5LBGA

Crystal structure of the mycobacterium tuberculosis l,d-transpeptidase-2 (ldtmt2) bc-module with faropenem-derived adduct at the active site cysteine-354
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
259
structure length
259
Chain Sequence
HLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Binding and processing of beta-lactam antibiotics by the transpeptidase LdtMt2 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 72
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5lbgA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbgA01
4JMXA 4ZFQA 5LBGA 2HKLA 5K69A 4A1KA 5E1GA 4HUCA 4QRAA 4GSQA 3TX4A 3ZGPA 4QR7A 5DUJA 2MTZA 1ZATA 5E51A 3U1PA 4JMNA 5DCCA 4GSUA 4QRBA 5E1IA 4GSRA 5DVPA 3VYOA 4Z7AA 5DU7A 4LPQA 5D7HA 3VAEA 3U1QA 4XVOA 4A1IA 5LB1A 4K73A 4QTFA 5DC2A 4A52A 5E5LA 4A1JA 4LZHA 3ZQDA 4HU2A 3ZG4A 3TURA 3VYNA 3VYPA 5DZJA 5DZPA 1Y7MA
chains in the Genus database with same CATH superfamily
5D5MA 4QPEA 2F68X 4HMEA 3N1FC 3RUGE 5FK9B 1EZSA 4YK4B 5MEOA 1JNHB 3S35X 3C09B 4ONOA 1ZHLB 1KPUA 1M42A 2NY2D 3PDGA 5DZ9A 4K3EL 2CHXA 4KI5C 4WCYL 5D7LA 1W91A 3CFCL 3L4XA 4PIRF 4C58B 1NA8A 2M26A 2IANB 3LOWA 3LH8A 3VH8G 2YLHA 12E8H 4DEPC 1KLGB 4H26B 5HDBB 5AB2A 3MV01 1ADQL 5C0AE 3NJKA 5DUBA 2NY3B 4UOZA 3OKDA 4AZ8A 2VXSL 3PDOA 5CM1A 1MFMA 1IAIH 4OJFH 2ZYIA 2O5YH 4U6YA 5GGSB 4UOJA 5BUGA 2WTRA 3AREB 4OLYL 1KZYA 1UXSA 4K7PL 3CMOL 1QSFA 1DO6A 4U05A 3TBWA 4LARL 5DXWA 3D4GA 3F7VA 4JRYA 3S3DB 4OIIL 4N2OA 4ZTOH 4KO9A 1BG9A 2CBQA 3D3VE 4ADIA 4P5TB 4O02H 4UZUA 2UZXB 3AU0A 3PFQA 4QCIA 3BW9B 1BPVA 5JIDA 3S0PA 2A83B 4FQHA 5FA3B 1S7WB 5HGAB 3ZUNC 4LASL 4MMXB 4PI0A 5T1LB 2Z91B 5F7HA 1ZSHA 4PLJC 1IEHA 3HE7B 2X05A 2AJUH 2ADYA 1U4FA 4L5FL 3N41F 3UCRA 4DN4H 1S46A 4LDLB 3VFPA 1WS7A 1ZLVH 2JIXB 1WFTA 3TWCL 2N1KA 1BGXL 1JVOA 2WQVA 5AYTA 3WFHB 2DQFA 1E3XA 3VGDA 2KPWA 3PAZA 2JI3A 3T0WA 3V0JA 3KVDD 5L7XH 5KSUA 4AM0B 3RL2A 2D0HA 1IGYA 1FSKC 1QRKA 4JVPA 3T8XB 4X5WB 2VQ4A 1TNNA 1G0YR 4PJAF 4GQZA 1OGTB 2R39A 3GXFA 4G5AA 3QIBC 2FEDD 3ATBA 1RH8A 1JZ7A 3CFCH 1QZNA 3L5JA 3UBXB 3MLVL 5A40E 2VUKA 5H37G 4ACPA 5HY9B 2PO6B 3O9WD 4OKDA 2BXYA 3T08A 2BWDA 1AACA 3UZEC 1Q94B 2WVVB 5BS0D 4Q97A 2PTTA 3K5RA 1HSBA 3S6CA 2CM5A 3WD5L 3U0PA 3F64A 3ZKQD 2DWSA 3RGVC 2CPCA 1FIGL 1LVEA 3AXHA 1OTTD 2PP8A 2OMWB 3P4OA 4EZMA 1A1NB 3I6KB 4YL9A 1G1CA 3U7WH 3W9DB 4IDLA 2RH0A 3BKYH 4HIQA 3O6MH 1ZANL 3ILQC 4N0YL 4IQHA 4LSVL 1S7SA 4LARH 3SIKA 3TTSA 5F7BA 3CZNA 4UTCA 4CSZA 2D3VA 4WI7A 3VXSE 2V0AA 2VLRD 1N0LB 1TNMA 4KKBC 4FA6A 4AEFA 4G9FA 4E0RB 4N0FA 5EU3B 2VAAA 3E7JA 4F37K 1YDPB 4HU2A 4PJXE 1XF4A 2VQ1B 4JM2F 3ECVA 3DPBA 1TDQA 4ZUSA 1SUHA 4HYTB 3G04B 1A4KB 3BX7C 4L5FH 3E38A 4I48A 2GTZA 2J71A 4JCMA 1HL4A 1TQCC 1T3FA 1EEYB 3VXOA 1WHPA 3HZMB 1JYNA 2VGLM 1HX0A 4L18A 3QNFA 5EPMB 5ICUA 5CSZB 2C9VA 4J8QA 3UGUA 3PL6A 3BAWA 1UM5H 3UAEA 3ZT5A 1IAKA 2AK4B 1BJ8A 4JFHE 1J5IA 4PSPA 4GAJL 3PQYA 5AD0A 2AGJL 3PHOB 1C5BL 1T03H 1A1MA 2C9SA 4WGWB 2FTAA 3N44B 1LO5A 2ARWA 4NQUA 2PCPA 5LDSA 4UTBA 1N5YH 2LVCA 2WCGA 1GZPB 4XN8A 1KB5L 1IGFH 1Q1PA 3UAJD 3MLVH 5B21A 2WIIA 5EBWB 4PRAA 1F1AA 4GKNB 1Z0MA 3EJQA 5CINH 1CFBA 3SDXA 5I0YA 4HLEA 1H5BB 4P2QD 5L4JA 3TO2A 5HYJD 1KCVH 3F01A 3WD5H 4XOCA 1X6LA 1OSYA 3EJZC 4KK5C 2Z8SA 2GEQA 4NBZB 4YQXH 3A5VA 4XO5A 3QZNA 2UYLA 1RZ7L 4KJQC 3OMAB 5DD1H 3RIAK 1KIRA 1OALA 1XMEB 1N9PA 3MNZB 1ZANH 4N0YH 1L5GA 4UBDD 5JIQA 2QGBA 4NCC2 2E4TA 3EJPA 4GIPD 4WK4B 4X99A 5D2LE 1CVRA 4PP1D 1SBBA 3EGXB 3FUMA 3DRTB 1BVOA 2H6PB 1XF5B 4QKXB 4XRCA 5D96B 1A6TA 3QQXA 2J1KA 1YAZA 2DLHA 4UANA 3V2AR 4DKEL 4ETQA 4PJCF 1X7TA 3O4LA 4LHUA 3SDAB 2Z93A 2JCWA 1JGDA 4JBSA 4QHMB 4KKAC 5J3HC 1LJMA 1GC1C 3O3EB 3Q3GA 1DQJA 4E5XA 2VR4A 3F00A 1UB5B 4ZFQA 3BH8B 1S5HA 4N26A 3UO1L 3LAFA 2FR4B 3RQ3A 3DSFH 1TENA 2FWUA 4KUCF 3ZE1B 5LNGA 1EJ8A 1LM8V 1G6RH 3FAXA 2GI0A 2V4LA 2Q87A 1DVTA 1TSHA 3MBEC 3S34L 2OSYA 3V5DB 2PYEE 4IRZA 5LGJA 3F5WB 3FPYA 3UFIA 3L2NA 2CLZA 2E6JA 1PZCA 1LO0H 4GIAA 2ADGA 1CLZL 2GT9B 4N0UE 5I71B 5EEZA 1UM6L 1OCRB 2ITCB 3THML 1C5BH 1AJ7L 3FTWA 4OZGB 4WNJA 3BFOA 4Y4KA 3TIEA 4C56D 5JIKA 4H1LB 1HILA 3FQUB 3NIGE 1KB5H 4X7CC 1FRGL 3SBWA 3S36X 1FVDA 3PHQB 1YEDB 4X4KA 2OYPA 2NXYB 4XI5D 1RLWA 2WNGA 3BUBA 3RP1A 2JJTC 2R8SH 1ZJBA 5F9OL 2ZX9A 2OXGB 5ECGA 1EVTC 1DLHA 2IWEA 1M2VB 4PY8J 3KLHC 5E03A 3QG7H 1VENA 2C9UA 4U1IB 2R0WH 4I85A 4AMWA 3K81A 1OP9A 1J88A 4N2IA 2C8NA 5FEBA 3MOAL 5A2LH 3RKPA 3VXRE 2IFGA 5TD4A 4FEIA 1J1XH 2FAUA 5LBGA 1RUMH 2GI7A 4DO6A 2VM9A 4UT7L 3VFWA 4PI2A 4EIZC 1ONQA 4ERSL 2O5XL 3V52H 1DQLL 3ARWA 5EZJB 2E59A 1AXIB 4FG4A 4HZLA 4KVNH 5AW8B 2W95A 1V7NL 1NAKL 4WY7L 5KVFL 2DQTH 3PGCA 2ZPKL 5DQ9B 1T7WA 5EUOA 3BIAX 3FU9A 1J5CA 4X9FA 2V5SA 3W0WA 2KZBA 1PD0A 3EFOB 1ZT1B 3C8KB 4AVJA 4GW4A 1D5BB 1ZAGA 4WFEE 4U2YA 1IVTA 1TXKA 5B1CA 2X10A 1PSKL 3OXSA 4K8RL 4F57L 4IMKC 4PRIB 4EAEA 1MY5A 3UMNA 5HDQL 3PAVA 1XVSA 4F1ZA 2QKSA 2EABA 4Z7WF 3RU8H 2WVTA 3ARFD 4MAYD 5FX3A 5AG8A 1YJDL 3P9LB 5PAZA 1EUUA 2EE3A 4LK4A 4WZ9A 3D05A 3QHZL 4YR6B 4ELDA 2X0UA 3P0VL 3BWZA 4QTHB 4WI8A 1YUKB 3BDBA 32C2B 1UM6H 1TOXA 4G7YH 4XNYH 3G6AB 2Y7NA 1U8PB 4Z77B 5B38A 4GBXB 5SX4I 1ZDSA 3FUHA 3KXFA 1FRGH 1S8DB 3WS3A 1VDGA 2WLIA 4WFHD 3PWUA 4HWBL 5L8LB 2VISB 2M1KA 4R7XA 2H3KA 1QQDA 1EGJL 5BXFB 3WFDL 3CGTA 3ZY7A 4Z3TA 5T3XE 3AB0B 5DRXB 2A9CA 1FNAA 2H1PH 5F9OH 5DO8A 4YDJB 4ZW6A 4D9QE 3WO4B 5IFHH 3W38A 4BFOA 3C6LA 2O30A 4FFVD 4QHLA 2HH0L 4ODXA 5F0LB 2UY6B 4HKJA 1Z3GH 3NGBC 4AC2A 3L4VA 1NEZA 3C6EA 4D0BB 1U36A 4KK9D 3QJVB 4X83A 1DP0A 1NUDA 3BEVB 1SOSA 3MOAH 3PY9A 4M5SA 5D1ZA 5FGRA 4EI5D 5T1MB 4J12A 3CQFA 4JKPH 4L4VD 4ALAH 2J6EL 4H0LC 1N64L 5FHBH 1ERNA 2DMCA 3MLYL 4ERSH 1DQLH 4LP8A 1XEUA 5SWZB 4G1MB 2DKUA 3D06A 1IARB 1NAKH 3PL6C 5JA8B 4P05A 4WY7H 5KVFH 2NSXA 2GW5A 3P4NA 5CBAB 2CDGA 5IKCB 4J8RB 2MMXA 4GEIA 1FO0L 4PJ8B 2NXZB 3MRPA 1RZJC 1P7KA 3C6SA 1QO3B 4L4JA 5D4IA 1PSKH 1A9EB 1G7QB 5HDQH 5F1IA 4AXWB 1TFPA 2EP6A 3PGFL 3U9UB 4NN6B 3UYPB 2IAMB 4AQEB 2XTJB 1OSZA 2C26A 2YN5A 4XCEB 1HJBC 1I1YB 2VUOA 2W9EH 3K3QA 1A6WH 1YJDH 4PR5A 3N85L 2ZXDA 2XWEA 1FYHB 5HGGS 1NMCC 3NCYP 2ZCKL 2X9WA 3CSFA 3P0VH 3VE0B 3BP7B 1TJXA 1LD9B 2VMEA 1WISA 4BQ8A 1IAOA 4DGYL 4NOBA 2P5WD 1S9XA 3I74A 2H5UA 4P2AA 4Q0XL 1CFSB 1CDUA 1TQWA 5LB1A 2TSBA 3QG6B 1B4JL 3EHBC 3EOAB 1NH6A 5F7DA 2PCYA 4I2XA 5HYJE 4WVRA 3BWSA 4Z0BL 4HWBH 2AXJA 3TH2T 1OWWA 5F70A 5HGDA 3U36A 1EGJH 5IB2B 4YE4H 2DOCA 2J5LB 5DMKA 4OD2B 1JL8A 2CLVA 2TRHA 4V1DA 4P2CG 1TTUA 1XBDA 4K94C 5CGBA 3E3QE 3KE0A 2XWXA 3B9DA 2IPKA 3CC5B 2Z31B 2WM0A 1F58L 1P4IL 5IVZA 4QXWA 3WHE0 3H85A 1GYWA 2R2HB 3GFUA 4LU5H 5DHYA 4AL8L 1BP3B 5JW3L 2J6EH 3FSVA 2R2EB 1E43A 1MIEL 4LLWA 1N64H 2Y1AA 1AGDB 3OKNA 4DVRH 3GINA 3LNFA 4ELKB 1J0ZA 2YD2A 1RP8A 4GG8B 5LAPA 2AEIT 4G8GD 2Y36H 3GLAA 4YHZH 1AS7A 1XH0A 5FF6A 3FT4B 1PEZA 4FLRA 4Z7UE 5T1DL 1FO0H 43C9A 3JWDC 1AQHA 3GI9L 3NZUA 4GT0A 1AR1B 1IIKA 5CWSB 2AMGA 5D70L 3NABL 5AOMA 4NN7B 2ICEA 1XIWD 5HDBF 1X5KA 2Y07L 4U3SB 3PGFH 5ABAA 4DVBA 1OT2A 4TUJB 3BUQA 3SBWC 3N85H 4MXQD 1M3JA 2X1WL 3L7EA 3FULA 3VFUB 4N2AA 1G6RB 3WIFB 5FXCH 1DDHA 3LY6A 4CBZA 2ZCKH 1BVNP 1HYSC 3UEQA 4R96A 2VMDA 4ZW8A 1TR7A 3HC0B 2YPVA 2L7JA 1OGPA 1E28B 1BQUA 2I7SA 2NSMA 3I6GA 1GYUA 1T04A 1BYPA 3S35L 3SKMB 4PS3A 2IH1B 3F7LA 3U1QA 2GITA 4YO0B 4YH6A 2IALA 2ZWNA 5IY5B 3IWUA 2NZ9C 3D34A 1MHPL 1TJIL 5FYKL 3UMTA 3JWNC 5TDNB 2YWZA 4Z3HA 4PY7A 1ES0A 1DQKA 1T1YB 3UP6A 3CZLA 4FNTA 2GABA 1JK9B 2C3XA 4HIEA 5CJQL 1D5MA 1NC4D 2HG0A 1ACCA 1AYRA 1PY0A 1CTNA 3TBSB 3V10A 3VGBA 1INEH 2BY2A 2JXMB 3FW6A 1F58H 4IW4C 4WI4A 4RA3A 5KVGH 1FZKA 1JTPA 1AZZC 3LDBB 4QTFA 4QGTA 3QFGA 3MTXA 5E1QA 4PRDB 1RIVH 1E0OB 5JW3H 3AMKA 4IU3B 1OM9A 1JGVH 4PJ6A 4YSDA 3TIDB 2G2NA 3MN8A 5CP7A 3R06A 4KTEH 4BD4A 4RMBA 4R8WH 5DA0B 2BH0A 5EHFA 1U8CB 2OXHB 2NY4B 5SWSD 3H56A 1SJMA 2JSFA 4MZRA 2FNWA 3Q2CA 1HOCA 1MWAL 2VLJD 4IEFA 3ULSA 1BVKB 4YX2H 2VLKE 2YZ8A 3CSTA 3LS5L 2N7AA 5IBUG 3KBPA 2CDEB 2IV9A 3NABH 4L9LA 1VPOL 5D70H 4HGWA 2EYTB 2MQCA 1FNSL 2Y07H 3DX3A 5L9DL 3IKCA 1H6FA 4PG2C 3TO4C 3VI4A 1U92A 5DHEA 3GSXB 5DUMH 1P2CB 1PY4A 3MJ9H 4G6MH 1QRND 2J3SA 3RWCB 4DESA 1XF2A 1D6EA 1KB9J 4IIQB 5DWPA 3DJ9A 2ZWKA 5LUMA 3KZ8A 1OHQA 5D7IB 1N8ZA 2EDBA 4J3SA 4XOAA 5BRPA 5H4ZA 2OMVA 2SODB 3ARDA 4FQ1L 4BZ2L 1ZT4B 2HKFL 3F2LA 5FR3A 5MI0C 3MROA 1SVZA 3HG2A 4L48A 3ZTNL 4KK6D 5DJZB 4U1LB 2EC9U 3DX4A 5C0AA 3GMPB 2HVKA 5CMAB 3FB6A 3F7RA 5F9JA 3AUVA 3VD0A 1PZDA 1KDIA 2ZCHH 4KNQA 1SDDA 4MJIE 2CU9A 1A14H 2X41A 1T83C 1OQXA 4MNGA 1CE1L 1BBDH 4GG6B 2DKMA 3FRUB 1MRFH 3HPJB 1SHWA 4XHJC 3MA9L 5H2BB 1U3ZA 5F8RC 1E2ZA 1PG7H 4HC1L 3GXPA 1YEEL 5AUMA 5TQ0L 3D3VA 1DUZB 3VWJA 1WA2X 4JDEA 4IRSB 4YPGB 1UJ3A 5M94B 5C08D 1IC0A 4DGVL 5SWQA 2ZOLB 3SKUD 1JHLL 4X7SL 5IZ7A 1NKGA 4PJ9D 3APFA 4G9DA 4TM9A 4X5PA 2DQ6A 3QC5X 2A74B 5CP3H 1W72B 2VDML 4DGWC 3N44F 3BSZH 4JFXB 1MHHB 2ZWLT 2FQFA 5T3ZD 3AQDA 3OHXB 3K6OA 1GOFA 2WUCL 3DA0A 4P4KD 5C0CD 3C2AL 1BZ7B 1VPOH 2A9MH 3WN5B 1E2WA 3H6AA 2W0KA 3RFZB 1FNSH 5I1DB 3KS0J 4OUUA 3WDHA 1Y0LA 1U3YA 1RZIB 4JHWL 3Q5TA 1ICTA 3AU1B 2NW3B 2WXRA 3D85A 3H4HA 4WHTA 2XG4B 4Y88A 4RRPM 4A39A 4Q6IB 3DVNB 1BJMA 3BVUA 1TKWA 3GBNL 3MRRB 3WXVL 4KVCL 2IDTA 3MJ7A 4MYPA 2X70B 4ODVH 2YD8A 3TNNA 4BZ2H 1UQSB 2G9HB 3KHQA 4KX8A 1I4FB 3L3GA 3ZTNH 1ETZB 1MG3C 1YEGH 1BEYL 4JJ5B 2H8PB 1MCOL 2W0FA 1UXWB 1KG0A 4KROD 5HHXL 1TTAA 1M7DA 3PHAA 4GI6A 1ROWA 4MA7H 2VKWA 5K1VA 4A7SA 4PPTA 2E7DA 1S6NA 2XWJB 3K72B 4LVOB 2W07A 4JRFA 4TNFA 2XPGA 5BO1L 1CGXA 2C9QA 4TF4A 3MA9H 2IBBA 5FWRA 5KSAD 2QLVB 1UA7A 4FJZA 3ZE1F 4KXCA 4HC1H 5TQ0H 1YEEH 3GRWA 2EE9A 3OB0H 3MUUA 3FQ2A 5ESAB 1SXCA 2WXFA 1ZDQA 1T1ZB 4DGVH 1ZPUA 1P5VB 4IGBD 1TQBB 1IX2A 4NRYB 4GUPA 4OZGF 2VDMH 1HL5A 4HK3N 5CCHE 2DIEA 5D2LB 1C9SA 2F53A 3IK2A 2ZXQA 2X3AA 5HJ3A 1HQ4A 2WUCH 2AJZB 1JZFA 2PMZA 2IH3A 4PRPB 1BAFH 3VG9B 3GMNB 5AYQA 1YMHA 3UPRA 2C3GA 3BRGC 3TNMA 2GYSA 2LTQC 4D8PA 4PRNA 3U6XS 1KIQB 4XXDA 4OGYL 1A9BA 4KWUA 5IROA 5HJBA 3G6JE 3KJ4C 1FHNA 1OOAA 5C0FB 2DWTA 1KPRA 1O7DE 4PBWD 5C7XH 2P80D 3PE9A 3QZOA 1MKFA 4LBEB 3VXUE 5CCKL 4GS7B 1PIGA 3JV6B 3RPKA 2CJTA 4NP4L 4A2GA 1EZVY 2DYSB 3AACA 4NQDD 3TVMA 1BEYH 3UBXI 4NGHH 3GZKA 3MC0A 3QUHA 3TS8A 4TUKH 4ODSL 3DJSA 5HHXH 2C1PA 3DVIA 2G9KA 3S36L 4EKJA 4EJ1C 1T7YA 1ZWIA 1CG9A 3E2HB 2D7MA 3KGSA 3NJLA 5DQDH 3STBA 2BMKA 4OF5A 3C5XA 5TQ2H 4PBDA 3D0LA 3VXPA 1DVUA 4M7ZB 2L4OA 4A68A 4EI6A 1DUYA 1U4EA 1U8OB 4QJ5B 5BO1H 1B6UA 1L7IL 1KBBA 4NUPA 4UQ3B 1A6VH 4I0PD 4L9LC 4M4PA 1YMMD 5EU6B 3DGCR 3WFZA 4OGQC 2I60L 2VDPL 4QHKJ 3I6SA 1DJYA 3D39B 5FOJA 5SWSE 3V9EA 4F7CB 3IJSA 2K8MA 3V4PA 2VLJE 1F18A 2JE8A 2WXQA 4WV1B 1N3NB 2FHBA 2B15A 1KOAA 4K7FB 3H2QA 1MJJB 2RR3A 1CQKA 4YHOL 2NR6C 4BFEA 3LRLA 1SXZA 3FTYA 3LV3B 4NO0A 2OTWB 4HEME 1G4MA 4L8SC 4JO2L 1JCVA 4RGND 3U9PH 1GZQB 3G5VB 5IMOA 1BLIA 3WKMH 2I85A 5ESQA 1QMUA 3GI8H 3OLEA 1WP6A 3BP6A 3JTTA 3PWJA 4HK0A 5B3JE 3D0AA 4JGJA 1M05B 1PL3A 3WEXA 1BFOB 4PG9A 2YKKA 1MIMH 4U1MB 5C0JB 3ZL2A 3VWKD 1UG9A 1JHTA 2KH2B 2MQGA 4LXFA 4RIRB 3WHXA 3LRKA 3MOBL 1TZGH 4AEHH 5KVEL 4L8BB 1VCAA 4RX4D 4YS4A 4OCYL 5F97E 1T0PB 2GTWA 1ZOXA 3OGCA 4U6XA 1OB1B 3VWJC 5IR1A 5MENB 1UJ3C 3IXTA 5C0EB 1D2PA 3IRCA 3MRHA 3QJFB 3NCCB 4XCNB 4ATWA 2FB4H 2HJLB 1JVKA 1XTMA 4B9PA 1I7RA 1AO7B 5J11B 4I1PA 3VUAA 3VXRA 4TTDC 2V5RA 4DUWA 1R3JB 3OZ9L 1L7IH 4FYRA 5F1OB 5C08E 2G60H 4HHWA 4LF3B 4UQ9A 4XMWA 3TPKA 5I5JA 3EGDB 3AT9A 2NOYA 3UGXA 2J21A 2NUPA 3RL1A 2DQHL 2H4EA 1XL6A 5J7CC 2I60H 2VDPH 2ORBH 3C8HA 3MRQB 3TBCA 4E9SA 1HH9A 2E4FA 3QEQD 4C55A 2ADFL 5B4MD 3TONA 5E1IA 1KTJA 3GMOB 3QJUB 4FNQA 3H3BC 5E6ZA 1MCPL 4BFNA 5CU9A 4QRPE 5F44A 1PQZA 4JO1H 3MV9D 1B0WA 4FQQB 5DK0A 2MOVA 1N0XH 5T33L 2WKOA 4LCWB 5DD5H 4J2XA 3K7UA 4PJ7B 1FE8H 5TFSL 2WQSA 5GS0H 2GJJA 1A3QA 3MREA 1VJSA 1UUNA 3FFCB 3GRGA 5GIRA 3C08L 4V2BA 2WIMA 2F58L 1GC1H 3M88A 3QR0A 3O9WA 4XPBL 5DC0A 2EDOA 4OZ4A 3BC9A 3MQIA 4WUUB 4PJBB 4V33A 5F7EL 4NBYB 4TNEA 4AEIL 1M56B 1NAMA 2DBLH 1G7MA 1KF9B 2CLRB 5BS0A 3OPZL 5AB0A 4P5MA 3MFFB 1KBGL 3WUWG 2GCYA 1FZMA 1QYGL 4L8DB 4LCCA 4HS3A 1J9CT 4OFKA 3WIHL 4R4NC 3MLUL 4FXGA 4OCYH 2CK2A 1F6FB 2JJUA 1Z7JA 3HAEG 5B1BB 5EG6C 1K3IA 4MMZA 4RSVA 8PAZA 2CHZA 3L3OC 1ZATA 2NT1A 4BFKA 5JPNB 3FQYA 4L0YA 3R18A 4I9WD 2A0LD 1MLBB 3SPCA 3DX8A 2VLRA 3ZX1A 3DLQR 5D7HA 2PP9A 3L6FB 2C5DC 4JQXA 1M7IA 1IAII 2PR4L 3OZ9H 4BGLA 4E36A 2KLRA 1UFGA 2W8CA 3KEHA 1Y6KR 4XGZA 1HL8A 5A16A 4PJEE 2Q86B 1TTFA 4A6YA 3IAPA 1DBJL 4QRTA 1PX4A 4DEPB 2Z1PA 1DJSA 2ZQKA 1DZ0A 1JZEA 4UQCA 2QZ5A 2Z92B 5EORL 5I1AB 3FJTA 3RWFB 1RIHH 5MERB 3HHSA 4UDTB 4MDIB 4AMXA 1TLKA 5IROC 1OT1A 1ZGLM 4X0KA 5BV7B 1MCPH 2YQGA 2AXFB 2FDBP 4I18B 4GKSB 4FULA 4LCYB 5GSVB 5CEZD 1CTMA 4Y2DC 3SJVE 3U46B 3QEUB 2OCCB 3F12A 1EK3A 5JOEA 1AD0B 3IN0A 2Q20A 2VT0A 4ZUTB 4NPYA 1CDYA 2ZX7A 4E9XA 1PMYA 5GGQL 5F0PB 5CLXA 2AQ3A 1AZBA 3SQOH 1MELA 5HI4D 3UG4A 3IS1X 2F1BA 4FC3E 3UAJA 5LNEA 3HBGA 1DEDA 3WYRA 4QO1A 2WNWA 1F3DJ 1PLAA 2ZAGA 4HHAB 4U1GC 4RRPA 4MA3A 3BZEA 4P2QA 1CPUA 1RPQA 4H1LG 4NPKA 1UVQA 3QXDA 5HYJA 3KWTA 1U3HD 3O4OB 1FAKT 1NIAA 4FFWD 5DC2A 1SFHA 1TFHA 2BCMA 3QWOB 4RMVA 5IFAH 4XMTA 4GSXA 3SQBB 2EYSB 2IWGA 1JZHA 2PTUA 1HHJB 5DEJA 4A7GF 5I66B 3QS2A 3IETB 2IXQA 3TYFB 2H3NB 5KJ4A 2EEXA 1F4XH 1BBJB 5I1CH 3FDWA 3WL9A 5EO1A 5AW7B 3PWPB 2MHAA 3P3RA 4QWWC 2PR4H 3IDXL 5E23A 3I84A 3P54A 4XE5B 1XGQB 1Y18B 1ET5A 4L37B 1LYQA 1O75A 3RTQB 4HEPA 2QDWA 4M6NL 4KITB 4JPKH 5T5NF 1DBJH 1QTSA 4PGBB 5EOQL 5E8DL 1Z9LA 3CD4A 5IBTL 2W5PA 5D7IF 5EORH 4Z7UA 3GF8A 4O51B 3RGVB 3QCUL 1I7TB 1RUAL 3FQXA 4NAJA 4RGNE 1RK7A 3MLRH 4JANA 3ZVVA 1EAJA 3K2UH 4PVNA 4UIMB 1HS6A 5FW6A 1ZHNB 2O61A 4EIBA 5JLZA 5GGVY 1EHLL 1CK0L 4MDRA 5EEWA 5MEPB 3MV8D 3K6IA 1IFHL 3HCVB 4F91B 4LSUH 4MJ5B 4F3FB 1ITCA 1DBML 4C56A 3ARBD 5LGHL 5IP4A 5KSBB 3REWA 3ULVL 3I02B 4GG6F 2F8IA 3OJMB 4LLDB 4M29A 5E7FA 3NCFB 1RZJH 4WFGD 5L2KB 1VGEL 1C16B 1SN2A 1IM9B 4M7JH 4UTBH 5IM7A 2Y1VA 4D0CA 1QABA 3LKOB 8CGTA 2VXTL 1T5WA 1P7HL 2AXWA 2NY6D 1ORQB 1FL6B 5IEKB 3NJHA 2X4UB 3IPEA 3SPIA 4NLAA 5KSVA 4X7TA 1AD9B 1SLWA 3SY0A 4KMQA 3BUDA 3ETTA 4YC2C 5L0QC 5LJYH 3FCGA 4M4RB 3ARUA 1JGEA 2Y3AA 5HD8D 5B7FA 2XYCA 5BRZE 1CQYA 1HCYA 1JRHH 3QUMB 3SDYL 1CICD 2P5EE 3CDYA 3K74B 4OM1L 3UJJL 1SY6A 4LVEA 4Q7DA 1GGCL 1GTFA 5K9QG 3GXTA 1RZ8A 1CU4H 2O6DA 3BHBB 3IDXH 4U6HA 4XP9L 4B6ZA 1UM4L 2VR5A 1JXGA 1WAAE 4RMWA 4TL4A 4N8CH 4GNKB 1QKZH 4K55A 1MXGA 2IDUA 4AENB 3FU7B 5EOQH 1I1AD 1E4XL 3MUGB 4PJ5D 5FUOL 1PG7W 5EOCL 2WVSA 4N1EA 3SKJL 4LLVB 4K94H 3BQVA 3R1GL 1ZLUH 4QOKE 4F9LC 2VLKA 3ARFA 4MAYA 3VXQB 3CZJA 1S2EA 3W2DL 2QADB 1C7SA 3O9WC 1SUJA 3S5LB 4Z7NB 3MGOA 3ARYA 1WRFA 3IJEB 4LBAA 1HZKA 1CK0H 5FECB 1FCCA 4S11A 3TBTA 3WMPA 1D5RA 4A37A 1IFHH 2I9TA 4MNQD 3RG1C 3DETD 5DZVA 4EOWL 4F27A 1QLRB 4U1JA 4LCCC 3L3JB 3ERXA 4QY8B 2GTQA 2FQDA 2ZSVB 3ULVH 3HE6B 1G0DA 3PWNB 3U7YL 5F96L 5JXED 1FBIL 2R7EB 5LBVA 1SYSB 3QAZB 3EYFB 3HAEH 1H15B 5D5MB 3JWDH 1CD1B 4JAMB 4AG4L 1VGEH 2P8PA 3B3IB 1B90A 4XVSL 2XT1B 2BC4B 2R51A 1N68A 1IGJB 1IGCL 4EN2A 4ECNA 2IVFC 1KPUB 3BE1L 4JM0A 1I9RL 2ZWSA 4AGNA 1KJMA 5D7LB 3V5KB 4B3VA 1TTCA 4K2UL 1HESA 1N7MH 1JPGA 2FX9L 4X5RA 3VG0L 1YO4A 1A3ZA 3P2BA 2NYZA 5E6UB 2EDRA 1HH6A 4IRJB 1MFAL 1KCSL 5D2LF 1U95B 3L5XH 4EI5A 4W93A 3TFKD 3K8KA 5KVMC 3VJ6A 4JDZA 3SPVB 4P3WA 4AZ8B 3PDOB 4NT6A 4DZBB 4MKMA 5TTRA 3ULUD 1GGCH 5FGSA 4H2CA 5G4OA 3SO3C 4XP9H 4Y1AE 1UXSB 3SDCD 4FTDA 2NX5E 1UM4H 3BWUC 1BD2E 3TBWB 2GBAA 3DX9B 4J3WA 3ZO9A 3QNYA 2HMID 4U7MA 1MCIA 4DP5X 1VESA 3JWNH 4NIYE 3VQ1C 4XMKL 4TRPH 3F7VB 4JRYB 1E40A 4RZCA 5FUOH 4L4TD 1ZGLP 1S9WB 3MBWB 3C8DA 4QCIB 3SKJH 1GOHA 1G5GA 3R1GH 3QDMD 3LKPA 4HUXA 4P8QA 3U0TA 1NGQH 5KVDH 1WZLA 4MDJB 2IADA 2QV2A 1NBZA 1U41A 4QR7A 3VFPB 4YLQT 4XBPB 2NY7L 2P5WA 4NRXB 4P46A 4Q9RL 4O9HL 3MZTA 4YHYC 2YMOA 2ZJSH 2WJ5A 3HBPA 3ZKMD 1I3RA 5DD0L 5HYSG 5KS9E 2H32H 4FL4B 1NGWA 3KM1A 4N0CC 3RL2B 4JFOA 3U7YH 1MJ8L 1OP3H 3SD2A 2IPTL 1IGYB 4WSKA 4IKNA 2R23A 3EFFA 4UBDC 2BWIA 2XWDA 3EG9A 4AG4H 4Q2ZA 1IGCH 2BP8A 3O6KL 5K1NA 3BE1H 2HWZL 3G6JB 3HB3B 5J0BA 3BP5A 4K2UH 3TEWA 2EIZB 3B9KA 2E27L 4PCTA 2FX9H 3LSOA 2FEEL 4WWKB 5LBSL 3LNGA 3VG0H 2XC8A 4HIXH 2WBXA 1DCEA 3F04A 4HCGA 4ZMTA 3NSYA 3U0PB 2PTTB 3B2PA 1HSBB 2CR3A 2LT9A 3GLZA 2ZP9A 4X5LA 3WENA 2IH9A 4R7DA 3AGVA 3PG2A 2R1WA 4NQVA 2BFVL 5I6XB 1MN4A 1D5ZB 1UFUA 4TSBL 1UCTA 2EECA 2G3NA 4PB0H 2BVQA 2P5PA 4G8GA 4POZD 2MRYA 4ZI8A 1S7SB 5I9QB 1H8OA 3MA7A 5J6HB 5JHAA 3ECUA 5EN2A 4AUJA 2BP3A 3T0XA 3UAAA 1KTLB 3CTTA 4G9FB 3B43A 2VAAB 3A6BL 3O3BA 1M6OA 3NCJL 1QI4A 1XF4B 1I8LA 4P23C 3DPBB 1T0OA 3AZUA 5FGCE 2JB5L 3RNQA 2MKWA 1QSZA 3UX9B 4GXVL 5AW5B 5I1EH 1TVBA 1ZGLA 3VXMD 2MNJB 1EZVX 5FYLE 3VFNB 1CUOA 1FH2A 2ERJB 4NKIL 2B5IB 5E2VL 1T3FB 4LCIL 2NY7H 3VXOB 4Q9RH 2O72A 5HHOE 2R0KH 4NNPL 5B22A 5T5NG 3ROOB 5IWLC 5B3SB 3FQTA 2OR8A 5DD0H 5B7MA 3DVGA 3IE4A 3VXUA 4JFEB 5ICXB 5AD0B 5D71L 5IQ9B 2H0JA 2UV3A 1A1MB 1FAIH 3LB6C 4AYFA 3O6KH 4ZXBB 2HWZH 2HFEB 2PCPB 1ASOA 1AGCA 4MXWH 1FZOA 3AWEA 1GHFH 3LKQA 4WDIA 1U8MB 2KZWA 2WIIB 1MPAL 4M3KB 3LN5A 1E4WH 4UYPA 5AOLA 2JI1A 5H4YA 2ED7A 3SDXB 1WITA 2ITFA 4H8QA 3VW3L 4L3EE 3HLKA 5TH2B 3DJTA 1OGAD 4CKVX 4NZRL 3BT0A 4XNDA 3UTSE 1S7VB 1I9JH 1FLRL 2HPOA 1RJZA 3JV0A 3OWRA 4MAYC 5FPIA 1BIIB 5GRVK 2BFVH 4R4BA 1FORL 1JYVA 3OGOE 4G80A 2UYLB 3QFJE 4PJ7F 1AP2B 3RA7H 1KIRB 4WI9A 5EEYA 3LQMA 4O2CB 4V2CB 5SWSA 4JFQA 3P0YH 4KJYB 4FOMA 5F6IB 2VLJA 1H8SA 4X6DE 2Q2LA 1TMQA 5CZXD 5DFVD 4X99B 3GIVA 2X2JA 2ZSWA 2BPBA 1YLBB 1ZSDA 2DLFH 4PJBF 4PV9A 4JFDD 1AE6L 4HEMA 3ZZLA 1FL5A 3NCJH 4X8JA 4XVTL 4M1DL 4ETQB 1QLEH 3TASA 4LHUB 4HUMB 2JB5H 2Z93B 5HYIA 5C1MB 1EJFA 1JGDB 4IBTA 2PPFA 4JFFE 1C1EL 1QFWH 3Q3GB 4Z1PA 4E5XB 3OMIB 5I74B 1N26A 3C12A 5F8QC 4LGSB 1S5HB 4NKIH 4JDTH 5E56A 4GUQA 5E2VH 4TLSA 5F3HB 4OZFG 4LCIH 3TH3T 1A66A 3GT6A 3NCWA 4K5MA 3DUUA 2BP0A 1JGLL 3BH9B 3GSOB 2ZXGA 5L8JB 5LGJB 4TKWA 3SE9H 5C8JA 4R5VA 4FFYA 4LP5A 3RNKB 2ADGB 4Y5VA 1Q9OB 3VD3A 5D71H 3X12B 5I6KA 4FCHA 4HIPA 3Q6FA 1E42A 3TURA 3GSNL 3L45A 4Y4KB 4NXKA 3VX1A 3WXWL 5EF2A 1HILB 1ACXA 2X9YA 3Q06A 4JMXA 4OI7A 4Y2LA 2QQLL 4IKLA 4Z5RA 1JGUH 2RFXA 5D1XE 1UA6H 5J6GB 2AQSA 3RE0A 3ULUE 3GC3A 2ZKXA 1BOGA 2ADIA 1QFUH 1DLHB 1WBYB 4OCRL 5C08A 1CI5A 1WIUA 4CMMA 5JQIB 1HHHA 1FLRH 4PJ9A 5KANI 3FFOA 5E24E 2IQAA 2IDFA 5ADOH 3D69A 1HEZB 2AXHA 4QT5A 1NSNL 3TN0D 4FXKA 4HKXA 3IAQA 3MNVA 2GIXA 3HG1D 4P46C 5D1QD 3VD1A 2IV8A 4YQXL 1DANU 5CJ5A 3SOBL 3MI6A 5C0CA 1M1XA 4HZLB 1AE6H 1YSOA 2YC1A 4QRPA 4XAKD 1MFEH 4S1DD 4BQ9A 4PGEB 4KX7A 4XVTH 3H6JA 3PGCB 3W0WB 1RVFL 3MKKA 4WI3A 1C1EH 4JFVA 4MD5A 3H8NA 4J27A 3NSFA 5HVGB 4EUPA 3TJEH 3B9KC 4NQSA 1BG1A 4KNTA 1ZT7B 4LRIC 4AQZA 3KL5A 1JGLH 4JHAH 2NZ1A 5B8CA 4KKCD 2VR7A 1KWKA 4IU2A 4DPRA 2XETA 4L29B 4ELME 4G6JH 4PWKA 2WQUA 1CL7L 4BYHA 1U91B 2WCPA 1P69B 1G7LA 1YEKL 3RWDA 4BH8B 1T21B 4RZKA 4Y16A 4HBCH 4YNYA 3ZQDA 1GMIA 5BCAA 2YA1A 2Y22A 4TS6A 3MRBA 4J3OC 4MD4A 5B38B 2D3NA 1AIFB 3N50A 2I7OA 3U1SH 3WS3B 4TUUA 2QQLH 3PWUB 2H6OA 1Z5YD 2RMNA 5T1KB 3TZVC 5INDA 3AVEA 3UYOD 1M71A 3DGGA 3DUSB 4IBWA 2ZG2A 1JNLL 1D9KB 3NFSL 4O58L 2G5RA 1EFQA 2JQMA 1L9QA 3C6LB 4OCRH 3TJHD 3BPCA 4QHLB 4ODXB 2X4RA 4IGBA 1U8KA 4UOW0 2FWOA 3OLGA 3ZT6A 4WHYH 3IDIA 3QXUA 3V0AC 2BOBB 3QHTC 1U0QA 4LZHA 5D1ZB 3ZG4A 3ASWA 5EZPA 5IJDC 5KSBF 2XQYG 4XBGA 2X3BA 2OSLB 4FDWA 1YEWA 4M6AA 1NCNA 1P5UC 5ELIA 1LEIA 1GJWA 1N6VA 1C12B 3HVNA 4NI3A 4MCYA 4M5TA 1O7DC 2YGOA 4PMFA 3VI3B 1CTOA 3MKGA 3RZCD 5JQ6L 2BVOA 3K71A 4RNRA 1R1CA 3GB7A 4OZHB 1RVFH 3DC0A 2Z8VC 4Z7QB 1P7KB 1IEBA 3C6SB 3QIUA 1AYOA 4X7EC 4JZJB 3AT8A 1NGZB 2XVGA 3QI9D 4X2UA 1IKFH 2P80A 5DI8B 4YXHH 2WXHA 1OM3L 3SBRA 3UOAB 4PR5B 3N0AA 1F2XK 2JK5A 4QUOA 2ID5A 3T2LA 4UV7H 4M48L 5D7JC 3SE6A 3HKFA 1DBAH 1IAOB 3LS4L 1I7ZA 4OSUL 2AQQA 3ZDYE 5I30L 5E94A 3RVXD 3CC1A 2ADJB 5BW7A 4F58H 4NQCE 3BVNA 5C3IA 2X09A 4XVJH 2LLNA 1OTUD 3G08A 5C70A 4OU3A 4EXPX 2I26N 4H0HB 5CGTA 1HKLL 4JRXB 3NZ8B 4YAQB 3VA2C 3IMUA 3U36B 2NY0B 5HGDB 2VZUA 2Q5BA 4OFYA 5E4IA 1CBVL 4PLNC 3CV5A 1TEYA 3ABGA 2CBPA 4Z7NF 4A1KA 2L8AA 4G42B 1JNLH 4I0PA 5D7KD 4O58H 1YMMA 2CLVB 2DEYX 4MQSB 4V1DB 5DJ8A 3BZDA 5E2UL 3U25A 3SSGA 3KWXA 3D51A 4OLVL 3QE5A 4XPAH 2IPKB 1RMFL 2P8MB 2ZKMX 1BM7A 3P30L 4N2FA 5AVYB 5IVZB 1YPZA 3GRWH 2QV4A 2YRBA 3VMPA 5E0FA 4Z9KB 5DHYB 3QCTH 3HHRB 2R9HD 3B7UX 3IJYB 3ESMA 5D5MF 2H6UA 2QFRA 4HULB 5IHHA 2R69A 2CGRL 3OKNB 4JQVA 3EYVA 3GRBA 2YN3A 5DURD 4UYQA 4KK6C 5IB5A 3FT9A 1XR9A 1SEBA 3AQXA 3OMNB 5AZEL 4LKXB 2BNUB 2WP3O 5JQ6H 1QLEB 3T1FA 1PGRB 3T8VA 3UPCA 3ALXA 4ZPTB 2XKNA 5AVSB 3FZUD 1E4KA 2ICEB 4LLYB 1QEWA 2IDCA 4IOSD 3P40A 1E7UA 1ETJA 4XMLL 1OM3H 2DYPD 4M8VA 4PW9A 3RDTD 2EUVA 3LQZA 5DYOA 5FO7A 4GP4B 5BMFH 1CURA 3L7EB 1XB6A 5JNYA 3X2QB 4BDVB 2CJ3A 4RX4A 3EYUH 3QHFL 1IM3B 2WQXA 2MNUA 4FGMA 3BPLB 4R96B 3LS4H 4N22A 4OSUH 5I30H 1URZA 2B59A 3MRKA 4PAZA 2H2PC 3II2A 3E8VA 4P5SA 1T04B 5ABDE 1R9FA 4S2SA 4XCYB 4LCUA 1N4XL 4NSKA 5D7EA 1I3GH 2EUXA 1HKLH 5IQMA 4HT1H 1NUGA 4FXKC 3BISA 2EQDA 4JY6B 5BRZA 2ZZUT 2V2XB 1L7TL 3D2UD 2WAQA 2CUHA 2DM7A 4QRUA 1CBVH 1N67A 4XWGL 1YQVL 3JBG7 4AIZB 3KHOA 3BDXA 1ES0B 4MHHI 5FO2A 3V9FA 3ME0B 4A1RA 3WU1A 5GS1B 1I8KB 4FQXD 2IGLA 2GSIA 4QF1A 4GW1A 1R5IA 3BPOC 1UUSA 1F6AA 1WAAA 1TO4A 3CFDB 4HIEB 3TBYA 2EVHA 4WO4D 4OI9A 4OLVH 2OTUA 3P30H 2Z35A 4NM8L 5D1QE 5GPRA 2AQ2A 2JCCE 3OR6B 4NENB 4CVXA 1FZKB 4MB3A 3I9IA 4MMYB 4P3DA 3MLWL 1IRAY 1EHAA 3M46A 3V4PH 4EI0A 4Y1AB 1EX0A 5D4QA 1FFQA 3FONA 4X6FA 4F7PA 2CGRH 4WUKL 3Q8AA 3R06B 4IYKA 2EDKA 4HXAL 2HT2C 3KG5A 3G6JF 4WKZA 5DJAB 3LIZA 3L1GA 3CDFA 5AZEH 1DVFA 4UINH 4M1GL 4JPWL 1I8MB 5ACZB 4IEFB 4KROC 3U30B 2HN7A 1EIBA 4EN3D 1BYOA 4NQED 5D8JL 3ULSB 2TRYA 4Y16C 1VKXA 3T0BA 2H26A 3NESA 4R90L 2D7TH 3IKCB 4XMLH 1ID2A 1CBJA 3DYPA 3VI4B 1QPKA 2J25A 4GOSA 1U92B 2X2HA 4PRHB 1YNKH 1XF2B 1BQLL 1D6EB 4ZYKB 3NSCA 4WU7A 3V6BR 1I8IA 1YRKA 4Z3JA 5FHAH 1KXTA 1HWHB 2OMVB 3ARDB 4WW2A 1P7BA 4R7LA 1RZFH 2AVGA 3PP4L 4JCLA 3ARGB 3H9SB 4IGBC 3SE8L 3FTVA 4JL1A 5IIEB 4AQAB 5T3XL 4RCAA 4LDOB 5A2JH 2N3JA 2IGTA 4QJ4B 4GKLA 1U8IA 1FFPA 3U2SA 2DIJA 2HVKB 2MSPA 4P04A 4G8IB 4LSDA 5ADPL 5CNHA 5IB3A 1BJ1H 3FB6B 3QPXL 1YAIA 3P9MA 1YQVH 1SDDB 2PW2A 1NFIA 2RACA 1ZRUA 1Q0XH 3LEXA 3PF2A 5E1HB 1DJZA 2EDFA 4ESKA 4ZX3A 4MNGB 2DQJL 3QULB 4GUCA 4J3XA 2VO8A 4ZNCD 1L9RA 4ODHL 1TPXC 3TCLB 3OHMB 3VDAA 2FJFA 4LPTA 3NIFB 4PU2A 4NM8H 3F7PC 3QIUC 5AUMB 2FYYB 1JHKL 1KXQA 5CIPA 5INCB 5EFIB 3PWVA 4K8RD 3RFRA 1LWHA 2CMRL 4N6RB 5DHDA 1UH3A 1BFSA 5SWQB 4F2MA 4F7MA 1N59A 4G9DB 4NUJA 2BIPA 3VNZA 1KTKE 4HXAH 5A2CA 4M61A 5AAWA 1EXUB 1JI2A 3S2CA 2PXYC 2GY5A 5ABZA 4Q9QL 2BIOA 4APQB 4LVHB 3WFEH 5BW7C 4QYAA 4PB9L 2ZCLL 4Y1TA 3SDXF 1D5XA 4B0MB 1QACA 3ARRA 4KHXL 4JG9A 3I2CH 4R90H 2UUDH 4OUUB 5FM4A 1Y0LB 1PVHA 5I0ZA 4HWUA 1SM3L 1U3HA 2MH4A 1AH1A 4PBXA 3UTOA 2EJ1A 2H45A 2XQYK 2EO7A 3EYSL 2IO5A 1ZA6A 4PY8I 5JHDE 1JZ3A 1J05A 1TKWB 4U1NA 3TEYA 4ZW5A 4YSPA 5CR1A 3K0WA 1DJGA 2CXGA 3TNNB 3PP4H 3D09A 2BNQE 2WB1A 1YNTB 4J2QA 3L3GB 2CO6A 3LZPA 1B3JA 2YGPA 2C9AA 4ZQKB 3CFEA 3DIFB 5ICZB 3SEPA 4XCFL 2W0FB 5D7KE 2EO1A 4CGUB 4HAFA 5FS5A 2TAAA 3TA3D 5ADPH 4S1RL 2XWTA 5LLIC 3QPXH 5ACMA 3EOYG 1KJ2A 4RGNC 3M7FB 4S0TD 4HIJA 2X5PA 2VC2L 4JQVC 2F19L 1EEUA 1XR8A 1T89A 5ETUA 3Q6GH 2EKJA 2DQJH 1DJHA 1QUNA 1GA2A 3S97C 1T2QL 4NC1C 5GRJL 5BPPA 1VGKA 2NY1D 4KRMB 3TEXA 2DI9A 4A6YH 1QPPA 2Y69B 3IM1A 4UZGA 2GSGA 3WSQL 1MI5B 4MD0B 2R29L 1E4KC 1JNJA 2CR0A 2YUWA 1LO3L 4XNUL 4L0PB 4BFGA 2YAHA 3HG5A 1EFXA 2CMRH 3IDMB 4RDBA 3LNHA 5ALCL 4ZZFA 5I17A 3MV8A 2XN9D 3WJLA 4KOCA 4GUPB 3V4VA 2EVIA 4HPHA 4JO4L 1EJOH 4PTTB 2BFGA 3GBMH 1C5CH 2F53B 3LH2H 4ZUUB 3NPSB 4TN9A 43CAA 1HQ4B 4XNQB 5HHOA 1F4WL 4GRWB 1YMHB 1IAIM 4CGTA 1MHCA 1JZ8A 3VRIA 3IAGC 1HHGA 2ZKHL 3BMVA 4CC0A 2XA3A 1WHOA 4PRNB 2J43A 4CW1A 4XXDB 4XO8A 4DTGH 4ZT1A 5E9DD 1JVLA 3QIWD 3NIDE 1IEAB 5J56B 4D7BA 4U0QB 1ZIAA 3NFPA 5C0BD 3FUJA 3VSUA 5I6NA 4HCRL 4IHOA 3HMXA 4ZJ9A 4HUVA 3SO5A 2BW5A 1A9VA 1G9NL 1BX2A 1KPVB 5HP5A 1CICA 5E2TL 5B4MC 3TVMB 1ZLEA 2GG1A 4HKZA 4OT1H 4L3EA 4P0DA 1NMAL 2X4PB 1U42A 4XCFH 1X4ZA 4K07A 1L3NA 3RKDC 3HOGA 5CJ8A 2P24B 2C1PB 3M17B 4UNIA 4S1RH 4EO5A 4G83A 3WJMB 2WLHA 1ZWIB 1CG9B 2YAPA 4EIGB 3UBGA 1IC4L 2OR9L 3BUIA 2F19H 4L3CB 1I1AA 5J89A 4A52A 1HNYA 5ESVA 1T20A 1WAPA 4PJ5A 4EI6B 1DVFC 1DUYB 2AABL 3GHEL 5GZOD 1KGXA 5DF0A 5E6ID 3KPSE 4KKZA 1B0IA 3WSQH 2FBOJ 2X38A 3QWQB 1FNFA 2R29H 3W1ZA 4PWHA 3I50L 1F6LL 2HG5B 3II1A 4PLOB 3IJSB 2UX7A 3KPRE 1RJLA 4QXTA 5DRZA 3KPQA 4MNQA 4NQEE 1KYOJ 4JO4H 3UZQA 3RX9A 1ZHKA 2QPFA 4YOKA 2OI9B 4A1JA 3NVQA 2Z7UA 3DMMD 1SDYA 3QZWB 5HPMA 1QBAA 5JXEA 4NHUB 4WW2C 5J5EA 4NZ8A 1FG2A 5IMOB 1F4WH 1NDGA 4ZNEE 3AAZA 3H4FA 1A7PH 2XZAL 4WNQA 4H40A 2NY2B 4ENZA 3P4MA 3TT3H 2ZKHH 1K4CB 3F83A 1XCWA 3BP6B 3HPLA 4E41D 1NBCA 5IVXB 4FQIH 4GH7B 4RFNC 3EO0A 3VGHA 1XH1A 5CCGE 2HVJA 5AZ2L 2QVIA 3QUML 4XMPL 2ZAIA 1JHTB 2CG9X 3B6SA 4XP4H 3T77A 3WHXB 3ATFA 1R5VA 4P59L 3CE1A 1GCYA 3BZ5A 3AG2B 4W9DC 3QARA 3E1ZA 5D1XA 3JVGA 5CO1A 2GC7C 2GTWB 4C4KT 4U6XB 3VI3F 5DFAA 3HHMA 5IR1B 3SDCA 3IXTB 3ASOB 1RAMA 4JHUA 3OR7B 1UA3A 1MW2A 3MRHB 1JF1B 2V17H 4PGDA 4OZHF 3PDDA 5AAMA 2XTLA 1SY6H 4Z7QF 4BQCA 1GS8A 1JRHI 2K7PA 2WO3B 4DP8X 5AAWC 3GSUA 3M1BA 4JKKA 4RAVB 1MH5A 1OTSC 3VXTA 1WA0X 4X50A 1ZTMA 4ZDHA 4HOZA 3FAWA 3QORD 3QDMA 2D9CA 5C86A 5EU5A 3O11A 1QA9A 2IOMA 2IWKA 2V2TB 1P6AB 1ZHBB 4YC2B 4E9QA 3RL1B 2WPGA 4XPHH 2FECL 1KEML 3D4ZA 3ASNB 1SLXA 2VDLB 3ML8A 3NEOA 5FWQA 5LGKA 3IGLA 2KQMA 2LAGB 3LRHA 1GS7A 3ATDA 2LABA 2YHGA 3HVDA 4R84A 4K4KA 2YD6A 1USQA 3T65A 3MLSL 1P4BH 1CGSH 2XKUA 1PQZB 2APXA 2EDDA 4P2RE 5IHBA 2XVLA 5DK0B 4UM9D 4K3JH 4PJGE 3BWAA 3I3EA 5DD6B 4JFYB 2L3BA 2VR3A 2O6EA 1S4IA 4MS6A 4UQEA 3MYJA 3VXNA 3MREB 5GIRB 4YLCA 3VMOA 1TJGH 2WQAA 1ED3A 3DV4A 1F4AA 2N7SA 1FYTD 4OZ4B 2FYVA 5AZ2H 5CZVL 2WKGA 4HJTA 2FJGB 2BY1A 1J9RA 1NAMB 1G7MB 1YEHH 3KPLB 3IMSA 4RVBA 4XMPH 3WIIH 4KI5D 4P5MB 4B9YA 5HI3D 5IW1A 2GCYB 3Q5OA 4LCCB 2Y7QB 3AWGA 3P73A 4HS3B 5DJ6A 2LHAA 1MW3A 3L9RA 4FXGB 4ZMQA 1SQMA 4KKRA 4LAQL 4MMZB 3US1A 2XA8L 3ARQA 2VL5A 5J1AB 5DMIL 4FLSA 3DX7A 4G3YL 4JY4A 4X4ME 3IDYB 3QJZA 2VW7A 4MGXA 1FP5A 5HHME 1RZGB 5EO9A 2B1HL 1CYWA 3O8XD 3DX8B 2VLRB 4OQTA 4E2OA 2AXGB 1OAXL 1EBPA 2N0KA 3FN0L 1M7IB 5IB1A 2ZOOA 5F7KC 5DWUL 5GGVL 4JGMA 2IEPA 4XGZB 5A16B 5TE6H 5DR5L 4A6YB 2IPUG 3V0WL 5DEFA 3U2JA 1OAKH 3FS9A 2J56A 3VXMA 3WV0A 2GUYA 2IFFH 1VZGA 1VF5C 2ZUQC 5C07E 2AQNA 1KEMH 3HC3L 1A65A 1URLA 2GPZA 3FF7A 2BSRA 3HHSB 2KZKA 3K2MC 2KT6A 1HN1A 4BHUA 1Z5LA 2JELH 1WWWX 3L95B 4X0KB 3L2MA 2PPDA 4HS6A 4NKQB 5GGTL 3MLSH 5I75B 4PLJD 3DBXA 2YPLE 3FPXA 1NLDL 3CXHK 2HVBA 3WJJA 5CCJA 4IBVA 2CE6A 5A2BA 2XZZA 1DEEB 3RX5A 5HD8C 5LXGL 1CC3A 2EADA 2HUEA 3N6YA 1ZXKA 4HAKA 1CICC 3QUXB 3QYCA 2ALWA 5DJ0A 5IQOA 3E6FB 3SPHA 1DHKA 1K8DA 4PMEA 4BSVA 4ZO9A 4TQEL 1ZJAA 4X8XA 1ZLSL 3ESPA 4K9EH 3B7RL 4NQCA 5D2NE 1HAUA 4QO1B 4JEGB 3FRPG 3OAUH 1J11A 3A0OA 2ZOKA 5FCUH 4Y0GA 2WNXA 3EXJA 2OMXA 2I9LB 4P2QB 4PJFB 1OCOB 1X5HA 3N1MC 1UVQB 3QXDB 5A3IC 3SBQA 1IJ9A 2WXKA 2HFGL 5DO2D 3MNDA 4S0SD 4O5LH 1KEGH 2VB5A 1HIML 3BGFC 2YKLL 4PYHA 4YHYB 3LZFH 1SGKA 2R0ZL 5J1SC 1H3WM 2OJZH 2BVYA 4HWNA 3FSAA 5F1KC 3MV7D 1MRCH 3KYAA 4RBPH 5JHLL 2I32A 2J55A 1CXLA 2ZT9C 4G3YH 2IXQB 1QUPA 3ZTDC 4OCSL 5T5FL 4XZ4A 4EEEA 4KZ0A 3VRJA 4HV8A 3WL9B 2VDKH 5EO1B 1OAXH 2MHAB 2BVPA 4ZTPL 3LPGA 2WXJA 3EJCA 4J3OH 1V54B 3MRJA 4JFDA 2B8OT 5E08H 2XQ0A 1CF8L 3RY6A 5C0IA 5D1ZI 2W9DL 3VI4F 4APXA 3ZRCC 4DP9X 4RDQF 2AVFA 3H1ZA 1NWOA 5DR5H 4YHKL 4NJ9L 4OF8A 4TOYL 5KEZA 1OV8A 3QUYB 2ZF8A 4KKBD 1FL3A 3KWVA 5CEYB 2LLGA 4DERA 1NIBA 2I24N 5AEAA 3FU3A 1T0NB 4TULH 5D55A 3FQXB 1MJUL 5KYXA 4WEUD 4A2FA 1LO2L 3DOIA 1MVFA 1X44A 1G94A 4M62L 4QXUL 1W2KT 2BSDA 1K3ZA 2F8OA 4K3HA 4R26L 4DPCX 3QQDA 1NLDH 5JLZB 3SKNA 3H0TA 5KTEH 3ZKND 4NKDB 3EXLA 5DLMH 1IGML 3QZPA 5AL8A 2XPYA 1A7RH 2VQUA 4PJAE 4BXVA 2VDOB 5D1XC 3QZBA 1HEJC 1RHHA 3GJEA 4C56B 5DMJB 1D7DA 5FYKE 4JN1H 3ULUC 1E9OA 1J1OL 1MFUA 1CT8A 2V5MA 1C7TA 4ZSOE 5GHWH 1DN2A 2EKSB 2X4QB 3PV7A 4MNHA 3GKWH 4A7QA 4QYOB 3IJ9A 4WF7A 2HMIC 3NIFF 5AAMC 5M7QA 1XGYL 2XHNA 4HJIA 4YDIL 7CGTA 4Y2OA 1J9TA 3S8FB 3SE3C 1AHWA 4D0CB 1T5WB 4O02A 4NWUL 5JPMB 5BQ7A 5FC9A 2J7LA 4P5RA 4BWTA 2X4OA 1GRWA 5IEHA 4K71B 2A6DB 2UX6A 1ZEAL 3QVAA 1FFNB 2ZCZA 3M8OL 1JGEB 1KCLA 2DJ4A 3TN0A 5CUSH 2EIBA 4AZUA 1K8IA 4KK5D 4OCSH 5C09D 5AALA 2N01B 5T5FH 1OE1A 2QTVA 1NANH 4TVPL 2FD6L 3HG1A 5D1QA 1FCGA 1A47A 2JCCA 5I8KL 3T0EE 3DBSA 1OK0A 2VDNH 4PJHB 1JWUA 3ZKMC 4KJQD 3ZMEA 1IUZA 4U6HB 3MMEB 1NC2D 1NOFA 2W9DH 3QRFM 4JKLA 4ZAKB 1LL1A 2WWNA 4RGMB 1OQOA 4NJ9H 1GXEA 2WAHA 3ZE2B 3DIVA 5F7LB 3S3CB 2IQ9L 4F15C 5ID0B 1JAEA 1AGFA 3HS9A 5JTWA 2BZ7A 2C9RA 4GEJA 4NERA 1LDPL 2GJZA 2R56L 1YNTF 3ARFB 4MAYB 4YEEA 2R4SH 1LO2H 6CGTA 1DBBL 3S4SA 4QXUH 4KKAD 2ZX8A 5J3HD 4R26H 2CALA 1W0VA 3MGOB 2QHLA 2MPAL 2N56A 1QFWI 2V7NB 3TBTB 3NMEA 3MUJA 1PKQE 3F6IA 2I9TB 2BINA 1ADQA 2Z9TA 1MCJA 4U1SA 2O1AA 4U7KA 4X9YA 3KW8A 4MQ7A 1SEQL 2YJQA 4S1SL 3MBED 1J1OH 4YGVB 3DJRA 5CD3A 4FFYH 3VSQA 1R3KB 4KXZH 2YD1A 4MJ2A 4POZC 3ARTA 3CHSA 5I6OA 1AS6A 4HH9A 1KBKA 5AVWB 4ZMVA 2D31A 1AY1L 4UT6L 4HUNB 1MCEA 1KJMB 3AG1B 3RWHB 1CLCA 4FERA 4JG1H 2XIDA 3KJ6H 2WINA 4FYQA 4YSCA 1JPGB 3ESUF 3D4CA 3QJHA 2AEPH 2YK1L 3IDJA 4GSRA 1G5AA 1HH6B 4UNVA 4BH7A 5GRUL 5EIIA 1ZEAH 1KN2L 4M93B 5I1GL 4EI5B 3M8OH 4Z7VB 4L4VB 4JDZB 3KLHD 1MZYA 1IL1A 1Q90A 4IS6A 3C75A 2FD6H 2Q3AA 4NT6B 2GBVA 4GRWF 1V27A 3ZKXC 5FFGA 5I8KH 1MXDA 1KACB 4KO5A 1QBML 1B0RA 3PJSB 1WYJA 4JPSA 4X6CA 2C9PA 4PJCE 3RZCA 4M43L 2WGXA 1VCBC 3HZYA 2HT4C 3ZRFC 4LRNH 1E2VA 4ES8A 5B39B 4LMQE 5I76A 4N3UA 3X13A 2BRRH 2OJ1A 1A4JB 4QRFA 1BIHA 3HC4L 1JFQL 2Z1KA 5DJXA 2DTML 4GW5B 1G9HA 2G75A 4FS0A 4JDVA 3QRGH 3U0TB 3LKPB 4F7TB 1LDPH 2R56H 3LKNA 1N5AB 3JXAA 1DBBH 4L8CB 2X1PA 2MPAH 3LRMA 4MZ2A 1UT2A 4K5LA 2DWEB 1I3VA 5TK2A 4PGCA 4OLZH 2P5WB 3ZDXB 3QDGD 4N25A 5AOZA 3D50A 1JXDA 5DZLA 1SEQH 5JHDA 2NCEA 3BVXA 2DL9A 4HIHA 4GRMB 5GGRA 4ANKA 5AOIA 4FABL 3VVWA 3G9AB 3T09A 2R23B 3EFFB 1YN6A 4Y5YB 2RGSA 1T7VA 2DM2A 3G5ZB 1YEIL 3B83A 1QSEE 3HG0A 1N70A 5G5DA 2DWXA 4HZ1A 3WKNA 2AFNA 4RMTA 4XC1L 2X87A 5KBNC 3BP5B 4X4YA 5IK3A 3AMLA 4CSSA 3TL5A 5H8DA 1MSPA 4FQLH 3QDJB 4LDEB 3IFLL 1IC7H 2YK1H 3X3GL 4DK3A 4Y5XA 3B7TA 4Y9BA 3BQUC 1KTCA 1Z5HA 2XBDA 5GRUH 1DE4B 2AITA 2JIXD 4HPOL 1O6SA 4CN4A 3VFRA 2I5YL 1LK3L 2K9FB 5FA4A 1FGNL 4WJKB 3CDZA 2R1WB 2GK0B 4HMDA 4XP6H 1HXYA 5IGXH 1X3DA 3LEYL 2BVQB 4CN6A 2CDFB 4G8GB 3L4TA 3VD7A 4M43H 1H0DA 2WBWB 5IVXF 3MA7B 4QTIH 5EN2B 3VH8A 1ZS2A 4WK0B 4FTVD 4YDLB 3ZU8A 4BK4A 2H0FA 1KCUH 3SYAA 2Q6WA 3HC4H 4M8UA 2PW1B 4LLAA 1XIWB 4V11A 3O3BB 2FWLB 3ZXAC 1TMCB 2V37A 1NPJA 1A3RL 1AQKL 2DM3A 3FTSA 4IOSA 4Z7WE 5K9KA 2DYPA 3VDBA 4FMVA 2A9BA 1KB5A 3RNQB 3PREA 2RIKA 1I9IL 1X5IA 1TVBB 1ZGLB 3LHPL 5DHVA 1PX8A 1F4YH 1T5XA 1OAQL 3ALWA 1KYUA 1YN7A 1UT9A 1HQRA 3CUPB 1ETA1 4KMLB 2KPNA 4AQ1A 4LE8A 3MJGX 1A7NL 1W6WA 4YBLC 4JREC 1ND0A 1CIDA 1EHNA 1XGUA 2KERA 1SOQA 2YLKA 3BKML 5CSGA 3HI5H 1NJ9B 3GBEA 2P7TA 4G7QB 4YFDB 5DVKA 4FABH 4X9IA 3IFOA 2QKIC 4X98A 1X7SA 5J1TC 3KYNA 5KYUB 1CCZA 3FU8A 3EOTH 4GRLA 5D1QC 5F72S 1Z66A 2IC2A 1KB9K 2YRLA 4BIKA 1AGCB 4FQXA 3EHBD 2F6AA 1LQBC 5EH1A 1BSIA 3GK8H 1NC4B 3IFLH 4DZ8A 3CZGA 4WO4A 3F7YB 3Q8FA 5J9PA 3UTTE 4I3RL 4QGYA 3HJEA 2H0PA 4ZUVB 2OFQA 1PU0A 1URIA 4H88L 5IMKA 1MCSA 2YD7A 1UD8A 4LLQA 2H3XC 1CZ8H 2CO1A 3FB8B 1A7OH 4XB3A 4DQAA 3VCLB 1A7QL 3ZW3A 3O4LD 2W65A 4R97B 2ITDA 1B2YA 1WTGT 5TDOA 2QSTA 4G80B 1RP9A 4Z6AT 4QRRE 2Y3NA 1Z1WA 2VDNB 3LEYH 4FXTA 5JUEL 4CN1A 2D7OA 2JJWA 5H37A 4FP8L 4LB8A 2NY5L 5I5RA 4L1TA 4OFVA 3IDGB 3FO0L 1G7IA 2R69H 4NQEA 4AQ8A 4EN3A 4O4YL 3HRZC 1B3IA 1RERA 4CU8A 2MQ3A 4YZFF 3ZDZB 4RFEA 1ZSDB 1P1ZA 4DK5A 2ISDA 1S7XB 2CHWA 1P7QB 4L05A 1MOEA 3RHWF 2DJMA 1A3RH 1AQKH 1Q4NX 5KW9H 2VDRB 4FI8A 3Q2LA 1AI1H 5D7SL 4PGZA 3ULVD 4A67A 4KDVA 2QELA 4XOEA 5LAXA 2OYMA 1QR4A 3DYMA 4PWEA 3VSVA 3WS6C 1QRNB 4DAGH 1MCKA 1WSST 3LHPH 1CWVA 3CFNA 1B2WH 4OFPA 2FHCA 1OAQH 2BNRE 4P9ML 4PJIB 1UYWH 4ZMYA 3ESVF 5CU5A 1QBBA 3FOLA 3QEGL 2FT7A 2X4TB 5IQLA 4JPIB 2VMFA 2BP0B 4UQ2A 5IHUL 2N4IA 3QA3B 1S9KC 1HYSD 1W0WA 5C8JB 2ESVE 5MEQA 4Y5VB 3TFBA 1WGOA 1R5WA 2YPKB 4KTDL 4M8QB 5ERWB 1WGVA 1WE5A 1ILUA 3VFGL 4I5BA 2SEBA 1IGIH 1JV5A 5GGUA 3EBIA 3LN9A 2HLEB 5EZOH 1CR9L 1GY1A 4CKQA 2YMXL 2K4AA 2NZ9D 4I3RH 2DMKA 4G43A 4LT7A 2ADIB 3I3DA 1EO7A 2DV6A 3QR2A 2IDQA 1RK1B 4MB5A 1F8TH 3IF1B 5JIHA 3BO8A 4CMMB 3QZLA 5AVUB 1NCJA 3U4BL 1MG2C 3GTVA 3NTCL 4PJ9B 4K73A 2VLLB 3ZKSD 2F2HA 5JYLA 1VFMA 4PD4J 1GMEA 3BAEL 5DK3A 2QJDA 2QQQA 5JUEH 4QT5B 2VR6A 4FP8H 3TV3H 4HKXB 1XWVA 1R33A 2IANE 2HX9A 1F00I 3ZYIA 4O4YH 4WEBL 5F1NA 2D7NA 1WT5C 3MLXL 1XH3A 4P4KB 5C0CB 1FNEA 5HDBE 2YC1B 2NNAA 3LIZH 3MBXL 4PJFF 4Z7IA 3P2TA 3ETBF 1XSIA 4H8UA 1FVEA 3EFDH 5D7SH 4RAUA 4KZEL 2GSMB 5DJCA 4FLOA 1PZBA 4FRWA 3ELQA 4HWBA 3O3DA 4N4YB 5I0WA 2QGDA 3GTTA 3RWGA 3BIKA 1EGJA 3O41A 4BZYA 1G1YA 4GJTB 4P9MH 1IFRA 3SDDB 4O2FA 4EUPB 3DX2A 4IBYA 1HI6A 3C5JA 3QEGH 4NQSB 3TO4D 3FTGB 5ES4B 4N2CA 4Y5XC 5I26A 5B8CB 1SHMA 2DLTA 1U93A 4MVBC 4N9GB 4H20H 4B60A 1KTBA 2DL2A 5JOPE 5K9OA 1E27A 4KROB 4JN2A 4TQ8A 1JUFB 3RWDB 1JJUA 2J8UE 1J8HD 3ILDA 1XH2A 1Z9SB 4ISVA 4X7DC 2A3TA 4KTDH 3P3YA 2ETWA 2OZ4L 3QJXA 2K1MA 4ODBD 4YNYB 4YHIA 3MACL 1K4DA 1L9TA 2YUXA 1OPOA 3VFGH 3MLTB 4MD4B 5FO8A 1BXUA 3QUKA 4K23H 5DDHA 1MRDL 1CR9H 4HPYL 5L4IA 2FH6A 1B4LA 2YMXH 3EBHA 5KSAB 1M71B 3FTXA 1G43A 4MWFA 5E8PA 1FO0A 4X80L 3QYNA 4OFQA 4U0RC 5SX5K 3X1FA 2A4ZA 3DGGB 3IMVA 1A6UH 4LOFA 1DL7L 1DSYA 2OP4L 1COBA 2F7RA 3QWRD 2WMPA 3BPCB 4DFHA 4ZS7H 2QPSA 5CHNB 3BVTA 2P46B 3FBKA 3NTCH 4G6KL 4XHJD 1IGTA 2NCMA 3HNTL 3UJIL 4IOIA 3KR3H 3MRGB 3BAEH 4XMUA 1MCDA 3H7BA 5CIPH 1XQ4A 4KV5F 4AY0A 3KLSA 1UD3A 1MVYA 5F9DC 4AQ1C 1BMGA 2F9BT 2Y1YA 4ZFGH 2GJPA 3MZGB 4WEBH 1OCWL 2XQBH 3QUZB 1A22B 3DGDA 3HNVL 3MLXH 5FYLL 3K6FA 4AJWA 4MCYB 4JG0L 2YPLA 2R0LL 4YHLH 1N6UA 3IU3B 1F4HA 2BVOB 3QZWG 4RNRB 5AYUL 3CHOA 3GB7B 5E9DA 2NQDA 1MAML 3QIWA 4WSGA 1ZK5A 1IEBB 2R2BA 4GRLC 1T0MB 5BJTA 2BLFA 3WNLA 4B9IA 5C0BA 1EAPB 4XO4A 1U8LB 2FEJA 1UOLA 5K59F 2QEJA 2H9GA 1CFQA 2B4CC 2JK5B 4WTWA 4DKFH 1CE6B 3KDMA 4NQDB 1S9YA 1NINA 4JFZL 1EEZB 4CUCA 2YZ1A 4PJHF 2XU9A 4Z76A 3RWIA 1I7ZB 1CDGA 3SGJA 5E94B 4A63A 3N2JA 4WNSA 4C83A 4NXSA 2UXVA 5SWZD 1I1FA 5DJYA 3KYMB 3ZE2F 1ORSB 3FO1B 3MACH 4GAAA 2Y5TA 4ILDA 4DT2A 4E9WA 5ISZD 3VFSB 3IGUA 4RMRA 1VA9A 2E9BA 1OANA 1V3LA 2NXZD 1KENL 4EZJA 3NH7H 1VADA 5IW6A 3EDJA 4WFFD 5E6IA 5HHQA 4LSTH 4AQ8C 1NLBL 4BUGA 6PAZA 4H7VA 4XBMA 2J88L 3KPNB 1GGYA 4PJDB 4GAGL 4I0PB 2AK4E 4LOEA 3TOPA 1YMMB 4OH2A 4NS0A 2XIIA 1DL7H 5DJ8B 3WAKA 1UB6B 2ZX5A 4M7LL 5JDJA 1XXFC 4G6KH 2IGFL 3O2DL 2VDQB 1OAYL 1WZAA 4NKOA 3HNTH 1W8OA 3HZVA 1YPZB 1KBVA 3TTYA 1TQUA 3KLLA 4G6FD 4TPRH 4OD1H 3UERA 1ZVSA 3GHBH 4N1HB 2XN1A 1KLFA 1I1CA 3DMMA 4KJWC 3NACL 5IV2B 5C9KA 3DOSA 3SYPA 3T0EB 3WMQA 5HYQB 3NQIA 4LHQB 1SYVA 4WWPA 1E6JH 4XPFH 1F1DA 1BQHG 3IN2A 4UU9B 2BDNL 1CGVA 1ZLWH 1XR9B 1SEBB 3WTUA 1C5DA 5HGBA 5E2WH 1FA4A 4OVVA 1E5CA 2ZP0T 3FNKA 4KKLD 4E41A 4Y19D 4LP4A 4XPTH 5AYUH 3T1FB 4ZMAT 1BWMA 3V0HA 2EVFA 5HHVL 2Y6SC 1RK0A 2UWEA 1QNZL 3ORJA 2A9NH 4ZSOA 3VWKB 3EJUA 4Z7VF 5D72L 2Y0SA 2TSAA 3ILEA 1T6BX 3LQZB 5DYOB 5FO7B 1HXMA 3NJXA 1Z9MA 1ZV9A 1Q8MA 2XTSA 5JIIA 4WAFA 5JNYB 3QNXB 4X6EB 3AC0A 5EF3A 3HMXH 5DVNA 3INUH 3GSWB 1HWWA 3CJJA 5LNDA 4K8RC 1G7PA 4ODUB 4D94A 4XCCL 4N85A 3MRKB 3K6NA 4I3SL 4MZ3A 3UTQA 1QASA 2YUVA 2I27N 5LKNA 1QHOA 4LCUB 4NSKB 3WAJA 5CP3A 1E90A 1Z9OA 3AROA 1KENH 3TV8A 3DURA 4E9YA 5I8CA 2VMCA 5JHBA 3ZE1E 2A73B 3QORA 3MNWB 1MWAA 1NLBH 2J1XA 3EH3B 4QRUB 5FAAA 5JZ7C 2XFXA 4OLUH 2GY7B 4GAGH 4Q6YA 4UCFA 3W11C 4QF1B 2GSIB 4ICXA 4WKXA 4GW1B 5JO5B 4X9HA 1R5IB 4ZOEA 4ABQA 1N6QH 2LFEA 2G30A 4M7LH 3TBYB 3P4LA 2XRAL 5EDSA 4OZGE 3ZDXF 1UCBH 3O2DH 3QEQB 4A55A 3TA4D 2NSQA 3MRNA 1INQA 5GJTL 5G2NA 2WBJC 1F97A 1OF2B 1RULL 5E8EB 5GZND 1YUHA 3MU3A 1FPTH 4NZUL 3SKOA 3NACH 4YFEA 2BSSA 3MV9B 1TZOA 4X6FB 5I8OL 4F7PB 4BUQA 4UM9A 2MCG1 4BZ2A 2HYMA 3O6FC 2YSSA 5IT2L 4KVPA 3U2IA 2XI9A 1U3NA 4WKZB 2EDLA 2NR6D 4YDVA 4ZRGA 2G2PA 3BKCL 3A67H 3E6HA 4DOHB 3L13A 2HN7B 4C4BA 1I85A 3IJ8A 3R8QA 2GJ6E 4YVUA 4A2LA 5HSFA 1VLXA 5I1LB 1VKXB 4HIIB 4WW1A 4D0DA 4NX0A 2E7MA 4XAWL 1KXVA 5E9NA 2IDSA 3V5HA 5IESL 1DQQB 3AT0A 5D72H 4EIUA 3S98A 3IDNB 5I18H 5C0AD 2NY1C 2OX5B 1MVUA 1W15A 1MQKH 3MFGB 4XMVA 3CMGA 2VR8A 1VFAA 3GUTB 1K5NA 2WXPA 2GEEA 3DARA 3KLDA 4MTMA 3C60B 3HS0A 3NPZB 2F5AH 1I8IB 4HC1A 3NA9L 3R0NA 1QPXA 3QK0A 4ZD3L 2PPCA 1TVHA 2Z64C 3WLBA 2VE6B 4I3SH 4NZFA 3WE1A 3EJTA 3DECA 2IBZX 3MHZA 5IOKA 3OB8A 5CLYA 3ULUH 3O8XA 4PRIE 1YVLA 2FO4A 1J87A 1FFPB 4JRLA 3HMWL 3PP3H 5CXPA 1R46A 4KRLB 3MO1A 3P9MB 4EBQL 1HINL 3LX9A 4EXKA 4IOFC 1NFIB 2EE2A 3EF7A 3LEXB 4NRZA 3VM5A 2RA1A 3B3BA 2R4RH 4B5ZA 2Y6TE 4FA8A 1WF5A 4PJCA 4ZTEA 5LO7A 2ICWA 4TTDD 5JW4Q 2X0WA 4UAOB 2XRAH 4I4WA 2O26U 3AM8A 3ZK0A 1JE6A 3GMRB 2NTFB 3MODH 4AIEA 3CFBA 3OKOA 5I73C 3PUUA 4XN7A 4OJCA 5L8KB 4HX1A 3FT0A 3FQNA 3PWVB 4BFIA 4H5SA 2B1AL 1MF2L 3PXLA 3RTLA 1N59B 1KUMA 2WO4A 4WHDA 1ZVNA 4W9CC 4UAHA 3Q8BA 3Q48A 5FYJE 3I9GL 5IT2H 4M61B 4GIOA 1OF0A 3OZKA 4OW6A 2GVYA 3SGJC 4J6RL 3DV6A 5CJOH 4AL8C 1TU2A 1KT2A 4JFSA 3VFTA 4IK6A 5IESH 3QO0A 5A2FA 3VFVB 1U3HB 3IDUA 5E6IC 1KIPA 5SWZE 3B9EA 1ZA6B 3B7SA 3UTZA 1J05B 1LILA 2BIIA 3GIZH 1AGEB 2E56A 3NA9H 3UYRL 3H53A 1QHPA 4CU6A 3MV7A 1UD4A 3CU1A 5EMYA 5JA9A 1FNGA 1MNNA 1RKRA 3L5WB 1OPGH 2LW3A 5IG7B 4YXLL 2CO6B 1NOLA 3BDYL 3VXSD 3CHXA 1KGIA 3ZDZF 3CFEB 4FKHA 5KBMA 4UILH 2YO3A 4FZ8H 4ODTL 2XTJE 3HN8A 2L0DA 3DMMC 3FMGL 4YMPA 4FI6A 2XWTB 2QSCL 1S7RA 1KJ2B 2D3LA 3WE6A 1HINH 5KG9A 3QSKB 1XR8B 5ETUB 4OQTH 4E9TA 1IMHC 2I07A 2VZ1A 5IQ7L 5EO0A 4PJIF 4Z3GA 1OD9A 1HSAA 4XVUD 1UWEL 1ZS8A 1N2RA 1VGKB 3BSHA 1J5OL 3J8F7 3FB7A 3UBFA 3D8MA 2AJ3A 2J1YA 2OPCA 4ZMLA 1FJ1B 1E6OL 1YYML 3T4YB 2A6KA 3HR6A 4Z7WA 1R6VA 4MB1A 2F7PA 4C59B 4JFHD 4N5EC 1NFKA 3GSVA 2B1AH 4FNSA 4ZOCA 5I17B 3MV8B 1R47A 2V7HA 1P53A 3V4VB 5F89A 4QNPF 4DGIH 3SZKC 5I6LA 2VOTA 3I9GH 1SZNA 3ARBB 3MJ8A 2FX8H 3IXAB 4XBEH 1UTDA 43CAB 3ZL1A 4J6RH 4JGUA 3FFDB 4Y2DD 4OZIB 2DD8L 1J0IA 4HFWA 5HHPB 1A4CA 5DVOA 3FT2A 2YA0A 3LPWA 3OAYK 1CFTA 1U6AL 2VZOA 4B7IA 3JZYA 1L6PA 2AZAA 3VRIB 1HHGB 3LRGA 2Y2WA 3BZ4A 1VHPA 1U21A 3FB5A 4OB5L 5AKRA 3TBBA 2HJKB 4ZOBA 1DLFL 2NY6B 1V05A 3SZ6A 5DQJA 5EULV 2XKSA 3AXLA 4XX1G 2CO3A 1TTBA 2FLBT 2PPAA 5JQHC 3K5SA 4JM2C 4Z95H 4NQXB 4Y4FD 3QFDA 2MCAA 1BX2B 1QWNA 5C09A 1Q72H 1FH5L 3MRMA 3BGMB 2AERT 1SXBA 5BO0D 3QQ4A 1JCKA 4ODTH 5KZCD 3HLAA 1E4HA 1LNUA 2KI6A 4Z0XA 4PRPD 5LG1A 2B0SL 1NCDL 1NC2A 1ZA3B 4H8HA 1P4LA 2QSCH 1U9KA 1KFAL 1HCFX 3KDPB 5TDPA 1J12A 1I1AB 5ESVB 1T20B 4LLUA 4PJ5B 1TO5A 1UWEH 3DO3A 4RWYL 5CGMA 2DQEL 3MCLL 3UTPD 1Y6NR 1MCBA 2Q3XA 1J5OH 1MHEA 2BVTA 2FSEB 1IKOP 2Z4QA 5K39A 1I85C 5B39G 1ID5I 3GUFA 3ZR5A 3RHWK 4P9HL 1E6OH 1L9SA 1YYMH 3BFWA 4TYUA 4CU7A 1KXVC 2PYED 3MGAA 4NB7A 1S5IL 3OKYA 5HI3C 2HT3D 1RJLB 2Y7OA 3DTXA 3TPUB 3KPQB 4MNQB 4KHTH 1RSFA 1PIFA 2HSIA 2PR9A 3D48R 1HEHC 1JMZA 2BNRA 3HS0C 2BK8A 3V0IA 1LMKA 3MBEA 4R2GC 1TZIA 2VITA 2HTKD 5J12C 2Y06L 5AKVA 4X4XA 3BAXA 3IGAA 2ROYA 1FG2B 4G6AD 2V9UA 3DTUB 3AAZB 4F20A 2H2SD 2FK9A 4KFMA 1U6AH 3BCFA 4LLMA 3UC0H 3HW7A 3LYRA 3O2VL 3O8XC 1BAGA 3P4MB 3ZMNA 5F9WB 3HPLB 2VXQA 2V2WB 3EH1A 5K5YA 1DLFH 3EO0B 3O0LA 5JOFA 2OL3L 2C7UB 1JG9A 5K33A 3V4UH 5DRWB 2HVJB 1YNLL 2XV2A 4QXGL 1Q9KA 3D39D 3S3SA 1KV3A 1OHZA 3DX6A 3N9GH 3GXMA 2JJTA 3B6SB 3HC2A 3VXRD 3T77B 3CFKA 1M1SA 1R5VB 3AM8C 3C5ZA 3U6XA 3CPLB 1LEKB 3CK0H 5FOBB 1NCAL 1AXTH 1DBKH 2ARJA 1W8EA 2J8UB 1ITBB 4WRLA 1JGIA 4LSRH 3Q1SL 3SDCB 4HWEL 5KAQF 2F8VA 1NCDH 3CAFA 4HF5L 4Y4HC 5ANHA 4PGDB 5IB4B 2DDQH 1XCTA 4ONGL 5A43C 1QVOA 2WLLB 7FABL 3WFCH 3Q43A 5LXVA 4GQQA 1D3CA 4F33B 1D5IL 4WFED 1TJMA 3GSUB 5D7IE 4RWYH 5C2UB 4L4TB 1TTGA 5FKAB 4IK7A 1MH5B 4KFZC 3VXTB 1QI5A 3I9AA 1JK8B 3QDMB 4F1SA 4IJ3B 3V7MA 3M6DA 1T4KA 1KLGA 5L6YL 4H26A 1HNGA 4TQHA 2VSKB 4UTAA 1ULVA 4QJ3B 4IMKA 5AWNL 4K3EH 1PZAA 4WCYH 5IFJA 2X12A 1KGUA 2VSMB 2DMHA 5DO2C 3QDGA 3L5HA 4EQ2A 1FFOA 3OC8A 3WMSA 1AZUA 1VFUA 5D9SA 3T65B 3WIHA 1XHHA 5DVPA 2ZXBA 4MQXD 3KCPA 4GG6E 5I1IL 3DXAB 5GJSL 2HFFA 2Y06H 4AGQA 4LOUC 1LGVA 3GXDA 3CVHB 2ZUTA 1Q9LA 1ADQH 2PWDA 3ZT7A 4N68A 2AEQL 2C1OB 4PJDF 2VXSH 1AR2A 3LEVL 5T3XD 2Y2YA 2YXVA 4U4IA 1CDJA 3VXNB 2A83A 2YBRB 4D9QD 1CGUA 4OLYH 4K7PH 3T0AA 1S7WA 3CMOH 3P3TA 2FT8A 5HGAA 2EDMA 2Z91A 2XPZA 4KXZI 2OL3H 4TVUA 1KGCE 3CZSA 4KDWA 2WUBL 1YPZF 2CHDA 1YNLH 4WTZG 4QXGH 1WA1X 4B9GA 4ODWB 4OIIH 1XZWA 2HLFD 2JIXA 4PS8A 4R4FL 1E65A 1I82A 2BP5M 2YAEA 3AG3B 2AV1A 3L9BA 3WFHA 2DW5A 2X0VA 3P73B 4HFUL 3L9RB 2HPTA 4AM0A 4LASH 3HUJB 3WUZA 4DP6X 1QFWM 4LSQL 5FM5O 5ALBL 3FSWA 3T8XA 4HWEH 3GXNA 4X5WA 3DX7B 4JY4B 1QP1A 1ZE3C 2WWMC 3ZKNC 2E86A 3GSQA 5HPOA 4I77L 1OGTA 2K45A 5EO9B 3TWCH 4FTVA 4C57C 1TCRB 5JORB 1MFCL 2W92A 1F11B 5HVHC 1BGXH 1D5IH 3LD8C 1OEZW 5IB1B 3STLA 2E46A 2RTTA 3NJIA 8FABB 3O45A 4OGZA 1RUQL 5DEFB 1Q94A 1A4BA 3VXMB 2YR3A 1I8AA 2YXFA 4HWZA 3ZZ1A 3GO1L 4UIKL 1YEJL 2Y4SA 5AWNH 2XG5B 1IE5A 2OMWA 3HRPA 4GKZA 1XSJA 3DO4A 4FG6C 1A1NA 4X8CA 3W9DA 2CHNA 3UC2A 4L9DA 1DZBA 1B4RA 1FFRA 1AZRA 3CFTA 2VZTA 3DBXB