5LBGA

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with faropenem-derived adduct at the active site cysteine-354
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
259
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
total genus 72
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lbgA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbgA01
4QRBA 3VYOA 4XVOA 4QRAA 3U1QA 5LB1A 4QTFA 4A1IA 1Y7MA 3TURA 5DCCA 5E51A 4GSUA 5DZPA 3ZG4A 5DVPA 5LBGA 5DZJA 5DUJA 4GSRA 3VYNA 2HKLA 4HUCA 4LZHA 4JMNA 5E1IA 5K69A 4ZFQA 2MTZA 5E1GA 3TX4A 3ZQDA 4Z7AA 1ZATA 4A1JA 3U1PA 3VAEA 5E5LA 4LPQA 5D7HA 4A52A 4JMXA 4QR7A 5DU7A 4A1KA 5DC2A 4GSQA 4HU2A 3ZGPA 3VYPA 4K73A
chains in the Genus database with same CATH superfamily
5FCUL 1B6DA 1F4XH 1KTCA 3BD3A 1UXWA 4OCXL 5D9SA 2XQYG 3P77A 4ANVA 4ZMLA 4ONGL 5L8LB 1E5BA 2NY5C 1LO5A 5AG8A 2BNQE 1LE9A 1HL8A 2BCKA 3FFCB 3H3PL 4UBDD 5F1OB 5C3IA 5I76B 5DD1L 4AIOA 1QSFB 5LXVA 4YWGH 4XR8C 3WJMA 5FF6B 1FVCB 4N22A 2V3DA 1QW8A 5TQ2H 1MCQA 3S34H 2HT4C 4MMZC 4AKQA 4QO1A 3KPNA 4Z6AT 5IESH 4IRSB 4NKQB 4KMQA 4LIQE 4QKXB 4GSQA 1CFSB 1NSNL 2XKSA 3LZPA 3FQ4A 5CP7B 4F7CB 2K3TA 4L8BB 5BV7B 1U58B 4RGOH 3OM3B 3JBG7 3KCWA 3S5LG 1FPTL 4DFIA 1T1XA 2EKSA 3RHWK 1DQQB 3CDFA 3EJYD 1FO0H 1V3JA 2ATKA 2GHZA 2JCCB 2W9EH 4ONFH 4G7RB 3QHTC 5F7LB 2FD6L 1S78C 5LAXA 2DDQL 2G2RA 4A7VA 1K5WA 3R7RA 4GQ9L 3PWPB 3Q8BA 3SBQA 4GXVH 1NCCH 4P9ML 2OJZH 3NIGE 2WNGA 1R19A 3JWDH 5K93A 3B56A 4OGZA 1KCRH 5CWSA 2H0FA 2P8LA 2Y5TB 4PRHA 1F4AA 3SGDI 4KUCF 5GQBA 5JOFA 3S3JA 5EDXA 1TQCB 4XO5A 3KL0A 3KHQA 5IESL 3GB7B 2WZPD 1MCEA 1JNJA 1BFOA 5J6GA 3QAZC 2WK2A 1RY7B 2C9RA 4WTWA 5KBMA 3I50L 3QCUL 1FVCA 1EK3A 3O9WD 1DBKL 3P0GB 1U2HA 1VFBB 1DVFC 1BBDH 3O2VL 3P11L 3J2PA 4L37B 2Z93B 2FJFA 2BZDA 2BRQA 4I4WB 3M17A 3IGUA 2PYEB 2BSBA 4JKPH 4PR5B 4XVUD 3SY6A 3VA6A 3WJLC 4MMXA 3MACH 1ROCA 5D2LE 3IDIB 4P2QA 3FQNA 3QW9A 5T1KA 1DQJA 1IGIL 2O26U 3KH4A 5IJKC 4J8QA 4L05A 1QPPA 1DQTA 2O30A 3DVFA 2WBJC 4HD5A 3BKYH 4WHTB 1ZJAA 2XWDA 3TA3A 4MCYA 3ARYA 4JCMA 1ITBB 1MCPH 2VSMB 3GPEA 1E28A 2YAHA 3ARDB 3IPBA 3AMKA 3HA0A 3PF2A 1I7RA 3LB6D 3QFJD 3TVMC 2JJTC 4UDTB 5JW5B 2PLTA 3AAZB 2E7DA 4GRWE 2WXGA 4IRJC 2D0HA 1ZV5A 1QHQA 3NCJL 3SOBH 4R97B 5FYKD 3NZHH 1OO2A 2JJVA 4J4PA 3KBHE 5CEYA 1AXTL 3EYOB 5FM8A 2XTJC 3NJFA 4NZ8A 2NX5D 4BKSC 4Y5XA 1FDLH 4P2QB 1OSZA 1U8MB 4P4RA 2R83A 3G5WA 4EBQL 4Z3FA 4Y16A 1IC7L 3HZVA 3KBPA 4KDTA 3QQXA 2N7SA 1BZ9A 1D7DA 1WBYB 4HFWA 3ZQDA 4LLWA 2OS7A 4B3VA 1CR9L 3MLZH 3QORA 4QHMB 5KW9L 5EEVA 3BESR 1KJ2L 1G7IB 4AL8C 4H1LB 4UOQA 1W0WB 1KB9J 1K72A 4BFEA 3QWRD 1I85A 5J12B 4HAKA 3QFDA 4FEMA 2CO2A 1D3CA 3HBGA 3FQNB 3CFCH 3VFOB 3M17B 5DZJA 1L9MA 1GMIA 5F7UA 4NI6A 2DLEA 4Y2OB 2AK1L 2QV4A 3IPFA 4U1GB 3RWDA 5DHVH 4UM8B 2NMSA 2NW3A 2XQ0A 4JFDA 3QFJE 4GW5B 4NO0A 1N0XL 5F71A 1FRGH 2I9LA 2IDCA 3QBTB 4NSKA 1KY7A 3WXVH 1LO4H 5HYJE 1K4CA 2XZZA 1WBZA 3TCLA 5E9DB 2APWA 2WTOA 3IDMB 4G6JL 5L2JB 2VN3A 5SWQA 2GI7A 4FHKA 1LVEA 4XNYL 5IFJA 3ALXA 4G8AC 3EBGA 3MNWB 2L8AA 3PWVB 4L4TD 1WEJH 4UU9B 2NSXA 3ZGIA 2MNWA 3IGKA 3MXWL 4Y4HD 1KYAA 1A6AA 4RSYA 4GOSA 3EGXB 2HXAA 3MRMA 2O4EA 2BDNH 4KQ3L 5I30L 3SOBL 1JDCA 3NJHA 1IQDB 2HUHA 1JAEA 2PWHA 1IGYB 3OKYA 4LPXA 5FS5A 5CM1A 1DVUA 4H0GA 2WBJB 1TEGA 1CU4H 4OZ4A 3S35L 1OAZL 1CWVA 1IAII 3P77B 3WUWG 3RDTA 4JFFD 2DQCL 1XCTA 4NRYB 4J12A 5FHAL 3T04D 7TAAA 2ZE0A 2DLGA 4MQXD 1ZHNA 4NCC1 2A73A 2DM3A 4BSWA 1CN4A 4UM8A 3PHAA 1SBBA 2BRRL 3NIFE 1PF3A 4X0KA 1I1CA 2X9YA 1MCJA 1UUSA 1UGNA 2FQFA 1JGUL 5D8JH 4JFPB 4M48L 4ZOAA 4NHCH 1N6QH 4YHKL 5IMOB 2GY7B 5L4IA 2WNXA 3MUGA 4IRZL 2OBGA 3QQ4B 3OKEA 1J8HA 4KU1A 4OD2B 4UQDA 3TJHC 3TURA 2XX0A 2WLIB 3E80A 4GI6A 4GG6E 3WNLA 3ULSB 2EDRA 5CJOH 3L4XA 2KI6A 3AG4B 5I6PA 2KMWA 2Z92B 2FUTA 3PPEA 5CBAA 3VFSA 2J1YA 5EU6B 1JYNA 1Q9OA 4ILDA 2VDML 5CD3A 1HKLH 4AVHA 2X53A 2ZSVA 4IM8A 4RMVA 4DP8X 3FW6A 4AM0Q 4QLRA 5C0RH 1J9SA 4PBXA 3K2UL 3BP4B 1SY6L 5D1QE 4BINA 1FVEB 3KXFE 4X8XA 3Q2WA 2R69L 4LGSB 4H8HA 1KFAH 2A1WH 1W72A 4FZEH 4P9HH 4IRJA 4QRPD 3ZTEA 1BM3L 4YAQA 5DD5L 1L6XA 3APFA 3K2KA 4KKNA 4Z7UA 2YOAA 5MI0B 3T6WA 5DEZA 2NNCA 1BIHA 2GTZB 4YSSA 1FNSL 4MZ2A 4MAUH 1KCRL 4ZX4A 3PLYA 2ZUSA 5I1IH 3DGGB 2VE6A 5D6DC 5K1NA 4IMKC 2P43B 4OM1L 5JR1H 2YUWA 3BHBB 3N9GL 3MUGB 3GIVB 2WJ7A 25C8H 4KKBC 3RWJA 4LLVB 1KZQA 3L4WA 7FABH 1KCUL 1OV8A 2EDXA 5AVXB 1D5XB 4OCXH 2I60H 3N40F 5IP4A 4ONHA 4L0ZA 1M53A 5BUPA 3AROA 4KK8C 4PGEB 5EC2B 4AYBA 4G11A 3BP5B 4U1JA 2HX9A 2FO8A 2HTKC 1G7QB 1DBBL 2MIZA 5KSUB 1EX0A 5EUOE 4L3FA 5D7JC 1IGIH 2ADGB 2XWTA 1HYSC 5ICXA 3QWOA 3QYCA 4AY0A 2XY2A 4TVUA 1B4TA 4MMZA 2DKSA 4P46C 1U2YA 3ARFA 5FOBA 4PD4K 4WDIB 5LG6A 2VSCA 1FVDA 4ZAKB 4RAUB 1QLFA 1BFVL 3RZWA 1E6OH 3RA7H 5AOIA 3VB8A 5JIMA 1BVOA 5HDBF 1F58H 5D7IB 2ZUQB 2P24A 4AQ8A 4ONFL 4LLUB 3HNTL 2YD4A 4GO8A 1G7QA 4XOEA 5KSUA 3SBWA 1E67A 1LO0L 4M03A 1TZGH 2PCFB 4WI7A 1JGDB 4RQQA 3FN0H 1WCQA 2OJZL 1J5IA 2ZKWA 5FXCH 2CE6A 2CK2A 1A7OL 3U4BH 2WLLA 3ROLA 2XJKA 2IANE 4JFTA 3SPVB 1U92B 4QXWA 1MCWW 5IREA 4X7EC 2HJKB 4W9FC 3FPYA 1EUTA 2PP9A 4XODA 4IOFD 4YHML 1MVFA 4FQIH 5GSVA 5I6MA 4BFIB 3KLHC 2EDNA 1JOIA 1S9WB 4WI6A 4X5RA 1ZLVH 4NQEB 2FUQA 5F1SA 4QDGA 3C5ZC 2NX5E 2DQDL 3DTUB 5LVEA 1DVZA 4NUMA 4LASL 5E6YA 4MA3A 3DX8A 2GT9A 5F8QC 5FCUH 2KL6A 1SJMA 1NC4A 4AYID 1N0XH 4LLVA 1FRGL 1GZHA 3D4ZA 3QJHB 4OZFH 1BQSA 1U3ZA 2R69A 2WV3A 1M1XA 3D4CA 4GKSB 2X6AA 1GA2A 3D2TA 3MZTA 1CGXA 3SHSA 3GSWB 1AHWB 1MFAH 4R6UA 3BH9A 3BISA 4AITA 1NUNB 4H26A 4TNFA 4D8OA 3SYQA 1GKEA 4K7PY 4QYOB 1R3HA 2FYVA 4U6VH 5T1LB 4C83A 5LWYL 3C9NA 4OAWA 1GZQB 1JGLL 2XA8L 2ZCKL 4HUUB 5F97E 3C08H 5ICYB 2O6CA 1DDTA 1OWWA 1JHKH 3H9HB 3HPJA 3B2XA 1GKOA 2IPKB 4GRWH 4WHTA 1BOGB 3QNYA 4DK6A 1YNLL 1L9QA 1AY1L 3QDGE 4JL1A 3WDJA 4D9RD 1AJ7L 5GS2H 4UT6H 3F64A 5EV7A 4UTBL 4P3CL 4NQCD 5D1ZB 4ZQKA 1F5WA 1HEJC 1COBA 1EVTC 2X9ZA 4JPWH 4BFIA 2EO7A 4CMHB 3OLEA 2IQAB 4J3TA 3OR7A 1P5UA 5D2NE 2PETA 3DMMB 3BSZA 3MTXA 3QDME 5BZXA 1UJ3A 3AXLA 2HPTA 4OVVA 4KXDA 5C09B 4NT6B 4FTVA 2WN3A 4XP5L 4WF7A 3BQUA 3KPPB 1N67A 1BLNA 4KMTL 5D7JD 5IEHA 1JBJA 3BUYB 3KH3A 4TSBL 5FO7A 4LLDB 4MBOA 3EDFA 3D4GA 1NIBA 4W6YB 1A3QA 4OBRA 1K3IA 2VERA 3HNTH 2V7HA 3FTYA 3N42F 3P9LA 4NO0D 4TLUA 2AXGB 1MRCL 2VLMD 1E6JL 1RSFA 1MFNA 3L9BA 1S7RB 3NCFB 4IIZA 4ELKB 1XEDA 1XSJA 3PGDA 3HB3D 1E4HA 4GB9A 5AYUH 2A83B 4IIQA 4M7LH 1HHKB 4ORGB 1ZVSB 4BZ2A 1Q9OB 3FFCA 4TLTA 3R7QA 4KQ0A 1GZPA 4ZXBB 4BFGA 2W9EL 1UZ8B 1XSIA 2V5MA 4L4TA 4TL4A 3JWOH 1G7JB 2BX5A 4DEPC 2QGEA 1GIGL 3M1OA 4H44C 1NMCC 2E86A 1LK2A 4JFUA 3O2DH 1Y6NR 5EUOA 1UWEH 1N8OE 3NVQA 5EIIB 1BHGA 3KWTA 4HCIA 5I30H 3OBAA 1S5IL 2JB6A 3U6XS 4TXVB 4TUJB 5J9PB 4Z7OB 4XCNB 1B0GA 1E3ZA 1Q90A 1MCCA 1OLZA 4UT9A 1OT1A 5GGSA 4DUVA 3FSOA 1A4JB 1VSCA 1UM6H 3BSGA 2UWEE 3GSNB 4KH9A 4JHBA 5K1JA 1DLHA 3WG7B 2XIBA 2ZX7A 2NRDA 3PWPD 4PIRF 2ICWI 3T4AB 3K3QA 4Y19A 4U7SA 3BZFA 2AANA 5FM5O 2ZOOA 1R75A 3FT2A 4NCC2 4B6ZA 3L45A 1ZEAH 4HUWA 5E6RB 2CHXA 2X4SA 4QRRB 5ID1A 1AO7E 3ILEA 1DLFL 4N5UA 1KIUA 5TDNA 3GZQA 5DHYB 3V6OA 1BM3H 3HHSB 4G6AC 1A6ZA 4GLRI 4A2HA 4A39A 4XNZC 5GGSB 3KCPB 4M5TA 1YY9D 1A3RH 3ES6B 2WWOA 3AY4C 4U49A 3MLYH 3N40P 1AJ7H 4QNPF 5F9JB 1X4YA 1IEAB 2O5NA 4PJDB 1V3MA 3RVTD 3W0WD 2V17H 1OD7A 2WLHA 3T77B 1CFVH 3WXVL 5BVPL 2RB8A 2X4NB 3MV8D 3ZYIA 4F57L 4FXKC 3NDZE 1E40A 3FQRB 2IDFA 1X5MA 3HS0B 1AR2A 2C5DC 4K3EH 2A9AA 2XKUA 3MUHL 3AM8A 3BJ91 1C8PA 1EO5A 3KAAA 3X13A 4WI0B 3HN3A 4PGZA 5A40E 4LU5L 2ZOUA 4FZEL 3NA9L 2X7LA 3CMOH 2GK0B 4XP1H 2G2PA 4PJIA 3ESNA 1Y7MA 2QPEB 3MV9D 4OZGA 1FV1A 5E5UB 1T2XA 4JUSA 4TNVF 2DI9A 3QUXD 4M3JA 3T4YA 2KZBA 3D18B 2V9TA 4HJ0C 1GGCL 2ZG1A 1WISA 3GK8L 1HX0A 3CLFL 4PJBA 2RQEA 2E7HA 1U8OA 3EYUH 4ZMQA 4ZQTA 1X44A 4JGMA 4MJ6A 4WHCA 1NC4B 2WO2B 2BOCA 3FMGL 4N5EC 1SJHB 1RIHL 1MDTA 3IE9A 2PABA 1OAKL 2AEOA 3MJWA 3P4MA 1UB6A 3RTLA 3STLB 1O9WA 4Z7NB 3ZKXB 5E2TL 2DY2A 4E5XA 1O7DE 1CYWA 4N2IA 4PV9A 3U2IA 5C9JA 4LMQE 2DQDH 4G70B 2NXZD 5CILH 5F9WC 4PJFB 4MZIA 3WMQA 1RJLA 3GSUB 3GM8A 4O2CA 1VEPA 3HZKB 2YUZA 3QQ3B 5IB5B 1RUPL 1U8HB 1VIWA 4I87A 5ALBL 2OTUB 4HG4K 2HSIA 4YHKH 4PGCB 3KJ6L 1DLFH 3N85H 1UWXH 2D7NA 3T0EA 2QQQA 2AMGA 4GAYB 2C4FT 5DLML 2R2BB 3TGXA 1OM9A 1N8ZA 2MFNA 1YNKL 3PWLA 1F11A 2K9FB 3HUJE 4JRXA 1AGCA 2KLSA 1IC5L 2V2TB 2QHRL 2CO7A 5BOZG 2ICEA 1DQLL 4J2QA 3H9SB 1DQVA 2LABA 3D48R 3NFNB 5CCHE 3IBEA 3MU3A 1NSNH 2QELA 3V10A 3ZYZA 4XP9L 1PY0A 2GTWB 1S4IA 2XQYA 4MRCA 1MEXL 1VFOA 2JTDA 3CVDA 3C75A 4N90D 1IZJA 4YBHA 1WYJA 3KNBA 4FQXA 2HT3C 5AL0A 3RP1A 3V9FA 1I1AC 1D6EB 1QG3A 2MNJB 3GSOB 4DPAX 1QR1B 3Q3GB 2DMGA 4Y4KA 2HFTA 4XXWA 2PWFA 2AC0A 1MWAL 4OSUH 2DYPB 5F21B 1AO7D 1OF0A 1KGCD 5G4NA 3CC1A 4ES8A 1ZDQA 1LNUB 3SKNB 2JK5A 2FDBP 1BF2A 2X9XA 4KKQA 1I3GH 2J8UB 3IJHA 5LXGL 2XV2A 4MNQB 1NFDA 3T08A 1G84A 3FRUA 4MNHA 2VN4A 3P3RA 4LBAA 5D7IA 1BAFL 1J8SA 4WFGD 3OJMB 5HYEA 5I1AA 1KEMH 2X4PA 4LSUL 1YG9A 3H6JA 4GAYA 4QCIA 3DV4B 3A6BH 2Y36H 3FSZA 2AMUA 2B7DT 2R2BA 4FMVA 4MFHA 5KJ4A 3OXSB 5JR1L 3OHXA 4CW1A 1UJ3B 3AXLB 2XPGB 4QHUB 3W56A 4ODTL 3FQUA 5ISZE 3SZKC 1U8JA 4QY8B 4PTUB 3OG4B 3GBDA 3VUAA 5M94B 5FYLE 1UT9A 3ARQA 2KQNA 3BVVA 1W0YT 4MQ7A 3RBGA 1CPUA 4PRIA 1QKZH 2GTWA 3F65A 4ANKA 2EDLA 2YLKA 5ALCH 1MCOL 1QTSA 1S8DA 2XTJB 4UV4L 3VXPB 3CCHA 4RWYL 3KYOB 4CUCA 4N68A 4ZAKC 3OKMB 3QIWD 3RJQB 1IAOA 4IW4C 4UCFA 5HDBB 3ARFC 3LXCA 1I4FA 2IMMA 4KK9D 1CFTB 3CFEB 3CBKB 4BJLA 2EIZA 4CN4A 1V54B 1YEEH 3DIVA 4Q6IC 3IJSB 5FLUA 2DB8A 2YXFA 5J89A 5A3IC 1BGXL 1OSZB 1U8MA 4P4RB 1S7QB 2UXFA 3BXNA 3WAJA 4U1SB 1P7BA 4JZJB 3MCLL 5SWSD 1AI1L 2HLEB 3WL9B 2Z31B 4P59L 1UATA 3RWHB 1MFDH 1QPXA 1CXEA 4ZW8A 1YN6A 3FHQA 1LDPH 4NKDA 5KTEL 2X09A 1I7RB 4AQOA 2QGBA 2QADB 1DVFD 1QRKA 1BWWA 4LDLB 3LZRA 4QT5A 2W59A 1BCIA 4DH2A 3O3AA 1HSAB 2ZSWA 4GFXA 4PJAE 1WA0X 4Y2LA 4OCSH 4ZFGL 2P5WD 3DVGA 1BV8A 4LFHG 4M5YL 4ZSOA 5IOPA 3WTXA 3WV0A 5F9JA 2UZYA 5DVMA 5IVXB 1F8TH 2Q8BL 3MLRL 4C56D 2HT4D 1IEHA 5AVZB 3TNNA 3TONA 3IFNL 3PP3K 4AZ8A 4G7VH 4LSUH 4A6YB 4CU6A 2H6UA 1YC8A 4F7EA 1H6TA 2AEQH 1ZT7B 1SUHA 2EUXA 1IKOP 4X98B 1ZRUA 1MJ7H 2WVVB 4XC1H 5D7LB 1KBKA 4JDTL 3QULA 1QLEB 5DRZA 5T5NG 3AABA 1K2DB 4XNMA 3RIFK 1XIWA 2RBLA 3GMOA 4XE5B 5CJQH 2C8NA 2QDWA 3HTLX 5AOJA 3X14A 5I2IA 4DKAA 1IEAA 1FIGL 2X2YA 1JWMA 1LMKA 2J1KA 4FNLH 1EJOL 4AEFA 5DYOA 1F02I 3NCBB 1IGMH 5BRZB 5J13C 2MCAA 3RAJH 4CVUA 3LZOA 1H3PH 3EH1A 4QRQA 3KMDA 2OP4H 3ATEA 2DQFB 4JM2C 4F7TA 4MMZB 4FERA 3H3PH 1SF5A 2F54E 1NKRA 1S5IH 1LWJA 2XQBH 2WLJA 1URZA 3UZVA 2YRZA 3V8OA 5CZXC 2BWIA 1EAJA 4JDEA 4DP6X 4QRUA 1WGVA 4XNMB 4Y89A 2VUKA 2BHUA 2VZUA 3BT2L 3PFUA 1FH5L 2AEIT 4K5OA 3FT3A 5ADOH 3C12A 2YOCA 4XOCA 5EZOH 3FN3A 3CVHL 1CDHA 2M83A 1NMAH 5A1AA 1N8ZB 4AZ8B 4F80A 3HI1B 4P5RA 2XJLA 4XP4L 2IH1A 1Z5HA 2QPSA 2Z31D 2F8VA 4DO6A 1E27B 3C6LD 4XCNA 5D70H 2H26B 4HT1L 4UIKL 2CKBB 1E4WL 1G6VK 3UJIL 5GRJH 5IROD 2C34A 4FQHA 1R3KB 4D3CH 1WH0A 2C9SA 3H7LA 4IBUA 4W4OC 1T6VN 4HOXA 5EU6E 4HG4J 2FAUA 1ILSA 3OHXC 4HKZA 4WJKB 5KVDE 2YD1A 2H1PH 3II3A 4UQIM 5B1JC 4N0CD 2PUQT 3TXAA 4MX7A 1HZKA 2FE0A 3U9WA 2BIOA 1R1CA 5KBDA 4ZUTA 1EAPB 3FT1A 2AITA 5F89A 3IF1A 3ZSSA 1DVFB 3CLEH 3F62A 3MLVL 3FTZA 1ZY9A 2NY7H 3TZVC 4JDVA 5J6HA 3K2UH 2CLRA 3VU2A 4EUPB 3DPBB 3UTOA 4NQUA 1GPOH 1TYRA 4WW2F 4LCVA 4HXBL 1Z32X 4GQZA 2EE0A 5BZZA 5I1EL 4JGUA 2Z8VC 4B9PA 3MPCA 3AAZA 3JV4A 1JF6A 2EH7L 1AC6A 2GSMB 3O4LD 1IM3A 3EYFB 1NPNA 1YCSA 4KDTC 4XB3A 3ZTJG 2DBLH 4OVUA 4AC2A 4U3HA 4HMCA 3OX8A 4E42A 4FLQA 3WY4A 3QUXA 3IDXH 4DP4X 1SHWA 2F7IA 3VI4A 4QXTA 2NY6C 4OUOA 3VNYA 2X70B 4GRLA 4TUOA 3US0A 3O6LL 1OSEA 4JDVB 4HJJL 1KUMA 2LU3A 4CGUB 2HCZX 4FQ2L 4GKSA 3BGFC 5C0AE 1REIA 4P05A 1FIGH 4L9DA 5K9JL 5E08L 3DBXB 1MNNA 2DJUA 3C87A 4TNGA 5FGCB 1EXHA 3WHXB 3LTVA 3AQDA 2IAND 3T8XA 2BVUA 2VZOA 3O6FD 3E6FA 3QS2A 5IB3A 1CTNA 2WGXA 4HKZB 5JYLA 3V9CA 1HIML 1MCIA 5A6LA 3MRJB 1T5KA 3V4VL 3UJIH 1R4XA 4RZCB 1AQMA 1GYVA 5TDPA 4BWUA 3DPBA 4KXBA 5AYUL 2V9RA 4LHJB 2AF2A 1R3JB 1FL3A 4U1KB 4FGMA 5ANHA 2GJ6E 4LFHD 4MJIB 1EZVX 4NQDE 5HGDB 4GKZA 3L08A 4ZFZB 1YEEL 3H0TB 4XHJC 3AACA 3G6AB 4H5SB 2BNQB 1XL6A 1ZIBA 3C5XA 4S1QL 1QLEH 5AZUA 5SX4H 2HKFH 5AW6B 5HTSA 5C9KA 5L2KA 4J6RL 3WKML 2PCFA 4TVPH 4XN9A 3QIWB 3OG6B 5KSAA 1ETB1 5D5MB 1M7UA 5FUOH 1T4KA 3IYLW 2FL5B 2NCMA 5EO0B 4P59H 4ZMNA 4NENA 3WFCH 1UZ8A 3QCVL 1Q9LA 2Z4QB 1ROWA 1XGRB 3MROA 3V7MA 4P4KD 4FMFA 5H4ZA 2W0PA 4GQ9H 3IMVA 2IWFA 1VFBA 1PNDA 1KACB 3HC4L 3QAZB 3JXAA 4QRRD 1AXSB 4MASA 4NWUL 4X6CB 2XG4B 4OCSL 2K6WA 3CLWA 3L95A 4QHPA 1JYXA 1XH3A 2D3JA 4PV8B 3OKLA 2ORBH 3D2UB 4QRAA 4LPTA 2Q2EB 4JRWA 3WGUB 5C0BB 7CGTA 2VDPL 1A7BA 3DHUA 2Z35A 4Z5RB 4WENB 1CDUA 1RK0A 3QJOA 1F13A 3T4AA 1OTUD 1AI1H 5IB4A 3A47A 3E6HB 3FQTA 3MNZA 4MD5B 3VTAA 3QO0B 3STBA 5EZJA 4WWKD 3AS0A 5FKAA 3G5ZA 1NEZB 5D7HA 1CE6B 3BWUC 4TUKL 4Y4FC 1EH9A 4AQ1A 4LAJH 4PU2A 3T8XB 4IRZA 4ZOBA 1FYHB 2C9AA 5GGSY 3UFIA 3W57A 4JHAL 1RK1B 3SDCB 1KTLA 2K78A 5ESAA 5BZWA 2V5TA 3JVGC 3E9TA 2BRRH 3O6LH 3RRQA 2W0LA 3EYQD 4HJJH 4NRZB 5BNXD 1PG7L 1F6FB 2ENQA 3I9GL 3IU3B 1WFNA 2C3VB 1I7ZA 2DAVA 3FTXA 3GDBA 3MLTA 1KMGA 4O9HL 1ND0A 1NQBA 3CQPA 1QASA 5LWYH 4OI7A 4N25A 5F1IB 4RFNB 2NPLX 3FCUB 3QXTA 1T7XA 3MA7B 3ZVVA 3F7PC 1QSED 3C6SA 5DFTA 3U0WH 5E1AB 2WY3B 2X4NA 4URKA 4F3FA 4EOWH 5I16B 5D1ZA 4UQ3A 1WS7A 4JKPL 4PUBL 4HV8B 1XR9B 4NO5B 1A4AA 4KI5F 4ZMWA 4P2QE 2R1YA 2AJZA 4AYDC 2RR3A 4QTHA 4PJCA 2VLKB 9PCYA 4NBYB 4ODWA 1N5AA 4PPTA 3X1BA 1X6NA 4PJ6A 4UINH 5KUMA 3CDZA 3WFEH 5AEAA 2WO3B 3CFJB 2Z31A 3EG9A 4BH8B 3FQRA 5DU7A 5EF3A 1H3XA 3VMNA 1KGYE 43C9B 4HMDA 1Q94A 3AGWA 2E74C 1AGDB 2YMOA 3BH9B 4BZ1H 5I71B 5D71L 1THAA 3ZL4H 3RPIB 4LCUB 5EO1B 4K5PA 3LVEA 3U30B 2VMJA 1DBJH 3NACH 1ZHLB 3P3UA 4MAYC 5DVOA 1JV2A 5F9OH 3LN4B 4MS6A 3DO3A 4PUBH 4G43B 1FN4A 2GSGA 2VW7A 3N55A 2ROXA 5GZND 3T0DA 1LP9F 1C5CL 4P46A 4G8GB 3FQTB 3MNZB 2PW1A 1U6AH 5B7EA 5KS9F 2CJSA 2O72A 5BXFB 2CO6B 2VO8A 4PRPB 5MENA 2A0LD 5HYSG 5I8CA 4OJFH 4HWZB 1ANUA 3LXUX 1NCOA 2XSKA 5BVJA 3DJSA 3VW3H 1A3LL 4Q74A 1O5PA 1JGVH 2F18A 3PV6B 1IX2A 3ZGHA 1WFTA 4WKXA 3LVTA 1TCRB 2Q5BA 1TQVA 4PI0A 1WFMA 3EGSB 1I8MA 2ERJC 3W1ZA 1E8WA 3UTTD 5AW3B 3WTSA 1M3JA 2EEFA 1FNEB 2DQTH 1HHKA 2QLYA 2VLLB 4LKXA 1WGOA 1YYMH 1PZAA 5AOMA 4HVBA 2Y0SA 3D8MA 1OALA 4H0HB 3AY2A 4HU2A 4M93B 2VDNH 2Y7OA 4DTGH 1OARL 3CVCA 4JVUA 1RLBA 4RMTA 4OB5H 4N0YH 4O4YH 3RPIA 2Z7WA 4LQ1A 2IFGA 2UWEF 2BVOA 1Q94B 1HT6A 1BFVH 4LCWD 5B8CB 4ODSL 1FL5A 4FOMA 3ELAT 2W1NA 4G1MB 4YHYC 3GI9H 4YPGA 5DVLA 5GRJL 1N5AB 3POCA 1SOKA 4A52A 4FYRA 1RZKC 3PPSA 2LLNA 1OM3H 1U8HA 4RFNC 3NK3A 1USQA 3NA9H 2MSPA 3KYNA 4JFVA 4KITB 4J3OG 5F7DB 5E24E 5D93B 3IDYC 4PJ7A 1JGDA 4JPKH 1JZ6A 5KSAB 4FL4B 4PWIA 3ULAB 3F7YB 1EEYB 1LHZA 5E4EB 5B4MC 2EDQA 4C58B 4HIJA 3SYPA 2VW6A 2W0KA 1YAZA 4Z0XA 2ADIA 3JTTB 5KYWB 1U21A 1C5CH 2YEZB 1WFUA 1ZA6A 2IQ9L 1WHPA 1MI5D 4UINL 5I74C 4HXBH 4Z3TA 5HGDA 4N87A 4X80H 1RHFA 5L2KD 5D8JL 4W9GC 4JFDE 4E0RA 3DGGA 4G8GD 1CBJA 2L3BA 3CZEA 4LL1A 4I1RA 3J27A 1TZHB 2J44A 4PJ9B 1FO0B 4UNVA 1QYGL 3FQUB 4MCNA 1TJHH 3IF1B 1SVBA 3VGAB 2WSKA 4U1NB 2QVKA 2R1WA 4DKEL 3CVHA 3CZKA 1MFBH 1KCVL 2DMHA 2XZQL 4BK4A 3P1VA 4BA0A 5AD0B 2UVEA 5HHQB 3WENA 3P4MB 1MRFL 4FLHA 2VDKH 5EHFA 2ISDA 2D9QB 1G7IA 3HG2A 1E28B 4N0UE 3CCHB 4DPCX 4WFED 1CVRA 3SBPA 4IJ3B 3D1MC 4CN1A 1FI8C 5H2BB 3LH8A 1G9NC 2GKIA 3D85B 3EYVB 4C4KO 4PJIB 1VGKA 2VZVA 2HG5A 2P5WE 4OF8A 3BOVA 2ZUWA 4X6EB 3I6SA 4DJMA 4JCWA 2HKLA 2X70A 5EDSA 1OPOA 3WDHA 5IVZA 1U8JB 4I18B 1MELA 4RGNB 3VWJA 4UT6L 2DI8A 3CG8A 2DQMA 2P9RA 4R7DA 1R5WA 4HALA 2B59B 3GRWL 2DJMA 2GFBB 4Q0XH 4ELMF 3LKRA 2HFFB 1EZLA 1P6WA 1YUKB 2RHEA 3KL3A 3VD3A 1V3LA 1FUNA 5F72S 4OFKA 4ZW5A 4ZMXA 2MWCA 2EUVA 4N0YL 1OLLA 4O4YL 4PJ9A 1FSKC 3TLRA 1SFHA 3MBXL 3FU6A 4CVXB 4DEUA 3CLEL 3MLVH 4G82A 1F11B 1TKWB 3WFZA 2OTWB 3K74B 3DXAB 5KSAD 1UFUA 3MRRA 3X12A 4JM2F 5I17A 3BH4A 3AG1B 5FOBB 5C2UB 1ZS8B 5KSBF 4TPRL 3WFCL 2A2QT 4YBQC 4C55A 4WK2B 4OZ4B 4WTZG 3JV6B 4DKTA 1FG2B 2HB0A 1IIIA 2ESVA 1MAML 1UXSB 2F5BL 5ALCL 5EZIL 2YZ8A 5IJVB 3RPKA 3HRZC 1PG7H 2QHRH 1C7SA 3GSNA 4K2UL 5E1IA 4NBXB 2A83A 4IIQB 4R3SA 3P3YA 4NQSB 4UIKH 5TE4H 3U7YH 1P4BL 5LBSA 4JFQA 5JUEL 4H7VA 3FTGB 1HHGA 3R4RA 4RMSA 1TF4A 5I0YA 1JGEB 3G04A 5I0WA 3VQ1C 4FADA 1Q9KA 4Z7UE 4I3SH 1RULH 3LKQA 1ZV9A 2JQZA 4G5AA 4PCKA 2P48B 4E9XA 5ICZA 3T4AC 2BM3A 3UIZA 1JNLL 1FG2A 1TR7A 4G72B 3EYVA 4ETQB 1E4XL 4X8JA 4NZJA 2NY0C 2BFVL 3DX2A 3AFLA 1U8CB 2RFXA 3ZMRA 1M56B 1QNZH 4LOUC 3UCRA 1AOZA 5TGBB 4XMPL 2VLJA 3LH9A 2YD8A 4PREB 3S96A 4Y2NA 3GSXA 4AK2A 4F8OA 3NCCB 4QOKD 1F8TL 4U1LA 4OLWL 3CZFB 2CLVB 3KLAA 5DWUL 2Y36L 3A6BL 5DK0A 1PEWA 1YY9C 2XICA 3G6JA 1NH6A 3T9WA 1EV2E 2Q8AL 4KJYA 3WKPA 4AV5A 2YO3A 3H2PA 4WI0A 3EIFA 3UTTA 2G3ZA 3COOA 1JGLH 2F1BA 2ZCKH 1R24A 4D8PA 4FJZA 2G60L 3WN5C 3WFDL 5ANMB 3PG2A 3AG3B 2FBJL 2C3VA 4YUEL 4WK0B 1KBWA 1CFVL 2OULB 1AMYA 1EFXD 4JZJA 2X4RB 3UO8B 5HVHC 4POZC 4GW4A 2ZTBA 3H53A 3TH3T 3BXNB 2G3XA 1E5YA 4NQDB 4WGWB 3QIBB 5IMKA 4NZTH 3EZ8A 3BW9A 3VFUB 5DJCA 3LS5H 4K15A 1QP1A 1I1YB 4L1TA 1T03H 3TBTB 3WXWH 1KNOA 2UX7A 1ZA3A 2O6DA 3QEUA 3TIDA 2B1AL 2CR6A 4KFMA 4EI6B 3GTNA 3UC0L 1MXGA 5FW8A 1BEXA 2V8MA 2W81C 4LARH 2A6KA 1CFQA 2XQBL 1F90L 4S2SA 4ZW3A 1UVQB 3T6XA 1G7JA 4M29A 2GJRA 3BAYA 3S8WA 2CAKA 1TIUA 4S1DD 2XNAA 1Q9KB 4WWKC 4YX2L 1KIPA 2DQHH 2Y5TA 2D7MA 3M45A 4PRHB 1HXMB 2J55A 4N1CA 5IMOA 2ARJA 2P49B 3PU7A 3GJEA 4GP5B 2VRKA 4GQRA 2ODHA 3O45B 5FYJH 5EOCJ 5HHNB 4DPBX 1G9NH 1BFOB 5J6GB 2EO1A 1L5GB 2QT6A 2YEZA 5C7ZA 4JRXD 4UILH 3N50A 3ECQA 1B90A 2UZIL 3MNWA 2NYZA 1NDMA 2J71A 2WZ6A 5FYJD 4S0HA 5B7MA 1F97A 3K46A 1FC2D 3T71A 3ARRA 4Z7WA 4A55A 3QUZC 5DD5H 3IDJB 2X0UA 3F12B 4POUB 3TJPA 2QL1A 1YYML 2F74B 3BPOB 3IDIA 4MXQD 4QRTA 4N26A 4B9IA 5MENB 4LPCA 1EDHA 5F7AA 3FQ2A 1UACH 3N3EA 3VI3F 2EH8L 3FOLB 3KPRD 1L9OA 2EVJA 5C08E 4YDVA 5A3ID 3QUGA 5DZOA 1PEZA 1S2EA 4MJIA 3TYFA 1Z6JT 4R5XA 4X9YA 3CFTA 5AB2A 3EFFB 2VDOL 4CU8A 4F20A 4XRCB 4DP7X 2BCMA 1XAUA 4X0NA 5EWIL 3HE6B 3QORD 4P3DA 4ELMB 4QXUH 3WJLA 2IAMB 2VR7A 4J3OC 3D85A 3WFEL 4YFEA 1EFQA 4UILL 3B5TA 1NC2A 3QXVA 4EN3B 1DQMH 2B1AH 1J9CT 4X6BB 2OZ4A 4PP2B 6PAZA 2DJSA 4XBMA 1Q0XH 5BUAA 2VDLB 1AHKA 3SPHA 3ABLB 5CSGA 5HVHB 3X12B 1DBJL 3NACL 1ZLEA 4X7SH 2KQMA 1E7VA 5EA0L 1UYWH 1WSST 5SWSE 3MLYL 1P2CB 2Y7NA 5JHLH 4E2OA 3O11B 3OB0H 1AHWA 4AGPA 5KUKA 3IFPA 4JJHA 1XF4A 1TSRA 4PYGA 1M71B 3IDJA 5A43C 2ZWZA 3RUGF 5HYQB 3QFDB 4PJEF 1BDYA 3D52A 1FZJB 2ITCA 4FRWA 2D9CA 4MJ6B 2XRAL 1H6EA 1S3RA 2CBOA 3HPJB 4G3YH 3ZKXC 2A6DA 4D3CL 4G1EA 3DYPA 3L4UA 2AZAA 4MYPA 5JIIA 5BPPA 2MTPA 1DUZB 1S9XB 1MCOH 3CQQA 1Z1WA 1HHIB 1BZ9B 2XZQH 3I3DA 3VFRA 2EDFA 1AGFA 3PWUB 2X0WA 3A5VA 1SVZA 3L4ZA 2X7LB 4OCYH 3PV7A 1RK1A 1D9KC 2AXFA 5AWNH 3GLAA 1YNTF 5SWSA 4Y9EA 5E2JA 5AW2B 3HZ3A 3G6JE 2DQHL 3U7YL 1WAEA 4MB5A 2ADFH 3QVAA 3ZL4L 1WBXA 4NC0B 1G7MA 3FBQA 3W39A 4EVNA 3B1TA 1KCSH 2TSBA 1UZ6F 4LSRL 1ZIAA 2GYSA 4X6BA 3DSNA 3R8BB 4ODSH 4KKAC 1OCOB 4HUVB 3TZVD 4MQXC 3EHBC 3CU7A 1CLZL 3TIEB 4XNQA 3BPOC 4W9JC 3D87B 1H5BC 3FUKA 1HDMA 4D0BB 4D9LL 5HBBA 5K5YA 4XP1L 1M71A 4N0FB 5F7NC 5L8JB 4O51B 4H25B 2APXA 4FNPA 2YRLA 4HHGA 1NCUA 4JY6A 3D33A 1H3UA 5DJAA 3JWDL 1G0YR 3LZNA 5TPWL 5J57B 2EIMB 4B5ZA 2Q9OA 3MJ7A 3ZMEA 1KN4H 3CH1A 3LKOA 4N8CL 5FV2A 4YHLH 3VXMD 3WSQL 1E4JA 2JI3A 2R56L 5DGQA 1HZLA 1QLEL 2JJSC 2FWSA 5EO0A 4OLXH 1KLFB 1XV8A 2E7CA 2UXGA 4UAHA 2VR9A 2K7QA 3X1GA 3U0PB 6PCYA 1RULL 3LNEA 4YSQA 4D9QD 1TITA 2X44D 5CJ5A 3WU1A 4E41E 4HUCA 5ICUA 2FYYA 3RTQC 4QRQB 4DGIL 4L4VD 1RZFL 3MMEA 2GQHA 2J4WH 3TOPA 3D3VE 2Y72A 2FZ3B 5KYNA 4I5BB 1AC0A 1G5AA 4ELKA 1GY1A 4ZFZA 1IC4H 4GAJH 3SGEH 4MMYA 4Q14A 5J56B 1F2XK 1MWAH 1U8IB 2Z7UA 4OSUL 4Y5YA 3RY4A 5KYXB 1MJ8L 1BZOA 4K07A 4TVPD 5I1LB 1R17A 1OAUL 2WM0A 3MREB 4KH2A 4L1SA 5SV4A 4Z7OE 5I18H 5L2KE 4DSYA 5CZVL 5JOEA 1NIEA 5LXGH 2CPUA 3HNVL 1LK3L 1J1XH 4FA6A 2FT7A 1MI5E 3UZEC 2XYCA 5FDWB 4FABL 1OGAB 1KLGA 3UAAA 3VSTA 1BX2A 1MEXH 1V05A 5PAZA 1I8KB 1OPGH 4NAQA 3APDA 4DESA 4WWNA 2HJFA 2AV7A 4XN4A 1AXSA 5DJZB 1SQMA 3FAWA 1GTNA 1KC5H 3IKCA 1TVHB 2Q6WB 2PR4L 2MCG1 4EMZA 4JY6B 3TEYA 1NBZA 1ETZA 4NAJA 1FIEA 4RH4A 5K39B 2H1LM 2A38A 4FKKA 5GSRB 3ULVF 3BQVA 4AVIA 5J1AA 5KG9A 4MTMA 1X5YA 2G9HA 3TH4T 1RZJL 3WNJA 4WJG3 4Q0XL 4QUOA 3HUJF 3UO1H 4O02A 3WIAA 1M2OA 4NO0B 4W70A 5CLWA 4HIPA 1QFWI 2X41A 3D51A 5JQIB 2VKWA 4X5XA 3QARA 1NAKL 3FFOA 2G5BB 4R90H 2UZIH 2FNWA 4DGWC 1S7RA 4HUMB 3DRQA 4S1DC 4X83A 2WKOA 4MA7L 5DWPA 3ABGA 3WIFB 1D2OA 3VFOA 2OI9B 3SDDD 5F8RC 4P5KB 2PR4H 1TPXC 1CLZH 3MQIA 3ILPB 1HHHA 4FFVC 2K6ZA 5DDHA 1HSBA 1F86A 4TUKH 4LLDA 3BWUF 1AR1D 2SODB 5DJ0A 5B39G 4ZT1A 3VACA 4N2NA 3OSVA 4M02A 4RWYH 4NP4H 3H54A 2VRAA 2WAQA 3ZO9A 5HVGB 1G1YA 3OSKA 1ZT7A 3NIGB 4DF9A 2DBJA 2FATH 4L8DB 3ARGB 1UD6A 1E4KA 2QDVA 2VXTH 3BI9X 4M8UA 3TCTA 5J06A 3POHA 2H2PD 1IE4A 5DK3A 1KYDA 1MIML 4G6MH 2Q2LA 3V4LA 1VACB 3IS0X 4PEEA 3MBEC 3D85D 4X4KA 3WKNA 3BWZA 1U8KA 2VTFA 2AK4B 3IRCA 4G8FA 1BLIA 2VUOA 2X87A 4HKJA 4M9OA 3WNNA 2HX7A 5J1AB 1AYRA 1GR7A 2GC7C 1A8JH 5FK9A 1Z0MA 3MODH 4JFPA 3FU7A 4KO5A 5I6OA 2J25A 2ZWSA 3OPUA 3S98A 3SJVA 2YBGA 1GGBH 3NSDA 1CI5A 4BFKA 5FHBL 1XZ0A 5DTFA 2EDYA 3ZQ9A 5DUPL 4PJXE 2QR0A 3F7VA 3C2AL 2F08A 3RDTB 2PN5A 4F57H 5EBLA 3NMEA 2VCOA 2X88A 3OQ3B 5CZRA 4JFDD 5KVEH 1LK3H 2WQUA 4GW1B 1I9RH 5CUSH 4KK5C 1WVZA 5CN3A 3RFZC 3SCMC 2APSA 4AT6A 4NQEE 3TS8A 2J5LC 3IXTA 5I6XB 3G6AA 1FNLA 1W15A 3AS1A 5DSCA 1IE5A 3ZDYF 3E8UH 2G9KA 1QUPA 4HZLA 1UKTA 1VDGA 2BXYA 3DI3B 4W1TA 1O7DC 4KK9C 1SVCP 2PTUA 5D1XB 3WNOA 5CR1A 2N4IA 2F7PA 3K0WA 1SDYA 1AZBA 3KBFA 3KHOA 4PJGA 5JW3H 1ASQA 5A16B 3B2DC 3FRUB 1Q4NX 4DO5A 2PXYB 3CXDL 4WV1B 5D7IF 5E99L 3TO2A 3O6KH 1Q0EA 2BOBA 5BV7H 3QUKA 4LEXH 3D34A 4Q9QH 1TVBB 5GSVB 4HS6A 3GFUA 3PWNB 2EUZA 5GS0H 4LLMA 1EJOH 4B27A 2NZ9C 3FU7B 1KV7A 5E5MA 4I3SL 5SWZD 3UDWA 4ZMPA 3OHXB 3QQ9D 3GMPA 2JH2A 3ZZLA 4X9FA 4B7LA 2D4DA 1QW9A 2R9HD 1MH5A 5IVZB 1ZE3H 5CIPH 4JANB 2KZ1B 2A0LC 5DHXB 4KHTH 3UTSD 1DUYA 2XWEA 2VT0A 1W72H 2BVQB 3VTMA 5DFAA 1BREA 4KBPA 4L4JA 1GH7A 1P4LB 3NCEB 1NFDB 4PGJA 1NKGA 4G9DA 4YGVB 2ZCLL 1EHNA 5IROC 1XR8A 3N42B 4H8WH 4KRMB 2VH5H 2ZAHA 3DHMA 3LKSB 3W5NA 3EHBD 2B1OA 4IS6B 4PB0H 4PRBB 5DWUH 5D2NB 3S37X 5FCSH 1SDDA 2HVJA 1JD9A 5HDOA 3OAZK 4BH7A 1WAAE 5LGYA 5F0LB 1TZHA 3P0VH 4UT7H 2J8OA 5TJWK 4K5MA 1A2YA 4GIPD 4M6AA 1SZNA 2AQNA 2ZNWA 4OTXL 1BBJA 1OP4A 4G6ML 5FUCE 4F91B 3QNXA 1UZ6E 3ABZA 3FZUC 3BIKA 4XPGL 2BP3A 5D93C 5MENE 5IBLD 4H40A 3WIHL 3GO1H 5FUZH 2EYSB 3MBEB 3EO9H 4JQVA 1UOVA 3MRCA 3QJVB 4FG2A 1FHNA 2ZKXA 4ONHB 1GS7A 4G9FB 3IDXL 1HOCB 1CIUA 3QNZA 4KJWD 4N85A 5E9NA 4AH2B 4TVPE 3RVVC 4HLJA 5AVVB 2WNKA 2R4SL 4KHXH 4NNPH 2X28A 4OFPA 4PMEA 5D1ZD 2IXQA 5L6YL 3D30A 4AWJC 4QRPA 2GITA 2BVQA 4J3WA 2WC7A 4MZRA 1GPOL 5INDB 5KBPA 2BSSA 4B95C 3NFSL 3EH4B 1S3KL 3KGSA 5C8JB 1P1VA 4GW4B 4KO9A 5E00A 5D72H 4OZGF 2HFGL 1IVLA 5KVFH 5KVGH 4BV1A 5C08D 4YR6B 2A9MH 4YNYA 5I66A 2DWEB 1XF1A 1I53A 3K1KC 4L3EE 4LSDA 3F05A 5CKGA 1JRHH 1GGUA 1LEGA 2G3MA 1E2ZA 1MN4A 3FN0L 3R0MA 4R5VA 4YS4A 4M43L 5I18L 2V6HA 3U2SA 3K6IA 1IM9D 2VR5A 2P1YA 2YC1A 1FE8L 4R2GC 4TUUA 4AYMC 4QTHB 4EZKA 2J2ZA 2H0PA 3LRMA 3AREA 2P44B 3DUSB 3A22A 1KN4L 3QDMB 2FNBA 5FYJL 5GRYA 5GSRA 5FYKE 1UYWL 4UQCA 1NLBL 4O5LL 4ZD3H 4WWID 2WP3O 1T7YA 1CQKA 3RWGB 2WCPA 4RGNC 3QXDA 4YO0A 1EEUA 2VSKB 3LRKA 1AE6L 3QDGB 4UV7L 3UCQA 1JPSL 3UTPD 3KPSB 2MPAL 2UYLA 1OP9A 3DIFB 1D6EA 5CGYC 3QWNA 1XCTB 4TKWA 4XMVA 3U25A 1A6TA 2Q3XA 1HIMH 3NEXA 5KVDL 5IFAH 4S0SD 3NIGF 1WUNT 3VXSA 2JKJA 1WTLA 1ULVA 4BFRA 4S2SB 1Y6MR 3QUML 3D3VD 4PTUA 5C6TL 2VABA 1J11A 4POYA 2ID5A 4WTXA 3QI9D 2ZWLT 4Z0BL 4XVUC 3TX4A 4JL2A 5CS7A 2N1KA 4FA7B 5J5EA 1Q9LB 2Z4QA 3U2JA 1XX9C 5FKAB 5C8JA 4UIMA 4PV1C 2MRYA 3EHBB 4NKMB 3VCLA 5C0AB 2IV9A 2DS4A 4OQTL 4R96A 4NZUH 1BYNA 3PDOB 4RWHA 2F53A 2D7TH 3S5YA 4JDEB 1KPRB 2OR9H 4KRNA 1WD8A 4HWNA 4NFBA 5IIEA 1HSAA 2ZSWB 5B1CA 5C0IA 2C3HA 3GPSA 4AUYA 3SDXB 3ZRSA 2J21A 4HK0A 4DKFH 5C0FA 5KVDH 4P2OA 1OARH 4FFZA 4OM0H 5FGBC 2IVFC 4OB5L 5E9DD 5INCB 4QJ4B 4NP4L 3FQ1A 1U8LB 4NNXB 2KLRA 3NYKA 1TMCB 4JPWL 4XBEL 5E7FA 5IBLC 3LRSB 4KXAA 4QI3A 2VWEC 4AMWA 4MJ5B 2VGLM 1TTAA 5GGRY 3LOWA 1PYWA 3G6DL 2AS5M 2BSTA 4DPRA 4LPWA 3SB3A 3LDBC 1PD6A 3L7EA 2CDFA 1UWFA 1ET7A 4QJ3B 1KXTB 3OF6D 4H8UA 3ATBA 2YKLL 1B4RA 3KLDA 1FCGA 3WJJA 3ZKND 3VAEA 1MI5A 1SF3A 3WFDH 2ICWA 2A9ML 3OTTA 1RUKL 3LRHA 2D31A 3ARBD 3FQXA 3V7AE 5I5JA 1RURH 4XZ4A 2Z64C 2BIMA 5ICZB 5F88B 4CADA 3HC3L 2V9QA 5ABZA 3V5KB 2AXGA 2EDTA 5D1QB 2HT3D 5I6KA 2I26N 4NZTL 5FYLH 2IJ0C 5AZEL 2EXWC 2Q7YA 2WLZA 2J88L 2XN9E 2QEJA 4PLKC 5TTRA 1DE4B 2C7FA 1LEIA 1OTTC 3FTSA 3N1GC 1ED3A 3QH3B 5CEXA 1FFNB 2OZ4H 3LKSA 4Y1SA 5I15H 2YA1A 3NJNA 5CLTA 3BPLC 4Q58C 5KN5A 3CPLA 2GTQA 3DVNA 1QD0A 2JQAA 4OIFA 4BSJA 3RJDA 6FABH 1RUQH 3CGTA 4OH2A 1BD2A 4OQ1A 1JDAA 1Y18B 1FO0A 1IGJB 1DSFL 3BO8A 2CBQA 2JELH 3CDYA 2NTSP 5AW0B 4PJHA 3ZT6A 3VXUB 4XPTL 5AW4B 3TT3L 2F54B 3LQAC 4LVEA 2VQTA 3TO4B 3N6YA 4Y1TA 4YDMA 1KTKE 5JNYA 4HC1A 5EF0A 4AJWA 4ZAKA 4C47A 4OM0L 3ZDXF 1CICD 4M4PA 5D1XC 1MQKH 1WCBA 4EXKA 2W60A 1EPFA 4A2MA 1HQ4B 2PWGA 4OLEA 1HWGB 3PE9A 2KLTA 2E7LA 3F7LA 1N3NA 1A0QH 1YEJH 4FQXB 1FAIH 4FNSA 3ZYOA 2OMTB 3AS3A 2XQYK 4QF1A 4WAFA 4CC4C 3L3IA 4K8RD 1QNIA 3T77A 1GC1L 3QIWA 2F53E 1OAQL 2WKLA 4IOFC 3S35X 3KPRB 3V0GA 1DQJB 4NZRH 1DEDA 1Y1UA 4HETA 5FUZL 1PYWB 2N3JA 4KZEL 3A4AA 4U1HB 1NCDH 3GZOA 1AGBB 1MVUA 3GNMH 1H19A 2APFA 1OOAA 1GL4B 2VLJD 5F3HA 3UROR 3ZMNA 4Z3HA 2AGJH 3EGSA 4W9DC 1LO3H 5EA0H 3S3SA 2AJ3A 2XWXA 4MB1A 4XBEH 1M6UA 2W9LA 4AEHH 1WAPA 5KSAC 4AI7A 1GCFA 2D4FA 1WIPA 2QSTA 5LLIC 4Z7WB 3OAUL 5DZLA 1INDL 3KS0J 5ACMA 1CTMA 1BQHG 4W9IC 1CZ8L 3RG1C 3ARBB 4XMKH 2JXMA 1HS6A 2G30A 5C07A 3BKCH 5F6HI 5DR5H 5F1NB 3L3OB 1A7PL 1FGVH 3DPDA 4R7LA 3LXAA 4MLSA 1IRAY 3HG0A 4AKPA 4MS8D 4IRJB 4FQ1H 5C08A 1XGYH 3EYQC 3LNHA 1LEIB 1NZRA 4RNRA 5FYLD 5EEXA 2ZWNA 4EXPX 5IUSA 3OAYH 3LKPB 4BK8A 5HP5A 5F70A 4W6WB 2GHWB 2R4SH 1L0QA 3D9AL 4I9WE 1AG0A 3ZHKA 1XD1A 3L5WB 5IHWA 2CDGA 1KBGL 1YUHB 5HGHB 5IQ9A 1E42A 5HYSA 1CFSA 5IW6A 1NCAH 3D39B 5IOKA 2CO7B 2NTFB 3B1UA 5D72L 4A2LA 2XFXA 3V5HA 4JREC 1MF2H 4JHWL 5DVKA 4Z0XB 1A7RH 1FZKA 3QDHA 4XPGH 1E5ZA 4MQSB 3RWGA 4O02B 5BOJA 1EERB 1L0PA 1A3ZA 3WHXA 5C07E 1RP8A 4F1SA 3WEBA 2VXQL 5C0DA 5GHWL 3PJSB 3I84A 4NO5A 3MO1A 1LE5A 3DIDA 4FQ1L 2PCYA 3WTUA 2WWNA 1M05B 1SMOA 3W38A 1G94A 2EADA 5ICXB 3ETBJ 1N59A 4I1NB 4PLNC 1CO1A 1DVTA 4JAMA 2O5ZH 1WICA 2ADFL 2N59A 3NPSC 5EUKA 1I8KA 1M7DA 5HJ3A 1A0QL 3VDAA 4AYFB 5HHPA 3IK2A 4F8LA 3GXMA 3U30C 4ODXB 4HKXB 5JDSA 3KR3L 2VSDA 3QUYC 5KVFL 1XR9A 3BPCB 4H4NA 1T3FB 2OMYB 3GXNA 4FKHA 1QYGH 1RIUL 4ATWA 5K39A 3NJLA 1DLHB 5C0JB 2W80C 2J4WL 4JMNA 2DLHA 3B2MA 5E1GA 3HN5A 4LB8A 1IM9A 4Z0BH 1OP5K 2NTFA 4A1JA 2BLFA 3GKWL 3Q8EA 1CFMA 4BSWB 4Z77B 4ODUB 2I07A 1IT9H 5IW6B 4OGXH 3I02B 4Q56A 3QEGH 4MD0B 4Y16D 2JKLA 3VTTA 3MBEA 3O2DA 4HWUA 4WUUB 1UA7A 3D69A 2VL5B 3UTZB 1IGFH 1KJ2A 2LV4A 4FABH 4S0TD 3G08B 5DT1L 1WZLA 1NCTA 3BSZL 4LSTH 2BNRA 2XN2A 1XF3B 2DL2A 35C8L 2DQFA 5SX5K 3O3DB 5F6IC 3M46A 1WWAX 1AS8A 3MO1B 4X6DE 3CH1B 4OIAA 4ODTH 2GABA 3DV4A 1PS3A 4Y5YB 1AS7A 3BJLA 4OTXH 4KZ0A 1FN4B 2GSGB 2ZCHL 4AEEA 3QFJA 4M4RB 5B38G 1XCWA 2GW5A 4L9LA 5F7EL 3IGAB 3SDYH 3CN4A 5EUOF 4F27A 3P4OB 3U79A 2GSIA 4FFWC 2NXZC 4J4PD 5IEKB 5FO8B 3T2LA 5T5FH 3U0PA 3G9VA 5F7KC 4UB0L 2Z3FA 1ZHBB 3TNMA 1J1XL 1KV3A 1G4MA 1KJ2B 2O5XH 3UO1L 1AKJD 3ZZQA 3P0YL 3REWA 4AW7A 5BVJB 4E41A 4N8CH 3WSQH 3FJTA 1XB8A 4LEOB 2VAAB 1ZLDA 4KQ4H 1A21A 3FXIC 4NT6A 4HULB 4NJ9H 2A4ZA 35C8H 4MWFB 2LFEA 5EEZA 1G7HB 3G5XA 3FB7A 5LBSH 1PIGA 2DV6A 1Z5LB 2WLKA 4BUHA 1A6VL 2WQWA 2X4OA 4XX5A 4W9LC 3TNNB 4YDKH 1RZFH 5ECJE 1PLAA 2PYFB 5GPRA 2X6UA 1M3IA 1AVAA 1FNAA 1AQKL 4R7VA 3UTSB 1VGEH 1GZHC 4WUKH 1JF1B 3SE4C 5EF2A 1EJ8A 5LGHH 1MFCH 2AJVH 2R29A 1QFHA 1PZBA 2VL5A 3FFDA 2X3AA 3UTZA 4D7BA 4LCCB 1RJZA 3BZ4B 4FFYA 1SXBA 2QZ5A 2J88H 3PS6A 3TBBA 4MCMA 3UJTL 3BZDA 1X6LA 1ZKAA 2F5AL 3G6DH 4LKCA 1UD5A 1S7VA 3NTCL 5C09A 5CCJA 4JFOA 3GS4A 4JFFA 3IU3A 4XAKD 3FUHA 5DHVA 4Z1PA 3PWPE 1MPAL 1YEGH 2E8YA 4N5ED 1MIMH 2AXWA 4XO4A 4RSVA 3KWVA 3MV7A 4G7VL 5FAAA 4PJDE 3WD5H 3S0PA 1CJYA 2VXQA 1MREH 1KY6A 4I7ZC 1M1SA 3TN0C 1MCHA 4U1MA 1YEHH 1IVTA 3MRJA 1MW3A 1TNMA 4L4VB 3VI4B 4TQEH 2CNZA 1MHPL 5EORL 2OJ1A 2XI9A 3BX7C 2VR3A 1CCZA 2G75B 5IGXH 5FGSA 1T7WA 2N0KA 4Y4KC 4TMPA 2IG2L 3SGKA 4LOFA 1FFPB 4X5WB 4KNQA 1BMGA 5LGHL 3T1FB 4L8SB 2YZ1A 3VFSB 1MG3C 3SE9H 1JZJA 5C71A 5JHDB 4QHKJ 2VL4A 3LIUA 3VXTB 2V3FA 2ZJSL 2X4TA 2HFGH 2Q7AA 3O4LB 4M8RA 4BQ8A 1M6OA 1OB1A 3QO1A 4XXCA 3R8QA 4HSCX 3FQXB 1ZLVK 4PS8A 4MKMA 3RX9A 3WTVA 1J9RA 3NZ8B 2DH3A 4GRMA 1NLDL 4X99B 3OVUB 4CVZB 3LRGA 3P2TA 4MXWH 3EO1B 2DQEL 3V95A 2MOQA 1F3DJ 3IMSA 1R0AH 1FNGB 3EXJA 2G75A 3IU4H 1EQWA 1FZKB 2DL9A 2H6PA 3W3BA 2CDFB 1FFTB 1KT2B 1D5BA 1DE4A 4R83A 1JPTH 4XBPA 3TZVA 5BZDB 1FORH 4BQ9A 2DF3A 4J3VA 1NCWL 3BLPX 4Y1AD 5A2KH 3AGVA 2Q10A 1BJ8A 3OKLB 3BCDA 4YBQD 1KDIA 5IWLC 2F5AH 2X2UA 3F8UB 3TP4A 1TXKA 3VMOA 3BUBA 3WJJC 3P9MB 3UDWC 2CIKA 3KEDA 1RPKA 3AT8A 4N2DA 1D5RA 2YEVB 5CN1A 4KVNL 1TYEB 5HGAA 3VXMA 2GJ6D 3DGCR 1A8ZA 2H2PC 3MROB 3V5DA 1KPUA 3FK3A 4IK7A 5IB2A 1R3KA 1NFKA 5JXAH 3HI5L 4PP1C 3ZE0E 5IF0A 2BWQA 4XBPB 3TZVB 5BZDA 4P3DB 5B8CC 4BFNA 1J10A 5HHVL 2QTEA 3TEUA 1AD0B 5AZ2L 1RHHB 4JRYA 1A65A 3L3IB 3K72B 3MRPA 1FZMB 1C12B 4OQTH 1ODUA 2AI0L 4FN0A 2YPVH 3W81A 1IAKB 1CYXA 5C09E 5JW4Q 3TF7C 1BQKA 4K3DH 3ZSTA 3NQKA 4NBZB 3Q1EA 3ARFB 5HI3D 4EN2A 2R23A 2GPZA 4RA3A 3G7TA 4P57B 1CBVH 1UD8A 5C0GB 3SDDA 3WMPA 2R2HA 2OTPA 4LL4A 2WMPA 3QHFH 1I9IL 1PQZA 1ZDSA 4EKXA 3BAKA 3C8DA 1TNNA 5KWYC 3MRDA 2WOYA 3C6LA 2CLZB 1U3HD 2GBVA 5D96B 1TZAA 1Q9WA 3ML8A 5CEZE 1CXFA 4ZFOA 5D1XA 3CHQA 4ZDHA 4ZMZA 3SPIA 3T0EE 2FX9L 3PL6A 4KTEH 3L81A 1OP5H 3F7QA 3OGOE 3QB7C 5DMGD 3BP6A 4I85A 1I8LA 2EE3A 3S8FB 4F93B 1YMMB 5I6NA 3IFLL 1RI8A 3QXAB 4M00A 4FAAB 2EUWA 2PYED 4XNUH 4JHWH 4U0RC 3ORJA 3VSUA 5A2FA 3ML9A 3MLWL 3LKRB 1K4CB 4AV0A 2WVVA 3TT1H 3HPLA 1Z3GH 2APTA 5KVGL 1DO5A 2GJZA 5CSZB 2ITDA 3BSHA 4MXWL 1NUDA 1F18A 3G6JF 3LKNB 5DJYA 2CBPA 4U3XA 3VWJB 3OKKA 2EDJA 2F58L 4PW9A 5BRQA 1SBSL 1JNHA 2NY6D 1IM3D 5KBNC 2AABL 1CLOL 2AGJL 3GMLA 3Q6GL 1T0OA 4OD2A 2NY4C 4MHHG 1ZXQA 1NGWB 1T5WA 3I85A 4NPYA 3HE7C 1IBYA 1Q38A 1Q72L 2YPVL 4PSRA 5F88A 1MXDA 4WHYH 2FO4A 4OZHB 4PY7B 1FBIH 5HVFB 3KGUA 2LU7A 3ARGA 5CIPA 4Z7WE 2BP0B 1B4JH 1A6ZB 4LEOA 4KRPB 1J5DA 1XGQB 1P9MA 3UAJC 3VXUE 5IJVA 1JCVA 1JTOA 2VC2B 3EDDA 2CDGB 1J0ZA 1Z3RA 3S36X 4HK0B 4JAMB 4V1DA 4DQOL 1GMEA 3EKCA 2FX7H 3VFTA 2IBBA 5FB8B 4EQ3A 3F00A 1HINL 4ZK8A 5INDA 1URIA 1B0RB 5IQOA 2X10A 5AW5B 5LCVL 4H8WC 4X7TA 1MFVA 4BZ2L 1T04A 2F54D 5AWNL 3B7SA 3M7FB 3S36H 4K3GA 4RX4D 3UJTH 3LNGA 3N0AA 2XBZA 2FSEA 1S6NA 1ACXA 5I1AB 4FTVE 1ADQL 4LCCA 5J1SC 1WLHA 3WS6C 4L18A 2XVGA 4GBXD 3LPOA 1FYTB 3EOAB 5EU6A 4I0PA 1GYUA 5IUCA 1KXVC 3N1PC 4QYOA 5L4MA 2A6JA 3GZPA 4OLXL 5JLZB 3T2QA 4CSZA 3PWJB 1L3WA 4YDKL 5KYUA 3ZQWA 4JJ5B 3C60D 4KOCA 2CGYA 1TLMA 3I02A 3LQZA 1LTXA 4OJDH 2NT1A 4TV3A 1U30A 4XVSL 4ZTPH 3ASWA 4PLKD 3HAEB 1CE6A 1B9KA 2QQKH 4LLAA 2I24N 1G0DA 2R2EA 4OM1H 4OD1H 2J57A 5F96L 1I9RL 1P69B 2EAEA 4I48B 4YLQT 1VA9A 3P0YH 5CUSL 3T65A 1CF8H 4F8NA 4A7UA 3MLXL 2H2SD 4HAFA 1OSPL 4GRLC 4P5MA 2UZYB 3P30H 3X17A 5EU3A 5MEQA 3GBEA 4LVHB 5F7YC 4DKDC 3NAAH 3BE1H 2CK0H 3FCTA 4TYUA 3UTTE 1XO8A 5K9OB 1AE6H 2D7TL 4GP4B 2LTQB 4XPFL 2YKLH 5CHNA 2R7EA 2NSQA 1FBIL 3O0RH 3W0WB 5FUCC 5B3NA 1KEGL 1DBBH 5F0MB 2VISB 1IQDA 2BINA 2QJDA 5E2VH 1U3JA 4JFZH 1MH5B 2QQNH 5DFVC 2K70A 3H8NA 1NCBH 1VJSA 5E4AA 1XF3A 2JJTA 1IAIH 3PHSA 3PGCA 3LHAA 1E43A 3VWJD 4N2MA 1A25A 1HINH 4N2KA 1CT8B 2AABH 1MJUL 1Z9PA 1TT6A 1ZLUK 2WQRA 1MHCB 1UXMA 1PD0A 4QF1B 5L4JA 2H45A 2CBTA 3X3FH 2G3NA 3QUXB 4CMMA 3S3BB 4L1LA 2GJPA 2BOLA 3HR5A 3HB3C 4Y19D 3LH2L 5DO2D 4YC2B 5DQJB 1CLVA 1R3IL 4CNIA 1U3NA 1A1NA 3L4CA 4KK6D 4XXDB 4JO5A 5HHQA 3H7BB 2GJ6A 2IOOA 4K55A 1TQSA 3N2JA 3O6ML 4GNKB 3O9WA 4XWGL 4TQHA 4AQ8C 4JPIB 1YYLL 5KSBB 3SDXE 2JNZA 4KGLA 4L4TE 1FFOB 3F83A 3H9SD 4BIKA 3K2IA 3DTDA 2NY2B 3WS3A 3CPLB 1T22B 1MCBA 2HVJB 3VGBA 4HWBL 4AW4A 5I26A 2ZYSA 3W0WA 4K94C 2AJSH 3FB6A 1WJ3A 5BO0D 4JRYE 2ODIA 3GB7A 4OLYL 1JZDC 1C16A 3K1DA 2RIKA 2OMZA 3JV5A 3NN8A 1IKFL 1DDHA 1CT8A 2BNRE 1NGZA 3BDYH 4IBLT 5EH1A 1T1WB 3U83A 3PGCB 3MLSH 3KCPA 4M1CD 4RGND 4TSCH 4X6DA 2LU4A 3QUYD 4XRCA 5E6IB 1RUKH 1S7XA 2RALA 2XZAH 3WN5B 4FQXD 2VDLH 3ESUF 4N2FA 1I7TB 2X42A 4FXGC 2D0GA 1ZLWK 4MDIB 2ITDB 1NMBH 5BJTA 2ZUYA 4PJGE 2XVBA 3MUUA 1BF8A 4P2YA 5FLVA 3WUZA 3BKMH 2CJ3A 4FCHA 1YEJL 2HYMA 2EE6A 3GRWA 4WO4C 4FF9A 4DN4H 5CBEA 2XY1A 3K7UA 1F4WL 4N90E 1W72B 1MJUH 3IAPA 5D55A 1KJ3H 3GGWA 1J0JA 4NO2B 3WCYA 5IW3A 1XXFC 2AXJA 3OLIA 4Y88A 3GTTA 1CF1A 5E94A 1F3DH 2IWKA 5T3ZL 3MCKB 2BW5A 4PS3A 3GXTA 4GAFB 4MJJA 4M8QA 1DZ0A 4XH2A 2JKRM 2J12B 2Y07L 1NCBL 2RFXB 1N0LA 3K8MA 1IV8A 4WJ5B 2K1MA 2XXMB 5AAWA 3L6FB 4PJHB 4HPOL 4XE0A 1UM5H 1AGBA 1MUJA 1VPOL 3QRBA 1ETJA 4F2EA 4YSUA 1FJ1B 2R29H 1OGAA 1UM4L 4JR9H 4YHNB 5E99H 1U58A 1NBCA 1AFVL 1NIFA 2A6IA 2HLFC 2Y1YA 5KVEL 4Y7MA 5FV1L 1LP9B 1INDH 3P4OA 4YC2C 3SE3C 2CHDA 2GSIB 2WKGA 4JY5L 4ZI8A 4Z3GA 3VWJC 4PGEA 1YJDL 4N3TA 4BWTA 3E6FB 2AW2A 5IB3B 1CBVL 3N44F 4JO8A 3R06B 4NM4L 4KNUA 1KWGA 3LEYL 1M4KA 2YWZA 4KRLB 1NUGA 1MWOA 1KXHA 3IMBA 5HGBB 1H6FA 3MNDA 1FZMA 3VSVA 1WIOA 3LN5B 4ODVL 4Y2DB 5GHWH 3ZTCC 4PJ5A 4G6FB 1QBMH 2WHVA 5DEFB 1U3HA 3OKDB 1P7HL 4UQEA 1LD9B 1WV7T 2A9BA 3QJUB 2NX5A 2GUYA 1J86A 3EJZD 3BVUA 5FGRA 5IHUL 5KYUB 3VFTB 5LDUA 2IOMA 3NZSA 5IEHB 2LVCA 3ILDA 3T6VA 5IEKA 1NGXA 5TK4A 1CFBA 1FFRA 3O6KL 5BV7L 4YHLL 3MRNA 3ZX1A 1ES0B 5EU4A 3U6RB 3CZNA 4N0UA 1ZSHA 1NMBL 2XV6B 4X5PA 2NY5L 4WK4B 3RWCB 1YNTB 4NKIL 4WSKA 4AGQA 4NDMA 4R4ND 5TF1L 2UXTA 5I0VA 4QMEA 3TIDB 3NGBC 3RZCC 4B50A 2AK1H 4DZ8B 2RD0A 1F56A 3ELQA 3KWUA 3Q6FA 1OE3A 1ZWIB 2P5WA 3P40A 4ZODA 2R0ZH 5TFSL 1KJ3L 1UQSA 4TLSA 4XVTL 4X5QA 5DMKA 2XN0A 2X0VA 3GMOB 2E6JA 4LNVA 4ISVB 4ZPVA 4MA1C 3OD3A 3B43A 4LDCA 2YJLA 1K8IA 1ZOXA 4WU7A 3CFJA 1HXYB 2XFXB 3V5HB 4Y4FB 3ZE0B 2HRPH 4OU3A 4N0UB 4YR6A 1SJEB 3L5XL 4EQ2A 5CZXD 5KANG 3V0DA 1Q1PA 5IJKA 4H26B 4L9LC 3INOA 4CC1A 4HH9A 4FQLL 2OXGB 3UEZA 4X7FC 4U6HA 4MRBA 3BAIA 4RETB 1OCWL 1EHAA 2R0WL 4J6IA 1WE5A 4L5FH 3OXRB 4PJDA 4QHUA 3FT9A 2P28B 4FP8L 3VFVA 5FECA 1O6SB 1BOGA 3QNYB 4YQXL 3MGTB 3R1GH 2NUPB 1A7QH 1TQBB 2C3WA 2P80D 2WN2A 2W91A 5CLXA 1M7DB 1D5MA 3C6LC 4N9OB 4QPEA 5GIRB 3ZZ1A 5ITBH 3DDGA 3M8OH 3EH3B 5F2FA 3QISA 5IK3A 1YN6B 4IDLA 1ES0A 1MNUH 1OTTD 4NAMA 1BD2D 4X8JB 5AALA 4IMLB 4UOJA 4RLDA 4LSQH 4DP5X 1HILB 3D2UA 3ECVA 4EIBA 1YPZB 2R0KL 1KLUA 4RGMC 3BDBA 4RDQG 3BD5A 3CZJA 5J8OA 5EU6D 2H6OA 3L1OH 2FX8L 1EAQA 4R0LB 1HHJB 2VITB 4CJ0A 5I0XA 4IKNA 3FTGA 3WO3B 4KO7A 2VDRB 2QQNL 1X4XA 4GXVL 5EZJB 3VFWA 3H4HA 3BUIA 3DURB 5CJXC 4PP2A 3FB5B 3JTSA 2YGQA 4HIJB 3MLUL 5DS8B 3V0HA 2D03L 1ZVHA 1KGXA 1J8HD 2ICCA 1QNZL 3QJFA 4GUOA 2OCCB 2ZP0T 1RIHH 3SDCC 5G2NA 3UAFA 2AJVL 2W88A 3VXMB 4KKZA 5C6PB 1TFHA 2W9DH 3V0WL 3V9EA 1WPCA 4F2FA 2PTTA 5E8NA 3RWEA 1QZNA 3GLDA 2DDQH 4YSOA 4MNGA 3EBIA 3IM1A 3T3PE 4FQCH 3HVDA 4OJEH 5FGBA 1QFWM 1IIKA 2JXMB 3ARFD 1KPVA 1HWHB 2IAMD 5CEZL 4LP4A 2CWRA 4KPHL 1C1EH 1XT5A 5A16A 2BY0A 3B37A 2HMIC 1EEZA 1IB5A 2B16A 1THCA 3CBJB 2CR0A 3B7TA 2P8MB 2Z91B 4I2XA 4XWOC 5K69A 1QLFB 1JHTB 3IVKA 1AH1A 3GBML 4WTQA 1OGAD 4WCYL 4M7KL 5CINL 1RFDL 4OUUA 3ULUD 5LCVH 5C0CD 4D7PA 1N68A 3F7KA 2ZPKL 3B3IA 3TPUB 3QIUB 4YHIA 3FF8A 4PLJC 4U33A 2NUTB 1MPAH 1TTGA 2W0FA 1QLRB 1FDLL 3MV11 4NKOB 1J8HE 2FL5A 4AGNA 4XNXH 4DGYH 1RZ7H 3ZG4A 5GS0C 3MJ8A 4IMLA 4AX3A 1HJCA 4S1RH 2NDFA 3TIEA 4TOYH 2V5SA 4LARL 4ODBD 4RBPH 5IB1A 3GMMB 2HFFA 1MDAA 1I1AA 1S5HA 3KZ8A 2Y06H 4PH8A 2A77H 4MAYB 1XR8B 3V0VB 4UWQB 5GJTH 2LAGB 3CHPA 5TQ0H 4LHUA 5DD3H 1VGEL 5T1JA 1MJJB 3DBSA 4OKVB 2EC8A 3G3LA 4GY4A 1DBMH 5F3BA 4L4VA 4N9GB 3ZL1A 4LNRB 4LLYB 5E2WL 5LQBL 1NC4D 3PHQB 3AADB 4P2OC 2NW2A 4U7KA 1UD4A 3RTQD 5A2JH 4LRIA 4DP2X 2ZUTA 5D9SB 2IH1B 1RZQA 3VXRB 4F7PA 1SHMA 2HJKA 5GRXG 2EC9U 1LXMA 1USZA 4DIXA 2JCCE 2X6BA 4G83A 1WFOA 2X4QB 3ISRA 4BGLA 2DZEA 2E5EA 5IWLA 3D06A 4K71B 3S48A 1CMOA 4UDTA 3ZIMA 3SGEI 3IT8D 3QH3A 4ZMOA 3FH7A 1JHTA 1LO4L 2NQ3A 3O0RL 4OZHA 4PY7A 5DHEA 2XOTA 3WS3B 3TA3C 5B3JF 5EZLB 2O5ZL 1MW0A 3X1FA 3V52H 3EFDL 3B34A 4EAEA 1TLKA 4A7GF 2K0RA 2NXZB 1GC1C 3FKUS 1RCYA 2Z65C 3GM0A 2HN7A 4PJ5E 4PGBB 3O41B 3SDAB 2ZQKA 2BZ7A 2GJ6B 2NY5H 5FKPA 1HI6A 2Y3AA 1LILA 1PCSA 4FULA 4NKIH 4WFFE 3IE4A 1ZT4B 3ATFA 1UOWA 4X6DF 2EKJA 1IKNC 2PW2A 5EIVA 3NSYA 3VXPA 1N7MH 4ETQA 4UQ2A 1T1ZA 3HNSH 1UA6L 3JV4B 3UERA 2VQ1A 2ZYRA 1A6PA 1CU4L 3VXSB 3LH2H 1QQDA 3FUJA 4DO4A 4P5TC 4ZUSA 4HZAA 5D1ZI 4JG1H 1IT9L 5BO1H 1DN0A 4WWPA 3E1F1 5JW4R 3LIZH 4PJGB 3MLXH 1JP5A 1TJGL 3TBVA 1IFGA 1XMEB 2Y7QA 2MOVA 1NCJA 3RUGB 1ONQA 4U1IB 4UM9A 3T3ME 1HNFA 3V6OC 4L0PB 2Q1EA 3N44B 2V7HB 2AV7B 5CGTA 5DJZA 1T89C 4YXHH 3QQDA 1BEYH 3QR2A 4JKWA 2BNRB 1KBVA 3EJQA 4JFZL 4KROD 4Z7IA 2F53B 3X1NA 4GJTB 4NPKA 1UCBH 5TE7L 1A9BB 1CFNA 4K3HA 4YE4H 1PMYA 4P5MB 1AHMA 1M7IB 5F6HJ 2VDMB 1PCXA 3BKJL 4Z7AA 1WD9A 4L9LB 5L9DL 2V2WB 4KOBA 2HTKD 5FFOA 3RTQB 3TBVB 2DLTA 1NPJA 5SX4I 2HN7B 3MLSL 2FJHB 4IOSA 1JVKA 1INQA 3DKHA 4M62H 4QRPE 7PCYA 1L0XA 4HJUA 4FNLL 1L3NA 3HS0C 4I0CC 4KKCC 3SE8L 5JA8B 3OWRA 4MJIE 4P5TB 1B9ZA 3FUEA 4APQB 1D5ZB 2YQBA 5I1KL 1XH2A 3ZOAA 1BF5A 2V5RA 3ZT5A 4N2LA 3IWVA 3FTWA 1R3IH 4R26L 4OLZL 4UNUA 2V0AA 1WFJA 3KXFD 2BVEA 2FH6A 4LSRH 3FSWA 1QQDB 4AQAB 2XKNB 1KTBA 4ZXBA 3LZQA 1SGKA 2CH8A 2EDWA 3GJFB 2CO1A 4TTDD 3VJ6B 1WBYA 4Y5VB 3E7JA 3QZMA 5FKPB 5A2AA 1JXJA 2FLMA 4XN8A 1SMAA 5HI3C 3DUUA 3OMZA 3RI5F 5DYOB 4URTB 3QDGD 1B0IA 1XH1A 4ESKA 1OQOA 2OMVA 4HS8L 4Z7QB 3E3QE 3S4SG 1HEZA 1KJMB 3SCMD 4JFYB 4X6CF 5EO9A 2WQVA 5KANI 1GAFL 3MUJA 3RLSA 3EJYC 3N9GH 2R69H 3PNRB 1HYSD 3VX1A 3CIQA 5BRPA 3T8MA 1RIVH 4ZDHB 3QDJA 3SO5A 4P9HL 4Z7VE 3LKNA 1GZQA 1UADC 2J1WA 4OCWH 2B15A 1CS6A 2XZCH 2J56A 3EF4A 4TQEL 3D18A 2G0LA 4OFVA 5E00B 4WU7B 4PJAA 3ZDZF 4O2FA 3BUQA 1U91A 1V7ML 5EBMB 1KYOK 2YMXL 4PJEA 4U1MB 4UOW0 3EYSL 3V7AG 2W0FB 5C1MB 5LB1A 3KM2A 3L3HA 3PHOB 2H8PB 3VXNB 4AE1A 3UPRB 1ZPLA 1XGUB 3T1WA 4HBQA 1ZK5A 1PKQB 4JRYD 4L29A 4HV8A 3FRPA 3IJEA 3SE9L 1WK0A 2AKRA 3STZB 1G1KA 3BKJH 3X13B 3CHSA 4HS8H 2YRPA 4PRIE 2E7MA 2Q3AA 3ECUA 2W9DL 1U93B 2J6WA 5J3HD 3DO7A 3LEXB 3FTVA 2VUYA 4LSQL 4M6OH 1NGYA 3CNKA 4AQAA 1FPTH 2YD3A 3LSOA 2LE9A 2Q20A 1B88A 2BHZA 1B3IA 2HKHL 3RDJA 2BH0A 2FWOB 4GP8B 2E9JA 2JV6A 4P4KC 4CMMB 1E9PB 4J23A 2ATPA 4PLOB 2XIDA 4YXHL 1YC7A 3QT2A 2P7TA 3CSBA 2OJEA 4BM7A 1GGYA 3EUDA 5JIKA 1RVFL 2NUTA 4P9MH 4PMFA 1QLRA 4JHZA 7PAZA 4R4NC 2Y2WA 3PYCA 4JS7A 2CIKB 3CSGA 3KDPB 4LHUG 4NC1C 1I8UA 2GEQA 1WCBB 1K6QL 1P1ZA 4XZUB 1PG7W 1CC3A 1ZA6B 3QIBD 4GRWB 5H35A 2V7NA 15C8H 1TVBA 1O7VA 3BAJA 5I8KL 1H3TA 2FJUB 2XBTA 1CL7L 4KY1L 1RJLB 3GSUA 4HS6B 4O2CB 5B22A 4OGAC 1JZFA 2IO5A 2WZ5A 5GGVY 1UKQA 2W94A 1JWUB 3DHPA 2HRPL 1UJTA 3RVWD 1TTUA 2O6FA 2P4AB 1RMFH 4G6FD 4LAQL 4X9HA 1MCLA 4JANA 5LUMA 4KVNH 4CKVX 3L54A 2X1OA 5DRNB 4B96A 5GGVH 5EN3A 3EJUA 2R2EB 5DVNA 4M6NH 4DCQA 2PYEE 3FH5A 4KWUA 1TCRA 4WFHE 4OCMC 3HB3B 2WNWA 4JPQA 1PFCA 2V8LA 1CGSH 4FHJA 4F2MB 4Y9GA 3UBHA 3FT3B 3N41B 4HIEA 3TBSB 4E9LA 3RWIB 3VGAC 4HCRH 4BSVA 2QHLA 1WZKA 2CCVA 4CDGC 4O2FB 2PCXA 4G6KL 4ATTA 3UX9B 1TJXA 1W0VB 2FJGB 2ATPB 1BOYA 4PBDA 3LHPL 4XN7A 4KROC 5E2TH 1AHWC 4PRPA 3B9DA 4LE8A 3EJZC 3KGRA 4G8EA 4RMRA 3T2NH 3HS0A 4TVPL 1GC1H 3QEUB 1R5IA 1BVLA 1L5GA 2CDEA 3GEWB 3TA3B 1MW1A 4OZFG 3LEXA 4O51A 4GEJA 3EF7A 2B5IB 1ZV2A 4HIXH 5MEND 3U36B 2G4GA 4NIKB 1LEKA 1JNNH 2WCSA 3N43B 4X42A 4LVNC 1HVXA 1XQ4A 4KTGA 2PYEA 1M6OB 1OB1B 4PR5A 2QKSA 4PHXA 4Y5XB 1SOQA 5DD3L 3RNQA 2ENJA 3PUUA 2O6EA 3C5ZB 3OJ2C 4WKZA 4LZHA 4LSSL 5IJCC 4JHUA 1QPKA 2IGFL 2N7BA 2FEDC 3HUJA 3B2VL 3WMSA 1C5BL 3FQWA 1F2QA 1I31A 5DTFB 3FB6B 4LLQA 5L4FA 2IALA 1TMQA 2EYTB 2VDPH 2FR4B 3LNFA 3NRPA 3BKML 2H1XA 2A74B 3BGMB 4H8VA 2P8PA 1KWKA 3QUYB 1HCVA 3VFMA 1NGWA 4AL8L 1KBBA 4HOMA 1OF2A 2B1HL 3QQ3A 4WEMB 4PG9A 3WAKA 1ZWIA 4HH9B 1MCDA 5AVQB 1XFPA 1MCRA 1A6UH 4L8CB 3QPXH 4ONOA 4E0RB 1CXHA 4U6HB 2ZXCA 2WVUA 1PZCA 4IK6A 3FT4B 1JNNL 1X7QB 1QI5A 4XCFL 1AMXA 2Z31C 3L9RA 4YXLL 4XXDA 3VJ6A 4HS3B 3SCMA 4AGLA 4ZJ9A 1RQ5A 3MV01 3OZLA 1R47A 1JZ3A 3I9GH 1NGXB 2X6CA 2YN3A 5IKCA 5KVEE 1BX2B 1EO8H 4Y4FA 1AO7A 4LCWB 4LEXL 4Q9QL 1BYPA 1SXSA 2O61B 4CU7A 2E27L 3O3UN 3V6OE 3KLAB 1BIIB 4JW3A 3HI6L 2CM6A 3LHPH 1IJ9A 4ELMA 3UP1A 1BZQK 3U36A 4PVBA 2UYLB 5CO1A 2L04A 4DZ8A 1MLCB 4N2OA 4WGVB 1ETZB 4EBQH 2EECA 4BH7B 2Z7YA 4ORGA 2D2CC 1UB5B 1V10A 2PPAA 4RX4A 4M4RA 5GGQL 4UU9A 3C09B 4N6QA 1EVUA 4YHPB 3WEAA 3MFFB 1PZ5A 4HD9A 4WI5A 5D6DA 3D39A 2DEWX 1U8QA 1T83A 5JXAL 3H9YA 5ETUA 1OGTA 1P4LA 4FI7A 1KENH 2F19L 2ZD0A 3O8XB 5C0GA 1KSRA 5TQ0L 2EILB 4HCRL 4NUPA 1S9WA 1GGTA 5JPNC 1JK8B 1J8HB 3QI9B 4LEEA 5D4JA 4OCNC 2C1PB 5HXMA 2ZONA 2WXPA 4OZHE 3KPLA 1I3VA 3QUZD 3IJ8A 5CEZH 4PJIE 2OX5B 5GGRA 3D50A 3Q05A 2R51A 1YECL 3AQZA 4C4BA 3LEVL 4MWFA 1JPFA 5GGTA 2B0SL 3PWVA 4UT9H