1T66D

The structure of fab with intermediate affinity for fluorescein.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVKLDETGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRAEDMGIYYCTSYGYHGAYWGQGTLVTVSAAKTTAPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSALYTLTSSVTVPSSSWPSQTVTCNVAHPASSTKVDKKIVPRNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin light chain
publication title Three-dimensional Structures of Idiotypically Related Fabs with Intermediate and High Affinity for Fluorescein.
pubmed doi rcsb
total genus 46
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t66D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t66D01
5CGTA 3HAEA 2H1PH 3MA9H 2R0KH 4R97B 1N6QH 4OF0A 4Q74A 3RBGA 5C8JA 1F4WH 3QDMD 3BEVB 3MLVH 3L9RB 1HK6A 2R1XB 4KZDH 1P53A 4IMKA 4X6EB 5L6YL 3KYMA 1OLLA 2OTUA 1O5DT 2UZIH 3OZ9L 2PO6B 4PJEB 2KQNA 5HGHA 4P0DA 3KLAB 1RIHH 1WISA 2HG5B 3V5KA 5SWZD 3NCYP 3TVMB 1F58L 4UDUB 3UTSB 3LCYA 5LKNA 4HJGB 1CIDA 3DBXA 3EYFB 1BLNA 1RUQL 3V6FA 1QVOA 4OZIF 1J8HE 3QEHB 1DDHA 1RIVL 4PV9B 3EJYD 1FJ1A 4QGTA 5I74C 5D1XC 5AAMA 3IF1B 4HGWA 1S9VA 5D70H 5MEQB 4IS6A 1SEBA 1BVZA 1ZA6B 3MPCA 2KL6A 4XBPA 4P4KA 1YEFH 1F6FB 3HAEG 2E27L 5CZVH 5GS0H 2YPKB 5DFVC 2PYEE 3DRQB 4I2XE 4AENA 2VNCA 3LQZB 5DGRA 4YHIB 2BNRD 4AEIL 3PDGA 4ODSH 5E8DL 4AQOA 1VACB 2CRIA 1NCDL 4P2OA 3IXTB 3D2UD 4YDKH 5IW6A 3G5VB 2IAMA 1MQKH 4FQXA 1BVKA 3DURB 1G9NL 1DBJL 2FIKB 5CGYC 1OWRM 1RJLB 5ILTH 4GRWB 3CMOL 4NKOB 4V2CB 3HI6L 5J56B 4WU7A 2XZCL 4X0KA 3PV6B 3LEVL 4NYLA 4XXDA 1NDMA 2FEDD 5E99H 1FL5B 2DJ4A 4LCCA 5EZOH 3WXWH 4L3EE 2O5XH 1I1YB 1CVSC 1UEYA 2GFBA 2VXTH 1CLZL 3NPSB 5FCUH 1OAYH 3MRBB 5TPWH 3FB5A 4EN3D 3G6JA 4JFEE 4R97C 3OG4B 1IT9H 5FHBH 5T5NF 2CUHA 4LBEB 1GGIL 3GBMH 3KPNB 4X98B 5T5NG 2PO6C 3U0TB 4QHNB 2PXYA 1EAJA 4URTB 4KROB 5BVPH 1E6JH 3DI2B 3TVMC 5IM7B 1RUMH 4P3CH 4YGVA 2NY5H 2FR4B 1TETH 2BVPB 2APTA 2GTWB 4GUPA 3C6SA 3DMMD 1KIQA 2DTMH 5EU6A 5EH1A 3TFKC 4DK6A 2ARWA 1A5FH 1JGUL 4M1GH 5DDHA 1OGTA 4M7LL 4L9LB 4XPHH 2YXFA 4U3HA 4XRCB 3G6JF 5IBTH 5EO1B 1WF5A 3O6FA 3HG1B 1FV1A 1FZOA 1YNTB 2AJVL 4NP4L 5EBLB 1XF4A 3D39E 3ARPA 4F57H 5ACMA 3DSFH 1P7HL 1BFSA 2J8HA 1CLYH 3ZE0E 1ED3A 2BSRA 1XGQB 4Q6IA 3MRKA 1LDPL 4W68A 4Z7WE 2E7HA 1DFBL 4G9FE 2NW3B 3G5XA 2AJ3A 4YO0B 1LD9B 5GGQL 3VGAC 3BQUA 5JUEH 3C08L 5DI8B 5I0DA 1V7NL 2VLJE 1NMBL 1JPST 4H8WH 1J8HA 1DQLH 2PW1A 4JGMA 2YRLA 5I8CA 2JTDA 1T4KB 1OHQA 1A22B 3CAFA 3I02A 5FA4A 2GJ6E 4K94L 4FFVC 4Y4HA 5M95B 3DGGA 5A2LH 5GSVA 2HLFD 2VZUA 5E6IB 5IFJA 4AEHL 3O0RH 1CD1B 1G7QA 4JDVB 3CVIL 3PWLA 4GBXB 1AXSA 5IMLA 2PYEA 1LNUB 3NPSC 4I2XA 4DUVA 5CP7A 3DVGB 2CSPA 1WC7A 3KXFD 4N8CL 1AD9A 1A7QL 1XGUB 4RBPK 5L8LB 3IYLW 4PRHD 1G6VK 4TQEH 4WCYL 3W9EB 1NSNL 4JZJA 5IW3A 2BVQB 1CFNB 4TUOA 1T2QL 3MOAH 1OSZB 3NA4A 4KROC 5D7IE 4POUB 4YFEA 3TO4A 4KRLB 1QSEE 1DN0A 4U1LB 4DKEH 3FOLA 2E8ZA 5ITFA 2DLEA 2FZ3A 1AGBB 4U2YA 4JQVC 4L3EA 2X9WA 4R26H 1YNKL 5D1XD 1RK0B 3CSGA 3MROB 4L9LC 4K3EH 4JFEA 1MEXH 1OAKH 4IOIA 2D7MA 4LQFH 4JFZH 1QG3A 1WSST 5SV4A 2UYLB 2ILLA 4ODXB 5IHZB 3ARFB 4GAFB 3EZ8A 3CFBB 4OI7A 4YXHL 4Z0BH 5DFVD 1ZLWK 1BF8A 3WIHA 1OGAE 4ODUA 3MFFA 3MRJB 2VUYA 2W9EH 2P24B 5IKCA 3AXLA 5CJQL 5J1TC 1XR9A 5FYLL 3X3GH 3NACH 3AM8A 1MCSA 3I3DA 3QDGD 5CGYD 2YPLE 1ZEAL 2XQBH 5T1KD 2NX5B 5E08L 4XP4L 4R7NA 5E00B 5BQ7B 2VXQH 1NCCL 1FG2B 4MXVE 5E6IC 4HFWB 5F72S 5IV2B 4YXKL 3VGEA 3D39A 3HZYB 1FE8H 1WV7T 5E8OA 1G9MH 2JK5A 2Y5TA 1QOKA 1T7YA 3HKFA 5GRJL 3FL7A 2LFGA 2P5EB 4DGVL 4KHTH 4Z7WA 4NO3A 1ZWIB 1MSPA 4G9FA 4U6VL 3VXPB 1LE9B 4CADB 5B38B 4RFOH 1YMHB 5FGBA 5L88H 3S3JA 2VLJA 4TRPL 4AK1A 4JB9L 2IQ9L 2PO6D 5BZWA 5MENE 2MNUA 1IEAA 3I84A 4JJ5A 4KXZI 3U83A 6FABH 5H94A 2GJ6A 4UUJB 3TVMD 2YD9A 3UTSD 4GW4B 3HI1B 5J9PA 4MD0B 3VRLE 3GRWH 5GQBA 2BCKA 1HHKB 4O2EB 3TFKD 4KI5E 4XCCL 4YPGB 4M6NL 5L2KB 1ORQB 5C0FA 3ZE0F 3VD9A 2GSIA 1RJYA 2CDEB 1U8OB 4Z7WF 3TH3T 4D8PA 3TC9A 2F5AL 4ZS7H 4JFOA 4GXUM 3IFNH 2R1YA 3Q5TA 4FA8A 1RVFL 3P30L 4XH2A 4OT1L 4DVRH 4ZUUA 5FM5O 1DQTA 1EMTH 1IM3B 5CD5C 1HQ4A 5AZ2H 1WTGT 5D7IA 4YIQA 3HC3L 4OZFA 2XOTA 1EHNA 3MBEB 4X4ME 2EKJA 2G75B 1QSEA 1CDYA 1IE5A 3C87A 4N0RA 1KB9J 1XIWB 1T0PB 3RY5A 1SYSA 4MD5A 2EDWA 3U7YH 1P4IH 5KSVA 3OF6D 5T1DL 2WLZA 3O3UN 3QUMA 3QDJE 3GMRA 2FB4H 2X4NB 4FFVD 3VFRB 5SX5H 4OI8A 2OSLA 5BJTA 3STZA 1BX2B 1RHHA 3P11L 1U95B 2AS5M 4M00A 1LO2L 4UU9B 3C8KA 3VXNB 1MRFH 2F8OA 5I2IB 1VSCA 1JRHI 5IB5A 2EIZA 3LQAH 3O2WL 5GSRB 4XMLL 2CDFB 1OGAA 1Q0YL 4OQTH 3T0WA 3VRJA 4KZEL 4BFIA 1MCFA 4JO1H 5D7IF 5IB1A 4AIZA 4ZOEA 2VIRA 2IBZX 3F7QA 3LH2L 5DEZA 1LP9B 4RQQA 5DEFB 1CL7H 3ZZ1A 1AY1H 3BKCL 1U8HA 2P45B 3K4DA 1MFEH 2OJEA 1MJJB 4KHXH 1U8PA 3EYVA 4KROD 2FD6L 32C2B 2YPLA 3AAZB 3G5YB 5D72L 5LQBH 3V7MA 2D0HA 4NNPL 3VXMD 1D5ZA 1X5JA 2R69L 2ZOLB 2Z91B 2VDKL 4XNYH 3OXRA 4RFNB 5A2KH 2R15A 1ZANL 4UT9H 2C5DC 4KDVA 2PR4H 3HG1D 4RAVB 1LEKA 1D6VL 1VHPA 3CLFH 1UVQA 2XA8L 2P8PB 3F12A 3IDXH 3L3KB 3BRGC 1MHHA 5MENA 5DK0B 5E8EB 3UTQA 4O02H 1CG9A 2ADGB 1FIGL 5GGUB 3BYYA 3IXAA 1E4XH 4RIRB 3MBEC 5GGSB 2GK0A 1G7JA 2ORBH 4UTBL 5HYQA 1J0YA 5I8EB 2BDNH 4MXVF 1KCVH 2QL1A 1XIWC 1YDPB 1N6VA 1ZT4A 3BGFB 5DHVA 4RGNB 1ZKAA 3EOAA 3V4PL 3WD5L 1M7IA 4S2SB 3QDME 4K23L 4OGXH 4PLKC 3KJ6L 3EYOB 5EOQH 35C8H 2VE6B 2EDLA 2DLHA 1T1YA 2XQYG 4TSCL 5E6ID 3B9AA 1ZLVK 1YEHH 1AGDA 2UY6A 1M05B 3WIFA 1JZ3A 2B2XL 1IGIH 1OSPL 1ADQH 4OLXH 4R7DA 5DS8A 1NLBH 1D5IL 4YNYA 4X4MA 4DGYH 2AW2A 3MJ7B 3VRLF 1KF9B 1CICB 1QLRB 2Q87A 3LN9A 3MRLA 4WWKA 4G8IB 3U30B 1WAAE 2EDQA 3IJYB 5I1KH 3I6GB 4KI5F 1BP3B 2L4OA 4EI5B 2J6EH 4X4ZA 2QJDA 3GZKA 5EN2B 1T66C 5BW7A 3QDJA 4KDTA 3IDIA 5C0CB 1JN6B 1I8IA 1P7QB 1VFAA 3QIWC 2EEBA 5T33L 5B4MC 5KANI 3Q1SH 4BSWB 3GJFK 2HKFL 3U82B 4HX1B 4LVNB 4RFNC 4JO2H 1NCAL 1IGMH 2BNRE 3GBNL 3IFOA 3B83A 4M7LT 1YN6B 1KJ2L 5ELIA 4B41A 3MYJB 1D9KA 2R0LL 3OKOB 5ENWB 1KTLB 4CNIB 2WBKA 5LAXB 3QB7C 2CRZA 3IDNB 5MERA 5CD5D 4JLRA 2DJSA 3EAKA 1JZ7A 4HS8L 5J13B 4XCFL 1INDL 3VI4E 3IKCA 1I3RA 3T08A 4HS3B 1UENA 3HE7C 3QR2A 1KNOB 2ZUQB 4PREA 4N8PA 1C5DB 3BGFC 5T3ZH 1A3LH 5SV3A 2MQ0A 2BSSB 4RGNC 4W6WB 3MZTA 3N9GL 3TBWB 4UV4H 1UXWA 2OJZL 2GSGA 1GVIA 1RZIA 2XIDA 1C7SA 2NY7L 1ZAGA 1B4JH 4GRMB 4R4FH 1XCTA 2A1WL 2HJKA 2E7LC 1Q72L 1IGJA 1HKFA 4C56E 1MAKA 3DX9A 4ONGL 3CU7A 2P5ED 1AJ7H 5FA3B 3BP6B 3IB4A 2VXUL 3QCTH 2A6IA 3OXSA 2W65B 1NAMA 3ARDA 4RMTA 3WS3A 5FUCC 1CICC 3OB8A 1FN4A 4PY7B 4G3YL 2WM0A 5HGAA 3U30C 2VSCA 3MV9B 4LF3B 4IBLT 2AGJL 4EI5C 1EEYA 2N56A 3QDMA 4WI2A 1ZMYA 1WWWX 4J3SA 1S7XA 3RNKB 1DANT 1A7NL 3NFSH 4ZUVB 1TJGH 3H3BC 1NAKH 1CGXA 5L2KD 1C12A 4AM0A 3W2DH 1F02I 4LVNC 4PJ8B 4BH7A 4BK5A 4JGJA 5KSUA 2W92A 1TCRB 4N0YL 2OI9C 2IH3A 1VGEL 4PJIF 3TPUA 1G1CA 5C92A 4IRJB 1UA6L 4KTEH 2CRYA 3KYNB 1KG0A 3SY0A 2ICEA 1WFNA 4XC3L 4M7JH 4U7MA 3IETA 5AG9A 4U0RB 4ZTPL 4Y2DB 5ISZE 2OS7A 5J13C 5CEZH 1GC1H 4I3GA 4LAQL 2R0ZL 4KFZC 3MBED 1I1AB 4J1UA 4RX4D 1XGTB 3AU1A 4NUJB 1XIWD 3I50L 1CFBA 2ZUQC 2WBJA 4HK0A 4HGMA 4XP1L 5IW1B 2YWYA 1X9QA 4PJGE 3KXFE 2BNRA 2UUDK 4PLKD 5HVWA 3TJEH 1EEQA 3PG2A 5INDB 1V3KA 4HBQA 4HKBA 4ZD3L 1FVCA 1MFBL 1MRCH 1CGVA 1WAAF 3HCVB 3CFKB 4JO3H 4JDTH 3QUZB 4EUPA 4JKPH 3BVNA 1NMAH 5ESQB 5EOCJ 1WFTA 1PAMA 5JO5B 1WWCA 3UROR 5IJKA 1N64L 3MRNB 1UG9A 2IQAA 5GS0C 2AP2A 2VZOA 2E8YA 4EN3A 4JN2A 3CNKA 2DQGH 5DC0A 3L5WA 4AH2A 5CIPA 1T66D 1HHHB 5BRZB 3D0VB 4X6DB 2OP4H 5FYJL 1QYGH 1IGCL 3QH3B 4OZGB 1QEWB 3QIWD 4BZYA 5B4MD 5TE7H 1F4AA 3VFTB 2BY0A 4C56A 2X4SB 3QHZL 1MFDL 4PJ8C 3B5GA 3UTTE 3FQWA 3QA3A 4LLYB 2X44D 3BHBA 3HN3A 3L5HA 1U8QB 2X1PA 4IRJC 3DMMA 5IHUH 1JK8B 4UOJA 4S1DC 1T5WA 2XXMB 3VI4F 4EUPG 3RWGA 3EOYG 1CTOA 3WSQH 3BMWA 3VWKB 3THMH 4DVBA 1A6ZA 3BSZL 3N85H 4Y2DC 4Y8DC 5J6GA 3A0OA 3JV5A 3B8YA 1YQ2A 4JPVL 4PJAB 4YR6B 4P46B 4JFPA 1ZTXH 3VE0B 1X5FA 2BRRH 1UH2A 2O5ZL 3HE7D 4ZUTB 3TO2B 3VXUE 5D2NE 4RGND 3RVVC 2V9QA 1WT5C 3MMEA 3QCUH 1WIOA 4NZJA 4CGTA 1TXKA 5BXFB 2NY5C 3V8CA 4PRPB 3PABA 4EDWH 4YX2L 3T3ME 5T1MA 2I9TB 1DQDL 1NAML 4DW2H 3V2AR 5DK2B 1JZ6A 3LKPB 4GG6E 3ULVH 3OKMB 2PETA 4OF7A 4HWBH 5CINH 5ISZA 1DBBH 2W0PA 3QUZC 3UTSE 2E6PA 4POYA 2F19H 1V3MA 2JJWA 2EEAA 3RZCB 5C9KA 4QY8B 3WFHB 2H3NB 3MOBL 1JNHA 3P0GB 1OM3L 5I73B 1S78C 1CICD 1U8MB 1IM9B 1XGRA 3PNWB 2Y07H 3CD4A 3E1F1 3FO2B 4EI5D 4MQ7B 3DHJA 3CVHH 4PJGA 2WP3O 4DKDC 1WBXA 3KXFA 4NT6A 2L7JA 2ZUVA 3JWDH 4XPBL 5FF6A 4GQPH 2P8MB 4B5EA 5C0CD 3WUWA 2CPCA 1G7LA 2YD6A 4OJFL 1P7QD 1U93A 2WIIA 1RV6X 2XWTB 4H8WC 4U6HB 2RFXB 3QJHB 4PGBA 4DQOL 2ZCLH 1TLKA 5I1GL 5KVDH 2X4UB 5DUML 1DLFH 4LLWB 4JY4A 3RY6C 1J0ZA 4PRDA 1C08A 4YHOH 2VDLH 5LVEA 4U1KB 3GGWB 1MCBA 3H0TB 5FIEA 3BGMA 4O51A 1VFOA 3NCJL 4OCRL 3S5LB 3VWKC 5D1XA 1YEEH 4OCXL 3F58L 4TNVF 4KWUA 2NY3B 2QQNL 5C0JB 4X6FA 4XBGA 4PJGF 3D6GA 2EE6A 4P46C 4W70A 2HMIC 2F54E 25C8L 2AJUL 4LU5L 1E4WH 4R8WH 4KV5E 1KLUA 3EFDH 3WUWG 1MLCB 1M7DA 2R2BA 4F33A 3UTTA 5JHLH 5HYFA 5KSBE 5ANMB 1A0QL 3E6FA 4HWZA 2YR3A 2BFVL 1C5CL 4UV7H 1KCSL 3SEPA 2QV2A 3AS1A 3B9DA 3T0EB 2OLDA 2QKIA 3BP5B 3L3DB 3T2NH 3U6RA 3JUZA 1HKLH 1FNLA 5T1KA 1G7MB 1VESA 4QXGL 3NH7L 1JGLL 3W11C 1PW3A 4BSJA 3VXME 1UQSA 3UO1H 5I73C 5GS0D 1LDSA 1FVDA 3VXUA 5FKAB 3MV9D 3RVTC 5D2NA 4U1IA 2CKBA 5IFAH 2H32A 2BVEA 4OIIH 3GIVB 1I4FB 3HG1E 5HDQL 3L9RA 4HAFA 1FH5L 5TE6L 4H1LA 1ACYL 4L8DB 3CXDL 2DBJA 1UZ8B 2VSDA 4GG6A 1OT1A 4WEBL 4XPFL 1B3JA 2HG5A 2OL3L 4GLRI 4PJ8D 4UDUA 2EDEA 3UTSA 3S3PA 2EDJA 2FDBP 5T5FL 4AL8L 1LO4H 2YWZA 5HHXH 1DBML 4HXBL 4IRJD 3K1KC 5GS3A 3QEHA 4S1RL 2J8OA 3OJ2C 4PV9A 3REVA 1KCKA 1G9MC 1X5AA 2W9DL 3IF1A 4Y2DD 1PY4A 2NY3C 3F7RA 1RZ7H 3K7UA 3ZKQD 2H41A 4FMKA 5GRUL 1HHJB 4GOSA 2J3SA 4UMGA 5CCKH 3N1MC 1CT8B 1AGCA 1AKJB 1S9XA 2VYRE 5MI0B 3T3MF 3QEGH 3LSOB 1RUPH 2YPKA 3LB6C 2XG5A 3DRQA 2H8PB 5C2UB 1YEIL 4GG6F 1DBKH 3BP4B 1S5HA 4H1LG 3RVVD 4HC1H 4E41E 1FLRL 3NFPB 4HDIB 1AXTL 3LKNB 4UILL 3VJ6A 5I75B 1E4KA 4R2GB 2JB5H 4FQ1H 1JPSH 1PFCA 3T0EC 3HMWL 1YEDA 3DURA 4MNHA 2FIKA 5CMAB 3OF6A 1QD0A 4JY6A 1D5XB 1IGTA 2JF1A 3QUZD 4ZPTB 3VFOA 4NKOA 1HXMA 5BO1L 2RBLA 3PV6A 2F54A 3PHQB 1A1MB 2A73A 1S78D 3DPBA 3QPXH 4MAYB 5I19H 3FQRB 2FCBA 3L1OL 3F8UB 3G6AB 5F88A 1WQVT 4G43B 5BRZD 4KJQC 1ZHBA 4FOMA 3U36A 1EH9A 1TDQA 4X98A 5EO0A 5J6HB 2YD8A 2OM5A 3P4OA 1QUNA 4ELMB 2IMMA 4NM8H 4R90H 4LEXH 3UBXB 2XQYK 1I9JH 1GL4B 2DN7A 2HWZL 4H25B 3VXMA 1VFUA 1XFPA 4KU1A 1AQKH 5C0RH 4C58B 2GHWB 3LQAC 7CGTA 5IVXE 4KV5F 1VKXA 5JPNA 4FFYH 2H45A 2DM7A 4HIXL 5GRXG 5HPOA 2YUZA 4KKNA 5D71H 2J88L 3HG1A 4P46D 5KSBF 3ZDXE 2HMID 4R4BB 3KDMB 5F7HA 5MI0C 2AK4E 3TBSA 1ETZA 2ICES 2ZJSH 1SY6A 3CFJB 5JW4R 2DMCA 4I3RL 4XWGL 3A67H 2NW3A 1H8OA 1QR4A 4YO0A 4PRPD 4HZLB 2D7OA 4NRXB 4NRZB 2VERN 1JUFB 5I75C 4YDIH 3DV6A 4OUUB 4R2GC 2CO6B 4ZFZA 4HSQA 1JNLL 4XTRC 1UYWH 3L3JB 4K8RH 4UT6L 1ZT7B 1N2RB 4KVCH 3MFGB 2CKBL 3BZFA 2DQHL 4O4YH 2FH8A 4D9LL 3MNVB 3QO1A 3W11D 1R3JB 1P1ZB 4NQXB 3U4AA 5FUZH 5FKPA 5HHVH 5K9JH 4R9HA 5DJ6B 3Q6GL 4MAYC 5CWSB 5L2KE 1IM9D 1N3NA 3OKEA 5DQDL 3RVTD 1SJHA 4LRNL 1DEEB 2XI9A 2UZYB 1KENL 2A6KB 1X5KA 4S1SL 4LLMA 4E41A 5LBSL 2FYYB 1ES0B 4WENB 5BV7H 2AI0H 3W39B 3MCLH 2BERA 3FN9A 3W9EA 1F97A 3LS4H 2BVQA 3M1BA 4X4XA 4H20H 4P9HH 1OSZA 1OOAA 3TV3L 3HC4L 3BMVA 3O2DA 1FQ9C 4K2UL 1CDIA 4LSDA 1MCQA 3RHWK 5IB2B 3FQUB 5MP6L 4U1LA 4B7IA 3LKSA 2Z31B 4NUGL 2DLFH 1ZGLP 3P4NB 1XF1A 1NUDA 4NHCH 2Z93B 3MROA 7FABL 1WIPA 2NY3D 2DQEL 5D9SA 2IH1A 2UYLA 1CFQB 3SDYL 2LQRA 5F7NC 1U3JA 3X13A 4E42A 2ADJB 1J11A 1V3LA 2JIXD 3LB6D 5I16B 4ZQKA 2CGRL 4RRPA 1YEKH 2FBJL 3BE1H 4O9HH 1UM4H 4PP2B 1KT2B 2VITB 2P8LB 1NCWH 3CH1A 3KNBA 3OHXA 1TNMA 3QIBB 3MC0A 3T0ED 4OGZA 1C1EH 4R3SB 2W60B 5IVXA 3BKML 4WTZA 1JHKL 3TN0A 2VAAB 1JWSB 5E00A 5BQ7A 2G5BA 4G6FB 5GPRA 5TFSL 3CJJA 5FUOL 1NFDB 3CZFB 4CKVX 2BOBA 3L5JA 2NZIA 1A6UL 2AK4A 1OF2B 4GW1B 2X6MA 2YUVA 4WGVB 1KPUB 5HDOA 4YHMH 2HH0L 4P2CG 4TSBL 4CADA 4DZBA 4KJQD 5B38A 3BPOB 3DGCR 4RRPG 3H8NA 1NBYA 3MUY1 5L6YH 4FQCL 1H3UA 1A4KB 3OZ9H 4UI2A 3I75B 1T80A 4ODHL 5IVXF 1IGFL 5AD0A 1GGYA 4UUJA 5D7JA 1T83A 3HI1A 1KLGB 2VLMD 4KI1A 2VMFA 1BJMA 1MRDL 1F58H 4KK6C 2CH8A 4PGDA 3ZDXF 3SGJC 4O2EA 1RUQH 5L2KA 4RGNE 1ORQA 5EBWB 1AO7B 1RIVH 4U7SA 1U8OA 4N0FB 1BOGA 4IHOA 3IJSB 4HKZB 3GBLA 3ZLQC 3O3AB 1KEGL 1AKJD 4JM2B 1QSZA 3K8KA 1IM3A 2E27H 5B38G 2CUIA 1UWXK 1A6TB 4PP1D 4QYOA 1J1PL 3MBEA 4PJHE 5C6WH 1BWMA 4I0PB 4WWID 2PYFB 2D7PA 4AEIH 3GSNA 2ZKHL 3QIBC 4XTRD 5E8DH 1G7HA 1LEIB 1NCDH 4PD4K 4GG8A 5BVJA 2BNUB 2X4NA 3VFRA 3W0WE 1FL6B 1DBJH 1DQML 1G9NH 4OQ1A 1BFOB 1BX2A 4AEEA 3CMOH 4WI5A 5EUKA 3VXRD 2Y6SC 1A7RL 1KJMB 3VXNA 2NY1B 4QHMB 5I2IA 1EZVX 3HI6H 4UAOB 2XZCH 4MAYD 3LEVH 3PGCB 3FJTA 4LNVA 1HEZB 4IMLA 2CDFA 1D7FA 3O2DL 1QFUL 1T89C 3D9AL 3BUYB 5GIRB 1GC1C 1CLZH 4I48B 4L4VE 4J8RA 1N59A 5IB3B 5EFIA 1BQSA 3BPOC 4CL7A 3U1SL 5JOFA 4TOYL 3MUGA 2HN7A 3O6KL 4CU6A 2QR0A 3HRPA 5TF0A 4Y19D 2FX8L 1GGIH 3CX2A 3TT3L 1A7BA 3AAZA 3B9VA 4A2LA 1HNFA 5E94A 3ARTA 4OFPA 1M71B 2HFGL 1UACL 4YBHA 1OWWA 4P48A 4XVJL 3QIWA 1U42A 1MCCA 3IAGC 1IL1B 5GS2H 3RL1A 1QRNB 1FFPA 3CCHB 4YE4L 3B2UC 3TZVB 3DUUA 2QHRL 3T8XB 3RKPA 2Z8WC 2AJZB 1JGUH 4M7LH 5BOZG 1AQDA 5GGVL 4YHLL 5HJ3A 5JNYA 4JM2C 5SWSB 4XGZA 1J1XL 4QRTB 4HULB 2AJVH 3MSPA 4NP4H 5ID1A 4UOW0 3CVHB 3U46A 5CKAA 5GGUA 3EKCA 4WTXA 4MJ6B 4CDHA 5ACZA 2YRPA 1GOFA 5GGSA 4WV1B 3U7WL 4G8EB 1YUHB 2NQCA 1K3ZA 1LDPH 4M9PA 1U36A 1KCUL 3ARRA 4WUUB 1DFBH 4I0PC 5I8EA 3HE7A 4LMQI 1B90A 5GGQH 4Q9RL 1XGYL 3C08H 1K8DB 3P73B 1V7NH 4XP6L 1NMBH 1TVDA 4F37F 5JMRA 3EFFB 3WNKA 2MCG1 4ZUWB 5HHNA 1ZA3A 5T1LA 4ZSOE 1FNHA 4NDMB 3REWB 1MCLA 3HAEH 1UH4A 4K94H 4XZUA 2NY1C 2E7LA 5IK3B 1I8LC 4UAOC 4AEHH 4MDJB 8FABB 2FWOB 2C4FT 1FYHB 3JV0A 4HZAA 3M07A 3SDXB 3CVIH 4ZTOL 1FRGL 2GEEA 2YEZA 3ZO0A 4TNVK 2NY2B 3PGDB 1HE7A 3MJ7A 4PJHA 2VZ1A 4PJ7B 1G0DA 3FRUB 1HHGA 4N8CH 4NBXB 1CDCA 1A7QH 4G8IA 4KKBC 3IJYA 5T3ZD 2DM2A 2V7NB 4XPTL 4WCYH 1NSNH 5KS9B 5F9JB 1Q9LA 1T2QH 3W0WA 3K80A 1JN6A 3U79A 4V2BA 4WFHD 4KK6D 1R3LB 2AJYL 3ULVC 4J12A 5EZLA 3TZVC 4OAWB 4HX1A 4CVUA 1F3DH 4KRNA 3EO9L 3TNMA 4MJIE 4M6ML 1YNKH 2HFTA 4L4VA 1UFUA 3C5SB 4Z7UB 2P49B 3WFZA 1S7VA 4PJHF 5ACLA 3GSNL 2Z35A 3SCMB 1F3RB 1P2CA 4MA8L 4YXHH 3JWDC 1WVZA 1IC7L 2VKXA 4WV1C 3QQNA 1J87A 2OQJB 1KNOA 5CJQH 3QIBD 2AJXL 4X7DC 4TN9A 1LO5A 8CGTA 4N90D 5DD6A 3C6LB 5FYLH 3P4LA 4DEPB 5BRZE 1MCEA 4X6DE 3EO0B 3CXHK 4OZGE 1ZEAH 1CXIA 4G6FD 2Y6SD 5E08H 4XP4H 5DA4A 1GZPA 5FYKU 1NCCH 5ESAB 3QQ3B 4F7MB 2X1XR 1NEUA 4WHDA 4YXKH 4WI8A 3ALPA 5C86A 5CEZD 3BP6A 3T2PA 5I1AA 5GRJH 2NY2C 4DGVH 4JFQB 4X7TA 4NCC2 5D6CB 1OTUC 4MA3B 4U6VH 4PY7A 4XNXL 1BQUA 1QR1B 4LF3A 3WNPA 4TRPH 2GJJA 4JB9H 4XCNB 2IQ9H 4Z9KB 2HRLA 4PJAE 4S1QL 4ZSOA 2VDRL 3WHE0 1R24B 5HHQB 1Q0XL 3RNKA 4QXTA 3MRCB 3EYUL 5HYIA 5ITBL 3ZT6A 2QQKL 2V5RA 4L3CA 3B2UD 4N9GB 2E6JA 3Q48A 4JHAL 1RZKL 1AO7D 4PJ8A 3RWFB 4U1NB 3HPLB 5F7EL 4XCCH 4M6NH 4YLQT 2ZOKA 5DVNA 4YHZL 1AR1C 2GT9A 1TPXB 4IRJA 1U91B 2F5AH 2YKLL 3SCMC 3RY4A 1VPOL 1RVFH 1VDGA 3P30H 4ODWB 3CMGA 4OT1H 5DURB 4LGRB 3WIIL 4XI5C 2XKNB 5A16B 2E9BA 2HVKB 5INCB 3HC3H 1EFQA 4I0PD 3DV4B 5ICZB 2IC2A 3WFEL 2MPAL 3FHQA 1ZHLA 5IW1A 1NGXA 4JANA 5GHWL 3C6LC 4W81A 4DEPC 5F44A 3C60A 4MJIA 2JJTA 2ZSWB 3T77B 5E7FA 5T1DH 1KELL 1IAKA 1IAOB 4EQ2A 3QNZA 2NY1D 5DK3A 3P11H 5CJBA 1JGVL 2M1KA 1LO2H 3CFKA 1PD6A 1TJIL 1FAKT 1FNFA 1NC2A 3O2WH 3WEXA 1FGNL 2KZ1B 3GM8A 4XMLH 1R3IL 1MIML 1Q0YH 4KZEH 3QG6A 2YZ1A 4NSKB 3FB7A 4WHYG 5TDNA 3DX7B 5GRVK 5KTEL 4KKBD 2B8OT 3LH2H 3BKCH 3SKMB 2KZWA 1ZLSL 4KDWA 5E70A 2YK1L 4LVEA 5BRZA 4RA3A 4X6DA 1XGPA 1H3TA 2DAVA 2FD6H 3QH3A 5HGBB 4OZGA 1QEWA 5F3BA 4YFLI 5D72H 9CGTA 3ULVD 3O41B 3TZVD 2X4SA 3PL6B 3UPRB 2BY3A 4NNPH 4JFFB 1F4YL 1QZ1A 1ROWA 4QF1B 4LLYA 2R69H 1QFHA 4PGCA 2VDKH 4WU5A 2IF7A 1QBML 1FGVL 4TTGA 1TPXC 3GSRB 2C3HA 1JK8A 1ZANH 1ZVSB 3T0EE 5F9AC 3RX7A 2GW5A 5IP4A 5SWSD 3JTTB 4OKVB 3FONA 1D6VH 1NDGB 5SWQA 3QXDA 2XA8H 5IMOA 4MCYA 1KYOJ 4PJAA 5C0AB 3ARQA 4P46A 3GI8L 4WI9A 1NUFA 4F3FA 4HIHA 2HKHL 4X6DF 5BV7B 1FIGH 3D25A 4LRIA 4OZGF 3FFDB 4WUUD 2DMBA 4AEFA 5JHDB 3K4ZA 4JRYE 4UTBH 2XZQL 1CDJA 4XPAL 4AG4L 3RVUC 4FS0A 1A1OA 1ONQB 3IDYC 1U6AL 1UZ6E 1R5WB 5KG9A 3V4PH 3FTGA 3WD5H 4F7TA 4K23H 2V5SA 2DQDL 1X6NA 2P7TB 3KJ6H 5FGSA 5C0NC 5I8OL 4TSCH 5H35B 1BZ7B 1AHWC 3VFSA 1CFSB 5KVGL 5JDSB 3ALXA 1NUNB 4X8JA 2B2XH 1YPZB 4FZEL 3TJHC 4YEFA 4PJAF 4KJYA 2NY2D 1OSPH 3HNSL 3CX5J 2FJHB 1D5IH 2X4PB 1OTUD 3BPNB 3FKUS 5FAAA 2IPKB 4QRPB 3C09B 5EIIB 1RZJL 1T3FA 1D5BB 2UWEB 3R8BB 3J7HA 1MCIA 3R1GL 1CGUA 5JW4N 3FO2A 1JWUB 2AQ3A 3LVEA 2HAZA 3WJLA 5ICYB 1BFVL 5IB4B 5J1AB 2P8MA 1UCTA 3AREB 2XWJB 2XWTA 5KN5A 4U6HA 2RFXA 3QJHA 1OP5K 2CXGA 3MRPA 4K8RC 5T33H 1UB6B 2D7TL 3PL6C 2GCYA 4LLWA 1H3PL 2HKFH 4MMXC 1BREA 2VXVL 4UBDC 1AR1D 4ONOA 3GMNA 4XVSL 2AXGA 1NCAH 4J3TA 1VGKA 3GBNH 3GMOA 1L9NA 4QCIB 5I1DB 1AIFB 1KJ2H 2GY5A 5D1QB 1DSFL 1CIUA 4PV8A 3S5LA 3VFUB 3SCMD 4CVZA 2R0LH 2MTPA 5DYOB 1WBZA 3IS1X 5DRXB 3VXRE 4HS8H 2X1QA 5BV7C 5ETUB 5E8PB 3T4YB 1G0YR 2JIXA 4XCFH 1INDH 5JIKA 1OAZL 4P9HC 2PNDA 1MLCA 2UV3A 3C6LD 1IQDA 2PTVA 3N9GH 4L1DA 3SO5A 2X4TA 3GRWA 3IDJA 2CRMA 3TBVB 1R3KB 2OJZH 4Y19E 5HGDA 3T0EA 4ELME 4YDVA 1OB1B 2NY7H 3L3DA 5HPMA 4LARL 5DHYA 2BC4B 3BIKB 2A1WH 4P99A 3SE3C 1Q72H 3PP3H 1G7MA 1HINL 4ONGH 3S5LG 5GISL 1U9KA 3WHXA 2YSSB 5F9WB 3BPNC 2DWDA 2VXUH 3C09C 1LMKA 4JRYA 4DN3L 2OR8A 2ZNXA 3H3PL 4G3YH 3CSPA 3TBTB 1I4FA 4LFHG 4LCUA 1KTKE 3KS0J 2AGJH 3ZYOA 1I1CA 1CXEA 3AREC 4I77L 4L8DA 2V2TB 1YY9C 4CN1A 4OF6A 2DB8A 3B2VL 2DMKA 3RDTB 1A7NH 3WNLA 4EQ3A 1MAJA 2YD3A 1XF3B 3DRTB 2CJUL 1X4XA 2ADIB 4HW6A 1Y18A 1WEJL 4N0YH 5D1QC 1VGEH 3DOSA 3OJMB 4Z6AT 1UA6H 2FX7L 1EHAA 2XNAB 4XC3H 4RMQA 1WLHA 2APFA 4ZTPH 1ZE3C 4Z77A 3PQYB 4OV5A 1BGXL 1SYVB 4NZTL 2WWKO 1UZ6F 1ZVHA 2X5PA 4CMMB 4HG4K 3VFPB 1AKJA 4NN6B 4F7CB 1FYTB 4LSQL 3BPCB 4LAQH 2R0ZH 3LSOA 3GJFB 1D5MB 2H8PA 2EDOA 3WDHA 2ICWA 4MB4A 1A6AA 3QNXA 1QFWI 3RVUD 3I50H 1FSKB 1BJ1H 5J06A 3NFPA 5FK9B 3LKNA 3QIUB 4XP1H 4HS6B 12E8L 4P4RB 3SJVE 3MA7A 3LEYL 1FFNB 3S4SB 5C0ND 3HZMA 3O45B 5K33A 5CILL 5CMAA 1FNSL 4ZD3H 2D0GA 5H8DA 3PGFL 3MO1B 1MFBH 1DQJB 2C7UA 3TJHD 4PJ5D 1S9WB 3VXRA 4HUXB 5KVFL 1A1MA 5F9WC 3O11B 4CN4A 4GJTB 4D3CL 3V4UL 3MV8B 3D85A 1N64H 4QO1A 1RMFL 2I27N 1HXYB 3FOMB 3GIZL 3LIZL 4O58L 4M8QB 3FB8B 2PTUA 5L0QB 4Q9BA 4Y19A 3ET9F 5FYJH 1IGCH 4MB3A 3RDTC 4ELMA 5JXEC 4OZIB 2CLVA 3RNQB 2FL5B 3JV6B 4K8RD 2R2EB 3FT3B 3PL6D 3W9DA 4WHTB 3UBXA 1F4XL 3BIBX 1G9NC 3QHZH 1MFDH 3HAEB 4UBDD 5J11B 1J0HA 1NBZA 3FFCB 5C8JB 4WI7A 4EXKA 2Q3ZA 5CD3A 4JQXC 1X5IA 4MNQE 4RMWA 5DJAA 3KYMB 2LU7A 2OTUB 1ADQA 1WGOA 5DVOA 3NAAL 5C0AD 3BSZH 3V5KB 3D87B 3IU3B 4LHUG 5EOCL 2E7MA 3KDMA 4JPVH 4NN6C 4FMFA 3DBXB 5ECJE 5JHDD 1BLNB 3AY4C 1QVOB 4ELMF 4H0HB 2J6EA 1DDHB 3CFJA 5C0DA 2O5ZH 1TTUA 3T0VA 1FJ1B 1FSKC 4RISL 1U8LA 1CLCA 4JR9L 3DTXB 3QIUC 4HZLA 1ZV5A 4M48L 1NJ9A 1S9VB 1JUFA 4IS6B 1SEBB 4OUUA 4XBPB 4YX2H 4I18A 4P4KB 2V9TA 3L3JA 2Q8AL 5T3XE 4PY8I 1DQDH 1NAMH 1IGYA 1ZT7A 3EO1A 5AG8A 1NANI 4QKXB 1H15A 2X4RA 3MNVA 1R3JA 1P1ZA 3ARXA 4NQXA 1KCRL 2F15A 4ZXBA 5DJ6A 2RB8A 3O4OB 4QRPD 5CWSA 3MOBH 1JZ5A 1AO7E 3NOIA 4EDXA 1OM3H 3QHTC 5HVGB 4P2OB 5IW6B 2W07A 3SE9L 5K9QI 3X3FL 2IAMB 2A6KA 4U3XA 3D1MC 2FYYA 1YMMB 5TF1L 4FFZL 5F7UA 6CGTA 3SJVA 4RWYL 3ARED 4M3JA 4XPBH 5L0QC 1SVCP 2C1OA 1YY9D 4HCRL 5FXCH 2CIKA 4X0KB 1MQ8A 4OJFH 4LDOB 4NYLB 4XXDB 3I3BA 4LCCB 4DQOH 2GFBB 1VEOA 3A6OA 5I1GH 5IB2A 1TJHL 3FB5B 5ID0A 5J11C 3G6JB 3H9ZA 3QJFA 3VGBA 5DUMH 4K94C 2ENSA 3HS0B 3U7AA 5E8NA 4B0MM 3RFZC 5D1QD 3EDEA 1EGJA 1H8NA 3TNNA 3NCJH 2Z93A 4C54A 4OCRH 1F8TL 5F8QC 4OCXH 3F58H 1GGCL 3UJIL 5HXMA 2QQNH 3T4AA 3SBWA 1CFVL 2HJLA 4TUJB 4LASL 3MRFA 3Q3GB 1FFOA 3FQTB 4CVWA 3C6SB 25C8H 2AJUH 4LU5H 1KIQB 2C26A 3ILPA 1S9YB 1JNNL 2VISB 1KT2A 5DDHB 4DZ8A 1CXFA 1OTSC 2VITA 4EUPH 2P8LA 4F8QA 1A0QH 3LRGA 3O6FB 4PR5A 1FV1B 3QIBA 4MNQA 1I7TA 4P4KC 2BFVH 1C5CH 1KCSH 1XF4B 2NZ9C 2YPVL 2DLTA 1QO3A 1ED3B 1JWSA 4LAJH 4Q6IB 3MRKB 2P44B 4IM8A 5CIPH 4HMDA 4QXGH 3G5XB 3NH7H 1MY7A 1JGLH 4JKLA 3O4OC 5C0BE 3B43A 4GW1A 2Y9RT 3PWNA 4P2OC 1KPUA 3ZL4L 2PW1B 1T89A 1A3QA 2DYPB 5DD0L 1P6FA 3I02B 5FA4B 4K9EL 4E5XA 2WINB 2QSTA 4PRBA 2W1NA 4WW1B 3WN5A 4Y0GA 5HDQH 3HMXL 4PFEA 4DN4L 1FH5H 5TE6H 1Q38A 5IFJB 3RDTD 5JXED 5FGCE 1ACYH 2VLLB 3I75A 3CXDH 4LCCC 1G7QB 4UQ3A 3PWLB 1AXSB 1G6RL 4FTVD 2PYEB 2WWKT 4WEBH 4I2XB 4XPFH 1KLGA 1M6OA 2OL3H 1TITA 1PEZA 3HPJB 1WC7B 4WFFE 1AD9B 3G9VA 5T5FH 4AL8H 1KGCD 1DBMH 4HXBH 4NN7B 1AO7A 1NEZA 3GMQA 2B0SL 2D4FA 4S1RH 1FG9C 4JZJB 4NKMA 3WL9A 4TUOB 3IJSA 2APWA 1FZJA 3B6SA 4CU7A 5CHNA 2W9DH 3QQ4A 3PQYD 3TO4B 1FYTD 5GRUH 1DN0B 3FOLB 5A1AA 5ITFB 4OZ4A 3SDXE 2FZ3B 2FHFA 2XZZA 3PWVA 4L3EB 1YEIH 5EUOE 3QIUD 1F90L 1TQCB 4IOIB 4JFEB 4OCSL 2N7AA 1FLRH 2PYFA 2WQRA 5GS2D 1AXTH 3QWRD 3O6FC 4UILH 5HVHB 5BMFL 4D0DB 1LEIA 4F2MB 1L0QA 1IEBA 4JVPA 2VUOA 3HMWH 5IJVB 3VDCA 1MFCL 1FL6A 4LSVL 4UT7L 3UJJL 3GHEL 2VL4A 4Q6IC 4Q7DA 1BFOA 4Z78A 1NEZG 4XBEL 5IKCB 2AJSL 1I8LA 3S6CA 5BO1H 4JM4L 2VLRE 3MRGA 3VA6A 4IRSB 3MV8D 2DTSA 4I8DA 4NFCA 3NVQA 4KC3B 2Z8VC 2VLKE 3L1OH 5IB3A 3FT2B 5FV2A 1PZUB 4KJPC 4JQIL 2DQIL 1P4LB 4WI3A 2RJMA 1EGJL 3OMZA 2VDQL 1I3VA 4PJCF 5JXAL 1MOEA 3U2SA 5E8OB 1CD9B 2MFNA 2COQA 2J8UF 2H26A 3GK8L 4L4TB 1EPFA 3QNYA 1UJ3C 4Z7WB 4NO3B 4OFKA 3FFCD 1JVKA 4G9FB 4TUKL 3UX9B 4D0BB 2HWZH 4PRNA 5GJSL 5C0BA 4HWBA 4NN7C 4OD3L 1C5BL 4JZJC 5C70A 2W59A 1IEAB 3RAJL 1J0KA 4JJ5B 1MAML 1U2CA 4EJ1C 4HIXH 3TO4C 2GJ6B 2C1PB 5J9PB 1E6OL 2J88H 3HNTL 4PTTA 3B9KB 1GAFL 4G80B 2BCKB 3FT4A 3WBDA 4WV1A 5C0FB 4G8EA 1OTSD 4I3RH 4LCYB 3SO3B 4XWGH 1TQCC 3JZ7A 4ZOBA 4D8PB 4JFOB 4NWTL 5A2FA 4KUCD 4QLRA 5HVHC 2R1YB 4OFYA 4P4KD 3ZE2E 5EZJB 4NJAL 1KN2L 2GJZB 2IBGA 2NZ9D 4ZUUB 1DEDA 4ZUWA 1JNLH 3U4EB 1MVUA 1Q9KA 1DP0A 4UT6H 1HQ4B 5D7IB 2CKBH 2H32H 2DQHH 4JHZA 4D9LH 4U6TA 4CW1A 1PG7W 8FABA 3AVEA 4HJJL 1W72L 4IRSC 5T3XL 5E5RB 3SDXA 4P2OD 3Q6GH 1SYSB 3AM8C 5DQDH 5EUOA 4YFDB 1YMMD 2V5MA 4LRNH 5KSVB 5BS0B 4EBQL 1KENH 3AS0A 3GMRB 3FRUA 4S1SH 1J0IA 5LBSH 1ACZA 2OSLB 5BJTB 3STZB 3HB3C 4PTUA 4PJBE 2DKUA 5FYLD 4K7PL 5IB5B 3BDYL 3KAAA 3LV3B 3V7AE 3TV3H 3HC4H 1OGAB 4M03A 3VRJB 4K2UH 1Q94B 1K5NA 4P5KA 5E2WL 5F96L 3T1FB 4AIZB 5IB1B 1R3LA 5MP6H 2BXYA 3UJTL 4RQQB 2VLRA 4NUGH 3SDXF 2OJEB 2X4QA 4LCIL 3RZWA 3EYVB 1NCBL 2VLKA 2Y23A 7FABH 5EA0L 5EUOF 3ALWA 2DQEH 3VFVB 4P23C 2JCCB 3B9KC 3SDYH 4JPKL 3UMTA 4HWEL 2YUXA 5F1NB 4FFWC 4WJ5B 2OMNA 4O5LL 4X5LA 2CGRH 4PJ5E 2FBJH 5EBGA 4GRLA 2Q7YB 3SO3C 5D6DC 2OQJA 4HIIA 1PLGL 4U05A 3O6FD 1W0WA 4MGXA 1CXKA 3K46A 3F12B 3TIDA 1MHHB 3BKMH 2O5YL 1JHKH 3NA9L 3UTQB 1EK3A 1CG9B 1U3HD 2CLZB 2A2QT 1PX4A 3IXAB 4LIQL 3DWTA 3E2HB 3MRQA 4D9RE 5KOVC 3VXTA 2GK0B 4OD1L 5DC9B 3ECBA 3LN4A 5TFSH 5JDJA 5FUOH 3F7YB 2DIBA 1INEL 3V6OC 1A6UH 2W38A 5DQJA 4HUKB 4QNPE 3EOAB 1MELA 2DYPD 3ARWA 5D6CA 4KJPD 5IVOA 2HH0H 4MA3A 4TSBH 4TNWF 3I6KA 1T1YB 3L3IA 1QR1A 4C55A 3BIAX 4KGLA 4OD2A 4WO4B 4BFEA 4XCNA 3WIFB 4NWUL 4FQCH 4Y16A 2PYED 4LLVA 1R24A 5HHQA 4ODHH 4R7DB 5DS8B 1IGFH 5SX5K 3SDAB 5JHDE 4YNYB 1FFQA 1MRDH 1B2WL 4FQ2L 4OF8A 4X9HA 2FH6A 1LE5B 3SPVB 3DO7A 3MRLB 4GQ9L 4U1NA 4WWKB 2LU3A 2F8XC 4X9IA 4DJMA 2KUTA 3TO4D 3QDJB 2AAVA 2AERT 3C2SA 5IHBA 3D5OF 1I8IB 4J7RA 2IBBA 5IQ9B 1VFAB 3RJDA 1KEGH 1QRKA 1X7QA 4PJBA 2LU4A 2D9QB 5IF0A 2VQUA 1UCBL 1YPZE 4L3ED 1KCLA 1J9CT 5DSCA 3QI9A 3ARSA 3IFOB 4JFED 2EE2A 1J1PH 1SMAA 3TESA 1GSMA 5ICZA 2IADB 4GKNB 2R4SL 4PG2C 2UWEE 5L2JA 1D9KB 4JVUA 1EHXA 2DLGA 3F62A 2ZKHH 3ZHKA 1CXLA 5AYQA 3SDCC 5DLML 4JLRB 1IAOA 5HY9B 3E2HC 3VXOA 5DJCA 1I3RB 3HUJE 1AHWA 5E5MB 1A47A 3ZKMC 4IRSD 1A7RH 5EU7E 2D31A 4PREB 4PJBF 2DWEA 5FO9B 5F1SA 4PJ5A 3IGAB 5IROC 3O2DH 4LEOA 1QFUH 4PRAA 3D9AH 2PKDA 2GSGB 2F53B 1RHFA 5GS1B 4U1HA 3MV7B 5F7MC 3HB3D 3U1SH 4TOYH 3V7AG 2WANA 3O6KH 2FEEL 4WO4C 5CBAB 4AIXA 2HJKB 1IGJB 1JF6A 3DX9B 2FX8H 5JW3L 3SHSA 1WUNT 3TT3H 1KULA 4L4TD 2ZUWA 4PJIB 3SDAC 4G9FD 2HFGH 2A6IB 1UACH 3OXSB 4XVJH 3ARDB 1NAMB 3WS3B 2OK0L 5E1HB 4F7EA 1FN4B 4QF1A 4WWKC 5HGAB 4YE4H 1FORL 2QHRH 5DT1L 1EEYB 2RCSL 2WBWB 2W91A 4KDTC 4P23D 5GGVH 1CVRA 4YHLH 1MY5A 3B9KD 2HVJA 5GGRA 1TMCB 1J1XH 3RI5K 5D93B 4QXWA 3KJ4C 1KJVB 1C12B 1Z9MA 4R96B 3K81A 5K9KA 1RQ5A 5ABDE 3OJVC 2VL5A 5KSUB 3VRIA 1B6UA 3U7WH 5JHDA 2IH3B 3TPUB 3IVKA 1B6DA 1D9KC 1KCUH 2AEPL 4OM1L 4OLYL 3VDAA 1YJDL 3SY0B 2ICEB 2DQJL 5E1AA 4Q9RH 1ONQA 1QQDA 1XGYH 3IETB 3T65A 5I76B 4XP6H 3VFMA 2V9RA 5IEKA 5E9DE 15C8L 1HZHL 4QNPF 4HMCA 2YMXL 5DZLA 1FC2D 3AU1B 5ALCL 3OR7A 4LVHC 4YC2B 4FTVE 5JDSA 4HK0B 4HFUL 2WBJB 2FSEA 1P9MA 3MTRA 1YPZA 1MVFA 3NCBB 3E3QE 3NCFB 2BNRB 1FRGH 4ZTOH 5TDPA 3HLAB 5BS0D 3KPSE 4HK3N 5JORB 2IPKA 1KGCE 2ZCHL 3NCYS 5EIIA 2JB6B 3LAFA 4L8SA 4CU8A 1D5BA 3KR3L 1XAUA 2UWEA 5GS1C 4U1SA 5JPMA 1FPTL 4HKBB 4QXUL 1FVCB 1JWUA 5F7YC 3BESR 2ZUTA 2MCPL 2EXYC 4XPTH 3S37L 5IB4A 5J1AA 1OGAD 4IOSD 5DWUL 4G8GE 3AREA 3BT2L 4EUPB 4F9LC 1SMOA 4NOBA 1UB5A 3C5ZB 5IOPA 2P5WE 3ARDC 3HUJA 4D2NA 2IQAB 2AJYH 2RAMA 5KW9L 1N4XL 4EN3B 4JN2B 3L5WB 2F8VA 3EO9H 3DVNA 5CIPB 1CS6A 4M7ZB 3SGDI 2EDHA 4GAJL 4M6MH 3LEXA 3VFUA 3LMJL 1BFTA 2J1KA 2UWEF 4YHNA 5DYOA 3GSNH 5D93C 1EUUA 1N26A 4C56B 3KVQA 1A3RL 4MA8H 5MEOA 2F9BT 3V4VL 3ISWA 3RX8A 3T4YA 1IC7H 3Q5YA 3BHBB 1DUYA 2VZSA 3OBAA 2H2PC 3WMSA 1DR9A 3HUJF 3RWGB 4LSUL 1HOCA 2AJXH 3SDCD 1A6ZB 4DVBB 2OL3B 3P9MB 5DRNB 1YY8A 4JFPB 5CZKA 3OQ3B 5DQ9B 3C8DA 3ZKMD 1HWGB 3BIKA 4YC2C 2WBJC 1XF2B 3U48A 2WMPA 3LRHA 3FFCE 3MMEB 5TQ2L 3BISA 1IAIL 3RWIA 5JR1L 3PABB 3H9HB 3OGOE 4GMTL 1UM5L 5T1MB 3QUKA 1TZHB 5EWIL 4WO4D 2P46B 2FO1A 4XNXH 3SQOL 3HE6B 2Z0BA 5E9DA 5ISZB 5DTFB 3VG9C 4KKLC 4XX1E 2DM4A 4S1QH 2V2TA 2VDRH 5GGTL 3SDAD 4OCNC 1Q0XH 3RDTA 4NRYB 3C5ZC 1JNHB 3CDGA 3EYUH 4WFEE 5IJKC 5ITBH 1JGDA 2QQKH 3DUSB 4FTVA 5F7KC 4WWKD 3QQ9C 5EB9A 3EW3B 4EN3C 4JHAH 1RZKH 3BD3A 5F7EH 1WBXB 3KXFB 1NFKA 3NABL 4JQXA 4M7ZC 3QDJD 4YHZH 3KPSA 3MLYL 1F5WA 3WUWB 1CGSL 1U93B 2WIIB 1RK1A 4Q0XL 4PGBB 1MLBB 2GTZA 2YKLH 1GGUA 1VPOH 3RA7L 3PDDA 3WIIH 1Y0LB 4ZO8A 4JY4B 1C08B 3K8LA 3PV7A 3FMGL 5FYJD 3AY4A 1D5MA 3BGMB 2P5WA 4O51B 1NC4D 3BWAA 5J3HC 2VWEE 1U3YA 4ACPA 1YMME 5FK9A 2YOCA 3WFEH 2MPAH 1RU9L 3QIUA 4APQA 5GHWH 4UINL 4X6FB 4XBGB 4W6YB 4H5SA 4X6CB 3QWRA 5JIIA 1EZVY 4V1DE 5JMOC 1B88A 1A8JH 1KELH 4AT6A 5I1IL 5FYLE 1X5ZA 5AYUL 2WV3A 1KLUB 5DD5L 2YRZA 1DQJA 1JF1A 1JGVH 5K93A 5J7CC 3ZYJA 1JZ2A 2R2BB 4F33B 4HUXA 3UTTB 2VZ3A 1TJIH 1FGNH 2ARJA 3AS2A 4HIJA 2R29L 3ZDYE 1R3IH 1MIMH 2F53D 3DXAB 3ZSTA 1II4E 3MV7D 1T5XA 5E2TL 5KTEH 2YD7A 2J12B 1DZBA 4K71B 1ZLUH 3U6RB 3FOMA 2EXYD 3HE6C 3UDWA 4O2FA 3AMLA 4M8QA 1ZLSH 1HHIA 2YK1H 2A0LC 1NGWA 2HLFC 4XHJC 2FL5A 1UQSB 3ARDD 4WHTA 2IJ0C 4HHAB 1AI1L 2XN9E 1FVDB 3VXUB 5D2NB 3SDDD 3UCRA 1F4YH 4U1IB 2CKBB 3UP1A 3FFCA 2H32B 1QBMH 2HFFA 2J7LA 1GXEA 1FGVH 4NHUA 4H1LB 5D8JL 1HCVA 1CF8L 5E7BA 1B0GA 3GFUA 4LLAA 4GG6B 4I4WA 2JJVA 4AY0A 2D7QA 1BWWA 3IU3A 2FECL 5KJRL 3GMPA 1HDMA 3FHAA 1IKNC 3GI8H 2XRAL 4UZGA 5F97E 2HKHH 4N1HB 4UNTA 3V5DB 3MRDB 2B5IB 2H2PD 3WDJA 3VH8B 2HLAA 3REVB 4BH8A 5CZXC 1R5IB 2Y7QB 4JPIA 2XZQH 1IARB 1KTDA 3DTXA 4XPAH 1CLOL 2FX9L 4YK4B 4AG4H 1HILB 4HXAL 1U6AH 1OQXA 3MLRL 3S96A 1NCUA 1QHOA 3S36L 1ITCA 1AGCB 1S9XB 1Z9OA 2DQDH 5D1ZB 4KVNL 1S7SA 2DQCL 2WBJD 5I8OH 2Z92A 1QSFB 5IUSA 1JHTB 1A6VL 5KVGH 1J86A 1S5HB 2HTLC 1CWVA 1UWGL 1B0RA 4FZEH 3VGAB 3VJ6B 3QXAA 3HNSH 3IFPA 4Y4KB 4XX1G 2R4RL 1RZJH 3O6ML 4WI6A 4D9QD 1YEDB 4MNHB 1SJEB 4K71C 1YMMA 3R1GH 4JY6B 1WZLA 1IGTB 4G7YL 1CDUA 4KKLD 3GDBA 4XNQA 1BFVH 1RURL 1YEJL 3VFOB 1HXMB 2MKWA 1RZFL 4KUCF 4HKJA 3C5ZD 1FNAA 3B5HA 2F54B 2A73B 3QQ9D 2D7TH 3RRQA 4HPOL 4EIZC 5D2NC 5F88B 4WHYH 1H3PH 4PJ9A 4YEEA 3KLSA 3HS0A 2VXVH 3X17A 5KSBB 5CJOL 3VWJB 1ZHBB 1RPQA 4XVSH 3U36B 1WJ3A 5EO0B 1DSFH 4X7CC 3JSSA 3P4OB 5JOPD 4NNXA 4C56D 1F3JA 1GGTA 1KXQE 1FC1A 3RWHA 1MFAL 2YD5A 3GSQA 1FAIL 4TUJA 3SOBL 3Q3GA 3FQTA 3PIQA 3VXMB 3FCTB 4TNWK 3O3EB 4XVUC 2B5IC 5J3HD 4K7PX 1S9YA 4DGIL 2VISA 4LP5A 2YBRA 1OAZH 2XN9A 2YD4A 3VFWA 1VKXB 5JPNB 4YK4C 2OTPA 3QISA 4DKFL 4L3AA 4IEFB 1JYXA 1CBVL 3ZDYF 3RIAF 3L5XL 3FQXB 5D1ZC 2YD2A 4HEME 4N5UA 1Y6KR 3TBSB 1ETZB 3ARBA 4LARH 1U3HA 4L4TE 1MNUL 4Y1AE 2A6DB 3S7GA 5CJXA 1F00I 3ESVF 3V0WL 4F7PA 1HINH 2EIEA 5GISH 1SHMA 3TEUA 1XCQA 3DV6B 1E4KC 4ZFZB 4Y4KC 3AUVA 4DN3H 3DYMA 1IEHA 1GOGA 3H3PH 3JTSB 2DYPA 3HE6D 5A43C 1LO3L 4QTHA 3VI3E 5ISZD 4CUCA 3BZFB 3U9PL 2WINA 4RGOL 4WW1A 4NO2B 2A0LD 3QO1B 4XHJD 3U0WL 1CE1L 2ZSVB 4I77H 2VLLA 1UXSA 2XACC 5FKPB 2FGZA 4GMSL 5AZEL 3B2VH 3T2OA 2IGFL 1N3NB 3OKEB 1BBDL 1M4KA 2A6JB 3B5TA 1SJHB 2CLRA 1UJ3A 4QRSB 3K2UL 4J3UA 3HPJA 4LLMB 2CJUH 4E41B 3VWJC 2I24N 4ZDHA 1WEJH 5FB8B 2C4XA 3M1BB 4CJ0A 4X4XB 2FX7H 2N4IA 2L7UA 1PQZB 4R0LA 1KV3A 1KJ3L 4XWOD 1IBGL 1BGXH 4NZTH 1QLEL 2X1WL 5I15L 4LSQH 3LKSB 4PLJC 3OPZL 3QULB 4M6OL 4ODVL 3V6OE 1EIBA 5CZXD 1BM3L 5HBBA 5BS0E 1FCGA 3GKWL 2DIAA 2DI8A 4C57C 4F15B 5D9SB 2IH1B 4JZOA 5I1JL 4KH2A 2EH7L 12E8H 1ZHNA 4D0DA 3MGOA 2EDTA 1ULVA 3X13B 4F2MA 4E42B 3LEYH 2J5LB 5IJVA 4ZQKB 4Z7OE 5CILH 1FNSH 5JOEA 1BD2E 3PGFH 2HTLD 4N1CA 1GOHA 1UWEL 3UTTD 3TLRA 4JDZB 3ZE1E 3DXAD 5KVFH 4IRSA 1PZ5A 3PUCA 3CH1B 1V8HA 3KNBB 3OHXB 4YJZL 4Q9QL 4D3CH 1CTNA 3V4UH 2Q86A 5IVXB 1CL7I 3U4BL 3K4AA 3TN0B 3FT2A 1Q9WA 2C3WA 2VABB 3VA2C 3ULSA 1RMFH 2JCCE 4U6YB 4AMKL 3GIZH 2A83B 2ICWI 1P4LA 2ZUXA 4JKWA 4WVRA 3ME0A 5EPMA 3LIZH 4O58H 2G5BB 5F6HI 3X14B 5EIQA 3WO3B 4MZ3A 4JCMA 5KOMC 2BOBB 3ELAT 4TYUA 2AK4B 2EDFA 5F7LB 3VXUD 4L4TA 4P2RE 4Y1AA 1F4XH 3L5IA 3OX8A 4D0BA 4G8FA 2A38A 4YHKL 1DJSA 4DZBB 1ZSDB 4X80L 1NBYB 5F9OL 2Q1EA 5I1LA 3F7PC 4K3JL 1LEGB 2UY7A 5BZDB 5B3NA 5F3HA 5AD0B 4M61A 5D7JB 4P23A 3NAAH 1FIEA 2C1PA 2ARJQ 1CYGA 2ITCB 3B9KA 5EOCH 3D0LA 4Y4FA 1E4XI 4G80A 4PGDB 4XVUD 4RMUA 1U41A 3QWOA 4LCYA 2Z8RA 3QUYB 4RISH 1BOGB 4IHOB 4QT5A 5D6DA 4BQ6A 4F15C 4HT1L 2C3XA 4GFTB 4JR9H 4M48H 1U8KB 5EZJA 3UBXI 2GJZA 5D1ZD 1RZ8A 2J5LC 3U4EA 2Q8AH 1S7TA 1MREL 3VD5A 1QSFD 3GJEA 1WCBA 3IU4L 4U0QB 1EEUA 3OKLB 4QYOB 5FM8A 3VI3F 1KJ2A 5A3IC 3RWEA 1J1OL 1JTPA 4FXGA 1KCRH 1JWMA 3GSNB 4PJFF 4Y4KD 3V6OA 5CFHA 2V5YA 3N1PC 3ZTNL 1G7HB 3TN0C 2YZ8A 3SE9H 4GG8B 4Y2OA 5BS0A 3X3FH 5BVJB 3MXVL 1HYRC 3OG6B 1WITA 4ZFGL 5TF1H 4FFZH 5EUKB 1DL7L 4RWYH 2F54D 4HCRH 1P7KA 3OB0H 5EU5B 1I9IL 1HQRB 3LV3A 4PS4L 2OCFD 4IMLB 2YC1A 1BD2A 4TVPL 1Q94A 2Z4QA 4LCWD 2PTTA 3T1FA 4DTGL 4J8RB 1N59B 5FYJE 1TJHH 5EFIB 2MWCA 3VWJD 1PKQE 1TFHA 4HJ0D 3MACL 2EC9U 5F93C 5JOFB 3MUGB 2HN7B 4NM4L 4CN6A 2QR0B 2BVOB 3KPTA 4HUUB 4L8CA 5IFHL 1GIGL 2AV1B 3ZSSA 5L7XL 2O26U 3DETC 1F8TH 4KRPB 5E94B 3VFVA 5D7JC 2JCCA 5IMMB 1T83C 1GGCH 3RWDA 4NO0A 3UJIH 3QIWB 5DJYA 3IRPX 1CFVH 1N7ML 5F1NA 1S5IL 4JN1L 4PLJD 4WJ5A 3RL1B 3R0MA 2ZNWA 4LASH 1FFPB 1RFDL 2DS4A 1JRHL 5FGRA 3DUUB 3S37X 4ORGA 4Z7OF 2Q7YA 5I9QB 3QUYC 1JNNH 4P2RA 3RX5A 5KANG 3MGTA 3L7EA 2F53E 1AQDB 1FNEB 4PG2A 4NQCB 3MV7E 5HJ3B 5JNYB 2X10A 2WUCL 3ZE1F 4NPYA 4XGZB 1SBBA 1PX3A 2Q6WA 4UTAL 4GT7A 3SDCA 4M8VA 5ID1B 3RU8L 1TENA 1WTLA 2EYTA 2CLZA 2YPVH 3U46B 4PJIE 3QEUA 5ACZB 3Q5OA 1F6AA 3GEWB 2JCCF 1DLHB 3GSVA 3HNVL 5F71A 3EJJX 3IJHB 5CLTA 3HE7B 3F7YA 1ZGLA 5M94B 3LPWA 3WFBL 3UZVB 5IROA 1I3GL 5DHXB 5HHNB 1ZA3B 3ZL4H 3GKZA 5T1LB 1Z6JT 4MXWL 5HHPA 1MCNA 1R0AL 2ZP0T 5DD0H 4DKAA 4K9EH 1Z9LA 4PYHA 4XZUB 4WO4A 4ZS6C 4HBCL 1MCKA 3HMXH 4DN4H 2I07A 4X9GA 2J4WL 1F6LL 3TPKA 4ZO9A 2K7PA 1T7VA 1G6RH 2YEZB 1JYVA 3SDAA 1VENA 4E41D 3KPPA 1U8JB 4PJHB 4JREB 1HHGB 1LE5A 3SPVA 1MCOL 1GZQB 5DXWA 5BCAA 2XT1B 2B0SH 4QRUA 1DCLA 1BJ8A 5DUBB 3EJZC 1Q9LB 4KRPC 4XAWL 1EO5A 3W0WB 5IQ9A 2ZG2A 4MX7B 2XPGB 1N0LA 3PHSA 4XCEA 1H9VA 5EZLB 5SX4H 1X6LA 3DVFA 4PGEA 1IQWL 5I9QC 1N5YL 2ATPB 3TNMB 3LKOA 1UM6L 2IADA 2OI9B 4GKNA 4L4VB 4YBLB 1F90H 5C9JB 1PKQA 1X5XA 5GXBB 1S7VB 4OCSH 1NC4A 4J23A 2FATL 3MQIA 4D9QE 1RAMA 2Z35B 5BMFH 1P2CB 5LGKA 1MF2L 1QBAA 1RZKC 1EEZA 5DMJB 2FJGA 3P0VL 1MFCH 1E28B 5CKGA 5HY9A 4LSVH 4UT7H 5A3ID 3ESUF 4TULL 3UJJH 3GHEH 1VFBB 4XBEH 4I1NB 3V0VA 3L95A 5E5MA 3RQ3A 2AJSH 5FO9A 4JM4H 1LO5B 1ZVYA 2D03L 3IGAA 5DD6B 3TN0D 3R4DA 1BZ9B 3MRIB 3O6LL 3KLDA 4GKZA 5B21A 5D7LE 5DVLA 2F53A 5GS1A 3MV7A 4JQIH 1YYML 2DQIH 5CBAA 1SJVA 5JOPE 1GZPB 1UGNA 1EGJH 1XEDA 2RGSA 3PDOB 4N68A 4KMQA 2AK4D 2VDQH 5JXAH 4F9LA 4PJIA 4YQXL 5I1AB 4G6ML 3GK8H 3DECA 4RMRA 3W81A 3PWPE 4XNUL 4X7TB 4JREC 3EZJB 2JE8A 4TUKH 3UZQA 3QZWG 3GSOA 3P4MA 5GJSH 4OD3H 1JPGB 3SDDA 1U58A 1MHEA 1C5BH 3J8F7 3L3GA 3DETD 1L6XA 4ZSOB 4B7LA 5D7JD 5DR5L 3GMMB 3RAJH 4QXTB 1MAMH 2HJFB 1E6OH 2BOCB 3HNTH 4L3CB 1VADB 5C3TA 1KJVA 1F45A 1GAFH 5FDWA 4OGAC 4R96A 4YZFE 4PJDB 1NPUA 4GXUN 3QUYD 2OZ4A 4ZFOA 2ZOKB 2GYSA 5F1IA 2GT9B 2VH5L 4YBLC 3BGAA 2H6PA 5EG6C 4LOUC 4NWTH 4MB5A 1WAAA 1CU4L 4OLZL 2R0WL 4U3CA 5I76A 4NJAH 1KN2H 4GXVL 3FAXA 3C2AL 1IKFL 3CZJA 3OJDA 3PJSB 2WK2A 4OFDA 4WDIA 3NIGE 3AGVA 3OKKA 3S97C 2G60L 3RPIA 3MLSL 4HJJH 1W72H 1WWAX 5T3XH 1ZHLB 3A6BL 1NGXB 4JANB 2B1AL 3HLAA 3C60B 5JORA 1AGEA 4MJIB 3TA3A 2JB6A 2X7LB 4BYHA 4EBQH 1IAKB 4LSRL 4YBQC 1ORSA 4ZS6D 3QNZB 1EFXA 4Q6YA 3SKOB 3QCVL 3JWOL 4K7PH 2IFGA 1NC2B 3WEXB 3BDYH 5TGBA 4CMHB 5B8CB 3C5ZA 3RIFF 3QG6B 3S36X 3P9LA 5E2WH 3FB7B 5F96H 5TDNB 5TQ0L 4XXCC 3GMLA 3RIAK 3CFDB 3UJTH 3ARVA 1JF5A 3SQBA 3QFJB 3C5JB 4X6CE 3ROLB 3EJZD 4LCIH 4KRPD 5D7LA 4BUGA 1NCBH 2HFEA 1XGPB 4HEPG 5IESL 5EA0H 2BSTB 3BKJL 1N0XL 5D2LE 5F3BB 1K3IA 2BK8A 3GSUB 1RZJC 2QLVB 4LPTA 4KTYA 3LPGA 2R2HB 3PWJA 3G9AB 4JPKH 4HWEH 1EO7A 4O5LH 4J3OC 4PGCB 3NBNA 4WU5B 4P59L 3DXAE 5TH2A 2QSVA 4NQCD 5HI5C 1PLGH 1G7IA 3ZHDA 4YGAB 4ZPVA 3FONB 1AGFA 3QUXA 5SWQB 5AEAA 2OL3A 2CK0L 3P9MA 3QXDB 5DRNA 1IFHL 2VAJA 5IMOB 4MCYB 4HWUA 4LSTL 5ERWB 4YWGL 4A6YL 3VG0L 2O5YH 3NA9H 5DQ9A 1T20A 4F3FB 4HIHB 3D25B 4GAGL 1WIUA 2X2YA 4LIQH 4LNRB 2AQ2A 2Q20A 4X4YB 1JGEB 5AUMB 4S10A 1XF2A 4OD1H 4PY8J 3OKDA 1XH3A 2R39A 1INEH 3DYPA 1A1OB 4QTIL 5T1LD 2E3VA 3C60C 3H9HA 2JJTC 5KG9B 3FTGB 4F7TB 1ERNA 1TZHA 1X44A 2MJWA 2EDDA 1ZHKA 2EYRA 4PRIE 4NC2B 3HE6A 1PY9A 3VFSB 5HHOB 1IZKA 5DTFA 1NGYA 4R4NC 4NWUH 2VDPL 4X8JB 5D7KD 4WGWB 2B4CL 4CMHC 4KJYB 5B8CC 1CCZA 4NRYA 3JUYA 2ZPKL 4WNQA 3DUSA 4LKCA 4RAUA 1T3FB 4R6UA 1B2WH 4FQ2H 3UYOD 4TVSa 4LPVA 4GQ9H 5DJDB 4YZFF 2OX5A 1JPFA 2OZ4L 4ZFOL 4FQLL 4GAYA 4ZAKD 3W0WD 1L4IA 2FLRT 2GAZB 3RWCB 5DZNA 5KN5B 1MLBA 1PSKL 3MRPB 1QSFE 5TDOB 1RD6A 2WZPD 4OGAD 1UH3A 2GCYB 1Y0LA 5C09E 4ETYA 1UCBH 1IKNA 1EHLL 4L4JA 4QHLA 3GMNB 4L4VD 5IGXL 2AXGB 1VGKB 3GMOB 2X70A 4HV8A 5F8RC 4LOUD 1BAFL 2R4SH 4K07A 3NIGF 5LGJA 4PV8B 1CDHA 1A64A 4CVZB 5GGSY 1A6WL 1SQ2N 1WBZB 4NGHL 2DQFA 2QSQA 4X6CA 5DLMH 1P4BL 3C9NA 1HNGA 4NQEE 4LRIC 5D2LA 4ENEC 2JIXB 3EGSA 4Q97A 1MPAL 1LO0L 5E5UB 1XT5A 3CC5B 5FO7B 1FO0L 4LCWE 1FHGA 2MMXA 3I6LD 1RUKL 1IQDB 1AD0A 2EDNA 1I75A 3DXAA 2X4TB 3IDJB 3PP4L 1OPGL 4YBQD 5HGDB 5IBUG 3UEZA 4YDVB 3HR6A 1PYWB 5HPMB 4JKKA 5DHYB 2F58L 5F7WC 2G9HA 2E5EA 5DFWH 1H0DB 4WIQA 3OGCA 2NTFA 5JW3H 4X6CF 2XYCA 3WHXB 2P43B 5DJ8B 1RULL 4Y5YA 5FECA 5D2LF 2DWDB 3IFLL 1AE6L 3R06A 4HHAA 4JRYB 3RTQA 2B1HL 5CEXA 2OK0H 1K2DA 4IDJL 5EZIL 4BKLA 3WJLC 4LCUB 4I5BB 4KY1L 3C8HA 1FORH 3WKML 5DT1H 2RCSH 3NN8B 2AXJA 3CXHJ 4PRIA 4NQSB 5DGQA 1JYWA 2E7BA 2A74A 4MHHI 4HUWA 5DMYA 1Y18B 3V5DA 3MRDA 5HI5D 3VH8A 4RNRA 3BD5A 1R5IA 2Y7QA 3LKRA 2AEPH 4OLYH 4OM1H 1YJDH 4ESKA 2DQJH 1RZGA 1HILA 4BZ2L 1MCHA 4A2MA 4Z77B 4OV5B 15C8H 1HZHH 3HZKB 3I9GL 2EYSA 2YMXH 2IFFL 5D1ZA 3QRGL 1KBGL 4EOWL 1O7SA 5ALCH 1S7QB 1P69B 1QSFA 2ICWB 1JHTA 4J3XA 5C07D 1A6AB 3QNXB 4HFUH 5C09A 3VMPA 3C60D 4MJID 5I66B 1YQVL 3CFCL 2Z8SA 3MA7B 4WUKL 2PCPB 4Y4KA 2ZCHH 2EXWC 1QHPA 3KR3H 3HZMB 3LY6A 1SJEA 1MJ8L 1FPTH 1NUGA 3MV11 4QXUH 1LHZA 3QO0B 2MCPH 4R4ND 3VH8G 1NC2D 2C7UB 5AWNL 3S37H 3ULUE 1LK2A 3VXRB 5DWUH 3BT2H 4LGSB 4NQEA 2QTEA 5JQ6L 3FB6A 3I2CL 4G42A 3D85B 4FXKA 4LHUB 3UTZB 3PP3K 3WLBB 3QFJD 4LCWA 4FQIL 5KW9H 1N4XH 4BFGA 1NGQL 5KSBA 4HLZG 3VWJA 3MODL 2EECA 3NZHL 3DX8A 1L9MA 5FM5M 3KG5A 4GAJH 4Y19B 4IOFC 2CLVB 3LMJH 3H7BA 4RFEA 1HCFX 1CZ8L 3W9DB 3NGBB 5DRWB 1V05A 1DANU 2H9GA 1A3RH 4OFVA 1NL0L 1NBZB 4OLUL 4WW2A 4G7VL 4FG6C 3FCTA 3V4VH 1KIUA 3O3EA 5CD3B 5FCSH 5D96B 1KSRA 1YNLL 5DJAB 1J5OL 3RVWC 2NMSA 1GJIA 1G6RB 2HT4C 1Q8MA 4LSUH 4RDQF 5C2BL 1FBIL 4YHYB 3VXSE 3ZHLA 3FQXA 1IC1A 4ENED 4RDQG 3E6HA 4RAHA 4L29B 3BH9A 5C0DB 1J12A 4PP1C 2A6DA 1GH7A 1U8LB 4ZODA 2HYMA 4Z5RA 1TVHA 2BMKA 1NJ9B 5TQ2H 1IAIH 4WW2F 3MREA 5JR1H 5HGGS 1PJ9A 4GMTH 4I18B 5IIEA 2DBLL 3OAZH 1DVFA 1UM5H 2WP3T 4ERSL 3JTSA 2XXCB 1IGYB 3X11A 5EWIH 3EO1B 5HHOD 1QP1A 2IWGA 1OLZA 1H15B 3SQOH 2X4RB 2ZUSA 4NO2A 1A7OL 5D7SL 4XCYA 1JI1A 4WRLA 3TF7C 2ZSVA 5GGTH 4ZXBB 1EXUA 5E03A 2QSCL 5F1OB 2R23B 4EDXB 1KPRA 2A6JA 4XMKL 4QRSA 3T0DA 3VFNA 3NFNA 3VCLA 3BOVA 3FO9B 2EC9T 1HSBA 3SJVB 5B3JE 3NABH 5B22A 2C1OB 1MH5A 4LVOB 5FB8A 3V6BR 3MLYH 2CIKB 1CGSH 4N9OB 4Q0XH 1PQZA 3NGBC 4KGJA 3IAPA 4OUOA 3RA7H 4MD4A 5ID0B 3KPOB 5CAYB 1BPVA 1UC6A 3QJFB 1XR8A 3HRZB 4FQPA 4K9EC 5HD8C 5E8NB 3FMGH 3QULA 2SEBA 3PWUB 4MAUL 5D96C 4FQJL 3TNNB 3NPZB 1U0QA 4NQDD 1RU9H 1AXIB 4JFDE 2NY0B 1OP3H 3T4AB 4UINH 4YHYC 2DDQL 2HJLB 1MCRA 3MRFB 4LFHD 1FFOB 5TE4L 5I1IH 1I7RA 1QLFA 2M2DA 5AYUH 3O4LB 3ILPB 2FHBA 4X9BA 4EZMA 5DD5H 4DZ8B 2DKSA 4JDZA 1S8DB 4G6KL 3ULUF 4PR5B 1Z2KA 2R29H 4MNQB 4I18C 1I7TB 2APXA 2AKRA 2EXWD 1QKZL 5E2TH 2VJXA 2VABA 5C6TL 1QO3B 4U6YA 3U0PA 2A83A 3JWNC 3STBA 3NIDF 3X14A 4HQQL 3P40A 3VXSA 4MS8C 1FDLL 3NTCL 4ZXBC 5MHSD 3IKKA 2BY1A 2E6QA 4JRYD 3PWNB 3LOWA 1P84K 3VU2A 5FM4A 1AI1H 4F58L 1KUMA 2N7BA 4NQCE 3TCLB 1ZSDA 4E5XB 4PRBB 2FGWL 3WN5B 1OP9A 3LRSA 4LVOC 3V5HA 1LEGA 4IOFD 2O61A 1X4YA 1ZS8B 2OR7A 5D8JH 1W72B 5BZDA 1CF8H 3Q2CA 1EO8L 3MBXL 2K9UA 4UQ3B 4BA8A 4H26B 1K4CB 4OV6F 5K9OB 3BPLB 1GGBL 3DYOA 2ITCA 1M6OB 1BIHA 2VQ1A 3AFLA 4FG6D 3TIEB 5KJRH 4MDIB 1FZKA 1UKQA 3MOQA 4KK5C 2XRAH 4OZHE 4P9ML 2WSKA 3JVGA 3SGEH 1KLFA 2YA2A 3SE8L 1NEZB 3GMQB 5DC4B 3WL9B 4NKMB 3E8UL 3RVWD 5IG7A 3QUYA 4HF5L 2HT4D 4ODBD 2GI7A 1FZJB 1YYLL 3B6SB 5CHNB 5HI4C 3QQ4B 1CLOH 2FX9H 1RIUL 2NY0C 1U8KA 3SBWC 4HXAH 2CIIA 3RIFK 3MLRH 4PYGA 4TPRL 2OBGA 3S36H 2DKMA 1N5AA 4H88L 4OZ4B 3O9WA 1WBYA 4KVNH 3OKLA 2EE9A 3PWVB 5D7KE 1C16A 2DQCH 4HUMB 4X99B 1EBAA 1A6VH 1UWGH 4N5EC 4CVXB 4LP4A 4KK9C 1AC6A 2DJUA 2NLJA 4B53A 2O93L 1BIIB 4PJCB 1IEBB 4MNGE 2R4RH 4OSUL 2J8UB 3O6MH 2A9NL 4DCQB 2ESVB 2BRQA 4KKAC 1WZMA 1RJCA 4Z78B 4JFDA 1G1YA 4G7YH 4EXPX 4LDLB 1RURH 1YEJH 3QP3A 5B3JF 5EU5A 1RZFH 4G6JL 2AEQL 3MRGB 4HG4J 1HQRA 2A77L 4O2CB 4Z7QE 3D85D 4LHUD 3STLA 3VGHA 1DE4A 3ZTJG 4HPOH 3ULUL 2X4OB 1EJ6A 2BVOA 5CJOH 3WN5C 3CH8A 4HUUA 4PB0L 2R56L 3BRDA 4NO5A 3SKNB 3KYKL 1FCCA 2AV1A 3U2SB 1O7VA 5IMMA 4BZ1L 3BPLC 5HHME 3GHBL 2H26B 2VTFA 3QNYB 1FL3A 2X09A 3CDCA 5HD8D 1MFAH 4K55A 4EEEA 4PRNB 1FAIH 1NCTA 4OBRA 4QRQA 3SOBH 4MWFA 5H2BB 5C0BB 3I6LE 3BP7A 5FOJA 1INQA 1JV5A 2BP3A 4DGIH 4C83B 5C0IA 1FNEA 3Q0HA 4NQCA 3BFOA 1MFNA 2AXFA 4DKFH 1JIBA 4PTTB 4RCAA 1CBVH 3L5XH 5FGCB 3EYSL 3FT4B 3MCKA 3SN6N 1DLHA 4UIMB 5K59E 1MNUH 3MRMB 3FN0L 3IJHA 5DF0A 3V0WH 2JLLA 5DD3L 1P5UA 2CMRL 3P77A 3D3VE 5MEPB 1SEQL 4OZHA 1T1XA 1J0JA 4EVNB 4X7SL 4MXQC 4MCZA 5IT2L 1MVUB 4HK3J 1Q9KB 5J8OA 2PW2A 1XF5B 1LO3H 3NZ8A 1UKSA 3U9PH 4RGOH 4XPGL 4MS8D 1J05A 4ZXBD 4Y5VB 4CW1B 4NQVB 3BW9A 3U0WH 1CE1H 4ALAL 4PB9L 3KPLA 4PJDE 4HIEA 4LL9A 4GMSH 5AZEH 4ZFFB 2IGFH 1TZIA 5EUOB 1BBDH 1BOYA 1U8JA 4E0RB 4DAGL 3K2UH 4GBXC 3SJVD 1FVEB 1GZQA 4GH7B 4NZRL 4JGUA 4PTUB 4OZHF 1OW0C 3KPQA 4JRXE 4XP5L 2VB5A 1YA5A 5DUBA 4MNGA 2XG4A 3WO4B 1KC5L 4ZAKA 1QA9A 1IJ9A 4J3WA 2XPGA 1A2YB 4MX7A 1K5NB 1A9EA 4P5KB 5CEYB 2EEDA 1KJ3H 4KK5D 1T0MA 1TVBA 1IBGH 3K0WA 3ES6B 1T21B 1QLEH 3BAEL 5C07E 2VLRB 4Q2ZA 5I15H 3WFCL 3CLEL 3OPZH 4M6OH 1ZGLM 4ODVH 4OCLC 4B50A 2ATPA 2X4QB 1BM3H 1L0XA 3D69A 4WEUD 2VLKB 1W0YT 5HI4D 1OAQL 2DL9A 3GKWH 3RL2B 2NY0D 3KS0H 5C9JA 2KDGA 3UYPA 4JO4L 1A4JB 5I1JH 4IIQB 2EH7H 3MR9B 4OCMC 3O4LD 5DVMA 1E28A 4M5YL 2YN3A 1VFBA 4LK4A 3ARFC 4GRLB 1T1ZA 1UWEH 4N5ED 2NR6C 4P5MA 4KK9D 2NCMA 4HIIB 1S3KL 5I71B 4MNQD 1W0WB 4POZC 3X12A 3QFJE 4Z7QF 4Q9QH 1BZ9A 3MRIA 5I1CL 5DJ0B 3TIDB 5HI3C 3U4BH 4KKAD 5FYKE 5EC1B 1LK3L 4MQTB 5I1HL 3MRQB 4AMKH 3RPKA 4Y5VC 3VXTB 5CS7A 3PDOA 3ECBB 3LN4B 1PVHA 5DUPL 3EDJA 5GRWA 4QRRE 1YEGL 2Z9TA 4Y7MA 1ZOXA 5DQJB 2BJML 4MZ2A 4Z8FL 4NC1C 4XXCA 4YHKH 4Q58C 5E2JA 1QACA 2QHLA 3I6KB 3D3VA 3S8WA 5HYEA 3L3IB 4X80H 1JPGA 4OD2B 5F9OH 5T3XD 3PF2A 3DROA 2Q76A 4K3JH 1MUJA 4U31A 4Y16B 3WO4C 4LLVB 3GMMA 5FYJU 1R3HB 2Q3AA 2HJFA 4OZFG 2BOCA 43CAA 4YFLF 3JXAA 1VADA 4OCYL 4PJDA 3DO7B 4GS7B 4P2QB 4GO6B 3VMOA 3G08A 4ZNCD 2DRUA 3H2WA 5K59F 1JBJA 4HT1H 3IDGA 4BSVB 2X41A 4IIQC 3W5NA 2AABL 3WIHL 1EJOL 2FO4A 1X7QB 4O00A 5HHOE 4JE4B 4PJBB 4JRXA 5IF0B 3PJSA 1MREH 4YUEL 3IU4H 4NOFA 5DSCB 1YECL 4GRLC 1ZXQA 2D0FA 3GSWA 3EIFA 3QI9B 4KXZH 3IRZA 3CSBA 1RJZA 2ATKB 5I71C 1J1OH 5E6YA 5L2JB 5C07A 4MXQD 2DD8L 3P2TA 4PJDF 3IDYB 1OCWL 2ESVD 3ZTNH 2EDYA 1CR9L 2X7LA 1S7UA 3ARUA 3LDBB 3MXVH 3VXOB 4ZFGH 5DJCB 3SKOA 3UTPD 3BDXA 1W0VA 1MHCA 1DL7H 1AHWB 1YJDC 2D31B 5EU4B 1I9IH 2DWEB 2I9LB 3BEWA 4P5TB 4PS4H 4PJ5B 2HA1A 4RWHA 3EOBB 3RBSA 5B8CA 4LLDA 4LEOB 4TVPH 4PRAB 1BQHA 2I5YL 3OKNA 4Z0XA 3S3SA 4NCDA 2CDGA 4GBXD 4DTGH 3CFDA 5SWZE 2JELL 4FNLL 3DNKA 4U1HB 3B3IA 4ZYKA 1L6ZA 3MACH 3OR6B 4NM4H 3QFJA 3C5JA 4NQDE 4FZ8L 4JFXB 3ROLA 5IFHH 3UPCA 1GIGH 4Y16C 1IC4L 2BSTA 5L7XH 4HUVA 2JJUA 5FOBB 1L7TL 4K7PY 3GSUA 1UADC 3DVIA 2R2HA 1A7PL