1T66D

The structure of fab with intermediate affinity for fluorescein.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVKLDETGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRAEDMGIYYCTSYGYHGAYWGQGTLVTVSAAKTTAPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSALYTLTSSVTVPSSSWPSQTVTCNVAHPASSTKVDKKIVPRNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional Structures of Idiotypically Related Fabs with Intermediate and High Affinity for Fluorescein.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin light chain
total genus 46
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t66D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t66D01
5EBMB 1ZLUH 1FG2B 3ZKND 4JLRA 1IGCL 4L8CB 3B5GA 3ALPA 4PJGA 1IC7L 3O8XC 3ULVC 4JEGB 3Q6FB 2WUCH 3RL1A 1JI2A 3SKOA 3C60C 2JB5L 4N68A 5DJXB 2AEWA 2CGRH 4XNQA 2ARJQ 1DBMH 3ARRA 3TA3D 1EMTL 4CNIA 3CK0H 4JRYE 5MENB 4JRYB 4MD0A 4F7CB 2IPUG 5C09A 3RJQB 1A3LL 3REVB 1BVKA 3VXOB 2A9ML 2CJUL 2YXFA 3QZWA 3EAKA 1D5IH 1JF1B 1P5UA 4YDVA 3RBGA 5KSBF 3UBXI 1CGUA 2VAAA 5CEYA 4ODBD 2A9NH 4ZTOH 3O4OB 4DZ8A 3FT3A 3NABL 1YEEH 3OHXB 3G6AB 3ARQA 3KXFD 3D87B 3K1KC 1T66C 4DKDC 4G9DA 3DUSB 3MCG1 2ZG2A 2ZCHL 4B53A 3VGAC 2D0HA 1BJ1J 3EO1A 1MRCH 1P6AB 3QCUL 2CDFB 5I1EL 1ADQA 4OFPA 3QA3B 4UMGA 4NNPH 4RRPA 4PG9B 3L3OB 5EH1A 4YFDB 1XR8B 5FGBC 5FIEA 1MF2L 2R29L 1QZ1A 5TH2A 3CDYA 1CS6A 1KCSL 3WE6B 1HIMH 1MFDH 3O45B 4JDZA 1QSZA 4L4VD 3B5HA 2ZSVA 3EYVA 1I1YA 2BVEA 4EN3A 1KFAL 4WW1B 5I71C 1XGQB 2YD9A 1T0NA 5ID0B 3JUYA 1XF5A 4G5ZH 3EO9H 2VZOA 2X70B 3QWOB 2NR6C 5K9JL 1W8NA 3CFKA 5DSCB 2E9IA 4PRIB 3TO4D 1T0NB 2EYTB 4NO5B 1JPTL 3KYAA 5ID0A 1ZXQA 4Y16B 5IMOB 2BSSB 4WVRA 3SDAC 2CMRH 4YBQC 3O45A 1SJVA 4JDZB 4XT1C 5JA8B 4HC1H 5I18L 4NUGL 5L0QB 5MEND 1B6UA 1XR8A 3O6KH 2P5EA 3BIKA 5E03A 4G6AC 1S9XA 1Q9KA 3AVEA 3P0VL 1FGVH 4NCC1 5I1JL 1KBGL 3D6GA 3UX9B 4BQ6A 5F88A 2ATKB 5E7BA 4M6ML 2D3VA 1X5GA 4QHLB 3D39B 4QT5B 4JFFA 4HUUA 3NIFF 1YEKH 1JNHB 2VXUL 3BXNB 4R97C 3D2UB 3UTZA 1FLRL 2OJEA 4U6XB 4HCRL 3QDMA 2V9TA 3QISA 4HH9A 3IFLL 3QDGA 4GLRI 4YHYC 2C7UB 1BVLB 1G6RL 1ZLSH 5SX5K 5LGJB 4R4FH 3VRLE 3HG1D 3P30H 3OKNB 3VXOA 4N9GA 1YMMA 3CU7A 4YUEH 1R5IA 2QEJA 3GSQA 2A77L 3MRPA 2YPLE 2V2TA 3C8DA 1NL0L 4WHYH 3OB0H 3UMTA 5DJ2A 3MLRH 1NC4D 3NFSL 3P9WB 1OPGH 1DE4A 3GK8H 4TVPD 3EDKA 3OGCA 2UY6A 4L9LC 1TJGH 3RVTC 2J8UE 3CVHL 1HSBA 4K9EH 1YY8A 4IOSD 1VGKA 2AJSH 1BFOA 2WUBH 2JCCF 5DT1L 3LD8B 5INCB 5DZNA 1NEUA 2R0LH 3FHQA 4HIHB 2Z8SA 4XCFL 5EBMA 5DUMH 3LKSA 3BWAA 4RGNC 2D7OA 3G5ZB 5IB1A 4I0PC 1IVLA 4MNGE 2AJXH 5DO2D 4I2XE 4BSJA 4H25A 1CG9A 1TQBB 3WFCL 1W0WB 5J0BA 4GKSB 4BKLA 1D9KB 2R1WA 5SX4H 1FV1B 5F1OB 4P2RB 3MJ7B 3LS4L 3C6SA 1X7QB 3EYUL 1U91A 1AH1A 4D9QD 5LBSL 1XGRB 5JOPD 2PW2A 4PYHA 4ETYA 25C8L 2NY3B 1TNNA 1CDBA 1FV1A 4MA3A 1AHWB 5TDOA 3C60D 2FBJH 3PABA 1S7QA 3PWPD 2BNRA 1FAIH 4HWZA 1ES0B 1B9ZA 1JE6A 3PWJA 1BM3L 1U3YA 5CS7A 4YDKH 2XFXB 3WXWH 1IKFH 5IB1B 1I85A 3BZEB 3QDAA 5TDPB 5IW3A 4XRCA 1D6VH 3L3GA 1KB5A 2E7CA 3GSUB 4D9QE 4ZOEA 1QRNA 3SDDA 2GK0A 5E5RB 2GJ6B 3V52L 1PG7X 3LHPL 4YHYB 2Z31A 4F7PA 3F7RA 2A6IA 3FQXA 3HR5B 2QKIA 1PYWA 3D0VA 1RULL 5HY9B 2IQAB 1QO3A 1EBAA 4HDIB 5ICZA 3ILPA 4J4PA 2IH1A 4NN6C 1WZMA 3PDGA 4LHUD 4TSAH 4Z7QF 3MRPB 4K9EC 1S3KL 2QADC 4XPBH 2F53B 2I25N 3OX8B 3MRNB 3BE1H 1AE6H 3NCYS 1MREL 4X6CF 2YSSB 5T1KB 3TBTB 3GHBH 3ECBB 3T0EB 5IJKA 5B8CC 3VD4A 2V5RA 1LILA 4AQ1B 5I1LB 4HBCL 4GG6B 2D7NA 3GIVA 2IBBA 1HH6B 3BN3B 3L1OL 5D6DA 1I9IH 2AJXL 2Z31C 2O5ZH 2BFVL 3QCUH 3GSNA 5C07E 2HTKD 1JWSB 1HQ4A 2H9GB 2YD6A 4FA8A 1KN4L 4JRXB 3JV5A 1QQDB 3RHWF 3RIFK 2ENSA 4TUOA 3SDCB 1I85C 3HMXA 3GMQA 4QWWD 5E6ZA 5GIRB 4LGRB 3PP3K 3VCLA 5EOTB 5EORH 4ODWA 1KELL 2FHFA 4V2CB 1M7XA 3SE9H 3F62A 4ZUVA 1RZGB 5TPWH 1P2CA 1XH3B 1NAKH 1IAII 3B2VH 2BCKA 3VWJA 5H8DA 1PG7W 4NP4L 2CIKB 3SDAB 4FP8L 5H35A 1NCDL 5C0CA 3EOBA 4X4MA 3TBSA 5JXED 4M93C 5DJ2B 5E8EB 1SBBA 5F9WC 4ZUSA 3BQUD 5FUZL 1E6OH 4GMSL 2R8SH 4P4RB 4UDUB 1VFBA 3AREB 4OUUB 2IAMD 2ZG1A 4ZS7L 3CGTA 4HCRH 3VD3A 3DXAB 3ROOA 5A16B 5I8OL 2EZ0C 4HV8A 2R2CA 5TDNB 3ZKSD 2ERJC 4Y2DB 5C0ND 5DS8B 2IBZY 3O4LD 3BIAX 5CP3H 4U1LB 3IGAB 2X4RA 3QHTC 5EORL 5DK2B 3QA3A 2H1PL 5HGHB 35C8H 3AAZA 1E4XH 4LPUA 4PJIB 4LLMB 2XQBH 4J4PD 2NYYD 4ZUUA 2EKSA 3MBEB 3WIFB 1BWWA 1I3GH 2EDTA 1MY7A 3SJVB 3ZTJH 2A38A 1IL1A 4NCC2 1FVEA 5I17A 4FQHA 4D0CA 5KBNC 4HT1L 4NZTL 1ND0B 4OGAC 2DQHL 4M00A 1X5LA 3BGMA 3BIKB 2DM3A 4JDVA 4X7TA 5EU5B 2P5WA 3OF6A 4NKOA 2EE2A 4HFUH 1SMAA 1QR4A 1VACB 1NANI 1BQLL 3SGJA 2D4DA 1CE6A 1FYTD 4LCCB 2Z35A 4IOIB 4FABH 3E3QC 3CFIC 5KSBA 5IQ9A 5DJ0A 4QHMB 1ADQH 1HILB 4BH8A 1FZOB 3MLSL 4JO2L 5LGHH 3I85A 5H94B 1J8KA 4HS3A 4P9HL 1CI5A 4UT6H 1KJ2L 4MA1B 5E8OB 2UWEE 5HGAB 3OB0K 1NEZB 3KPSB 4G6MH 4YHPB 2NX5A 5F9JA 2ARWA 4J8RA 4MJIE 2FLRT 1Q1JL 5JHDB 1R3JB 2BHUA 1HYSD 1JN6B 4NHUA 1TVBB 3RWIA 1AQKL 3GHEL 4HJJL 2GFBA 4EDWL 3HMXL 4ZUWB 1IKFL 4P5TD 1WAAA 2DM2A 2VWEC 5F7NC 1ZT7A 4RMQA 4H8WH 3WV0A 3EJYC 2B39A 1MWAH 4GAGH 4NGHL 1MCNA 3MZGB 3MMEA 3N9GH 1HKLL 3U6RA 1VKXA 2MQ3A 4IOFC 4EJ1C 4FQXD 3D39E 3DJ9A 4XP5L 3VFTA 4POYA 3EBAA 3G6JB 2G75B 1OHQA 1MJ8L 1PX4A 1UEYA 4P9HH 1X6LA 2ICWB 1GZPB 2DQDL 5GRJL 4JO3L 3MLTB 3E8UL 1X5YA 3PWVA 3LHPH 1OB1A 3VXTB 1J5OL 2DMKA 1OT2A 2F58L 4KK5D 1UH2A 1C5DB 1HZHL 2WSKA 4I3SL 1N4XH 1MCPL 2R2EA 4I18A 4HK0B 5DFVC 4LRIA 4UBDD 2VLMD 5I1IH 3IVKA 1FNGB 4ESKA 4L8CA 2P44B 4U3CA 4NJ9H 5HJ3A 1EV2E 1YEDB 2DM4A 4J3VA 1K3ZA 1FYTA 3KPMA 4UNVA 2APFA 3QPQD 4PLNC 1UWEL 4LP4A 5L2KE 3L3IB 2NXZD 4HKZB 2BVUA 4ORZC 3D85A 3MNVB 1RUKH 1Q9LB 2YC1A 3HG1A 2WZPD 3RDTD 1G6RH 2NY1B 2W0FB 4QGYA 4NZRH 1S7XB 5GGRA 5DQJA 1K4DA 1A6UH 4Z7WE 5DLMH 3M17B 2EIDA 3HZVB 1B0GB 5CEXA 4YHIA 1J0IA 4M5ZH 3RWEA 4P9HC 1CFNA 1T83A 3RNKB 2VIRB 3O9WC 3LIZL 4PJEF 4RGNE 2XTJE 2FSEA 5F71A 1LO2H 5JW4M 1KEGL 5GSVA 3L7FA 2EEBA 4P5TA 3PG2A 3OBAA 4GOSA 4OCYL 2C1PB 1DLHB 4QRPD 3U79A 5I1JH 5E1AA 4XNUL 1MFEL 2GI7A 2NW3B 1AGFB 3WXVL 1NCNA 2FIRT 3VFMB 3CSGA 2NR6D 4QNPF 4M61A 4UOW0 3N9GL 3ZDYF 2DDQH 3ZE0E 1VPOL 5L8JB 5D1QB 2ICES 2JJUA 3TT3L 4HJ0C 4TULL 3GI8H 4M62L 5ALBH 1UJ3C 3S4SA 4JY4B 3RGVD 4XCNA 3TM6A 4GMTL 4PJ5E 2SEBA 2OZ4L 4RA0C 5IEHB 4WI2A 3MRLB 1S7SB 5HGHA 1FFNB 3FQWB 1ED3B 3HRPA 4FTVD 5F1KC 1I7RB 2H26B 2BRRL 6FABH 3C60A 3KYOA 1BZ9B 1FIGL 3O6LL 5K9KB 1IAOB 1X9QA 3N85L 1C1EH 2Y6SD 2J4WH 2F5BH 1U6AL 3HG1E 2XXMB 4KKLC 4OJFL 4OUUA 1BD2B 5I8KL 1NBZB 2JB6A 4YX2H 3CFJB 3VMPA 1A3QA 1A6VH 1QLFB 4MAYC 5KN5A 1N3NB 3HUJB 4OV6F 4PJBB 3ZL4H 5K59F 2J8HA 1AR2A 4LLUA 1G7QA 5C0CB 5AD0A 1L7TH 3VGBA 2YK1L 3U7YH 1YQ2A 5CJ5A 2EXYC 3FRUA 2ZWLT 4JFPB 4X4ZA 4P2QA 4KZDH 2Q86B 4NC1E 1YPZA 1NGZA 3MRDB 3OXSB 4ZOBA 2BDNL 4KI5D 1W72H 1DQDH 4KRLB 1Q0YL 2CDGB 1EH9A 4M6AA 4R26H 4GBXB 1XMWA 3WUWB 5D96B 2Y6SC 4W81A 4X6CA 5EZJA 4G5ZL 1C8PA 43CAB 3BGFC 5BOZG 1QQDA 3LRGA 4NQXA 2I5YL 4P2RE 1K2DA 4KWUA 5SWZD 4F33B 1R6VA 2JCCA 5C0BB 1ORSB 3MTRA 4PLKC 3NCEB 3ARGC 2YMXL 4XBPA 3CC5A 1QLFA 4JKPL 3KPPB 4MA7H 2Y36L 1ZHLA 5DJAB 3MRFA 5EO1A 3S3PA 3ULVE 4DTGH 1B4JH 4XP1H 5T3XH 1UWXH 3HRZA 4IOFD 3DTXB 1OAZL 3O2DH 3VGEA 3L3DB 1IMHC 1F5WA 3U9UA 2V6HA 4KJQD 2FLBT 1DUYA 4GW1B 1UYWL 5EWIL 1JZ3A 5GGQL 5E99L 3SY0A 1S7TA 3UYOD 5DMGD 3HI1B 5IEHA 4GW4B 2OJZH 3T09A 4JY5H 3D3VE 5EC1A 1PAMA 4UNTA 4FQCL 3IVKB 4K3EH 2KDGA 3H8NA 3VWJD 2X2YA 4LFHD 1C12B 3SE9L 4LEXL 1SY6L 2XTJD 2GT9A 4OCWL 1JCKA 4LVEA 2AAVA 1BZQK 2R1YB 4LBEB 1I3UA 1BQHB 3F7VA 5FYJH 3ES6B 1OCWH 3FO1A 5FFLA 5HHQA 4HFWB 1GGBH 5IMLA 1FNSH 1R24B 2DBLL 3I02B 1KN4H 2HWZH 4OQTL 1LP9F 2E6PA 3X12B 3BZFA 4M1DL 1I9EA 3PABB 4JFHD 2YD7A 5LCVL 1AO7B 1IGCH 3TBVB 2QSCL 3QIUC 2VISB 4I77H 4NOBA 3NTCL 4R26L 3RWEB 2AGJH 1T22B 1GSMA 2FYYB 3P4NA 3Q3GA 5JLZB 1NCTA 1HWHB 4JFEB 1ACYL 2R1WB 3S4SG 2FSEB 1H5BC 4HGMA 2EKJA 4XBEH 4XMKH 2KL6A 5HHMB 3HNVH 3JWDH 5C6WH 1S9YA 1TNMA 3SKMB 5IMKB 1Q0XL 4E0RA 1URLA 4DVRL 1HHJA 4XBGA 4UV4L 3U4BH 3VGFA 3BN9D 1I8LA 2HN7A 3KPPA 1AD0A 2PR4H 3CC5B 5EIQA 4KTDH 4GSDH 4Y88A 5E6ID 3LDBB 4HKZA 5HGAA 2MKWA 4PBXA 1NLDL 1L7IL 1LP9B 5HYIA 1JPGB 5E9DE 4IMLB 1GIGL 1DLFH 1Z2KA 1N6QL 4LGPB 3RZWA 1R0AL 3BJ91 4TTDD 3H3KA 1F4WH 4OUOA 4X5LA 1QKZL 4NKDA 5C0GB 3ARFA 4WFGD 5DK0A 5C07B 4C83B 4CKVX 5E6YA 4NN6B 3RY4A 3EO9L 2OSLB 4KH2A 1P9MA 3GO1H 5D7KE 3UTSB 2G5BA 1HH9A 2OTUA 1KJVA 5DUBB 1O7SA 1I8MB 4M02A 1IL1B 3BW9A 3HC3L 4LU5H 1Z3GL 4EIZC 3NA4A 3QO0B 5F9OL 4ZUUB 1FNLA 1EHLH 4QRRB 1K8IB 5D6CA 5C08B 3ZKXB 4GLRH 1ZVSB 1TZIA 3ARWA 3T1FB 4F7EB 2FEEI 3X3GH 5CJOH 1ETZB 1NCBL 4MS8D 3MV7E 2VOTA 4AMKL 5C0FB 4DW2L 1V3KA 3PP4H 5I6XB 3FT4A 5ADOL 5F9JB 2VQ1B 5M94B 2OK0L 3D3VA 5CUSL 5D7KD 1NMAL 4NWTL 3LKNB 2AABH 3QEHA 4QXUH 1NEZA 2V5MA 3T04D 3WDIA 1S9VB 1TVBA 1CGXA 4LLYA 4X6DF 4G8FA 4JHWH 4ZXBD 5DD3H 1FVDA 4V2BA 1YPZF 2DQEH 5F93C 4JFEE 4GMSH 4YXLL 5CP7B 2CXGA 3UBXB 1R3IL 3IDIB 5E8OA 4UOJA 1Q0YH 1MCJA 4P3WA 3T0XA 4AZ8A 4QCIA 5FO8B 2DQJH 4OZ4B 3S98A 5C9JB 3R0NA 5I1IL 4DEPC 3GB7A 4PGEB 1LDPL 4PTTB 3QI9D 3QPXL 1A0QH 5BVJA 3VXMA 4HIJB 3IDNB 2VQUA 2EC9U 1A4KA 4MXQD 1CU4L 3SCMD 2G60L 3I3DA 4ODXA 3UJIH 4RGMC 2YRZA 4YHIB 4MYWB 3WKML 2VR4A 4JFED 1P4LA 1PKOA 4GAYA 2L4OA 2BNRE 3P30L 4P0DA 1T20B 5FA3A 1CDCA 2G9HB 2OYPA 5HYEA 4J2XA 1FSKB 4POZD 3PJSB 3ARFD 4OLYL 1FSKC 3U82B 3RL2A 3QFJB 3FB8B 3HN3A 1FNFA 2KBGA 3BPCB 3M8OH 3L9RA 4N0YL 4Y4KD 5LXGL 5DRNB 1RJYB 1YN6A 4UI2A 3UYRH 3QNYA 4ODVH 3C08L 4GRWE 2H32A 4AEIH 1M6OB 3IJHB 2VLKA 1IEBA 3SBWC 4HWEL 1X5FA 2HFGH 5HJ3B 3QDGE 4EUPG 4LSRH 4PPTA 1MCRA 4YE4L 4JRYA 4MD0B 1JL8A 4KDVA 4FQXB 4OLWH 3QT2A 1E6JH 1CICD 5F1NA 3ZKXC 1IAMA 1WICA 4N8VG 4YAQA 3CCHA 4FMKA 1C5DA 3MJ8A 4A2MA 2DBLH 2VO5A 4Y5YC 3BW9B 5DR5H 3RGVA 1Q1JH 2AV7B 1LE5A 1F3JB 2DL2A 5LWYH 5FYJL 1ZLVH 1DN0B 1LQSR 3VRJB 4CDGC 5SWZE 2EC9T 2FWOA 3ARXA 5B3JE 1KEGH 4I9WD 3NOIA 4M03A 3JV4A 4PJXF 1MJ7L 2MKLC 5I6XC 1R3LB 1AGBA 1NQBA 5GS2H 3LB6D 4YLQT 3H2WA 3PDOB 4YR6A 5AWNL 3H9SE 5IBTL 3VCLB 2OTWB 3TIDB 4XMPH 4XPFH 2P4AB 4OD1H 1NGWB 5DMKA 2OI9B 3UJJL 2BVOA 4XBGB 2X89A 1WT5A 3IXAB 4QRUB 3OKKB 4KPHH 2JK5A 3CSBA 2QBWA 1C7TA 3W11D 4FXLA 5ACZB 2VXSL 3FO2A 5JR1L 4JHAL 4UIKH 3MV7A 2Y7QA 4GXUN 1HHIA 4OV5A 1CBVH 4EI6B 4HMDA 3MLUH 5JLZA 4X8JB 1MCFA 2X40A 4PREB 1HHGB 2CLZB 4KDTC 4R9HA 4Y1AD 5T1DH 5JQHC 3RZCB 4I3SH 3OX8A 1JHLL 2VXVL 2GTWB 2ZUQB 3OGCB 3MLXH 4K7FB 4AL8H 5T3XE 4PTUB 3ZKMC 3KNBB 4LCWD 4JO3H 9CGTA 4A6YL 3CMOH 5J11C 3CH8A 5FUZH 1TJGL 1NFDB 5ACLA 2C3GA 2VXSH 3FOLB 4F9LC 4LLVB 3IKCB 2BHZA 4Y2DD 4JQIL 3QIWA 5IB3B 5J6HB 3QDGB 3ZL4L 5H37H 3MYJB 3VA6A 1FL5B 1FVEB 2VE6B 4NQDD 3FONB 1JPST 3MGTB 4RAVA 3D2UA 3UTZB 4K94C 4QXGL 5TE7L 4HK3N 4OD1L 4PJBA 1FO0A 3PWJB 1U91B 3PHSA 4BELD 5D4QA 4ZUTB 3ME0A 4Q97A 4X6FB 5E9DA 4LKXB 1CL7H 2ZOKA 2FD6L 3KJ4C 4XWOC 4LCYA 2LV4A 2YD3A 2WIIB 3VFPA 2BHYA 5I30L 5DJAA 4YEEA 3QHFL 1WEJL 5CBAB 4HUVB 4PD4J 4ZUSB 3GI8L 2V7HA 4M62H 3RQ3A 5DQ9A 3C6LD 3T0VA 3L3DA 2PYED 1UM5L 2X89D 3AU1A 1JYXA 1BMGA 1DANT 1TPXC 5CGMA 1AI1H 1YYLH 4PJ9D 3BWAB 4WWKD 5C71A 3NCMA 5IFHL 2EDOA 2WM0A 3KPRE 3MNWA 2LTQB 2HWZL 4OQTH 1XGQA 2J12B 2EH7L 4F9LA 3JZ7A 1YNTA 4LKCB 1IGYB 4AM0B 2PYFB 2I26N 5HGBB 5LGJA 2OR8A 3PWLA 3DMMA 4OLUL 1RAMA 2EE6A 3UPRB 3QIBA 4NZTH 1NUDA 4RFNC 4W6YB 3QDMB 1IC5H 1R5IB 2FEEL 3ZDZE 3ZKNC 1UKSA 1LK3L 5IVZB 5TQ2H 1W0VB 4RA3A 2C7UA 2IC2A 1EXUB 1VEMA 4FS0A 3RKPA 1FQ9C 4N0RA 4EOWL 1T66D 1CFVL 5D2NC 4YDKL 5E6IA 4R90H 3PV6B 3OG6B 5BZDA 5GQBA 2GIYA 3E0GA 1YEFH 5KOMC 1F4YH 4OGXH 1J05A 3PL6D 1NEZG 4YXHH 4NO0D 1PSKH 4PRBA 3NIFE 3T65A 2VWEE 4ISVA 5EU4A 2DQFB 4FQIH 2VYRE 5CZVH 4KKBC 4L4VE 3MRLA 5J3HC 3UPCA 1TTUA 1CCZA 2VDRH 3EZ8A 4Z7VE 1G0XA 1YN7A 4XCNB 5IMOA 3PWPB 4ZODA 2NY0B 3IETB 2IMNA 2NCMA 2D2OA 3DWTA 3FQXB 3HR5A 2E5EA 2VNCA 2JELH 2NY3D 1OARL 5JIHA 3FN0L 2WP3T 4DZBA 4Q9BA 3WIHH 5EZIL 1FFOB 3SGEH 3O3AB 5DUML 4NRYA 12E8L 1C5BL 2AEIT 4MDIA 1GYAA 1YMME 1G7HA 2OR9H 2AV1B 3FMGL 5E7FA 1N0XL 2Y25A 1BFTA 1XCQB 3JSSA 2WWMD 3QQ3A 3A6OA 3S96B 2PCPA 4DJMA 3AB0C 4WW1A 2H8PA 1CD1A 4RBPK 4R4BA 3EYVB 3GBNH 2KKQA 5TDOB 1BOGB 4P57B 4WNQB 4NM8L 1F4YL 3OB8A 4OGXL 2C1PA 3ZDYE 2EC8A 1F42A 3NCCB 3HE6D 1RUPL 1DQTA 2OCFD 4TNWK 5BQ7A 3HFML 5EBWA 5C0AB 4N0UB 5D7JB 3SO3C 4JJHA 5ESAB 3ISWA 5FDYA 4I18C 4GRMB 4LLQB 1WWBX 1C5CL 1EDQA 1MLCB 4MNGA 2MWCA 3DX8A 3DMMD 1RHHA 1T3FB 3KYNA 5I2IB 1GHFH 3QIBD 4E5XB 4WDIB 5BS0B 5HD8C 1S8DA 2GTZA 1VFMA 4YDVB 4POUB 3FCTA 5JZ7D 3OV6A 2C3XA 1FYTB 3MRHA 4XAWL 4O4YH 1A6AB 2HKHL 2YKLL 5DQDL 5C09B 3WJJC 4RDQG 3RBSA 2BP3A 1ORQB 4OZIB 1HINH 3BMWA 1E4KC 1D5MA 1MCCA 4M4PA 3SCMA 2R23A 3TA3C 4C4KO 2HKFL 2DDQL 4BQ8A 2XPGB 3D39D 4UUJA 3QO1A 1J8HB 3LB6C 1OT1A 2A6DA 4JFOA 5IESH 2ATPB 3HPLA 4PS4H 5CFHA 2K3TA 1BVLA 3S37H 1ZTXL 4PJAA 5C0IA 5I15H 4HLZH 1SYVB 4NKOB 3VFTB 1MRCL 3Q0HA 4YXLH 4EDXB 4Y4KA 5KAQF 1QVOA 1K5NA 3ZKMD 4XP4H 5IVXF 1I1AA 3MA7A 4DCQB 4WTWA 2ADIA 4J4PC 4XP6L 4OLZL 4FQHB 3JWNC 2VC2H 4PJDB 4JFFB 3O4LE 1C5CH 4JRYD 1HIML 3OZ9H 4EI5A 3ABZA 3ARSA 4ZO8A 4PV9B 4GG6E 2BNQB 3MLWH 5KSBE 4FQQA 2H8PB 1XIWA 1OTSC 4L4TB 4JN1H 4OF6A 1PD6A 4GAFB 1IQWH 1RUMH 2GJ6D 1JNNH 5F9AC 1LD9B 2BNQD 3LSOB 4X6EA 2D31A 3EJZD 1G7HB 4WFHD 3IAPA 2RCSL 3LKRB 1DSFL 4XAKE 1KCLA 2FJHB 4J8RB 3HE6A 2YR3A 2Y07H 4Y1AE 3VFUA 2NX5B 2PCPB 1V3LA 2FECI 2X09A 2PKDA 2EIZB 3DYOA 3EIFA 1F4XL 1UCTA 5JXAH 3A6BH 3RWHB 4OLEA 5JHDA 5TPWL 1HQRA 1U3HD 3QEGL 4LOUC 4OIIH 3MRCB 3VW3L 4JGMA 4KTYA 3KYMA 2X4NA 4ZS7H 3SGDI 4P4KB 3RAJH 2ESVB 2ICEB 3IJSA 4JE4B 4HUNB 1E4KA 4NKIL 2DLHA 3QQ9C 5IW6B 3U0TB 2P5WB 3PWPA 1OAUH 2BNRD 1SM3H 5AG9A 4BUHA 4NN7C 1FL3A 1HKLH 2OTPA 3MV7D 1JJUA 2ZUUA 3AS1A 1R3KB 1WISA 5A2LH 4CJ0A 4PJ5D 1IARB 1AQDB 2CO7B 3BEWB 5C3LD 4OFVA 4Y4HD 5AYQA 1YEJH 1I7UA 4G6KL 1IILE 4P3DB 1I1FB 3WHXA 5FO9B 4LCWA 3TH3T 4MAUL 1N5AB 1QA9B 2PYEE 4X7SL 1MH5A 2OS7A 4YHOL 3QUML 5E4IA 5FM8A 2MNUA 2NTSP 2LU7A 3SE4A 3VGGA 1F90H 1TZHA 4P23C 1G7IB 3K74B 1XIWC 1FORH 2HG5B 3P40A 1M71B 4XP9L 4WV1B 4Y2DA 4WO4C 3EOBB 3TBSB 4XNMA 4OM1H 3ROOB 1J10A 1MCDA 4NQDA 1EBPA 3D2UD 3OAUL 1ADQL 4KC3B 2GJ6A 1KLGA 1H3XA 5JIPA 5F7DB 3AREC 2E9BA 3QG7L 4BQ9A 3BP7A 5F6IC 3C5JA 4LMQE 2V9QA 3QPQC 4ONHB 1OAYH 5D7LA 3P3YA 5E9DD 1E0OB 1QFUL 1U8JA 2R15A 2XN9E 3WCYA 2R1XA 1QBBA 3HNTL 4XNYH 2HTLD 2UUDK 1RZGA 4O2CB 1FIGH 1NSNL 4LAQH 1WTGT 4JRXA 6FABL 5CIPH 3SE4C 1YUHA 3UJTH 4G43B 3GSNB 4MHHG 4UAOB 4OZIE 2APVA 3RZCC 1PLGL 1M7DA 2X1XR 3TO2B 4LPWA 4TUOB 4Y16D 4ELMA 4CVXB 5J3HD 1EFQA 5ENWA 3QIWB 4AH2A 1UQSB 3P9LA 5B22A 5F7WC 4ODVL 4LIQE 4KY1L 4PY8I 4JPWL 3O0RH 1TQBC 2P24B 4U1NB 1BQHG 4NPYA 4FMFA 4DGVL 2O61B 3TNNB 4K55A 4PJ5A 2Y36H 3EJYD 3SKUD 3QXVA 2F19H 3C5ZC 4WI3A 1RJCA 1AC6A 2OR7A 1QO3B 4HDIA 3MRNA 4N0CD 5ICZB 3MR9B 5IROC 3EHBD 5TQ0H 4NQSA 4DN4H 2WWKT 4BYHA 5L6YH 2I5YH 5A40E 3SO5A 2X4TA 3WFEL 3RHWK 5FV2A 1KCVH 1E27B 3VRIA 1AXTL 3F58L 2E7MA 4U1NA 2W0PA 3PWUA 1KYOK 4UDTB 4IMKA 1CD0A 1EEYA 1MVFA 1X5AA 2A6KA 5GISH 3O0RL 4PREA 2HVKA 1KB5B 4XP4L 4Y5YB 3V6ZB 2NXYB 3RX8A 4CVXA 1EHLL 3C6LB 3S36X 5D93C 1UQSA 5L2KB 1UM6H 5FYJD 3TO4B 3P9MB 3OKEA 1PY4A 4X6CE 2DM7A 1QNZL 4ZTPH 3DECA 4KXZI 4ZYKB 4Z7UF 2VR9A 4EI5C 3BH9B 2NY3C 4JANB 3FT2A 1U3HB 3DYMA 3SKNB 5K9OA 3RTQB 3LH2L 4Z7NE 4XH2B 2V5SA 2P43B 2Q7NA 2BOBB 4Y4FA 4HEME 3J8F7 1T1YB 2YPLD 1RURH 2LU3A 5DMGC 4OSUL 2W0LA 4XPGL 3ARYA 4Y16A 4X99B 2ZUVA 4JO2H 4X9IA 3KPLA 3K4AA 5LGHL 3DVNA 5ALBL 3PHOA 4HGWB 3JV6B 1TQCB 5ERWA 1Q72H 2P8LA 3VFGH 3EZJB 5FM5O 3RIAF 3HB3D 4ONGH 2EIBA 1MFDL 1A2YB 5IVXB 3VDBA 1H0DB 3K4ZA 4TVPE 1U92B 3BWUC 3B43A 4KI5F 1T7WA 5D70L 5FGRA 3S3JA 1QA9A 3CFBA 1JRHH 4LCWB 4X7SH 4HH9B 4BZ2L 5DJDB 1XGPA 3DROA 3EUUA 1MCEA 1EUTA 3L3KA 1K8DB 1F6LL 1A9BA 3VJ6A 4ELME 5FCUH 5JW4R 5C1MB 5IT2H 4MX7A 1FZKA 2APTA 3QIWC 3Q1SH 4I77L 5I76B 4D9LH 2ZOLB 4X7CC 5BV7C 1IGIL 4KROB 4MQ7B 3TT1L 4R97B 1A7OL 2NY6D 3BHBB 8FABA 1JIBA 1CU4H 1R3KA 5JOPE 4M1DH 5EDXA 2CK0L 1N5YL 1FVCB 3BGAA 4PGJA 1CVRA 1JF1A 4BFIA 2CKBA 2VZTA 3QZWB 1S7VA 4F7MA 4NN5B 1A4KB 2FATH 3EO0A 1BVKB 3ARDC 2R56H 1YEIL 2DI8A 1WCBB 5DJ6B 4RNRA 4NO5A 1J1OH 3D85D 3I3EA 4PJ7B 3A6CH 3S35L 2EDRA 4M7LL 2J8UF 3MGAA 1L0XA 3NZ8A 3PQYE 4ZDHB 1FZJB 2QJDA 4OI7A 3HKFA 5ANME 4HS6A 4LSSL 1EJ6A 1DJSA 5ITBH 2FJHA 2VLLB 2AEPL 3W9EA 2OP4H 3BAEH 5F3HA 1ETZA 5IW1B 4YIQA 3UZEA 1MJ8H 1EMTH 1B6DA 5GGQH 5D71H 5E95B 5KVFH 5DHVH 2B0SL 5DJ8A 3HE6B 4NZUL 1RZ8B 2VDNL 4C57C 4C56D 3IF1B 4PGCB 1R5VA 4XTRD 2AKRB 1CICB 3E6HA 4OD3L 1PSKL 2XI9A 4ONOA 2HT4D 3X3FH 2HA1A 4JPVH 4JDTH 1HDMA 5CINL 2CUMA 2L7UA 4OD2B 5DFVD 1CXLA 1CFSA 1KIQB 4XPFL 2IAND 4GXVH 1I8MA 4RCAA 3BKYH 4Y5VB 3PUCA 4UQ3B 5GJSH 1AD9A 3Q5OA 2OQJA 4XI5C 3O81A 4N8VB 1TITA 4XCYB 3X13B 4LSSH 4CMMB 5C0IB 4PJDA 5FA4B 2ZCLH 4UILL 4Y5XC 5DTFA 5GRXG 1KT2B 4LSQH 1HH9B 4FFZL 4XMLL 4MD5A 3MOQA 4N9OB 3VXNA 1UB5A 4KHTH 3A0OA 1J1OL 3K2UL 4BH7B 2QR0A 5MENA 1RULH 1CTNA 4QXTA 4FQPA 4I0KA 4XPAL 1FO0L 1X5XA 3FN3A 3BD5A 1QFWI 1IM3B 3HCVB 4L3CB 1L6XA 1KPRA 2VLJB 4WO4D 2VLJE 4NC0B 1V05A 4RZCB 4UBDC 4X6DA 5BXFB 3QI9B 5CCKL 4Z95H 2F8OA 4LIQH 1LEIB 1JPGA 4K3GA 1MWAA 4PB9H 4RGND 4WW2C 5GRUL 4UIMB 3IXTA 3NGBB 5KSVB 3FQNB 5JPMA 4ZO6A 1A1OB 5EUKB 1T7YA 4KV5E 3LY6A 5CSZA 5CILL 1H8NA 2V9RA 1C16B 3O8XB 1AJ7L 4PJEB 4JQIH 4L3AA 5JUEH 5EOCH 4NQVB 2D9QB 4AEEA 2AK4B 1NCCH 4FG6C 4NRXA 3MODH 4DOHE 4DKFL 1KIPB 4HWNA 5JW3H 2YWYA 4YO0A 5CJBA 3PHQB 4K3JL 5E0QA 4ZPVA 1TZGL 4YX2L 5HHOB 4BZ1H 1VFUA 5SWZA 5E5UB 3TT3H 1XGUA 2BERA 1W2KT 3X3FL 3G04B 4DKAA 1JI1A 2VISA 4HXAH 4O58H 1CXFA 4ODTH 3K1DA 1LE9A 1KPUA 4MB3A 4IBLT 4OZHE 2MOVA 3LEXB 3VFNA 2BJML 1CD1B 5HVFB 4WUKH 4XPGH 4IDJH 5I0ZA 1VHPA 4MD4A 2M8XA 2IANA 4UT9H 4UTBH 1M1SA 3ARBC 3BEVA 4K8RD 5CEZH 2FX7L 3O3EA 3UTSD 1HSAA 4WHTB 4X6DE 2Z8RA 4FFVC 2E27L 1A14L 4LSQL 1FBIH 3PGDA 3GSVA 3KWWA 3M07A 4HUXA 3VWKB 4ODSL 2IGFH 4LHQB 3TZVA 4MA8L 2CXKA 4ZFOL 3NH7L 5J12C 1ZLSL 4NCDA 2DKSA 4KMLB 4KK8C 4PP2A 4XC3H 3UZVB 2VTFA 3QNZA 4OB5H 4OM0H 2VDML 1T6WA 1DP0A 4MB5A 4QRRE 2HJLA 5HHME 1Z5LB 1FPTL 1HOCA 4FZ8L 4NO3B 2Q3ZA 4R8WL 3DRTA 4MVBC 5CGYC 2E8ZA 4QHKJ 2H2PD 3MRKA 3O6FA 1MELA 1QRND 1IGIH 1ACZA 1O5DT 2ADJA 4D9LL 3MCKA 5IHBA 3QDJE 4P2YA 2XWTA 3CUPB 5ADOH 1K2DB 4XMPL 1RU9H 4R7NA 5FCUL 2XZQL 2VZ1A 4MA8H 2APXA 4HF5L 4M43L 3TGXA 3N1FC 5ITBL 4NT6B 5C0BA 4ZAKB 4LHUA 4GBXA 3V7AE 5L6YL 5SWQA 3L6FB 1RZKC 2WBWB 5JQ6L 1WBXA 5D1XC 1CZ8L 4P99A 4JPIA 2OXHA 1CLOL 4KVCL 2R69L 3MGOB 1G7MA 4U6YB 3S35H 1MLBA 5CJXC 1XFPA 3GMMA 1AGDA 4R7DB 4TUJB 4Y1AB 4H0HB 2I9TA 1GH7A 1AFVL 1YEIH 1AO7D 3K8MA 4HWBH 4LLUB 4EUPA 2JIXA 4K23L 1Q94A 4TUKH 4C58B 2KQMA 2V7HB 5JIKA 3AS0A 3VD5A 3VI3E 1OGAA 1BJ8A 4Z77A 4YHML 2RB8A 2AERT 2A73A 2FX8L 4MCZA 2BOCA 1MF2H 1ZE3C 2DLIA 4JO4H 1K9TA 4ALAH 4G8IA 3JWOH 4LVNB 3RWJA 5FYKL 1BLNB 3FO9B 5EB9A 1UGNA 1DBJH 2GSIA 3N85H 3O41A 2YZ8A 3OAYK 3V4VL 2QADD 3DO7A 4UTAH 4Y4FD 5CSGA 5HYJB 2EXWC 2AJVH 4HX1B 3TZVD 4NKQB 5EFIA 2YRLA 3N1MC 1H15A 4H20L 2AW2A 2VDLH 3RU8H 3AY4A 5E2TH 4PP2B 4Q6IB 4TQEL 1CLOH 5IB3A 5GGVH 2DYPB 5C0DB 3VXUB 4PJ8D 4K71B 5JQ6H 5DMJB 1IBGL 2V17L 3P73A 3IU4H 3QFDA 4L5FL 2UWEF 3BQUA 1UXWA 5L88L 5GZOC 3S4SB 3O6FC 1KLUA 1VPOH 3FONA 1UA6H 1NMCC 1U8IB 1KENL 2HFEA 3FQRB 4AEFA 1XCTA 1T2JA 4XPAH 3O4LA 5C86A 1G7LB 2YA2A 4YK4C 1A6TA 4Y7MA 3QI9C 4FRWA 2ZJSL 3VFNB 5KS9F 1YJDL 5SWZB 4IHOA 4PRDA 5KSAD 1AIFB 5FYLL 3BRDA 2AK1H 4I3GA 3VDCA 4NT6A 2NY4C 2XICA 1DTUA 5IWLA 3G04A 4KKCD 1QBLH 1DQLL 1QEWA 5AYUL 5CEXB 1D7FA 1K4DB 5D72H 3MFGB 1HHIB 3MLVH 4LU5L 4W4OA 3P77B 2XOTA 4POZC 4DVBA 1HI6B 4ZTOL 4ZXBA 2L7JA 3RVWD 1CFNB 3BDBA 3FO2B 2KH2B 4XGZB 4OGYL 4YO0B 5GGSY 1RZKL 2R0WL 5JA9A 4WCYH 3ZHLA 2N1KA 5C7XL 3QNXB 1D5IL 3G08B 3WS3A 3TN0D 1KJ2B 1QFHA 1BF8A 3I75A 2Q76B 2R4RH 3FL7A 3VXUD 1DQJB 5E6IC 3VXMD 3QXAB 1OGAD 1C08B 5KSVA 3IFOA 2EYSB 3LEYL 4P2CG 5IM7B 4F58L 3GMRA 2Z93B 3K46A 1KACB 3IDYC 5J11B 1PEWA 4M7KL 3G6DL 3SE8L 2QQKH 3MOBH 3TZVB 5F89A 3CXHK 4HUXB 2AEQL 1OB1B 5HSFA 5C92A 5EIIB 3QEGH 3NCFB 1IAIM 4F8QA 1G7PB 2ITDB 5FKPB 2FWOB 2VL4A 3U2SA 3BEVB 5JOEA 1BBJB 3WFEH 3NN8A 4Y4KC 2FNBA 5DVLA 4DN4L 1TJIL 3RIAK 4RDQF 4ZFOB 5AAWA 4N8VA 4Q74A 5ITFA 3BP6A 3VXPB 1YA5A 2HT4C 2FB4H 3C2AH 4C56A 5C8JB 2VLKD 3MUGA 15C8H 4IDJL 4PJAE 4WI9A 4PJ8A 3HNVL 3JWDL 5EULV 3MBEC 2ID5A 4EQ2A 2ARJB 4I2XA 1OSZA 2HMIC 4NC1C 4OZFA 4ZOCA 3QG6A 4JQVA 1CICA 2Z92A 2C5DC 4HBCH 1PEZA 2P8MB 1VFAB 3GMRB 4FQLH 2A1WH 3ULUC 4QRSA 1INEH 4FQXA 2F5BL 3PF2A 4S0TD 2CIIB 2DLFL 3ULVD 1A6ZB 5IHUH 1T2QL 3TIEA 3VXSB 5GS3A 4YPGA 2B8OT 3GKZA 1AQKH 3GHEH 3F8UB 5T5FL 1S3KH 1RIHL 3HZKB 3CZFA 1G9EA 3G5VA 1MVUA 4JPKH 5F9WB 1FFQA 1IGTA 4M93B 3TVMD 3MCLH 4OKVA 5BVPL 5BJTA 4UIMA 3L7EB 4G8GE 5IKCA 3MOAH 1GOGA 2FH6A 5KZCB 4IRSD 4NHUB 4QYOA 3WIHA 2BMKA 5E5MB 2X1PA 5CD5C 1XGTA 4H8WC 4HIJA 4TULH 4XHQA 1F00I 4PJCE 4JQVC 4QHMA 4QXGH 1U6AH 1UZ6F 3T77B 2AK4D 4ODXB 1IKNA 2CR6A 3OG4B 4Z0BL 5CCKH 4Q9CA 4JFDB 4HS3B 3TN0A 2DI7A 1NKOA 3OAUH 3WJJA 1F3DH 3OKMA 1KJMA 4L9LB 1KGCD 2ZSWA 3HAEH 3LV3A 5EWIH 3VMNA 3Q6GH 2CDEB 1XCTB 2J88L 3CVHB 3WUZA 2WINB 4JHAH 3RDTA 3K2UH 1FZKB 2RGSA 4LLYB 4XPTH 3GJFK 2BRQA 3HZMB 1UXWB 3WIFA 25C8H 2VDOH 1T6VN 5CP7A 2KZWA 3E1F1 1CDUA 2EH8H 4O9HL 5HHMD 1LK2A 1QFWM 3AAZB 5CJQL 1INQA 4G6FD 3S97C 3STZA 4BK4A 4JJ5B 1MVUB 3I2CL 2P1YA 4ZD3L 5EOQL 1KTLA 3L3HA 3NZHH 1T1WA 1H0DA 4RWHA 5E24E 2FIKB 2IWGA 4P4RA 4UDUA 1BVZA 1B3JA 3ARTA 1X5JA 4RSVA 4F15B 3PQYB 2R8SL 2UZIH 3INUL 2LVCA 2VLLA 3HAEA 2G5BB 1W8OA 3UTSA 1OGAB 4PJ9C 1JGDB 3V5HA 5F21B 1E4WH 2ITCB 1F13A 1RUKL 1OAXL 2JELL 3ULUL 3WIIL 5C0CE 2IG2H 2XTJB 2CDEA 4W70A 1KB5L 2IBGA 3PWNA 1HYSC 4FTVA 5I1AA 3MRRB 1UG9A 2ZUQC 4OFDA 5EO9B 4Q9QL 4LEOB 3VFWA 1CLZH 1MCHA 3H7BB 4TQEH 2VH5L 1PG7H 3CLFL 4R2GB 1MHPH 1ZHNB 3UCRA 2Y07L 1FVCA 2AI0L 3RTQA 3T3MF 3VG0H 2FATL 4ZAKA 5EIIA 3MXVL 1OY3B 1AD0B 5F8QC 2ZOLA 3C6LA 2PYEA 1JYVA 2FX9H 4IRZH 4QYOB 3V7MA 2D4FA 3OKOB 5BMFL 1EO7A 3U4BL 1DQJA 3TH4T 4P2QD 4W4OC 4HJJH 2J1KA 4I13B 5C0BD 4ERSH 4MXWH 3PNWB 3LD8C 2EDYA 3NPSC 1QEWB 3OAZH 1XF2A 3P4NB 3Q3GB 4PJXA 4LLWB 3BFOA 4OTXL 1JMZA 1DVFC 5D1ZA 1GZQA 4LL9A 5D2LF 3PWPE 3VFSB 2EDXA 2W38A 4GRWB 5C3TA 1Z0MA 3BZFB 1FGVL 4KMTL 5BRZB 5HBBA 5ERWB 4PGBA 4LP5A 4IRZL 3QXTA 3QR2A 3D0VB 1G9NH 4ONGL 4C56B 5FOJA 5HPMB 2GJZB 3VFGL 1A7NH 1T5XB 3KGRA 4N0FB 3CFDA 4KGLA 1M05B 1U3HC 3GUTB 1QACA 1NGYB 3RJDA 3QXWA 1Z9SA 4MQTB 4Y4FC 3LPWA 5FKPA 1ZGLB 2VUYA 3BH9A 4WW2F 1YEHL 2IPTH 4HQQH 5L2JA 2VAJA 1MY5A 4HWZB 1XGUB 2LAAA 4HZAA 5IV2B 4NNXB 1S7QB 4NM4H 4P23B 4XVUD 4WHCA 4WY7H 4JCLA 3VGHA 2O26U 4LF3B 1KTRL 2PXYC 4ZO7A 35C8L 1L0QA 2MHAB 2YPLB 4KJYA 5L7XH 1Z9MA 3EOAA 3H9SB 4CADA 2X6MA 2F54B 4XC1L 1Y6MR 3ZT5A 1FG9C 1ZT4A 1JNLH 1KEMH 2ZNXA 1IM9A 3U46B 2ILLA 5T3XL 1ZLWH 1K4CB 1VGKB 3LKPA 1A1OA 2K1MA 3HLAA 1Q94B 5EUKA 4DVBB 4WIQA 2F19L 2FZ3A 1DBML 3T0ED 1WTLA 1CGSH 3LKSB 2OBGA 2H2SD 4HIHA 3TZVC 5F7UA 5I71B 4PJBF 1KLGB 1T1ZB 1C5BH 1HSBB 2EH8L 1EVUA 5I1KH 1A7NL 1MCWW 1HZHH 4L1DA 4F33A 3L6FA 1NPUA 1TVHA 4HHAA 4PGDA 1Y6KR 1N5AA 3AFLA 5HI3D 3SGEI 3T3PE 3HNSL 5EPMB 4U7SA 3MGOA 5GSRB 2J88H 3KPOB 1VDGA 4HKJB 1DEDA 4XZUA 4D9RE 2OJEB 4U6XA 1KT2A 3R1GL 1MPAL 3TWCH 4OCRL 1OP5H 1NGXB 2I9LB 3P9LB 5T3ZE 3VXUA 4FFYL 1YNKH 4LASH 2KPNA 4DK3A 1SEQH 4NN7B 1ZA3B 2NXZB 2AP2A 4K71C 5IGXH 5AD0B 4PLOB 1QLRA 3BXNA 1H15B 4Y5VA 1QFOA 1NDGA 4YHNB 5DD1L 1J0JA 1TTFA 3MV9E 3MV9B 2COQA 2X4QA 3ZTNH 5C6TL 4DVRH 1MFAL 4LARL 4HKXB 3BE1L 3QJHB 3L3JA 3WEXB 3BZ4B 4UOW1 3V8CA 1MJ7H 4S1QL 4F80A 4KRNA 3GSVB 4Y4HC 3K2MC 4U7KA 5GGUB 2ICEA 3IJSB 3E6FB 3FTGB 5KSUB 5F3HB 1U8MA 4QHUB 5F7DA 3HNSH 3OJDA 1IAKA 1IJ9A 1QFUH 3TESA 2C3VB 4KQ3L 1I8IB 1A6WL 3VDAA 3G5YA 2QSCH 5EC2B 4Z95L 2E8YA 2DWEB 1SYSB 1OAXH 3ULUH 3U7AA 2AEQH 1ZT1B 1XIWD 3EYOA 5D2LE 1U36A 4HAGA 1K3IA 3BT2L 4KQ4H 1EAJA 3BKYL 4LCUB 4K3DL 3MRMB 2BNQA 1NC2B 4N8PA 1XF3B 1S78D 3RNKA 4NQDE 1LD9A 4I3RL 5FO9A 3G6JE 4PY8J 5E4EC 3D3VD 3AY4C 3KVQA 1Y0LA 2CLVB 3RRQA 3G6AA 3DURB 2CDFA 4AY0A 4IRSA 4LLDB 4H26A 4EZMA 2Z8VC 5JHDD 2HTLC 2NLJA 2XKUA 5BJTB 2E7LC 1BJ1H 2NW2A 4K7PL 5GGRB 4UQ2B 4OIIL 5DDHA 4WRLA 2NY4B 4OZHB 5JHLH 3CFCH 1YEDA 5DD5H 4JRWA 4HC1A 2AXFB 4JFQB 5K93A 1SEQL 3U0PA 3QI9A 4CNIB 4KTEH 3HTLX 1SYVA 1CXIA 2FBOJ 4PJAB 1P4IH 5JDJA 2BSRA 2H45A 4JVPA 3N06B 2NPLX 1U92A 3PV7A 3MRCA 3BQUC 3EDEA 2NZIA 4N90D 3QG6B 4JR9H 5C0RL 1BECA 5J1SC 3VW3H 4P5TC 4HIEB 2ICWA 1UJ3B 5E2WH 3O2VL 3QRGL 1TJHH 4RFOL 4QTIH 2OK0H 3VA2C 4ZFOA 1QHPA 2J8OA 5AZ2L 1VSCA 3ALXA 1AGCB 1QTYT 4UQ3A 1BHGA 1RQ5A 2B5IB 2F8VA 2D31B 2AJ3B 3BRGC 3FCTB 3NPZB 3U2SB 4XI5D 1CR9H 4NSKA 3IRPX 4KTEL 5SWSB 4JANA 4AT6A 1ZT7B 3S6CA 1A7PL 1KN2H 1OAKH 1AD9B 4ZPVB 4X5WB 3U6RB 3DXAD 3O9WB 5HYQA 2IAMB 1NGQH 2J6EA 4K7PH 4XNXL 1OM3H 1A4JA 3MRQB 1CYGA 3HMWH 4MJ5A 1AY1H 4WEUD 3T08A 5JORB 4HWEH 3FHAA 5D8JH 4W4NA 1AGCA 4KAQL 1JN6A 1CFQB 5D7LD 1K5NB 1NCWL 4MDIB 2HKFH 1BOGA 3OR7B 1FFPA 3WL9A 5IF0B 1FCCA 4NM4L 4XVSH 2AXHA 3DETC 3T0BA 4Z7QE 4ODHL 5F7EL 3WFBH 1JNJA 4XGZA 2VSCA 4Y4HB 3W0WB 3PWUB 5IW1A 1WC7B 3W9EB 4JFOB 1U8QB 3S8WA 4Q9QH 5GHWH 4O4YL 3T4YA 4HS6B 4RIRB 4WI5A 2HFFA 4LSTL 3I6GB 5HDOA 1U8MB 3BPLC 3JWOC 5JMOC 4R96A 5GGSA 4HF5H 3F5WA 2VLME 3DRQB 4B50A 4HXBH 2VABA 2DMCA 3VU2A 5CHNB 1AY1L 2YBRB 1GJIA 4KGJA 4GRLC 2F74A 4M1GH 4YC2C 3WEXA 4JM2F 4ZPTA 2J7LA 4F7MB 4GXVL 1F6AB 4LHUG 5I17B 1YC8A 3V0AC 2X1OA 4AEIL 1W0YT 4NJAH 3S36L 4K8RH 3SO3B 4FFWC 3NCJL 3KHOA 3GKWL 3QCTH 4RFNB 5E4EB 3VI4E 3V5KB 4LARH 1QP1A 3DBXA 2NY2D 3TEUA 3DGGA 3CVHH 1NMBH 3MUHL 3VJ6B 4H0GA 2Q8BL 1LEGA 3K80A 4JFYB 3F6IA 1XF3A 4HV8B 4G80B 2VXTL 4BSWB 2C3HA 4L3EA 2XXCB 5GSRA 5MEQA 1XCQA 2R2HB 3VG9B 4X9BA 3PWLB 5E8EA 3NFNA 3VMOA 4U49A 1NCUA 4NRZB 3WFDH 1CQYA 1E6OL 2R1XB 3QIWD 4UT9L 3DXAA 2A73B 2B2XH 3UBXG 1LDPH 1YNTB 1P7QD 4Z77B 5D7JD 4N5UA 5DRWA 4GKNA 3FMGH 5BZWB 4DGVH 4M5YH 1YECL 3QH3B 3MROB 1SY6H 1SBSL 4OQTA 4UU9A 5HHOE 1UA6L 2K7PA 3HLAB 3VWKC 5L88H 3GSOB 2E27H 1CN4A 3WN5B 1YN7B 2YA0A 4F57L 4PJCB 3OAZK 3LKQB 4LCYB 1KTKE 1LWRA 1A7RL 1T1YA 5GS0L 2VXTH 3RDTC 3U46A 4QXUL 3QJHA 1I7ZB 1RJZA 1JHKL 4XVTL 2DQFA 3ARPA 1PJ9A 2WIMA 1G84A 1VENA 2CD0A 2DQCH 4B5EA 4CMHC 2GITB 3INUH 1MH5B 3EOAB 4CADB 2NXZC 4CAGA 2YPLA 4KJYB 3GMQB 3F12A 1J05B 4O02L 5IHLB 4PJAF 4HXAL 4FQ1H 2V2XB 2XWTB 4U6HA 1JWSA 5IWLC 4HD9A 1FYTE 4PJ9A 4GS7B 4WWKA 2FHBA 1A3RH 3FFDB 3TV3L 3M45A 5KVGH 2C26A 2R4SH 3C8HA 3UTQA 1U8LB 1UACH 4ZXBC 5IJKC 1F6AA 4U1SB 2X4SA 3AXLA 1MFBH 4WFFD 3LRSB 5I9QB 4PLJC 4MQXC 3DMMB 1QD0A 1WK0A 2BXZA 2EDKA 4LLVA 4NO0B 2YBRA 4IJ3B 5DJYA 4EKXA 2X4TB 4QF1B 4XBEL 4ENED 2GHWB 3SDYH 2CMRL 4LKCA 4H88H 3FRPA 4G3YL 3V4PH 4PS4L 5IB4B 4O51A 2GK0B 3QUYD 4YBLC 1T0MA 3RI5K 2P45B 4OF8A 3BD3A 3FAXA 4Z0XB 1NBYA 1NJ9A 5FHAL 3LQZA 5SV4A 5JW5A 2C3WA 4HJ0D 3V79C 2DQUL 1QPPA 3VFRB 4XVJL 4NO0A 4WEBH 2B1AL 2KZ1B 3PGFH 2FHCA 5JXEC 4LSRL 4OV5B 4XNZB 4Q0XH 1CFQA 5K9OB 3U0WH 4BM7A 2F54A 3WMSA 2ESVD 5GRZA 4AH2B 3GBML 3W82A 4OBRA 4MAUH 4P46B 4MA3B 3TWCL 2EDLA 3WJLC 5A3ID 1JV5A 1FP5A 2BC4A 5JHDE 3L5XH 1AGBB 5F7FA 5EU3B 2CGRL 5IEKA 2VL5B 5FGCB 4QWWC 5TE6L 2X4PA 1JGEA 5SWSA 1NCDH 3GJFH 3RAJL 2NQCA 1ZGLA 4M8QA 4KUZL 5FV1L 4QOKE 1IC7H 4X5XA 4PRHE 4ONFL 5GRYA 3DV4A 3LKQA 4DUXA 3QP3A 4WWKC 4YFLI 3RWGA 4EDXA 1O7VA 1T89A 4TPRH 4FFYH 4LASL 5B39B 5JPMB 4XTRC 2ZUWA 1REIA 4XB8A 3HHRB 3IXTB 1NFDA 1U3ZA 4L4VB 4DTGL 2VDKL 3WNOA 5EUOE 2DQJL 3C5JB 1CLYL 2Z4QA 1K6QH 3MUY1 1CBVL 3RVWC 5INCA 3FRPG 2XA3A 2Y4SA 2O5YL 4OLVH 2OP4L 3BAEL 1RMFL 5FB8B 3DGCR 1G9MC 3VXRA 2CK0H 3OKYA 1OARH 1J1PL 1VA9A 4PV8B 4LNRA 2XG5A 4QHKI 1CIDA 3C09B 1CLCA 3O2WL 5AZEL 1G7IA 2NXYC 3TNNA 5JXAL 4A6YB 4LPXA 4BH7A 3FB8A 2AXFA 1UB5B 5T1DL 4M9PA 1TTGA 3MOBL 3MRHB 4UB0L 3QNYB 4HUKB 5FA4A 3QUYA 4HUUB 3W11C 5BS0A 5JO5B 5DHYB 4O2EA 1WWCA 5JR1H 3S36H 3QFJA 3QXUA 4X6BA 1EEQA 3FB6B 3ZE1F 1CT8B 2ERJB 4Y2DC 3VXQB 2CKBL 4HULB 4ZD3H 3AC0A 1L9NA 4YPJA 1KEML 3LPFA 4L29A 2HRPL 4X4ME 2NY6C 5FKAA 43C9A 4CDHA 2ED7A 2J5LB 3D39A 1P9MC 2MJWA 3B8YA 4DAGL 4U3HA 1RJZB 2IQ9H 2UYLA 2ESVA 3VWJC 4JGUA 4JZOA 4PJCA 5I9QC 1RZ8A 2IADB 2F58H 3WN5A 3S96A 3LQAH 3U0TA 2YPKB 1ZT1A 3NCYP 1JPTH 1DFBH 1I1AD 1CWVA 4I0PB 3MC0A 1ZA6B 3WYRA 4NWUL 1FORL 1FC1A 1QR1B 3QULA 4X80H 4NQDB 2GJJA 5B4MD 2Z0BA 4FQ1L 2BMKB 2G2RB 4U6TA 5E5MA 3OMZA 2QSTA 3ZKQD 4F7EA 3DX9B 3CVIL 3QJFB 3SGDH 4RRPG 2EDBA 4MSWA 2VQ1A 1F97A 3WL9B 2XTJC 4A2LA 4ZFFB 3BZ4A 5HDBE 1UM6L 4PV9A 3VXSA 2HRPH 3WN5C 4F57H 2X42A 4PFEA 1J8HD 2CKBH 2DF3A 5EU4B 3P4OA 4H20H 3RU8L 4BQCA 2WQRA 1C7SA 5EBGA 2X4UA 1LMKA 5EUOB 2VXQL 4D94A 2CQVA 4RAHA 4F15C 1V3JA 3P11H 5DF0A 5I74C 2Q7YA 3TCLB 1RZJH 3GGWA 1NCWH 4J3OC 4X80L 1OL0A 3SDXB 1ZEAL 4K9EL 1TDQA 3HZMA 1MHPL 4C54A 1IE5A 1JGVL 1YMHB 3LAFA 4NSKB 5IBUG 1JHKH 4GAJH 2N4IA 5GGTH 4PJHB 5E70A 3CVHA 5F96L 4KKCC 3UC0H 3IDNA 4XNXH 1L0YA 3VG9C 3FN0H 4HKJA 4XZUB 5J1AA 3LQAL 3QIBB 3T3ME 3WO4C 3UPRA 3QWRD 3CU1A 2DKUA 1EVTC 4MLIA 3HA0A 3QFJD 4N1HB 4CU6A 3WFHB 4HJGB 5HGBA 3NBNA 1RZIB 3SOBH 4XCFH 1N0LA 2ATPA 3HPLB 3REVA 1RHFA 1N0XH 2FRGP 8CGTA 4WEMB 1XF1A 3O3DB 1OP3H 1OTTC 2BJMH 3OKDB 3VH8G 3O6FD 4U4BA 2Z4QB 4M8VA 1RUAH 1BZ7A 1EGJL 4O58L 4ODTL 5KW9H 1LO2L 4Y4HA 5E00A 5DD3L 2QQLH 2XACC 3CZFB 4CL7A 2CRYA 3OR7A 4OB5L 4OM0L 4H0IA 4MS8C 1HHJB 2JJVA 1S9KC 1RK0A 1D9KC 2PO6A 1S8DB 3N0PB 5CIPA 1CDJA 2AXJA 3X3GL 1RZJL 3QFJE 4ODSH 5ISZA 1MNUL 1FLRH 5E94B 1ONQA 1XR9A 3ULVF 1MOEA 1QSFD 5F3BA 3NZHL 5JHLL 2IALA 2Q6WA 3DHJA 5IHZA 5EZOL 2NTFA 4GG6F 4YBLB 5DMIL 2H6PA 5E2VL 4M1GL 4P2OD 3TBVA 1HXMB 3CIQA 5TE4H 3MRMA 1LO0L 3F7YB 3KXFE 4KJWD 2VDPL 5ACMA 3RVUD 2A6KB 4IJ3C 1EEYB 3U83A 4OM1L 3CSYB 3DMMC 1MFCL 2A2QT 3HI5L 3GRWL 1MAMH 2VRAA 3WLBB 4Z78B 4GKZA 5MEOB 3ZT6A 5D7IE 1I4FA 5JZ7C 1I8IA 4ZG1A 2UZYB 2YUZA 5D5MA 3GIZH 1P7KA 1OAYL 5FECA 5B38G 1MI5E 5CMAA 1R0AH 5ESQB 5DUPL 5HI5D 3ZTJG 4XAKD 1OTUC 3UTTB 4TN9A 3QWRA 4XWGH 4L9DA 3QUKA 4LRIC 2AJYL 1YEJL 1MWAL 4GAGL 4NGHH 3LRSA 5C07D 3RGHA 5JDSB 4U1SA 1R3HA 3LQAC 2BX5A 3DVGA 4PR5A 4E5XA 1ODAA 5IB2B 1H5BB 3C08H 3QRGH 3BH8A 1BFVH 3BKCL 1OP9A 4MAYB 5DWUL 2JK5B 4LLQA 1BAFL 4X4YB 1A3LH 5T33H 1T03H 4FXKB 2BVQA 2DL9A 4XPHL 5EOCL 5J7CC 2ORBH 3T1WA 1SJXA 1SJEB 4WU5A 4HZLA 4MNHB 5EZJB 3EFFB 4LK4A 1F11A 5E8PA 4JG0H 2GITA 3ZTNL 1A7RH 2IMMA 4G3YH 4A6YH 3GRWH 1GC1C 32C2B 3QQ3B 4LEXH 1NMCB 5AUMB 3X12A 2GY5A 5HYFA 3H7BA 5ISZD 3FRUB 5ESVB 1IRAY 4KRMB 4KKAC 2A9MH 2CJUH 1CVSC 2AV1A 2UVEA 1U8JB 1T1XA 1QSFA 1UACL 1KNOB 1AXSA 5E2VH 2OXGA 5D7LB 5D7IA 2F54D 1F3JA 4ELMF 1E4JA 4UIKL 2EDNA 2DD8H 3NAAH 4U1GB 4NFCA 4QTHA 3H9HA 4MXVE 1EO8L 1II4E 4P2OA 3BSZH 1I8KB 3KLSA 4JN2A 1SJHB 1TMCB 3QUXC 1IQWL 4NZDA 1QSEE 4PJEE 4NRZA 1RUQL 3HUJA 4YXHL 1XGYL 3T2QA 2JB6B 5SWSD 1GCFA 2YD1A 3FQWA 4YDJA 1T1WB 2VKXA 1I7TA 1QSVA 1IT9H 3U9UB 5K9KA 1I1FA 3WHXB 5JOFA 3QIUD 1U8KB 1T4KA 5ICXB 4XXDB 2C1OB 4QY8A 2X41A 2GW5A 1CF8L 3TCXA 3BO8B 4HAFA 4MQSB 5FO7B 5HHXL 3TFKD 1NFIB 1FPTH 3O11B 5JIIA 3BKJH 1KJ3H 4XHJD 1SQ2N 1NGXA 2I9LA 2VDNH 5FA3B 4EBQL 1U0QA 3PGCA 1EO8H 3KWWB 2P7TB 1XAUA 4EUPB 1RZKH 2R0WH 4YNYA 4XC3L 1ZSDA 2D9CA 2W91A 4KUCD 3U30B 3VXRD 3CDFA 4WI8A 4S1SL 2EH7H 2XKSA 2XNAA 5J6HA 1DL7H 4RWYL 1AE6L 4CRPA 3QUXB 1EFXB 2W1NA 1A9EA 1UFUA 1WBXB 1EGJA 5IW6A 4MJID 5MERB 4OLWL 5D7LE 1RK1B 3S35X 2VIRA 2NY4D 4OZ4A 2E7BA 4G42A 2HFFB 1WEJH 5GRWA 4R7NB 1ZLWK 4J6RL 3RUGE 4KV5F 3UDWA 1ZGLP 2CK2A 1DEEA 4PRNA 3MYZA 2DICA 1OOAA 1WC7A 4N0YH 4UTAL 3QHZH 1FNHA 4MB4A 2XA8H 5KN5B 1L7TL 3TBYB 4J3TA 3C9NB 1NFKA 3I6KA 3QEHB 3MZTA 1KIPA 3OKKA 5MI0C 1MRFH 4KDWA 1ZT4B 4OI9A 2FR4B 4UV4H 1C16A 3O8XA 4X6EB 1U8OA 3STLB 1J8HE 1CXHA 4FQLL 1WF5A 1K8IA 4PJHF 1KTDA 4GO6B 2EDWA 3SKJL 1P53A 4YR6B 1JZ5A 2BY3A 1S7SA 1UZ8A 5DURB 2HT3D 3ARBA 5L2JB 1DBKL 1MIEH 1MCKA 3TP4A 4U1JB 2ARJA 2X7LA 3UTTE 4JO4L 3E2HC 1S78C 1MJUL 3PQYD 3V4UL 5KZCD 4KZEL 1KCVL 1QVOB 3CXDL 3CFDB 4M61B 3QIUA 1D6EA 4PUBL 3MJ8B 1MFCH 3REWB 4U33A 1R5WB 3TJEH 1CDYA 4X0KB 5LGKA 1BOYA 2GCYA 3QHZL 3ARFB 5DC9B 3VXSD 1M7IA 3RNQA 4NZRL 4U1KA 3GNML 3BJLA 3DX7A 1J8HA 2PXYB 5INDA 4I48B 5ABDE 3QQNA 5EU6D 3GMOA 3QBTB 5F89B 2WBJB 2WNGA 4WU7A 4URTB 5E8DH 4Z8FH 4CU7A 3ARBB 2XWBA 3BPOB 3IU3A 4DUVA 2A83B 2BXYA 4KVNL 5D1QD 3WFZA 4PJXB 5DRNA 4ZUWA 3RPKA 1HHGA 2CLZA 3NMEA 5ETUA 4X8JA 4JHWL 3PNWA 2HN7B 3QCVL 4JZJB 4OZHA 1T83C 5GZND 1M6OA 5GGTL 1I75A 1EJOH 2V2WB 5ETUB 1G6RA 1NH6A 4ELKB 2FDBP 1U93A 4Q9RL 1U2CA 4D8PA 4H1LA 3KPMB 4ZSOA 5BW7C 4MNQA 4WO4A 4NKMA 2FX7H 4K8RL 3PE9A 1Y0LB 2AXGB 5KVFL 3FO0L 4LQ1A 3DX6A 2LQRA 2Z35B 1RZIA 3HCVA 3PDOA 4L3CA 1IGFL 3IDGA 4ZNCD 2NY7L 4DQOH 4P57A 3DUUB 3NPSB 4R4BB 1A6TB 1JPSL 1TPXB 2FCBA 5C70A 3VXMB 4O9HH 1MQKH 2EDQA 4NQEB 2BNUA 1NLDH 1ZWIA 5HHNB 3CFCL 5DD5L 1MI5D 2HVJB 4XCEA 5CGTA 3BP5B 5K9QG 1LO3H 3QUMA 4HPYL 1QHOA 3I6LE 4OLUH 4CVZB 5EU6B 5D5MF 2P7TA 3NAAL 4WENB 1FE8L 2VN7A 1QYGH 3DUHA 3LRHA 3WUWG 5ILTH 1WIOA 1G7JA 3GSRB 1HHHB 3TJHC 1VKXB 3IT8D 5I76A 1TCRB 3PQYA 4OTXH 1DCLA 3MMEB 3WBDA 1AKJD 3MXVH 3OKLA 3L7EA 2LTQC 2O5ZL 1HDMB 4PBWD 4PJGF 1IQDA 2EKSB 1V7MH 4OFYD 3FT4B 1U8HB 4JAMB 4AK1A 5C0FA 1DZBA 2VLKB 3BESR 4NO2A 4J3WA 4U1LA 3RWFB 1U95B 3VXUE 1NGQL 1OM3L 2FO1A 2UVFA 3U4EA 3T8XB 5FF6B 1LNUB 1HHHA 5IQ7H 1BQUA 4KK5C 2VERN 2DIJA 4S1SH 3T0EC 5ILTL 2YN5A 1YC7A 1ZA6A 1XT5A 3WNLA 3KJ6L 3FFCE 4XBPB 5BRZD 4I0PA 5D70H 5D7IB 5D9SB 4J6RH 4IRJC 3MA9H 2DTML 1INEL 5EOTA 4NWUH 4OCWH 3SDYL 1FJ1A 2QSVA 2I9TB 3JTSA 4HSQA 2PN5A 5BVJB 5ANMA 4PTTA 4U1HB 5HHXH 3DSFL 3SDCA 1CE6B 1VGEH 3WUWA 5C07A 2O5XH 1JHTA 3WXVH 1ZSDB 5I75C 1IM9D 1CE1H 1JTPA 4L29B 5IFJB 4OT1H 3O11A 2XN9B 4K8RC 3LMJH 3CZJA 1HQ4B 4OD3H 1FC2D 4MJIB 3MCKB 3HUJF 3HC4H 3QUXD 5I1EH 3LKNA 4AEHL 3SKMA 4MHHI 3LKPB 2YSSA 3WLWC 4LLMA 4R8WH 2Q1EA 5F44A 3S9DB 2EE9A 3Q5YA 4NKIH 4GBXD 1NBVL 5DK2A 1KCKA 4CU8A 2QQNL 4KHXH 2W60A 5FYKD 1OTSD 4QGTA 1T04A 3IFNL 2CLRA 3THMH 2A83A 3IU3B 4YHZL 4YHLH 4QOKA 5ID1A 5KS9A 2R4RL 1AO7A 1UB6B 3GMOB 1I9RL 5ESQA 3TFKC 5KG9B 1KIUA 1RUAL 4I48A 5CEZD 2JIXD 4NNXA 1P7KB 5TJWK 2XZCH 3SDDB 3ULSA 1N6UA 4JM2D 3SDDC 3LMJL 3E3QE 3JV6A 1R24A 1NFDE 2G5RA 3SDAA 3MGTA 3Q6GL 2ENYA 5ITFB 1FL5A 4IHOB 4PRDB 2FEDD 2LE9A 5FUOH 3SOBL 3ZYZA 3SGKA 2R1YA 4XPHH 1E28A 2VDKH 4CVWA 3I3BA 3TJEL 3IKCA 4M3JA 3HC0B 3IFPA 3G9VA 2XY2A 2BVPB 2XWJA 4OI8A 5CJ8A 1OWRM 4MXVF 3QDME 2D7MA 1XZ0A 5F96H 2H6PB 2YWZA 4U0RC 3GJEA 3VRLF 2PR4L 1MUJB 5BRZA 4WU5B 1NMBL 2BC4B 4S1RL 3TYGH 5ENWB 3HI1A 1FN4B 4RQQA 3W0WE 5KG9A 4R6UA 4G6FB 4GKSA 4BKLB 5KS9B 1Q0XH 2EYSA 1JUFA 5DR5L 3HR6A 1GHFL 5JW3L 4Y8DC 5ISZB 3RVXC 5BOPA 1RIHH 2H3NB 3GIVB 4I4WB 3C87A 3ZE1E 3EDDA 3HRZB 3WO4B 5F6IB 3RTQC 1UWGH 1D9KA 3D25A 1UCBL 3MLWL 1R3HB 1MFAH 2GSIB 3I50L 2Y7QB 2W92A 2VDQL 4QRPB 4U0QB 2YC1B 3WHE1 1DUYB 2FX8H 5BMFH 2H3NA 4I4WA 2DMBA 3UP1A 3VFVB 4GRWH 5F1SA 3HI5H 5ADPL 4EVNB 3FQNA 2CSPA 2R0KL 2Q3AA 3LQZB 4MJIA 5JW5B 5KSAA 5MP6H 2AJVL 5I74B 3S37X 1BZ7B 5C0EA 1EUUA 3Q48A 2HT3C 2DLEA 2IH1B 2KUTA 1LO0H 4LSTH 2O93L 5IB4A 1JGUL 4WFED 1FL6B 3FB7B 1FNSL 1PY9A 4PRIE 1JBJA 1AIFA 4PLJD 2VLJA 2CPCA 2R2EB 3TC9A 4M48H 5IB5A 1M71A 1QRNB 1R3LA 1B90A 4HGKC 4RGMB 1OP3K 2A0LC 3I02A 4PRPE 1JTTA 3GSXA 1I9RH 4X98A 5E2JA 2P24A 4PJIE 1FGNH 4GUPA 3SQBA 2EXYD 3N50A 4KKLD 3QPXH 4WJ5A 3O8XD 3P73B 1LEKB 4DAGH 2VDRL 1J86A 2WP3O 2X1WL 2YA1A 3WXWL 2IALB 2Q6WB 1GAFL 4DEPB 4QO1A 4R4NC 3BDXA 3GFUA 1JPFB 4J3XA 1I7UB 4OZFH 3GSWA 4XXDA 3KLHD 3BEWA 1NGPH 2P5EB 3ULUD 4NOFA 1BZ9A 4Z7UE 1I3GL 3G5XA 2E3VA 4QXWA 3S7GA 4KI5E 4PJHE 1WFTA 2ZJSH 5CLWA 2NY5H 2XZQH 1JGLL 4Y5XA 1CLZL 1W72B 4JY6A 5C0BE 4RFEA 3LKOB 1U58B 4WFGE 4U1IB 5TFSL 1VGEL 2YEZA 2OLDA 3V4UH 3GBNL 1MCWM 4M48L 4U3XA 4TYUA 1ORSA 2EYTA 4R4FL 3CJJA 4GAYB 1QKZH 1I1YB 1KNOA 1FZJA 1D9KD 1HSAB 4HCRA 1OW0C 4G6JL 4ENEC 3RDTB 4NQXB 4YFEA 1DLHA 1ZEAH 2EO9A 1MIEL 4FHBD 5D1QA 4KJPD 2WK2A 2YHGA 4MD4B 4RNRB 4X4XA 1YEKL 1JWUB 3NFSH 3S5LA 5MP6L 1FGNL 2ZSVB 4PGEA 1S5HB 2FJGA 4Y8AA 4NUJA 2UYLB 4JG1H 1CGTA 3B4NA 5IVXE 3GO1L 2I07A 2BVTA 2Y5EA 4YUEL 4KZEH 4HZLB 5I30H 1KBGH 2GJ6E 4P3DA 1V7NL 3TVMA 1ZANH 4CVUA 2DOCA 4NKMB 3V5KA 1XGTB 3MCLL 1K6QL 1ND0A 3CX2A 1N59B 3MJGX 4Z6AT 1S9VA 1BGXL 1GIGH 1N6QH 3FFCA 1X5IA 2WLZA 4PGZA 1IC4H 4PG2C 1QBAA 3MV11 5F88B 2AK4A 3U9PL 4LVOC 3BVNA 3BGFB 5FYKH 2F74B 3QUYC 2VLRB 1JFQH 4RBPH 1VFOA 4J12A 2DIAA 3UXFA 4OLXH 4APQA 4MSWB 3IYLW 1WSST 2JJSC 4A6YA 4GRWF 5D1XB 1KG0A 3C60B 4B7LA 3LS5H 1RIVH 3B6SA 2HLFC 1AR1C 2M2DA 4OLZH 3EFDH 3D0LB 4K07A 1MI5A 3TPUB 2FGWL 4PV8A 4YDLB 3RL1B 1VCAA 1DL7L 4RWYH 2OM5A 3UDWC 1MQKL 1QR1A 3PWVB 3VXTA 1P4BL 4K7PY 4OZFB 3C2AL 3BPOC 5MEOA 1HQRB 4PRIA 4YHKH 4XNQB 2P8LB 4HK0A 4PJ8B 2DYPD 4YC2B 3HNTH 3MUGB 2EIZA 5C8JA 4MMXC 4ZFZB 4LRNH 3Q6FA 5A43C 4NIKB 2IH3B 5F1IA 5AAMA 5TGBB 3MLSH 4GW5A 2ZUYA 4HIIB 4PYGA 1Q9WB 2F53E 5LQBH 4X5XB 1V8HA 1KFAH 4FABL 3DX6B 2YZ1A 5C0AE 3KG5A 2GY7B 4L3ED 5MI0B 2NY2C 4OCMC 3B5TA 2YS4A 3O9WA 5E99H 4NQCE 4ZYKA 5F3BB 3DX8B 4DW2H 4MNQB 5CINH 2QLVB 2R9HC 1YPZE 4LDEB 5IK3A 3PHQA 5HHPB 1JYNA 3SHSA 3BYTA 1C08A 1ITCA 1E4XI 1EA9C 3HZVA 1MHCB 3OTTA 1MHEA 1UJTA 3TVMC 3HG1B 3X17A 3ARGB 1OVZA 1R3JA 1KXTB 2IH3A 1ZS8B 3Q2CA 3ROLB 2HVKB 3TBTA 3I6KB 4M6NL 3GNMH 3TBYA 3SDCD 4YH6A 3DSNA 2FEDC 4JPVL 1QBLL 3RTQD 3I6LD 3QO1B 3O3DA 2B7DT 4LGSB 4QKXB 4ZAKD 5IQ9B 4M5YL 4M7LH 5HGGS 3P0YH 3ALWA 4RZCA 4KROD 1KPRB 2B0SH 1CGSL 5HY9A 2DD8L 5H94A 4F58H 2XKNA 2YD2A 1M4KA 4IDLA 5DJ0B 3O4LB 1DBKH 5IOPA 1BPVA 1FG2A 1EPFA 3TYFB 3BVNB 1BD2E 3L1OH 1L7IH 5CWSB 5FHBL 1A6VL 2GTZB 3ARED 4GSDL 5I2IA 4E41B 4E41E 4L4TE 1JP5A 3OWEA 1BIIB 1S5IL 3TBWA 3U30C 2XG4A 4OAWA 3KR3H 5HPOA 1A7BA 4H26B 2DYPA 4Y89A 5C0DA 5GS2D 2H32H 3BKMH 4P9MH 1FNAA 3IFLH 5BZDB 4OZGA 5D1ZD 3V6OC 4QOKD 2EZ0D 2AJZA 2X4RB 5EN2A 3EOTL 3SJVA 4JB9H 3V4VH 3WFDL 3S5LG 1EXUA 3MREA 3RA7H 2AK4E 5L9DL 4JM2A 3C6SB 4NUJB 1FO0H 5A16A 2ADGA 4ALAL 1WGOA 2RHEA 4LNVA 4GW1A 1UZ6E 4X4XB 3ZSTA 1GAFH 3KLAA 2X4OA 3DVFA 3QQ4B 3C9NA 5J13C 4IS6B 4K3DH 5CD3B 4R0LA 4PB9L 1GPOH 2HLAA 1SJHA 1SMOA 1IC5L 4PRNB 1A5FL 4NRYB 5I8CB 1NJ9B 1OTTD 1QRKA 3H9HB 1FFOA 3MROA 4XVUC 4RAUB 1KLFA 4ZDHA 3RY5A 4QHUA 1IGFH 4WGVB 3RP1A 1EZVY 1WQVT 3PHOB 4MVBD 2FBJL 4WUUA 1FH5L 5CZXD 2QSQA 5F7MC 4JM4H 1MLBB 43CAA 5BO1L 3ZZ1A 5MEQB 2NYYC 3V52H 1UENA 1DBJL 1U8LA 3B9VA 4G80A 2AABL 4B7IA 3PGCB 3SPVB 3JVGC 3EFFA 1NDGB 4MQ7A 3LS5L 1JK8A 5B4MC 5F7YC 1CT8A 3ZHKA 3BYYA 3EGSA 5GHWL 3ULVL 5FO7A 3P9MA 4X4YA 3T0EA 4LFHG 4ZUTA 3S34L 5J12B 3F6LA 3U48A 4F7TB 1N3NA 1DQQA 2BY1A 2APWA 3LIZH 4PY7A 4NZUH 5T3ZH 3WNMA 2VLJD 1SM3L 3U1SH 3U4AA 3EYSL 1WFUA 3LQMA 1NUFA 3KR3L 1Q9KB 3FOLA 4K3HA 1LGVA 4WUUB 4KVCH 1R3IH 2VABB 3MV8A 2YD5A 3UTTA 2BNQE 2Z9TA 3F65A 3WKMH 1I8KA 3VE0B 2IAMC 3QH3A 3KPSE 2EDDA 4KROC 3I9GL 3KYMB 1E27A 4OLVL 5KVDL 3IDUA 1F45A 2ZNWA 1EGJH 2UZXB 4XRCB 2W59A 1MRDL 3KLDA 4F7PB 2X70A 4R0LB 5GXBB 2EXWD 2X4OB 3QQ4A 2K9UA 5E2UH 5H2BA 4U1GC 2Y9RT 4Y19E 3RWDB 2YK1H 3U7YL 3PDDA 5IVOA 2ED8A 3BUTA 4JKKA 5E8PB 1QOKA 3KDMA 5DC0A 5F9DC 2A77H 3QEQE 5DA4A 3B9KB 1SJEA 3DBXB 3LVEA 1N64H 4K2UH 3SDCC 1XR9B 1W0WA 2BVOB 4DKFH 4OAWB 4V1DB 3VFOA 1M7DB 3TO2A 1MIML 1J0KA 3JVGA 1XZ0B 2UWEB 2AJZB 5EN2B 4DGIL 1GGCL 5CWSA 4KY1H 3T0WA 5DQJB 5IIEA 4XNYL 2RQ8A 1CG9B 5H2BB 4HIIA 3WO3B 4FG6D 1BIIA 3SCMC 5I15L 5E8DL 2HP4A 5DA0B 3DV6A 4Y19D 1Z6JT 3QG7H 2I60H 2GJZA 2VR5A 2XQYK 1MWAB 3MXWH 4KK9C 2AQ3A 2IFFH 4MJ6A 3VRIB 3UJTL 4BJLA 5HI4D 3OKDA 2V2TB 4KDTA 4K7FA 1KCSH 4HIXL 4CJ1A 2XPGA 3KXFB 3C5ZA 1MFEH 1RJLB 2Z31B 2Y5TB 4RMRA 5FGSA 3SKOB 4EBQH 3CXHJ 1UWGL 2DQHH 1WWAX 4MA1C 1ORQA 2RR3A 3MLYH 3V5DB 2X4SB 3AXLB 3BP4A 5TDPA 3CDCA 2ZCHH 3MV7B 2H2SC 2VKWA 1IEBB 5HYSA 4PJGE 1FZMB 1KCUH 5A2JH 4APQD 3BZDA 5IHZB 3CD4A 4LCCC 4QLRA 4QHLA 3ZLQC 2IQ9L 1T3FA 1P7QB 3GGWB 1TFHA 1S5IH 5GS1B 3OKOA 1TLKA 4JHZA 5DZOA 1JNHA 1PQZB 1JK8B 2QQQA 3MRIA 4F9PA 2OZ4A 5EA0L 4P2RA 2KQNA 2C4FT 2I07B 2J2ZA 3CPLA 4PLKD 1I7ZA 4WI6A 1ZKAA 3H9SD 1GGBL 3MJ9H 3DI2B 1MJJA 4S1DD 1CL7L 3VFWB 4ZFFA 3S5LB 2QHRH 2X9WA 5ISZE 3JTSB 1EEUA 3T2NH 2WQ8A 1FJ1B 1P4IL 2OR9L 3MRRA 4Y2OA 2OI9C 1UJ3A 5TE7H 4UILH 4N0UE 1KPVB 3O2WH 4U0RB 1SBSH 1KB5H 2JE8A 1KXVC 5LCVH 1HWGB 3UBXA 1I8LC 1YECH 1NAMH 2C3VA 4JKLA 5KJRH 3RVTD 1W72L 4PJDF 2DJUA 1LNUA 1LP9E 5TE6H 5CD3A 1U58A 3GJFB 1XF5B 5GGVY 1FZOA 3FJTA 3RWFA 2ORBL 4E41D 1MSPA 1UKTA 1GOHA 2VB5A 4Y19A 4APQB 4Z76B 5E1HB 2IADA 3SDXE 3P11L 1RFDL 5GRVL 4Z7WF 4OCXH 1GGTA 2EECA 3HC4L 2VXUH 2VZSA 5LAXA 4UV7L 5EU7E 3EDFA 3ZT7A 3ZYOA 4YBHA 1FCGA 3DUSA 3IFNH 4PRBB 3C5ZD 4FQQB 3QIBC 4YXKH 4U2ZA 5EBLB 5I75B 4EOWH 1I1CA 4DZ8B 2QQNH 2NNAB 5FM5M 4AJ0A 1T7XA 4EI5B 3KPNB 1H9VA 1NBVH 4XXCC 5DK3A 4NDMA 5T1MB 1FZMA 4KVNH 4ZS6C 4XCEB 1NAMA 4GUPB 4KPHL 5HYSB 4KUCF 4MWFA 3WNKA 3LV3B 4E42A 4LCUA 5CHNA 4Y19B 4KZDL 1EO5A 3V5DA 3DRQA 4AIXA 3QYCA 4JFHE 4JKPH 5MHSE 3CFBB 5LAXB 1WVZA 5EIVA 1KENH 1SHMA 1G1CA 4FOMA 2Y5TA 4L8BA 4FQ2H 4JFZL 4CN4A 2X4NB 3IDXH 5FB8A 3IDIA 1IEHA 2BSSA 4DKEH 4F7CA 3LN5A 1A2YA 4GT7A 2XRAL 1EZVX 5KVEL 3MNWB 3DETD 1Z0NA 4YWGL 3QWOA 5DMIH 1NC2D 3LKOA 1F2QA 3GIZL 3TO4C 2DLGA 1NUGA 4RMTA 4H88L 1K4CA 1YNLH 4JZJA 2YPVL 4U1MB 1WFOA 3LSOA 2WIIA 4S1QH 3WKNA 4MXWL 1TZIB 5I1CH 5L0QC 1OAUL 4M8QB 2FGWH 1CL7I 4KKAD 4TNVK 1RHHB 4PJFF 2VL5A 4I5BB 4PJCF 1MEXL 3GSWB 3DPBA 4OZIF 2ZOKB 4EN3C 1G9NC 3NA9L 5IBUB 5ESAA 3MLPA 1P7QA 2PXYA 5D7JA 4E9LA 5INDB 4TRPH 1OAQH 1MUJA 4PD4K 2J3SA 1JWMB 3VXPA 3GSNL 1JPFA 3RWDA 4YEFA 3BP4B 3DARA 1RI8A 4S1RH 3SDXF 3TYGL 3L5JA 4WUUD 3B3IB 5D71L 2VLRD 2GK2A 1BBDL 2LABA 5DK0B 2H2PC 3CMOL 4HIEA 1RJLA 2AEPH 3AS2A 1RUPH 2A6DB 4I9WE 1QSED 3NCBB 2G60H 2ZZUT 1CK0L 4H5SA 3GI9L 2K7QA 1YYML 3B9DA 3R8BB 4DZBB 4ZTPL 5EO0A 3OJ2C</