VPOH 1XV8A 2OTUB 3CSTA 3T04D 1X5GA 4YS4A 3PWNB 5DO2D 4DKTA 1KTLB 1AMYA 4BCXA 5E8NB 2ZXAA 4PVNA 4MZ3A 5HTSA 1I8LC 4J8RA 3VFVA 3RJQB 4IU3B 1JPGB 3EG9A 3VFWB 4X6DE 3WXVH 4U6TA 1QPXA 4JFWA 1ACZA 4G9DB 2ZUTA 1YYCA 1RPQA 2DQGL 3B9KC 3BFOA 3ZOAA 3HCVA 3REWB 2DLEA 4L4VB 2H2PC 1IZJA 4WW2F 1VFAA 4OF3A 1A9BA 4MXVF 5ADPH 1FRGH 5FYLD 3T65B 1B4TA 4KVCL 3DUSA 5G5DB 4MMZC 1ACYH 1N8ZA 1KY6A 5F88B 2HUHA 1DQJA 2YEZA 3JVGA 3L3OC 4PLJD 4WFEE 3X1NA 1S6NA 3ZKND 4EN2A 3T2NH 3MRBA 2PR4H 1MFAL 1N12A 1SDAB 2H1PL 1Y0LB 4K23H 4D0DA 2CMRL 3HG1B 3BZ5A 3WMSA 4MRCA 1CE1L 1ZGLM 1DSFH 1AD9B 2V7HA 3UACA 1XCWA 3VVWA 1FFTB 3C6SA 5J12B 2K9UA 4PVBA 2VR7A 2D7TL 2ODHA 2XX1A 2APTA 1N64H 5TQ0L 2C8NA 3P4NB 3CZFB 3MJ7B 3BDYH 2AZUA 3KHQA 2WP3T 4I9WD 3RY6C 3SKJL 2BIOA 2X2HA 2E9GA 3D25A 5MENB 1GW0A 2B2XH 2J72A 1SLWA 3LEXB 3MBEB 3ALWA 1HSAA 3O6FB 2L7QA 3DVGA 2Q86B 2AJUH 5DFVC 4YE4L 3L48A 4NJAH 3RWDB 5I19H 2O26U 1UD6A 3QQDB 1TNNA 3RWFB 2EYTB 1FC1A 3UDWA 5HYSA 1W6WA 2V17H 4A2MA 3VYNA 2PP8A 1KLUB 5E1AB 2BNQE 4N26A 1CICA 4XO5A 4LSQL 4W6WB 3K2UL 4OKDA 2ZCKH 3B9AA 2KPNA 1RK1A 2J2ZA 5F3BB 5IROA 3DO4A 4DFHA 4M7LT 4Y2DB 4A7SA 5EEWA 2EC9U 3TURA 4PJ8B 5A6IA 3FHQA 2H2SC 3CC5A 3K6IA 5J1TC 3KL3A 1J8KA 1SXBA 1NCTA 5CGMA 5DSCA 1PZ5B 2OXHB 4I77H 3TYGL 2CLZA 2JXMA 4FMVA 4KKRA 4R4FH 5DK3A 4R0LA 3DO7A 3BZFB 4FMFA 5TDNA 1OB0A 1SGKA 4PGCB 3Q2NA 2YA0A 4FQXB 4IBTA 4QHPA 1EANA 1MSPA 2R56H 3FCSB 4AEHL 4LFHG 3RTLA 5DVNA 2A9CA 1DLFH 4IW4C 1O6SA 4RRPG 3V0EA 3DX2A 4TSCL 3B8SA 1FO0H 2AK4B 1A1MA 3NJNA 4OCXH 4YHOL 3LPOA 3MNMA 4J12A 4YO0A 4BUGA 3GMOA 4RMVA 3W9DB 2JKTM 3VM7A 5BVPL 1MWAH 3O8XD 1PKQA 1YEWA 4MZIA 1DUZB 4WI3A 4AQ1A 4FNSA 4HJEA 1TEGA 1RZKH 5CWSB 1ONQA 2BRRL 2C1PA 1QWHA 3BPNC 3ZT7A 3AQYA 3FT0A 1ITCA 1CXEA 3NIFE 2DEYX 5DT1H 3TU6A 4DKAA 1TVDA 1MCOL 4QHUA 4LCUA 3B6SB 3DGCR 3DRQB 4X8JA 3NOIA 5DMKA 3HHMA 1XIWA 5JIIA 1NUNB 4A1IA 4P8QA 3NQKA 3FFCE 4KROB 4L8DB 4JCLA 4MSWB 1T80A 3T77A 2AEWA 3BZ4A 2PCPA 3VXUB 3NMEA 4PLOB 4Z6AT 2N1TE 1X5FA 3G08B 1QFOA 2I24N 3O6LL 3ULVH 4LSUH 3N9GH 4XP1H 4KZDL 4Z5RB 3Q43A 1MHEB 3DV6A 3MJ9A 5HI5D 2Y2TA 3MLWH 4LHUG 3PWPD 4WFHD 2Z0UA 4XBMA 4W9JC 1OSPL 3HS0C 1HK6A 1CFQA 1T0OA 3L4WA 4M56A 1E28B 4EUPA 3CQPA 2WK2A 3EAKA 5HDQL 2GKIA 4NN7B 4I1RA 2Z93A 5C0BA 4U6XA 4GS7C 5GS2H 2CUMA 4X4XA 1YEDA 1NMBL 4NWUL 3P3TA 3L4XA 3IPEA 1L3WA 2ATPB 4F1SA 6TAAA 1D9KB 4A52A 1OZUA 2Y36H 1JXKA 1IGCH 2FDBP 3DK2A 2XXCB 2A2QT 4PGZA 4L05A 1ZIBA 4MMYB 3KVPA 4KQ4H 1WBYA 1B2YA 2QLVB 1VFMA 4NRYB 4AGOA 1ROCA 3CHQA 5I1JH 5IUSA 1OPGH 2ETWA 1F4HA 1BP3B 1KSRA 3LRSA 5HBBA 1D2OA 2AJSH 3BN9C 1DBJH 5IM7B 2AS5M 4WCYH 3IMRA 3IJ9A 1CQYA 2NTFA 5DJ8B 2F15A 4FJ6A 2MMXA 1L9RA 5D1QB 4XNXH 4M1DH 3I6LD 1A4KB 1P5VB 3R06A 1HYSD 3FB6B 2OR9L 2YUVA 4DGUA 3FK3A 2BXZA 2QSTA 32C2B 3MCLL 4Y1AD 4F5CE 5L8JB 2GAZB 3ULUE 3KLHD 2Z8WC 1HQRA 2CBOA 3DXAA 5ABAA 1Q1JH 4OIFA 2AEPL 5M94B 4CVXA 1MHCA 4PGBB 4OCWL 1KLFA 2NY4B 3TNMA 2HT4C 1XXDC 3V4UL 1DVSA 1IC7H 5ITBH 4OJDH 4AMKH 2FR4B 1BD2E 3CLEH 3A47A 5BO1H 2KH2B 1R3JA 2EH7H 2O5XL 3OL2A 3KMDA 2VDLH 3FXIC 2K9FB 4PTUB 5I0YA 2EDWA 4F7CB 2MHAA 2W0FB 1M2OA 2AJXH 2QFRA 4KOCA 3DJZA 4NQDA 3BP7B 4HIHB 2YAHA 5DZVA 4ZQTA 5FGSA 4OF8A 1MZZA 1I9JH 4QRFA 2X5PA 3O8XA 1YNKL 1QFWL 5FO9B 2DI7A 2VDRH 4MVBC 1G9NL 3V79C 4U6HA 4ACPA 4HIJB 4LHJB 4NERA 4NENB 4D0CA 2A83A 5JPMA 1G9EA 4OCYL 2X4QB 2LU4A 3V4VA 3WNPA 5CAYB 5HSFA 5JA8B 2IPUG 4HIIA 4TRPH 4GRWE 3WTTA 3J07A 3ZDWA 4ZMWA 1FFPB 4ZK8A 5MEQA 4DKEH 5DVOA 1ID2A 1KJMA 5HHXH 3FTUA 3BD4A 3FOLB 3BO8B 4MQSB 4V11A 1JI1A 1IL1A 4N0RA 1NLBL 1SXZA 1KTKE 2YD6A 3RGVD 5I1LB 3BE1L 5K9KA 2XZAL 5JZ7D 1A4JB 3C08H 2OSLA 4J4PA 1FAKT 4O02A 5F3HA 3WO3B 3POHA 3L2LA 1A4CA 3US1A 3PWPA 1YECL 5IW1A 3BEWA 4HCRH 1LO3H 2VAAB 3DYPA 2PUQT 3TGXA 4G6FD 1RPUA 3SGJC 4AEIL 2EVFA 4N1EA 4XPAH 4Z7WB 1E0OB 3SPIA 4IK6A 1JN6B 1IAIH 4XO8A 4BFGA 2VDOB 3QRFM 1U91B 4UANA 3HR5A 1NGWB 2WO2B 1F4WH 4XNMB 3R1GH 2E47A 2DQDH 1U6AL 2J6EH 2XWDA 3TIEA 1AO7E 2G2RA 4J6RH 2OCFD 5KTEL 4JMXA 1EJ6A 4GP8B 2CHZA 1U92B 2DQMA 3K3QA 4Q2ZA 2EEAA 1JPTH 3GDCA 5F7UA 1YJDC 4ZXBA 3WTVA 1R5IB 2V2XB 4HJ0D 4MA1C 3QXVA 2FUQA 4MNQB 1X44A 3FSZA 3MRNA 5A40E 3CU7A 3V9CA 2WBJA 5IHUL 5EOQL 4LAQL 5LNGA 3MZGB 5AG9A 5B1AB 3EGDB 5EUOA 1CLOL 1MDTA 1JTTA 4KH2A 3LIZA 3QYNA 2FH8A 5AYQA 2QKIB 3GXDA 4U6VH 3HC4L 4JO3L 2VL4A 2HTLD 1KIUA 4OM1H 5HDBF 5HDBB 1UZ6F 4Y1AA 1SY6L 2W38A 1JGLH 1WBXA 2E7DA 2XN2A 3AB0B 2QGCA 3FOMB 3OHMB 3QUGA 4G3YH 2CHNA 4X8XA 4HUNB 5EU3A 1E4XH 2ZSVB 3D85B 2NX5B 4IK7A 3NZHH 4MASA 1AQDA 4FXKC 3WU1A 3BAIA 4PG9A 2IQ9L 3ZHKA 4DGVL 2Y1AA 2ZX8A 1F3JB 4LU5H 4KX7A 3WFHA 4X98B 4GXUM 1FGVL 4P4KD 4ZSOA 1P7BA 2B1HH 2G4EA 4KJPD 1AIFB 2XWCA 3OXRB 4ODUB 1KN4H 5C0AE 4HWEL 4WU7B 2DDQL 1KXQA 4LE8A 3RDTB 3NIDE 2OQJA 1MVFA 3BH9B 1IE5A 4GP5B 2YPLB 3V6OC 4PJ7F 4TSAH 4PJ7B 3F8UB 2HX9A 4N0FA 2W9EL 1J5CA 2LOEA 3RI5K 1E8ZA 1P7QA 3PQYB 3EFOA 5INDA 2QZ5A 2HT2C 1U93A 2FRGP 4X4MA 3HVDA 3HG5A 3I2CL 4LPQA 4M1CD 3WIIL 3S96B 3GJFH 1OALA 2UWEA 1UKQA 5DZ9A 1IFGA 2RR3A 1G7PB 3F58L 3KWWA 2VISB 2YXWA 3F7YB 3UYPA 3AG3B 3BFWA 2FBJH 3B7TA 3L1OH 3RTQD 1KYAA 3LRMA 4ZS7L 3RGVA 4ZUVA 5KSVA 2QMJA 1AD0A 4FNUA 4B27A 2CK0H 1T1YB 3HB3C 1EGJL 1YPZE 3T6ZA 2IOMA 3GMNA 4Z7VF 3HN8A 4GAYA 2D4DA 3ZZQA 3EH5B 4PS4H 1UWGH 4WY7L 1H6UA 2WM0A 1XO8A 3HRZA 4K9JA 3GXUB 5C0FA 5F9AC 2IH1A 1I8IA 1D6VH 1S9YA 2P5EB 1FFNA 2Q6WA 5K1JA 3PUCA 1FUNA 5IB2B 4KUCD 4G43A 3FUKA 1YMMD 2N59A 1KV7A 4H25A 4UWQB 5AW2B 4AYID 3LJ3A 4UYQA 2HFEB 2Z6FA 2AXFA 3WXVL 4XNAA 1J18A 3K1KC 4XC1H 3OLIA 5TDPA 2XICA 3RIAK 2BC4B 4OGYL 3IK2A 2LLGA 2VN6A 4KMQA 2A38A 3L5WA 5IVXE 2EZ0C 2Y06L 2WLLB 1MCKA 3GIVB 2F54A 4XP6L 2YPVA 5EIQA 1BWWA 1SEQL 3L5IA 1JNHB 4FFYA 3A21A 4HKZB 3DX0A 2WWKT 1ACYL 1GZHA 3LV3B 1L5GA 4UT6H 4FC3E 4HWUA 4U7KA 5TD4A 2A4CA 2WP3O 2OM5A 4LEOA 1X5KA 3DPBA 3T0DA 4NPYA 5LXGL 3QZWB 4CSTA 3QNZA 2HN7A 3H4FA 1IIIA 5T1MA 1S5IH 4HK0B 2W8CA 1HIML 1OZTG 3TV3H 3FQXA 1PEZA 1RUKH 2ITDA 1R33A 5GS0L 3WBDA 4D9LH 3PWVA 3V10A 2I9TA 3M88A 1BVKA 4RFOL 3UO8B 3UJIH 5ACZA 2CAKA 3MNWB 1AQKL 2BK8A 1UM4L 1Z5HA 2LHAA 1CGXA 4BFBD 2C3WA 3VFUB 2VDKB 3ZXAC 3UABA 3RX7A 4BYHA 1IAKB 1E4JA 3H6AA 2GJZA 4F80A 3P30L 5E51A 3COOA 5HP5A 5BMFH 5B39B 3SJVD 3O45A 4P4KA 5HYQB 3T4YA 3MRMB 3U36A 2VLLB 2XVLA 2H3KA 1NH6A 1MFBH 2AGJL 4LKCA 3U1SH 4F15C 1ZTMA 4GG8B 4OLVH 1CK0L 4E5XB 3DX4A 3FPXA 1DQLH 4CVZA 1VF5C 4ZO7A 2WWMC 1D5ZB 3TFKC 2EYSB 5DHVH 3VW3L 5M95B 4IRZA 4J7RA 4CN4A 2R4SH 5IW6B 3WLBA 5LBVA 3IU3B 4P5KB 5D1ZC 5DWUL 1QPKA 4U4BA 3VMOA 4MXWL 5D2LE 2XIDA 4XBPB 4KNSA 4ZPTA 1EVUA 3ULSB 3STLB 1YYLL 1A7RH 1LO5A 1YY8A 4R7LA 4HGWB 3DX3A 4CILA 4YXHH 3MV7B 3GSNA 4WI0B 4WU5A 1YNTB 5ANMB 1B0GA 4L4VD 2R7EA 4LBEA 4PW4A 4XNZC 3WKMH 5CBEB 1YN6A 4ANKA 1NGQH 1QHPA 1I7UA 3GZQA 3FT2B 3HOGA 4PRBB 1NFIA 3MRHB 1KTDB 3T6XA 1CR9L 2G60H 1T4KA 1UEMA 3D33A 2VUOA 4IU2B 4KK5D 1UENA 1XEDA 2RJMA 3HG1D 1YMMA 4LLWB 1UXWA 3PE9A 2YKLH 3S34L 3N50A 5BV7B 1NIAA 3CLFH 1U58A 4CMHC 1PMYA 3CFJA 2YR3A 4PJDF 4PJDB 3C60B 3ILPB 1COBA 4JO8A 1O7DC 5DJXA 3KVDD 1DJYA 1AQMA 5FUZH 1ZVNA 3D87B 1NANI 2R2BA 1NC2B 2NY1C 3M6DA 2QVTA 2IWEA 4X4YA 2J5WA 3DTUB 2J4WL 1AY1H 4G6JH 3FB8A 3FN0H 4N0UE 4HHGA 3O6FD 3IS0X 3L81A 3ZE0E 3U79A 3IMUA 4YJZL 3HAEA 3IGAB 5CSZB 4JS7A 1JVOA 5EIIG 3C87A 4ELDA 1PYWB 1EZUA 2MWCA 3ARTA 2HPTA 4K3EH 2OX5B 2RA1A 5EIVA 2G0KA 5JPNB 1G7HB 2K6ZA 1QQDB 4TL5A 4YIQB 3UOAB 2A9MH 4NJ9H 4RAUB 5KS9A 3VFNB 1UD4A 5DJYB 5GJSH 4HX1A 1FVDA 2RCSH 3OKDB 4PRPB 2X4RB 4F7EB 1KWGA 2IDFA 4AYSA 4BFOA 3QBTB 1WWAX 2XZQL 4N3UA 4HPHA 1UXSA 2D0FA 1BJ1J 4KZ0A 4H26A 2E4TA 2TSBA 7PAZA 4XP4L 2EIZA 5E2TH 1R46A 2Y36L 4PS3A 3SJVA 5JHAA 3C5JA 4CW1A 5I1CL 4JKLA 3ARGC 5DQ9A 3SGKC 4H0LC 3GMMB 4B97A 3O41B 4IGBC 3T0WA 1OPGL 1T0PB 1R75A 1ZK9A 2COQA 4Y2OA 3SSGA 1LLAA 1Q9KA 5ACMA 4ZNEE 1ECZA 1OE1A 2OTUA 1AOZA 1MJ8L 3PWNA 1ES0B 1L4IA 4ODSH 4PJ9B 1QR4A 3MROB 4XNXL 5E8NA 4M1DL 3QDHA 2VZVA 1RZ7H 3GM0A 1XBRA 3NDZE 2XC8A 3K46A 2Q7YB 3RILA 3N3EA 4PJBF 3QUYC 2OR7A 4IU3A 1JPGA 5BQ7B 1AGEB 4DOHE 2WWOA 4R8WL 1Q1JL 1TLMA 3MN8A 1G7LB 3SDCC 1CLYL 3BGMB 2EILB 4G9DA 2AQTA 3IMBA 2K70A 3O2DA 4UQAA 3CLEL 2VDPB 3REWA 1WO2A 4PRIB 4W9EC 3SE9H 4L4VA 1WCBB 3FQ2A 3OKKB 4LVOB 3KLAA 4OVVA 3FCGA 3T65A 4KROD 3CDZB 4BBWA 5C0RH 5KYUB 3D30A 3TT1H 3DHJA 3SE4C 3VXUD 5F93C 3Q2LA 3MV9B 2WKLA 1B4JH 3Q01A 4GQ9L 5F88A 1WUZA 1MG3C 2YAOA 5H37H 3DSFH 3U30B 4PR5B 3VG0H 3FB5B 3CU1A 3HI6H 5GRUH 1HVXA 2ZX9A 1Y0LA 5KVEE 1OTUC 1UCTA 2JB5H 3HG1A 1UJTA 1KJ2B 2VN3A 2PPAA 3BVXA 5I28A 1AD9A 5EMYA 1I31A 2JKIS 1NGYB 4OD2B 4MX7B 2AXHA 5KUKA 1UC6A 2FL5B 3BUDA 3SO3B 5ENWB 1VB9A 2W80C 3BKYL 4LPVA 1BVLB 2DV6A 1XH2A 4YDIH 1YQVL 1SN0A 5DD3L 3MJ7A 4X5XB 1AHMA 4X0KA 3ARBC 4B9IA 1P4IL 2NY6C 5AKSA 4DQOH 1PNDA 1TQSA 3L95B 4ZX4A 5DFAA 2CK2A 4J28A 4OZGF 1AS6A 1ZDSA 4P9HH 5I26A 4YFDB 3LEXA 1C5BH 5E6YA 4NO5B 3FCUB 3PFQA 5C8JB 3O6FA 3OTTA 4LARH 1DCLA 4LL1A 3TCLA 1XF4B 3ILQC 2VKWA 2ZUUA 3RWFA 3QQDA 3U4EB 4HU8A 2EYTA 5L6YL 1TFHA 4HJSA 2EUXA 4NUJA 5FYJL 4L8CB 3A23A 4JDTH 4HCRL 4Z7NB 4JGUA 3U7AA 5E1AA 3QZPA 3W1ZA 1PZ2A 5DJCB 5F9WC 5JW5B 4TPRL 1JF1B 4Q6IC 5CCKH 1QOKA 4BH8B 5E94B 4PH8A 2XETA 1RULH 5DD0H 4XCFH 4FG2A 5F8QC 2OL3B 1BOYA 1BG1A 3GK8L 1RUPH 2FJHB 1AG0A 2YK1H 4F3FB 4ECNA 3PREA 5LGHH 1LD9B 4YDKH 5HGHB 3VX0A 1L0PA 1PZ5A 3ARFB 2OXHA 3L4YA 3Q6GL 4MMXB 4NFCA 4HIPA 4ZG1A 2HB0A 4TLKA 2H45A 3BZFA 3O3UN 2MCMA 4PGCA 4FQXA 5F0JB 3NCEB 3FCSA 1QWNA 3IS1X 1UFGA 3VYPA 4MBOA 3KLQA 4R96A 4BUQA 4GI8A 2XTJC 4N90E 1JWUB 2AK4A 4ES8A 4QTIL 3CVHH 4XZUB 3OKMB 3W9DA 3UAJC 5FW7A 2HTKC 3CXHJ 3VGDA 4Z8FH 2P5WD 2F53B 3BLPX 3IDIB 5CWSA 2CGYA 1F1GA 1H8LA 1GJWA 1MHPH 3GO1L 4NRXA 5KSBF 5KSBB 2E4FA 4NI6A 5A16B 4H2CA 4ELMF 5AKVA 3RIFF 5IJBC 3DJTA 3B6SA 1TZIA 5EOCL 1OT4A 1PKQE 1A5FL 2EE2A 3DRQA 3HJEA 4B6ZA 1I7TB 2O6DA 1T5WB 4Q8BA 1KXVC 3RNKB 2C9SA 2KBGA 4QLRA 4OFPA 4HDIB 1NOLA 3MO1B 4L8DA 4K8RH 5CILL 1JRHI 5DJ2A 3VXUA 3B1UA 1TYRA 3G08A 2P43B 3BOVA 4K5NA 2WXQA 1HDMB 3UZQB 5T3ZH 4L8BB 1FLRH 3VMNA 5I6LA 2IV8A 2AMGA 2OTPA 3IYLW 4Z5RA 1OP3K 5FYLE 1KCUH 1LDPH 1OIOA 3CE1A 3QQ3B 2VC2H 4HFUH 4JG1L 3VWKB 5LNEA 5BUGA 1GYCA 3K0WA 4UM8B 3FYEB 5E8OB 1E28A 2WXGA 3QNXB 4NQCD 5ESQB 3DK0A 3ATAA 5HDLA 1TYEB 5LQBH 1RI8A 4N9GB 3O3EA 3DLQR 1V3LA 1EEZB 4IS6A 1TO5A 2CJUL 4Y8AA 5A2KH 3ERXA 2GTWB 3KR3H 1UEYA 2IPTH 2GBAA 4KI5D 2VXUL 5E6IC 4H1LG 4A67A 3MRLB 1AMXA 2F5AH 3WUWA 5C0BE 2DL9A 1CDIA 1IO4C 4I9WE 5AVQB 2NDFA 4HZLA 3RZCD 1XQ4A 4NRYA 5F7LB 1CUOA 5IEHB 4TTGA 5SX4H 4X5QA 1OB1A 4YPJA 4PRHD 5IM7A 3NSJA 2YD4A 2CKBH 2Z4QB 3RWJB 2ZPKH 1NAMB 4WNJA 3GMQB 1D5XB 5DJ8A 3LB6D 5D1QA 1R3LB 4AQEB 3ALXA 5JOEA 1H3UA 1TR7A 1E9OB 3WFBH 1CE6A 2WBKA 5EF2A 4HLJA 1A4KA 4UYPA 4K7PX 4RDQG 1P5VA 5C71A 3T0EB 2WKOF 2WWKO 1XGPB 3M8OH 5DXWA 1OARH 1E5YA 2DLFL 2VR9A 3D8MA 1GAFL 2MPAH 3VJ6B 5E5RB 2BFVH 2B1OA 3FO2B 3LIUA 4HSCX 1L6ZA 4D8OA 3QCVH 5LKNA 4AE1A 3F7KA 1OM3H 2FR4A 3RLSA 2EEBA 2E46A 4GKSB 4FDWA 5BS0D 1JNNH 1UZ8A 3S3SA 3P40A 3AABA 4I0PB 1AKJD 2JQZA 4PTUA 3DXAE 3LPGA 4MB5A 4HUXA 1PFOA 3SD2A 4F7CA 1ZPUA 2IALB 4HAGA 3IM1A 4HIHA 4YAQB 2P8MA 4RH4A 1K3IA 5B8CB 1BMZA 3ELQA 3LY6A 2GK0B 2DICA 4UV7L 3OB0K 4YL4A 3ZDYF 2ZUYA 3ZDYB 1CXKA 4Y4HB 4H8WC 3TV3L 4UAOC 2FH6A 4RWHA 1FHGA 1SF3A 3ZMNA 4NENA 4UT9L 4D9LL 4NQDE 1GMEA 2X4QA 3BJ91 4DVRL 4WV1C 1A7BA 1ANUA 3J2PA 2VLRB 3IDGA 4UQ3B 2ISDA 4APQC 1R5VB 3ARRA 2AQPA 1N6VA 3VQ2C 3NH7L 4ANVA 4O58L 4KKAC 3L16A 3VB9A 1FFPA 1KG0B 4FG0A 3SIKA 5FV1L 5BMFL 3Q48A 1ZLSH 3A67L 1FV1B 1VZHA 3U48A 2XV6B 3DJSA 4GBXD 4JCMA 5JXAL 1KYOJ 4M29A 1FIGL 2OYPA 5I1LA 4B9GA 3EBHA 4HOZA 3D4GA 4LEEA 1U21A 1A4JA 1KV3A 1S9WA 3BPCB 5D7LD 4MB1A 1RKRA 1VGEH 2DM7A 1LEGB 1WZLA 1PGRB 4OB5L 3DETC 5B1JA 4A6YB 1HKLH 1DQLL 4BKSC 3NSFA 2DJ4A 4JL1A 5JORB 4GMTH 1X7QB 3BVNB 1M42A 1UOLA 2ICEB 2P5ED 1ET5A 4Z0XB 3S5LB 4Z7WA 1KFGA 3ZKMC 1TMCB 3LNEA 1JN6A 3QXTA 1EHXA 2VDNB 5LBSA 1OF0A 1G6RH 5DR5H 4DUWA 1U91A 3PWPE 5IB3B 3AC0A 1YEEL 4K2UL 4WFHE 1NGWA 1V27A 4HBQA 4XNMA 1NBCA 4JX0A 4URKA 4M8VA 4LOVA 4YBQD 4U0QB 1KXHA 5CJOH 2PTUA 3H1ZA 3KDMB 4XCCL 4X6FA 2L04A 4YUEH 1FNSL 4JCWA 1FYTB 1U92A 5SWQA 2NXYC 3MLVL 4WGVB 3WKML 2OS7A 4Z3IA 1R5IA 4Y2LA 4GH7B 3MGAA 3T2QA 2IBZX 1MFMA 4PRHA 4P4RB 1A9EB 2QELA 3MJWA 1OF2B 4MAYC 4KMTL 5CLZA 4PJFA 4GAAA 3GYRA 3HNTL 3EGDA 1X5YA 3MYJB 1I7ZA 4PP2A 1AR1B 2DYPB 2ADJA 4M6OL 1BFSA 1MW0A 4AH2B 1I1AC 4UB0H 2QKIA 4OF7A 4KK8C 4BV1A 1RURH 2L7JA 3FS9A 4XNUH 4CGUB 4M3KB 1E5CA 2YKLL 3CIQA 1AC6A 1E5AA 3FOMA 3REVB 3TWYA 3R19A 3WDIA 1PZBA 3C8DA 3D85A 4XPHL 5EUOE 4LL4A 4JG0H 4L8SB 2NX5A 4JREC 4Y9GA 4ODHH 3I6LE 3FO1B 1JK8B 1F97A 4GP4B 4LLUB 1RIUH 2V37A 4TTDC 4XNYL 1RAMA 2F58H 4Y1AE 3G6DH 2Z0BA 1AKJA 1OV8A 1BCIA 4P2RB 5DMYA 5L7XL 3BWSA 3QCTH 4JPKL 4JUSA 4LCCA 1AIFA 3HNSL 2Y2YA 1ML0A 4NZUL 5AW0B 2A6JA 2WIMA 3BH9A 2D3LA 4FYTA 5A3IC 3DO3A 4PJ7A 4JZNB 5HYFA 1P7KB 1RFDH 1E50A 4LCVA 4OZFB 3TZVB 3VMPA 3O9WC 2Y72A 4GFXA 4NJ9L 2G5BB 4ZSOE 1NFKA 2BSCA 4OLZH 4IRJC 5D96B 4F7MA 3EYQC 1NCWL 3WY1A 3H56A 2PWGA 3OAUH 4P59L 3RVWC 3S96A 1KXQE 5LLIC 1NMAH 1JZIA 1DBKH 4K3DL 4MLIA 3JYBA 4JVUA 4NHUB 5CIPB 2NXZC 2APBA 1X6NA 3L08A 1G7PA 2M8XA 5F2FA 3VU1A 3UO1H 2KHAA 5I15H 5IBLD 1BWMA 3F7YA 4RDQF 1YYML 1BQLL 2R29A 2X44D 3CFUA 2ORBL 4X4ME 2QGEA 4GBXA 1K85A 2XKUA 4M7JH 4Y4KB 2XVBA 5T1JA 2VN7A 5D7LA 2WUBL 4YMPA 4HLEA 3QC6X 4JFEB 2OZ4L 5H35A 3D2UD 1CXHA 2H9GB 2IBGA 4JDVB 5C70A 4CC0A 2ZWZA 1QG3A 3RL2B 2Q7NA 1MH5B 4XE0A 4FD0A 5DZOA 1MEXL 4QXGH 4P9ML 3VH8G 1NMCC 1P4BH 2WZ5A 4ODSL 1RUAL 4K7PH 4DWHA 3E8UL 3B9VA 2XQBH 4PUBH 4XVTL 2BOCA 2P5EA 2OJZL 4WKXA 5HI3C 4QRRB 4NN6B 1A7PH 5IB2A 2KC0A 4QHMB 1UWEL 4TS6A 3SCMC 1VZIA 4XMPL 5GZOD 1A6ZB 2HFEA 5DF0A 3OXSB 1RY7B 2VZSA 4FEMA 4WDIB 3G9VA 3H3PH 2BC4A 3KLSA 1MUJB 5GRVK 4KRPC 4NBXB 4OZHE 4DGYL 4L1TA 2K45A 5T33L 4X7TB 3GIVA 3JWOC 4KH9A 1NC2D 3OMNB 4N2MA 5JO5B 4AMXA 4DF9A 4BGLA 1JNHA 1V7NH 1XFPA 4FNRA 4HKZA 2WXOA 5IB1A 5C0RL 2BPBA 2W94A 3OMZA 3S6CA 3X3GH 3MHZA 1AXIB 3LV3A 3RY4A 4DEPB 4EN3C 4NKOB 1E2WA 4BZ2A 3MV8B 5GGUB 5B1BB 1MIEH 3FUNA 4H8VA 4L0PB 3GSUB 1JZ2A 2F54E 1WH0A 3QZWA 5IJKA 4EIUA 3EJZD 4AGPA 3X1GA 5E5UB 4HK0A 2Y7QB 1ZLVK 2PPEA 3FRUB 1HXKA 1HOCA 4PSRA 5ETUA 4UBDC 5DDHB 1FSKC 1SN5A 5D55A 3MNWA 5D72H 3Q2VA 4OSUH 1NM9A 5DLML 3QDAA 3IFOA 1WQVT 5E08H 2W95A 2CE6A 3VFUA 5TFSH 2OYKA 2V5RA 4MQXC 1IAKA 1T03L 1Q72H 1U3HC 1RZJL 1C5BL 3IFPB 1NCBL 3J27A 1QI5A 1K72A 3V9FA 1ICTA 1MN4A 2H1XA 3LZNA 3MRMA 2BIHA 4QYOB 5HYQA 5EEVA 3N91A 1P6AB 4Q97A 3V5HB 5AENA 3ARED 1WT5C 1J5IA 4K94C 2A74B 4N8VB 3VRLE 2DKMA 3FMGL 3AQZA 4LVHC 4E5XA 1I53A 3F00A 3L54A 4U3HA 5IGXL 1WLHA 4A37A 1D5ZA 4G5ZL 5KJRH 1W6LA 5GSVB 2EYSA 4PJEB 3QHFL 5CJQH 3NCFB 4DKFL 4LNVA 1W0WB 2XWTB 1KGXA 4L1HA 2EVHA 5IW6A 1WZ1H 1WZKA 2ZX7A 1WG3A 3IU3A 3JYCA 4P5KA 4EOWH 3FUJA 3IFLH 3DI3B 3KPRB 4PS8A 2H6PA 4JFHD 4XBPA 3ULSA 1MRCH 3HHSB 2WUCH 4M4PA 4F7PB 2HFGH 4QJ5B 1SHMA 2X2YA 2VABB 4HGWA 5SV4A 3N42B 3LKPB 2FIRT 4WI0A 1MWAB 3X13B 4UTAH 1YNTA 5ANMA 4NQXB 5E2WL 3D2UA 4HSQA 5AVRB 5CBEA 4XX1G 2ZG3A 3PHOA 1PVHA 3O0RL 2HFTA 4PRBA 3DIFB 2ZXGA 3MRHA 4XP5L 3ZE2B 3JUYA 1KTDA 1QNZL 3WN6A 1P5UB 2J56A 2CWRA 1H5BC 3QPKA 4WWID 4J3OD 3FFOA 4BRJA 4LLWA 3QO0B 4YSAA 3HFFA 4OCMC 4W9KC 1BJ1H 1N67A 2J55A 3CHXA 1EUTA 2ZXBA 4GQZA 3MODH 4PWEA 5FHBH 1XD0A 2J8UF 2J8UB 5GRYA 3IGUA 4NHCL 3WIHA 3QJFA 1JWMB 1SHWA 3LOWA 3G9AB 3CVBA 3P54A 4RAHA 3C60A 1CFVL 2NR6C 2AZAA 2XPGB 1AZCA 5EZPA 3KWUA 3G6AB 5DRWB 4JFFD 1YMME 3QI9B 4C83B 5CN2A 2V5MA 4ABUA 1NC2A 3RX5A 3P9LB 1IGMH 4DK5A 5IB5B 1IBGL 4TQEL 3LS4H 4M03A 4LSRL 5D1ZI 1CLCA 1B6DA 1YG9A 3EYUH 4CNIB 2D9CA 2FJUB 2F8IA 2VR3A 3HG2A 1AFVH 4ES9A 2X40A 1OSYA 1KCUL 3IGAA 5CSZA 4C4UA 3OKLB 2WCSA 1PYWA 3EOTL 2C9PA 3BZDA 4FG6D 2AW2A 2OX5A 5TF1L 2VDPL 5JPNA 4NAMA 3RWEB 1G7HA 1QQDA 4YIQA 2NY5C 3VQ1C 3O3AB 3VFNA 3N1QC 5DJYA 5KW9H 3MLPA 3OKDA 4PRPA 2X4RA 3H2WA 4F7EA 1JPFB 1JF6A 2VDMH 4F37F 4X4KA 2B16A 3NP3A 3VI4F 3VI4B 3MLXH 2JKXA 5EORL 4QLWA 3LRHA 3L4TA 2C4XA 5KS9E 2V9TA 3G5VB 2IPTL 2AI0H 3B9EA 4P5TB 5A6LA 4GNKB 4XX5A 1YJDH 4BK5A 3PGDB 3NCJL 3OF6D 4AYFB 1RZGB 3GNMH 1JGIA 4ZW7A 1KPVB 3JV6B 3LKQB 5FAAA 4AXWB 1BYOA 3TCXA 4M43H 3W11D 2AMUA 3US9A 3DVNB 4NB7A 3SJVE 3DX9A 2CA4A 2ZPKL 1GYVA 2KQNA 3FTWA 2WXLA 3TV8A 4O51A 4BSVB 1CF8H 4LGRB 1NCHA 3RP1A 1MNNA 1ES0A 4PJ9A 3MROA 4M93B 3EZJB 3WN5C 1OANA 1KOAA 3NRFA 4I88A 4NLAA 2Q7YA 4DN4H 2KDGA 1XCTB 4JZOB 2VDLB 1JL8A 3NGBC 4HWBA 4X7SH 5BQ7A 2XIIA 5A2FA 4N0YL 3U4KA 1F4YH 1G7LA 2VO8A 2VW7A 4PBWD 3GSWA 5IW3A 3BGMA 1M6OB 4OCRH 1MJ7H 1LK3L 4N8CL 4ANUA 4XP9H 3PP4H 4PRIA 1MXDA 1PLGH 5IUCA 4GG6F 4GG6B 3LS5H 2VDRB 5DRZB 1WCBA 4XWOC 4MNGB 4Y5VC 2B14A 4AX3A 1JP5A 4HOXA 1N8OE 2R69A 3CDZA 2QQLL 3LAFA 3KVQA 3S9DB 5KYUA 4HQQH 3RRQA 3MV9A 2H7WA 4PR5A 4HETA 1PLBA 2OL3L 3FB5A 4L4VE 4HIEB 1KCVL 4NZFA 1WFTA 3PUUA 3TNNA 1AKPA 4KK9D 3RHWF 1B0WA 3W0WD 1KJ2A 4N0CD 4JPVL 4QNPE 3Q1EA 3GJEA 4XGZB 4OD2A 4MX7A 1UM5L 1DE4B 4LDOB 5ENWA 1E2ZA 1S7UB 1BVLA 3NESA 1ZS2A 2ZOTA 5D1XB 3HG1E 1A1NA 1VACB 4ALAL 4HJIA 1I1RA 3L95A 1A9VA 5D70L 2V4LA 1TTGA 1A3LL 1DBAH 2BHFA 1MREL 1U3JA 4NO5A 4NQEB 5C8JA 1ZGLB 1GZPB 2JSFA 1VGEL 3QHZL 1C8QA 4FCAA 2FNWA 1U8LB 4WGWB 3U4EA 1BW8A 1BA9A 2AQ2A 3D4CA 3F6JA 4L8CA 5CJXC 4PJIF 4PJIB 2Z8RA 2FX7L 1FPTL 1RJLB 1DVTA 2R1YB 4FABH 5KSAD 4N20A 5JW5A 3H9HB 1JF5A 2FEDC 2LE9A 1AANA 4H13C 3QR0A 3VXRD 3AG4B 5E94A 4BH8A 3ZZSA 1OPOA 1BSIA 3LNDA 2ZOWA 3TYFB 3CSBA 3CMOH 2OK0L 2FJHA 4KO5A 4NWTL 3QQ4B 1DJGA 1LD9A 3UCRA 3LN5A 4YUEL 1X3DA 3OKEA 3LQZB 5EZJB 4MMXA 3DX8B 3DVIA 5F6HJ 2B3RA 2HKFH 2LABA 3LN9A 1GCYA 2CGRH 5CUSH 3ESMA 2N3JA 4I0PD 2F7IA 3P9MB 1A7NH 4U1MA 1WWCA 3APNA 3QUZC 3UJJH 2Z65C 1F58L 4UIMB 3LPFA 2ERJB 3S36L 5ALBH 1JWUA 4P2OD 5IT2L 2WQSA 1WE5A 5EEZA 3G6JF 4KAQL 3G6JB 4I3SL 2K1MA 1X4XA 5F89B 1S9VB 3QRGL 1BZDA 2QVMA 5ILTH 1TETH 2F53A 2XSKA 1RSFA 4N1CA 4G83A 1KYDA 4ZMZA 1ZGLP 2AK4E 4WFFD 5KSBA 1S3KL 5A16A 2ITFA 4E36A 3WFEH 2E0PA 2OMWB 4UCFA 5J3HC 2DQJH 2EIKB 4KRMB 3G6DL 4B53A 1T5WA 3RNKA 1Q94B 4HDIA 3MO1A 4WEBH 2FX8H 2A9BA 3FFDB 1M71A 4P3CH 4JFSA 3EFDH 1BDYA 1CG9B 3FUHA 3GJFB 1UWYA 3P0YH 3KJ4B 1IKNC 1HDMA 1QBLH 3UZQA 3WEOA 4L8BA 3CFMA 1AHWA 4Q14A 3IRPX 2F68X 5A2BA 5D9SB 3BP6A 3UBGA 3QQ3A 3IJYB 1E5UI 4BA0A 3VWKA 4BZYA 1WS8A 3VXUE 5HHPA 1HNGA 2DMCA 3GQFA 2NCEA 2ARJQ 4UM8A 1BBJB 3FN9A 2LLNA 4UOZA 2HMID 5AYTA 1JRHL 4GEIA 4ENEC 3IDYC 5E8OA 2EDFA 4NZRL 2A73B 3QNXA 1CURA 1OT2A 1G9ML 2TSAA 5FOBB 5ESQA 2P3YA 2F2HA 5GGVY 3WEAA 5I15L 2GSIB 3UO1L 5J89A 4N9GA 5CR1A 4JJOA 1FFRA 2I32A 1GS6X 2GTWA 1QSEB 1V3KA 3PDDA 2YC1B 5IY5B 3MRLA 1XZ0A 1B4LA 1IGYB 3JUZA 5FOJA 1XB8A 1FYTD 2HX7A 1IQWL 1G94A 1I3RB 3VO0A 1JDCA 4PVMA 3VUAA 4CSZA 3KCWA 4DEUA 5IEHA 4U7SA 5HVGB 4L0YA 3CK0L 2WQXA 3ZU8A 3NYKA 3O4OB 4OFVA 5J13C 2QHRL 2DN7A 4EDXB 2EDDA 3RWJA 5DS8A 1NAMA 2YAPA 1F4XH 3FW6A 4H0GA 4F8TA 3SKUD 3GMQA 1D5XA 4H44C 4QEGA 1AR1D 1R3LA 5DC9B 4AQEA 3OAYK 1NGZB 1E9OA 4M1GH 3VXRA 4IKLA 4QMEA 3QR1A 5EA0L 1XB6A 5I5IA 2J73A 4AYEC 3W82A 3WKQA 1KMGA 4ISVB 3UTPD 4ZNCD 1MCWW 3VJ6A 1PX3A 4B9KC 3ARPA 3FO2A 2A6DB 5D1QE 2ZX6A 2I25N 1B9KA 2Q1EA 3LMJH 3N1FC 3VAEA 3PWJB 2PLTA 1QNIA 4GKSA 4V1DD 1HESA 2DKUA 2VMCA 3GIZL 4I0PA 1KB5H 3P77A 4XC3H 3M7OA 1QYGL 2YXVA 3A6BL 2EDJA 2IALA 4N3TA 5LGJB 3I50H 3QXDB 3T5WA 3WIAA 1VFOA 5B8CA 4P2OA 3VXNA 3U46A 2GK0A 4JJ5A 1MCLA 4UOJA 1H3VA 5GHWL 5F9JB 5JQ6L 5C0ND 1AQ8A 4LIQE 2WZ6A 5CKGA 2F8XC 1OGSA 1OAQH 2J43A 3UEZA 4BKTC 2NSXA 4CJ1A 4HG4J 3PU7A 5HHVL 3WLWD 2Z1PA 4A04A 1E4WH 3TJPA 4ODVL 1A6UL 1R5VA 4AJWA 5E6RB 3L3JB 3FB7A 2RHEA 3SBWC 1J5OL 4ILDA 4Y4FB 3P2TA 3GGWB 1ZLVH 1X7TA 1SLUA 5DI8B 1K8IB 3F7QA 3DHUA 1INEH 4UNVA 1G7IB 2CDFB 1KYFA 3B83A 4TN9A 4UNTA 1FQ9C 1Q72L 4J27A 1H8NA 4OZIB 4OZIF 4M5SA 1Q0YL 1FV1A 3MREB 3NA9H 5DHVB 2Z7UA 4FMKA 4ODWB 1N5YH 2ZCHL 5F7EH 2E59A 1LEGA 4A6YA 4KY1H 3GMLB 1WFJA 1ZJAA 5CFHA 4RMBA 4U1NB 4U0RB 5JORA 3KPMB 3BVNA 5CJQL 2BERA 5AWNH 4F58L 2ICEA 4DZBA 4Z0XA 4LLAA 2I07B 4QRRD 4N22A 4YSRA 7FABL 4ONOA 4IHOA 1TMQA 1UACL 3QNYB 4KTGA 4G8GD 4EBQL 2KL6A 4GRMB 5IB3A 4X42A 2CRYA 4I18B 1RZ8B 4LOUD 1QP1A 3QIBC 2HFGL 2AXWA 2DBLH 3WKPA 3PP3H 4Z7WE 1HXYB 3KDMA 4NQCE 3DGDA 4KV5F 1FYTA 3ABGA 3CFKB 1AXTL 3S3DB 1LWJA 2CIIA 1RK7A 2BX5A 4P4RA 1YNLL 4KI5E 1K5NB 4V2CB 4ZD3H 1OF2A 3K4AA 5KN5B 4IOFD 1PD0A 4GT7A 1JZDC 5CLTA 2X4NB 2CM5A 3MV8D 1MFVA 2DYPA 3ATDA 4BSJA 2IGFH 1IJ9A 3C2AH 5KUMA 3VACA 3GRBA 4GXFA 4YE0A 2NZ9D 4KNUA 1P9MA 1YEIH 3KL0A 3C9NB 4PRHE 2BWQA 4GKZB 2Y1VA 4PJFE 5GRWA 3REVA 4AYMC 5ICYB 1UCBH 4APXA 4OU3A 2XBDA 1D7BA 4DO6A 2PWDA 5JHMA 3VI3A 3NN8A 4L8SA 1IBDA 3VRIA 3ABKB 3FO1A 6FABH 4V1DA 1JK8A 4LLUA 4MJ6B 2ZKHH 5HDBE 2R4RL 2CPCA 3W2DH 4KKZA 25C8H 1CO1A 1ZRUA 5EU7E 5GRXG 1UOKA 1EO8L 3PGFL 2VJ0A 2XG4B 5FFOA 3DOSB 2NX5E 5FKAB 3SDDC 3PG2A 3ESNA 1S7TA 4KVNH 1TZOA 4AWJC 1ZCRA 5EBGA 4OI8A 3QIUB 4JZNA 1P7KA 4JM2D 4LCWB 1TTUA 3TZVA 4M62L 3UBHA 2EDTA 1DN0B 4RMRA 3MACH 3S7GA 5HD8C 3M07A 5AVUB 1J8HB 1FCCA 1T21B 1U8CA 1CZ8H 4GSQA 1ZY9A 5CIPA 1F90H 1MI5B 2OMNA 4PJ7E 2MNWA 3MLXL 4JQIA 1DQQB 1V8HA 1M4KA 2M2DA 4W70A 3KPRD 5FCUH 1QTPA 2D9QB 2PF6A 3QO1B 4U1KA 1TQBB 4FZ8L 3FU0A 5SWZD 3T71A 4L23A 1Q1PA 2ICWB 3AREC 3LQAC 3B5GA 3GNML 4J2QA 3QUXB 4OH2A 2ZUVA 3PNRB 4JDVA 2R8SL 4FE9A 3RL2A 3UDWC 1NKRA 3GI8L 2MQCA 3TWCH 4PPTA 3OV6A 2P8LB 3OPZH 4GT0A 3KWVA 4R2GB 5D7LE 2V9RA 4XXCC 3DKHA 4XPGH 4DQAA 5L2KD 3Q06A 1CICC 3TL5A 1AZBA 4XVSH 4HD9A 4QRRA 4DN4L 3QJQB 4QHNA 3IE9A 4H88L 4LOEA 4QHMA 4WNQB 4G8GA 4LSVH 4GKOA 4PB0L 5DCCA 3VGBA 4LP5A 3AMLA 3WIFB 1A6ZA 1G6VK 4HF5L 3SPHA 1CLVA 4XBEH 2XA8H 4FFZL 3NG5A 4J3SA 1F6LL 3P0GB 3THML 1VEMA 4WDIA 1MJ7L 2P5EE 4X7EC 1PSKH 3HMXH 3X3FH 1MUJA 2OULB 3QPQD 3ULVD 4O9HL 2VSDA 3LS5L 4UM9D 2WJ7A 1WF5A 2R0KL 2VL5B 4X7TA 4N2OA 1RHHB 4A68A 4B3EA 1BM3L 1NPUA 4MCZB 5JO5A 4R0LC 1C16A 2GY7B 1A6WH 3SHSA 2EKSA 4HQQL 3GPSA 1ITBB 3N1MC 3ARDB 2CDEB 1U42A 5ICZA 4ZW5A 4GLRI 4Q58C 1Y18B 5T5NG 1P6FA 3JTSA 3MV8A 4L1SA 2XVKA 3GSUA 4OD1L 5D7JB 1GJUA 4OQTA 5CZKA 2OLDA 3CZNA 2X6UA 2Y7QA 2ZXQA 1H15B 1M7IB 1HE7A 2YRZA 3FRUA 5I18L 4R7XA 4RMTA 1R0AH 4BGDA 5DDHA 4WHDA 2HKHH 3LEYH 1DQVA 3VXPB 4OUUB 4Y1TA 1I75A 5C3IA 1XIWC 3CFCL 1P4LA 1SVBA 2ED8A 1P7HL 2A4ZA 2QBWA 3IFPA 4OR1A 4P5TD 5AYUL 3TBWB 5MEOB 2QQNL 3M17A 1PJWA 2UXTA 4Z9KB 3ASOB 2Q5BA 2A6IB 3V5HA 1DCEA 1TVBB 2ZUQC 4JAMB 4R5XA 3KYMB 5L88L 1WTGT 4N8VA 4EVNB 3B7YA 5CJBA 4TULL 8PAZA 5FYJU 3I6GA 1KCBA 2HRHA 4QRUB 4CDGC 4OGAC 4UDUB 5GSVA 3MFFB 3HPJB 4PJEA 4Y19B 3V4PL 2R0LH 5DD5L 5EZOL 2APVA 5FO7B 3AGWA 2CSPA 4OD3L 4QUOA 5I73B 2WQ8A 4EI6A 3TJEL 2F74B 4OGQC 1WZMA 3CMOL 1OCCB 4W9DC 3VDBA 2YUXA 3ECUA 3IF1A 2ZZUT 3HZ3A 3KG5A 2DEXX 3OAZH 2P42B 2IH3B 3KPRA 3Q8BA 4KZCA 4WK2B 2N0KA 2BZDA 1NEZB 5SX4I 2FJFB 3HHSA 1FO0A 4F7PA 2LU3A 3S3JA 5FEBA 3CVHB 2PETA 2XRAL 5SWZA 4RMUA 1V5JA 2VABA 1FZKB 3LKPA 1MWAA 4GRLC 3X13A 3SE8L 4NQXA 5DJZB 3F7VB 3R0NA 4LB8A 4JFVA 4LASH 1J1PH 4HIXH 3JVFC 1PKOA 4D8PB 3HZYA 3W39B 5IVNA 3D50A 2V5SA 4HMCA 3DIFA 1BF8A 5AVWB 1HJBC 1G1OA 2PYEB 2D2CC 4LDLB 1P5UA 3UAEA 4PRDB 3QORD 2D8KA 5IBTH 4H8WH 4KUZL 5DUML 3TH3T 4Z3FA 2AK1H 1HCFX 3IMSA 4DK6A 5F70A 3BUQA 5JW3L 4JB9H 5I1GL 3TT3L 2DWYA 2BY3A 5E00A 1V05A 4IJ3C 1JWMA 4FQIL 3HW7A 3MBXH 3UTTB 3ZTDC 2X41A 1KFAH 4MZRA 3SKOB 3D0LB 2XPGA 4AIOA 4AG4H 3APFA 5D1XD 3G6AA 4UM9A 5DRWA 3QI9A 5AD0B 3BAKA 2FLRT 1E4KC 1D5IH 1G9HA 5I1KL 5JW4N 4QGYA 3P9LA 3FC8A 5IB5A 2UVEA 4UNIA 4QF1B 1VHPA 4NQED 1E6JL 5IVZB 5LWYL 5A6MA 1K6QL 3RI5F 4CNIA 2WPGA 2NYZA 4KWUA 4QT5B 1Z9LA 4BQ8A 2DQUL 2JTDA 3OKLA 5CINH 5DRNB 1AQHA 1QHOA 3QIWC 2CLRB 3RBGA 3RWEA 2V2WB 1S7QB 3O3AA 5T3XL 3EBGA 3PABB 1UA6L 2DQHL 5T5FL 1Q0XL 5E2VL 5D93C 4LSSL 3MV11 3CZGA 3H9SB 2A9AA 4YXLL 3GUTA 2VKXA 2VNCA 1NCIA 1HHIB 3EYVB 3LH9A 3NIFF 1VAHA 2PO6D 3VI4A 1QMUA 2H0JA 3FU8A 4GMSH 2CKBB 3G5VA 4RX4D 6PCYA 4DPCX 5EDSA 1JYVA 1EDHA 4LLQA 4P5TA 3IDMB 2H0FA 1C5CH 3PF2A 1KEGL 4WO0A 4XPBL 5E95B 3QYMA 3PGDA 3ILDA 3UBFA 3HE6D 1CU4L 1RJZB 3RVUD 4AYFA 1RZGA 5LBGA 1XH0A 1KPVA 4POYA 4AXWA 4HWNA 4F27A 4K5OA 4J4PC 2FO4A 2ZNWA 1TKWA 35C8H 5B3NA 1AYRA 4HZ1A 5LDUA 3LN4B 2XZCL 1RXLA 1SF5A 4LZKA 1CD8A 1J0HA 5IQMA 4X0NA 3GBMH 4JO5A 3TFBA 5BZZA 2VLJB 2X53A 4P49A 4FP8H 3RDJA 1I8AA 1ETA1 4IDLA 5AOJA 1GC1L 3P3UA 3RIAF 1XCTA 4JZOA 4DVBB 1LTXA 3MNVB 3OJDB 2R2HB 1HZHH 1TT6A 3H55A 3T3ME 3LPWA 4S10A 1QHQA 2UY6A 3S3CB 1RIVH 1M6OA 3TTYA 1JGDA 1FHNA 2ENSA 1MY7A 1M56B 2DWEB 3AACA 2DQFB 3UZEA 4XN5A 1G9NC 5JIKA 1TSHA 5I16B 4JANB 1TPXB 3B5HA 4GG6A 1QKZL 3RL1B 4MNGA 3N0PB 5HXMA 2AANA 4YDZA 2WLHA 1WK0A 4JFHE 5IB4A 4I87A 2OP4L 1O6VA 2HX8A 1G43A 2WBJC 1IMHC 1TQUA 3NDYE 4XN7A 1KN2H 1FN4B 1XGTB 2I9LB 3FCTB 4PRIE 5AUMB 4ZUSB 3V52L 3SPGA 3L3KB 3QORA 4HIEA 4R90L 4UTBH 3UJTH 3D18B 1D2PA 5AFAA 2MKLC 3C09C 1L7TH 3HVNA 5A2LH 3VVVA 4ERSL 1JGEB 4XGZA 3MV9E 1DE4A 2D03H 5DVMA 5HYJD 1BZ9B 3LRLA 3RPKA 1JFQL 1S7UA 4KRLB 5DZNA 1J12A 3ULUF 1MCJA 5HJ3A 5BVJA 1JHKH 1X9UA 4EI5C 4L5FL 5D1XA 2QQKL 1YVLA 5H94B 1FDLL 3LH2L 4LBAA 3H9ZA 4ZYKA 2UZIL 1BD2B 1QSED 1TCRB 4WWKB 3STZB 3FU3A 3IU4H 4NQEA 2BVTA 3S3BB 2QPUA 1ZGLA 2EE9A 3S35L 4GB9A 1JXGA 1U8LA 1G6RB 3MA9H 3SBRA 3B37A 3HTLX 3K2IA 3LYRA 4I85A 5E7FA 4E9LA 2UUDH 1F11B 3B9KB 4O2FB 4RESB 3MRFB 2N7SA 2J6EA 4JFTA 4KJWC 4PJIA 4MXQC 1RJLA 1ED3B 2R1YA 4UV4H 3H9HA 4M4RB 1U8NB 3KPSD 4LFHD 4Z7UB 2CDGB 2A0LC 3BAJA 3MLSL 5IOKA 3EO0B 5EG6C 3C6LC 4UIKL 3TYFA 2VM3A 4GRWF 3V0HA 4GRWB 2RQ8A 3L3OB 4Z7NE 3E38A 3CVDA 4RX4A 4MJJA 3QQ4A 3CFBB 2YS4A 1JUFB 3JWOH 3PPSA 1JYNA 3BDXA 5EZJA 3LQZA 2ATAA 3HE6A 4I13B 2N1KA 3MPCA 4RFNC 1DJIA 5FR3A 4ZFOB 4NKMA 2CUIA 3U9PL 3BQUD 5HGDA 3P9MA 1CVRA 3FQYA 3P4MB 4UIMA 5HYEA 2C4FU 3QJHB 1OTSD 3CBKB 3TTSA 1ZT7B 2AP2A 3FQRB 1QR1B 1XTLA 3G6JA 8CGTA 2GW5A 4XCNA 2AAAA 5ID1B 1N7MH 2AERT 1VZGA 3QDMB 1MCSA 1SDYA 4QWWD 4W9GC 1GGIH 1WA0X 2O5ZL 1WIUA 4UQDA 5GGTH 3T8VA 1NDGB 1UD5A 3H0TB 1EHLL 4NUGL 4LHUD 3U7YH 2OMWA 2LU5A 4TUJB 4FZEL 1ACXA 1S4IA 1V54B 1HOEA 2F53E 3VD5A 2QDVA</